1GAJA

Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transport protein
molecule keywords HIGH-AFFINITY BRANCHED CHAIN AMINO ACID TRANSPORT ATP-BINDIN
total genus 81
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gajA00
2AD5A 1II8B 3THXB 4LC0A 2W0SA 2VH5R 1ELOA 1W49A 5FUWA 3ZVMA 1E9SA 2GA8A 2RAPA 1DADA 2QG6A 4Q9KA 3CRQA 3LX8A 1P2VA 2FSGA 2ZAMA 3QEJA 4JBWA 2OLJA 1VPLA 4OL0A 2HLDA 3W6NA 1S0UA 4NCJA 3QKUA 2AKYA 4DRZA 4QBFA 4DZZA 2V55B 4DCVA 1E1RA 4DWJA 4LV8B 2GESA 1GSIA 2E1RA 3EWSA 2IS2A 1EXMA 4PPFA 1TU3A 1YZQA 4LBYA 4BE7B 2EYUA 4OBEA 1DAHA 3WBJA 4CEIA 3IIKA 3ZZ0A 5H8WA 3CX8A 1UKYA 2PT5A 4MITA 5KSOA 4A0FA 4CDGA 2PX3A 5LPNA 1QRAA 4NYIQ 1GRNA 1E0JA 5J4YA 1E4YA 5KTYA 1ONBA 4BZPA 3VHLB 5C2JB 5J4HA 4M2LA 1II9A 1SULA 3OE7A 3QXSA 2BDTA 2VBCA 5IF9A 4JLMA 1QVAA 2DFKB 4IOLA 2W6JD 3QY0A 2GETA 1JXOA 1XZPA 2QSZA 1CR1A 3QF7A 4HUQB 4LHYA 5EUQB 4B3XA 3AKYA 1G41A 1V43A 5E7MA 3AF0A 4TL6A 3ICQB 2ZPTX 4ACAA 1E2JA 5KNCA 1EX6A 1FX0A 1ZUNB 2J0UB 2ZRHA 3TR5A 1VCOA 2P5SA 2GEUA 2P2LA 1UF9A 1JEDA 3OFND 4QOSA 5AJZA 2FV8A 1QHNA 2FN4A 3I92A 1QDEA 1YRAA 1G3UA 2IYLD 2XJ9A 4B34A 3C14C 3MAAC 2QZ4A 2DBYA 2OXRA 1XEWY 1NVWQ 1Z06A 4ERNA 1XXHA 4KHZA 4XD7D 4TTQA 1Z6TA 4J0QA 3IEUA 2O0JA 1OW3B 1BO6A 2ERYA 1OH6A 3KUCA 3VR2A 4W9MC 2ZR7A 5BN5A 3BJIC 1RZ3A 1ZYUA 2GEDA 4AK9A 1P2TA 2WV9A 1U9IC 5IK2D 1RC8A 1GFIA 3GMTA 4TT3D 4CVNA 3DMDA 3AVVA 3THYA 2W2VA 2FFBA 3O8BA 4UKDA 3AUXA 4DDVA 3CWZA 6Q21A 3D8BA 3KJGA 4LGMA 4XH9B 4C0QC 1H8EA 2ODNA 1JR3D 1T8TA 3AF4A 2BEKA 1XEWX 3DEFA 3K0AB 1OH8A 2F1JA 2IS6A 4TLBA 1CJKC 1KK3A 3CR8A 4LHXA 1QHYA 1VHTA 4UNQA 4RJLA 4EJSC 3N2IA 3GFPA 5KUTA 1KAGA 3CX6A 4Q7KA 4Z1MA 1I2DA 5FPSA 4IXNA 2PEZA 3DVLA 2A9KA 2QUZA 3EIEA 5FBLB 4BPBA 2XB2A 5EP4A 3RDPA 4AKGA 1R5BA 2ZYUX 2PH1A 2QGZA 1LW7A 4QHYA 5DYIA 3TNFA 2LKCA 3KXLA 3UMFA 2R6AA 4WZBE 1ZNWA 4K46A 1Z0JA 1G8FA 2NIPA 4I1VA 5HE9A 1WF3A 1P72A 1ZVQA 2L0XA 5FFMA 4TL8A 5KSYA 2ZJZA 3QSYA 5JSZB 1I2MA 1KAOA 2J41A 2JA1A 2YINC 2YYZA 3W8RA 3A1SA 2NO6A 3ZLJA 2QRNA 3PUWA 3CNNA 3EXAA 4RD1A 2HYIC 4WXPA 4BECA 2X1VA 2GJ8A 1COWD 4G5RA 2XNDD 4TMVA 3U3OA 1KTVA 2LKDA 3WYGA 5FTLA 1R0YA 2P67A 1IJFA 3TW8B 1XMVA 1WXQA 1E2QA 2GXUA 3VKWA 1X86B 2O8DB 4Q00A 2ORWA 2AX4A 3KJHA 2FSHA 4JLDA 5KPJA 1NN1A 2RMKA 5DYGA 2JGNA 2QE7A 5FOTA 4ZV4A 3B13B 1XP8A 3CB4A 1X8KA 1A5TA 1GKUB 1W0KD 2CLSA 4RKEA 1S9DA 1F5NA 2CE2X 1OXTA 4OJQA 3ZGXA 1RVDA 5EJEA 1AZTA 1KMQA 5JS8A 2QMHA 1XXHE 2GK6A 2JEOA 4FWTA 1ZIOA 2G3YA 1WBBA 3CKLA 2FPKA 4BFZA 3QKRA 1CJVC 3ZS9A 221PA 2IW3A 4NYJQ 1ZW6A 1VTKA 2C77A 1U90A 2KSQA 4RZXA 3W34A 2MMGA 4JLOA 3FOZA 2X77A 3K0FA 2C5LA 1ZUHA 2RCNA 3A36A 2IWHA 3W8NA 1CTQA 1P60A 4PX9A 4C0SA 2CJWB 4X8OA 3B1WA 4OJKA 3SEAA 1XX6A 1ZNYA 3CH5A 4NMMA 3GLFB 2FA9A 1K5DA 4GOKA 2ZREA 1E9EA 1TUEA 3ONWA 3SBEA 3ZD6A 1F2TB 2CBZA 4QGGA 3HDTA 4Q9LA 3T5DA 5KPDA 4YXWD 1OKKD 2C95A 3I8XA 4Q03A 3BB1A 3TQFA 1AS3A 3O8DA 4CYMA 2ZRJA 4D4MA 2WVJA 3E2IA 1HV8A 1RE0A 1Z63A 1W4RA 5JRZA 4URUR 2CEAA 1HE8B 4BFYA 2IXEA 3DM5A 2H16A 4KV9A 4JKYA 1YZUA 3EA0A 4ZCMA 2QPTA 1JJVA 5FI0B 4R98A 1XJCA 2GJAA 4DLWA 1G7RA 1CIPA 5KYKA 1D5CA 2EWWA 3IBGA 4A6XA 3AVWA 2Z4RA 2QP3A 1VG1A 1JECA 4D0LB 1NF3A 4XSGA 2D7DA 4TQAA 4L5BA 2QMOA 2O0HA 1G7SA 4BFUA 4BQSA 5IHPA 3U7FB 1NJGA 1IBRA 1IY2A 2P65A 4Z8XA 5BXQC 1KSHA 2ZRBA 2XEXA 4GZLA 1I4TD 2OCAA 1GM5A 4QJ3A 2TMKA 2RH5A 1GILA 1I4DD 4IJMA 3Q72A 4TL9A 1XD2A 2B7BA 4G3XA 1W7AA 3SZRA 5DN6D 4TZ6A 3T61A 3KKNA 3THWB 5C4GB 2MSEB 4XOIA 2J1LA 3PITA 4IRUB 1YR9A 1GOTA 2O8CA 4FMDF 2PJZA 3B7GA 3FTQA 5F98A 3V4FA 1TQ2A 1AK2A 4JS0A 3ZYCA 4ESHA 4ZI3A 2C96A 2FMXA 2IYRA 3WRXC 4A4DA 4C0BA 2HXYA 2F1IA 2QP4A 4Q4AB 3RS5A 2JJ1A 4DBLC 4ZCIA 4IW3B 4XTCS 1NJFA 4H1UA 1EFRD 4QM7A 1K8RA 2C03A 5HZKA 3BH7A 5A5GA 2BOVA 2BCJQ 4P4SB 5CYPA 1JR6A 2DFTA 2OLKA 4D81A 2YC4C 3PVSA 3QENA 3QKRB 2XZLA 3I3SR 5LB4A 3WXMA 2IYSA 3L8ZA 4NKRA 1NIPA 4DVGA 3I4LA 1ZD9A 2ZSAA 2GZDA 4R7ZA 4HZUB 4OHWA 2OM2A 1TEVA 2VHQA 3D3QA 1KSJA 3L0OA 1MABA 3GPLA 2H92A 5CJ2A 4L15A 2BCGY 3VR1A 3R7WB 2WWWA 1Z28A 3MFYA 1DG1G 2V3CC 2NG1A 1HTWA 4GSYA 2HJGA 4MDEA 5CDFE 5JWHA 5K8UA 2FU5C 2H18A 1F48A 2A2ZA 2ORIA 1N6KA 3ZS8A 2GZHA 1SKYE 4BFSA 4EPRA 2R6GA 2BHRA 4LRWA 1ZM7A 1G3QA 1XMIA 5JCZA 3L82B 5FPYA 4MH0R 3AH8A 3NHAA 1MO3A 4TMKA 1EGAA 1RPZA 3VFDA 1KKLA 4EJSB 4KITB 3TBKA 2XZOA 5IK2A 5JEEA 1Z0FA 3KXKA 4M22A 2QT0A 4NZYA 3GJ6A 3QVUA 5G40A 1OFHA 3TSWA 3U5ZB 4NYMR 4NP6A 5AUOB 3THYB 1AS0A 2WHXA 4V0OA 1E9CA 2GAOA 2ZJ8A 4RFSA 1PZNA 1MO6A 4PO9A 1ESMA 4B48A 2W2TA 4IFEA 2KI5A 1KI8A 1P9WA 1R5NA 2HF8A 3PEVA 1G5RA 4QG7A 3HJNA 4IOMA 5P21A 3KQUA 2XXAB 4A36A 1GITA 4B6FA 3ZD7A 5DI3B 3ICEA 5E4FA 2G88A 2JLWA 1KNQA 3O8CA 2B21A 1XD9A 1IXSB 1UKVY 3HU1A 2JJ2D 1Z6YA 5LB2A 4AKHA 1YU9A 2O8EB 2VP6A 4QNMA 3OIYA 4TLEA 3QKSB 3N70A 2B7CA 2QT1A 5EXSA 4BGDA 4GOJA 4R2HA 1ZAKA 2WOJA 1AKYA 5E95A 3WYFA 1FX0B 2G83A 1XD8A 2J0UA 2IXFA 1QG2A 3K09C 3LVQE 5JEDA 3DDCA 2XTZA 3FFBA 1UDWA 4PPNA 4TYPA 2ZM5A 1CULC 1UM8A 1NN5A 1PLKA 1XU4A 2HV8A 3IDQA 3QJYA 4JJZA 4JBXA 4RKFA 4JVLA 1DPFA 1G16A 1T5IA 5DGXA 1P6XA 1M74A 3WRYC 4DHEA 4DCTA 2WPDA 1PUJA 3DKVA 4IVPA 3ADBA 3VR5A 1AGPA 4Q18A 3PCRB 4JLVA 4RVCA 1MABB 2ZS7A 3KQKA 4QRHA 5G3YA 4IXMA 3NKVA 4KLNA 2BWJA 2ZRNA 3AB3A 4F7WA 3SN6A 1FNMA 4Q1DA 1P4SA 3JVUA 2V9PA 4PO8A 2WIBA 3T1VA 4DEYA 1DEKA 1SXJD 1T3LA 1R10A 1G6HA 1HEIA 3QF4A 1RRCA 4A8JB 1XMJA 2EFCB 4ZKDA 4XIGS 4FCWA 4FMDB 4PSKA 4LV6A 4TQ9A 3K70C 4ZKEA 1CJTC 4WVFA 3BD9A 2A5DA 1E2KA 3MWYW 1WMSA 1ZC4A 2G6BA 2QENA 1FMLA 5JZVA 1E1QA 1MR3F 4MUBA 3ZQJA 4AKIA 1LF0A 3QQ5A 2NZ8A 3HPRA 3JZAA 2GCOB 4DEXA 4Z51A 3RC8A 1FQKA 1RKBA 2KBEA 4HLUA 2QEQA 3KTAA 1ZRHA 3QXJA 3CPEA 2GBLA 5J4LA 2C8VA 3I72A 4LBZA 2R6DA 4G5GA 3GQBA 4LJ4A 1JPJA 1E32A 1GZSA 2QM8A 2ZU0C 1OXXK 2R65A 3IKJA 1IXRC 1US8A 1DARA 5JRJA 1Z0AA 4HB2A 3K0CC 5DE3A 4KAXA 4F38A 4RZ3A 4JZKA 2R62A 1JPNA 4PC7A 2RGDA 4MKIA 1TUIA 1U8AA 4HAUA 2QN6A 4Q9IA 4YMTA 3KZ1E 1C9KA 2YNMA 3CM0A 4DB4A 4JLJA 3G0HA 3SS8A 2GJ9A 1O87A 4W7SA 4M53A 1R0XA 4AWXA 1RYHA 3MJRA 3TAUA 1ZP6A 1UBEA 1ZNZA 3QXCA 1ZC3A 1LTQA 5TV2A 1G5TA 2ZVQX 2JCSA 4NHOA 5JFGA 3FHTA 2WMNB 1KJYA 1UEJA 3L0IB 1SVKA 5GJCA 3M6AA 3TIFA 1QZXA 2VRWA 1SVLA 4B32A 1N0UA 2AK3A 1QHHB 3GLHA 2JASA 1R0WA 2CVFA 5FR1A 2WSMA 1Z6AA 4KCGA 4LYAA 2VEDA 3AVUA 2JJ8A 3SC3A 2HCBA 5JJKA 3KB1A 1LF5A 3RSLA 3B1VA 4G5QA 3Q7PA 4ZI2A 1RRFA 2IEZA 1DAFA 5D3QA 2QP9X 3UWOA 4BZXA 5G53C 2J46A 4X8MA 1NNEA 1J70A 2J87A 2D62A 3GLGA 1E3MA 1DAIA 3GP8A 3VX3A 3LQRA 5FL3A 1L2TA 2OFXA 5BN3A 1YZKA 1D9XA 3EA5A 2GWHA 4AIIA 4GI7A 4NCNA 3GLHB 3KDSE 3NVAA 3OAAD 3CZQA 1Q3TA 1QHXA 4BRWA 4F4JA 1L8QA 3B1YA 5F3WB 3N5CA 1LFDB 1QHGA 4V0LA 2WZQA 1I4LD 4M21A 3TJZA 1JXMA 2JAQA 5DO9A 3IGFA 3TMKA 3WMGA 2GHIA 5FI1B 4EKDA 2QAGA 2QROA 1M7GA 1KO1A 2OXCA 4ASUD 4HUQA 3SNHA 2ZS8A 4Q7MB 1OXSC 1UKZA 3U7EB 1KK0A 2GXQA 2WWXA 2XSZD 4Q1EA 2ZSBA 1YKSA 1W36D 2NQ2C 1FP6A 4I1SA 4N3NA 4YONB 3EG5A 2UKDA 4URZR 1VHLA 4OQXA 1TQ4A 1FMJA 1YR8A 4C7OB 4LJ8A 4QGHA 3DHWC 2X2EA 4CZ2A 3V00A 2XNSA 1HY3A 4V02A 5EZ6B 5JECA 2AHOA 4P4SA 1KK2A 3AF2A 2J9RA 1HQYE 2QAGC 1CLUA 3UG7A 1YZLA 2HDNB 3KKMA 2BBTA 3TH5A 2DHRA 3OHMA 4JVMA 4IDOA 1UBCA 4DC9A 2ZRLA 1YHNA 4B71A 3GJ7A 5L3VA 1J8YF 1OPXA 4B3CA 2ZRKA 1JEEA 4PC2A 2FE4A 1M2OB 1R5OA 1TF7A 4QNRA 4WA7A 3TQCA 1SXJB 4JYBA 2AWOA 3MMPA 1Q3HA 2RGXA 3RWOA 3RRMA 4S2EA 1OIXA 2XAUA 1H8HA 1HT2E 3CRMA 4QJ5A 1G8YA 1Z6XA 3HU2A 3R8FA 4F93B 3T1TA 2VIIA 4ZO4A 1UAAA 4A0HA 1GTVA 4L16A 1P3JA 1S2MA 1MH1A 4AKEA 1S1CA 3SJCA 1OHHD 4D80A 2IF0A 1E79D 3R7WA 3I8SA 2AXNA 1IONA 4TLCA 5TDHA 1E2GA 3MLEA 3RLFA 1T6NA 4RFVA 1JALA 3FKSD 4NCHA 3RRNA 1AGRA 3VHXA 1JQJC 4TTPA 5BW8A 1KI2A 2B6HA 5EE1A 2CL6X 4F4CA 3W5JA 3PEWA 3UPUA 4P4UA 2ZYWX 2BM0A 1BOFA 1DELA 5JI2E 5JMTA 1J99A 2ODWA 3ZQ6A 4TMWA 4ITRC 3L2OB 2AFIE 4C2UA 2OCYC 3KUDA 2HXSA 1RRGA 1S3GA 1HURA 3X1WA 5KOYA 4KYUA 3FHCB 2OAQ1 4DDWA 4D4JA 1H8HD 5AR1A 5JHHB 1MOZA 2A5GA 5FTKA 1GVNB 4OHYA 2A30A 4IKEA 2H1LA 4PAOA 1N5IA 2NZJA 821PA 2XX3A 3PEUA 2P6NA 2GVZC 2QSYA 4U7DA 3CO5A 4OHZA 2JLSA 4BASA 1RIFA 2ZI6A 4V0MA 2Q9CA 4K81B 2N46A 3NBZC 1G6OA 3AKCA 2BMDA 4P32A 4AG6A 3UG6A 3Q85A 3U3KA 2EU8A 1G20E 1W2HA 4NE2A 4Q66C 4TTRA 3EPJA 1UFQA 3K0CA 2OUKA 3W5IA 1Q57A 4Q02A 1WCV1 2WSSA 1VG8A 1LS1A 4Y0AA 4GMDA 2PX0A 2CJWA 3U2QA 1X6VA 1OLOA 3U44A 1TEXA 2A7QA 2FOLA 2GZAA 4KJZA 1E9BA 4LZZA 2EVWX 1UADA 2MSCB 2RGAA 2PCLA 2CL7X 3MG9A 2XNDA 3K0EA 2G0TA 2RB4A 5L8VA 1AN0A 1OH5A 2JLXA 1Y63A 4XD7A 3PENA 1NSFA 2OILA 2F3RA 4FXPA 4QBGB 1CBUA 3TSZA 2REXB 3T1QA 2OFOA 1M7HA 1D6JA 3ETLA 2FNAA 2WICA 1CU1A 3ZVLA 2J0SA 5F2EA 1W2GA 3B85A 3VKGA 1XXHB 1XMSA 2ZRCA 4Q7JB 3QNUA 4WAUA 4WZAE 3T34A 3U3JA 3X1DA 1P75A 1TAGA 1Q1EA 1UKEA 4QL3A 5J4KA 1T0HB 4CT5A 4EPYA 2H17A 1ZCAA 4XJXA 4PQRA 3BOSA 1VG9B 2AR7A 1MT0A 3B9QA 1XEXB 1FOEB 2HEIA 3K0SA 2EFEB 5HCIA 4RZUA 2DCUA 4O25A 3AKEA 2Z43A 4LJYA 4U00A 3I73A 2VTKA 1PVOA 3F8TA 4JL6A 4I99A 1GL9B 4PTLA 1Z47A 3EC1A 4GZMA 1U98A 2KWIA 1KYIA 2B8TA 4LY6A 1G18A 4EPTA 4MGIR 1GUAA 3IQXA 4LK2A 5EE0A 4ZIRB 2GK7A 2VSXA 3MRSA 4JLNA 4RZ2A 5AWFC 3DKPA 4YQFA 1KY2A 2PLRA 2IT1A 4OK5A 2V54A 3A1UA 1KI4A 2K5UA 4LHWA 4B44A 2QGNA 3BFXA 1G21E 3LW7A 4Q19A 1NSTA 3GLIE 3IO5A 3OEED 2GJKA 4HYYA 2ZRGA 3PUYA 1G3RA 1XTKA 1NMYA 4ZPXA 1X3SA 2ZI7A 1T91A 1Z8FA 5KDDA 4WBSA 3TSOA 4AD8A 3LFUA 1W5TA 1Z2AA 3VR4A 4KXFB 3GLIA 4Z8YA 1CS4C 3SR0A 1N6PA 4OQMA 3NEJA 1CRPA 4DKXA 2IYUA 2W6IA 2OBMA 4JVNA 1BH2A 2GKSA 4HLQB 1U8ZA 5TVKA 3LLMA 1DO2A 2O52A 4IDQA 1G7TA 1RYFA 4YMUA 4ILEA 2FSIA 4LYFA 4EQ6A 2YWHA 4JL8A 2XOKA 3Q5DA 3VQTA 2HT6A 1Q21A 2JLRA 1KI6B 1N5KA 1IN8A 2FEOA 4FIDA 2Q3FA 4QXAA 1DOAA 2R6FA 4BEJA 4PQFA 2H7VA 4ZDJA 2ZI9A 3BERA 3RS7A 4CT4B 4PAQA 3TGPA 1VG0B 2OG2A 3U7GA 2BMFA 3B1ZA 3NEYA 2P0EA 1N0WA 2QAGB 2XTNA 1ZM4A 1T8UA 4C0KA 4YMVA 1MO5A 4TMTA 2BJWA 1IY0A 1KSFX 4P0TA 4JSYA 3ADDA 4KO8A 1NRJB 1L4YA 2CXXA 4OI1A 2O8FB 2VP2A 1D2EA 5JHGB 2PT7A 2IEYA 1WA5A 2IYYA 3P1JA 3W9YA 3ZVRA 2WOOA 3WY9A 4Q1CA 2VSOA 4LOAA 521PA 1VCIA 1KDRA 4L9WA 3IIJA 4DDUA 3WNBA 4ZDKA 3R9XA 2YWFA 3Q9LA 2Q3MA 3B8HA 2W2XA 4UNSA 2NTYC 4QGAA 4A0GA 2C04A 3MWLA 3PG5A 5EUMA 1GIAA 3PUZA 5HR5A 1MRSA 4E5UA 4UJ3A 1NN3A 2UVQA 3NG1A 3GLGB 2RGEA 4A2WA 5EP2A 1DAEA 1TU4A 3C15C 2R6CA 2QQEA 8OHMA 1M6NA 1N6RA 4NU0A 3BB4A 3K0FB 4AURA 2VF8A 2YOHA 4M1TA 1W4CA 4KFTA 1R2QA 1XJ0A 4KLZA 2FSFA 3C41J 1KO8A 1TX4B 1OE0A 1W0KA 2OAP1 4V0KA 3K9HA 3GLFE 5CB8A 1XEFA 2FH5B 4RD0A 5GJVC 2C99A 1OSNA 2BBOA 1KOFA 3FMPB 5SZKB 4B75A 5A0FA 1JBKA 3K8YA 3NBYC 1VYVA 2QQ0A 3WNCA 3NIBA 4QBHA 1QVRA 4LC1A 2JLQA 4D2IA 4DUGD 4V03A 3DOEA 3U61B 3RC3A 2VHCA 5KNDA 1VIAA 3LVRE 2DFLA 4A8JC 3CNOA 3ECCA 3I1FA 5FPKA 3T15A 1G17A 1FNNA 4DLYA 2AFHE 1G4UR 1TQDA 3SYNA 3GJ0A 1P9RA 3ASZA 5DLQC 2I3BA 4HDCA 1QHIA 2XITA 3BGWA 5EE3A 3TUZC 2FEMA 2ZI5A 3AVYA 2SHKA 2WKQA 3TKLA 4B6EA 1U0JA 2ZJAA 4M4SA 4PC1A 4TYNA 2GILA 3VR3A 1SXJA 3LDAA 1UBGA 4B74A 1N25A 2CMKA 1P2SA 1T3HA 4RY2A 5BYJA 4TYYA 3QPVA 2ZE5A 4QHTA 5CJPA 4MGKR 5CB6A 5EZ5A 3DZ8A 4D26A 1TPZA 1TF5A 4HLDA 1US8B 4U5XA 3GD7A 1P73A 1ZM2A 4DLTA 3F5FA 3B1XA 4F91B 4CF7A 1LNZA 5GADl 5F9FA 3A37A 4LJ7A 1EWQA 1FQJA 1TMKA 1NVXQ 2R44A 1D2NA 1SZPA 3EASA 3K53A 3A58B 4PANA 5JBQA 3S1AB 1FP7A 3FMIA 3BE4A 4LHVA 1CRQA 2IUSA 2F43A 5HKKA 1N2CE 4HATA 4NPHA 1J2JA 3FFAA 2ZUCA 1N6HA 3U3MA 3THWA 4B73A 3GCGA 4US2R 2BKEA 4D0NA 1E1RD 3QIAA 3RRYA 3SOPA 4ZDWA 2EFHB 1WP9A 2NO7A 1E2MA 5KU1A 3TW4A 3M0EA 3KJIA 2F7SA 1PLJA 3TR0A 3W3AA 4RD3A 2QU8A 1SGWA 3GJ4A 4ZCLA 4XWOA 2ZYTX 3BWDD 2QBYB 3C4JA 4ZDIA 3A6PC 1KZ7B 2GXSA 2HCJB 4LCBA 3R8CA 1NVVQ 5F9HA 2I1QA 2GXAA 1T9HA 4Q21A 4HSEA 1BMFA 3EZ7A 4NCKA 1GAJA 5FOVA 2AK2A 2ANBA 2IYQA 4JVSB 3WMFA 1KJWA 4MYHA 4BLQA 2OSBA 3LWNA 2XZPA 4Q9JA 1E0SA 3JVVA 1IJEA 1EFUA 4CIDA 5L3SA 1P61B 4QHSA 3QG1A 5L3QA 3QXXA 2D06A 1C4OA 4C30A 2G1KA 4JBYA 5EXTA 2IYTA 5IDVA 1F2UB 1Q22A 2WJJA 4HI0E 4G5SA 3I5XA 3KQNA 3RAPR 5FUXA 1IXZA 2HF9A 1SVSA 3BAFA 3LXXA 4GBMA 1G3IA 1U0HC 2FFAA 1OH7A 4YXWA 5CLLA 3WYAA 1AA9A 1PV4A 2QNRA 5K8LA 1M1YE 3TUJC 4IDHA 4LI0A 3AV0B 2PMDA 2VHTA 1FUUA 2BEJA 3OF5A 3CRVA 5KDOA 5FL7D 3AVTA 3FGNA 2O8BB 3IPYA 1U0LA 5TY0A 2GF0A 3S1AA 3IEVA 1OYYA 1G64A 1E0KA 4TQUS 4B35A 2JLYA 2O8DA 4B47A 2F43B 2YV5A 5H68A 5JI3E 1D9ZA 1FL9A 1VKJA 1N6NA 1ZD8A 5LDDC 3GLFA 2WWYA 4A15A 2BJVA 2ZJ5A 2Q9BA 3H4MA 1G291 2X8AA 4R2IA 2NO9A 4HB4A 2IYWA 5JSZA 4S35A 3FHOA 1NMXA 2OEPA 2D3WA 4B2LA 1B0UA 1ANKA 3OIUA 4PPQA 2IHYA 1EFTA 3N2EA 4FINA 4MRNA 2F6RA 3GLIB 3OEEA 3MWKA 4GL2A 4EJSA 1SKQA 1JAIA 2MSDB 1G8GA 2CHGA 1X8LA 3G82C 4GMXA 3AVXA 2FZ4A 4JLKA 3AEZA 4QGFA 5DN6A 4B3GA 3U7HB 1R0ZA 2XSZA 4DLZA 1W36B 4Q5IA 1WB9A 3GFOA 1NG9A 2DY1A 1E9AA 1ETUA 3PUXA 1U81A 2V8OA 2Y8EA 4IEEA 1HA3A 2DWQA 2CK3D 1NBMA 1IQPA 421PA 1IN5A 5FOXA 1FFHA 4RD2A 4DLUA 3F0TA 1W1WA 4C0HA 5AJVB 5H1YA 5KNBA 1Z0KA 2CCGA 2UZ3A 4PXAA 1JAHA 1COWA 1W0JD 3EPHA 2Q9AA 1LY1A 4KVAA 3RYTC 2A5YB 1NLYA 3P26A 3NC1C 2QA5A 3QOFA 3KQLA 4JMPA 2WJHA 1CJMA 2A3RA 3FDIA 3CF0A 3F3YA 4OHXA 3B78A 1ZIPA 4Y0VA 2O8CB 1SVOA 4M1MA 5CYOA 2OFWA 5SZHB 3U6KA 4HAVA 3V4RA 2O8EA 2X19A 2W6JA 4ON9A 5E3HA 2WM9B 4FCTA 4NYIR 1IN7A 2X2FA 2J45A 1NLFA 3OEHD 5LBIA 3O47A 1BYIA 1SXJE 1T5LA 2ZI3A 4MQBA 2QORA 3E1SA 1IOZA 3SYLA 4KBGA 3C5CA 3B82A 2QI9C 3CUEF 3KXIA 4EUNA 3EIQA 4TZ0A 3LBHA 4LJ9A 5EXXA 2YOGA 3JZMA 2O8FA 1Z6GA 5FBRB 1GKIA 1W4BA 2BM1A 1CEEA 4HDOB 1E79A 1J7KA 4KU4A 2WWFA 2FPLA 4D4LA 1Q20A 1AS2A 4HDQB 1NBMD 1A2KC 4EPWA 4B2PA 5JCPA 1EFHA 1OYWA 4KI0A 5KSZA 4URWR 2CNWA 3AUYA 1Q1ZA 4BFTA 4KFSA 3CX7A 2WJGA 4XVUA 4POAA 3NWJA 4PZZA 5FUVA 2PJRA 1BMFD 1E2DA 1P7CA 2C98A 1ZU4A 3PJRA 3D7MA 2Q6TA 4HLCA 5KDLA 3BBPA 1DS6A 2JATA 3NHBA 4KVGA 2G9NA 2FGKA 4TL7A 2RHMA 2ORVA 1E98A 2AL7A 4HAXA 4JKIA 1WQ1R 3AQ4A 3AVQA 4LJ6A 1IN4A 2KBFA 2IYXA 3ZIAA 3UKDA 4DCSA 3LX5A 3I5YA 4M1KA 1G1MA 3KB2A 4A6PA 3DZDA 3CRRA 1CR4A 4TLDA 5CM8B 2GCOA 1GWNA 1R7RA 1H8ED 2REOA 1HQCA 2CE7A 4UXIA 1N6LA 4Q48A 3QBTA 1XTIA 2GDJA 2V7QD 2B92A 2BIFA 1DO0A 4GT1A 1QHHA 4MKHA 5B30A 1OFIA 3PFIA 4OHVA 1GRQA 3G5UA 4UXHA 2IYZA 1ZINA 1E4VA 3GEEA 4NL4H 5FTJA 4TWZA 1KNXA 2GAAA 1P62B 2JDID 5HCNA 2GJSA 3GLGE 3ZZTA 2BVNA 3PV0A 4DDTA 1Q44A 4G1UC 4LDJA 1S96A 3C8UA 4Q9HA 4E07A 4KFRA 2FGJA 5B2ZA 1E2NA 4FMBB 3QI2A 3TAHA 4JSTA 2O5VA 4HB0A 4M8NE 3L43A 1OV4A 2CL0X 4TMXA 4JLAA 4TSFA 2MMCA 4GFDA 1YR7A 1F60A 1YZNA 4BFVA 5ELXA 1GL6A 3SQWA 4IOJA 3IIMA 3RHFA 2GBLC 2ZETA 3UK6A 3KJEA 5DISB 4HZUA 2WWIA 2C2HA 1TL7C 4BLPA 4V0ME 5FUYA 5CIQA 4H1VA 2ZRPA 1AKEA 4Q4LA 2ANCA 3FE2A 3UATA 1YQTA 2CLDX 3BRWD 3KKPA 4M9XA 3IHWA 5H70A 3EZ6A 5UKDA 2CHQA 3RABA 2J7KA 2BBWA 1EFRA 2F1RA 3IO3A 3L0SA 5CK4A 1ZJ6A 3T1OA 1N6OA 1LV7A 1Z07A 2F3TA 2EFGA 4TLAA 3VU9B 5HE8A 4MRSA 1OF1A 2XJ4A 1RJ9A 3ND9A 2AWNA 1LVGA 4MRVA 4PZYA 4URYR 1E2LA 4NCIA 3H84A 2NPIA 3OIWA 3TLXA 1OIWA 1TADA 4EFNA 1IAQA 1IM2A 2VPPA 4BLOA 1NN0A 3KQHA 5IT5A 2OO7A 4TMZA 2ZSDA 5FBWB 3CW2A 3HR8A 3RANA 4US0R 4ARZB 2J7PA 4BLRA 2XGJA 3H1TA 2ZJBA 5AUQA 3H86A 1E2FA 1EK0A 2IXGA 1VDZA 4EFMA 1FTNA 2D2EA 3LXRA 5DI9A 1CKEA 4M9SA 1HH4A 1OFTA 4U02A 4PZLA 3RWMB 1KI7A 5B57C 1LB1B 3LH5A 4PSVA 1CJUC 1KI1A 2FZLA 1ZNXA 3B9PA 4GP7A 1W5SA 1GKYA 1WDTA 5CDFA 1NKTA 4B3BA 5L3SB 3CZPA 3HR7A 4M1YA 3C7KA 4YC7A 2RGCA 3ZJYA 2IK8A 1H65A 3M1IA 5JJLA 4TYWA 3OZXA 1BIFA 5E7JA 1EWRA 1YR6A 4KSCA 4F92B 1ZUIA 1HUQA 2W6ID 4QC2A 2RGNC 4WZ6A 2IS4A 3ZVNA 4OI2A 4CEJA 4W5WA 1M7BA 1F2TA 5CIWA 1KZGB 1N6IA 2BMEA 1EX7A 3O8RA 4N0EA 3ADCA 5GJBA 4W5JA 4A2QA 4B33A 1CR2A 1UPTA 4K8OA 4DLXA 2XTMA 4FI3C 2IBMA 1E9FA 4US1R 5J47A 1P5ZB 3SBDA 2VL7A 5DI3A 1XTSA 1FW6A 4XSHA 3TK1A 1KO7A 4KODA 1Y3AA 3FWYA 4B2IA 3A4LA 1CR0A 2DYKA 4RCZA 2ZRIA 3SE0A 5C1BA 1T3SA 3VNVA 1O3YA 2BMJA 1KKMA 3FMFA 1PJRA 3MJHA 3P4YA 4DXAA 4PHHA 4KFUA 1AM4D 1SVMA 1ZBDA 2KE5A 1AZSC 4B43A 5DNYB 1X8JA 1JB1A 4YDSA 4O3MA 1GNRA 5EP1A 1R8QA 1XWIA 1JQLB 4UNPA 1L4UA 3ND8A 4GOXA 2EW1A 2ONJA 1UBFA 2VP0A 4P4TA 4B3FX 3KFXA 3Q8XB 3T35A 1P9NA 1UJ2A 3GLHE 4PFSA 4A8JA 4BFXA 3K9GA 2ZJ2A 2WWGA 1TF2A 5JS7A 1AQYA 3EWAA 5E7IA 1YVDA 2CLCX 3CPJB 3E70C 1IY1A 4HB3A 3EPKA 3BFVA 2J5XA 3LLUA 4LHZA 3PXGA 3KKQA 2V4ZA 3KTAB 5A4JA 2FDCA 3LW8A 3QEOA 4CGZA 3AKDA 3AF1A 4MKGA 2IL1A 3AVOA 4OQNA 1Z0IA 3DL0A 5FPTA 3VU9A 4OQFA 4CEHA 2WTUA 3CLVA 4FW9A 1U99A 1KO4A 2GCPA 3KKOA 5AK0A 4B3DA 1FUKA 1MRNA 1YJ5A 1E1QD 3VX4A 3DOFA 4TSFD 3U60B 4JJKA 2WIAA 2F1HA 1F3OA 2WAXA 4HAZA 1XEXA 3NDPA 1Z22A 5DHAA 3HPQA 2H8KA 3QF4B 4Q4AA 2OT3B 4LJ5A 4M1OA 2IUUA 3GJXC 2O0KA 5L3RA 4DIDA 1DAMA 1GNPA 2VYFA 3NBXX 1XJQA 1E2IA 1SHKA 2CVHA 2GTPA 5JWOA 4AG5A 1D2MA 3LA6A 2LCFA 2OESA 3UMRA 2BV3A 1U9IA 4AYWA 4FMCB 3LO5A 4JT2A 4P3YA 1Z3IX 5JJIA 4OQLA 4Q4HA 1W36C 1KJZA 4RD4A 5TARA 4MKFA 1VMAA 5BN4A 4HUTA 3LBNA 2UZIR 3HP1A 3AGQA 3BFKA 4GPTA 5GVSA 1N5LA 4PC6A 4LPKA 4FMCF 3FVQA 3VR6A 2YJTD 1BYUA 1HE1C 4X8LA 5CM9C 1HYQA 1Z08A 3RS2A 2CCKA 4LPSA 5FBQB 1OT3A 1JR3A 1KMHA 1EG7A 1K6MA 2P5TB 3K9LA 1ESNA 2P6RA 3ADKA 2I4IA 3BK7A 3A1VA 4DCNA 2R8RA 2E9SA 1VYUA 4C2TA 3REGA 4Q1BA 3KX2A 4WIAA 2Z6VA 4IDPA 3GJ8A 1IHUA 2EQBA 4Q1FA 3RS4A 2YVUA 4NYJR 3A1TA 2G1JA 721PA 1NP6A 1F2UA 1MKYA 3DMNA 3PR1A 1VYTA 4X8HA 5GVRA 4ASUA 4URXR 3C5HA 2C78A 5EQTA 5HZHA 1SQ5A 3EPLA 3R9WA 1SKYB 2XXAA 4CEIB 1U2RA 2VHJA 4JIMA 1WRBA 1NL3A 3OFNA 4LWZA 1Q0UA 1ZD1A 2BKUA 3SU8A 1NY6A 1VCNA 3W90A 2QM7A 1XNJA 2DWOA 4OI4A 2OCPA 4FN5A 2Z4SA 5J40A 1ODFA 4MYUA 2PEYA 3K1JA 2DPXA 2VQSA 5HTKA 3M4YA 3LAWA 2H5EA 3REFA 3L0PA 2PMKA 1KDOA 4PHTA 2YHSA 5C18A 2NMVA 3OE7D 2A5FA 1C1YA 4DSUA 3IQWA 1WBDA 3GFTA 1E99A 3EX7C 2EYQA 3Q5EA 5FH9A 2OBLA 4YMWA 1T4GA 3VKHA 2V6IA 1RJ9B 1OIVA 2QPAA 4CW7A 1WE2A 4EPVA 4E22A 1TNDA 1VECA 3D31A 3UWKA 4UNRA 2WJVA 1R6BX 2QL6A 2W0MA 3NDBB 3TRFA 2NO0A 3ZZUA 3T12A 2Q21A 3BH6A 1LS6A 2A78A 2F9MA 3A4MA 4DSTA 1YZGA 5CLQA 2A5JA 2ATVA 2BBSA 1N3BA 2PZEA 4BLTA 2FPMA 4BRUA 2YKGA 3SI7A 1BS1A 4LX0A 3CONA 3K09A 4IVQA 4C0AC 2HYDA 3GJ3A 2ZYVX 3VMFA 1RW4A 4DT1B 1M34E 2QAJA 2N42A 2HT1A 4DLVA 1E9RA 1DAGA 1T0JB 4I1UA 3HWSA 1G8HA 1KI3A 2IHBA 1ZM9A 2ZJYA 3IPXA 5TMPA 5JWRA 2GVDC 3QE0A 3K70D 3SHFA 2ONKA 1GDDA 4PHGA 1AIPA 1JR3E 2ZROA 4A92A 2J7PD 3BC1A 2C9OA 3EAQA 4TT3A 4EPXA 1E6CA 2FG5A 2QE7D 1NVUQ 1SXJC 4JT4A 1KK1A 4ACBA 5DHFA 3RSOA 4DB2A 1J8MF 4MGZR 1B23P 4GP6A 2WJYA 4DJTA 5DIFA 3P32A 1L7VC 1Z29A 2PLFA 4PO1A 5EE9A 2OHFA 3U44B 1PUIA 1AJEA 3VAAA 1QF9A 1OXVA 1NIJA 2ZR0A 3E5HA 4KSBA 4O2RA 3LV8A 2QMEA 4KYIB 3FKSA 1CP2A 2GNOA 4YMSA 5FOSA 3K70B 5DH9A 5K8TA 4OI0A 1W47A 1KGDA 2NOAA 4AI6A 3J81k 2ZQ5A 4OK3A 2ZSFA 3K0AA 1W46A 3AP1A 4D4KA 3CF6R 2FX3A 1U8YA 4G0NA 4PSAA 1NY5A 4LYJA 2OCBA 4HAYA 5B64A 4XWAA 3SYKA 1GRRA 1VIYA 1YZTA 4R71A 2ZIAA 2IX3A 4DSOA 2G0NA 1DE0A 4MUAA 3QG5A 2DB3A 3U4QB 2ZANA 3A1WA 4LBVA 4JL5A 1CXZA 2IWRA 1J90A 2JIZD 1NMZA 1G7CA 4II7A 5FL7A 3RS0A 3VTKA 3SJAA 1OB5A 2ZRDA 4HEJA 2ZR9A 3B2EA 4CEJB 3OAAA 1G4AE 1DAKA 1OKKA 4DT1A 4I81A 2WAYA 2R2AA 3FB4A 5TXGA 2JJ1D 3AM1A 5D3MB 2WBLC 4PHFA 1E69A 3CH4B 2Q0HA 2VA8A 4EAQA 4NTZA 4PR0A 3MGCA 2EFDB 1FZQA 3LRPA 5KSPA 2Z83A 3LQQA 4NONA 1NVVR 1GG2A 2VP4A 1Q12A 1TTTA 2CNWD 1OHHA 3WHLA 2VF7A 3CF2A 4RFSB 2AKAB 2AN9A 1KI9A 2ZJOA 4JLBA 2RGNA 1JNYA 3QPWA 2RGBA 3SHWA 4IVRA 2JIZA 3EZFA 3R9IA 3QUSA 2LWIA 3CRW1 3W6OA 1ZCBA 4EIWA 4HAWA 4FD2A 4PPGA 4A82A 5C4MA 2JJ2A 1N5JA 4JYCA 5HPYB 2FWRA 1G5PA 2I1VB 3UXMA 4BEBA 5GJWC 1A82A 1W4AA 1Z5ZA 2IUTA 3CR7A 3FPAA 1II8A 3KFVA 3Q7QA 5SZIA 2ZAOA 3WP1B 1XTRA 2IF2A 4E03A 5EXPA 2ZXUA 4UXJA 4C4PA 1E2PA 1Z2CA 1A1VA 2QTFA 2GF9A 1NBME 2ASEA 2W58A 3H0KA 1D8TA 3NTUA 3QBVA 1KDTA 2YZ2A 3TVTA 4BFWA 4CRWB 4XVQA 4G01B 121PA 1ZM3A 4YDHB 1E96A 2V1UA 4NYMQ 1GL7A 5G3ZA 3DM9B 3NBFA 3B60A 1W48A 4I1OA 1XCGB 3TUIC 1SVIA 4HZIA 4GDFA 1NI3A 4I4LA 3GEHA 3LY5A 4UJ5A 3ZH9B 2ZVPX 3B5JA 1XTJA 1Z0DA 2JLVA 3SJBA 3X1XA 5FBVB 4C9BA 4BWYA 1FPMA 4IHQA 4XTRA 1ZU5A 2VSFA 2WJIA 3AP3A 3IBYA 2B8WA 2GRJA 1W0JA 3EIHA 3CPHA 3AF3A 4L9SA 5J5CA 2Z0MA 4PAMA 1G3MA 3LD9A 1NKSA 2REBA 3WHKA 2FFHA 3L8YA 2VHUA 2E87A 3NH9A 1XPOA 1U94A 5AJWA 2O8BA 2CHVA 2NGRA 2Z5FA 1XD2B 5TB5A 4FWIB 2JDIA 1RFLA 1G9XA 1IN6A 4BLSA 4C0LA 3QPUA 3SJZA 4UQOA 3U6BA 2JLUA 3WNDA 4QJ4A 1CF4A 1OJLA 2V1XA 3SDZA 5AJYA 3MSXA 4LYHA 2ODEA 2P6UA 3EARA 3IILA 2AXPA 4LBWA 4AYTA 2WSSD 1MV5A 1UEIA 2NO1A 3I32A 5FR2A 2D74A 3H2YA 3MUFA 1XRJA 4LUCA 2WKPA 4UNNA 2ZITA 3C16C 1Q1BA 3NC0C 3RNLA 3U3RA 3ZIAD 3SFVA 2CCJA 3LNCA 5DSZA 3OIVA 2QPOA 3SQXA 5J4VA 2FJUA 2QY9A 2V6JA 5D3MA 2CK3A 1E9DA 3A4NA 2ERXA 2KJQA 3DO6A 4ARZA 5AUNB 2OV2A 4M0LA 5K8IA 2ODBA 1R8SA 1KHTA 1K5GA 1NG1A 2J59A 3WP0A 4A2PA 1UDXA 1S9HA 3HYTA 4AY2A 1XTQA 1A7JA 2WKRA 1X1SA 2D4HA 4A0RA 1DVRA 1DTSA 3NH6A 1VCMA 4NDZA 3QXHA 3P4XA 3X1ZA 2YOFA 4A1FA 1XPRA 3FYHA 4QKQA 1XCPA 4MDFA 1XFAA 2VP9A 2ZEJA 2J0VA 4NH0A 4L8GA 3T5GA 4A9AA 1KY3A 2C9YA 2BC9A 2HLDD 1II0A 1PLLA 1OB2A 3W6PA 3ZDQA 2ZRAA 1W44A 2QTVB 4EFLA 1XPUA 4P31A 1EFCA 3PIRA 4Q4JB 4D25A 2QTHA 3MD0A 1XB2A 4ZIRA 2OE2A 5AJXA 1KO5A 3ASYA 5BYKA 4LJAA 3T06B 3GJ5A 4DLSA 1Z83A 2WMOB 5B58C 5SZJA 3IHLA 2EWVA 1GNQA 3IUYA 1TQ6A 2GCNA 4N0DA 3NXSA 1JI0A 4HLUC 3BXZA 2OBNA 4G5OA 1XZQA 3K9NA 4MGYR 4N1AA 4O0MA 3W3ZB 4M1WA 3P27A 1KDPA 5JLJA 4MA4A 3TE6A 4ABYA 3BH0A 1YE8A 2J3EA 3CBQA 4Q1AA 5LD2B 1G19A 1N0VC 4WXRA 1E2EA 1Q1QA 4AC9A 4DIEA 2DFNA 3Q3JB 2W00A 1S1MA 4QFMA 2VO1A 5FTMA 2PBRA 4GRAA 4WW0A 3MWJA 4LV5B 4D0GA 1YRBA 2ZUBA 4RCYA 2W83A 4KBFA 2WPDD 2YWEA 5BQ5A 4BZQA 4IEIA 2IA5A 1OXUA 3OEHA 1XF9A 2RGGA 4QM6A 1V5WA 4M9QA 1RRPA 2GEVA 2ZUDA 3QVVA 2NPFA 5HKKD 4FCVA 5M04A 1AQUA 1X1RA 2ECKA 1NLZA 3P20A 4DSNA 3X1YA 4M1SA 5LD2C 2RHDA 3CNLA 4CEHB 4QBIA 2ATXA 4DCUA 3A8TA 4RSGA 2DR3A 2XOKD 2ZRMA 4LSGA 2IYVA 2G77B 2VLIA 2ZI4A 3I61A 3HYRA 3MCAA 4OYHA 4ESVA 2PZFA 1F6BA 4PC3A 4AYXA 3THXA 5KHOC 1G8PA 4IFBA 5C46F 4XVRA 4WOPA 2ZTSA 5CK5A 3BB3A 1SHZA 5FOWA 4V0NA 5EP3A 4EDHA 1JJ7A 2ZE8A 2VP5A 1E94E 4MRRA 5FPHA 3UIEA 3U4QA 2QMUA 3WMEA 4JLPA 2YC2C 1XCMA 621PA 3I62A 1M8PA 4MRPA 4M9ZA 3OESA 2D7CA 1FTSA 2ZSEA 2F9LA 4C0JA 5KO2A 3RVBA 4NBSA 1P2UA 2P3SA 4P33A 1XBTA 2HUPA 3WBKA 3PEYA 3EW9A 4R9UC 4D6PA 4C7OA 1OFUX 3AGPA 4GNKA 4L4UA 4XWKA 4D82A 2PCJA 5FOUA 4Q4JA 2ZU6A 3PUVA 1A2BA 3B6EA 3EC2A 3DPUA 5IRCD 2H57A 2JLZA 4YLGA 2IS1A 2FFQA 2ZS9A 1A4RA 3CWQA 3RS3A 2OZEA 1S8FA 1E0AA 1E2HA 3R20A 3BORA 4DUGA 4RD6A 1XDBA 1QHSA 3TVDA 3QKSA 5G41A 4MYCA 2KB0A 2C9CA 3X2SA 2R9VA 4Q4HB 1HT1E 5AUPB 2AD1A 3LBIA 1R4AA 4TN1A 2CDNA 1QBKC 2V7QA 4H9GA 5L3QB 4Q01A 2RKOA 4B76A 4E09A 5ANRB 5CITA 2Q3HA 4IDNA 4MYTA 4Z1MD 1KI6A 3D6TB 1DBSA 3V9PA 3BIFA 2J0QA 5EE5B 4BUJA 3FMOB 4O2LA 3KL4A 2XB4A 2WWHA 2PL3A 5BWMA 3QKTA 1ZMXA 3PQCA 2QBYA 4OKSA 4F4IA 3EZ9A 4Z54A 1KMHB 3SFZA 2QRZA 4C3ZA 2IC5A 2ZRFA 3VNUA 3BS4A 4OK6A 3GEIA 1GP2A 4IOKA 1KSGA 1EESA 5FTNA 2D2FA 2F55A 4W5HA 3UANA 2N1BA 4PQYA 4EQ6B 4URVR 3THOA 1BKDR 4DLRA 2PZGA 3EZ2A 2FF7A 1QG4A 1S3SA 2ZE7A 1S4QA 3CIOA 1MO4A 2HJVA 3HU3A 3RRZA 2DWPA 1DG3A 2YWGA 3AP2A 3AVPA 4Q7LA 3UMSA 4Q47A 4TYQA 1SVWA 2ZE6A 3FKQA 1KIMA
chains in the Genus database with same CATH superfamily
3V7FA 4GOLD 3M2TA 3RV3A 3OBBA 3AEYA 5EJMA 4R1TA 3RBAA 4N3AA 3I09A 1QANA 4Q9KA 1DADA 2QG6A 5D3ZA 5I47A 2FSGA 1ML3A 2ZAMA 4PBRA 2XB9A 1Y8RB 2QTZA 2OLJA 3AHJA 1T3GA 4OL0A 5AVWA 5HRCA 4F1WA 2BFEB 1S0UA 2PLAA 4KX3A 1R9JA 5D51S 4XJTA 3IP9A 5CFPA 1UJMA 3D8HA 4II3A 3IE0A 2QRVA 4RAOA 4ENRA 4WK0B 5EIWA 2GESA 3VPBA 1PBTA 1ZUWA 5IPFA 2PKQP 2IS2A 5I5GA 3GPCA 4EM6A 3AXSA 1C30A 1VMKA 3MTDA 4BE7B 2NM0A 1DKUA 4TMFA 3DV0A 4D8UA 1L4FA 5A02A 1JQ5A 2WB2A 3WBJA 4OUDA 3KPVA 3H18A 3VO2A 3UA3A 3CX8A 2BZGA 4GKBA 1LC3A 5IC4A 2BGRA 4E51A 4B2PA 3VR6H 1M34A 2J07A 4NYIQ 3KSBC 4OIFA 1E0JA 5IMSA 5J4YA 1XE3A 3OHPA 2VATA 2OZLB 3VHLB 3OKFA 1UC4B 1YL7A 3RC1A 4K6HA 4L6AA 4QOGA 1FFEA 5GTDA 4MWTA 2BZ0A 1EXDA 2BDTA 5EWJA 1F8GA 2DFKB 1P1JA 4HO1X 2FJ0A 1XZPA 3JS5A 1G8JA 4GDMA 1NF2A 1YULA 4LHYA 4KP7A 1NQUA 3S2ZA 5J9FA 1JYEA 1A97A 2VTVA 1XQVA 1R4NB 2R84A 4B3XA 1B42A 2RI6A 3W5VA 1GLVA 2Q8QA 4G0WA 3DDOA 2Q50A 4IDBA 5K3DA 2NU9B 3AF0A 3B8EA 3IBCA 4KQCA 2H9IA 4ACAA 1K66A 4Q3OA 1FX0A 1VCOA 2AX3A 2OBBA 3E3LA 5LBTA 4AICA 5AJZA 1MB3A 3BTVA 4H7IA 1QHNA 4QQRA 2FN4A 4WESA 1YRAA 3E3MA 1PL8A 5IJWA 2B4YA 5LOVF 3KYCB 1YVUA 4CL8A 1PT5A 5HUHA 4P22A 3IR5A 1ZK4A 3DDWA 1FFBA 2H3EA 2DBYA 4S12A 2HPVA 1NVWQ 3BA1A 4WINA 4LXTA 6AT1A 3NBQA 3QLVC 5BR8B 2PQMA 2HI0A 1GZ3A 3E53A 2VDQB 3FBGA 2O0JA 3EEOA 3WAGA 1BO6A 3NYWA 2ERYA 4RAQA 2BSXA 1IIBA 9MHTA 1NBEA 2C5EA 3KSRA 2V9CA 2ZR7A 4YTEA 5FLKA 4F97A 5A5DA 5BN5A 5DPMA 1AQJA 2GEDA 2R5FA 4OX9Y 1ZKMA 3PDCA 4AK9A 2XODA 1P2TA 2C94A 1N2CA 2P9ZA 2CFTA 2WV9A 3G9UA 1BFDA 1GFIA 1Q7TA 1EEXB 4KIGA 3NTLA 2WF9A 2B25A 4TT3D 5FPPA 2VSNA 3RVDA 5BN1A 4ILKA 3QYAA 2BW0A 2W2VA 2Y0CA 3G0IA 3QBEA 2AQ8A 3O8BA 3AUXA 4DDVA 3CWZA 4ZVMA 2RD2A 4ND4A 3D8BA 4LGMA 2R6HA 2JAUA 3PBKA 1R4MB 2BEKA 3DEFA 3FPJA 2C2XA 2D2VA 2PUVA 1T8RA 3K0AB 3PPVA 4G2TA 1ECGA 4A73A 3RADC 1KRHA 3GJZA 1PTKA 1QHYA 1B43A 3JQPA 5KYTA 2PU7A 5KUTA 4FOTA 4Q7KA 4MHTA 1HOXA 3GIDA 1JJAA 4INAA 1I2DA 2D2IA 4K9LA 4WJZA 4JCCA 5FPSA 3UK7A 1WETA 4HH0A 4RVNA 3TSYA 4F7DA 1BROA 3FOCA 3WQQA 1M8JA 1C9NA 4R1LA 3EIEA 1IRXA 2J9YB 5FBLB 4BPBA 1CNEA 3C4QA 1Y9ZA 4PXYA 5EMHA 2I91A 3QYJA 5DYIA 4IV8A 5E9QA 2FHPA 4WZBE 4KXWA 4ZZ2A 1ZOPA 1JFVA 1Z0JA 1G8FA 2I76A 4INJA 5ALRA 3EDQA 3L41A 5HE9A 2NPOA 5JYEA 1P72A 2FCRA 4RF4A 3F97A 1GPMA 3WI7A 5D6OA 5KSYA 1DCFA 5TF4A 2G5GX 3RUIA 2JD0A 1L8XA 3DTTA 4NQZA 4G41A 1I2MA 5JSZB 3DMFA 2YYZA 2FPUA 1JG1A 2DUNA 3OM0A 1FVOA 4RD1A 1UEXC 4BECA 5DWQA 2X1VA 4MCHA 2XCRB 2GJ8A 1COWD 5F78A 5BRNA 1ECJA 4Q82A 3G9QA 4G5RA 1D1PA 1OI2A 2R7KA 3SYRA 1DCKA 3WYGA 3HBAA 2WUEA 3RKRA 1XSEA 3ROQA 4E33A 4TLMB 4MVJH 1R0YA 2P2CA 2HSWA 1G20B 2NAPA 3CSDA 1DO8A 4PNPA 1JKMA 1MFZA 5DCYA 3RSCA 1XMVA 5E9JA 5CBPA 2B1GA 3GDGA 1X86B 2VSQA 2O8DB 2NXWA 3HLKA 2HR1A 3A4IA 4KQJA 4JB2A 3O31A 1EJ6A 2TMYA 4I8DA 3GRCA 5BQFA 1T6BY 3NORA 4UZSA 2C7GA 1DSSG 1A5TA 1X8KA 2CLSA 2IU6A 3GX1A 1WVIA 3IAM1 2PU5A 3NJ8A 3PGMA 4RKEA 4UDYX 4WACA 1GNVA 2HWUA 3DHNA 5HKLA 3DEAA 3PR3A 4OJQA 3ZGXA 5U4QA 5AW6A 2ID4A 1KMQA 3CF4G 4QLOA 3FPGA 3E48A 1U7PA 3OJCA 1XXHE 1EB8A 3IT2A 5I5EA 4TROA 4NSNA 2DC1A 2VJBA 4X95A 1GGMA 3RVNA 4R0MA 1U8CB 1VHJA 4KPYA 221PA 2IW3A 4CTMA 1VTKA 2H00A 3UFXB 2KSQA 3PUJA 1P0MA 5E9AA 2MMGA 3MMSA 5ER9A 3W34A 4QU9A 4GPAA 1EHIA 4E6EA 4G0MA 2VRBA 3EVCA 3L18A 4O63O 1BXGA 1CTQA 1PSDA 1AB5A 1N2ZA 4LFCB 3TECE 2O3TA 5JWRA 1B76A 4REOA 4OHRA 5DTMA 5K0JA 2YXLA 1O95A 1XX6A 3DC2A 3RYHB 1JDUA 1UQRA 1WEHA 5C32A 4G84A 1IZZA 2MINA 2P78A 1K5DA 1TJ3A 2AMJA 2EDCA 1IZ8A 1TUEA 5KB3A 5IKPA 3FPEA 3ONWA 1D6NA 2QK4A 1XRQA 1F2TB 1V1JA 3HJAA 2CBZA 3U4GA 1XJWA 5ER6A 5JXGA 3WDMA 4H18A 5BWNA 1RHQA 2OO5A 1OKKD 2C95A 1CDOA 3KUXA 4WQMA 5C4IA 2BP7A 2ONZA 1KP3A 3RFTA 3L46A 1J09A 1V5GA 4KEAA 4CYMA 2WW8A 1CIJA 4J76A 1SBYA 3AR5A 1HDCA 1W4RA 4KQHA 1O8BA 1UQUA 1PNQA 2GSDA 1WXEA 2GNPA 4WTOA 4X92A 3RRJA 3HV2A 4CR6A 1JDZA 2FEWB 3DVAA 2VDJA 3K4PA 1LLFA 2IXEA 4KQIA 1RWOA 4IO1A 4P5EA 5C35A 4DV1B 1LSSA 4D0RA 1PJAA 1GZHB 3EA0A 3BF8A 3IUMA 5AVUA 3MGKA 3DFUA 1JJVA 5FI0B 2BJHA 3AESA 1JSRA 4R98A 1XJCA 1G7RA 1W88B 5KYKA 1DX9A 1D5CA 4ZYTA 2AFRA 2WHPB 3Q1KA 3K2QA 3LC2O 5LKRA 1JECA 4B6PA 4XSGA 4FYIA 4QTTB 3GCXA 1Y3CE 3OFKA 4UTNA 3FSGA 2ZB2A 2I22A 4MW1A 2X0KA 1NJGA 1IBRA 2P65A 4BL5A 5CB4F 3W4JA 4KTTE 5LNK6 3WX0A 1HK7A 1UK6A 3DJFA 4ZI5A 3KS9A 3VA7A 4H4DA 3R7BA 3O21A 3FPHA 3G2LA 1GILA 4IJMA 3WGQA 3B1KA 3FWNA 4ENQA 2ZUEA 2HJWA 4DR5B 3SZRA 1TT5B 1FLDA 5DN6D 3DNMA 1LX6A 4XDGA 2VQ3A 3AEKA 5K8JB 4TKUB 1C1DA 3VDRA 2C29D 3CUUA 3GAZA 3KOMA 3L6RA 1U9JA 2O8CA 1ODTC 3UMVA 3GXOA 3B7GA 4HADA 1GJRA 2QR2A 4P80A 4PVCA 4ZQHA 5F98A 4N4AA 3V4FA 1AO3A 4ESHA 2XBUA 1LTKA 1TKCA 2FMXA 2IYRA 5DBOA 3T4UA 3RIEA 3JYLA 2F1IA 5IS2A 3KZCA 5KYYA 3AU8A 3RS5A 2JJ1A 4DBLC 1ONSA 2AZDA 4IW3B 1G5FA 1I5RA 1Q0LA 1M34B 4IUDS 1Z8DA 1UMDB 1UK9A 3BH7A 3OZGA 5A5GA 2EG5A 3MS7A 2H0RA 1OLXB 4HP8A 4FFNA 3V4OA 3L8CA 4OXXA 1RKXA 2YZMA 2W22A 4HFNA 3PVSA 1HQDA 1PZEA 3PIDA 1PRYA 2NYUA 3TX2A 1Y1KE 1OU0A 3AUAA 5IMBA 3TZCA 3L8ZA 1UM9B 2P5YA 1ZGGA 2NN3C 2QRVB 3I4LA 1R74A 1ZD9A 2WA2A 3LYLA 3PICA 4R7ZA 3RAGA 3ZI0A 2OM2A 4MJ3A 2BFEA 2H92A 3H9CA 5CJ2A 4BCDA 3VR1A 4D96A 4QREA 2VZEA 1RRMA 2HWXA 3E05A 2GLXA 2RSLA 4PGMA 1NBOA 2HJGA 4YYEA 2NZYA 2X3FA 2H18A 4XFKA 4LVUA 1PEDA 3WWOA 1JDJA 1SD1A 3AR9A 1N6KA 3O91A 4BFSA 1XCBA 2BHRA 3JVIA 2DHCA 5IU6A 4IBOA 3K5HA 4S24A 1Y3IA 2CUTA 3G1WA 1V16B 2L82A 4PGHA 4KVFA 1KYTA 3AH8A 3NHAA 4TMKA 4YALA 1B14A 4KMOA 2XHEA 3L7NA 5DOVA 4RPIA 3TBKA 1P31A 2BUAA 4DM4A 2XZOA 4OQZA 3R8XA 1CEXA 3U13A 1Z0FA 4GUDA 4M22A 4YPFA 3TNJA 3GJ6A 1FXSA 4LOLA 1SU6A 1CFZA 3QVUA 5G40A 5H0IA 2FPGA 3GLVA 2H48A 4KL8S 4E2FA 4YUAA 5H4GA 1U3WA 1AS0A 2WHXA 1DCMA 2CN1A 1T4CA 4DADA 3EBOA 2I2AA 1IUNA 2G0AA 3EAGA 1PFYA 4ZK2A 3MCTA 2Y1GA 1ESMA 2DAPA 5B1SA 2W2TA 2WLSA 4D5EA 4HTFB 1UXKA 1JVNA 4QYMA 2L42A 5JC1A 2Z2XA 1M5UA 4RNDB 2G9ZA 1R5NA 2RHGB 4YN3A 2YVQA 3PEVA 4QG7A 3HJNA 2E5WA 4IOMA 4EEXA 1KAEA 1GITA 4IIVA 3ZD7A 4A36A 3LRTA 4X94A 4UUMA 4OHFA 3PUKA 3L4SO 4DMFA 1WB5A 3C3WA 1PJBA 1T4MA 3VR4H 4G5HA 3GN1A 3PU6A 1OAKA 1YK0A 4GD3Q 4OBBA 1MNQA 3KYCA 4J0CA 4NHEA 4EHIA 4OHMA 4DCJA 3LMKA 3C7AA 4TWBA 3RTDA 3LP8A 3ABSB 4AKHA 1NA5A 1C7FA 2PH7A 3IRUA 4E4YA 1WXDA 3L7BA 4QNMA 4TXJA 4WKPA 5JVDB 2XGSA 3E3NA 3QKSB 2JFUA 3KE9A 4OLJA 3ZGVA 3WKAA 2FW0A 3A4YA 4DA6A 1QIJA 3IVRA 4R2HA 4E31A 5E95A 5CVDA 1MXHA 3EQ2A 3N58A 1YHZA 3WYFA 3I45A 4B3SB 1FX0B 4EW2A 1FTQA 4KO2S 1QG2A 5BYAA 3RFVA 3DWFA 3NGMA 1WB4A 2A6PA 3CURA 4CODB 2XTZA 5JEDA 2ATEA 4PPNA 4TYPA 1TA4A 4LMRA 3T7IA 3QJYA 4S05A 3IDQA 1O5TA 3ZLBA 5K6TA 3VZRA 2PUCA 4X7MA 2C2GA 3RYCB 1K86A 5AVRA 1CY4A 4UCFA 1LI7A 4IIDA 4UCWA 1YA8A 4XWTA 1KAHA 3P0HA 5A6VA 3WSVA 1B6RA 2C8JA 2D8MA 4KO4S 7ABPA 4CG0A 1ISSA 3BKXA 3WYDA 3F7NA 1MABB 2ZS7A 3PGA1 1QXSA 2EZ4A 2W37A 4QDJA 4F5YA 4W5TA 3GK3A 3NKVA 2FPXA 2HJ9A 2VCHA 3ZWBA 4TVKA 2QVBA 3MJ4A 4BP9A 8MHTA 4ZTBA 2ZBDA 1YC2A 3PXXA 2A7XA 3T1VA 1DEKA 1SXJD 1I7DA 1R10A 1HEIA 1RRCA 5B3JC 3D3WB 1PS8A 3DLIA 4EB6B 2EDAA 3COJA 3DYIA 3EVEA 3L4EA 3ILSA 3VUEA 4PSKA 4D8VA 3S4YA 1RXIA 1PUXA 1Z6PA 3B6IA 3C3XA 2I99A 2FETA 4J9UE 3RW9A 3W2EA 2CXHA 2PS1A 2A5LA 3BD9A 2IOFK 1E2KA 3MWYW 4I2VA 1KEPA 5IAJA 1E1QA 3AIMA 4KR0A 4MUBA 3ZQJA 1LF0A 1YRYE 5LVAA 2IU4A 5EXEA 4NIMA 3JZAA 4M38A 4DEXA 3RC8A 1RTKA 2B4QA 5ED0A 4A0SA 4BNZA 3PD0A 1HLDA 2O2DA 3E4CA 5K4HA 2E3JA 3CPEA 2YDXA 4HH1A 3I34X 4IIJB 8ADHA 3TPZA 5J4LA 3OEYA 4DV3B 4GPD1 3HKDB 5I51A 2W9XA 1JPJA 1ZJ5A 3D5QA 2ZU0C 2O2GA 3L0ZA 3LUHA 3FPSA 1IXRC 1US8A 3OEWA 2A88A 4GEGA 4QARA 1V6SA 2WUWE 4HB2A 1LQUA 4OHPA 3BSYA 3C43A 1CUJA 1RM3A 2PL5A 4WN9B 1SXIA 2R85A 2OORA 3BWBA 2GFHA 4KAXA 4JZKA 4F38A 2SKEA 3QWFA 5JXHA 2RGDA 4Q9IA 2QHXA 3QHAA 3WZ2A 1VE9A 3AI7A 4YMTA 1GTJ1 3AY3A 1Z73A 2Z95A 4U7TB 4F3KA 5B1HA 2SECE 4DB4A 3WTCA 1UBJS 2J3QA 2GJ9A 1R37A 2VJLA 2G5CA 3D8TA 4GC5A 2Q1XA 1IQ0A 2XB8A 1RYHA 1VKNA 3TAUA 3NWEA 5JC8A 3ENZA 1ULUA 3VDQA 5IDXA 1G5TA 1V0JA 3GARA 3KYBA 4WL0A 3KVRA 1LPPA 1JDBB 4ND8B 3LYHA 3HWX1 4JEHA 2WMNB 1EE2A 3GMIA 1ZVMA 1N2EA 1W88A 1W29A 4MWEA 3WSTA 1K8ZB 3RK4A 3BYZA 2AJDA 1ABBA 1QHHB 3LC0A 3EVAA 1I0LA 1OWPA 3PXAA 1NP7A 4TUYB 2WSMA 4KZPA 2QM0A 4JK3A 2JJ8A 5HIIA 4EO7A 3QE4A 5ITZA 5COQA 1TMOA 1JGTA 3NFYA 4QOJA 3KB1A 5IM4F 1P9LA 3N8NA 2C2OA 3BIJA 1T9AA 1TGYA 2IEZA 5B37A 1NI5A 1J70A 4YB8A 4YVFA 1W85A 3UCEA 3GLGA 2BSAA 1MLDA 2HY7A 2P91A 3EHDA 3FUCA 4RM2A 4J07A 5J2TB 1L2TA 3OU6A 1PGNA 4WZBB 1YZKA 1ZA2A 3R41A 2GWHA 4DCPA 2J5RA 4DMHA 4RF2A 5DSTA 4GI7A 2OM6A 4CTJA 4RGVA 4EHKA 4Y1RB 1DXQA 5HGJA 5AJTA 5DK4A 3CZQA 3UC5A 4AT1A 3A9TA 5KYGA 3MAGA 2CBGA 1L8QA 2ZJ4A 3IV9A 1D2RA 4ZT6A 3AHGA 1CERA 1LFDB 2Q5HA 4D8WA 3H5LA 1MT3A 2AQHA 2E2WA 3PYLA 4TMYA 4DTCA 2IIPA 4V0LA 3PQDA 2P9EA 4EF5A 4EGSA 3ZE1B 1FJXA 4M21A 3HEMA 1XROA 2DX7A 3DBRA 1MAWA 1A5ZA 2WF8A 2GTHA 3EW7A 1VL6A 3IODA 3TMKA 1MRZA 3GJYA 3IPRA 5T57A 1X92A 4YUYA 1M7GA 3TQTA 1KO1A 4HUQA 2C3OA 2FOXA 2XE8A 2ZS8A 1PYDA 3R7DA 3SNHA 1KWKA 5FHRA 1CUCA 1L5MA 4R5HA 1E58A 5TS2A 1ATZA 5KYNA 3U7EB 1KK0A 2WWXA 3CZRA 3FWPA 1V3QE 4LFBB 2IHTA 1A50B 1HDRA 3FOBA 4Q1EA 1ZY2A 2ZSBA 1DDIA 4ETNA 2EGGA 1Y5LA 4JCOA 2AC2A 1Q7GA 4CFYA 3KAQA 2OFPA 2UKDA 3JAMA 3DOHA 3JWGA 3RIMA 1HYBA 3V8NA 1IXYA 4LOIA 1A77A 1YR8A 4IV5A 4NATA 4C7OB 3GGCA 4BQOA 3TOVA 3SLKA 4UU7A 2PUFA 3V00A 3CN7A 1MA0A 5FNVF 3QFFA 5JECA 1M3SA 2IHZA 3E9DA 4U7PB 4UTOA 4XIJA 4V0QA 4EY3A 2A9FA 3AF2A 2J9RA 2HRZA 3RSSA 4AY5A 1QP0A 1WUKS 1N9GA 2HDNB 4MV0A 2XGGA 2PMWB 2C57A 3TH5A 3OHMA 3RREA 2JIQA 5FI3A 4JVMA 1OASA 1UBCA 2Z04A 4DC9A 4LZLA 4EI8A 1YHNA 3ROGA 3ETDA 3W5HA 1LPAB 1NV8A 4PC2A 1EBFA 1JEEA 4WA7A 3TQCA 1TF7A 3SX2A 1LD3A 4LIPD 1TLTA 2AWOA 5KNCD 3GZ4A 3VKVA 4Z2AA 3I6ZA 4KR7A 5EMNA 4G1EB 4NJMB 1OIXA 2CXRA 1BDIA 1A2QA 3CRMA 3O03A 1G8YA 4QJ5A 1F8FA 4OQYA 4GXNA 2QX9A 5KJ6A 2VIIA 4ZO4A 4DFDA 2OENG 4A0HA 1APBA 1JEJA 2NVOA 1ENZA 4HGQA 4L16A 1S2MA 4QUDA 4YBRA 3UO8B 1OHHD 1WZUA 1YRWA 2H0AA 1PZMA 1KU6A 3KUUA 2PV7A 2HPHA 4ZT5A 4H7FA 3MLEA 3BG5A 1T6NA 1LK7A 1W0CA 2AMFA 5B5SA 3A2KA 4ZTUB 1IZ7A 2PUAA 1TCVA 3VHXA 3VZQA 5EOVA 5BMOA 2EWMA 1U6JA 1DUIA 1VRWA 3I42A 3D1LA 1DB3A 1QO0A 2P9QA 3EODA 3LBYA 4CQLB 4P4UA 4OJMX 4DRXB 4F4CA 5IG2A 1DELA 5FNZA 2ODWA 3PFGA 3F67A 1JDVA 3M3PA 2AFIE 4D43A 2XCTB 1OYVA 1RRGA 2AZ4A 2PQ2A 5KOYA 3X1WA 1B1AA 4WNYA 3TCKA 4EBBA 4U1RA 4NOKA 4DDWA 4D4JA 2ZKIA 1P1IA 1YQGA 4P7KA 3WIBA 3QUTA 2NLOA 1SUSA 1MOZA 4ZAVA 3TG8A 1FRNA 3ESDA 2X40A 4TVBA 3H1FA 821PA 5ALNA 2RGYA 2F1KA 1L5WA 3PEUA 3F1LA 3CVWA 4U7DA 2M1ZA 5LP6C 3QU7A 4CNQA 2Q1YA 5K3SA 5FUBA 2ZI6A 3M5CA 1KKUA 2Q9CA 4K81B 3STYA 1C4XA 3H9QA 1KE2A 3HB4X 4Q05A 4BVAA 4AG6A 3AKCA 3CRNA 2PX5A 3E81A 1K9VF 4X00A 2ADFA 3V8PA 4H1TA 4LMPA 4Q66C 1RNLA 3LYAA 2P3LA 4DLPA 5FUQA 3T3GA 3K0CA 3W5IA 1Q57A 1WCV1 2ZSKA 5JRDS 4Y0AA 2FEAA 4DQUA 4R1OA 3PNMA 2CJWA 3QVGB 1OBFO 3O1JC 1X6VA 4REQA 1OLOA 2GOYA 2O5EA 3OO1A 3TIXB 3F78A 4KIUA 1O96B 5ALHA 1E9BA 4LZZA 2CXPA 2DLCX 3WKEA 2MSCB 3L7MA 3OU7A 2IOFA 2ACKA 2NO4A 1N5OX 3TRDA 3PDJA 2XNDA 3NHMA 4YREA 2RB4A 2BHNA 1CZNA 4LDAA 1AN0A 4BNKA 5L8VA 3I83A 2YZGA 2JLXA 1TFUA 3H1EA 3JQAD 4XD7A 1XYYA 2YFYA 3PENA 5AOBA 2F3RA 4FC7A 4B81A 1EB9A 1NFRA 3H6KA 2C07A 3L1KA 3TSZA 4YH1A 1Z6QA 1JUDA 1M7HA 1ENYA 1D6JA 4X60A 3D3KA 3V1MA 1DWOA 4LXUA 2O4UX 2ZRCA 4HPXB 1JLLA 3QNUA 4WAUA 3WICA 4BX2A 2CJFA 1N7JA 3U3JA 2GERA 3X1DA 4R1UA 4ZA2A 1AHNA 2G06A 3N87A 2GF2A 2UZAA 2H17A 1P45A 1S8OA 2EKPA 1TO1E 5BUSA 4MV6A 1MJGM 1TJPB 3O1HB 4HX2A 4FYKA 4PQRA 3BOSA 1NUPA 5BT9A 3CH7A 5HK8A 2HEIA 2VQDA 1H5QA 5EWLB 2OCKA 3EGVA 3E9QA 3JXEA 5KEIA 2H65A 2Z3VA 3GZJA 3E8XA 4YA6A 1PFQA 3AR7A 4MVYA 1PVOA 3KHTA 4JL6A 1GL9B 2EZ9A 4ZVRA 2HMVA 3HSKA 3T0IA 4ARVA 2CJXA 1Y5IA 3KBOA 1U98A 3UMBA 1YJAA 4BKPA 2P79A 2QG9A 3ELUA 4LY6A 4MGIR 1QX3A 2B5WA 1QGAA 4BMDA 3ZU2A 3CLRC 2GK7A 1BX1A 1KJQA 4M99A 2PV0A 1R3DA 2QVXX 2XTJA 4NVRA 4RZ2A 2NU6A 4YRQA 3V8VA 4XUEA 1DV1A 3Q7IA 4N7JA 4R2KA 3VNBA 1E5QA 1KY2A 2PLRA 3JRWA 4OK5A 2I9KA 4LXIA 3F73A 3A1UA 3FVWA 2NVWA 3C5VA 4OMFG 4Q12A 3WLMA 5ADWA 3JWEA 3R3WA 2JEZA 4NABA 3AIOA 2QKYA 3HRKA 3NDRA 4Q19A 5CXUA 1O58A 3HKDA 4FE4A 4RW0A 3OEED 2PT9A 3REQB 3DEYX 5TGDA 4AXBA 2ZRGA 1XTKA 3FOWA 4XB2A 1X3SA 4NEQA 2ZI7A 3O2JA 5K2MA 2C3PA 3VVBA 1Z8FA 2AIRA 4KQWA 5T3YA 2W11A 3SF8B 4BX8A 5KDDA 5GIOE 2WC1A 4QYSA 3NBUA 5JMWA 1QJCA 4Z8YA 2J67A 5DXFA 3V9AA 2J08A 5EWMB 1OMOA 1PN3A 3VHRA 1YVPA 1O97D 3PC7A 3BHMA 3N76A 1HTTA 3FN4A 4FFOA 4OU4A 4WGGA 5KCMA 4CHTA 1P1HA 2OBMA 3MRTA 6YASA 4F4HA 2QRJA 2K2QB 2XY4A 4BQPA 1GGNA 2YBEA 1NX6A 3GIWA 4NZOA 4KKVA 3A2LA 1PQPA 3VPFA 5HHTA 4ILEA 3D2LA 2PFGA 1FLVA 4QRDA 1KEEA 3WMRA 3A4VA 2PT6A 3R3HA 1IN8A 1N57A 1L4KA 4QXAA 1TI7A 1TJ4A 4DLKA 3OA0A 5C5EA 4BEJA 1JF8A 2W6QA 2Y6UA 2PN1A 4X7RA 3BERA 3OX1A 1NQWA 4RQUA 3FNEA 2GPTA 3USZA 5HBRA 4M0KA 2WPNA 1ZM4A 3QMMA 3HCWA 5DBIA 4YMVA 1MO5A 2RONA 3W78A 4YPVA 1BQEA 4H0NA 4K28A 4DTIA 5BVHA 1FFSA 1QYVA 1Z8HA 3EQ9A 3QA9A 2QAIA 4JSYA 1DOZA 2GYWA 4IIEA 4KO8A 4ERXA 2CXXA 5F2NA 4P08A 5LP6A 3OQNA 2VTBB 3ZXUB 3S1SA 2BN4A 5JHGB 2O8FB 3G0OA 4JLUA 1BJTA 4LA4A 2IEYA 2ONYA 3ROPA 2IYYA 3PNKA 3ZVRA 3WY9A 1TLLA 4Q1CA 4LOAA 3R9XA 3WNBA 5ICFA 3AK4A 5SYMA 1MVNA 1RU3A 3Q9LA 3VNRA 2Q3MA 4RETA 1ONNA 2OHJA 1WKBA 2W2XA 3B8HA 3ZD9A 2BFBB 4LVOA 4CJXA 1O94D 4G9EA 2VOJA 4QGAA 2C04A 4A0GA 1BX3A 2X9VA 3INRA 4BNJA 3PVCA 4L3OA 1HFJA 3ZHSA 2XQIA 1I9CA 1MTZA 3DKRA 3D6HA 4LKOA 3JTMA 4BBPA 3GCZA 5HR5A 5IVIA 5AHRA 1GPAA 1G8KA 5HK9A 1DHTA 4GKKB 3GJSA 3GLGB 2RGEA 1FF9A 3GP3A 3CXRA 3UW1A 2PSHA 3HGMA 4HFRA 4QVGA 3K0FB 4AURA 1B93A 5LIPA 1JR4A 2FLVA 4M1TA 4WXMA 3CCFA 4WUVA 3TZKA 1M0WA 2D5IA 4KDRA 4EZIA 1U8EA 2FSFA 3C41J 3NT4A 1BE8A 1A8UA 1W0KA 4BGUA 2OVFA 2H4ZA 2BY4A 3W9BA 1XEFA 3NRJA 1L4MA 3RGWS 1EIWA 1HT3A 5IT9A 1VBFA 4YLEA 4EEKA 1NGSA 4LC9A 3OQIB 2O4CA 3EY9A 2QQ0A 1QVRA 4D45A 3LX4A 3OIGA 1P2BA 2PA0A 2NU8A 1RLMA 2H51A 2I7XA 3G59A 5DM70 1GCGA 3RC3A 4MLPA 1XYGA 2G9RA 4O4HB 3NWPA 4UEKA 1B3BA 1MFPA 2LP4Y 3HUEA 3CNOA 3I4FA 4KACA 4MTLA 4NPAA 4ZVLA 3SBXA 2GZSA 3T15A 4PFKA 4LX8A 2QJWA 4DQDA 1G17A 4LYYA 1UZLA 3W8DA 2R0QC 1PG5A 3CMCO 4AMGA 3DD5A 4DLYA 1K89A 5FAKA 4MVJI 5DX0A 1O5IA 3MXTA 4U3JA 3T8YA 1GL3A 1C7QA 4ZRMA 4L5JA 3N05A 3OQBA 4IIUA 4HDCA 1O77A 3BGWA 5EE3A 4C4ZA 4ZZ0A 3TUZC 2FEMA 3SIWA 3RG8A 3TKLA 2HWYA 3VH1A 3AVYA 5FTWA 3MJDA 3R0IA 1SCQA 3Q8LA 1JIJA 2V7UA 2X0DA 1Y1PA 5BYJA 4UFOA 4X91A 4TYYA 2Z9CA 3NTOA 3QPVA 4OXKA 4QHTA 3N07A 3AT1A 1SR8A 4JV5B 4ZAFA 3PWSA 3CGWA 2WTEA 4TT8A 1DJMA 1FRFS 3OJOA 4J0JA 4U5XA 1W9HA 5EMLA 3I9JA 3NLLA 1L5RA 5IP5A 2O9JA 4HRXA 4F91B 1J2RA 4UVHA 1LNZA 3ZOZA 1FP2A 3FETA 1GUYA 3IULA 4JYZA 3ETEA 5DM0A 4ATNA 4BMVA 4EHAA 1EWQA 1RPTA 4BNVA 5J58A 3H2SA 3B3AA 3DE3X 3GO4A 3FPFA 5IZCC 1SZPA 3H42B 5BNIA 4PANA 4EO9A 2D1TA 3ZKWB 1NPTO 1CY0A 1YJBA 5AK4A 3S1AB 1UXHA 4ER5A 1P7WA 5AKKA 5E6SB 2IUSA 3A3KA 3OLYA 4RPLA 4HATA 3G2MA 1I80A 3IELA 1TKBA 1UXGA 4IVNA 3H11A 2WHEA 3KZVA 4KDEA 1MQAA 3B7WA 4TV8F 4B73A 2XUZA 4D0NA 2OCIA 1E1RD 2GZ3A 5C8YA 1BEEA 3T3HA 3VVCA 1EJ0A 3I4CA 2EFHB 2VTDA 4UQLA 2OL4A 4UHJA 3KJIA 4XJSA 2VJMA 3HDQA 5AOCA 3TR0A 3DMYA 4JH0A 5AJHA 4J1SA 4DLLA 1I3MA 3TLXA 4F4DA 1RJWA 2D0DA 2QU8A 3GJ4A 2P2ZA 2X3YA 2OBYA 4L6IA 4TSRA 5CVJA 3ZH2A 3V5NA 4B3IA 1VSBA 4AP5A 4QYXA 3D4OA 3TTSA 4AMBA 4ZDIA 1KZ7B 2GXSA 2PA3A 3R8CA 2JI8A 3P2KA 1RXVA 3O4HA 2I1QA 4GKAA 2AJTA 3WL5A 2GXAA 1LXCA 3DAYA 3JZDA 4CM1A 1UBHS 1UAYA 1ZSNA 2B8JA 5LLTA 3WLHA 2KW5A 5A04A 4Y67A 4Q9JA 1IJEA 2C82A 2QTRA 2QUAA 4N39A 4EY5A 4L1KA 4B8WA 3TQSA 3HB7A 1P61B 1SC9A 3RSFA 1O8CA 3KEFA 3M6XA 1E3TA 1RMTA 5L3QA 4MMZB 1RLJA 4KX5A 4JBYA 5T4EA 4RHUA 2IYTA 2WT4A 2YYSA 3G85A 1JXAA 3KOOA 4KBYA 5JDIA 1OZAA 2YIVX 1HDIA 2O1XA 2ZT7A 4KUGA 4G5SA 1IY8A 3KQNA 5E4JA 3D0OA 5FUXA 1IXZA 3HN2A 2XAAA 1C2YA 2C1XA 3M6UA 1PV4A 3IDFA 4N5MA 2WJWA 4HV4A 2IYNA 3JZIA 2DEUA 1M1YE 3G1UA 2PYDA 2D1QA 2GBGA 3I6YA 4F3NA 1XZMA 2PMDA 1WBJB 1Q2UA 4QBTA 2HREA 3OF5A 3L7AA 3U4HA 1QRUA 3D4PA 1B0PA 3S2IA 3MMNA 4ZJYA 5TY0A 3C3YA 4JI2B 1OYYA 3ESAA 4UASA 5EC8A 2O8DA 4W8OA 2CYCA 2F43B 2QNIA 2YV5A 2WTBA 4NU6A 5LDDC 2QRQA 2JIMA 2O57A 1I7QB 1FS6A 4RM3A 2I2BA 2ZJ5A 3B6JA 2VDLB 3P4UA 1G291 5JANA 2X8AA 3L3BA 4R83A 4HB4A 4RA9B 1Q2XA 5JSZA 1NVTA 2OEPA 2D3WA 4XX0B 2I6FA 2YIJA 1E6WA 2NACA 1V96A 4C43A 2ZTVA 1EFTA 3PJFA 1NW5A 4MRNA 3SZOA 4RPCA 4D02A 5KMGB 4GH5A 2AKEA 1Y89A 2CLFB 5B6PA 5BP7A 2Z3ZA 3BN3A 1ZITA 4GL2A 2YNMD 1DCTA 1G8GA 1M1UA 3MTEA 4JUFA 1RWNA 4J6FA 2C3YA 4GMXA 3LKZA 3QVWA 4DJFC 2X5XA 3P8ZA 1K8XB 2ZDHA 3DOUA 1GCUA 2BH9A 3TOXA 3KUKA 5DN6A 4YDQA 4B3GA 2OUIA 5CURA 3HUFA 3PQEA 2JZNA 3VGPA 1UKAA 3UICA 1GPLA 3GFOA 3WYEA 1W36B 2JFZA 1QMGA 3LA8A 3O26A 5HM8A 4A10A 3CZ5A 1T1IA 1PJCA 1JB9A 1J06A 3GVCA 4FDLA 3CNQS 4E13A 3QPCA 2ZM6B 3W9SA 2IH5A 2D1YA 1AQLA 2BFCA 2WJ4A 3PK0A 3QX3A 2CK3D 1NBMA 4MQEA 3SCZA 4DMKA 5J2TF 3UGQA 2I9PA 3PUHA 3IALA 5H1YA 4E08A 3JTEA 4KW7A 5KNBA 3H2BA 4QASA 4CKWB 3R5KA 1COWA 1CS0A 1W0JD 4OXYA 5G1NA 2QYTA 1OREA 2BKAA 4DCGA 3SD7A 4YRDA 2V3VA 4JMPA 4LZWA 5E1OA 1CJMA 2A3RA 3WKDA 1EVYA 1X7XB 4ZVUA 3ZY6A 2H1HA 4ZQIA 3S7ZA 1JIXA 2H06A 3RFFA 1QS0B 2XT6A 5HQ3A 3RYCA 5AVXA 1I5OA 4H17A 4O4LB 3EF1A 2SKDA 4M76B 4N6GA 3B78A 1V41E 4O4JA 4Y0VA 4E1BA 2O8CB 4HH4A 1SVNA 4M1MA 1WDLA 1IAVA 5CYOA 3SQOA 2OFWA 3D6JA 2VFAA 5SZHB 5ALZA 2F59A 2J6IA 1T35A 1TVEA 4H59A 3MIIA 4UUOA 3RVRA 4E5VA 4EHJA 3X1JA 1BYIA 1LBHA 4BAGA 4KBGA 1ZMOA 3G0DA 3GFQA 3PEFA 1Y1TA 3VGJA 2QI9C 2F4VB 1YE5A 3M33A 2DPHA 3RJZA 1KARA 3RNOA 1GQQA 2AE1A 4LJ9A 1GGVA 1HLGA 1A88A 1MIOB 2ENUA 2YOGA 4ABYA 1OA1A 1Y82A 5D7BA 1Q50A 4FDUA 3N28A 4QDKA 5LMNB 4E5KA 5H83A 1YBAA 3BRSA 1E79A 4KU4A 3WE7A 1M2GA 4DGQA 1E6EA 3RAJA 3CLTC 1W34A 2GYVA 3THSA 4OP1A 2B8NA 5ALEA 2RHCA 3I53A 3OQ6A 4EPWA 1HLFA 2IHUA 4O5AA 3WBFA 2E18A 5AW3A 3ZJ5A 4KFSA 1AT1A 3U6KA 2ZSHA 4QAQA 3NWJA 2CWWA 3TTVA 1T34A 2PJRA 1BMFD 2E89A 2HN9A 3OAAD 2C98A 1ZU4A 2JFYA 3D7MA 2ZCVA 3T7RA 4D41A 5KDLA 1Y5NA 2JATA 3BBPA 3NHBA 1QLHA 4FFMA 4NXMB 2QZPA 3H1AA 4N03A 3S7TA 4AKSA 2RHMA 2Z8XA 1BEZA 4BGIA 1E3WB 4A5SA 1U1DA 3HY3A 1VMDA 2W8BB 4JKIA 5LYJB 3ED1A 2IYXA 5CB0A 3ZIAA 4B45A