1GAJA

Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords HIGH-AFFINITY BRANCHED CHAIN AMINO ACID TRANSPORT ATP-BINDIN
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 81
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gajA00
1JPNA 1UEJA 2DYKA 2YC4C 3W5IA 1Z6TA 4IDOA 2DWPA 1NNEA 3PITA 1W4RA 4M1WA 3K9GA 2O8CB 3EA5A 4B2IA 4ILEA 2E1RA 5IF9A 5FPKA 2JLWA 4NTZA 1JR6A 1UJ2A 3M1IA 2GK7A 1UBFA 3HYTA 1E2LA 1G8YA 3AB3A 3CWQA 2JDIA 4II7A 1GL7A 1Z6YA 3HU2A 4XD7D 3O47A 4MGZR 5C46F 5CM8B 1TQ6A 3TQFA 2KBFA 3OESA 1II8A 1T0JB 4S2EA 4US0R 2ANBA 4PC1A 4QHTA 1XU4A 2QM7A 1S8FA 2NO9A 2ZJ2A 5HZKA 4A15A 4BFSA 4E22A 4XVRA 4MYHA 2D7DA 4D4MA 4R98A 3ZDQA 3X1ZA 1MH1A 2WKRA 2FMXA 1FQKA 2QNRA 4DC9A 1E2KA 3CX7A 4OQFA 1CJTC 2UZ3A 3MWYW 2G0NA 4QBHA 4URVR 4UNRA 5JS8A 1FQJA 1G3QA 1I2DA 1OLOA 2VP2A 1E9AA 1KJYA 3LD9A 5JI2E 5HE8A 2ZXUA 3WYFA 4FN5A 3QBVA 2KSQA 2JJ1A 3KXIA 5CIQA 3GP8A 2N1BA 4GDFA 2IL1A 1Q57A 4B33A 4RJLA 1RW4A 4JBXA 2OBMA 3KZ1E 4BFXA 1CKEA 2BJVA 4XTRA 1DAGA 3AGPA 3TSWA 3A36A 5JBQA 1SVKA 4JYCA 4Z1MD 4EAQA 2O8DB 1CP2A 4NCKA 2PCJA 2YHSA 4OHZA 4L8GA 1VIYA 3H2YA 1HUQA 3R8FA 2J9RA 4KYIB 3CPHA 2EVWX 4H9GA 4UKDA 2MSEB 2OCPA 2VSXA 2WV9A 4YDHB 3VU9A 4PO8A 1QHYA 1WP9A 4XD7A 1KI6A 3DM5A 1IXRC 4E07A 3BJIC 3VKWA 1BH2A 5TB5A 2BVNA 3NBXX 3AVPA 1ZNYA 3LRPA 4RZXA 2V4ZA 3WY9A 2KI5A 3CZQA 4E09A 2Z4RA 3ADDA 2Z6VA 2GJAA 1PV4A 4A6XA 2XEXA 2O52A 1GFIA 4QGAA 4WZBE 4BFVA 1RJ9A 3FE2A 5EE5B 3TAHA 2ZE6A 2R62A 1KK1A 3K70D 1QG2A 2IT1A 2NPIA 5FOSA 3DKVA 3I3SR 4NPHA 2ANCA 3QXSA 1IN7A 2VP6A 3Q7QA 4MRVA 5KSOA 4O2LA 1TU4A 1R4AA 3A1VA 2FFHA 3BC1A 2EFGA 5GVRA 3SFVA 4B3CA 2D2EA 2ZAOA 4W7SA 4AKHA 2C5LA 4EPTA 2KB0A 1KI2A 1W4CA 3OHMA 2DCUA 1Q20A 1TEXA 2BBOA 4Z1MA 2QBYA 1E69A 2PLRA 1AZSC 2NGRA 3HR7A 1XMJA 1OW3B 3LVRE 2GZAA 4B44A 4RD0A 2XGJA 2GWHA 1EK0A 1KDPA 3KB1A 1QHHA 4Z8YA 3DPUA 1TF7A 2WMNB 1UKVY 2QA5A 4D4KA 4QG7A 1NN0A 4L9WA 1I4LD 1Z2CA 1DEKA 4IVQA 1KMHA 2B7CA 1OXTA 1DO2A 1W2GA 3NDBB 5JZVA 2Y8EA 1R6BX 3CF6R 3G82C 1XJCA 4Q4AB 4W5JA 1YZQA 1GWNA 3I8XA 2G1KA 1GVNB 1R0YA 4LWZA 1SVWA 5EXXA 4A0GA 4AKGA 3W8NA 3EWSA 4N1AA 1E9FA 3WXMA 4V0MA 3I73A 2F1JA 1KJZA 3CRRA 1J8MF 1T9HA 5HKKD 1D6JA 1JAHA 5KO2A 3TUJC 1TQ2A 1U0JA 4OI0A 3DOEA 4OK6A 4LHVA 5AUOB 2GJSA 3EZ2A 5JEEA 2AWOA 1GDDA 3BERA 3C7KA 1ZD9A 1G4AE 2ZPTX 1T8TA 4AURA 4Q18A 3N5CA 4NKRA 4L15A 5C2JB 1G64A 4D81A 2BHRA 1V5WA 4LBVA 1CJUC 4LX0A 4DLUA 221PA 2ATVA 2UKDA 3ZGXA 2GEVA 1YR6A 2XX3A 4JLPA 2VHJA 1KO4A 1LY1A 2JCSA 1HYQA 5AJZA 3RRYA 1Z3IX 3VFDA 5HE9A 1ZU4A 3CBQA 3BWDD 3SBEA 4RY2A 1XF9A 1HE1C 1OV4A 1ZINA 2R6FA 3LO5A 3PV0A 4C9BA 5G41A 2L0XA 1G17A 4N0DA 1UKEA 2KE5A 1X8JA 5E95A 1ZC3A 1DADA 2Q9CA 4O2RA 1XP8A 4XWOA 4TMTA 2RHMA 3SYLA 3TUIC 2QENA 3THWB 1VIAA 1P2UA 5C4MA 4ZPXA 5HKKA 5KDDA 1L4YA 1BS1A 2NQ2C 2QZ4A 4EIWA 3W9YA 1N6NA 4PHHA 2RMKA 1XD8A 3K9LA 4M9ZA 5JMTA 4NYIQ 3R7WA 3PJRA 2IC5A 1XCPA 2IUUA 1PZNA 4FCVA 1AS0A 1Z6XA 2O0JA 2GVDC 3F5FA 3IQXA 5K8UA 1W7AA 2GNOA 1VMAA 5BYKA 5JSZA 2BKUA 4EJSA 1XPRA 3PUXA 2ZU6A 4LC0A 2PMDA 4DWJA 1XB2A 4LUCA 1KO1A 2XXAA 4URWR 2WTUA 4HLCA 2FE4A 1XZQA 1ZM7A 4EPVA 3KQNA 4Q9KA 3TJZA 4URUR 3UPUA 2QQ0A 3GEEA 4G3XA 4M1YA 5FPHA 3T1TA 1R8QA 1XNJA 1XTIA 2F9MA 2HUPA 4PX9A 4A2PA 2FGJA 1LF0A 1JECA 1NSTA 1ZM4A 3K0CA 2DFKB 2Z83A 1G5RA 2BMEA 3AVXA 3SC3A 2VSOA 1NN1A 1VDZA 2IXGA 3QF4B 4PSAA 1TUEA 2WJYA 3TBKA 3WRXC 2I3BA 2BBWA 1DOAA 4ZIRB 4UNSA 1LVGA 3I92A 3MCAA 2A2ZA 1CR2A 2QMUA 4BEJA 1P9WA 4BQSA 2ZRKA 3GPLA 1XEXB 1N5JA 4PFSA 3FB4A 1D5CA 1N5LA 5UKDA 5FTNA 4WBSA 3TR0A 2ZRDA 1ZM2A 1H65A 3KQHA 5JFGA 1KK2A 4E5UA 1KI9A 3C16C 4W5WA 1G8PA 2PX3A 2HJVA 1EWRA 4CW7A 2E87A 2LWIA 4TZ6A 1E99A 3GJ4A 4WA7A 5DNYB 3A4MA 1L8QA 1S96A 2AD5A 5FTJA 1F2UA 5HCIA 1G4UR 3BS4A 5SZKB 1GRNA 4LI0A 2DY1A 2NOAA 1YZKA 3HDTA 5BN5A 4XVUA 3TGPA 1OH5A 3WBKA 1U8AA 5TV2A 2JATA 4LJ6A 3VR6A 2REXB 3GEHA 3FGNA 3IGFA 2D2FA 4QBGB 1Z22A 1XEFA 2IW3A 1FW6A 1GL9B 1N5KA 4G0NA 4JJKA 1U9IC 4XVQA 1FUUA 4C0KA 2B7BA 4M2LA 1KO7A 2QSYA 1D8TA 4HUQB 3ZZUA 1QBKC 3QJYA 3ZZTA 3EZ6A 4TZ0A 2FX3A 3IBGA 3QG1A 4IDQA 4D0NA 1KI6B 3CRMA 4PO1A 2C9YA 4S35A 2OE2A 2ZJOA 4CZ2A 2PT5A 4TN1A 4CEIA 4ZCIA 4PC6A 4G5RA 3MMPA 4D82A 4R2HA 5IHPA 1OXXK 1XD2A 3ZVNA 2MMGA 3T5GA 3GD7A 4BFUA 4DDWA 4BZQA 4EPWA 1HE8B 1I4DD 3UG7A 1MO5A 2PBRA 2ZIAA 2GF9A 1W47A 2IYSA 4CEJA 1BO6A 4LRWA 2JJ2D 1L2TA 3T34A 3EIQA 2I4IA 4MUAA 4PZZA 3MLEA 2V6IA 3IO5A 2BCGY 4WW0A 4P33A 5DISB 3PEUA 2D62A 1Q1QA 2V7QD 3QKUA 1W5TA 1AGPA 4EKDA 2QBYB 4DLTA 4ESHA 2IYZA 2XOKD 4F38A 3C41J 1AA9A 2R65A 4M9QA 4F93B 1WBDA 1GAJA 1WMSA 4JLMA 3TAUA 4BFTA 1EFHA 2GEDA 1QHHB 3GCGA 4JKIA 2YOFA 1P7CA 3R9XA 1VCNA 2ORWA 4JKYA 4X8MA 2V54A 4C7OB 4RFVA 1ETUA 1ZW6A 4HZUA 3CZPA 3WHLA 2F9LA 2FH5B 1NVXQ 4DCNA 4GPTA 4I1OA 3LH5A 2C9OA 2P6RA 3K1JA 4BFYA 3PIRA 2QORA 4HDQB 2J45A 4Q00A 5FUWA 4PQRA 2CE2X 3ZJYA 2FGKA 4OKSA 1KSHA 4AG6A 1G1MA 1CS4C 1P2SA 1FNMA 2QG6A 2ERXA 3B2EA 3K70B 5GJCA 1G7SA 2OILA 1H8ED 1VECA 4ZDWA 4CYMA 4LJ7A 2RB4A 2W0MA 2FF7A 4FMBB 3GLGB 1QVAA 3DOFA 4UNNA 2JJ2A 3REFA 3AH8A 1ZNXA 4GL2A 1IN6A 3Q72A 3AM1A 4B6EA 4DRZA 1P4SA 1YJ5A 3CKLA 4M53A 4DCVA 2P6UA 5KHOC 1CRQA 2XOKA 1AIPA 1E2IA 4JLJA 5FBWB 1CJVC 1OHHD 4OL0A 4UNPA 5JHGB 3AKEA 3W5JA 5L3SA 2BIFA 3A37A 4PHFA 1D9ZA 3WBJA 5DHFA 4BUJA 1AN0A 1Q3HA 1BKDR 5B64A 3GLFE 3X1YA 1RZ3A 2Z0MA 2G83A 2MSCB 1XCMA 5KPDA 5EP2A 1E2JA 3QKRA 1AS2A 4I99A 1N6PA 3GLFA 3DM9B 2W00A 2ZS7A 2YZ2A 4QHYA 2CDNA 1SXJD 4QM6A 121PA 3LAWA 3QKSA 1W36D 1P9RA 1YR8A 2A7QA 3BH6A 1KI8A 4Q5IA 4YMUA 3FOZA 2HYIC 1SHKA 4D4LA 1H8EA 3AP2A 4EQ6A 3L0OA 4DXAA 3BOSA 2RGNC 2GESA 1ONBA 1OYWA 3U44A 3CWZA 1B23P 3UMFA 1N25A 2W6JD 1JR3D 1W0JD 1J70A 2QQEA 2JLQA 3ICQB 2QROA 2YWFA 4IVRA 1N6LA 1O3YA 1R0WA 1W0KD 2JLRA 4NZYA 2YV5A 5JEDA 3TUZC 2GXUA 4F4JA 2F55A 3VMFA 1OHHA 3CLVA 4NBSA 3SU8A 1QHXA 4JBYA 4TWZA 5F9HA 4D0LB 4GNKA 4XSHA 3EZ7A 4G5QA 4GI7A 1E9DA 3Q8XB 3ZD6A 3VNUA 2VLIA 2AFHE 2GXSA 4CEHA 2B8WA 1TF2A 3L0IB 5FBQB 1SXJE 4DLVA 1NVVR 2DFTA 4TTPA 5FOUA 3QXHA 3VQTA 4DDVA 2GCNA 1FTNA 4MDFA 3W8RA 5TVKA 1SXJA 1NN3A 2WKPA 3GJ7A 4HAUA 4JLBA 4NCJA 1EESA 5L3VA 1Z47A 3UIEA 4BRUA 4P32A 4KVGA 4A6PA 3K09C 4NCNA 3TVDA 4NYIR 4C3ZA 5KYKA 1XBTA 2WWGA 2VP0A 1Z29A 2ZI9A 2E9SA 3HPRA 2NTYC 4QXAA 5L3QA 3CPJB 1G5PA 5BYJA 4ZDIA 1QHSA 1JR3E 1LS1A 3Q9LA 2QTHA 4ZO4A 5GJVC 1U94A 3HU1A 4DCUA 4OQLA 2P0EA 4WIAA 2W6JA 1U8ZA 1JR3A 1W0JA 1ZNZA 1E1QD 1G18A 1S3SA 4QBFA 1S3GA 3TH5A 1KY3A 4PC2A 1IAQA 3NBFA 2FJUA 4AG5A 3VAAA 5E7MA 2QE7D 2VHUA 1W0KA 2OHFA 5DI3B 1G3MA 2RCNA 2ZJ8A 1N5IA 4LHXA 4RFSB 1ZCAA 2GDJA 2WWXA 4B3FX 2VIIA 2AKAB 3FTQA 4MDEA 1DTSA 3SHFA 2RGCA 5FBLB 2X77A 3JVUA 1RC8A 2VEDA 1VG1A 4JL6A 1JI0A 5AJWA 1OFHA 3ADBA 3NWJA 1MRSA 1P75A 1JXMA 1XFAA 3C5CA 5TDHA 4QNMA 1U90A 5DSZA 2J7PD 1Q0UA 3U3RA 4A8JB 3ICEA 1DVRA 2AR7A 2VP4A 3ADKA 4CF7A 2HT1A 3U2QA 2J7KA 5HR5A 2XZPA 1OIWA 1CU1A 4RKEA 4M1MA 1EFTA 4YMVA 5H68A 1JAIA 3EPKA 3SNHA 1CLUA 4MRRA 1KO8A 2IYWA 2FPKA 1SVSA 4OQXA 1E2MA 4A8JC 4PR0A 1RRPA 3VR4A 2Z43A 2ZUBA 1E1QA 3SJCA 1ZBDA 5KPJA 1XPOA 1TQ4A 4HAWA 3EIEA 4JSTA 2XZLA 4EUNA 3NDPA 4U00A 2F43A 1R0ZA 4CDGA 1GP2A 3WP0A 5JWOA 2QE7A 3RLFA 1U8YA 4TMXA 3EZ9A 4F4IA 2O0KA 3EPJA 1L7VC 3A6PC 4DB4A 1RRFA 1BYUA 1WA5A 1OXVA 3LW7A 4DLWA 2YINC 2AD1A 1IY1A 1NVWQ 1AGRA 1ZAKA 1E94E 3B1WA 2A3RA 1XXHB 2BJWA 3CH5A 4V0OA 5EUMA 4DLZA 4M0LA 2CXXA 4QJ5A 4ON9A 1G3IA 1FNNA 2CNWD 2J7PA 3N2IA 2A5JA 3ZS9A 5JWHA 1UKYA 2FEMA 4W5HA 4R2IA 1W4BA 4GRAA 2G9NA 3K53A 2GVZC 5H8WA 4RZ3A 4DLYA 4X8LA 1IN8A 1OSNA 3UK6A 5EP4A 3W6PA 2K5UA 5LD2B 4BGDA 1KMQA 4OJKA 3CM0A 1SKYE 2ZRAA 4EPYA 2IYLD 2WKQA 1F2TA 3NBYC 3F3YA 1TADA 2ZRLA 3FKQA 1OF1A 4KU4A 2QI9C 5FH9A 1ZNWA 2WAXA 1RYFA 4DDUA 2ZSAA 3GLHB 5FOWA 2VF7A 5LD2C 3B8HA 4KJZA 1MABA 1VG9B 3MWKA 4JLKA 4Q1AA 3K0FA 4Q4JA 2ZRMA 2O8BB 4AY2A 4Q66C 1UKZA 2FZ4A 2J0UA 4KSCA 2PJRA 4DEXA 1XWIA 2NO1A 1VCIA 4D6PA 4B6FA 3LBNA 2X8AA 1FL9A 3BFVA 4B43A 2GCOA 1HV8A 1M6NA 5KNBA 4C0SA 2ZE7A 4TMVA 4B48A 2WM9B 4G01B 4GOJA 5BQ5A 1G3RA 3CX8A 3CB4A 3EX7C 1TUIA 2PMKA 3SBDA 1YR7A 3U3MA 1QZXA 4PSKA 1LS6A 2JAQA 1KKMA 2CJWB 4AD8A 1KSGA 5D3MA 3A1WA 2CNWA 3IPXA 3NBZC 3T1QA 2H5EA 1E9CA 3K8YA 3X2SA 3GLIE 1NMZA 1SVLA 3EW9A 4O0MA 3WMGA 1FX0B 3AVYA 3H4MA 5B57C 3FFBA 4P0TA 4M1SA 2F3RA 3GLIA 3TVTA 1EWQA 2CL6X 4WOPA 2QL6A 3KJEA 4B75A 3NEJA 4AIIA 1ZD1A 2PZFA 1LFDB 2OAQ1 4LYAA 4V0NA 4WAUA 3MWJA 3EARA 2NO6A 4XWAA 4KFTA 3NH9A 4RD4A 1T3SA 4D80A 1P2VA 3AVWA 1OB2A 3U7HB 4HLUA 4P4SA 3NIBA 1UFQA 5FL7D 5KUTA 1YU9A 5IRCD 4A36A 3ZVMA 3A4NA 5AUQA 5F3WB 2ZSDA 4TMKA 5J4VA 3V9PA 2QAGB 4JL8A 4LOAA 1O87A 4U7DA 1X8LA 3ZD7A 2ZJAA 2DWOA 3U4QB 3U6BA 4C30A 2IUTA 4TTQA 5KDOA 2YJTD 2R2AA 2ZSFA 4MGYR 3GEIA 4I81A 1XX6A 2V6JA 1N0WA 3W34A 4KYUA 2IX3A 2QAGC 2WWIA 4NYMQ 3QPVA 3THYB 3OF5A 1YRAA 1Z0JA 4LJ4A 1E3MA 1EX6A 5FUYA 4NP6A 5J4KA 3M0EA 4TYNA 2H57A 4GFDA 2GJ9A 3EC1A 3IPYA 3FHOA 2GXQA 1RRGA 2FNAA 3CPEA 2GA8A 2RGXA 2WIBA 4QGHA 3LLUA 3I4LA 2QU8A 5EUQB 2ZREA 4OI1A 2Q9BA 4IKEA 4RCYA 1YZUA 3F0TA 1UAAA 2YOHA 4TMWA 1XMSA 2EYQA 3CNOA 1W44A 1DAIA 3KTAA 2FEOA 2AN9A 5J40A 4JMPA 4YMSA 2F1IA 3RWOA 3BRWD 4AWXA 3LA6A 3BAFA 2G3YA 3QVVA 1HH4A 2J41A 1R2QA 4DCSA 2ZS9A 821PA 5FL7A 4Q01A 4NONA 3I72A 4LHZA 3OE7D 1N3BA 3REGA 4LC1A 3KDSE 2PJZA 1FPMA 1KOFA 4LJ8A 5L3QB 4C4PA 1D2NA 1E98A 4LJAA 2DFNA 1ODFA 4BFZA 2C03A 4B3XA 4Q4LA 1DBSA 4BASA 1E2DA 2R9VA 1PVOA 3T1VA 2EFHB 4GMXA 2HEIA 2I1VB 1E0SA 2HT6A 1N0UA 3QPWA 3GJ0A 1X3SA 4KFUA 2OUKA 5SZIA 2JASA 4OQNA 5AUPB 2OG2A 4QFMA 3CRQA 2ZUDA 5CDFE 5FI1B 3WYAA 1P6XA 4G1UC 1RKBA 4B2LA 2MMCA 4XWKA 2FA9A 1E2NA 1KDTA 1XTJA 3H84A 2CL7X 4IFBA 5CDFA 4JLNA 3NKVA 1P2TA 1XPUA 1KO5A 2OBNA 2SHKA 3C8UA 2EWVA 1CJMA 3K0AA 2BCJQ 2GBLC 4IRUB 3U3JA 3N70A 3BFKA 4X8OA 1GNPA 3MJRA 3MAAC 5JECA 1XJ0A 4QJ3A 1AK2A 4TL7A 4B3BA 3QENA 3ZQJA 2IEZA 1D2MA 3WMFA 1UDXA 2QTFA 2VO1A 3OE7A 3BB1A 4NH0A 4TLEA 1WQ1R 4HAXA 3WHKA 5F98A 2P5TB 4Q9IA 3TSOA 2FDCA 1MO3A 1KI4A 4IEEA 2ASEA 4GSYA 3CONA 1I2MA 1Z0DA 4IDNA 1MO6A 1VPLA 5AWFC 2GF0A 1G7TA 2O0HA 3L2OB 4BEBA 3UMSA 1EXMA 4A82A 1VTKA 4IOKA 5KNDA 4G5OA 1S0UA 2PZEA 2JLSA 3GQBA 1X86B 2A5DA 1P60A 4CT4B 1SVIA 2IYTA 2HJGA 4ZKDA 3SHWA 2ORVA 3SR0A 3RSOA 3NHBA 3AF1A 2Q21A 2CE7A 3G0HA 2VHTA 1LF5A 2DR3A 4MYUA 3O8BA 2WBLC 3KQUA 2VP9A 2ZAMA 3BGWA 5DO9A 2OLJA 2Q0HA 1Z0KA 4HAVA 3CNLA 2JLYA 4ZCMA 1U2RA 3FHCB 3T5DA 2ZS8A 2ZM5A 3LY5A 2H17A 3RHFA 4BWYA 2FSIA 3GMTA 2ZI5A 2O8EB 2WJVA 2W2XA 2YWGA 5IT5A 4HSEA 4TYWA 4H1VA 2ZRCA 3THXA 1Q1BA 1P3JA 1GNQA 2AX4A 3ZLJA 4BLSA 1XRJA 2FSHA 3DZ8A 3G5UA 5B2ZA 4BPBA 2YNMA 4I1VA 1GIAA 3IQWA 4XSGA 2HF9A 4MGKR 1US8A 2C77A 2WSMA 3DL0A 2OFWA 1JALA 1KGDA 4JL5A 4GBMA 1KHTA 1AM4D 3BH7A 3MG9A 4IOMA 3PXGA 3C15C 1NG1A 1AKEA 1GKYA 2PT7A 3DHWC 3KKNA 4PQFA 1HQYE 3TNFA 3VR5A 4A2QA 4DT1A 1OIVA 4K46A 4X8HA 4Y0VA 4AKIA 3IIMA 2N42A 1NLFA 2ZJYA 3H1TA 2CBZA 2WICA 1F60A 2JGNA 3RSLA 4LY6A 2AFIE 3A1TA 2R6DA 1IQPA 1DAFA 2ZYWX 3FPAA 1JNYA 2GCPA 5FTMA 3OIYA 4YMTA 1JJ7A 2IEYA 4GOKA 3CR7A 1NMYA 2QTVB 4LPSA 2X2FA 1I4TD 1NY5A 2KJQA 4V0LA 1CEEA 2HF8A 3KQLA 3PCRB 1XCGB 5D3QA 1HQCA 4ZI3A 1OIXA 3PVSA 2RGGA 5A5GA 3S1AA 1II8B 1N6IA 4FIDA 2WIAA 3LX5A 4LBZA 1XTQA 4DCTA 2ZQ5A 2FSFA 1IOZA 4LZZA 5CIWA 1ZUNB 2ZYTX 2OV2A 2CCJA 3RC3A 1M34E 1MR3F 2NO7A 1UPTA 3LBIA 3UKDA 4XTCS 1A82A 2ODEA 4IJMA 3E1SA 4P4TA 4FW9A 2R6CA 4U5XA 5FPTA 4C0BA 2Z4SA 1Z6AA 4US2R 2FPMA 4Q1EA 2O8FA 3P27A 5LB4A 2A5FA 5HPYB 4LV6A 1PUIA 3BE4A 5EZ6B 1FUKA 3WYGA 1M7HA 3AQ4A 4QM7A 1CIPA 2B6HA 4P31A 4JZKA 1W48A 2WJIA 4JVSB 3ASZA 3I1FA 4BLPA 2ERYA 4GMDA 3VU9B 4EFMA 3B60A 1E32A 4JLOA 1ZP6A 2NPFA 4XOIA 1S9DA 2ZU0C 1CF4A 1E6CA 1GKUB 3UMRA 4Z54A 3TKLA 1Z5ZA 1DG1G 3EASA 4QKQA 2NMVA 3KX2A 4ITRC 4OK3A 1IY2A 4IVPA 4O25A 3E70C 1GNRA 3TRFA 3PUWA 4MQBA 1RJ9B 3CO5A 2G1JA 1VYVA 5GJBA 5DN6D 2QT1A 2XSZD 1KSJA 2IYRA 5E7IA 5FBVB 1NY6A 3EXAA 2BKEA 4AC9A 2ZSEA 1WDTA 5G53C 1W46A 3L82B 4Q1CA 2ZRFA 4DLRA 5EE9A 5JI3E 2KBEA 2ZR7A 3WNDA 1SHZA 4B2PA 4MYTA 1GRQA 4MYCA 4NHOA 2YVUA 4UQOA 3TR5A 3M6AA 2IS2A 4UXIA 4I1SA 4C0HA 1FZQA 3B1ZA 1KK3A 4M22A 2EU8A 2IK8A 2ONJA 1IJFA 1G8FA 1OH8A 3A1UA 5A0FA 3SJZA 5BWMA 4DKXA 4M1OA 3PR1A 3ZH9B 1EGAA 2B8TA 5LDDC 1GITA 3K0SA 2J0SA 3D6TB 4DBLC 3SYKA 3QKTA 1G6OA 3MFYA 2QT0A 4Q21A 2JIZD 1ZJ6A 1CJKC 4ZDKA 4OHVA 3OEHD 2PLFA 2OESA 1JQLB 1KMHB 1KDRA 2ZEJA 3FMFA 3KJIA 1UBGA 1K6MA 3NC0C 5AK0A 1LB1B 3RS0A 4B76A 5CJ2A 5CYPA 4GZMA 2LKCA 2Q6TA 1E4YA 3IBYA 4IXMA 3BB4A 5DN6A 4RD6A 3KKMA 1Q3TA 1HA3A 1T5IA 2OFXA 2XNDD 4M9SA 2OXRA 3DMDA 4JT4A 2ZJBA 1NMXA 4ZKEA 4HDCA 2N46A 1BIFA 2A5GA 3C14C 4Y0AA 3CIOA 4WZ6A 3T15A 2XTZA 4D25A 2HV8A 4PAOA 5P21A 5JCZA 5JCPA 2ZR9A 4TL8A 1HY3A 1Z28A 4PPFA 4QBIA 1G41A 1M1YE 2QP9X 3K70C 2PEYA 2QPTA 1U0LA 3QUSA 2V7QA 5FTKA 3X1XA 2BM0A 1OH7A 3B1VA 4V02A 1J2JA 2VH5R 3FDIA 1E1RD 3KXKA 3DMNA 4QGGA 4LSGA 2O8CA 2ZJZA 4MA4A 1X8KA 1P62B 3MRSA 2ZRBA 1JEDA 2ODWA 1OH6A 2JIZA 3SJAA 1Z06A 5TXGA 3I62A 2ODNA 3D3QA 5JRZA 2Q3MA 5GADl 1U99A 5FUVA 5BN3A 4NYJQ 2IA5A 2FN4A 3EIHA 5L3RA 4P4UA 4TL9A 1OJLA 3CX6A 1AZTA 3GFPA 5KSZA 2H16A 3UWKA 2BDTA 2IHYA 2IXFA 5ANRB 3BFXA 2XNDA 1OXUA 4V0KA 1N6HA 3LW8A 1NF3A 3D7MA 2OEPA 1P5ZB 1X1RA 3IILA 5B30A 2QP4A 4M8NE 2GTPA 5FUXA 5AUNB 2Q3HA 2C9CA 2NIPA 1OT3A 3SFZA 3B82A 2EWWA 3IHWA 4C2UA 2ZUCA 3A58B 2WWWA 4PAQA 3R7WB 2EQBA 2QMHA 3BBPA 4ACBA 5GJWC 3OEED 2ECKA 2DB3A 3WNCA 1S9HA 1ZUIA 2GJKA 1VG0B 2VTKA 2RH5A 4TMZA 3U6KA 1XEWX 2O8DA 4D0GA 5JSZB 4FXPA 4A9AA 1E1RA 1J99A 3HP1A 4MKFA 4EJSB 3EPLA 1A7JA 5TY0A 1KI7A 1KNXA 4FCTA 1FTSA 2XXAB 4US1R 3SYNA 3AKDA 1OYYA 2ZE8A 1YVDA 4JVMA 2LKDA 4Q48A 4URYR 4EJSC 5CITA 1TAGA 2V3CC 2HLDD 4A0FA 1OXSC 2C78A 2QY9A 4MUBA 5DGXA 3ND8A 2DFLA 1PJRA 3CRW1 3E2IA 3KFXA 5JRJA 1DARA 2IYYA 2OT3B 5KSYA 1M7BA 5JLJA 2GJ8A 1EX7A 2YYZA 2WSSD 3KXLA 4JS0A 3RS3A 3B13B 2WMOB 2I1QA 1YZLA 3K0CC 1NLYA 5H1YA 5KDLA 3QIAA 3LBHA 3T1OA 4BE7B 1UBCA 1S4QA 3LLMA 1XJQA 2R6GA 3KFVA 3LNCA 3RAPR 2BBSA 4MKGA 2GHIA 3K9HA 1TQDA 1T0HB 1WF3A 3AP1A 3OEEA 3L43A 4NCIA 4Q1DA 3PEVA 1ZUHA 1G7CA 1KI1A 1HURA 4Q7MB 2QPOA 3VX4A 1KSFX 3O8RA 1KY2A 4JT2A 4Q03A 3ZZ0A 3ZQ6A 1F2UB 421PA 5EZ5A 2G0TA 4M21A 4A92A 1IY0A 2CK3D 4RCZA 1DO0A 4LV5B 5FI0B 4OHXA 3AUXA 5M04A 2CEAA 1NL3A 1E9BA 2FWRA 1RYHA 2HLDA 5AR1A 2AXNA 1P72A 2EFEB 4Q7JB 1YKSA 4Q4AA 2CCKA 3R8CA 3RABA 3DO6A 3QEJA 3FVQA 3PUVA 2DWQA 5FTLA 2A30A 3CW2A 5E4FA 4BFWA 1RVDA 1JJVA 1Z0FA 3QE0A 3EA0A 2PH1A 2WSSA 5HTKA 2QEQA 2BWJA 2XB4A 2UZIR 5EXSA 1NKTA 3LX8A 4KITB 4QJ4A 4DEYA 2RGEA 4HEJA 2OXCA 2F6RA 3U7GA 2H1LA 1KI3A 5JJIA 2WOOA 3OAAD 3UANA 2ZVPX 4O3MA 3RS7A 4CEIB 4MH0R 1R5NA 4FINA 2ODBA 1QHGA 5KNCA 3MJHA 1E0AA 2P3SA 3AF0A 2ZTSA 1Q1EA 1XD2B 4YC7A 2D3WA 2GEUA 1MRNA 1Z63A 2IBMA 3HYRA 2CLCX 5EE1A 1ZVQA 3GJ6A 3R9WA 2ZETA 2BMJA 2CK3A 4CEJB 3NXSA 2QMOA 3PUYA 1QHNA 4WXRA 3SEAA 4A1FA 3O8DA 3E5HA 3KJGA 1R10A 3DEFA 1Q22A 4HAZA 2XTMA 4XIGS 1DS6A 4DDTA 1S1MA 2G77B 4OHWA 1UDWA 4LJ9A 3AF2A 1UADA 1VHLA 1BYIA 1N0VC 3DKPA 4BZPA 4IDHA 4HB4A 2EFCB 2ZJ5A 2IS1A 3RANA 3RC8A 3THWA 3A1SA 5DHAA 1A2BA 3BD9A 5EE0A 5CB6A 1J7KA 2OCBA 2C8VA 3EPHA 2DHRA 2QPAA 3FKSD 4A0RA 1A4RA 3SZRA 3HJNA 1TPZA 3GFOA 4L16A 4HZUB 1JBKA 4PZYA 4TSFD 3QY0A 3QNUA 2IWHA 3OAAA 3P32A 3L0SA 3Q85A 3A8TA 5CLLA 4JVNA 521PA 4TLDA 5TARA 3KUCA 3PEWA 2FG5A 2ZI7A 3DDCA 4CRWB 4UXJA 4GP7A 3LQQA 1HT1E 4TQAA 2GZDA 3B6EA 2KWIA 2QSZA 4JBWA 3LXXA 4UJ5A 3UXMA 2A5YB 4PPQA 1SKQA 4GP6A 2W6ID 3VHXA 5JHHB 2F3TA 2FFAA 3SOPA 1SVOA 4A0HA 1G20E 1KNQA 3QBTA 3W6NA 1T6NA 3QI2A 1RE0A 4YLGA 1X6VA 2VBCA 4OYHA 3ASYA 1IN5A 3N2EA 4HB0A 3I8SA 4OJQA 1U0HC 2AKYA 2IHBA 3CF2A 1YZTA 4RKFA 4Q9HA 3QF4A 4MITA 1GM5A 3U3OA 2PL3A 1IHUA 1KYIA 3P4XA 4ZIRA 4LGMA 4A2WA 1MO4A 2ZRHA 3SS8A 5L3SB 1R8SA 1AQUA 2V1UA 3X1WA 3AKYA 1SZPA 2XTNA 4KLZA 3TSZA 4B35A 3FKSA 1XEXA 4K81B 2HXYA 3ETLA 2IYUA 4TSFA 3C5HA 5L8VA 3JZMA 1VYTA 3QKRB 4KXFB 3AP3A 5ELXA 3GLFB 3FMOB 3LFUA 3KKOA 3IIKA 1A1VA 1RIFA 1YQTA 3GJ3A 5EXTA 1CR4A 4IW3B 3RRNA 4Q7LA 5KTYA 4PSVA 4TQ9A 3QOFA 4F91B 1E4VA 3QSYA 1YZNA 1MV5A 3QKSB 2B92A 1LNZA 2W6IA 3PQCA 1ZU5A 2BM1A 2C99A 3FFAA 4ARZA 4FMDB 4BLTA 3PUZA 2ZI6A 4BZXA 4ERNA 4KHZA 3R9IA 4EQ6B 4PZLA 3NHAA 2CHQA 3U44B 1WB9A 1WXQA 4PC3A 3CRVA 2QGNA 1OFIA 1YRBA 1U9IA 4AK9A 1GL6A 5EXPA 1E2FA 3LV8A 4U02A 3B1YA 4NCHA 4R71A 5DH9A 4YONB 1G21E 3UWOA 4I4LA 1XTRA 4BLRA 2WJHA 1ESMA 3MGCA 4LBYA 4QL3A 2ZROA 3C4JA 3W3AA 4DUGD 1CR1A 4NYJR 1GSIA 1RFLA 1ZM3A 4ZV4A 1M2OB 1Z08A 2XAUA 4HUQA 1ESNA 2W58A 1G3UA 3WP1B 3AF3A 3T35A 1MT0A 4POAA 1FFHA 3QXCA 3AVVA 2QP3A 4CEHB 2XNSA 4Q7KA 3OFND 4NDZA 3KL4A 1COWD 4ZI2A 4KCGA 1NIPA 3T12A 1T3HA 2OM2A 2VRWA 4L5BA 2ZYUX 5SZHB 3VR3A 4AYTA 4B32A 5C18A 2H92A 1K5GA 1SXJB 4W9MC 1Z8FA 4EPXA 1PUJA 1W36B 3AVUA 2ZVQX 3VTKA 1Z0AA 5J4YA 1KDOA 2PX0A 4PPNA 1BMFD 1T8UA 2IF0A 4Q9LA 4FMDF 3EAQA 4HLQB 4UXHA 1SXJC 2BEJA 3EWAA 3K0EA 1TTTA 2WWFA 3B85A 1W36C 1UF9A 4G5GA 4NL4H 1T5LA 3EG5A 5K8LA 1VKJA 4TYYA 2OBLA 1IJEA 2BBTA 2JA1A 2UVQA 4PTLA 3FMPB 3BH0A 2YC2C 1Z2AA 3RDPA 2HDNB 4YQFA 1E0KA 3A4LA 3VKGA 2CHGA 1NIJA 4K8OA 4DUGA 5CLQA 4MRPA 1NN5A 2FSGA 4ESVA 3I32A 3V00A 1IONA 3AKCA 3H86A 4TTRA 2AHOA 1GUAA 1P9NA 3VHLB 1FMJA 4G5SA 4C7OA 1GILA 4LHYA 1LV7A 3K9NA 1WBBA 4Q47A 2RHDA 1NBMD 2AWNA 1NVUQ 1XTSA 2HCBA 1SULA 4AKEA 2BMFA 3OFNA 1COWA 2GAAA 3GFTA 4M1TA 3Q5EA 1FP6A 1GTVA 4V0ME 3L0PA 721PA 3AV0B 5F9FA 3HPQA 1CR0A 2HCJB 5JJKA 1CXZA 3TW8B 2OFOA 5DLQC 1KJWA 2W83A 2CVHA 3X1DA 3GLGE 1G16A 1BMFA 3F8TA 4TLBA 2ONKA 2C96A 4XJXA 3LXRA 4FMCB 2GXAA 1H8HD 3D8BA 3OZXA 5EJEA 3GLGA 3CNNA 3H0KA 5AJXA 2J1LA 3U5ZB 5C4GB 2NG1A 3QVUA 3L8ZA 4LV8B 3KKQA 1JEEA 4DB2A 4EPRA 3VX3A 3FHTA 3TK1A 4TLAA 4Q9JA 4Z51A 5BXQC 4D26A 4TT3D 1JPJA 4KO8A 2F43B 2IYXA 1T91A 1NRJB 2RGAA 3ZS8A 3RNLA 1KKLA 2CLDX 1EG7A 2ATXA 4Q19A 2WHXA 3NC1C 1MKYA 1CRPA 1NBME 4HDOB 4KSBA 3IEUA 2CLSA 4L4UA 3L8YA 1ELOA 3BXZA 2JLZA 2BMDA 2ZITA 5C1BA 1NBMA 4RD2A 3VNVA 2HXSA 1UBEA 3PG5A 5AJYA 2W2TA 1AS3A 3O8CA 3UG6A 5FOVA 2MSDB 4N3NA 2WWYA 2XITA 3IEVA 2OAP1 1F48A 2ZANA 1YR9A 2QUZA 4M4SA 1C4OA 4QNRA 2RGNA 2IXEA 3LDAA 3I61A 4V03A 1Z0IA 4GT1A 1NVVQ 4M9XA 2C98A 5BN4A 2AK2A 3QQ5A 4A4DA 1QF9A 4JJZA 1H8HA 2QGZA 1F2TB 4FMCF 1YZGA 1UEIA 5EE3A 1EFRD 1SKYB 2O5VA 3DVLA 2NO0A 2FFBA 1E9SA 4TT3A 3UATA 5G3YA 1G19A 1MABB 1QG4A 2RAPA 3P1JA 1N2CE 3K0FB 2VHCA 3PENA 4FCWA 1C9KA 2CMKA 4Q4JB 1KAOA 2R6AA 2VL7A 5IDVA 2XB2A 3KKPA 2J0UB 5FPSA 2Q3FA 1Z6GA 3WRYC 4QC2A 2NZJA 4BLOA 4Q4HA 3RRMA 3SQXA 3IO3A 1G7RA 2GCOB 2ORIA 2QAJA 2ZRNA 4YDSA 3TIFA 1DAHA 4FD2A 3KB2A 1G291 2D74A 2J0QA 3NG1A 4KBGA 3K09A 1KTVA 1XD9A 2OCAA 3BB3A 5E3HA 1K5DA 4JIMA 2A78A 3B9QA 1E0JA 1IXZA 5KU1A 5D3MB 2GILA 1E2PA 4DLXA 2X19A 3BK7A 3TMKA 3MSXA 4URXR 3DZDA 1ZYUA 2EFDB 1VCMA 4F4CA 2F1RA 3TQCA 5K8TA 3GLIB 3MUFA 1KAGA 2IYVA 4PC7A 1GOTA 1Q12A 2D7CA 1HT2E 1FP7A 2JLXA 3RYTC 2D4HA 3SJBA 1DAKA 1NP6A 1P73A 3CF0A 4HB3A 5CJPA 4FWIB 2DBYA 2QRZA 1EFRA 2D06A 1F5NA 2ZR0A 3VR1A 3U7EB 3B7GA 1VYUA 2P2LA 4HAYA 4Q1FA 1DAMA 1L4UA 2J87A 4IDPA 4P4SB 1HEIA 2BOVA 1IM2A 5J4HA 4PXAA 3LWNA 3B78A 5DI3A 2R44A 2GZHA 2GKSA 1NJGA 4LJ5A 1ZMXA 2PZGA 2ZE5A 1WCV1 1GKIA 3IUYA 2REOA 2FFQA 4LHWA 4RFSA 2GAOA 3VKHA 2VPPA 4ARZB 2ZI3A 1RRCA 4WZAE 4ZCLA 4HLUC 1E2GA 4DVGA 5DYGA 4DJTA 2GRJA 2WJJA 3HR8A 3ND9A 3U7FB 1KZGB 4IHQA 2QRNA 5KOYA 2P6NA 4LBWA 2IF2A 1XTKA 1ZRHA 2YWEA 2H18A 2CVFA 4CVNA 2G6BA 2J59A 3P20A 1E9EA 4B74A 4AYXA 1SQ5A 4BLQA 4A8JA 1IBRA 2VHQA 4OK5A 4RSGA 1G6HA 3T61A 5HZHA 4B34A 1JQJC 1FOEB 3RS4A 2WOJA 4OI2A 3ONWA 2FOLA 1SGWA 5H70A 1TU3A 2VSFA 1ZIPA 2C2HA 1E2EA 2NZ8A 4R7ZA 4CIDA 1R0XA 2BC9A 3KTAB 1IN4A 2TMKA 4M1KA 3NTUA 1XMVA 2WVJA 4DSNA 1G8GA 4TLCA 4RD3A 1S1CA 3PEYA 1G9XA 1OFTA 2OCYC 3D31A 5JJLA 3I5XA 2YKGA 3KQKA 4C0JA 5K8IA 1Q21A 3KJHA 2C95A 3QG5A 5E7JA 3TW4A 3RWMB 4NYMR 1Y3AA 2WWHA 5G3ZA 4KODA 1E9RA 4LJYA 4C0AC 1E2QA 1XXHE 2Q9AA 1SVMA 2W2VA 4EFNA 3CR8A 4MKIA 5LB2A 1TNDA 4JVLA 5FOTA 4FI3C 5EP3A 1XXHA 1OKKD 2BEKA 2REBA 1AQYA 4F7WA 4DSTA 4Z8XA 4C0LA 3AF4A 3P4YA 4KFSA 4OQMA 3FYHA 3R20A 4URZR 3OIVA 5HCNA 3RS5A 1VCOA 3TLXA 4DIEA 1G5TA 3QEOA 4KVAA 3M4YA 5BW8A 5FR2A 1OB5A 2OO7A 3SI7A 2PCLA 2XSZA 4Q1BA 2FV8A 4AI6A 5A4JA 2YWHA 4C2TA 3AVOA 5AJVB 3NVAA 3CH4B 4CT5A 2FU5C 3GLHE 3JZAA 1MOZA 1CULC 4F92B 3K0AB 4EDHA 4MRSA 5SZJA 1KIMA 1II9A 1TEVA 3PFIA 4NMMA 4PHGA 3GLHA 1G8HA 1QDEA 3I5YA 3T06B 1R5OA 1ZIOA 2A9KA 1S2MA 4KAXA 2O8BA 1W5SA 2IS4A 4TYQA 1OPXA 2B21A 3U61B 1ZM9A 3IKJA 2GETA 3CUEF 3BIFA 1B0UA 1NSFA 1XEWY 5CM9C 1NLZA 1T3LA 2OSBA 4HATA 1C1YA 3B1XA 4Q02A 2FPLA 3J81k 4LK2A 3B9PA 1OKKA 3SN6A 4B3GA 4JSYA 3AGQA 4LYFA 3OEHA 1DG3A 3Q7PA 2CJWA 4NU0A 3IHLA 1XMIA 2HYDA 1WE2A 1VG8A 1FX0A 4KBFA 4HLDA 2RKOA 4RVCA 2F7SA 4C0QC 3IDQA 4WXPA 4PANA 1D2EA 1U98A 1ZD8A 2OZEA 4WVFA 5EQTA 3BORA 2LCFA 1BOFA 1NJFA 1M7GA 4DSOA 1PLLA 1YE8A 2C04A 1XZPA 3P26A 1PLKA 4DIDA 2P65A 1R5BA 4HI0E 3THXB 2G88A 4ASUD 3AUYA 4DZZA 1U81A 1KK0A 3HU3A 2Z5FA 3B5JA 1QRAA 2V1XA 5IK2D 2QAGA 4XH9B 3U60B 2WJGA 5J4LA 4UJ3A 5DE3A 1US8B 1W1WA 3U4QA 1ANKA 5FOXA 1N6OA 1V43A 4D4JA 3LQRA 4LYHA 4DT1B 2X2EA 1K8RA 2BV3A 2VYFA 5KSPA 4PO9A 2XJ9A 1Q1ZA 1F3OA 3THYA 3ADCA 4P3YA 1DELA 1FMLA 4IEIA 3W6OA 4IXNA 1A5TA 1TF5A 4QRHA 1DE0A 4J0QA 4IOLA 4KFRA 4RZUA 4UNQA 5DIFA 1E96A 4PHTA 1XDBA 3OIWA 2YOGA 4LDJA 2GK6A 4KI0A 5F2EA 4Q4HB 5TMPA 4KV9A 5EP1A 3NEYA 1TL7C 3IIJA 4E03A 2JEOA 4MKHA 1M74A 1GZSA 1AJEA 1J90A 1CBUA 4GOXA 1LW7A 2QN6A 3KUDA 2ZRJA 5GVSA 3S1AB 1Q44A 4JLDA 3SDZA 1W4AA 2J5XA 4JYBA 4TYPA 4ASUA 4B47A 8OHMA 4AYWA 1M8PA 4DSUA 2V8OA 2AXPA 5IK2A 3MD0A 4LYJA 4ACAA 1II0A 1CTQA 1DPFA 5CYOA 1N6KA 3ZVRA 3FMIA 1T4GA 1TX4B 2R8RA 3TE6A 1NI3A 2VF8A 5FFMA 1NKSA 3SQWA 1ZCBA 5G40A 1GG2A 3W90A 1TMKA 2IS6A 1WRBA 5DI9A 1HTWA 3V4FA 5B58C 5J47A 2O8FB 1PLJA 4YXWD 5J5CA 2JLUA 3AVTA 4TL6A 2VQSA 3QXXA 4MRNA 2P5SA 3RRZA 2QM8A 2ZRIA 3OIUA 2GBLA 3EZFA 2WZQA 4LPKA 3MWLA 2AL7A 4RZ2A 4ABYA 5DYIA 2EYUA 5JS7A 2RGBA 1EFUA 3Q5DA 3LVQE 3QPUA 621PA 4ZDJA 2EW1A 4N0EA 2DPXA 3FWYA 2RGDA 2CL0X 2AK3A 3VR2A 4EFLA 2J0VA 5FL3A 1E79D 1VHTA 4YMWA 3ECCA 4PQYA 3U3KA 3W3ZB 1R7RA 2VA8A 3ZIAD 4MGIR 2F1HA 1A2KC 4NE2A 1OE0A 1LTQA 1J8YF 3NH6A 2PEZA 3SE0A 5FR1A 2XJ4A 2CHVA 2J46A 4LCBA 1NG9A 1JXOA 1KZ7B 1Z83A 2XZOA 4HUTA 1JB1A 1OFUX 2H8KA 4BECA 4HB2A 3ZVLA 5LPNA 1Y63A 2JJ8A 1GRRA 1AKYA 1IXSB 2V55B 4CGZA 4YXWA 2WPDD 4FWTA 2P67A 2IWRA 3EC2A 4GZLA 5CK4A 1UM8A 3GJ8A 3WNBA 4BRWA 2QMEA 1E2HA 2ZRGA 4QGFA 4R9UC 3THOA 5CB8A 4PPGA 5LBIA 4HYYA 2ZYVX 4B71A 1EFCA 2FZLA 2J3EA 3RS2A 2JDID 3ZYCA 1QHIA 3GJ5A 4OI4A 3HWSA 2H7VA 4D2IA 2WAYA 2ZRPA 2JLVA 3QF7A 2V9PA 2O8EA 1D9XA 4B3DA 4L9SA 4IFEA 1E79A 1RPZA 1N6RA 3JVVA 3AVQA 1Z07A 3ZIAA 2IUSA 2X1VA 6Q21A 3WMEA 1QVRA 1ZC4A 1P61B 4B73A 4OHYA 3GJXC 2W0SA 1YHNA 2IYQA 2ZSBA 1W2HA 4I1UA 4QHSA 4H1UA 4JLAA 4PAMA 5FBRB 5FPYA 4DHEA 5JWRA 1X1SA 2ZI4A 4KLNA 3V4RA 2JJ1D 1DAEA 5CK5A 4IOJA 2VP5A 4JLVA 2CCGA 3RVBA 4HZIA 3AEZA 4QOSA 1F6BA 1W49A 4OBEA 2OLKA 3Q3JB 4TQUS 2WPDA 3QXJA 4RD1A 4DLSA
chains in the Genus database with same CATH superfamily
1IBCA 1BVYF 1UEJA 3OPYB 2DYKA 2HTFA 1FS5A 3SMVA 4FBLA 1M1YB 2AVNA 4Q37A 5CA0B 3F47A 3TLAA 1UXHA 4N8DA 5LXTB 3KR9A 3PITA 4LMBA 2G1PA 1EUQA 2YDXA 3RHZA 4YRKA 5IF9A 3DDWA 3MMXA 3O1HB 3TIIA 5B7QA 3LBAA 1JR6A 1UJ2A 5JC1A 4LZWA 1CQIA 2NXCA 3M1IA 1UBFA 3HYTA 3AB3A 3CWQA 4YAWA 2Q6OA 3A32A 2R4TA 4HDKB 5B3AA 3WQHA 4NBVA 4MGZR 4EVRA 5C46F 4Z4HA 1FSFA 2BRUA 4TV9F 2J9XB 3TQFA 1L4GA 3SZUA 5E1OA 5BQPA 3VV2A 4BAUA 3UGJA 1JPVA 3OESA 4S1NA 4S2EA 2OZVA 4TM8A 2QRMA 4I8DA 4QHTA 4Z9XA 3L9WA 5IYZF 3C1UA 2QM7A 1SIWA 3DMTA 1L1EA 5HZKA 3MCTA 4A15A 4EHFA 2PQMA 4FDMA 2H4ZA 1P5JA 3UT5B 3G49A 1X14A 3NNNA 1FDWA 2EP7A 3Q9UA 3BL8A 4H3VA 4R98A 3VNAA 1BEUB 1M1UA 1QG6A 2DLDA 2PKEA 2H6EA 2W2NA 2VYCA 3GCZA 4DXHA 4RHYA 1FQKA 3UNXA 3P97A 4OQFA 2ARKA 1LEHA 3IODA 5C1PA 2UZ3A 4URVR 3TRDA 4UNRA 1FQJA 1I2DA 2AI1A 1C4WA 4DNXA 1H9BA 3M81A 1V1JA 5CIQA 3KXIA 4H4CA 4R8MA 2N1BA 1BNCA 1Q57A 1IVNA 5JUWA 5A0VA 4I1PA 3C39A 4UZFA 1FVOA 4JX9A 4MRAA 1M2WA 4XTRA 1UKAA 3TSWA 3CF4A 3GVPA 3C6XA 4DUYB 3PYXA 4NHEA 1JDBC 1KJJA 1UMBA 1YMVA 2PCJA 4ZOLA 4L8GA 1W34A 4MHSA 2P9HA 1UXGA 3A1DA 4U2FA 1HUQA 3VISA 2R8PA 3D7LA 1ZJYA 4OJNA 4XOUA 2XDAA 4EH1A 5CDSA 1T3TA 2EVWX 4H9GA 4UKDA 2MSEB 2OCPA 4ER3A 2QN7A 4RXUA 3ZE2B 3OZIA 2VQ6A 4XLZA 2C2YA 2VT6A 4RZXA 1RM5A 3LC1O 1D5WA 2Q4EA 2WWTA 4JJGA 2KI5A 4E09A 1C7JA 1PUXA 1B8OA 4JXJA 4X1OA 1E4OA 3SXUB 1D4OA 3EXFA 2AQIA 2BFDA 4KR2A 1UQRA 3ZVKA 1Z5GA 4UCQA 3PI7A 1IPFA 2O52A 3UV3A 1GFIA 4A6XA 4H7EA 2G63A 1RJ9A 1BA2A 3ZHZA 3OM0A 5EE5B 1FA9A 3I9NA 5AHXA 1JT9A 2FPGA 2X8JB 3ZOKA 1U0OC 1RR6A 2NPIA 4B7UA 3BKXA 5ARCA 3HVRA 4V1CB 1IN7A 4MRVA 1C4XA 3NFRA 1Y1KE 4O2LA 1QYVA 3HM9A 3LVBA 1R4AA 1RBMA 2FZVA 4BL5A 1RQXA 1R18A 2IZ1A 4D3XA 4FGKA 2ZSKA 1IWOA 2IXAA 2QTTA 3AHJA 4FZRA 1U6JA 3UXHA 1JFRA 5C8XA 1H6DA 5GVRA 4B3CA 3SFVA 4P98A 1H94A 4JVOA 2D2EA 3C6KA 1T3GA 4C05A 4YP5A 1T2UA 3ZHYA 3U7QB 3OHMA 4ND3A 4BO2A 1E69A 5D3KA 5KC9A 2PLRA 3HR7A 3NOVA 4AJ9A 2W2LD 3HVHA 1OW3B 5I7VA 1RHJA 2B83A 3CZAA 2C1ZA 1EK0A 1EFKA 4MYDA 3TE7A 3AEYA 1ID1A 2ORYA 3NPAA 3ONNA 4Z8YA 1TF7A 4LVCA 1Q0HA 3E9EA 4QUEA 3KLNA 4QG7A 1NN0A 1JHZA 3VO1A 4IYRA 4MEBA 3M3DA 4L95C 3FRJA 3VTAA 3R9KA 4WNCA 3T94A 4II3A 1TCVA 2DUUA 5CP8A 3W7VA 3K0KA 2XXJA 4N3CA 4M9UA 3B2QA 3HVKA 1UBMS 3CF6R 1TYZA 1XJCA 3G82C 4Q4AB 1H9CA 5M5BA 2YY5A 1QKIA 4B3SB 3AEUA 3PK0A 1UDCA 4AKGA 1CRLA 1N4AA 4LF5B 2CNBA 2ZK7A 3R6DA 1WTCA 3WXMA 4GWGA 3P2OA 3H5TA 4NI5A 3HKDA 2EHDA 4EI9A 1N2BA 2FY8A 2HDWA 2UVPB 2OHVA 2X22A 3QE4A 4KRGA 4TVKA 1WW2A 1D6JA 3AO0B 3RIYA 3ONVA 1YGPA 3CW9A 3QOYA 3C87A 5LOVB 5DM2A 1CNEA 1HFEL 2ET6A 3HCDA 4O4JB 3EZ2A 1Y4SA 5FXMA 2GAFA 1A27A 3O4FA 4GWLA 4TV8B 1S8AA 4PRKA 5DK6A 4R8VA 2ZIXA 4YEDA 2ZPTX 4UATA 4XQCA 3W4KA 4BBPA 2V7BA 2CT8A 3OBIA 3IEPA 2DLCX 3WO0A 3N5CA 2O3SA 4NKRA 1GTG1 4RQUA 3SQDA 4D81A 2CFOA 4LBVA 4LX0A 4DLUA 2VJAA 3CLSC 221PA 2YYAA 5IS2A 4ZWNA 1FPQA 1RXIA 3G9ZA 1LWOA 3R4VA 4WPGA 1MU0A 1MAWA 3N75A 4BO3A 1JLHA 3VFDA 2YIJA 1RXSA 4AQYB 1T5TA 2ZZNA 4V2UA 1I7QB 1SXHA 2OCLA 4N5HX 1Y7TA 1ZU4A 3FR8A 5HE9A 5LR6A 4MTLA 3SLKA 1T8WA 1EP1B 1OAOC 3WC4A 1Q6YA 1ZINA 2R6FA 1ZHHA 1GGKA 2WG1A 3LO5A 5HA5A 4G65A 3PV0A 2AE2A 5KTTA 4D8WA 1USGA 1F8UA 2AIRA 4CCSA 5KWIA 2O1SA 2QS9A 4K9OA 2JJMA 1X8JA 1ZC3A 2XGMA 2Q9CA 3NEAA 3OUTA 1SUWA 1JFFA 4Q3EA 4X92A 3D6HA 5KWVA 4K1XA 1IUOA 2RHMA 3M5CA 2J3KA 2WFMA 3T7TA 2F67A 3TUIC 1LDMA 4KZPA 1RWQA 4LISA 4JBGA 2Z3ZA 4NESA 1P2UA 4ZPXA 4XB2A 1L4YA 4QTUB 1E89A 1Q0TA 1N6NA 2RMKA 5J5VA 4M1ZA 1MA3A 2Q4BA 3V7UA 1BEZA 1A7UA 2WIDA 3LYUA 4NYIQ 3JSAA 4I9HA 4GX2A 3H2BA 4FCVA 1J6UA 4N7BA 3I9V6 4WFJA 4WEOA 3ZGYA 1VMAA 1OFVA 5SICE 4V3CA 2R00A 4GBGA 1HKHA 3W06A 3BGOS 1G2PA 4U7TB 2QXYA 3QW4B 4EG3A 1XPRA 2HRCA 5GZ1A 1M5UA 4LC0A 3F74A 4FFBA 4KKXB 1GTL1 4EECA 2XXAA 5E2IA 1F14A 3BN3A 4QTZA 1BVHA 1MGPA 1ZM7A 4D8VA 4EPVA 4Q9KA 2O8NA 1DUIA 2VRBA 1PVDA 1OREA 1QIEA 2PG3A 3C6QA 3GEEA 4WESA 5FPHA 3ABRB 2JBAB 5KC8A 1G20B 16PKA 1T1JA 1JLRA 1MNQA 4PX9A 3BCRA 2FGJA 3FWNA 3UXEA 1JECA 1H0KA 2DFKB 1JHXA 3AR3A 4JOBA 3SC3A 4OP1A 4G8DA 2IXGA 5T6MA 1CS0B 4PSAA 4E4YA 5IVPA 1R6XA 3FX2A 1ORWA 4OIFA 3TM5A 4UM8B 5DX0A 3WGUA 1CETA 5AVRA 1K88A 4DDHA 5D6OA 1E92A 2ZRKA 3ILXA 4I5DA 3SZMA 4HGZA 3ZY4A 4M46A 3BM5A 4Z4GA 3AXTA 1ENPA 1HDRA 2ZUFA 5FTNA 1T9GR 3A06A 5BSRA 1BWSA 1L5ZA 1ZM2A 4N39A 4YP0A 3E5RA 1KI9A 3IVXA 3ESDA 3V7YA 3FCCA 5HUJA 1HL3A 1SQ0A 6AT1A 4IFIA 1G8PA 1PGQA 3EZNA 5ELMA 1EWRA 2OBXA 3KSRA 2LWIA 2W6NA 4XDHA 4X66B 1QV6A 1R6VA 1E99A 2XE6A 4H6PA 5DWQA 1PGJA 1GU1A 1X7WA 4WA7A 3VSEA 4RLQA 1SBYA 3V6MA 5KI6A 1JHUA 1Q77A 1F2UA 3ND7A 2GN0A 3WLJA 1PP4A 1RHUA 2JFHA 4PBSA 2PAFA 3HGMA 3UH0A 1QRTA 4Y7DA 4DV3B 3I6MA 4ZP1A 1VE5A 4ZVRA 5K2OA 5HFJA 5E4JA 1Q2UA 3DE3X 5BY2A 4QD3A 3I45A 5TV2A 5CNJA 1Y1SA 3L7OA 2REXB 4L4RA 1FJHA 3A3PA 3FGNA 4WY8A 1LQ2A 2XUDA 5CB4A 2X5XA 3RUPA 1Z22A 2IW3A 3INGA 1OI2A 2BSXA 4MQUA 4RVOA 1NR7A 4WI1A 4PF1A 4G0NA 3C70A 1IDN1 1EK1A 1M9NA 2HO5A 5BWCA 1U9IC 4OH1A 4XVQA 5AT1A 2B7BA 3K9BA 2H11A 2ONYA 4HUQB 4CL8A 1IBMB 3FUUA 4OM7A 4H27A 1IZZA 3A0RB 2DGDA 4RH3A 3DDSA 2VAMA 4UAVA 3ULKA 2C9YA 3C3XA 3KQTA 4NZ9A 5LQRA 1CR6A 2MR5A 2I6GA 4CZ2A 4TN1A 2WYOA 3NT5A 5HJ7A 4CLRB 1JEQB 1UK8A 2XMDA 4DR6B 4FX5A 1ISJA 2RHJA 4LNUB 3H9JA 3MTQA 5F7JA 5DLPA 3ENQA 2R47A 1GGVA 1K6EA 1JVSA 4HWRA 3TBHA 2IUFA 3GRYA 3ROKA 2R97A 3GD7A 3T5GA 3TEFA 1Z2PX 3EXHC 1JLSA 3L5OA 4BDTA 2PGLA 3IE2A 1TYEB 4RZSA 3V4PB 4YR7A 1XNHA 1GZ5A 2PBRA 4MO2A 4PLYA 1N1GA 1KAMA 4BEWA 3AF5A 2PGIA 5MFZA 2IDJA 4RLFA 2GM5A 4MUAA 4PZZA 4AX4A 1XRLA 1I6WA 3OLYA 2CYBA 3CVWA 5EIXA 5DISB 2R6R1 3U4CA 3QFCA 2V7QD 1Q1QA 3DMHA 3QUBA 5EZYB 1M72A 3QKUA 3SIPA 4L8YA 3NIDB 4OHKA 3H8VA 2BY4A 2JAWA 4ND8B 3Q3CA 4FB5A 2EQ5A 3LIIA 4EI7A 3VPBA 3IV6A 3SAJA 2KQUA 1KA9H 1IWBB 4TLLB 5HBRA 4EG4A 4F1KA 3F9CA 3W5HA 2VBFA 4KVFA 1OFGA 1REQB 2JZCA 3G79A 1FEZA 3TAUA 1EFHA 4N4AA 3GCGA 2EBFX 4ZOEA 4Z9FA 3WICA 1HYBA 4QLAA 4YASA 4F4FA 3R9XA 2DCMA 2IGTA 4Y0NA 5DWVA 4DWVA 1QP0A 1YFLA 3CZPA 2VH1A 3S8EA 3BMQA 4NJOA 2ZXFA 2E37A 1J97A 2EQAA 1BCRB 3I83A 3PGXA 1GPDG 1QYIA 3B7WA 2P6RA 3G9UA 3LDUA 2DSNA 3NATA 4TRJA 4EG1A 3PIRA 3V1UA 4UUNA 4BN0A 2G4CA 4Q00A 3EBLA 1VZ2A 4RKYA 5FUWA 3ZJYA 4HGNA 3NM6B 1CE8A 1NMEA 1C0PA 1G1MA 3LQYA 1DWQA 2LNDA 1U0GA 2QG6A 4G63A 2ERXA 4RVDA 5PNTA 4CYMA 3AFOA 4G85A 4KQGA 4LJ7A 2RB4A 1D2AA 2JHFA 3C5EA 4GW3A 3STUA 1U11A 2A67A 5D87A 1FYXA 1QKJA 2A1UA 2GR9A 4UDXX 5FWXB 3DOFA 1U9CA 3GLGB 5HQ3A 2PUDA 2JJ2A 4FE3A 1L5WA 4ND6A 4RPHA 2B20A 3BULA 2BCEA 1W5FA 3Q72A 4ZRDA 1JLMA 3S0JA 1VRCA 3ENZA 3RGWS 1XZCA 1YJ5A 4QXPA 3T54A 4OEHA 4EZEA 4ZYLA 2J85A 3B6ZA 5JPDA 1T9ZA 3BTOA 1CRQA 1GZHB 4N7MA 4ZYYA 1J9ZA 1E7RA 3O3CA 1GFWA 4L4YA 2F3PA 2R1TB 4ZYVA 1WXIA 5E9WA 4MK4A 5LCXA 3ER9A 4WLEA 3K94A 5CYGA 5E1DA 1RWMA 2I8AA 4XRGA 2PMBA 2ZTUA 5FNVF 3AXSA 4HBZA 4UCFA 1Q3HA 4YQEA 2EKDA 3BJEA 3ZWOA 3GLFE 1RZ3A 3CA8A 4NMWA 5D1HA 5KPDA 5C7OO 5EP2A 2M2IA 3EDOA 2E5WA 1G59A 1GJRA 2Q5CA 1JAYA 1Q7BA 1NT2A 2PZAA 3DM9B 4FHCA 5J3JA 1NFRA 2YZ2A 3KYDB 4QHYA 6LDHA 1SXJD 3D6JA 5A6SA 4QM6A 1XRQA 2OD7A 1R74A 3LAWA 3OX4A 1PV2A 3EQ9A 3QLEA 4MVJA 4REMA 3VYRB 4DUZB 1FFYA 1YAHA 4OYYA 1W36D 1J7JA 1X7YB 2JD2A 4G97A 1FCJA 1KI8A 1PZEA 3QMWA 4JJEA 4MQMA 1MQ9A 1ZIYA 5BN4B 1H8EA 2PX5A 4PEVA 3L0OA 1SIBE 1ZCFA 1MVOA 3FUWA 2W90A 4F8YA 2GESA 1B23P 3CWZA 4HO1X 2QNBA 3OQIA 3ISVA 3B12A 1U7PA 1W0JD 1XCJA 4O08A 4PGAA 3LKBA 4BNDB 4G5YA 2JLQA 1YVPA 1KVRA 1H2BA 2EOAA 4KEAA 1QQBA 3ICQB 4JYMA 5CCDA 2O7QA 2O2CA 2Q7XA 3AONB 3IXLA 3N0WA 3BZBA 2RONA 3G8YA 1N5OX 4FNAA 1O3YA 4NZYA 4X91A 3JQAD 5JEDA 2Q5OA 5K8VA 3DYIA 4X1IA 4QU8A 3CVXA 1NBIA 3L0YA 3SR3A 2HLPA 1C7IA 1M2OA 1MC4A 1OLUA 1SC1A 4D0LB 3PXAA 4XSHA 5CTAA 3F5DA 4G5QA 1TD1A 3Q8XB 4OGKA 1JVNA 1LNSA 1O89A 1ODIA 4JI8B 1OXMA 5FBQB 1SXJE 1NVVR 1B8PA 1HNXB 2G9UA 5FOUA 2ZSHA 3RPEA 3FF1A 5JZOA 3ACDA 2AG8A 5ENDA 1FTNA 3VSBA 3DEIA 4S04A 2VZEA 1AQ6A 2I0FA 3SBXA 3HUEA 4HAUA 3II6X 4OUKX 5HK9A 4BRUA 1FIUA 4KVGA 4C3ZA 4LDPA 2FZ5A 3NTLA 4RJ2A 3MRVA 4RKQA 5A5VA 2JD0A 2WUGA 4UEQA 4L22A 4EF4A 1Z29A 1Y80A 2RK4A 2ZI9A 3HPRA 2NTYC 1E2BA 1DI0A 2PV0A 1G5PA 3KQPA 4P5PA 3W3AH 6REQA 1T2DA 1SBNE 2O4UX 2QTHA 1T10A 2FR8A 5GJVC 4YT4A 5DBHX 5K0FA 2JJYA 3G8DA 3OETA 3UXYA 3DC2A 5E2BA 1M6WA 4EW3A 5HF5A 1NXQA 2XCOA 3D0KA 3FROA 3G2MA 1I51A 1E1QD 1KBQA 1G18A 1K08A 2FW1A 4INZA 4QBFA 2Q5EA 7REQB 3KBOA 1NYQA 5D5HA 1EJ6A 1KEKA 5B6IA 4R51A 1IAQA 1LWNA 3LT0A 5EVCA 3WK5A 4IRXA 2XMQA 5L40A 1AJEA 4F85A 4JR1A 1BE8A 1NGSA 1SOAA 2O3TA 2OHFA 3N86A 4L3VA 5DI3B 4DM4A 5L4LA 1JDJA 1HDIA 4BNVA 4H6WA 4EUFA 3DG9A 2ZJ7A 3BRSA 2JVIA 5E8JA 3K5IA 2QKYA 4H7HA 5LNK6 3PHGA 1YJAA 3SR4A 1NXVA 4QDKA 4IQ8A 4MDEA 2B2XA 1QGYA 3OU6A 5FBLB 5BPHA 2V03A 1VHDA 3VZDA 3GMIA 1PFKA 2IU3A 2ZFUA 3AHFA 1QGAA 4MULA 4YP9A 3ZX4A 1MB3A 5TIIA 5IJZA 1XFAA 2AB0A 3UJPA 4J6FA 1T43A 3FSRA 2ZB8A 4GP9A 5EJAA 1JWLA 5KBYA 1OASA 2JHCA 2GZ1A 5EFOA 4YB8A 4BNXA 3ADKA 3L77A 3LDFA 4LXTA 2BEVB 2VBGA 5FO0A 4HQNA 2XZPA 1G42A 3HDGA 1KFCB 1OIWA 2FDXA 4E88A 3ZX5A 3IR7A 5AKEA 5KQMA 3QWHA 5DNWA 4N47A 1VE9A 5EIOA 4QLOA 4NOLA 5CA1F 2HCFA 2V5VA 2ZGVA 3GUVA 4PR0A 4XIIA 3UJHA 3VJKA 1EE9A 3VR4A 2HM7A 2GBPA 4MPJA 2GI4A 3R0XA 4IAOA 4ZO6A 3M7IA 5FORA 2Z43A 3ZZ1A 3JQBC 3ZNNA 4NZMA 3I2HA 1TQ4A 4O2AB 4FNMA 2HA5A 5JAZA 3EIEA 5EWJB 4EUNA 2I03A 2WZCA 4AJJA 1R0ZA 2HC9A 3MWDA 1HKUA 2DAPA 4PINA 3F6BX 3ISJA 4JI5B 1ZUD1 4CDGA 4D9JA 1U8YA 1KR5A 3WQBA 4CLHA 1N8TA 2O0KA 4MR7B 2AJBA 1BGWA 2HWUA 1T0BA 3A6PC 1OLXB 2YWJA 3ITEA 1LSUA 3MD9A 2NUTA 1GY8A 4HLNA 4QYTA 1X74A 2YINC 1TU0A 2C9MA 1LLDA 3C3KA 4KV7A 1N8SA 5BOSA 2XB2A 1NVWQ 1NJ2A 8GPBA 1YZ3A 2B8EA 1C9DB 2AMLA 3EXEB 1UPUA 2B4YA 3JQ9C 4GE0A 2Z9BA 3B6MA 4R9NA 3O1LA 2BJWA 4K1LA 1KYTA 4M89A 4V0OA 4Y1RA 5ALIA 2EERA 1JDTA 1KP3A 4QJ5A 5ALXA 2YW9A 3GHHA 4U0KA 1YFZA 4JI0B 3N2IA 4PRZA 2A5JA 4NRDA 3ZS9A 1I01A 5ECWA 3NTXA 1AQNA 2WDZA 2WD7B 1GCIA 1YH3A 1Y8RB 3MT0A 4ES6A 1UMDA 3FYCA 1K4KA 1RIIA 4LGVA 2WAMA 3TD2A 1DV2A 1KBOA 4QYSA 2GVZC 3SHTA 4RZ3A 3UMYA 2I2BA 3W6PA 2DULA 2K5UA 5LD2B 4X97A 4OJKA 2OP0A 4UDYX 2ZRAA 4D3YA 2C82A 1CUGA 4JENA 1WUTA 1TADA 3DE5X 3F3YA 3CBGA 4I4IA 3SIRA 3S1LA 2N3ZA 3FKQA 2OXFA 1GR0A 3OUUA 2AOUB 3R3HA 5BO5A 4ZAXA 3IEIA 1ZNWA 2QUJA 2RHLA 3BE6A 3JAKA 2PJUA 1NYLA 3ECSA 2Z1DA 3WE7A 1XQ9A 1VG9B 1RABA 3PDHA 2ZRMA 1NFFA 2HNKA 1C1DB 2ZT7A 3HY4A 3OKFA 4WD3A 2B61A 3ZE1B 1SOWA 1YZFA 3MCZA 5IG2A 1QLWA 4PZEA 4MRMA 4PGMA 3OURA 5ISMA 4B43A 1FL9A 4E21A 2GCOA 4CLEA 2QTVA 4CV3A 2CSXA 2X7XA 4OMDA 4C0SA 1ZI8A 4IKPA 4TMVA 2WM9B 3DFUA 4GYKA 1DRKA 4F11A 3DS8A 5BQ5A 4KMRA 3CX8A 3CLHA 3UCXA 2HDHA 4E11A 4UPVA 3BFJA 1E5TA 3M6VA 3RFTA 3SBDA 4LKRA 3U3MA 3VTZA 2GBCA 3WYNA 1H4QA 2R68A 3U80A 5EJGA 4INOA 3S2ZA 4F3RA 3DE4X 2OBYA 3IT2A 3OZ7A 3KM0A 3DTYA 2FDRA 3PQEA 2AJCA 4Z9BA 5AIAA 4CI9A 3GLIE 2ADOA 3WMGA 2BGGA 1RWKA 2HK7A 2Q41A 5HIAA 4KXVA 5BURA 1Z4PX 3QA9A 3TVTA 2ACVA 4RWZA 1J8FA 2NT3A 5H59A 3STHA 3UAWA 2BR3A 4AIIA 3PBKA 4EY5A 1E77A 1YB6A 1QLHA 1LFDB 5CFQA 4LYAA 3T5BA 1GV0A 3CC8A 3WQQA 3RUEA 3I3OA 4F0JA 1P31A 3W5AA 1ONSA 3EARA 1Z33A 1LZKA 2DBZA 2FSSA 2HFKA 4XR4A 3R7SA 5K01A 1Y4AE 1VC2A 5FP0A 1G6KA 4EA9A 2P41A 5B3LA 1O0SA 2EJBA 3DVRX 2WIFA 5JH7F 4GPAA 5GV7A 3SEQA 2RAVA 2QD1A 4RVNA 3ONEA 5EPUA 5F3WB 2V7VA 2WT8A 3ITDA 4ERXA 2QAGB 3TWOA 4JL8A 1O87A 1X19A 1RAEA 1I80A 3HSSA 5EWLB 4GKJB 2V96A 5JMWA 1RRVA 4OVKA 2ZJAA 1N2EA 3HCEA 3FG9A 5KDOA 2ZSFA 4MGYR 4DQDA 1ZO8A 4OQDA 1N33B 4MB2A 5DNCA 2ZKIA 4KYUA 3WRWA 1HSZA 2HY7A 4FFPA 3ZGZA 2IPXA 2POCA 3D4PA 1JE0A 1Z0JA 1MAAA 2DXIA 4JXXA 1AMOA 3PRYA 2W93A 3IPYA 4IGAA 4YN3A 3FHOA 4AWAA 3AR4A 4DY4A 4XSVA 3F6CA 4Y2GA 2GA8A 2IODA 3PEEA 4BEVA 3LLUA 3I4LA 5EUQB 1P1KA 2ZREA 2Q9BA 4OI1A 4TKUA 5AI8A 4MCAA 1DG9A 3TX2A 2HJWA 3P52A 4WZBA 5I4CA 2RH8A 3DAPA 5IXJA 3LQFA 4LWPA 3TLMA 3AFGA 1IUNA 1ZD5A 5A4AA 6YASA 1DAIA 2W2PA 1SZJG 4X71A 4UHFA 2AN9A 2Q7DA 1EHYA 2ZDHA 5DBEX 4B3MB 1KRWA 2XDYA 3BRWD 1WULS 2ID7A 3LA6A 1AKMA 4N48A 2VPXA 2I9KA 2VNKA 1JHYA 2H5JA 1C7QA 1ZRSA 4DCSA 821PA 2FMFA 4S2UA 3OP1A 1NZFA 3E3NA 3W79A 5KQGA 4LC1A 1WCIB 4AUMA 4U3JA 2W98A 1A9YA 1KOFA 1E5XA 4LJ8A 4DA9A 2AOVA 3ZIUA 4AROA 3FXAA 4PCLA 1D2NA 5EJIA 1W4LA 4G0QA 3TNLA 3IAFA 4BFZA 2C03A 4B3XA 4K87A 4Q4LA 4Q7EA 1YASA 3EVNA 5K6AC 1E6WA 4FYVA 1NNUA 1CQJB 2PU7A 2EFHB 2YV1A 2P35A 4B32A 2FMKA 3A3KA 3UT6A 3TSYA 5KNDD 4Z0PA 4KFUA 4OOFA 2OUKA 3F3MA 3HVUA 2JASA 5SZIA 3SE7A 5TLSA 1E3SA 3L92A 2JKYA 4YUVA 3CRQA 3UMCA 1XVLA 1DKRA 5ESDA 1VIDA 1P6XA 1RKBA 4O1IA 2D5IA 1Q83A 3ITKA 2FA9A 5E3IA 4IDEA 4LFCB 3SBOA 4ALNA 2ZTLA 3R5SA 1XTJA 2PS0A 1OROA 3I37X 2YXLA 3C8UA 2JIPA 1IJKA 3GBSA 2GN9A 2VHWA 5BW6B 3HS3A 1VE6A 2I6XA 1ZJ4A 1CZKA 1GKKA 5LJIA 5HHTA 5JECA 3H2IA 1VP3A 2YWBA 3F71A 3GVHA 4OXXA 1I3OA 3EVTA 3IKMB 4TL7A 5EKUA 3SC4A 5IKXA 3ZQJA 5KOHA 4GS5A 4NULA 1ZG3A 3SM3A 3WMFA 2O4CA 1GA6A 1JU3A 1JEAA 2W9XA 2B82A 3M2PA 5MGBA 3GFVA 4Q9IA 3DWIA 2VAWA 2FDCA 3RC9A 2GM3A 2F1KA 4IEEA 3V9AA 1D2HA 3CONA 1I2MA 1UZMA 2XDWA 3MRTA 4IDNA 4G1EB 4C4TA 3T0FA 1VPLA 4Q34A 2GF0A 1ZK4A 2O0HA 1TZCA 4E5NA 3L40A 4GEGA 3F9RA 5THKA 1SIUA 4G0UA 1EXMA 3P0EA 4IQ4A 2LCQA 3FNIA 4YWJA 4IOKA 4G5OA 2JLSA 3GQBA 2GPWA 4RTMA 3TRHA 3GGCA 2XZDA 2W4MA 1YA6A 1WXEA 2HJGA 4WGFA 4FQ8A 1MXHA 3OJWA 5CU7A 3ZHTA 1C9NA 1DBPA 1WHSA 3IDFA 4P2GA 1CY2A 1V11B 3BDIA 1YMQA 3EHEA 4U2EA 2DR3A 4W5RA 3VSAA 1KFEB 1N5DA 4HNQA 2H2IA 1AF7A 3G0GA 3KYCB 1LI7A 3MLBA 4OAOA 1LLCA 1MVLA 2ZS8A 1NQWA 1TYDE 5CDUA 5CFMA 1EE2A 3A0UA 2WWRA 2RIRA 4XX1A 2OZLB 2QXUA 5E0KB 3GMTA 4BAGA 1P4GA 3DT6A 5ALMA 2C0PA 3HFJA 3RWBA 2ZI5A 4E5KA 2WJVA 5T4FA 4UNIA 1SBZA 5EHQA 4H1VA 3THXA 3GUHA 4FJ1A 1Q1BA 5DEOA 5I7EA 3TB4A 1MV8A 1WD5A 2Y66A 1XRJA 2FSHA 3G5UA 4NH4A 4WX2B 1BHJA 1A9XB 2AEMA 1X92A 4B0OA 3Q7EA 1GIAA 1P7PA 4ZHSA 2C5BA 4MGKR 3DFZA 3IAM6 5KOJB 5D51S 1I2AA 5H9WA 4GBMA 1NTRA 2C97A 3P9QA 1E5QA 1XN1A 2CSUA 3FW1A 2PT7A 3TNFA 4A2QA 1TYBE 1OIVA 4FFVA 2HRDA 2N42A 3BICA 4UUAA 1JU9A 1NX6A 1PFGA 1P5FA 1SCUB 2FMUA 3DNMA 4QUAA 5A3VA 2JGNA 4YJDA 4LY6A 5K3FA 5GIOE 4UM7A 2QRVA 3G2LA 4TRMA 4AN4A 4Z7NB 1LLQA 2G5CA 4QFDA 2GPTA 2YYSA 1LCIA 1U1EA 3HXMA 2GCPA 3SP1A 5FTMA 3PFNA 3BXXA 5KYUA 1JWAB 2HO4A 2YY6A 3H2KA 2IEYA 4ME6A 1VPTA 3DEJA 1YIOA 1Q7GA 1Z18A 4R7TA 3VYVA 5CH8A 3OQVA 3STVA 4D9MA 5IABA 1AGYA 4UFPA 4EB6B 4RACA 1I2BA 3RJTA 1CEEA 4AP9A 4BVKA 3LS2A 1HQCA 3FDZB 4FDAA 1OIXA 3PVSA 2RGGA 5CG2A 4QOGA 3S1AA 3S2SA 1X42A 5AYVA 2KS6A 1BMTA 1U7DA 2E21A 3ELWA 5IKPA 1XTQA 4OQQA 1A77A 2FSFA 4HTFB 1YRLA 2A7XA 3QHAA 4IBOA 3PXBA 4REQA 4UTVA 3OE4A 3UAYA 1TVKB 4CM9D 3O9VA 4KJXA 2AV6A 3RC3A 2Q5JA 4P7BA 2YWDA 3ZDRA 1N2SA 1JHDA 1UPTA 5BSEA 4IF6A 3LBIA 2TMYA 4XTCS 4PYRA 3KQWA 3UKDA 3F6RA 2AF3C 1GFZA 2ODEA 3WHPA 4IJMA 4P4TA 5LA6B 3OZSA 3RK4A 1GTMA 3PFGA 5IP5A 2R6CA 5FPTA 2Z4SA 1LDNA 1Z6AA 3JYPA 2FPMA 3NM5A 4US2R 5JYDA 2A0UA 2Q3JA 3F97A 1QFZA 4PZ9A 5FPQA 2C4HA 4WTOA 3AV3A 3JXEA 4UUOA 4A0SA 4TVSA 4ZZ0A 1Q2XA 2A5FA 1IDOA 2G7ZA 3EC7A 4KQKA 1PT7A 1PUIA 2VUIB 1MIHA 4BXOA 1JGTA 1TA0A 4BWFB 3DE6X 1JFTA 3JWEA 1M7HA 3D7RA 2DLNA 3GDFA 3GLQA 1ZY2A 3HN6A 3KS9A 4GXQA 1A72A 4P31A 3ROPA 4Z6KA 5IZCC 3K8OE 5KZMB 3QIVA 4GAEA 3ASZA 2J3HA 3I1FA 4ALJA 3ESCA 3ZCUA 2BEWB 4EQZA 3VU9B 1MTOA 1SURA 4P1ZA 4IIJB 1VPDA 2ZU0C 3TRJA 4FOTA 3O84A 4FUTA 4MLZA 3TINA 2CLLB 4CQMD 3NNDA 4QT0A 3D02A 1Z5ZA 1DG1G 1JLLA 4QKQA 1XZBA 3KX2A 4ZAGA 1OPRA 3QTLA 2P90A 2H51A 1TT7A 1BHO1 5JVDB 3GFGA 1GNRA 2XUHA 1UBUS 1I7LA 3ILYA 3PUWA 3CO5A 3A1NA 4PG8A 5C37A 2G1JA 1VYVA 1YACA 3EISA 5E7IA 1NU6A 2UZ4A 3SSAA 1NY6A 1PX2A 1FU7A 1LKZA 2BKEA 4K9NA 4UEOA 3WTCA 1LU9A 1RAAA 3GRPA 4YH1A 1AUXA 3KETA 1AO0A 4Q1CA 1M8GA 4HGQA 2ZRFA 5ERGB 3DMGA 5EE9A 5JPIA 5T4BA 3RC7A 4B4OA 2B3TA 1SHZA 1A5BB 4PIMA 4MYTA 4B2PA 2G40A 2A58A 2D1FA 2IX9A 4RLHA 3COPA 2C92A 1UZNA 4R69A 4UQOA 1U0TA 4B2YA 4INAA 3CLUD 4YGXB 5A4IS 4I1SA 5CG1A 1A9ZA 2LXNA 3Q9SA 3COVA 1YS4A 2YASA 5CXUA 2MSWA 1RLUA 4MDYA 2PRZA 3NBKA 1UPFA 2AI2A 3QTTA 5AO9A 5LP6C 3GC6A 4YRSA 3AT1A 5F23A 4EP1A 1EGAA 5ALDA 3Q2IA 2CKMA 3REQB 1YIAA 1P0MA 3N8KA 5K0GA 1G38A 2VPQA 3QKTA 3ZLBA 3OZAA 2ONCA 4ENTA 2QYSA 4QDOA 5B2EA 5CFNA 2P6PA 4OHVA 3OEHD 4LWQA 2PLFA 2OESA 3HDHA 1JQLB 3V6LA 1KDRA 3WKCA 3KT0A 1GXSB 1N2HA 4U8HA 1UBGA 4EM6A 1K6MA 2VJNA 3FPJA 3IMKA 1VSQA 2H2FA 1RWNA 3RS0A 2AG5A 2WLTA 3R76A 4B76A 2I91A 4G8JA 1BAPA 3BTUA 3OPVA 2XGSA 4GZMA 4Q93A 3MOSA 5BVHB 3AB8A 3TPZA 3BB4A 5AXAA 1IRXA 1T5IA 1IB6A 2OFXA 3KVYA 3M3PA 4M9SA 4AJIA 3DMDA 3BMNB 2ZJBA 2N46A 1FNDA 4Y0AA 2E2WA 3GEGA 2DE0X 3TD9A 4D25A 3FPLA 4HXEB 5TPWB 3RRBA 5ALUA 5JCPA 1Y8QB 4MYRA 4FC7A 3IHKA 5LC1A 2G71A 4LRXA 4X6YA 1H0SA 5LP6F 1G41A 1L5SA 1U5CA 1U0LA 1YRYE 1JU4A 5BPFA 3UMJA 2BKVA 3X1XA 1KZ9A 1WVIA 2BM0A 4C14A 1VB5A 5CHEA 3OPYA 3RYCB 1KETA 1KXJA 1SBHA 2HRQA 1M1YA 2OWEA 5CA0A 2M6LA 1E1RD 2BP7B 1INLA 3SD7A 2AOTB 3FBWA 4X64B 4UOZA 4L73A 4LXYA 4LSGA 4F84A 2ZJZA 1I24A 4U4AA 2PY6A 3MBIA 3MJ4A 4X7RA 1NKVA 2ZRBA 4TT8A 4RAOA 2OBFA 2CW5A 4NU8X 5FFFA 4MGHA 2VQDA 2JIZA 3AEXA 1ID8A 2PE5A 5JRZA 2Q3MA 4BATA 1ZMRA 4EX6A 4NYJQ 2DSTA 1UPAA 2FN4A 2IA5A 3IP1A 4BMZA 3C6MA 1SHJA 5TQ2B 1UFOA 1YQGA 1H5QA 2TSYB 4P4UA 3WQRA 5HM6A 2Y0DA 4M1QA 1RJGA 1C7EA 3UT5A 2VOEA 4C6TB 4RPJA 1FRQA 1KEUA 1BHSA 2IHYA 2ZQZA 1G6Q1 4LOHA 5HBGA 3AIOA 1NMSA 5ANRB 5IVKA 3O95A 3BFXA 4FGZA 1OXUA 1UBTS 1Z17A 4FOSA 4J0JA 2RGRA 1NF3A 5JSKA 4P3NA 1LNQA 3IJRA 1KAQA 3D8RA 1DJPA 1FTGA 3I1JA 2JG3A 1H22A 1UJ5A 1W8IA 1TK9A 2GTPA 2Q3HA 2C9CA 2NXJA 3DR5A 1U0RA 3P2IA 4L72A 2WJ6A 4X45A 3O8OB 4OOEA 2EWWA 4A8PA 5IT0A 4C2UA 2ZUCA 2Q27A 3MCUA 3R7WB 2EQBA 4GXRA 3ZWBA 1QFXA 3CJTA 2ECKA 1VSTA 3I12A 4OSPA 1ODCA 1U3CA 1PSDA 3R2JA 1ADCA 1S2NA 1U7XA 2GPNA 1GZ7A 2P9TA 4FXPA 1DBVO 2ZZKA 1YVUA 4A9AA 4A5SA 1QX4A 5KTOA 2C3OA 1QG0A 1Q11A 1NE2A 2A57A 4CTJA 4N5NA 4RF3A 3ZK9A 1C41A 2EGUA 3SYNA 3WL6A 3RUAA 1YIDA 4L4ZA 3EBOA 1CFZA 1V7PC 4BNYA 3PWTA 4EJSC 5ED0A 2HRBA 2UUPA 2A0WA 1GQSA 2WU0A 3GAAA 3DV2A 4YAEA 3KXDA 4N6NA 3SXUA 1FLNA 4S24A 2II6A 2QPLA 4IGEA 2XB6A 5DGXA 3S3TA 5B7GA 3T7SA 3T5PA 2C1EA 3KFXA 1QX3A 1B3BA 1GARA 4YRDA 4LTNA 5JRJA 4S1PA 3ROEA 4QULA 2BUAA 2X8JA 4PZ0A 4BMNA 4YRBA