1GAJA

Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIGH-AFFINITY BRANCHED CHAIN AMINO ACID TRANSPORT ATP-BINDIN
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transport protein
total genus 81
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gajA00
4D0NA 3QQ5A 3O47A 1F2UB 1KTVA 1P60A 1NVVQ 1RRFA 2AKAB 3D6TB 4JLBA 3W6OA 4E03A 5BYKA 2R62A 2A5FA 1OH7A 3ICQB 3GFOA 4XVRA 4D4JA 1YR6A 2DB3A 2F7SA 4BGDA 5FOXA 5L8VA 1D2EA 2C98A 2FV8A 3VTKA 2H1LA 3AH8A 1G6HA 3QPUA 4B3DA 3RS0A 2VBCA 3D7MA 3HYRA 5CLQA 2IF2A 2ECKA 3A8TA 4LHZA 1MABB 3GPLA 3FWYA 1O87A 1OLOA 1KO8A 4A4DA 5JRJA 1G21E 2EYQA 5GJWC 5E7IA 1GKIA 2QTFA 4PC1A 4E09A 2IYYA 2ODEA 2KBFA 3GFTA 3RRMA 1VG0B 3FPAA 1SVWA 4HZUA 4M9SA 3AKDA 5FOVA 3KKMA 5C18A 4V0OA 1SKQA 1X6VA 3QPVA 3QXCA 1FUKA 1QDEA 2OCYC 4FCTA 1R8QA 4KFSA 3PXGA 1J90A 2ZIAA 1W0KA 2WKRA 1E2FA 5FPKA 3WRYC 3QXXA 3A1WA 2V1XA 3B9PA 4S35A 1XD2B 1UBEA 5CJ2A 4F7WA 2RMKA 2C95A 4UNSA 2F43A 2JJ1D 2H17A 3ZD6A 4B48A 3ZLJA 1RZ3A 4QFMA 1NJGA 2VF8A 2J0UB 3TAUA 1N6HA 5L3QA 1XCMA 1E94E 4DCVA 4JZKA 3T34A 2IL1A 1W7AA 1U9IA 2O8CA 4NZYA 4DLYA 2ZM5A 1P72A 2YWHA 2O8FA 3TK1A 1VG9B 3P26A 2WJVA 3U7EB 5A0FA 1L7VC 2ZANA 5CK5A 1TMKA 3PIRA 1TQ4A 2JLZA 4JYBA 3I72A 2BBSA 2BM0A 1N0WA 1G8GA 4Q1FA 4TN1A 2CNWD 1DS6A 4FN5A 2AWNA 3NVAA 4RFSA 1ZUNB 3U3OA 2W2TA 4LI0A 1DELA 1XRJA 1HYQA 3QEJA 4YMWA 1H8HD 1M7HA 1DTSA 4JSYA 4Z8XA 2IYRA 2FPLA 3ZH9B 1MOZA 2WWYA 4XJXA 2O8DA 1Q1EA 1SKYE 3PFIA 5KPDA 3B1WA 2BOVA 1JPJA 3GLFA 2I1QA 4P3YA 1U0JA 1P2UA 3U4QA 1G4UR 1G6OA 2F43B 2ZS7A 1CXZA 2F3RA 3PUYA 1GNRA 4V03A 1VCNA 3RAPR 1Z0KA 2GXQA 4L8GA 4GI7A 4Q1CA 2QQEA 2IEZA 4DCUA 2Q3FA 1TQ6A 4WA7A 5G40A 1ZM7A 2O8CB 3W3AA 4B3XA 4KLNA 3KQHA 1T0JB 1DEKA 1N5IA 1ZP6A 2C9OA 3IBGA 3IHLA 3MWJA 1XX6A 3RS7A 2CCJA 2DFKB 1RC8A 4LUCA 5KO2A 1GVNB 4F38A 1VTKA 1ZBDA 4PPGA 1UF9A 3TUIC 4NE2A 3DHWC 4PSKA 2PJZA 1EFTA 2D74A 5EE5B 3R9XA 4FWTA 4A15A 5H1YA 3EC2A 5M04A 2WWXA 5JSZB 2G83A 721PA 1AS2A 1DVRA 4MGYR 2CK3A 4IVQA 1I4LD 1KI2A 4TL8A 2Q3HA 3GLFB 1XTJA 2EYUA 1JR6A 221PA 1XF9A 2IW3A 2QT1A 5GJBA 4QKQA 3HR8A 5B57C 5L3SA 4PQFA 2FZLA 4HATA 5JCZA 2QM8A 1TNDA 4AWXA 1LFDB 2QENA 2VSOA 2KSQA 4TYNA 1N25A 4BASA 3CBQA 4QGGA 5HKKD 1WP9A 1G18A 3ZS8A 4HI0E 3N2IA 4ZKDA 3SR0A 5IRCD 3L0IB 3VR3A 3SNHA 3BFKA 3VAAA 2CMKA 4KYUA 4TSFD 1HT2E 5AWFC 1Q3TA 2G3YA 3HDTA 3WNBA 5EP2A 4AURA 1JJ7A 1MR3F 4A0FA 1OKKA 2CE7A 5JWHA 2QORA 3V00A 4HDCA 3X1WA 5TV2A 3OHMA 2ZJYA 3UATA 2QP3A 1DADA 4CEJA 2ZRCA 4JVNA 1ZC3A 2J0QA 4M9ZA 1JJVA 1PLLA 5ELXA 3ASZA 4NYJR 3I92A 2XGJA 2JGNA 3IPYA 1NIPA 1MV5A 3P32A 1GKYA 1E0SA 2QAGC 4KODA 3R9IA 1ZUHA 4DT1A 3O8DA 1GILA 4B6FA 1KIMA 4BLSA 5L3SB 1KSFX 4C30A 3B7GA 5H8WA 3LY5A 4Z1MA 3EG5A 1XJCA 4BUJA 3P1JA 2ZI6A 3L0PA 4MKHA 4ZI3A 4HLDA 2ODBA 1UM8A 1HE8B 4LJ6A 2ZSBA 1R6BX 3SFVA 4CIDA 5JHHB 4PZLA 2VP4A 1TEXA 2R6CA 2ZETA 2DCUA 1VYTA 3CH5A 1UBFA 2YOFA 3EIQA 3IIJA 4B43A 1XTRA 4LOAA 1X8LA 3CIOA 3GJ7A 1G7RA 4M4SA 2J7KA 3EX7C 2QMHA 2AXPA 1OH6A 1QHIA 2XXAA 2J5XA 3R8FA 1SXJE 2OT3B 4RD3A 1KI4A 5DN6D 3LAWA 3FKSA 5E4FA 5JMTA 4I1VA 1T8TA 1W4AA 4DC9A 1FX0B 4DKXA 4YMSA 1XPRA 3MCAA 3OZXA 3NEJA 1IN6A 2VHTA 2FN4A 2J7PD 3KUCA 1SQ5A 4MRNA 1HH4A 2L0XA 4L9SA 4EQ6A 2V4ZA 3R20A 4II7A 4ZO4A 1TU3A 2ZRLA 3BIFA 3PR1A 4FW9A 1BMFD 1ZC4A 3AKEA 4C0SA 4KLZA 1F2TA 2OBMA 1YZKA 1YZNA 2PMKA 1FTNA 1QHSA 4MGIR 1QZXA 1U2RA 4IVRA 4DHEA 2LWIA 2RAPA 1ZVQA 3QXSA 3IEUA 5KDOA 1TQ2A 5FOTA 4P0TA 3PUWA 1KNQA 1W2GA 4I4LA 1RW4A 4PC2A 3QENA 2JLWA 2XXAB 1KY3A 1CJMA 1KO7A 1XJQA 3O8CA 4NPHA 1X8KA 2VYFA 4UNNA 1KYIA 5DH9A 4EPTA 4BRUA 3K70C 1RVDA 2GKSA 1G5TA 4TQAA 3QVVA 3GJ5A 2V6IA 5H70A 3FE2A 2ZI7A 3GJ4A 4LHWA 1Z0JA 1ZD1A 2FZ4A 3IIMA 2IYTA 2IXFA 1GRQA 4MRPA 4A2QA 3DZDA 2YWGA 4EQ6B 1TF7A 1R5OA 1M8PA 5CM9C 2BBTA 2AKYA 1G8PA 1X1SA 4RY2A 1F2TB 2JJ2D 4LHVA 5KNDA 1YU9A 3FB4A 2H5EA 3ADKA 1XEXA 4M53A 4LV5B 1JNYA 4HB4A 2BJWA 5EP3A 2XJ4A 2W6JA 4UJ3A 3ZZTA 1U8YA 4MA4A 1ZJ6A 1W0JD 1BYIA 1OXXK 1TAGA 2GJ8A 1XXHA 4I99A 4A0RA 3NKVA 4LRWA 3UG6A 3BE4A 4MGZR 2HXSA 3TGPA 1SHZA 5KOYA 1NIJA 4M1WA 5E7JA 2FEOA 1XPUA 4BRWA 3THYB 4FCVA 2KWIA 1NLZA 3X2SA 2ATVA 2DPXA 2WJJA 3LBNA 1C9KA 2PZFA 1HE1C 1AA9A 1FNNA 2UVQA 4UXHA 2JLXA 2IYSA 4C0QC 3CONA 2ZS9A 1U9IC 2B8WA 1KK2A 1QHXA 4EFLA 4XWKA 5EE3A 1DG1G 2OAQ1 3F8TA 3E2IA 3M4YA 2ZPTX 4IOMA 1B0UA 2XTZA 3VFDA 1NY5A 2J3EA 2QQ0A 4NL4H 3SQXA 2ZR0A 4JLVA 3OIYA 2OV2A 3BERA 5EZ6B 1T91A 1W0KD 2O52A 2CHVA 1G20E 2C96A 1TADA 2QP9X 3ADBA 1AJEA 1W47A 5KUTA 2GJSA 5TB5A 4DSUA 4LCBA 1XXHB 3VKGA 4U00A 2DWPA 2BDTA 3CR7A 2OFXA 4NU0A 2Z0MA 3KXIA 3QY0A 2GZHA 2ZE6A 4ZDJA 1PZNA 3R9WA 5HE8A 3P27A 4MRRA 3G0HA 3I3SR 4QBHA 1QHGA 2FSGA 4LJ9A 3SBDA 3A1UA 2FU5C 4WZAE 2GRJA 3C8UA 1NKSA 3LV8A 1L8QA 3AKCA 4TZ6A 1N3BA 1D6JA 3SJBA 5KDDA 3NDBB 3NIBA 2J0VA 1WCV1 5TXGA 5IF9A 2QMEA 3BH6A 3LVRE 3TSWA 1KJWA 4JLKA 3LXXA 3KKPA 3IO3A 4ZDKA 4Q02A 4ZDWA 2FPKA 1YRBA 3GLFE 4CF7A 3EZ9A 3NBYC 3QF4A 1NP6A 2FSIA 2PCLA 1F5NA 5J5CA 2NIPA 4PSAA 2NTYC 4NP6A 4Q4LA 1HTWA 4UNQA 3GCGA 4DDVA 8OHMA 2JCSA 1NVUQ 3K0EA 1AKYA 2PT7A 4O25A 2WBLC 5FPHA 2CVHA 4ZI2A 2V6JA 3X1XA 4YDSA 4BFZA 3PUZA 1Q3HA 1RYHA 4URUR 1WXQA 3RS2A 4GFDA 2BMJA 2Z43A 5P21A 4JBXA 2ZYTX 4B32A 2CBZA 1XD8A 1KI9A 3VHXA 1ZNWA 1W5SA 2EFDB 2IYXA 4DLTA 3LLMA 2GAAA 4BZQA 4LV8B 2QGNA 1Q57A 3B1ZA 2H16A 4ZCLA 3K0AA 2YC2C 2C2HA 1R2QA 1YVDA 3FFAA 5DLQC 2Q9AA 3VKHA 2ZI9A 2ZRIA 5TDHA 4QBIA 2HYIC 2D3WA 2JAQA 1A1VA 4IJMA 4IOKA 2IS4A 4I81A 2REXB 3W9YA 1BH2A 1ZCBA 3QF4B 5KDLA 4U7DA 5DYGA 5KNBA 1OFTA 4H9GA 2AWOA 1H65A 1NJFA 2OCAA 4URVR 3EA0A 4BLRA 1VHLA 3K8YA 2ZVPX 3RDPA 2WOJA 1IXZA 4Q47A 4V0LA 3SN6A 2HJGA 3EZ6A 2CK3D 3IDQA 2HV8A 4GMXA 2YWEA 4E22A 4KCGA 1II0A 4TMXA 1Z29A 2XB4A 4FI3C 1CJTC 4B3CA 3H84A 2YV5A 2YJTD 2TMKA 2QT0A 1F48A 3NBZC 4K81B 4EKDA 2OEPA 5JJKA 4LYAA 1EFRA 1G16A 3N5CA 1T4GA 5DYIA 1ZM9A 3K0AB 4G5OA 3UMRA 2PLRA 3IPXA 1JR3A 1SHKA 3B1YA 1E1QD 4G1UC 4D0LB 3WP1B 2GWHA 3KFVA 3WP0A 4PZZA 3B1VA 1W4BA 5GJCA 1NSFA 1R8SA 2QNRA 3A1TA 5CIQA 3VR6A 2G6BA 3GLIA 4DDUA 2C9CA 4A1FA 4B76A 3CX6A 1AGPA 1VIAA 2GXUA 1G17A 2BJVA 1MO3A 1YZUA 3MWLA 4UKDA 5FOWA 4AK9A 1A2BA 3P20A 1QHYA 1G3QA 4D82A 3K9LA 3LO5A 2ZRJA 5EJEA 1UEJA 2PEYA 2Z4RA 1PJRA 2QN6A 2W6ID 3SC3A 2D06A 4HLUC 3SYLA 4C9BA 1II8A 2LCFA 3B6EA 4FMCB 4IOLA 1UDXA 2EVWX 3RHFA 4D25A 2QAGA 4LJ8A 4ASUD 4OQFA 3RABA 5JEDA 2PLFA 3SDZA 3ZDQA 5K8IA 3CRQA 3FMFA 4E5UA 4K8OA 2ANBA 2Q9CA 5H68A 2IYUA 3KQUA 4G5GA 2P67A 3LFUA 4ON9A 1SVMA 4BEBA 2ZJ5A 3C41J 4TT3D 5FTJA 2GILA 1DPFA 1NMZA 2J46A 1OXVA 3LX5A 1YZLA 2Z4SA 2I4IA 4WOPA 1P61B 1CKEA 5HTKA 1IOZA 1U98A 1G291 2D7CA 3GLIB 2EWWA 2O0JA 1Z3IX 4E07A 4OYHA 3A4LA 2HF9A 2VSXA 5JHGB 3RS5A 3X1DA 3FKSD 3GQBA 3B85A 3PEVA 5LB4A 2QEQA 3CF2A 4ITRC 3KTAA 3THWA 1CF4A 4EUNA 2Z5FA 4Q21A 2A78A 1II8B 2WSMA 2A2ZA 3EPLA 3QJYA 1HQYE 1N0VC 4LWZA 1ZIOA 4DEYA 4C0KA 2O8BB 1YR8A 4HAWA 4RZ2A 5FBVB 1NVVR 4C0JA 4S2EA 3NHAA 4CEHB 2WKPA 4JKYA 4DJTA 3GLGA 4PHTA 2ZRPA 4IFEA 4CEIB 4B35A 3RWOA 1SVLA 2W0MA 1HUQA 1NG1A 2R65A 2R6DA 4URYR 2IHBA 2JIZA 4AKGA 4LZZA 2H57A 1G5PA 4Q48A 4HUQA 2IS2A 5LD2C 1S0UA 2NOAA 2UKDA 2D62A 1YE8A 1SVIA 3SHWA 4FXPA 4YXWD 1HT1E 4R98A 4XVQA 1LY1A 2F6RA 2MSCB 1P9RA 5B2ZA 4US0R 5BYJA 5JZVA 1A4RA 1U81A 1YZTA 2DFNA 1VKJA 4JL8A 1VPLA 4EPYA 2N46A 4PO1A 5D3MA 3ZVMA 3CF0A 2ZRNA 1UAAA 4IOJA 3KTAB 3THWB 4B44A 1OIXA 3NBFA 3P4YA 1L2TA 5KNCA 1ELOA 1KHTA 1JI0A 3FGNA 4M1TA 3OEHA 1D8TA 4QJ4A 3LWNA 4PC3A 4Q18A 1E9CA 1X86B 2WAXA 4QHTA 4PANA 2VO1A 3T35A 1IONA 1Q44A 3UK6A 1FUUA 1JAIA 1DAEA 2RGAA 4YC7A 1E0JA 2ZE7A 1XXHE 2G9NA 1QG2A 2YNMA 3GLGB 4PAOA 4HB2A 4Y0AA 3TUZC 3GLHA 4GMDA 4BECA 2GTPA 5FOUA 1TF5A 4LSGA 1LS6A 3DVLA 3LD9A 2XNDA 1FFHA 1R10A 5DIFA 4AIIA 4HUQB 2PH1A 2WJYA 4ZIRA 3K9GA 4PHHA 3SFZA 2P6UA 2ZSDA 4M1KA 5LBIA 2ONJA 3DDCA 4TTQA 5FOSA 4HB3A 4QBFA 5FPYA 3X1YA 1XDBA 2CEAA 4QNRA 3TW8B 4TMVA 1Z06A 3K70B 5UKDA 1P5ZB 2MMGA 2GAOA 3T1QA 4DXAA 2OILA 5D3MB 3THOA 4JS0A 1YRAA 4QNMA 1WB9A 1Z2AA 1MO6A 2DWQA 2WMOB 2OM2A 1H8EA 4PC6A 1MKYA 3FKQA 3M1IA 3Q3JB 3AF1A 5EXPA 3QXHA 2HYDA 4ZKEA 2W83A 2X1VA 2GCPA 3B60A 2WWFA 3OEED 5JLJA 2RGNC 4LHYA 4ACBA 5SZKB 2IC5A 4RVCA 4PPQA 2DFLA 1CJKC 3AUYA 3LDAA 1KZ7B 2KB0A 3I61A 3AVPA 3GLHB 4BQSA 4PHGA 4A82A 2ZE8A 121PA 3L43A 4Q4JA 1E9BA 4JJZA 4KBGA 5KTYA 4B3GA 3I4LA 2DWOA 1KGDA 2ERYA 4ZIRB 5JS8A 2VP9A 1IN5A 5AJZA 3T1TA 3QIAA 4HZUB 1CLUA 4C0LA 2AD1A 1TUEA 3RANA 2HT6A 2XJ9A 3HP1A 4DCNA 2PMDA 2CHQA 4KFRA 4LJYA 3VHLB 2YKGA 3MWYW 4AKHA 4P33A 1QBKC 4M22A 5JBQA 2BM1A 4H1VA 3FMOB 1KI3A 3I73A 4OK5A 1T8UA 3ZVRA 1OIWA 1NL3A 1FQJA 1E1RA 3A4MA 5LB2A 3SS8A 1KO1A 5BN3A 3L0OA 5L3QB 4OI1A 3RWMB 4G5QA 2F9LA 2CL0X 1E9FA 5DI3A 3AVXA 4KXFB 3QPWA 1G7TA 2EFCB 1HQCA 1T0HB 4FIDA 3CX8A 4EAQA 2O8FB 4R2HA 4RZ3A 3ECCA 1GL7A 1R5NA 2OZEA 1RJ9A 4JSTA 1R0ZA 4BZPA 1PV4A 4O3MA 3Q7PA 1X1RA 3EPKA 2XTMA 4URXR 2BEJA 4A2WA 1Q22A 3BRWD 4Q4JB 4B2PA 1E98A 1NBMA 3CRW1 4JLPA 1JBKA 3VMFA 5JWOA 1Z63A 4RFSB 3W8NA 1QRAA 1ZD8A 1HEIA 3MRSA 4C2UA 3OFND 3BGWA 4ESVA 2D2EA 3RYTC 4PO9A 1W5TA 2GDJA 2NO7A 3LX8A 2NO0A 2CL6X 2WSSD 2ZJAA 5FBWB 3AGPA 3U4QB 1E2PA 2DBYA 2KBEA 2B7CA 3EWAA 2R6GA 5CDFA 1MT0A 4GOJA 5FUWA 4B3FX 1HA3A 3U3KA 1QF9A 5C46F 5F2EA 1IJFA 2ZRKA 4DCTA 4AY2A 3GJ3A 3UWOA 2GXSA 1E79A 2D4HA 2IUSA 1CTQA 4RKEA 2FA9A 3UIEA 1RJ9B 3RS4A 2CLSA 1JALA 3HU2A 2IWRA 4QM6A 2LKDA 3RSOA 2OLJA 2I3BA 4A8JC 3D31A 2GHIA 1JR3E 4PFSA 3TIFA 3NTUA 2B8TA 1N5LA 1VG8A 1WE2A 1LB1B 1E0AA 4OKSA 2X77A 2CE2X 5EZ5A 3GLIE 3RVBA 5HCIA 4B34A 1N6KA 4M1OA 1S1CA 1EFRD 2XNSA 1XFAA 1UKEA 4JT2A 1G4AE 2JJ8A 2ONKA 5CIWA 3T06B 2W2VA 2QUZA 2V8OA 4D80A 2Q9BA 4Y0VA 4GRAA 1FP7A 2QBYA 2BMDA 1IXSB 1JR3D 1OFUX 2ZJ2A 4G0NA 2EU8A 1OH8A 1WDTA 1DE0A 3AVVA 4EJSC 3LBIA 4BFSA 2HXYA 5DNYB 1UFQA 3A58B 1U8AA 3KL4A 2EFHB 1WQ1R 2B92A 4L4UA 2QMOA 2IWHA 4D0GA 4US1R 4QGAA 4Q4HA 2A3RA 2CDNA 5SZHB 5EUQB 3UKDA 2P65A 5GVSA 1OYWA 4L16A 4QRHA 5KSPA 2HF8A 1P7CA 3BK7A 3GFPA 3K0CC 4HLUA 5CYPA 3SHFA 3UG7A 4YMTA 1MH1A 1ZM3A 3PG5A 2CL7X 2WM9B 3U5ZB 3ZGXA 1NI3A 4RZUA 1FW6A 2BBOA 3QE0A 2WMNB 2JA1A 4B47A 1E2HA 1RRPA 1KI6A 2IYQA 2QE7A 3THXA 1GIAA 2DYKA 3GJXC 1GRNA 5DGXA 5SZIA 5ANRB 2XB2A 2FEMA 3ND8A 2IYVA 4CEJB 1N6NA 4OQMA 1N0UA 3AF3A 2Q0HA 1S4QA 4BEJA 3U61B 1Z2CA 2BCGY 2FJUA 4HLQB 2RGDA 1E4VA 2X8AA 4OL0A 3EPHA 2F1RA 2IX3A 1FMJA 4TQ9A 3BD9A 3QG1A 3TRFA 4MQBA 4DT1B 1SXJD 2BMEA 5TY0A 3QNUA 5DO9A 4Q7MB 1TPZA 1TF2A 3IBYA 4NYMQ 3VR1A 4QJ3A 1R7RA 4ABYA 4IEEA 2CVFA 1XZPA 2NG1A 4QGFA 3TQCA 2NO1A 3MFYA 3DZ8A 2G1JA 2D7DA 4MH0R 4J0QA 1CR4A 4YMUA 3IUYA 2XEXA 4Q4HB 1U8ZA 3ADCA 3TBKA 4AD8A 4PSVA 2WJHA 3AQ4A 4I1OA 4XWAA 2XOKA 1TX4B 2R44A 3KJEA 4OI4A 4LY6A 3GLGE 5EQTA 2QSYA 4HAVA 3ZD7A 1AGRA 1ZD9A 4IXMA 2WTUA 3GEIA 1XMIA 2ZSAA 2FOLA 4W9MC 2C78A 3UPUA 2P6RA 4I1UA 5CITA 1VYVA 5K8TA 1KI6B 1O3YA 1P4SA 1PVOA 2HCJB 3V9PA 4DB4A 1CR2A 3C4JA 3KQLA 1F6BA 4HDQB 1J7KA 2EFEB 5DHAA 3W5IA 2B21A 4D26A 2QU8A 4ZCIA 1M6NA 4FINA 2FFHA 2ZU0C 4PAQA 5KYKA 2X19A 2VP6A 5J47A 3KKOA 2ZREA 3B1XA 1KO5A 1RRGA 5KSOA 2IK8A 1QVAA 1PUIA 1ZNZA 2WPDA 4F4IA 3NC0C 3AP3A 3ZZUA 2WKQA 2YVUA 3LVQE 2OAP1 4KI0A 2ZS8A 5IK2A 4QM7A 1BKDR 3DM9B 2ZTSA 1IN7A 3REFA 3CPJB 1VCOA 3RNLA 3SJCA 3A1SA 4F4CA 1KZGB 1IQPA 2R8RA 4LYFA 3LNCA 3K70D 4BFXA 3PEYA 4DVGA 2WIAA 1RE0A 2OG2A 1I4TD 2JLVA 2JDIA 4YLGA 3GLHE 5J4KA 4TLDA 3RC3A 3ADDA 1JXMA 4QL3A 1GZSA 2FG5A 1GKUB 2GJAA 5G41A 3TAHA 2WHXA 5GJVC 1E99A 1W4RA 1E2LA 1E9AA 2GK7A 2J45A 2F1JA 2OCPA 3OEHD 4TMTA 421PA 2GVZC 4BZXA 1EWQA 3QOFA 4V0NA 3WBJA 3EZ2A 2GZAA 2FGKA 1SZPA 2NQ2C 1Q1ZA 3CKLA 5FTMA 2GBLC 3FHTA 1EFHA 2VP2A 3SU8A 1G3UA 4QOSA 1K6MA 2GK6A 1AS0A 4CZ2A 4P4TA 2ZJZA 1UKVY 1E2JA 5LD2B 2XNDD 4MYHA 4LBVA 4US2R 5AJWA 2ZVQX 2RGBA 5JI3E 3AVUA 4Q66C 1I2MA 1COWA 4BFYA 4BLPA 4UQOA 2AL7A 1SVSA 5FBLB 1QHNA 2I1VB 2QA5A 1XEXB 5F9FA 1XMVA 3AUXA 1XNJA 3MUFA 4TYYA 1W46A 4O2RA 1LF0A 3OF5A 4R2IA 3HU3A 4KV9A 3P4XA 3H0KA 2R6AA 3CH4B 4ZV4A 2X2FA 2J87A 1IHUA 3NH6A 5JJIA 4DLVA 4DSTA 2VHUA 3HR7A 4QG7A 4D6PA 1E2GA 4K46A 1CR0A 2C9YA 2MMCA 5J4VA 2MSEB 4TQUS 1N6IA 2RGNA 4KSBA 3W90A 2ZXUA 1E3MA 3C7KA 2QM7A 2CNWA 3B8HA 5FL3A 2PT5A 3K0SA 4UXJA 1G19A 1QVRA 3GEEA 1GP2A 2OFWA 4JLOA 1DO0A 1Z28A 1D9XA 1H8HA 1D2NA 4TWZA 2ZITA 3AM1A 1OW3B 3CB4A 1NMYA 2RHMA 1HURA 1IM2A 1Q1BA 1XJ0A 3H2YA 4JBWA 2K5UA 4WAUA 5E95A 3MD0A 3SBEA 3WYGA 3RRNA 4KVGA 4NTZA 4TYWA 4C0AC 2QPOA 4O0MA 2FDCA 4AI6A 3H1TA 4QJ5A 5EP1A 1KAGA 4QBGB 4XVUA 4V02A 5HR5A 1TTTA 1XCGB 4NONA 4G5SA 1Z6TA 1WA5A 4X8LA 4X8HA 1NLFA 4MDFA 4IXNA 2ANCA 2XSZA 4TZ0A 1RFLA 2IA5A 1G41A 3AB3A 2VLIA 4A6XA 3EZFA 3Q9LA 3ASYA 1IY1A 2FNAA 3VU9A 2VH5R 1S9DA 1E1RD 4XTRA 5C2JB 2CHGA 3F0TA 1PUJA 4IVPA 3TSOA 1GUAA 1ZUIA 3B13B 2BV3A 3CPHA 3LQRA 1N6RA 1NBME 1DAKA 3QXJA 2OHFA 5E7MA 4AG6A 3K0FA 1E96A 1Q12A 3W3ZB 5FBQB 1LV7A 4A92A 1R0XA 4PPNA 1XEFA 2UZ3A 2CCKA 1NN3A 4DLRA 2FMXA 1MO4A 2BIFA 1T9HA 2QG6A 3LW8A 4JVMA 1Z6AA 5C4GB 2E1RA 3BJIC 4AYXA 4EPRA 2GXAA 4EPVA 2XAUA 3L0SA 2Y8EA 1RRCA 1NBMD 5CDFE 1JAHA 4Q4AA 5A4JA 2AFIE 1GL6A 4D4LA 2RCNA 4RD6A 2A5DA 3DMNA 3JZMA 4Q7LA 3WYFA 4DRZA 2PJRA 2FFQA 2QP4A 4XSHA 3TJZA 1ZRHA 1YZGA 5EXSA 4TMKA 3FOZA 1S9HA 3SI7A 2VP5A 2YINC 4POAA 1ZU4A 2A5JA 3MMPA 5KU1A 2VP0A 4LYHA 3E5HA 4TLAA 3CUEF 4YDHB 1M2OB 3VU9B 3W6NA 2AN9A 4TSFA 3OE7A 4NKRA 1M7GA 5IT5A 2O8EA 2JLYA 2V55B 1W36C 4Q00A 1G8FA 3PJRA 3CNNA 3R7WA 3K0FB 1UJ2A 2YC4C 3I8SA 1NSTA 4HEJA 4F92B 1OB2A 2G77B 2ZR7A 4WIAA 4TYPA 1JQLB 1V43A 3O8RA 2GEVA 1NKTA 3C5CA 1KNXA 3ETLA 4XH9B 1AM4D 4A8JA 1M7BA 3FHOA 1EXMA 1GNPA 2RGGA 1F3OA 1OKKD 4TL9A 3SZRA 2CCGA 4C3ZA 3VR5A 4N3NA 5CK4A 4GP6A 5CLLA 1OSNA 2V7QA 1MO5A 1EX6A 2F9MA 4LBYA 4N1AA 4OHVA 3RSLA 1T3LA 3C14C 4QHSA 4XSGA 2VA8A 3NHBA 4IDQA 3KB1A 3VX4A 4WXRA 2VIIA 3QKSA 4L15A 5IHPA 1IN8A 1BYUA 3U3JA 3I5YA 3OIVA 4G3XA 4UXIA 5F3WB 2IXGA 2BMFA 1E4YA 1OYYA 3T15A 3AVWA 1Z0AA 4A2PA 1KY2A 5JECA 4C7OA 1KI1A 3G5UA 3LRPA 2QRNA 4EJSA 2O8EB 4Z1MD 1N5JA 3VR2A 1Z6YA 1P6XA 2JATA 3NWJA 4KJZA 1G5RA 1FQKA 4GP7A 1D9ZA 1B23P 3R7WB 1YR7A 4B2LA 3CW2A 2ZRHA 3RRYA 1XTKA 4DUGA 1KK3A 1XTIA 4LDJA 3M6AA 3K0CA 3K1JA 3N2EA 2VEDA 4HZIA 4NHOA 3T12A 1Z22A 4TL6A 2DHRA 4P4SA 1X3SA 1GL9B 1Z8FA 4GSYA 4KO8A 1Q20A 2OE2A 3ZIAA 2ZRGA 2R9VA 3EIHA 4XOIA 3U2QA 2J7PA 4ESHA 2IS1A 5JJLA 2REBA 2VSFA 2VPPA 3QBVA 2A5YB 1Z47A 2QE7D 5JI2E 1Y63A 3FFBA 1R4AA 3SYNA 3B9QA 4PQRA 4O2LA 3U6KA 4TMZA 1CIPA 1KMHA 2CLCX 2IHYA 2QAGB 5JRZA 1G8HA 3HYTA 4BLTA 1GTVA 1Q0UA 3DEFA 3Q5EA 5HCNA 3CRRA 2P5SA 1G3MA 3BBPA 5CM8B 2F1IA 2IUTA 4KYIB 3EAQA 1ZAKA 4EJSB 1WRBA 5TARA 1CJVC 4BLOA 1WBDA 1OJLA 5BWMA 4XTCS 4MRVA 4FMBB 4BFVA 3PV0A 2BKEA 5AUOB 2IYLD 1FL9A 4BLQA 3ZZ0A 4OHWA 2YHSA 1J8YF 1TUIA 1AIPA 4LPSA 4HB0A 3LW7A 5DHFA 4RCYA 4RCZA 4DIEA 4LBWA 3IKJA 3RLFA 3ICEA 2XOKD 4FCWA 3U3RA 3IGFA 3LH5A 4P4SB 1SVKA 3QG5A 2E9SA 1US8A 3TH5A 3O8BA 1XP8A 2OBNA 4B74A 1T5LA 1MABA 3AF4A 1GFIA 3OIUA 1KK0A 2ZRFA 3G82C 1IY0A 2ORWA 3PUVA 3WRXC 5CB6A 3ZQJA 1A7JA 2NPIA 3LXRA 5FUYA 2IS6A 1MRSA 3A4NA 2GESA 2NO9A 4XD7A 3VX3A 5HZHA 1KMHB 2XITA 4Q9JA 4DLWA 3QKUA 4R71A 4RSGA 4JLNA 4BFTA 1OV4A 3LBHA 2VRWA 1BO6A 2PEZA 4M8NE 2QROA 4JMPA 4MITA 2VHCA 3AVYA 4FMDB 1LTQA 2HLDA 1AKEA 5JWRA 2RGEA 3TW4A 2RGXA 1XD9A 1XD2A 1A2KC 1W0JA 2R6FA 4TTRA 4ZPXA 2WWGA 4IDOA 1LW7A 3UXMA 4C0BA 2F1HA 1VCMA 5IK2D 1EWRA 2B7BA 5FBRB 4RD1A 6Q21A 2OBLA 2FE4A 2J0UA 2OFOA 5FR1A 5J4YA 3AVTA 3NC1C 2RB4A 4Q03A 1CBUA 4R9UC 4GPTA 1TEVA 5FTKA 1KKLA 2W6JD 1E2KA 2YWFA 3W34A 5EXXA 1G1MA 1AN0A 1ZCAA 2JDID 1P2SA 1VECA 2C99A 1US8B 2ATXA 2E87A 2WVJA 4GBMA 4IHQA 4MKFA 3TLXA 4AYTA 2YOHA 4PC7A 4PAMA 4RD2A 4JYCA 2N1BA 2NMVA 2A5GA 1M1YE 2BBWA 5C4MA 1U0LA 1K8RA 1U0HC 2AX4A 3B82A 3MWKA 3B2EA 2GBLA 3BFVA 1LF5A 1QG4A 3AF2A 2O5VA 4D4KA 3FYHA 2H18A 3SE0A 1N6PA 1KJYA 4DSNA 1CULC 5AUNB 1EG7A 3AEZA 4A0GA 4GL2A 2OCBA 3CNOA 5CJPA 1FNMA 1M34E 4MDEA 3REGA 1W49A 1YHNA 2ZYWX 3EZ7A 4Q7KA 3S1AA 2IXEA 3AVOA 3WXMA 1KDPA 1N6OA 4DB2A 4TTPA 521PA 2CJWA 4B3BA 4B2IA 1NG9A 1COWD 2KJQA 4DLXA 1AQUA 4B73A 3V4RA 4KU4A 2ZJ8A 4JVLA 4IW3B 4FWIB 4BWYA 2AK2A 4H1UA 4NCJA 2WAYA 3TNFA 4NBSA 1CRPA 1DG3A 3Q5DA 2Q3MA 1XCPA 4LC0A 4YQFA 1IN4A 3L82B 1Z0IA 3DOEA 1BOFA 3BWDD 4D4MA 4FMDF 1TL7C 4Q1DA 3W6PA 3KJGA 3KKNA 3VKWA 1NNEA 2FFBA 1UPTA 4B75A 3CPEA 4HAZA 1UKZA 2ZROA 4EFNA 3MLEA 1E2EA 3GJ0A 1U99A 1ANKA 1G7CA 1E9RA 2VF7A 2FH5B 2X2EA 4CYMA 3AGQA 2VL7A 3FMPB 4TLBA 5JSZA 1UBCA 1KKMA 5LDDC 2O8DB 1RKBA 3S1AB 1SGWA 3MAAC 4Z8YA 4P32A 3ZVNA 4LC1A 2V3CC 4W7SA 2ZJOA 3CWZA 1Z07A 2CJWB 4DWJA 4CW7A 5B64A 2HCBA 4IDPA 4IDHA 4DLUA 3CZQA 3ZS9A 2C8VA 4A36A 5G3YA 1JXOA 3TSZA 3AVQA 4C4PA 1EX7A 2V9PA 4IFBA 2JLRA 1OFIA 4LV6A 1W1WA 2G0NA 2QAJA 1EFUA 4NCIA 2XSZD 3WNCA 3ZYCA 2QZ4A 4BE7B 4LHXA 2BEKA 1G3RA 4HSEA 3TMKA 2KE5A 4HLCA 3IEVA 5TMPA 1Q21A 4DDWA 3I1FA 2PZGA 3T1VA 1RYFA 4XWOA 3I62A 1II9A 1Z08A 5LPNA 1EK0A 3BXZA 4AG5A 3D3QA 2GVDC 4MRSA 3WHKA 5A5GA 1KAOA 2ZRMA 3Q72A 4DLSA 2EWVA 2RKOA 5KHOC 1UKYA 2OXRA 3L8ZA 2OSBA 1R0YA 1ZW6A 1S3GA 3Q8XB 3I8XA 4MUAA 2PX0A 2AFHE 1G64A 2P0EA 1CS4C 5AJYA 5DI3B 3RS3A 4UJ5A 4LJ7A 4L9WA 5EP4A 1VHTA 5G53C 3SEAA 2R2AA 4QC2A 2ZQ5A 2XTNA 1GG2A 4Q9LA 5AK0A 3U3MA 4PXAA 3BB4A 1QHHA 3HPQA 5F9HA 2CXXA 3QKTA 3A37A 1OHHA 4DDTA 1YZQA 4V0MA 3QBTA 2DFTA 1Y3AA 1XZQA 3Q85A 2QPTA 4MYUA 4Q5IA 5AJXA 2Z6VA 1CP2A 2A7QA 3NH9A 4X8MA 1E1QA 2ZUDA 2DR3A 3NBXX 2HDNB 2XZLA 4YONB 4M21A 3U44A 1XWIA 4PTLA 2ZI4A 1VCIA 2PCJA 3OE7D 2W00A 4P31A 4KBFA 3ZVLA 4YMVA 5FTLA 3UMFA 1XBTA 3DM5A 3MJRA 2P6NA 2ZYVX 1FMLA 4M2LA 1WF3A 3QF7A 1AZSC 1J99A 3F5FA 2BCJQ 4GOKA 1EESA 1FX0A 2W6IA 2F3TA 4OJQA 4OQXA 4LX0A 5EE0A 4NYMR 4TYQA 1ZIPA 2QSZA 4DEXA 4ASUA 4XIGS 1UADA 3GEHA 4WBSA 1JPNA 2RHDA 4AKEA 3D8BA 2V7QD 3FMIA 1F60A 5L3RA 1QHHB 1RPZA 1N2CE 2ORVA 5J40A 3CWQA 4JJKA 1GITA 4OI2A 2BWJA 3KXLA 4LYJA 4URZR 4ERNA 2SHKA 4OBEA 3KX2A 3PEUA 4EIWA 1T3HA 2FWRA 4EPWA 3AV0B 2J41A 5HPYB 4GZMA 3KJIA 1GM5A 1VG1A 5EUMA 1Z6XA 2GETA 2ZYUX 4TT3A 4N0DA 3AP1A 4I1SA 1FP6A 2YZ2A 4NYIR 4MYCA 1OXUA 3TR0A 3ZQ6A 1SXJC 2BKUA 4JBYA 1RIFA 3N70A 1CU1A 3U44B 5DE3A 1ZINA 4RD0A 1G9XA 1W36B 1VDZA 2B6HA 4KHZA 4OHYA 2IBMA 2JLQA 4IKEA 4PHFA 2GF0A 2J9RA 1D5CA 2BHRA 2FFAA 3ONWA 4Q01A 5EE1A 3WY9A 5DISB 2QBYB 2JEOA 4LBZA 1GNQA 2AK3A 3EWSA 3CF6R 2W58A 4DUGD 2QTHA 2KI5A 2ZEJA 4NYJQ 2BC9A 2ZRBA 3PCRB 5C1BA 1U94A 1TQDA 2LKCA 1DAIA 2PZEA 3K9NA 1LS1A 5BN4A 1KMQA 5KSZA 1MRNA 2QL6A 3ZIAD 1XPOA 1W48A 3FDIA 4D2IA 1E9SA 2GNOA 2DY1A 1ODFA 1KSJA 1GDDA 4LJAA 2IUUA 1E32A 1W2HA 2H8KA 1NRJB 4KAXA 4NYIQ 1OF1A 3DKVA 4ARZA 4EPXA 1DBSA 1AK2A 4GNKA 1Q1QA 1IBRA 4OHXA 1KOFA 3THXB 1E69A 4HAYA 4OK6A 2J1LA 1E0KA 5BN5A 4LJ5A 3X1ZA 1ZYUA 5FL7A 3K09C 1A82A 2VTKA 1ETUA 4A6PA 1DAFA 1KSHA 3GJ8A 5FTNA 4AKIA 1W44A 2ODNA 5EE9A 3SOPA 3GMTA 2GEUA 1P2TA 2HUPA 2EW1A 3IQXA 4YXWA 4A0HA 3QKRA 3IQWA 5FI0B 1J70A 1XMSA 3OAAA 1E2DA 3T5GA 3B5JA 2JIZD 1NY6A 3WMEA 3TKLA 1KDRA 3HPRA 1XB2A 3IHWA 4TLCA 3JVUA 3HWSA 2HT1A 3THYA 2HJVA 3FVQA 1FPMA 2A30A 2WICA 2QGZA 1GRRA 3IILA 3UANA 1OPXA 2NO6A 5SZJA 4Q9KA 3J81k 1I4DD 1KK1A 2WJGA 3NG1A 3TE6A 1E2IA 1J8MF 4N0EA 2AR7A 5J4LA 5HE9A 1N5KA 1G3IA 2AHOA 1R5BA 3OESA 3AF0A 4NMMA 4OQNA 2HEIA 3HU1A 4RFVA 4WZ6A 1XTSA 3PENA 4ARZB 2FF7A 2GJKA 3QI2A 2Q6TA 1GOTA 4PQYA 4XD7D 2NZ8A 1PLKA 2VHJA 3RC8A 3QEOA 2RH5A 1YQTA 4KFTA 1BS1A 5D3QA 2J59A 3PITA 5DSZA 3H4MA 2HLDD 4Q9IA 2WWHA 1KSGA 4G01B 5FI1B 4OI0A 4NCHA 3KFXA 1T5IA 2PX3A 3QKRB 4JIMA 2ZRAA 3CX7A 3HJNA 2C04A 1OB5A 1IAQA 4EDHA 1KDTA 2ZAOA 4P4UA 5K8UA 1AZTA 3CLVA 4QXAA 5K8LA 1CEEA 2YYZA 4MKIA 2BVNA 3M0EA 2ZSFA 1UBGA 3TVTA 2ERXA 1OFHA 2NPFA 1GWNA 1XTQA 2JJ1A 1G8YA 1T6NA 2H7VA 4HDOB 5B58C 4A9AA 5CYOA 3NEYA 5TVKA 2CLDX 4NCNA 3CRVA 1E2MA 3U60B 3I5XA 4M9XA 3F3YA 3MGCA 3C16C 2PBRA 3EARA 3KXKA 4HAXA 3WBKA 4W5WA 3MJHA 1XEWY 1CRQA 2ZR9A 1YKSA 3OEEA 3T61A 1K5GA 2XX3A 4IEIA 4Q1BA 3GP8A 1OIVA 2JLUA 3WNDA 1H8ED 3DOFA 1S96A 1WMSA 2IYZA 1E9EA 1XMJA 1NN1A 3KZ1E 1J2JA 4RJLA 1L4UA 1N6LA 2FSHA 1S2MA 2OESA 3E1SA 2ZE5A 3L2OB 4MYTA 2GZDA 4D81A 2WWWA 4F4JA 4WVFA 4Q1AA 4CGZA 2WJIA 1KDOA 2ZUBA 2NGRA 3VR4A 1R0WA 1U90A 3B78A 3C15C 4M0LA 4UNRA 1E2QA 3Q7QA 4WXPA 1GSIA 2W2XA 4M9QA 3KKQA 5F98A 3L8YA 2V1UA 1A5TA 2FPMA 4JLMA 1ESNA 4JL5A 4MKGA 1BIFA 2P3SA 3OIWA 1P73A 4M1YA 1P9WA 3UMSA 1ZMXA 3WMGA 1E6CA 2V54A 3WHLA 4DZZA 5BQ5A 4KSCA 4PPFA 3DKPA 3IO5A 4JLDA 621PA 2OUKA 4LPKA 3QSYA 2GJ9A 4GZLA 1JQJC 4JT4A 2OO7A 4JLAA 2QPAA 3AKYA 4AC9A 4BPBA 4CRWB 4OHZA 3WMFA 3ZJYA 3PVSA 2GCNA 2OLKA 2QY9A 5J4HA 3BFXA 2N42A 1UEIA 5JEEA 2O0HA 2Z83A 1ZM2A 3A6PC 1NF3A 3KQKA 3RRZA 3TR5A 4BFUA 1DAGA 1ONBA 3K9HA 4RD4A 4DCSA 5CB8A 2FX3A 2WZQA 3I32A 4HAUA 4B33A 4M1SA 2EQBA 3QUSA 4OQLA 1DO2A 2XZOA 3OFNA 2REOA 4MUBA 1JEEA 3R8CA 1CJUC 1DOAA 1EFCA 2ZSEA 3BOSA 1SULA 2QMUA 2IF0A 4UNPA 1NN5A 1NVWQ 3EIEA 4JVSB 4Q1EA 5FPSA 3WYAA 3A36A 4KVAA 1JECA 4FD2A 2WSSA 3EW9A 3AP2A 4LK2A 4QHYA 1KI8A 4CVNA 2D2FA 2QRZA 4HYYA 4EFMA 3NDPA 4NCKA 3U7GA 3CM0A 2ZJBA 3BAFA 4ZDIA 3EPJA 1ZNYA 1Z0DA 4NDZA 1X8JA 1DAHA 2C5LA 3TVDA 2YOGA 5HKKA 4GOXA 4LGMA 3JVVA 3U7FB 4CDGA 3KDSE 3K53A 3UWKA 3NXSA 1E9DA 4DLZA 1P9NA 2GA8A 1SKYB 4JLJA 4V0ME 5GVRA 2ZRDA 1C4OA 3DL0A 1PLJA 2EFGA 1S3SA 2GCOA 1E2NA 1ESMA 2AXNA 3KQNA 1G7SA 3IIKA 2WOOA 1IY2A 3U7HB 3EC1A 2ZAMA 3V4FA 4W5JA 1CR1A 1OE0A 2QI9C 4C2TA 5FPTA 3CRMA 2VQSA 1E79D 1FZQA 5L3VA 1VMAA 1NN0A 3BORA 2IEYA 4BFWA 3E70C 4DSOA 1LVGA 1M74A 1OHHD 1ZNXA 3ND9A 3GD7A 3FTQA 3PQCA 5JCPA 3EXAA 4Q19A 4HUTA 4ACAA 1OXTA 3PUXA 4Q4AB 4RKFA 2FGJA 2Q21A 1FOEB 4KITB 2GEDA 3LQQA 4CT5A 2VHQA 1ZM4A 3MG9A 4Z51A 821PA 1YJ5A 3CO5A 1JB1A 2ODWA 5AUPB 2C77A 3A1VA 4MGKR 4JL6A 1W36D 4Q7JB 4R7ZA 3W8RA 2J0SA 1HV8A 3TUJC 4URWR 2ZI5A 5EXTA 2F55A 2ZI3A 1K5DA 2ZU6A 1KJZA 3QVUA 5KSYA 4RZXA 2AD5A 1XU4A 3BC1A 4PX9A 3CZPA 1VYUA 1XEWX 5FR2A 3VNVA 5FFMA 2GCOB 5BXQC 5FH9A 2IT1A 3FHCB 5B30A 3T1OA 1DAMA 2H92A 3JZAA 3CNLA 2G88A 3GJ6A 1S1MA 4OK3A 5DN6A 4F93B 1W4CA 1I2DA 2NZJA 4U5XA 3SQWA 4TL7A 1WBBA 4Q9HA 2PL3A 1Z83A 2O8BA 2IYWA 1EGAA 5AR1A 4PZYA 4A8JB 4AYWA 3BS4A 2ASEA 2OXCA 4C0HA 4ZCMA 4CEHA 1SVOA 4B71A 1L4YA 1P75A 4CEIA 1NVXQ 4DBLC 1ZU5A 1Z6GA 2P5TB 1SXJA 5KPJA 3SJZA 1P3JA 2RGCA 4LJ4A 1DARA 4OJKA 3VNUA 4NH0A 3KUDA 5FUVA 3QKSB 1BMFA 1HY3A 3BH0A 4W5HA 2O0KA 3BB3A 2UZIR 5JFGA 3BH7A 3DMDA 1IJEA 1T3SA 3EA5A 3DO6A 4C7OB 1D2MA 1FTSA 1TU4A 2XZPA 3SJAA 4TMWA 1NMXA 1Z0FA 2JLSA 2P2LA 3LLUA 4CT4B 1JEDA 1UDWA 1VIYA 3KB2A 4TLEA 5AUQA 4DIDA 1F2UA 3BB1A 3DPUA 5AJVB 4B6EA 4U02A 4M1MA 4GT1A 1OXSC 2JASA 4JKIA 1OT3A 5FUXA 4X8OA 5IDVA 2WIBA 3U6BA 1V5WA 4QGHA 4V0KA 3PEWA 2G0TA 5E3HA 2WWIA 4IDNA 5HZKA 4GDFA 5GADl 3TQFA 3T5DA 2C03A 1Z5ZA 1KO4A 4WZBE 5DI9A 3K09A 4Z54A 4WW0A 1LNZA 1S8FA 5G3ZA 4PO8A 1SXJB 3CR8A 3MSXA 5FL7D 2MSDB 4ILEA 3C5HA 4F91B 4IRUB 5JS7A 2A9KA 1P2VA 2GF9A 3LA6A 2W0SA 1YR9A 2ORIA 2WV9A 3KJHA 1AS3A 2ZUCA 4L5BA 3EASA 2JJ2A 4G5RA 4KFUA 3W5JA 3H86A 4FMCF 3OAAD 1NLYA 4PR0A 5BW8A 1AQYA 3VQTA 2G1KA 2QTVB 1GAJA 1P62B 2FSFA 2WPDD 1IXRC 1OH5A 1KI7A 3SYKA 1C1YA
chains in the Genus database with same CATH superfamily
3MHPA 3SKYA 2WD7B 3W6OA 1T9DA 1VSTA 1VSVA 4NI5A 3UVEA 1HI9A 2PUCA 4I50F 3L06A 3ICQB 4B82A 3B6ZA 4UARA 3CUSA 2BGWA 3VTKA 3U62A 1P29A 3AI1A 3FPLA 3ZJTA 2W7TA 5LNK1 1V26A 3D6FA 4ICIA 1T4DA 1H93A 5ILGA 3WGLA 5INTA 2AF3C 4G0UA 3BXEA 4LHZA 1UP6A 2B1IA 1OI3A 1O87A 2C0CA 1XHFA 5CTJA 2JGDB 1Z37A 2EYQA 4H3KB 1YCHA 2XQFA 5GJWC 1GKIA 4PC1A 5BVGA 3OZVA 3LZ6A 2IYYA 2ODEA 2FLVA 4YNBA 4E09A 2QMYA 3GFTA 3QVSA 2XF8A 2XUAA 1VG0B 3FPAA 4WECA 2ICAA 4MCJA 1VFNA 1T8YA 1SVWA 4CKEB 4MVJM 1UPBA 4HZUA 2NTEA 3AKDA 2JEZA 2DC1A 2ZT7A 2QLBA 3NBMA 4V0OA 5BP7A 3HUFA 4FEEA 1QDEA 2WJ6A 4ZT3A 2OG1A 1R8QA 3PXGA 1SC9A 3MPOA 1XMOB 1R6DA 3ONVA 3G2JA 4HMQA 3WRYC 4X6YA 3QXXA 4FCCA 4MW7A 4UOEA 3B12A 4BVAA 1GPYA 3OPYI 4KDRA 4UTNA 1GCIA 3O4VA 1CR6A 5CX1B 1VHQA 4S0ZA 5HGXA 3ZY6A 4REQA 1NPDA 2J31A 1BXRB 1RZ3A 3FYTA 4MR8B 4N5HX 4RQTA 3LK7A 5EHQA 4C7KA 3URKA 1DFIA 4YUXA 2WZDA 3E7FA 3LCUA 1MJ5A 2IL1A 3D7SA 4O59O 1ZK4A 2O8CA 4DVJA 1JLKA 2FW7A 3HHEA 3ISTA 4UE3S 3J7AC 4GICA 2R79A 1VOTA 2V0GA 1VG9B 5AXDA 1VI5A 5T3YA 3DCYA 2JLAA 3MJEA 4H0FA 1TCCA 2Q5HA 4XPIB 4G0PA 5CK5A 1ZGAA 4ERXA 4YJKA 2ZATA 2DHCA 3FLMA 3I72A 4JYBA 1WVMA 1LI7A 1YS4A 4HMPA 1QUFA 3KUUA 2CNWD 4DPLA 3W4KA 4A16A 4ZYTA 2HNKA 3NVAA 3UXHA 1MG5A 1YRQA 2CFRA 3U3OA 2W2TA 4LDPA 3U3DA 3UZUA 3ZX4A 1HYQA 4K9LA 4YMWA 2P9TA 1XAHA 1H8HD 4K9RA 4JSYA 2IYRA 3MOIA 3JYPA 5EJ9A 1LVHA 4AWBA 5C1PA 3GFBA 3VR6H 1JPJA 4V0QA 2I1QA 4P3YA 4R3WA 1P2UA 2BFFB 3P9RA 4RVSA 5SY4A 5K0SA 1G4UR 1OX5A 2ZS7A 1D09A 4JJ6A 2F3RA 1GNRA 5EJFA 3M70A 3RAPR 4HNRA 5KTPA 5J2UA 2BFAA 2YQZA 1KPIA 4FEYA 4G23A 4KDEA 5DM0A 2QQEA 1UQUA 2IEZA 3GRPA 4GZ5A 4IUYA 4JKOA 4M1EA 3U37A 1TQ6A 4DCUA 2Q4BA 4YP5A 4M0DA 4Z9AA 4BMYA 3O21A 4DLBA 2LTAA 4B80A 3FR8A 4W1PA 4EI2A 4PGAA 5LJLA 1QRDA 4KLNA 1BQEA 1VGQA 2VCYA 2H0AA 3W77A 1AK9A 1VSUA 3IHLA 1C4XA 2NWQA 2VT7A 3H2ZA 4TS1A 1T5BA 1F4PA 2MU1A 3MWJA 2UYGA 1K4MA 3LXMA 3AWIA 3MELA 3UCEA 5TQ2A 1J0DA 4XQ0A 1ONOA 5A0TA 3M6MD 4BNUA 4R05A 3DBRA 3TQQA 1UF9A 3AJDA 4Q9NA 3EULA 3DHWC 4EB6A 3H8JA 4MMYB 1OT5A 3EJ6A 5KOHB 4WEQA 2PJZA 3W79A 3DFIA 5EE5B 1E18A 2D74A 4WZAB 4BV8A 2PVCA 4A15A 3S8YA 1J8DA 1GSOA 4B6RA 5M04A 3V3TA 5BSMA 3RARA 3G49A 3VO8A 3HV0A 4EMTA 2HCFA 1W581 5JC8A 3HM2A 2AUTA 3P0FA 5GQSA 4AO6A 4TL8A 1FU8A 3ANLA 4GZ3A 4HWOA 1VE1A 2IEIA 3COSA 5K8JB 1JR6A 2IW3A 5IVPA 1E60A 1ZIYA 1RAHA 1U9YA 1V8PA 1YR2A 2I67A 3HR8A 3I9V6 2ISCA 4L22A 4RW0A 4PQFA 5EKUA 5H0IA 5B57C 1M54A 2QM8A 3UMGA 1F12A 3AR9A 1TNDA 4KR9A 4G89A 3JD4A 4EENA 3JV7A 2VSOA 3L05A 4M89A 3PLRA 5IJXA 4CQLB 3MFQA 4EG3A 1WP9A 2CNOA 1V9SA 5E9QA 3ZJUA 2MYNA 3KV3O 2X14A 4H4CA 4ZEOA 3CF4A 4O2AA 1MF7A 2WJ3A 4U7HA 3QFSA 5IRCD 5HVNA 1X1BA 1YDEA 1A71A 4Q3BA 4AVYA 4IZIA 3DT8A 3TF5A 4TSFD 4L0QA 2YVKA 2FWNA 4Z4EA 3AXSA 4ITUA 4UW9A 5EP2A 2BSAA 3WNBA 2X0FA 4MNTA 1MR3F 4PBRA 2O3RA 2I4RA 1Y6RA 4E2FA 3EFHA 2M32A 3WTBA 2QORA 3S2YA 4HDCA 4IM7A 4C0WA 1J8FA 5CAEA 1KOJA 1JR2A 1FE8A 3O95A 4QWMA 5TV2A 1Z5UA 3R9XB 5E8JA 2ZJYA 3HJCA 2QP3A 4NJMA 2QRVB 4W7HA 1SG0A 4JU9A 4NAHA 2OGTA 4ZQIA 4P3XA 1JJVA 2YFYA 3H8WA 3QV2A 5K0ZA 4NYJR 4BYGA 3G7UA 1HDZA 5EPEA 1LSJA 1NIPA 1MV5A 1ATZA 1E0DA 1Q14A 2CHEA 4U2BA 2G9QA 5KTMA 4DT1A 5JCXA 1GILA 3BMNB 1A2QA 3TFQA 1KIMA 1MXHA 2Y0BA 3D2AA 4K1XA 1V1MB 1J8QA 3PRJA 1R1DA 3CIFA 3CMMA 5A9RA 1MTOA 5E9JA 5U1PA 1TOAA 2VG8A 3U17A 3EG5A 4EHNA 1O77A 3P1JA 1NVDA 2GN1A 4LZPA 5EN4A 5EUCA 3A27A 3PJFA 1EDDA 2ZI6A 5ARCA 3V8EA 4ZI3A 5JROA 4NMXB 1ZR4A 1U80A 3W5AA 1T2CA 4LJ6A 4KXVA 4BQIA 3V1NA 3VU8A 6ADHA 3UQYS 1H1TA 1TEXA 2R6CA 2ZETA 2CFTA 2NYUA 3HXQA 3DXXA 1B6GA 3IIJA 2YIJA 4FYYA 1X8LA 1F0NA 1JA1A 2J7KA 2JLCA 3VUEA 4NDAA 2WHPA 4XQCA 4JUFA 3CVUA 4Z4QA 2HH9A 2J5XA 1A88A 2DR0A 2C7GA 3MM4A 3PHBE 4EG1A 1LDGA 4KE8A 1Y6QA 2O2IA 3T1HB 4UAJA 3BGOS 3GLVA 1AMUA 1HLGA 3RS8A 5FFNA 1SKMA 3WLFA 5J2UF 3BULA 4DC9A 1FX0B 3FMGA 4DKXA 3GZJA 2AG0A 2RDMA 1UMDA 3N0VA 1IN6A 1AMOA 1Z4NA 2PGDA 3LKDA 3A05A 3OT1B 2FN4A 2EJCA 4GR5A 1SQ5A 2C4NA 2HSGA 5EY5B 4RZQA 3QFFA 3Q6NA 5EJ6A 5JFTA 1HH4A 4Y2QA 3P2KA 3OA0A 3KPVA 4F85A 3WV4A 1XOIA 4N40A 2HRDA 3K0BA 2ZRLA 4BV9A 2IRWA 2X42A 1Z4IA 1Z17A 3DL4A 3PR1A 4MWSA 3P9NA 4Y9TA 4M0KA 4QX6A 2G67A 1ZC4A 3AKEA 5FJJA 1JF8A 1ZN7A 4KLZA 4KTTE 4RIHA 3QMWA 2WF8A 5IN5A 3JVEA 1WABA 4IVRA 5LQRA 1N7IA 2PANA 2RAPA 2WUWE 3KJXA 4D3ZA 1QQ6A 3K9WA 1I36A 4PYLA 5KDOA 3QPBA 5FOTA 4P0TA 4WFKA 3GT3A 3ZU4A 3HLYA 2BHSA 2RHWA 4I4LA 2VT2A 1N2EA 2FWIA 3EAGA 3TQIA 5FP0A 1YH3A 1ES9A 1H0HA 5LSAA 3V2HA 3QENA 3LQ1A 1TJNA 2XXAB 1Z8NA 4L85A 1DJOA 3HCDA 4LJKA 1X1DA 4UNNA 2VYFA 4PONA 1P1JA 2GNAA 3U1VA 3PHCA 4EPTA 2C94A 2O8NA 3BN3A 5TVGA 2Q5JA 4UUBA 2AE2A 4LCJA 3K70C 1G5TA 2A0XA 4TQAA 2AOXA 3E2MA 1XAIA 4FWBA 1EDEA 5F7JA 3AFIA 1NUQA 1NYRA 3IMGA 4HX5A 3BMXA 1K8QA 2OKCA 3QVTA 4K3UA 3GJ4A 4O4JA 5DYYA 5H70A 3TNYA 2B1QA 2NTNA 1UC5B 4OHFA 3RAEC 1Z4LA 2Y1KA 2Z04A 4O2AF 1H3NA 2C9DA 2IYTA 5EZYF 1PL7A 3UW3A 2IEGA 2P27A 1TF7A 1YZFA 5CM9C 2JGFA 2O05A 3CT6A 1K68A 2HWWA 4MIYA 4AIRA 1YDWA 2DQKA 2JIQA 2W6PA 1CUHA 3DZCA 3VGPA 2J32A 3OZEA 1SBYA 4M0MA 3BIJA 3W2EA 3OM8A 1GGVA 3FRHA 2DETA 4LV5B 1FRFS 2VP3A 3LX6A 4HB4A 1FVXA 5EP3A 1GV1A 2VKQA 2Y99A 3SQNA 5TPZA 3TLKA 5COAA 5CCDA 3DDZX 1ZJ6A 2Y2UA 1BYIA 2XDYA 4G1MB 1OXXK 1TAGA 2EJBA 2ONYA 2V7WA 2VYCA 4D02A 1AU9A 4A0RA 2NZWA 4X3PA 2GLUA 3UG6A 4C4YA 3W6ZA 3A2LA 1O1YA 3TQTA 5FULA 1FIUA 1NIJA 4LWOA 3VZSA 3T41A 1CY4A 1XPUA 1FFXA 2EBUA 3TTSA 4EG8A 2ADFA 3THYB 4NU6A 2KWIA 1XK6A 1DU4A 5I9IA 1M6YA 2EGHA 2MSWA 3QWHA 4KVZA 3UJ9A 1TM2A 2WHEA 3RC9A 5K3BA 1R9NA 2C2ZA 2C5FA 5DGHA 4ALLA 2RHTA 2DPXA 1NSYA 2PG3A 3JQDA 3MCUA 2HIHA 3RF6A 1IG0A 2PZFA 4OATA 1HE1C 3DB2A 3K5PA 3O5AA 3PS9A 3BA1A 2UVQA 4UXHA 1FSZA 4IR7A 4DRXA 2JLXA 1PD0A 3SYMA 5AO9A 1GA1A 1Y5RA 2FPSA 3TRIA 5LQAA 4XWKA 4M98A 3R9KA 4DCOA 1DG1G 2OAQ1 2Q62A 3P9IA 1EJ2A 1AUOA 2X4DA 1X0XA 1H0RA 3KEOA 5FO1A 3M4YA 3QYPA 4IOMA 1JXQA 1C8LA 1NY5A 1WLSA 1V3UA 2B8EA 3I3OA 4NL4H 3VSDA 1R66A 2ZR0A 4JLVA 4WY2A 3WRYA 2OV2A 3Q9SA 4ZI7F 4PSDA 2MHCA 4WKGA 3BERA 5EZ6B 3RFUA 3QVOA 1O4WA 1EFDN 1SUAA 4X65B 2IIBA 4U8GA 4RXTA 3QX3A 1G42A 1XTUA 2BGKA 2DBZA 2IEAA 2UYCA 1SNYA 5CVUA 3EC7A 1EIWA 2FZCA 3K30A 1QTIA 5TB5A 5EJAA 3JTEA 2ZW9A 1S3IA 1PJQA 3P9XA 3CR7A 4CMIA 4TWIA 3R9WA 3QY0A 3KXIA 2BRUC 2ZE6A 3IUPA 2EC5A 2CXTA 3P27A 2H2AA 1G4HA 2WSYB 4MRRA 1L5WA 2XMCA 4X45A 1MNAA 4QBHA 5IABA 3D3WA 3M9LA 4MV6A 2FSGA 1IVNA 3UPDA 4Z7OB 5AW8A 5AW6A 2FU5C 4WZAE 1L8QA 4TZ6A 3BDAA 3SJBA 4J6EA 2PLAA 1ARZA 3K6JA 3N8NA 3WB1A 3A4TA 5HWSA 3NDBB 4XX1A 1ISPA 5TXGA 5HBRA 4RELA 2X15A 3H2GA 3AFMA 4KMSA 3LXXA 1F8FA 4Z3KA 4L6IA 1HE4A 2FPKA 4Q02A 1YRBA 4ZHQA 4CF7A 2IE8A 1XZ8A 1CB0A 1JMVA 1TXGA 2ZAGA 3ZK8A 2PCLA 4EVIA 1F5NA 5J5CA 1IVYA 3MAJA 3OTHA 4FOLA 2NIPA 2JIMA 8OHMA 4Q4LA 5COBA 1HTWA 1WB9A 1NVUQ 4MV8A 5F4BA 1HLPA 1VXOA 5D1NA 5C7IO 1ESDA 2CVHA 1TCUA 2G9UA 3C5WP 4YN3A 4AUKA 2QX4A 4YDSA 4BFZA 5LA6F 3ZWXA 3ICCA 1RYHA 1FFGA 2FY8A 2CUNA 2JF0A 2PTGA 3HDVA 4REOA 2Z43A 1EJ0A 3D5QA 4E5KA 1RZUA 2PM8A 3BHMA 3YASA 2FKAA 5EXDA 1OLXA 4F9GA 3TLJA 2DT8A 2K87A 1CZNA 1X1CA 1U2PA 4DQLA 2FP3A 1W5SA 5JG7A 3CVYA 4J0HA 3ZDYB 5EYPB 3K9BA 2GAAA 1KQFA 1Q7BA 3D6AA 1IK4A 4LV8B 1FFCA 4D9NA 5BNTA 3B1ZA 1IPEA 1JHOA 3R75A 3UPTA 2O5RA 2RONA 1LC3A 2PFSA 4EKNB 1BQ4A 2M6KA 1R2QA 3FFAA 4BB9A 3VUFA 3PFKA 3MD9A 2FEWB 2ZRIA 1M3SA 4JNCA 4WNYA 3Q0IA 2OD7A 5HZGA 1QFSA 5D00A 3C3XA 3WYEA 4L5AA 4O02B 1U7OA 2GZRA 2QMZA 1FSGA 4MJ3A 1Q6YA 3ZDZB 1JHZA 2REXB 1ZCBA 1QB7A 4E11A 1VMKA 2I2BA 3I39X 1DKOA 1OUMA 2XUZA 1V3VA 2H4FA 4PRKA 1SO8A 2NT3A 4H9GA 1G2OA 3ZNPA 1H65A 4HVAA 2OCAA 2HRCA 4KYVA 4KP7A 5HMMA 3UNXA 4BLRA 1DP4A 2ZVPX 3DXFA 5JZ9A 1GU7A 3MERA 4Q47A 3DMTC 4YRZA 2HJGA 4BMXA 4XQ9A 4GMXA 1G8AA 4TMXA 4W1QA 1Z29A 1PZEA 3RF7A 4FI3C 4IIYA 2YV5A 1CYDA 5HJ5A 3H5WA 2VHWA 2YRFA 4PX2A 3GXOA 1B8OA 4EKDA 2Y1OA 3G0BA 3P96A 4EW3A 3S81A 5JJKA 2BAGA 1EFRA 1HFKA 4B7XA 1C80A 1ZN9A 2C5SA 3N5CA 5AVUA 1FDWA 4MLZA 3K0AB 4I9GA 2ADOA 5DIZA 1JR3A 3HMQA 4YQYA 3B1YA 3LT5A 4G1UC 3A4YA 4II2A 3G8CA 3WP1B 4RVHA 4GX2A 3WP0A 3TFWA 4PZZA 4AJPA 3L41A 1OBFO 1Q83A 4U6QA 3ZXUB 3D2LA 3A1TA 1OU0A 4JR0A 2G6BA 4XJVA 5ENDA 3UMBA 3VR6A 4DG5A 2O2JA 4A1FA 1RXEA 2GXUA 5C8DA 3UKJA 3C8DA 4PLWA 4IF4A 1MO3A 3MWLA 4AK9A 4RA9B 3FA2A 4YRBA 3QVWA 1Y1LA 4ZVOA 2I6GA 4FOOA 4BCDA 4F45A 3LO5A 4KNVA 2CNLA 1GNLA 1S5PA 3L8HA 2PEYA 5E7QA 1WJGA 4P0QB 4UNIA 1O97C 2QN6A 4ML3A 4C9BA 3B6EA 3TXXA 1HX7A 4IOLA 1UDXA 2EVWX 4TXLA 2SNIE 3RHFA 4K2AA 5GONB 3DAPA 2P9HA 4FOPA 1SIUA 2JAUA 2ZUUA 5JEDA 2PLFA 1KEEA 2W37A 1N3YA 4FOTA 4QUDA 2X8JA 5DBGA 3ZDQA 1PYOA 3FMFA 4HS4A 3EY4A 2Q9CA 1WL8A 5CNJA 5H68A 3V4PB 4J1TC 3I58A 1NQAO 3JAKA 3KQUA 2BGMA 3E3OA 2GCEA 1N2CA 3FYUB 3WZMA 1IHPA 2NO5A 1VE5A 3GWZA 3GXBA 3O7MA 1SEVA 4UEWA 3H99A 3RYIB 2XMGA 4KPUA 4ZHQF 4BEBA 2C2WA 3SZ3A 3WO1A 4I50B 3NHWA 5KYWA 2BEWA 1UFOA 3QVMA 1OXVA 3RNOA 4ZGGA 4MVJG 1JEQB 4C20A 3PE3A 3HM9A 3HKEA 1CKEA 2DWUA 1PR6A 4E6PA 3Q9UA 1G291 1EP9A 5CVEA 4ND8A 1Z3IX 3MJSA 4E07A 4OUDB 1XLVA 4WKOA 3RVPA 4C04A 4DJAA 4KMMA 4B4WA 3X1DA 3W7VA 2BCEA 1F06A 3EOAI 2VXBA 3P19A 1IHYA 3AIIA 3CF2A 4ZHSA 5AVWA 1ZL2A 5LN1A 2XGSA 3THWA 2Z6UA 3EQ7A 1I1HA 1XJ5A 2Z5FA 4OHOA 2P9GA 3U4GA 5ECGC 4C4AA 3NLLA 1B8PA 5A06A 3O75A 5FQNA 3GGCA 4FUTA 4L51A 3KS9A 5J3JA 1NVVR 3NYIA 5JXWA 5SV2A 1XYVA 2NACA 3KCQA 3M3HA 5BSFA 4MPRA 4CEHB 2D5IA 4XZ3A 1Y7PA 2IEBA 3EWNA 1J0XO 4B5LA 4CM3A 5JOQA 3E1KA 3E6AA 4EP1A 3PQ2A 3TG8A 3IQGX 4IWYA 1YQWA 4QRIA 5DP1A 2PGXA 3NRCA 4XI9A 4YBZA 1BEZA 1XMPA 5AKJA 3W5CA 1YGPA 5JNVA 2DM6A 3AL2A 5CA1F 4DGSA 2XQIA 1SBTA 2QRKA 4D9IA 2FZKA 3QTBA 4MYSA 3REQB 2A1TS 4EW2A 5LD2C 1LK7A 4JASB 1G8MA 2IS2A 1GQQA 2Y6VA 3QA3E 4PYKA 3TNLA 4HEHA 4FFSA 5A4FS 1HT1E 1VCHA 1SC4A 4XVQA 2QRPA 3OC6A 2P6PA 2WD9A 5EUBA 2ZJFA 3WGVA 4I5FA 3W4IA 1P9RA 5DNDA 1A4RA 5ICMA 2DFNA 4MUIA 1NQUA 4FBGA 2QD2A 1J07A 5BNFA 3VPXA 5GMOA 4AUEA 5D3MA 2FPXA 2WQ6A 1YL6A 1XDUA 1P0QA 1OVMA 4BGIA 1XCLA 1B7GO 1C9EA 1U2DC 4NBRA 3KTAB 1UAAA 4Y2XA 4RTQA 2DZDA 4WFIA 3F49S 5LQCA 1EBFA 1OXKB 1APBA 2RHCA 1Y3HA 3LT1A 4A27A 3KEFA 1R3DA 3OOEA 1WHTA 5F52A 3AL0C 3FGNA 4Z0HO 4QJ4A 2VRCD 3M81A 1E9CA 1I3CA 4ZQFA 2XKAA 4AQYB 3AB7A 1MENA 3SZLA 1VPEA 3RTGA 1YFZA 4CMCA 2NYRA 4TWBA 1KGSA 1FW8A 5FA6A 3HCBA 4YC7A 3IPRA 3GLGB 4DV3B 4UVGA 4N8EA 2OD2A 5A7GA 4E46A 1FDRA 3GLHA 4GMDA 2UZ1B 5FOUA 4QLOA 2IEDA 4KXXA 2G28A 5F1PA 1T3GA 5A5DA 3DVLA 3FYCA 3KK0A 2E82A 3G2LA 3IOCA 4YRTA 1R10A 2EQAA 1NFQA 2HMWA 1K7EB 2X5XA 3BYZA 1DBPA 4UTVA 1E2BA 2M1XA 1TI7A 4PHHA 1ENZA 3HJTA 4YPVA 4M1KA 4R1NA 2CV0A 3TTVA 2HHCA 1FVFA 4DCPA 1BH6A 2E4UA 2ZIEA 3OQHA 4JN6B 4QNRA 3ZIDA 3V97A 4TMVA 2AOTA 3HYSA 4RVDA 2DG2A 3W7AA 2H7CA 1ZWLA 1J2YA 1W75A 4J0EA 4N47A 3AINA 1YRAA 3EN0A 4QNMA 3L0ZA 4YRLA 1KYZA 1H8EA 5IUNC 5C4IA 2P9BA 3GFGA 5F5XA 3AF1A 3QXHA 2HYDA 2PS1A 2QN7A 2GCPA 3I2HA 1XTTA 3DV0A 1PEAA 3B60A 4RFLA 3F6SA 1Z4OA 1T8WA 3R77A 5JLJA 2RGNC 3DLIA 5U9CA 4LHYA 1MAWA 2X7JA 2HRZA 3EDCA 5KI6A 3PNKA 4Y9UA 4ZODA 5B12A 2YJ6A 4L8WB 3RUFA 3OKFA 4N5LA 5LIPA 2B6NA 1WUTA 1ADCA 1F51E 3AVPA 4L5IA 1JWBB 5I4BA 2VDNB 2G7MC 3O2QB 4A82A 5K6AA 3FR7A 4XGIA 1BDJA 3HKCA 4DY6A 3PD0A 3I4LA 2DWOA 2O2EA 5ALDA 3W05A 2C7PA 1KGDA 3PL5A 5GWXA 1IN5A 3C3BA 4XLZA 3T1TA 2PQ0A 1X77A 2RC6A 1ESCA 3NBQA 4HZUB 1DRKA 2M98A 2I1WA 4YT8A 3AZOA 2XDAA 1H2HA 3AETA 1TUEA 2BRUA 4GBJA 5D2CA 4KK4A 4M6WA 3RANA 5KYXA 4KE6A 4NS4A 3HP1A 3DTVA 2J3KA 2PUJA 3E7PA 4R3NA 5JBQA 1H6BA 2C3OA 1Y8AA 3D0QA 4OK5A 1T8UA 3ZVRA 3H4VA 3FUXA 1V11A 5C3MA 2VI5A 2NV2B 1FQJA 2QL7A 5TX7A 1U5BA 2AGVA 3F98A 1CE8B 2AE1A 3D4NA 3LBFA 3O03A 3SNKA 4UD2A 1NQWA 3L0OA 4OJNA 4DA8A 4IL5A 4GC5A 4LRTB 2A7XA 1A5SB 2ECOA 4RMHA 3T3PB 3UUEA 1I1OA 1LLCA 5IBQA 3AVXA 4KXFB 3QPWA 5KQMA 4ID9A 2YBEA 4C7XA 3BE5A 1HQCA 1GEGA 4OP3A 4QDXA 4F12A 3F7OA 1PEDA 4BX8A 4DOMA 4FT2A 3MGGA 3OZAA 4MK4A 4K3VA 3H6KA 3WLQA 4ENQA 3ILSA 3S0JA 1PV4A 4P7BA 3M6VA 4UDOA 1M67A 2HPHA 3SYTA 3COJA 1Q22A 3AJEA 4KKXB 1I6LA 5BRNA 4B2PA 2I6XA 2PUHA 4JLPA 1WZUA 1KMNA 2FRVA 1A9QA 3R5SA 2Z3VA 4F2WA 1IH8A 4YA6A 3OFND 4QWWA 4YV0A 3WLTA 1GPH1 1ORWA 2XUHA 4GYKA 4X71A 3I5AA 1Z0ZA 2OORC 4P8RA 1W5TA 5JC1A 5HYVA 3UGQA 1P1FA 5DDIP 2DHDA 3KZNA 2ZWMA 3GBSA 5K4HA 2XWBF 3STUA 2DBYA 3MA0A 3DONA 1MAHA 3EWAA 1G2IA 1QH8A 2R6GA 3FCXA 5TMEA 3S29A 1YC2A 4YCLA 1M6VA 4DR5B 5J2UB 2F90A 4KHPB 1OZFA 4B3FX 5BN3B 4I55A 2Y66A 3DR3A 4QASA 5F2EA 2P2YA 1AHIA 1FTYA 2JKYA 2P2NA 4HNTA 1L3IA 2OOKA 3GJ3A 3W5HA 1WB5A 1N7JA 3A9UA 5JH7B 2Z8XA 3GU3A 1HEYA 4R54A 1E79A 1RWBA 3NW9A 5FA5A 3GZNB 3B9BA 4X1IB 3RTBA 2I62A 2HDWA 4DF3A 3MWDA 4WXHA 3WQRA 4HXFB 2X7HA 1JALA 3HU2A 5CB4F 1QLHA 2P2GA 2LKDA 2J4DA 4X7RA 2XE7A 5B4VA 3DMTA 3PNQA 5HKAA 3OP1A 1THTA 2OLJA 2GHIA 1OXMA 1QZUA 3DBRB 3SSAA 3ZJ4A 3GEPA 4MULA 3TIFA 4EB6B 4WBNA 1UK6A 2B8TA 1XZIA 1VG8A 1WE2A 1LB1B 2IQIA 2I4LA 1P4AA 3B1KA 3KR2A 1KBZA 2X77A 3FGPA 4IIVA 3RM3A 5DNWA 1C0EA 4UM9D 1P8JA 5HZMA 3EMKA 2QZZA 2O1EA 1EFRD 3DV9A 1B0PA 2VWHA 1MBZA 3DT9A 3FOAA 4JT2A 3T06B 4ZTUB 2QUZA 5EJIA 4D80A 1Y7LA 1ZOPA 4BMVA 4DWOA 2GM4A 1NF2A 2Q9BA 1BKSB 4LDRA 4GRAA 1VPWA 2PYIA 4N9QA 2BMDA 4YAWA 1JR3D 3Q87B 3JR7A 1BG6A 3UJNA 1ICEA 1PX2A 3IKMB 5D5QA 4BTVA 3ZI4A 4Q6WA 3MPUA 1OU4A 5DNYB 1D2RA 3STXA 2KPOA 3VR6D 1SBZA 3HB4X 4EGFA 1H4QA 3FVRA 3HRIA 1SXGA 5EZYB 5CGZA 1U3FA 2CDNA 3JQAB 2DQ4A 4PNHA 3DMYA 4HS9A 4WBXC 1RBZA 2IPMA 3SHFA 3GFPA 4PGMA 4MHSA 3OJXA 4YCCA 2BUBA 1JFRA 5KYYA 4KEAA 1FW6A 1NI3A 1LLQA 3WGQA 5BRJA 3QE0A 3K9FC 1BKYA 3I01M 4IG4A 5ARDA 2IXDA 5J5AA 2IYQA 4B47A 1KI6A 4ENRA 5A9SA 3G59A 3THXA 2DYKA 3N8HA 4KMOA 1P1RA 4JV5B 1A5BB 1VB5A 3ND8A 2IYVA 3KOMA 1N6NA 2P62A 1N0UA 4KOAA 1ZR2A 1NTOA 5FB3A 2W6NA 5JSUA 1S4QA 4BEJA 2C7VA 3L8GA 3WE7A 1U8UA 1FJXA 4PO3X 1ZRMA 3SF8B 2IX3A 5K51A 5I7SA 3ZW7A 4KYTA 3S5UA 4G81A 4JBGA 4DT1B 1WM1A 4L07A 2EWMA 4RPJA 3VSAA 5JO0A 2GCGA 1RXIA 4Q7MB 2IJGX 3F1LA 3MEQA 4NYMQ 3CEAA 4P3OA 1JW9B 1YHYA 3P9SA 2C0PA 4QGFA 4OD0A 3MFYA 4NARA 4J0QA 4LKRA 3WV5A 1TQ8A 1JSLA 4HN2A 3SSOA 4YMUA 4BO2A 1MD9A 2Y1CA 3TMYA 3GO4A 4RADA 1VIDA 1QRUA 4BNVA 4MTLA 2WKSA 2VHYA 5IT4A 2VZ9A 3G8AA 4I1OA 4PYQA 4QQNA 4XWAA 1FMFA 1YZ3A 2A9VA 1TX4B 1AKQA 4LY6A 4OI4A 4WUTA 5EQTA 4MR7A 3GLGE 1IBKB 3ZD7A 1ZD9A 2I33A 1R37A 3GEIA 4NY1A 4IH9A 4UDNA 1MJHA 3FNBA 1Q50A 3F4KA 3JALA 3S4YA 1XU7A 1I7LA 1VYVA 2CLOB 2AMYA 3ZYZA 1BWRA 2O1XA 4RTSA 1HDCA 1VJDA 3PC4A 4KXNA 4TRNA 4ZI7B 3BSFA 2OLEA 2HCJB 2UYOA 4RUKA 3C4JA 4I55F 3CPSA 2EFEB 1UMDB 4NZZA 4ZZ0A 2CLFB 2PZMA 3HBNA 4QVGA 2QU8A 4RV5A 3DDUA 3ZG6A 4UATA 1VB3A 3RIXA 2VP6A 1EYZA 1J0CA 4ZK2A 5I7RA 1QP0A 2ZREA 3B1XA 4X41A 2HF2A 2V6MA 1RRGA 1JU3A 3EYWA 4CPDA 4WZBA 5ALYA 2IYAA 2ACWA 1ZNZA 2PXCA 1ECPA 5JAZA 3RIMA 2WZBA 1SKUA 1SQFA 2EEPA 5CFZA 1YFKA 2REQA 2XVMA 3ZZUA 2PKEA 2Z95A 4QUBA 2AOWA 2JVKA 2FYTA 4RY8A 2ZS8A 4YI3A 2PJUA 2ZTSA 3REFA 4LW8A 4WBNF 3CPJB 3RNLA 1XDDA 3OLXA 4CM5A 5B53A 1KZGB 4LRYA 4YASA 5L4NA 4EL0A 3K70D 1PK7A 2ZBUA 1U2DA 2YTZA 1RE0A 3HLTA 4RNCA 1I4TD 3NM4A 1Z38A 4OB8A 1CZRA 2JLVA 3AIOA 2V03A 1E3LA 4RPKA 4PE5B 4PX5A 3RC3A 3K94A 1G60A 1GKUB 4X7BA 5TS3A 2RH4A 3TAHA 2WHXA 4RHTA 4F84A 5EHXA 3VJKA 4ZANA 1QG6A 1NNSA 1SUEA 2JHCA 1RYNA 1X1EA 2XNJA 1M2WA 4DZRA 3DHEA 4OXNA 3MS2A 3NTRA 5LA6B 5F5LA 4CLOA 4W5QA 3EVTA 1F6WA 4PIMA 1K75A 4PQEA 3ZWVA 1CYEA 1SZPA 3HVJA 4LZWA 2D2IA 5ETJA 3LRXA 3A28A 4KUHA 1HT3A 4XYBA 5FTMA 3SU8A 2VTVA 4WOJA 1K6MA 2QX9A 3CUKA 2GHRA 4X95A 2XKJE 1DXHA 1BQ3A 1PZHA 4B85A 4P4TA 1L0BA 2BTQA 1UKVY 5EIBC 4RM3A 1PGOA 3RRFA 1EMDA 4JI5B 1U7XA 1IN1A 4MUHA 5JAQA 4MYHA 4US2R 3EVAA 1C3EA 3CXRA 2C9ZA 5CU7A 3PGKA 1CUZA 2H0RA 1NQTA 2WAAA 5AOCA 5GGXA 4Q66C 5T3UA 3EZGA 4DLKA 2D1QA 5JJ5A 5DBEX 1IQ0A 1FDIA 2JD0A 4KWIA 2AL7A 5FBLB 1JHAA 3L3BA 1MW9X 4UFOA 1Z7EA 4HGYA 4JOBA 5DRTA 3O6VA 4HGPA 1SKBA 2E5LB 2Q4RA 4FLEA 3OPVA 1K8ZB 4NCAA 2Q07A 1LF0A 3AOGA 5B37A 2OVFA 1M34A 3QVKA 2YN0A 2W5UA 4JOSA 4V38A 3CH4B 3STHA 3BTVA 2X2FA 3DE5X 3ITEA 4EFKA 4H7EA 2CF6A 4QYIB 1VM6A 2FUEA 3D3EA 5B1EA 3DVQX 2OOSA 4DSTA 2BEUA 2VHUA 1I7QB 3WIBA 3B3JA 5LOVB 4IEFB 4X66B 3TQCA 4E0BA 1Z5NA 3W90A 1RLTA 2RGNA 3ZVKA 2YJZA 1TGYA 4FIZA 2ZXUA 1E3MA 4DLPA 2H1FA 5EWJA 1UH5A 3PVZA 1MJGM 5FL3A 1TYBE 4E12A 4BATA 2ZDQA 1XL1A 4FBMA 4Y2RA 3QA9A 1G19A 4L4SA 4LEIA 4ZZ2A 4D0SA 1STOA 2ZDHA 5C8VA 1GP2A 4FM9A 4XWTA 4K0KB 4QG3A 2JARA 3I53A 1OGJA 1CQWA 3AESA 3ZGLA 2C5EA 2ZITA 3CZCA 4A0SA 1TA9A 4BPRA 2WINI 4UQLA 1YL5A 1NMYA 3OY2A 4PXSA 4JBWA 5E95A 2A9QA 4OEHA 4D9HA 4P3NA 3WYGA 4LMPA 4HQNA 3TSYA 1CY7A 2P3QA 5JU6A 2OQRA 4C0AC 4TYWA 3R6TA 1HBJA 4O0MA 2BN4A 1P0PA 4O4HF 4XUCA 3OZIA 4XDHA 3FF1A 4QBGB 3TGLA 1L4EA 1XYYA 1PDWA 2E2WA 3QI7A 4G5SA 1UJ6A 3OT4A 1RC1A 1U9CA 3AI3A 2DFDA 4NONA 3D8UA 5FADA 2VOEA 4AM8A 1GA4A 2GPAA 3N7TA 4MDFA 4TZ0A 2WNHA 3KKZA 5SY6A 2VLIA 3ZV7A 7REQA 5BR7A 4RM2A 4CMIB 1JE1A 1YOVB 2CHGA 2WYVA 3F0TA 3CE6A 3QOYA 3DOJA 3Q3VA 1GUAA 1ZUIA 1FYWA 4RXUA 3B13B 2YRWA 3CPHA 1N6RA 1P7PA 2QD1A 3Q88A 3HR4A 3QXJA 5E7MA 1XKQA 3OZDA 4AG6A 4C6HA 3RSGA 2XCRB 1BSVA 2I8AA 4CTOA 2OP0A 3MOSA 4DQVA 4RGVA 2LNDA 4HFMA 1LV7A 1I9GA 1UBLS 3W3ZB 1WVIA 4PPNA 2IZ1A 4A92A 2MYUA 1X7XA 4RGBA 3WYDA 2TECE 3KR1A 2ZCVA 4DLRA 2XGGA 3UAXA 3LW8A 2QG6A 1L5OA 1CS0A 5HEKA 1Z6AA 5C4GB 4EPRA 1JAZA 3HDHA 1DGQA 1JIXA 4CMBA 4ZHQB 1WW3A 4IIBA 2JH8A 4ZQBA 2XAUA 1F7VA 4JENA 3ABQB 2OHVA 2V4MA 3VZBA 3DLTA 3K32A 4PTZA 2CVOA 4HNGA 4D4LA 2HJ9A 5LP6B 2RCNA 1W5AA 2JI7A 3DMNA 1MZVA 4JUCA 5GV8A 3WYFA 2PJRA 4D9KA 4ZMRA 3STYA 3T9FA 5TIIA 3TJZA 1R9JA 4LRQA 4ENWA 4RTKA 1CUJA 1KZ9A 3DJFA 4ZMBA 4TMKA 5ALOA 1MEJA 3FOZA 4R4JA 4ODIA 4FR0A 2XYGA 1HYBA 2R8BA 3NOXA 4ZTZB 3MMPA 3C48A 5KU1A 2FPWA 3E5HA 1P6QA 2GD2A 2R7KA 1M2OB 3VU9B 1XO1A 1LU9A 1VSQA 1YNOA 3OE7A 4QQ8A 4YGXB 5LB2A 3LUGA 3QEMB 2FVXA 1IAVA 1TUGA 4IJ6A 4LF9B 4EYOA 3W5DA 3DDNA 1YTUA 3PC8C 3RREA 3WB0A 2VTEA 3PQ3A 1G8FA 3TL6A 3K0FB 1UJ2A 5C51B 2YC4C 2GASA 1L6IA 3JTMA 2O3UA 4IZOA 4XUEA 2GGSA 3MINB 2WWVD 1MZPA 4WIAA 4TYPA 1BCRA 1JQLB 3VR3D 2EKLA 3OTOB 3C5CA 1NRIA 3Q3HA 2FP4B 1AM4D 4UZSA 4B3SB 3FFXA 3SZRA 1JA0A 1XU9A 3FWNA 2F9FA 4UBLA 3HJBA 3L77A 5C7YA 4YJGA 3EXFA 5MF6A 3N8IA 5CLLA 5K3EA 1Y1QA