1GAJA

Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
b'MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIGH-AFFINITY BRANCHED CHAIN AMINO ACID TRANSPORT ATP-BINDIN
molecule tags Transport protein
source organism Methanocaldococcus jannaschii
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
total genus 81
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gajA00
3U4QA 2AN9A 3RANA 2PJRA 2FEMA 2X2FA 5DHFA 2GJSA 2OM2A 4ZKEA 4EPTA 1EWQA 1QHHA 2QAGA 2A5DA 2VP2A 4DXAA 1R0ZA 1J7KA 4BFXA 2PCLA 4AWXA 3W8NA 4HLQB 5EE3A 2H17A 4CEJB 5JWOA 3EAQA 1HV8A 4KITB 4JKIA 3KKNA 5F9FA 3GCGA 5EXSA 3VKWA 1B23P 1RYHA 4PQYA 1T3HA 1VDZA 3I92A 3IQWA 1WE2A 2W58A 4M9SA 1SVLA 2QPTA 4BFWA 4YMVA 1YR6A 3TW4A 2ODBA 3PUXA 4B2LA 3NXSA 4JLDA 2F9MA 3U61B 3JVUA 2AKAB 1RYFA 4C30A 4DVGA 4JLAA 3IHLA 3WYGA 2CXXA 1E2FA 4YXWA 4H9GA 4RCYA 3FMPB 3QOFA 2R9VA 3ZH9B 4TYNA 4NBSA 1MH1A 4U02A 1ANKA 2BCJQ 1YVDA 1J8MF 1O87A 4B73A 4MKGA 2GZAA 3RS3A 5EQTA 3G82C 5F2EA 5HZKA 1IHUA 3LQRA 4IW3B 2DBYA 1XXHB 2EFDB 3IQXA 1EESA 1W2HA 4MDFA 1A7JA 2GJAA 3U3JA 4B2IA 1R10A 4IDQA 3TBKA 3WNCA 4CT4B 2DFLA 1S4QA 3U6BA 2ZI5A 2PBRA 3K1JA 4HAXA 4YDSA 3W34A 2PEYA 2QMUA 4AKEA 2ZE7A 3CX7A 1Q1EA 4FCWA 3OIWA 4OI4A 1HQCA 2WJGA 4QGGA 1IJEA 4NMMA 2JASA 5KDOA 1KI3A 3Q7PA 4KBGA 1PVOA 1E4VA 5JSZB 1MRSA 2YWFA 4HZUB 2CLSA 3L0PA 2GTPA 1SXJC 2QGZA 3RLFA 2JLVA 4KAXA 5F98A 1ZVQA 3AP3A 1W1WA 1GTVA 2ZYWX 4HATA 3I61A 4WZAE 3FMIA 3BK7A 2G3YA 4F92B 2JJ2D 3G0HA 1LFDB 3QPWA 2X19A 3UMFA 1CP2A 2P2LA 2QPAA 4Q4AA 1U99A 3GEHA 1UEIA 5FOUA 1K5DA 5KHOC 4ZI3A 4Q9IA 4KSBA 2VSFA 2AL7A 2IYXA 2P6UA 3MWKA 2AD5A 3NIBA 3QF7A 4I81A 5SZHB 2F55A 4UJ5A 4MRRA 3K0FA 3I8XA 2XEXA 1HE8B 2R65A 4RKEA 3L8YA 4AKGA 5J4LA 3VR2A 1MO3A 2GESA 4JLKA 3I8SA 4Q1DA 3RRYA 1KSHA 2A5GA 1AK2A 3ZZTA 1E2GA 4NYIQ 1OF1A 2OAP1 5EE1A 4ZDWA 3GP8A 2REOA 2IEYA 3B2EA 3LX5A 4RSGA 2G88A 3QXJA 2V1XA 3HR7A 2RMKA 1E9AA 1P73A 2FFHA 2XB2A 4OQMA 4PZZA 4OK3A 3I62A 3BOSA 3PV0A 3HPQA 4FWTA 3LBHA 4L9SA 3FMFA 1W4AA 4QM7A 1CJMA 4ITRC 2CLDX 4HUTA 1RC8A 4Z8XA 2OEPA 2FGKA 3HYRA 2ZROA 4MH0R 4P0TA 3W3AA 1DAIA 3KX2A 1IY1A 4PC3A 2V1UA 1KSGA 3RS7A 1OJLA 1ZIPA 3SU8A 1D2MA 4XTCS 1W7AA 4HB2A 4AI6A 1G6HA 3GEEA 1XXHA 2WSSA 1P7CA 3VKGA 4UJ3A 3X1YA 1DAGA 4JLVA 4PPQA 1XJ0A 3X1DA 1R5OA 1T8TA 3OIUA 1S2MA 2P65A 3QKRA 4F4IA 1WF3A 2J7PD 4LBYA 5FOSA 5DISB 4DHEA 1ETUA 1S0UA 3A4MA 1DS6A 2F43A 2RCNA 3IUYA 4GDFA 3ND9A 2JLSA 3WBKA 2P5TB 2O8BA 2IWHA 3AKDA 4BFSA 1UBEA 2R44A 5G3ZA 3T34A 1LS6A 5CB6A 1VYVA 5FBWB 2X1VA 3TQCA 1TTTA 2JJ8A 4NL4H 2ECKA 1Q1ZA 3AGQA 2D3WA 1N6LA 3C7KA 4P31A 2FA9A 4B47A 4B43A 2FZ4A 2H7VA 3MJHA 4LWZA 1N3BA 2ZE8A 1VHLA 3ECCA 3LA6A 3BS4A 4D25A 1N0VC 1TUIA 2HXYA 1IY0A 1TF2A 3EG5A 5JWHA 3LAWA 1XMVA 3EASA 4GNKA 2BKUA 4EFLA 4US1R 1JPNA 1HURA 5DYGA 3UWKA 2FFBA 2IS6A 1F2UA 3UG6A 1EX7A 1FX0A 2ZI6A 1KI6A 4FMDF 1E9EA 2ZM5A 1T91A 2KB0A 1M2OB 1OV4A 1KDRA 1MT0A 3LO5A 3ZQ6A 3UWOA 4HI0E 5CB8A 4TT3A 2OCBA 1UFQA 1WMSA 2JLYA 2O8EA 4PAQA 1F6BA 4IOMA 5FOWA 3I72A 1IONA 2WJHA 4GOJA 4R9UC 1EGAA 4DDVA 2VP6A 2NQ2C 3K0SA 3LBIA 4B34A 4NTZA 1I2MA 1GKYA 2ZI4A 1IOZA 1Z0IA 2WTUA 3LQQA 3W5IA 1RRGA 5AJXA 2D7CA 2ZVPX 4CRWB 4A36A 4LRWA 1NG1A 2C77A 3V4FA 3BD9A 5JLJA 2A30A 3KJHA 1FMJA 4ZPXA 4IHQA 4URXR 4G0NA 2H18A 1YR7A 4O0MA 3ADKA 4ASUA 3J81k 2J0UA 1LNZA 1UBFA 2BMFA 3WMEA 1QDEA 2N46A 2P6NA 1T5IA 3Q72A 1XD2B 2VA8A 3OEHD 4UQOA 2WKRA 1DAMA 1T3SA 2QE7D 2ZRNA 1AQUA 1NLZA 2QM7A 3B1ZA 4Y0AA 1IM2A 4RD6A 4BFUA 4TYYA 1SKQA 3LFUA 2F1IA 3NTUA 1OXTA 4Q21A 1F5NA 4Q4AB 2IYWA 3CRW1 1KKLA 1RJ9A 1KK2A 4KXFB 4PFSA 3ZVLA 3D31A 4RCZA 5FTMA 4PSAA 3OFNA 1ODFA 4OL0A 3C15C 1G21E 3GFTA 2LKCA 1GNPA 1B0UA 4N1AA 3WMFA 4OHYA 2JLZA 1L4UA 4ZI2A 1OYWA 2FJUA 4Q18A 2GCOA 3DM5A 4I4LA 2QBYA 4ERNA 2QTHA 4BPBA 4HUQA 5CLLA 1OHHA 1G1MA 2YINC 3IBGA 3QBTA 4Q4LA 5EP2A 4A8JA 2ZUDA 2O8FA 4W5HA 3GLGA 4MGIR 4BE7B 1M34E 1HTWA 1X8KA 3TR0A 5AR1A 1P2UA 2QTFA 3IPYA 2ZSFA 4QG7A 4M53A 3B9QA 3K0EA 2FSHA 4G5QA 4RFSA 3R8CA 4Q03A 1UM8A 3RRMA 5GVSA 5C2JB 3SHFA 2XGJA 4PX9A 1RIFA 2A7QA 3K70B 2SHKA 2IK8A 4BGDA 1XCMA 2CEAA 4PPNA 5JI2E 1H8EA 1RE0A 2WWXA 4EQ6A 5H8WA 3K0CA 5TXGA 4IRUB 1KJYA 4QM6A 2G0TA 4BASA 5JHGB 3K9NA 1P61B 4V0MA 1BYIA 5DE3A 1MRNA 3PEVA 4A6PA 3PUYA 3TNFA 2I4IA 1M7BA 4GP7A 1Q1BA 1KMHB 3WNBA 1E79D 2JGNA 1VHTA 1CR1A 4DDTA 1OPXA 2AK3A 3AB3A 3QIAA 2GILA 4TLAA 3CWQA 2YWEA 4TTPA 2UZ3A 3CRRA 1F48A 1W2GA 2MSEB 1IY2A 1PLLA 3WP0A 4AYTA 2QT1A 3IIJA 3BH6A 2WOJA 4QJ5A 1XTIA 5FFMA 3TQFA 2HYIC 1ZMXA 2RGEA 5FTNA 2GNOA 1FP7A 2BJVA 3FPAA 3FVQA 1CU1A 2REXB 3K9LA 4FWIB 2XTNA 3ZS9A 5JFGA 3PG5A 2IW3A 4NKRA 2J0SA 5B57C 2B8TA 4HEJA 1A1VA 3CONA 3BWDD 4LJ8A 5FH9A 2X2EA 3GLGB 1E6CA 4JBWA 3Q5EA 1KHTA 1KI6B 4HAUA 5J4HA 3THWB 3NHBA 1G41A 4MQBA 3THXA 1Q57A 4LYFA 1FQJA 3QKTA 1TF5A 4LPSA 4DSNA 1YRAA 2W0SA 2Z4SA 1ZUHA 3BGWA 2Y8EA 4HDOB 1JR3E 4OK5A 2ZJ5A 4ON9A 3REFA 4DCUA 3K09A 1W0KA 1OIWA 2GEDA 5EE0A 2JLWA 5FOXA 1JB1A 1E0AA 1NSFA 5FPYA 2LWIA 4AYWA 1E1QA 3CB4A 2WBLC 4B2PA 3NDPA 3UIEA 5BW8A 2WAXA 2ZRGA 4C0AC 1NY6A 4TN1A 4XIGS 4UNPA 1OIVA 2A9KA 2QQEA 2A2ZA 2ZRLA 4UNRA 2CL0X 4KFTA 4DSUA 4PSVA 1XZQA 2JJ1A 2ZVQX 3PCRB 5IK2D 1CBUA 3P20A 1ZUIA 2CMKA 3UANA 4HB4A 2NGRA 4I1UA 1QBKC 1Z5ZA 2J0UB 2JA1A 4B74A 3AKCA 1G7RA 4DEXA 2F1JA 5LBIA 4BQSA 3FHOA 2HCBA 3MLEA 1F3OA 4GSYA 1SKYE 4V03A 4HLUA 4MRPA 4EJSA 1Z0JA 4LJAA 4M9XA 2QG6A 3K8YA 4M22A 4B6EA 2HYDA 1OKKA 1G8PA 4PR0A 3KXLA 1HT2E 1ZRHA 1BMFD 1YZGA 3QPVA 4LV8B 2GZHA 2G9NA 4M1YA 1NJFA 2IT1A 2I1QA 1E2PA 2JCSA 4KVAA 2KBFA 1R6BX 4JBXA 1HY3A 1NLYA 2ZSAA 3K70C 1W4BA 1SVOA 2ZU0C 4DCSA 4LHXA 2BEJA 3PR1A 3VR5A 1NN3A 2F9LA 4XWAA 2C2HA 1JEDA 2DWQA 2FX3A 2D74A 2RGCA 1TEVA 2CBZA 1ZD8A 2ZJYA 5KNDA 2FF7A 1SXJA 4URVR 1BOFA 4NCIA 2EFCB 3CWZA 2C98A 3GJ7A 1E32A 1AKYA 4S2EA 1MO6A 4B44A 3C5CA 4M21A 4F93B 2ZANA 3GPLA 4X8OA 4ZDJA 2W2VA 5EP4A 121PA 4MYUA 2DFKB 4LYHA 3LV8A 3ZZ0A 2IHBA 1TAGA 5B30A 2GXUA 4BLQA 1KY2A 5BYJA 4IDNA 1GSIA 2OCYC 2R6GA 4OYHA 4XSGA 3V9PA 2ZU6A 1GKIA 2AKYA 3CM0A 5J4VA 2FDCA 1Z6XA 3TGPA 1UAAA 1OH7A 3C41J 4F38A 4ZV4A 4JKYA 2IS4A 4LJ7A 3QXSA 5GVRA 4ABYA 4ARZB 5SZKB 4C0QC 4HZUA 4XD7A 1AS2A 2OFOA 5DN6D 3PEWA 2J9RA 4QXAA 4Q9JA 2B92A 1XU4A 1T0JB 1UJ2A 1F60A 3KJIA 4N0EA 3DMDA 1L8QA 2IUUA 4TL6A 1DTSA 3L8ZA 2VL7A 1VIAA 1AQYA 4DSTA 4CT5A 3Q85A 1ZC3A 1SVSA 4NYJQ 4LPKA 5JRJA 3BBPA 1OXVA 2CJWA 3ADBA 2WWHA 3O8CA 2FOLA 3EIQA 2ZS9A 4LHWA 4DT1B 3FB4A 5JI3E 2XX3A 3B8HA 3CF2A 2W00A 4CEIB 4JT2A 2VH5R 3HU3A 3OFND 2OXRA 3QXHA 4QGAA 4BFTA 2NPIA 3UMSA 2J59A 3IEUA 4ESVA 1KKMA 2QL6A 3A6PC 4TLDA 4DLUA 1S8FA 2Z83A 4MGKR 3RC8A 1JQLB 2ZEJA 4CF7A 1SVMA 4RFVA 1N6RA 1P2VA 3OE7A 1ZUNB 1OIXA 1WP9A 2ZJZA 4PQRA 2DFNA 1NLFA 2ZSBA 4EUNA 5FTKA 3A1UA 4M1SA 4QL3A 5FUVA 4ZDKA 4RD0A 5EE9A 3EA0A 1XEWX 4R71A 3IEVA 1IN5A 1G18A 1R4AA 1TQ2A 2BBTA 2J0VA 2X77A 1AA9A 4PTLA 4B76A 4DB2A 2F1HA 2ZREA 4KYUA 3LXRA 3AQ4A 1FOEB 3IO5A 1T4GA 4GOXA 1E2IA 3RSOA 5L8VA 1SXJE 2A5YB 2ZETA 1U9IA 2FFAA 2N42A 1X1SA 3L82B 4C4PA 3U6KA 2O8EB 1YZQA 3LH5A 4Q1CA 1OFUX 1ZNXA 1JAIA 1US8A 5KUTA 3KUCA 1W0JD 3V4RA 4HB3A 4LJ5A 1XMSA 5A4JA 3LNCA 3ZIAA 2PX0A 2PLFA 4KHZA 1JNYA 4TL9A 3RC3A 4AKHA 1CR2A 4FN5A 4A0GA 3AF4A 1G7SA 4P4TA 1D5CA 5DN6A 5TMPA 3VMFA 1YZNA 1KI9A 5KO2A 1GRNA 2Q21A 4LJ6A 2V54A 2MMCA 4IVQA 5LDDC 3GLIE 3EZ2A 4UNQA 2O52A 5JECA 4QHTA 1N5IA 1GITA 2VTKA 1WDTA 1D9ZA 5JS8A 4MDEA 1FZQA 3LBNA 1Q3TA 1PUJA 1KO5A 2OE2A 2R62A 4RZ3A 1XDBA 2B8WA 2Q9BA 2G77B 4I1SA 3KKQA 4Q1BA 2ODNA 1TL7C 3N5CA 1P9WA 3TE6A 3I5YA 1U0HC 2HCJB 4BLTA 1E2HA 4AY2A 2PJZA 1CXZA 3B85A 1G291 3CR7A 4KU4A 4W9MC 5B58C 1P3JA 1N5JA 4M1OA 2XITA 1WRBA 4ILEA 3GLFB 1ZD9A 2OLJA 1GOTA 3BH7A 2CNWA 5H68A 3O8DA 2BJWA 1UKEA 2O0JA 5TY0A 5IDVA 1U8YA 4Q1FA 4G01B 1IXRC 2BMEA 3GJ6A 4URYR 2ASEA 4D0NA 4DKXA 5KPDA 4FI3C 1WBBA 4LY6A 2QZ4A 2KI5A 1GKUB 2I1VB 4IVPA 3RHFA 3KB2A 1JR6A 1UDWA 1ZNZA 1J8YF 3M1IA 1ZIOA 2EW1A 2GXQA 2OXCA 5DIFA 1X6VA 2PX3A 2JIZD 2VPPA 2GVDC 1EX6A 1TPZA 3QEJA 4UXIA 1IN8A 2WAYA 3ZVRA 1J90A 5C46F 1KAOA 4JYBA 2DWPA 5DO9A 2YYZA 1Z2AA 4POAA 3FTQA 5LB2A 1G7CA 3OESA 4LDJA 4YMTA 4KO8A 1OH8A 4V0KA 1ZU4A 4A1FA 2P0EA 2XTZA 2GEUA 1KJZA 3NBYC 2O8CA 1EFUA 1EK0A 4AIIA 5E4FA 3GFPA 1GAJA 1IN4A 5AJYA 2BKEA 2P3SA 1Y63A 5EXPA 2O8CB 2ZRPA 1T9HA 3D6TB 3IO3A 2VHQA 4Z51A 2L0XA 1UKYA 3N2IA 4Q4JA 5FL7D 1L7VC 2KWIA 4MKIA 5JWRA 3AF2A 4ZDIA 1TX4B 1XF9A 1U98A 1ZM9A 2XAUA 4U00A 1O3YA 3PXGA 3WYFA 5K8UA 4LBZA 2UZIR 1BYUA 1RFLA 3NDBB 3PQCA 5FR2A 4LYJA 3BFXA 3WMGA 2JJ1D 3ZS8A 1NVVR 3FYHA 5FTLA 5TV2A 2RH5A 3BFKA 1KZ7B 4L4UA 2EU8A 1W36C 4JLPA 4Q9KA 5HCIA 1XJQA 2QAJA 2DHRA 4QRHA 1ZU5A 1C1YA 4R2HA 1GL7A 3HP1A 2IA5A 4QBGB 2AFIE 1X1RA 3EA5A 3AEZA 1N5LA 1VCIA 3CH4B 3GLGE 1GP2A 2RGNA 4LOAA 4MKFA 2ORWA 4KFRA 3KQUA 1Y3AA 3KUDA 4CYMA 1JR3A 4C0JA 1G4UR 4JLNA 4PO9A 3KKOA 3VFDA 1AS3A 2YV5A 3LVRE 4EIWA 5HPYB 5CDFA 1SXJD 4RKFA 2PMKA 3P32A 2DR3A 3CLVA 3JZAA 2D2FA 2NG1A 3CUEF 4FMCB 4XOIA 4JL6A 4D0GA 2GCOB 1P2SA 4Q9HA 4AKIA 5KSZA 1XCGB 2O5VA 4C2TA 2ZAOA 3KL4A 1GG2A 3T12A 1HQYE 2C8VA 4LHZA 1U2RA 2HEIA 2J7KA 4LBWA 4BFZA 1CR0A 3B82A 3QXCA 4B75A 4YMUA 4DDWA 4QJ4A 3ADCA 1BKDR 3IILA 4BZQA 4P4SA 4TMVA 1OKKD 3IIKA 1YZTA 1MV5A 3MAAC 2Q9CA 1YKSA 3AVXA 3W9YA 4B35A 1GIAA 4AD8A 3THXB 1R5BA 3I1FA 1II0A 1TNDA 3GQBA 4DCNA 1XTSA 5CDFE 2CHQA 1G16A 1EFCA 3VX4A 1KO1A 4PC2A 4JVNA 1NRJB 1T5LA 2NOAA 3TSOA 4A8JB 4PANA 3DKVA 5EE5B 3U7HB 1R8QA 1G8GA 1W4CA 3GJXC 4Q00A 5IK2A 2QMEA 3SYKA 3VKHA 2ZJOA 2YC4C 3MWJA 3UMRA 2GJ8A 2LKDA 2KJQA 1N0UA 1KDPA 1MKYA 3GJ8A 3WHKA 2J5XA 1E79A 4LJ4A 2ONJA 3KQNA 1KI4A 1XXHE 4PHHA 4PO1A 1OXUA 4PAMA 4AG6A 4M1KA 3NH6A 3ICQB 4PZLA 5CK5A 2WWWA 4KV9A 3U5ZB 1II8B 1ZAKA 3B7GA 4QHSA 4Q9LA 4DUGA 4II7A 4EPYA 4E22A 3AVVA 2GEVA 1W0KD 1SVKA 1FUKA 5AK0A 2IYVA 1H65A 3CPEA 4DRZA 4DLYA 2WWGA 4A82A 4RJLA 3MGCA 2KBEA 2YOHA 3PUVA 4JMPA 3W90A 1NP6A 2BBWA 4P4UA 4D4JA 4RD1A 3SNHA 1AZTA 4YMWA 1KSFX 2OILA 4H1VA 1GL9B 3EWSA 4QKQA 1NMXA 3U7FB 1G6OA 3OZXA 3SQWA 2ORVA 1YRBA 2BMDA 1KK0A 2GBLA 3EPJA 4EJSB 1E94E 1I2DA 3X1ZA 5KNCA 2QMHA 2OV2A 3P27A 4D26A 3BIFA 4NP6A 3A1VA 4NYJR 3ASYA 5FTJA 2XZOA 1VTKA 4TL7A 1S1CA 3LX8A 2ZRIA 2XZLA 4KLNA 1CRQA 2J87A 2VP4A 5FOVA 1HA3A 4R98A 2H5EA 4OKSA 3REGA 3MWYW 3RSLA 1HUQA 2ANCA 2D4HA 3PEYA 1AS0A 2J46A 4DT1A 1N6NA 1Z3IX 3TUIC 3FMOB 2OAQ1 4IJMA 4UXJA 4DIDA 4O25A 2ORIA 3MJRA 4LYAA 1ZM4A 1P2TA 4GOKA 3ND8A 1E2JA 3M0EA 5L3SB 3HDTA 3EARA 3TSZA 4OJKA 2ZSEA 1U0LA 1OSNA 2F6RA 4JVSB 3KB1A 4NYMR 4P4SB 4XD7D 5KSOA 1BH2A 2R6DA 4WOPA 5IT5A 2XXAB 1S9DA 3CZQA 3C8UA 1JXMA 1K8RA 1QHIA 4OBEA 1J70A 1E99A 1G8HA 1G19A 5AJZA 5AUOB 4G5GA 5BXQC 4QFMA 5HCNA 1FTSA 1II9A 1W5TA 3DDCA 2B7BA 2OESA 2BBSA 3KQKA 3A1TA 3T15A 2BDTA 4HAWA 4KFUA 1YR9A 3I32A 1S3SA 1LW7A 1Z28A 2V55B 5CJPA 3EW9A 1I4LD 3JVVA 4IXNA 4KJZA 1JECA 1VIYA 5FI0B 1KO4A 3A4LA 1US8B 2EQBA 1EFRD 3B78A 2FSIA 2GXAA 3WYAA 2CCKA 4TQUS 2RHDA 4IDOA 2XSZA 2FWRA 2Z4RA 2BOVA 4HLCA 3T1QA 1P6XA 1A2KC 4XWKA 5E7JA 3TSWA 4BLOA 3K0AA 2J41A 4QNMA 3C14C 1U90A 3VR4A 3R7WB 3L0OA 1II8A 3MG9A 2ZQ5A 1EFTA 4Q48A 5EJEA 2F43B 4NHOA 1NG9A 1MO5A 1FFHA 1UKZA 2F1RA 5K8IA 1FTNA 2XJ4A 2VHTA 3CF6R 2OT3B 2LCFA 3Q9LA 5G40A 4E03A 4M1WA 3KZ1E 5JHHB 3C4JA 4XJXA 5LPNA 1GZSA 3CRVA 4PZYA 4YLGA 1G4AE 4HAZA 2H16A 2YOFA 2AWOA 1N6PA 4NZYA 4KODA 5GADl 4L16A 3G5UA 1VYUA 1W44A 1SQ5A 1IBRA 4V0LA 4Q47A 3F8TA 1XRJA 1M7HA 4LC1A 4BLPA 5KSPA 1BO6A 1E4YA 2QE7A 1RVDA 2YJTD 2ZPTX 3B5JA 1HE1C 3EWAA 1Z0DA 2QA5A 4BECA 3BAFA 2REBA 4C0BA 1DAFA 4BEBA 1JJ7A 4NE2A 1YJ5A 2CL7X 2IYQA 4M9ZA 2J1LA 4OK6A 1A4RA 2VO1A 3AH8A 3U7EB 4ASUD 2R8RA 2ERYA 4CDGA 1P4SA 4GFDA 3PVSA 2OHFA 1Q0UA 4DLSA 3IGFA 2QP4A 1WBDA 3PUZA 4FCVA 1UBCA 3FGNA 4M2LA 3K09C 1KZGB 3SJAA 1GNRA 1SHZA 2VSOA 5DH9A 3MRSA 2OFXA 2WOOA 3BB3A 2D2EA 2D62A 1NBME 4NONA 1EXMA 1H8HA 1E1QD 1CJUC 1E2LA 4RY2A 3EPKA 4TZ0A 1NN1A 1OW3B 4F4JA 4YXWD 2VP5A 4HB0A 4B33A 4XVUA 4IDHA 3DO6A 1QVAA 4RZ2A 1OH5A 2W6JD 2BVNA 3K53A 4JLBA 221PA 3DZ8A 2CE7A 2KE5A 1DARA 3EXAA 3HPRA 4YQFA 2C9YA 2MSDB 3EZ7A 4PHGA 1CJKC 1LB1B 5JSZA 3CBQA 5G41A 5A0FA 5BN5A 4WVFA 4CEJA 3H84A 2FZLA 2JEOA 2VSXA 4EPXA 3TR5A 1Q20A 3GJ4A 5HTKA 4YMSA 3P1JA 5KTYA 3NKVA 2FU5C 5FPKA 2JAQA 1KJWA 1E9CA 4CEHA 2Q9AA 3EPHA 1KI1A 2JIZA 1X8LA 1ZYUA 3UG7A 2V8OA 1KNQA 2ZI3A 1OFHA 4M0LA 3LDAA 3E1SA 1W36B 4CEIA 1A82A 1QVRA 2G6BA 1KIMA 3QKUA 2ZTSA 2B6HA 4OI2A 4JJZA 4LV5B 1ZNWA 2H8KA 4RD2A 4W7SA 4BFVA 1Q21A 4OI0A 4JLMA 4A0FA 4MUBA 4OHVA 4DIEA 1E9DA 2QRNA 2V6IA 2GVZC 4HUQB 4JL8A 2JLQA 2CDNA 1YU9A 2ZYTX 3JZMA 5JS7A 1TEXA 3KXIA 2WWYA 1IN6A 3TLXA 2JJ2A 2WWFA 2HLDA 2HV8A 3O47A 2WVJA 4ZCLA 4JBYA 1ZCBA 5CM8B 4HAYA 3VX3A 4LCBA 3B1WA 4FD2A 3E5HA 2HLDD 3QI2A 2B7CA 521PA 2QP9X 3FKSA 1COWA 3TVTA 1XNJA 3IIMA 2Z43A 3EZ6A 4IOLA 5KNBA 3H0KA 5J4YA 1ZD1A 2BBOA 4Q02A 2ZRKA 5HE9A 1FX0B 1M8PA 2GDJA 4W5WA 4O2RA 1WB9A 3FHTA 3GLHA 3WBJA 5HKKD 2WJYA 2C99A 3KDSE 4TLCA 1UADA 1XPOA 3CNOA 1V43A 1VG8A 2J0QA 1SZPA 2ZYVX 3QVUA 4I1OA 2JLUA 4B3CA 3FFAA 1AZSC 4Q7KA 3OAAA 3C5HA 2FPKA 4OJQA 3W6OA 1RZ3A 1YQTA 5KSYA 3QNUA 2QSYA 2FFQA 1MABB 1XFAA 5CIQA 2AX4A 2Z5FA 1QHNA 4JZKA 2C78A 2R6FA 1VG1A 3MCAA 4LGMA 3VQTA 2GK6A 2PL3A 2XNSA 3VHXA 1XEWY 2Q0HA 1C9KA 2PZFA 1XMJA 3O8RA 4OHZA 1YE8A 2IXGA 5FR1A 1N6OA 1KK3A 1S3GA 1SVWA 1RRFA 3LW7A 2BHRA 4GZMA 4DCVA 4NCKA 2P67A 4TLBA 1W48A 2RAPA 621PA 4AC9A 2IYYA 3FKSD 3R9WA 3PENA 3X1WA 1E9BA 1GUAA 4G5OA 3CW2A 3DKPA 2YHSA 3ZVNA 1A2BA 1Z6GA 5J5CA 2FEOA 3RVBA 3CPHA 5F3WB 3P4YA 5BYKA 1KI7A 3VHLB 1N6IA 4A0RA 2F7SA 4PO8A 4WBSA 3TIFA 4OQXA 2IBMA 3KQLA 1T8UA 1JI0A 4Z54A 1NJGA 4IFBA 3IBYA 3EC2A 1F2UB 1VPLA 2D7DA 1DO0A 4EDHA 2XB4A 2XOKA 5KDDA 3ICEA 5G53C 2ATVA 4I1VA 4MRNA 3U60B 4OQFA 4A2QA 1VKJA 1S1MA 2EVWX 1U94A 5DI9A 2ZUCA 1MR3F 3ONWA 5E7MA 4NYIR 3SR0A 3W5JA 1OH6A 2XOKD 1SXJB 4TSFA 1IN7A 1HEIA 1X8JA 2ZRJA 4JJKA 2VLIA 1ZM3A 2NZ8A 4EPWA 3IDQA 1RPZA 4TL8A 1XBTA 2HJVA 5FUWA 2VYFA 1CIPA 4DSOA 2ONKA 3ASZA 1QF9A 3F0TA 5AUNB 3SBEA 3MUFA 3OIYA 4DLXA 2GCNA 1NBMD 1AM4D 5JRZA 1LV7A 1Z2CA 3AVOA 4MYCA 4MYHA 4NYMQ 3A4NA 3HJNA 3ZJYA 2VHUA 4G1UC 4TMTA 5BQ5A 4ACBA 3BB1A 3DOEA 4XVQA 2GF0A 2W2TA 1ZP6A 1TADA 4DLZA 2PLRA 1VECA 1XWIA 3THOA 6Q21A 4F4CA 2GAOA 4ESHA 4US2R 4A15A 1OT3A 3BE4A 4WXRA 1VG0B 3LW8A 3WHLA 1FMLA 2GRJA 2GJKA 2V9PA 3RDPA 1OFIA 1SHKA 4B3XA 5AJVB 1K5GA 4BZPA 4KVGA 5JCZA 2F3RA 3EIEA 3NBXX 2HT1A 821PA 4GPTA 4GMDA 4P32A 2V3CC 5CK4A 4BRUA 4L5BA 2ODWA 3RAPR 2V7QA 3ZD6A 2ZR9A 1GM5A 1P5ZB 1J2JA 3OAAD 2IEZA 4CEHB 3UPUA 1W49A 1XB2A 4KSCA 4UKDA 2ZRCA 5HE8A 3L0SA 2IYRA 4L9WA 2E9SA 2OSBA 4MA4A 3RS0A 4O2LA 3I5XA 1VMAA 1YR8A 4LUCA 1P60A 3SE0A 3WRYC 2DWOA 2WWIA 1YHNA 4B32A 3AVYA 1ZC4A 2ZAMA 1G9XA 3AM1A 2Q6TA 3Q8XB 5E95A 2IYTA 1G8FA 1KGDA 1CEEA 1COWD 3FOZA 1R2QA 2I3BA 1DAKA 3TAUA 3PJRA 1KY3A 1GWNA 3U44B 2GBLC 4TYWA 3NWJA 2WMOB 1RW4A 3FE2A 5M04A 4Z1MD 4PPGA 1VCOA 4MRVA 4D82A 1PLKA 2QU8A 2V4ZA 5L3SA 1EWRA 2AHOA 4GT1A 4B3DA 3AF3A 3AVWA 3OE7D 3TJZA 1JPJA 1NIPA 5DI3A 1FP6A 2H57A 1NI3A 2WPDD 1NSTA 4C0HA 1KYIA 3QY0A 3ZVMA 2N1BA 3FHCB 5KDLA 4R2IA 1E2MA 5FBLB 3KTAB 1W46A 3AF0A 4GZLA 4NDZA 2PT7A 4P33A 2XXAA 3R8FA 2ZS7A 1TF7A 5B64A 2BCGY 1NIJA 4N0DA 2GZDA 3GMTA 4BLSA 2P5SA 5JCPA 1WXQA 1CR4A 2HF9A 4FW9A 2YKGA 1Q1QA 4DDUA 1QG4A 1ESNA 4FMDB 1XCPA 3GD7A 4E5UA 4DB4A 1XD2A 3CR8A 3RS2A 4CW7A 1KMQA 4B6FA 3TH5A 2VEDA 4J0QA 3AKEA 1E9SA 1UDXA 2QQ0A 4Q1AA 1LF0A 4KFSA 4TQAA 2BM1A 4EAQA 2ATXA 4U5XA 1LY1A 1Z07A 2XSZD 1KSJA 4LK2A 1NKSA 3UXMA 1M7GA 3T1VA 1EFRA 2WV9A 3L2OB 2UKDA 3L43A 3AF1A 5L3QA 1N2CE 4NCHA 1DAHA 1E0SA 5D3MB 4CVNA 2ZJAA 2WIBA 3B1VA 4KI0A 4TT3D 2W6JA 3TKLA 3GFOA 4OI1A 3VR1A 4TTRA 1QHXA 2A78A 2NO9A 2ZRBA 3R9IA 4YONB 4B3FX 3CNNA 3CKLA 2YWGA 2VIIA 3NG1A 4GP6A 4DUGD 2GK7A 5LB4A 2ZI9A 2FNAA 2OG2A 2RGBA 2XTMA 1T0HB 4WAUA 4NCNA 4E09A 5KYKA 1G3IA 3QJYA 2HXSA 3CH5A 2G83A 3AKYA 4MKHA 3A1SA 3EZFA 1NF3A 1NBMA 3FFBA 2OLKA 3EX7C 3HWSA 1PJRA 4RVCA 1N0WA 2EFGA 4MGZR 3SJCA 4D6PA 1KNXA 2JLRA 1JBKA 2BM0A 1QHGA 2YZ2A 1UBGA 1UKVY 2IS1A 1TQ4A 4JS0A 3V00A 4P3YA 3KFXA 4LHYA 3RYTC 1P75A 3OIVA 1XTKA 4PXAA 5AUQA 1ESMA 2RKOA 3M4YA 4QHYA 5JJIA 2H92A 3U44A 4IFEA 2E1RA 3LRPA 4Q7MB 4BEJA 1OB5A 3VAAA 2BMJA 3T1TA 3PITA 4QJ3A 1N6HA 1XD8A 3T5GA 1CJTC 3TW8B 1Z6YA 3H1TA 3HU2A 4NU0A 4RD3A 4PQFA 5DI3B 2IXEA 4DWJA 3CZPA 4QOSA 1WA5A 3U4QB 1KI8A 3ZZUA 3SZRA 2GHIA 1KDTA 5J47A 2DYKA 1QHSA 2QENA 1SGWA 1FNNA 4MUAA 5D3QA 3AUXA 3CX8A 2ZJ2A 4WZBE 5JZVA 1K6MA 3DOFA 3KXKA 1Z47A 5FPHA 1NN0A 1NMZA 3U3RA 4IDPA 2QP3A 1BIFA 3RABA 2HDNB 1KO7A 1H8HD 3FKQA 2OO7A 2AXPA 5P21A 3ADDA 3EPLA 1OLOA 3ZIAD 3D3QA 3R7WA 5A5GA 2MSCB 1NY5A 2F3TA 2R6CA 1G3UA 1CTQA 5E7IA 1TU4A 1MABA 2ZJBA 2IWRA 4WA7A 5D3MA 3CNLA 3U7GA 5E3HA 1EG7A 2RB4A 3P4XA 1JJVA 2WM9B 1L4YA 2CCGA 3H4MA 1VG9B 5L3VA 3IPXA 2ODEA 4Q5IA 4MGYR 4DLVA 3QBVA 4XTRA 2VBCA 3ETLA 2QEQA 3CRMA 2WMNB 4IEIA 4KYIB 4C0KA 3B1YA 3GEIA 4K46A 1I4DD 3BH0A 1KOFA 2NZJA 5DLQC 3R9XA 3VR3A 2GJ9A 1P9RA 1RKBA 4A8JC 2DCUA 3SQXA 5GJBA 4QBHA 1VCMA 3KFVA 3QKSB 2DB3A 5JEEA 2JATA 3AP2A 3AV0B 2NPFA 2ZI7A 1W36D 4Q7LA 3PFIA 2IYSA 4LC0A 3QPUA 3QKSA 2IHYA 4ZIRB 2JLXA 5JEDA 1R8SA 2HUPA 2OBNA 3ZYCA 4A6XA 4D2IA 1Z08A 1NL3A 4B48A 2QSZA 4F7WA 1A5TA 5SZIA 5BWMA 1ONBA 3SOPA 3VU9A 3AGPA 3CF0A 5HR5A 4TQ9A 4GBMA 2G0NA 2WJVA 4QNRA 1DELA 1YZKA 3A36A 3VU9B 2FPLA 2ZXUA 4L15A 2QROA 2CNWD 2GETA 4JVLA 2XJ9A 4LJ9A 3A58B 5K8TA 1KO8A 2WIAA 2IF0A 5FUXA 4URZR 5DYIA 2CK3D 4LBVA 5IHPA 4V0OA 4JLOA 5J4KA 2QI9C 3Q7QA 2FH5B 1E3MA 1XEXA 1JQJC 721PA 2OCPA 3VR6A 2VHJA 4RD4A 4Z8YA 5C1BA 1TMKA 2CJWB 2R6AA 2WJIA 3MMPA 4UNNA 4IOKA 1G20E 1OB2A 3EC1A 2QORA 4LV6A 1H8ED 3KKPA 1P62B 3TUJC 3ZDQA 4A9AA 4M1TA 5FPSA 3AUYA 3BRWD 5EP3A 4H1UA 4URWR 4LHVA 1E2NA 3Q3JB 4TMWA 4M1MA 2W6ID 1G8YA 1XEFA 3SN6A 4TZ6A 1ZM7A 1E2QA 1HT1E 2CLCX 2TMKA 4X8MA 5EZ5A 2QY9A 2NMVA 5BN3A 4US0R 3NEYA 4Q1EA 1N5KA 2OZEA 5CIWA 1RJ9B 4IKEA 1NVXQ 1W47A 1OHHD 2IX3A 3T61A 4K81B 1F2TA 3VNUA 1KDOA 1W0JA 1N25A 2ZSDA 3GJ0A 1KAGA 2EWVA 2RGXA 3AVPA 2GWHA 3KQHA 1D2NA 3HYTA 2EYUA 3DZDA 5DHAA 4XWOA 5CJ2A 3PIRA 1XZPA 4Q4HB 4D4MA 1T3LA 2J7PA 2P6RA 2RGGA 5JMTA 1G5TA 1ZM2A 2C5LA 2KSQA 3GLHB 1LS1A 3SYLA 5FBRB 5FPTA 3C16C 3LD9A 3DMNA 2XNDA 3DPUA 5F9HA 5EXXA 5FOTA 5HZHA 1R0WA 3SFZA 2RGDA 3LVQE 2QPOA 1Z06A 2QAGC 3RS4A 3CO5A 3I3SR 1BMFA 4C3ZA 1IXZA 1OXXK 2RGNC 1KI2A 5DSZA 1E1RD 3THYB 2CVHA 3CIOA 3ZQJA 3PUWA 5IRCD 1GILA 2NO0A 3ZLJA 1XTRA 1ZCAA 3E70C 1YZUA 2ZRFA 1G3MA 1T6NA 4ZO4A 3SFVA 4ACAA 1Z8FA 4C9BA 3QKRB 1P9NA 1CRPA 4FCTA 2ZIAA 4Q66C 4LZZA 1FUUA 2O8DA 3B9PA 3LWNA 1AJEA 2D06A 1GVNB 1XEXB 2ERXA 3NVAA 2ZE5A 3QQ5A 5AJWA 1FW6A 3LXXA 4C0LA 4HDCA 4ZIRA 4TWZA 1G3QA 4Q4JB 3F5FA 4JSYA 2GAAA 2A5JA 4ZCIA 1NNEA 1Z83A 1E2KA 1JR3D 2QGNA 5TVKA 2OFWA 4A2WA 4N3NA 4BRWA 1Z0AA 3K70D 1W5SA 4OHWA 2A3RA 2NO6A 3SDZA 3SHWA 1XPRA 2OBMA 1UEJA 2AD1A 2FGJA 1EFHA 1U81A 2QTVB 3DEFA 1CULC 4PSKA 1XTJA 1JXOA 4WW0A 3ZD7A 3GJ3A 4DCTA 4XH9B 2WZQA 1DG3A 1GL6A 1DAEA 4HZIA 5CYPA 5CM9C 2O8FB 3WY9A 4KBFA 4B3GA 1VYTA 2FPMA 5DGXA 3GLFA 2DFTA 3DHWC 3K0AB 3L0IB 2V7QD 1C4OA 3MWLA 3B13B 1L2TA 1Z29A 4KLZA 3HU1A 3O8BA 3T1OA 1ZINA 4NCJA 3SJZA 1QRAA 2Q3MA 1CLUA 3AVUA 4TTQA 1DE0A 1Z63A 1MOZA 2PEZA 1F2TB 1LVGA 2Z6VA 2DPXA 2ZJ8A 3MSXA 4FINA 1DOAA 3W6NA 1NVWQ 3RNLA 1E2EA 2QRZA 3D7MA 3NC1C 3QSYA 1I4TD 1VCNA 5EZ6B 1D8TA 2OBLA 2J3EA 2C95A 2CHVA 3F3YA 4FMBB 4IXMA 5B2ZA 2ZUBA 3QEOA 3K0FB 4EKDA 3WRXC 1OE0A 2W0MA 4AYXA 3W6PA 3WP1B 2WJJA 5CYOA 5BN4A 4Q7JB 2O0KA 1DPFA 4IVRA 4JVMA 1X86B 3IKJA 1CF4A 1G17A 2PCJA 3T06B 2GXSA 1MO4A 1OYYA 2ZE6A 3B6EA 4QBIA 4G5SA 3TAHA 2UVQA 3GLIA 3THWA 1HYQA 3KTAA 2FMXA 2IC5A 2WKPA 1ELOA 1G5PA 1ZBDA 2IYZA 4Q19A 3GJ5A 1M74A 3SEAA 1TUEA 4D81A 1Z6AA 5C4MA 1Q12A 2Z0MA 4TSFD 3RWMB 3CX6A 3SS8A 4DJTA 2BV3A 4HDQB 1NN5A 1E96A 1PUIA 1PZNA 3QG5A 3EZ9A 4B71A 4O3MA 5TARA 4AK9A 4YC7A 3AP1A 4PHFA 4BWYA 5FL3A 1NKTA 4PC6A 4V0NA 2Q3HA 4IEEA 2Q3FA 4LX0A 1YZLA 4JL5A 2O8BB 5GJVC 3BXZA 4WIAA 5C18A 5J40A 2YC2C 3HR8A 1U0JA 1PV4A 1XPUA 2GF9A 1AIPA 4I99A 1DBSA 4W5JA 4OQNA 2IS2A 1BS1A 3DL0A 1OXSC 1ZJ6A 5L3QB 5L3RA 1GDDA 4QBFA 4HAVA 2AXNA 4MITA 4G3XA 5GJWC 2X8AA 4D4LA 4PC7A 1N6KA 2NIPA 3LY5A 5KPJA 2R2AA 2QM8A 4EPVA 2GCPA 3DM9B 1KK1A 1E0JA 4OQLA 5FL7A 3QE0A 2AWNA 4JIMA 4RZXA 1SKYB 5IF9A 2C9OA 5C4GB 5DNYB 3QUSA 1E0KA 5FUYA 3UK6A 4A92A 1E2DA 4JYCA 4ZKDA 5ANRB 2ANBA 3TMKA 3QVVA 3PEUA 4YDHB 4DLWA 4HLDA 3LLMA 1TU3A 3Q5DA 4LSGA 2CK3A 2ZRMA 4TYPA 3WNDA 2PZEA 4C7OB 4PPFA 4BFYA 1RRCA 3FDIA 2CE2X 3TVDA 5KOYA 1V5WA 3LLUA 3KJGA 1UF9A 3K0CC 3NH9A 4Q4HA 3CPJB 4HSEA 1RRPA 4V02A 2VHCA 2XZPA 2FE4A 2ZRHA 4X8LA 3GLHE 1DADA 2YNMA 1P72A 1Q44A 1SVIA 4C2UA 2PH1A 3AVQA 2IYLD 1JALA 2WICA 4NPHA 1U9IC 2WPDA 4NH0A 4EPRA 3BC1A 2CCJA 4TMXA 4URUR 1W4RA 2FN4A 2IF2A 4Q01A 4A0HA 3U3OA 2YVUA 4WXPA 3SJBA 4FMCF 5JJLA 3S1AA 2QN6A 1FQKA 5KU1A 3T5DA 2O0HA 1DO2A 3NBZC 3OEHA 1D2EA 3R20A 2A5FA 1GRQA 4Y0VA 2O8DB 1CKEA 3TK1A 1Z22A 5AWFC 1R0XA 1S96A 2J45A 2BC9A 4JT4A 4B3BA 1J99A 3D8BA 4TMKA 4HYYA 4A4DA 1D6JA 2H1LA 3NEJA 4PHTA 1LF5A 3FWYA 3QG1A 5G3YA 1GNQA 8OHMA 2B21A 2BEKA 2ZRAA 2ZYUX 3RS5A 3N2EA 1G64A 1FPMA 2EWWA 2AFHE 2NTYC 1ZNYA 3SC3A 3W8RA 2VF8A 1Q22A 5CITA 2HF8A 5EUQB 1Z6TA 5K8LA 1AGPA 2VRWA 4TMZA 3B60A 4OHXA 3SBDA 421PA 1XX6A 2C96A 3B1XA 1XD9A 1M6NA 4X8HA 3VNVA 2FSFA 4AG5A 3BB4A 2W2XA 2QUZA 5FI1B 4XVRA 5LD2C 4C0SA 4XSHA 2RHMA 3P26A 1AN0A 3KJEA 2NO7A 3QENA 5EXTA 3MD0A 3MFYA 5FBQB 3X2SA 1XMIA 4UXHA 1AGRA 3RRZA 4PAOA 1QZXA 2IUSA 4LJYA 1R0YA 3NHAA 4RZUA 4DC9A 4DLTA 4GL2A 4M4SA 4ARZA 1R7RA 4V0ME 4EFMA 1LTQA 4CIDA 4PC1A 4FIDA 3U3MA 1HH4A 3U2QA 1IAQA 2ZR7A 3A1WA 1TQ6A 2FG5A 3QF4B 4TLEA 1AKEA 1G5RA 3CRQA 2VF7A 3I73A 4EFNA 2G1KA 2XNDD 1WQ1R 5TB5A 3QF4A 2VP0A 4G5RA 4RFSB 2VQSA 1IQPA 3BFVA 1Z0KA 1QHYA 2DY1A 1TQDA 4LI0A 5EP1A 4IOJA 3A8TA 2WKQA 2EFEB 2CL6X 3BJIC 2OUKA 4HLUC 3RRNA 4EJSC 2ZS8A 4F91B 1M1YE 1X3SA 3H86A 4DLRA 1KTVA 2WSSD 1CJVC 4D0LB 3W3ZB 2C03A 5UKDA 4BLRA 1JEEA 3K9GA 1QG2A 5SZJA 3I4LA 2WSMA 2OCAA 3OEEA 2CHGA 4WZ6A 1IJFA 3DVLA 1SULA 2IL1A 2FV8A 5JBQA 3T35A 3THYA 5GJCA 3TUZC 3S1AB 1DEKA 1DVRA 2V6JA 2W6IA 4Z1MA 3KKMA 3SI7A 1U8ZA 4JLJA 2WHXA 4M9QA 1QHHB 2FSGA 2QAGB 3NC0C 5TDHA 5LD2B 2ZRDA 2K5UA 3WXMA 4DEYA 1WCV1 1JAHA 4CZ2A 1OFTA 3A37A 3QXXA 2IXFA 2IYUA 1Z0FA 3H2YA 1E69A 1FL9A 4A2PA 2GKSA 1DG1G 1U8AA 1CS4C 4UNSA 5H1YA 4M8NE 2HT6A 3U3KA 1G7TA 2C9CA 2G1JA 2E87A 4ZCMA 2QBYB 1GFIA 1Q3HA 2EFHB 4GRAA 2ZR0A 2QNRA 4MRSA 5CLQA 2JDID 3SYNA 1D9XA 2PZGA 4BUJA 4C7OA 4L8GA 2PT5A 4D4KA 3NBFA 3OHMA 2NO1A 2YWHA 1E9FA 3UATA 1G3RA 2AK2A 2QMOA 2JDIA 1ZW6A 3X1XA 5H70A 3K9HA 2IUTA 1PLJA 1E9RA 5HKKA 4S35A 4TYQA 2ZITA 4CGZA 3VTKA 2C04A 4EQ6B 4R7ZA 4GMXA 4AURA 4U7DA 2PMDA 4JSTA 4BZXA 1XJCA 4QGFA 4E07A 1GRRA 2BIFA 2MMGA 3TRFA 2CVFA 3OF5A 2YOGA 3AVTA 1FNMA 2HJGA 3BERA 3BORA 2EYQA 4QC2A 5FBVB 1KMHA 3RWOA 2AR7A 4FXPA 2W83A 4DZZA 4DBLC 1NMYA 3EIHA 3N70A 1R5NA 4MYTA 1IXSB 4K8OA 3ZGXA 1S9HA 2VP9A 4GI7A 3E2IA 5EUMA 1NVVQ 5AUPB 1NVUQ 3OEED 2RGAA 1XTQA 3IHWA 2GA8A 4QGHA 1E1RA 1UPTA 3UKDA 3GLFE 5JJKA 2QT0A 4D80A 3GLIB 1XP8A 5ELXA 1E98A 4KCGA 3M6AA 2BWJA
chains in the Genus database with same CATH superfamily
2AN9A 3IOCA 4EI9A 2PJRA 2FEMA 3K2EA 5CXQA 3U09A 3PGKA 1GYQA 4EPTA 2CXOA 3RTEA 2A5DA 3MQ4A 4MV8A 4DXAA 2QPLA 4AWXA 1YHYA 1A9ZA 3KPUA 2H17A 3ZE6A 3C1UA 3PSHA 2CDAA 2WJPA 2ZSIA 1PZEA 3GFGA 4KGZA 2AJ8A 2A67A 2X86A 4AP9A 3OT4A 4LZPA 1TAHA 3C48A 1WO8A 4NFHA 1FX1A 3W5DA 3AJAA 4L8LA 4RTNA 4JOQA 5KHLB 1SU4A 5KVVA 1M33A 1PW7A 4MR7A 4GQAA 1L5KA 5ISMA 3DLTA 3O2QB 2SKCA 3U9LA 4ID3A 3QVTA 1VDZA 4XIFA 1OX6A 4QPPA 4Q7QA 1WE2A 3DE7X 2O2ZA 3GH1A 4M9SA 2YFHA 1ML4A 4G23A 4HH1A 3HB1A 4YMVA 2WJ4A 3TW4A 4FT2A 2ODBA 1R0BA 3ZIDA 1X2EA 2F9MA 3U61B 1JH9A 5FEUA 2NP6A 4NBNA 1CE8A 5HK8A 3INNA 4Z0HO 4KOEC 3HKBB 3HY3A 3NJ4A 1E2FA 4MKXA 3RJTA 4DR2B 2J33A 4LRQA 5A7HA 1Z15A 5HP4A 5AICA 4ZVQA 3FMPB 3QOFA 1Y1QA 3ZH9B 4Z7NB 4AJJA 2FW1A 2Y1OA 2XUGA 1INLA 4NBSA 4QJBA 3IJPA 2NW6A 2HFJA 1P2BA 1QRDA 1J8MF 3RREA 5KB3A 2BH2A 1QP8A 3NHPA 4OOEA 1ESEA 1JHXA 2FSVA 4MJXA 1J8DA 1IWBB 1IHUA 4RF3A 3SAJA 4XWTA 2DBYA 1VPWA 1XXHB 1CYEA 5FO1A 3UOGA 2GJAA 1K97A 3U3JA 2GFIA 2G36A 1UFRA 2HD4A 3R2JA 4WK4B 3TBKA 3SHQA 3WNCA 1O4VA 2P11A 2P4SA 5DHSA 2IZ7A 2ZI5A 3AESB 1W5AA 2QN2A 3K1JA 2OFPA 2MJLA 3JQ9A 3NX4A 4BAGA 1RLIA 2VJLA 2EQ5A 3DW1X 4GXNA 2FHPA 4W1QA 3ZW7A 3ZCVA 4YJKA 1Q1EA 5A04A 1GV1A 3ZDXB 5DM60 2GFHA 5JRDS 4J1QA 4OI4A 4DZTA 2WJGA 2ZIVB 3T3GA 3FLAA 4NMMA 4EK9A 1ODTC 4FGSA 4CMBA 1BDIA 4YHHB 1I1QB 3NGXA 1S5PA 4NBKA 3V1MA 2WQ7A 3RLFA 3Q1KA 4KAXA 3S2UA 1YMVA 1YE5A 2YWBA 3HV0A 1HFJA 5JAMA 1E3DA 4LRUA 4RNDB 1JW9B 3DTNA 3UWPA 3ZGYA 3KKLA 4NJEB 3MEQA 4HRYA 3FMIA 3U17A 2G3YA 2RHRA 2F64A 3FOBA 1WXWA 3N74A 5AM3A 4F92B 4GLBA 2W2KB 2CNKA 3IKTA 3QPWA 2FQXA 3UMFA 5JH7A 1E3WB 1I3NA 3BXOA 3SK0A 4DSAA 2GASA 4D8WA 3W5UA 1UEIA 1EBUA 4P7JA 5FOUA 5JCJA 4ZI3A 3WAJA 1P6QA 2VK8A 2PUJA 4KSBA 1TC2A 3IMKA 3BF8A 4MHOA 2AL7A 4YRGA 1SCJA 4FYVA 3OQPA 5CVUA 3SWWA 5HQ3A 1C7ZA 5E4JA 5BWLA 4P36A 3DT6A 5IXYA 4NBRA 4LZOA 2F55A 4CF4A 2Q3JA 2XEXA 3AUJB 4FYHA 2H31A 3L7YA 1K8XB 2Q1WA 4HK4A 4QOFA 2I29A 3N0VA 2Y1KA 2WD9A 1IBSA 3TMYA 4ZYXA 3HK2A 3ZUPA 1X42A 1PWYE 2PFSA 1H2YA 1PJBA 2J0EA 3IAM6 3GXBA 3OQ1A 3ZWKA 1J2EA 3OCYA 1X7XB 1OF1A 4I9UA 4ZO8A 5EE1A 4MWBA 4NNJA 1IWOA 1XA3A 4C7BA 2IEYA 1I4EB 2EBFX 2V59A 3QXJA 1KFEB 3DBRA 2RMKA 4Y9DA 3IEMA 3GGDA 3JWEA 2FSSA 1CPYA 4OQMA 4PZZA 5BSFA 4OK3A 1Y34E 2RHGB 4YJDA 3WGLA 1MJHA 2IYAA 3ONEA 3D1VA 5CFOA 1HDOA 1ZOLA 2I66A 3W2FA 3OTIA 3X2FA 4F5WA 1TEHA 1UT5A 3L8EA 4FFBA 2XVYA 4WV3A 1WF6A 4MVCA 1J0EA 4HUTA 4ITRC 2I1LA 4L3VA 4DV0B 1J1IA 1NJ5A 2C2KA 3JW8A 1V7ZA 2WUEA 5KTTA 1O08A 5TRTA 3EEIA 1QIGA 2EHDA 1MDBA 2BUBA 4FDAA 2V1UA 5JY6A 1X94A 4GHWA 3RS7A 2FOXA 1ZIPA 3DQPA 3FETA 4E2XA 2PO5A 4AI6A 1G6HA 1LLDA 2HQSA 9LDTA 1I0LA 2WJ6A 3GEEA 5H80A 3STYA 2JKVA 3VKGA 3DBLA 1E1CB 3X1YA 3O95A 1H0RA 2I7CA 5JASA 3GFQA 4ZZ2A 2RJ3A 3OIUA 4XASA 3QKRA 5F4BA 4IEFB 4FT4A 2J7PD 1HNNA 4DHEA 4WNYA 4PRLA 5BOSA 2WM3A 2F43A 1QQAA 4GDFA 1P2FA 3ND9A 4YCMA 4KFCA 2HMSA 2VXYA 4J16C 2JLSA 3RT7A 5JQGA 2IBSA 5TQVA 1O89A 4HDMA 2O8BA 2XYHA 1UBEA 1GFZA 1GZ4A 1VYVA 3TGLA 4WXYB 2ZJ0A 4EUSA 2H4XA 4QU0A 4NL4H 2PBZA 2JGKA 1N6LA 3AGQA 4B47A 4B43A 5A3JA 2VWQA 2H7VA 4RV4A 4LWZA 3ORYA 1X9IA 1DKMA 4UARA 1XOIA 3ECCA 1IBCA 1G1AA 2JANA 2Q6LA 3HY6A 3LA6A 1DOZA 1KL7A 1I9GA 1N0VC 3QJ5A 1TF2A 4EHHA 5BVHA 3PYMA 3IC5A 1ZGJA 4J0GA 1VRCA 4PS0A 2MR5A 3BRSA 5ENZA 5INTA 4GNKA 4JQOA 5FWYB 4US1R 4EFLA 5EKXA 1HURA 1ODJA 3UWKA 5AW4A 1LK0A 4A7PA 3AL2A 5AIBA 2QQGA 1OV4A 1DRUA 1JAZA 2EZTA 3UWOA 4QX6A 5LUBA 4F4DA 5CB8A 2EGUA 2X3FA 1EHCA 3ET4A 4WLVA 3OTOB 4L2IB 4WINA 5EMLA 1RQXA 4IOMA 5FOWA 4Q93A 2YXBA 5FBKA 1FYXA 4L8FA 4PLZA 3EDMA 1BNCA 1AZLA 2C57A 3D6VA 3ON5A 3O1HB 1E20A 1SXHA 2W71A 2GHRA 2IHZA 4CV3A 3ZC3A 4MLPA 5H9WA 3R3JA 4OB8A 1I5RA 2FRDA 1Z0IA 2B8JA 3IP9A 4MVJD 2PXCA 4RVHA 2ADMA 3CZCA 1PQUA 3LQQA 3ANMA 3W5IA 3NEAA 4O1IA 2ZVPX 4HMQA 4B6PA 1G20A 2XBLA 4MAFA 1EP1B 1NG1A 5HBRA 4AN0A 2C77A 2W93A 5JANA 2XW6A 3IJ5A 5IKXA 4XKJA 5JLJA 3PUKA 2O4CA 3G5AA 3G2HA 4Q39A 2PX5A 4XPIB 2H18A 1K6JA 4Y3UA 2QN7A 4LIPD 2D2IA 5HWSA 2HB6A 3OLVA 3WMEA 1ONNA 4G1CA 1M5UA 1ZGBA 2Q2QA 5AVTA 2VA8A 3OEHD 3ZOZA 4CN9A 3E9NA 4AP6A 4P92A 1JWLA 2WKRA 4B40A 1MZPA 5AW9A 5CFMA 2ZRNA 2C4WA 1NLZA 3B1ZA 2PYZA 2BFEA 3HB0A 4MROA 1TM2A 4GRDA 4RD6A 1JAXA 3TL2A 3TQQA 3EZLA 1SKQA 3ZZNA 1XCOA 4FDMA 4D02A 4B9EA 4JI7B 3NTUA 5B6JA 2JAWA 3NUQA 3WLTA 1OXTA 4PZ9A 4Q21A 4XD2A 5T7BA 1F8FA 3CRW1 1RJ9A 1KK2A 1WKVA 3C1TA 3PHGA 4KXFB 3QLEA 4X91A 3VZQA 1P33A 4OFXA 4D0RA 2EKQA 1J8QA 1HYHA 1B26A 3F97A 4FC6A 3F46A 1PO7A 4H4DA 2BKLA 3G49A 4MEAA 1Z82A 1N92A 3GFTA 3ACDA 1MAHA 2LKCA 3KL2A 4OXRA 4ALJA 3IX7A 4MV3A 2FMUA 4S0XA 3CMMA 4FFPA 2JLZA 4I9NA 4ZI2A 2R5NA 3WWOA 1Y8AA 2FJUA 2PUWA 1XA4A 4Q18A 1L5HA 3DM5A 2QBYA 4X62B 3RBXA 4DL9A 4M0PA 3W2TA 1OHHA 2CGEA 3JZFA 4Q4LA 2R3SA 2WUFA 4UHBA 5AKJA 4MGIR 4TMFA 3FUVA 4HRXA 3QX3A 1HTWA 1X8KA 2ZIUB 3L92A 2DP4E 1RKXA 2FPRA 1KQOA 3TLBA 3VYSB 4JYZA 1XQ6A 4CQMB 1I5OA 1SCUA 2WE7A 3IPYA 4TV8B 4ZTBA 4ARUA 4M53A 2A1TS 4C6TA 3H1BA 3O8OB 3QMWA 3KT0A 3IVRA 4RENA 4RFSA 3RRMA 2QQ5A 4OMCA 2JCBA 2XGJA 4QUIA 1CDEA 2WPNA 2XPCA 3MCVA 2CMFA 3KB6A 1HC7A 4IDCA 1M1ZA 1R9MA 5ILOA 2ZTHA 3RHZA 2ACVA 2IK8A 2Z1MA 4DLLA 3LY7A 1XCMA 3I01M 3LXUX 2WWXA 3KR2A 2AMJA 3QSGA 5TXGA 5IT0A 3QVXA 3WDMA 4PINA 1NI4A 2XB9A 3N28A 4ZT6A 4UMEA 3EMDA 3UXHA 9MHTA 1DMRA 2JH9A 3K9NA 5ERGB 5IMBA 1BYIA 3AFMA 3TTWA 1QLWA 1MRNA 1SJ9A 1W25A 3GXOA 3L8DA 4JMLA 4MV5A 2VJYA 3PUYA 4GM4A 5CNIA 5EKSA 3TNFA 2JI7A 1E18A 5FLKA 1AN9A 3UB2A 1NAHA 1UC5B 3DAPA 4NXMB 1C3XA 3LCVB 4PN7A 1E79D 4YX9A 3MINA 1HI9A 1B74A 1NM5C 2BFEB 1XHLA 2JGNA 1J97A 1CR1A 1Y82A 1HF3A 3G02A 4R6XA 4X7MA 1QYIA 4D3FA 2AK3A 3IDAA 3FTNA 3QIAA 5T3YA 2W42A 4JODA 4EATA 4NFYA 1B8OA 4TLAA 1DRVA 1JZSA 1NOIA 3USCS 5K0TA 2UZ3A 3D2CA 1W2GA 3MERA 4NY1A 3N6XA 2IGTA 1PLLA 1PTKA 5EVJA 2EBUA 2XTJA 1U5AA 2IXTA 4XPIA 4H35A 4W5TA 3RIEA 2BKVA 5CLJA 2WOJA 2XKKA 2Z5VA 4NU8X 3ZDAA 3C24A 3I30X 1DKRA 5A62A 2RGEA 2BJVA 2RK3A 4IF6A 2A4MA 4KR2A 1HE3A 1AHPA 2B4YA 1JIQA 1J0AA 5B57C 2B8TA 3HUEA 4ZOLF 3A1NA 3LECA 3CONA 1QS0B 3VRHA 2VRNA 2XIQA 3ZY2A 4ML3A 1HNWB 1KHTA 4KZPA 4S1TA 1TCVA 2XOXA 3G8YA 4DHWA 5J4HA 4HAUA 5ES3A 1S3FA 2FR1A 1D6SA 5K01A 2AI3A 4H0FA 1QANA 3PPVA 3OJXA 3AR7A 2GN2A 3WLMA 1UBSB 4PWZA 2W0SA 1X80B 2Z4SA 1ZUHA 2OA0A 2BMAA 3I23A 1JR3E 1YC5A 4ON9A 2PSSA 3LU1A 4JI8B 1W0KA 3N0XA 1YFKA 1CUFA 5EE0A 3AYZB 5FOXA 1E0AA 5FPYA 5B3AA 1E1QA 4MIYA 3PGJA 3JAMA 3NDPA 3UIEA 2VZ0A 5CPFA 1YDHA 5E0OA 4IJVA 2ZRGA 4W9NA 1VE3A 1NY6A 3EWIA 4C0AC 1V1JA 1Q7BA 3RJ5A 3LYUA 5A4IS 1OIVA 1GSOA 2O7VA 3ZVKA 3D4NA 4NH4A 2C9BA 4QPJC 5CUQA 4Y2VA 3T3MB 1SQFA 1RI4A 2ZK7A 3OFSA 3FB1A 4JCOA 4JYPA 4MI9A 2NYRA 4RA6B 4C87A 3WLAA 5TQ2B 2Q5OA 3FNQA 3G6KA 1PNTA 5A1TA 5KJCA 1XZQA 3PCRB 2RAUA 4ZU6X 1ZUIA 2ZSUA 4C3VA 4Q6BA 4KYTA 4OKNA 4JENA 1ODSA 1OH6A 3BQNB 4B74A 1GJRA 2XUJA 2CLEB 4TSKA 2GF2A 1W87A 1HE4A 4OAPA 4MUIA 2EIXA 4PGHA 1HWYA 1SBIA 3GRZA 2JIBA 3FHOA 1E1DA 3MLEA 5I9TA 1J42A 1ISSA 1DHRA 1SKYE 2B5VA 3DGFC 2FEKA 3ESCA 4TRMA 4QICA 1TVEA 4EFDA 4YRNA 1OKKA 2DKFA 3EIXA 3KXLA 3A6GA 2A6PA 1B76A 1DCFA 4PAWA 4XR4A 3RGWS 5I45A 1NQWA 5CVJA 1HT2E 1YZGA 1PT5A 2AZXA 2GZHA 3SKXA 2YJ6A 1GSHA 2XB8A 1EU1A 1DX4A 4XRRA 5CB4F 4JBXA 3UMGA 5F7XA 2YH2A 4P7KA 3G2KA 4FZRA 3W8EA 3GC6A 3VDRA 1QP0A 2C2HA 4XCXA 1TUBB 4PVDA 1BXGB 1N7HA 3HNPA 4J9UE 3UTDA 4NI5A 2D74A 3L9WA 3LHKA 4H16A 1ODCA 1TEVA 1Z45A 4P22A 3BIXA 3MTDA 3E3LA 4IG4A 1SXJA 1BOFA 1CW2B 4WKOA 5GQSA 4MRAA 4X0EA 4CLEA 2VRBA 2QRKA 1FQWA 2EAUA 4V1CB 4G56A 4E0BA 4QDUA 1N3IA 2CL5A 2ZPAA 3G13A 1DC4A 1OGYA 4G8CA 3ZZ0A 5SV2A 2IHBA 3G0IA 1F5SA 1KY4A 3Q7IA 3VUFA 2EKBA 1BEUB 3OWOA 3TW0A 2CXUA 1PTJC 5IJXA 4DMUB 2R6GA 3LPLA 4OYHA 3WLSA 4FUQA 1H2AS 2IYEA 4GLOA 3B3JA 4HQFA 3VOTA 3CLRC 3LK7A 4ZRDA 2QAIA 3A3YA 3FSGA 2BGWA 1W9MA 1KETA 3B52X 3HH8A 1EXDA 2ECQA 4EVSA 1K7CA 1D3AA 4CNBA 3VYRB 4HQ6A 2IS4A 3INGA 2V9ZA 1RWBA 2CD7A 3H65A 2MIIA 3QXSA 2GPSA 5LKRA 1Y1SA 1WHSB 5D7NA 5IH3A 1U28C 4ARZB 2G1AA 3UT6A 4C0QC 3KSBC 2DSNA 2PL1A 1AS2A 3VC7A 4YQEA 3W8FA 4BO7A 5DN6D 1JNXX 2VTVA 2AFHA 3KZVA 4FP9A 4RXUA 2BN4A 3OM1A 3QV2A 3W3AH 2XMSA 2AG5A 3KJIA 2YIVX 4NJEA 4RQTA 4XYEA 4RHXA 1U4SA 3IAFA 3GRFA 3DMDA 3UWSA 4KR6A 4Q9AA 3L8ZA 2BGJA 2VL7A 1Q77A 1VIAA 1E7WA 1W6RA 5AVKA 1ZC3A 4CM8A 2BEWB 4FYMA 4NYJQ 4ZHQF 5EZYB 2IH2A 4B4VA 2RG7A 4IDEA 3BBPA 4WUTA 5FBZA 1P1IA 5BT9A 2OXTA 4REQB 2FQQA 1M1NB 4BMXA 3BD6A 2XCOA 4BNTA 5JHHB 3FB4A 3VH3A 4PTYA 2ZKIA 3B8HA 4MW9A 1IFXA 3OFND 4QGAA 4MLCA 2C3PA 2NPIA 2XCRB 4ESVA 4Z9FA 1KKMA 3FIJA 5IKOA 2H06A 4BVAA 3NHJA 1IRXA 2PH7A 1UBMS 3QUQA 4BVKA 3KD2A 4MWCA 3IUBA 1S8FA 2E4AA 2Z83A 4IIGA 4F8JA 2FDCA 3RC8A 1VE7A 3H3JA 1A04A 5CA1A 1E89A 2R4QA 1RHKA 3KLBA 3IFSA 2ZB3A 1DUVG 1OIXA 1ZY2A 2DUUA 4PQRA 3G9XA 3K20A 1PKXA 1WDKA 3TLCA 5IPFA 4HVLA 1K89A 3MYRA 2CLIB 5KX5A 3S2SA 2XMGA 3EA0A 1H5UA 3IEVA 2FPGA 4PTLA 4BBPA 4XI9A 4EO7A 1GHTA 2YMPA 1IE3A 5FHQA 3K6SA 4TRRA 3AQ4A 4FOTA 3KO8A 3IO5A 4HNGA 3RB8A 3RSOA 5L8VA 1SXJE 1PCXA 2FFAA 3PA8A 4YNBA 4M0EA 1G9TA 3L82B 3LX6A 4UHJA 1IH8A 3AW9A 4F0JA 4D9BA 1WXDA 1XLTA 5ESDA 5HS4A 2O8EB 2WP8J 3OM8A 3UC9A 3UW3A 4CI9A 2NTNA 2AJTA 4LFBB 3UC5A 3V80A 2E21A 3M82A 3SIXA 1UMKA 2PX0A 2IZZA 1VL8A 4R69A 5EHGA 3ZIAA 3JQ7B 1JNYA 4RMNA 4G0PA 4MARA 1CC1S 3MUEA 4R8KA 2RSLA 2GEBA 3ESDA 1JZQA 3DWGA 1H2BA 4I66A 3J7AC 4C7JA 3INTA 4J94A 1UWKA 1G7SA 3HA5A 1D5CA 5EWJA 4BO1A 4L4RA 1YZNA 3R4CA 5D51S 2IV7A 1U7XA 2J9FB 2Q21A 5IP5A 1A50B 3V1NA 3P5BA 4YCSA 1A71A 2IBTA 4IVQA 3DOJA 3MRVA 4G97A 2AW3A 4C6TB 4JXXA 2GYWA 3HNOA 1Y4DE 5I8PA 2PKCA 1O97D 5JS8A 3K1TA 1REQA 2R62A 4GECA 4LSZA 1QMPA 1FYEA 1XGKA 5TMEA 3AR2A 4LXIA 2B8WA 4C4ZA 1KY5A 2B8NA 1FVFA 4Q1BA 1UDAA 1QYXA 2XMBA 5CGZA 5G02A 5I9SA 5FX2A 1TYZA 4TV9F 5HS6A 1YJBA 1EIZA 1RHJA 3G8BA 3PC2A 3W5CA 2C7BA 3I6MA 4GX5A 1HZZA 2XNHA 4B85A 1CXZA 3H0EA 3SSMA 4JAVC 3AY0A 1T5DX 4WCVA 5B58C 3NWBA 4ILEA 3TDKA 4P6VF 3IBFA 1YULA 1ZD9A 4HPJB 4QYTA 3DT8A 4G8DA 4M54A 3SXUA 3WLHA 2ENUA 4G4SO 3ZY4A 5TY0A 1BU8A 3CIFA 2WNHA 1U8YA 3GX1A 3O4IA 4MJLA 3LP8A 4G01B 1IXRC 2BMEA 1QE0A 4URYR 1TLLA 2ASEA 4PF1A 1L7EA 2XA9A 4FI3C 1DT3A 1M2EA 4LY6A 3USZA 4CDRA 2KI5A 2I1VB 3Q12A 4G63A 4PYQA 3KB2A 1TKCA 4NV1A 4R6WA 1JR6A 4PCVA 1ZIOA 2GXQA 1V41E 3MK31 3C97A 4E5NA 3PJGA 1TAUA 3E1GA 1ZICA 3E7FA 5EFZA 4DQ0A 3DTVD 3ENVA 3QEJA 4UXIA 1EX6A 2HO5A 3V4OA 5C46F 1J90A 4JYBA 1OH8A 1V35A 1G7CA 2IGBA 1HE5A 4IIUA 5K4AA 3GL9A 2OHVA 3O75A 4M8KA 4TLLB 3MTAA 4HDRB 3V42A 3NBYC 5HZMA 3OLXA 4CHGA 5BSKA 4F1JA 1EFUA 2O8CA 1AZWA 4IWXA 3REGA 5F9FA 2B20A 3H3XA 3MCUA 1AKUA 1G6KA 3BTUA 1SM4A 2I2XB 2GN6A 3HCAA 4G4GA 5EXPA 2YN2A 1C5KA 3GMSA 4RUKA 1G21A 3BXHA 3HCBA 3PWKA 1ZSNA 5JWRA 2X22A 1XF9A 2XAUA 3C3JA 3RR2A 4QG3A 3Q87B 4QOIA 1Y6QA 2YMLA 2ID4A 4HG2A 3ZI4A 5K8UA 2JAUA 3S27A 3KYIB 2BFOA 2WHRA 4KQJA 4ZQBA 3CF4G 5FR2A 1U1FA 1EDDA 3K8OE 2RAFA 4NARA 3DZIA 1H0SA 3N39C 5EMKA 2Z95A 3FYHA 2IY7A 2VK1A 2Y76A 4RKQA 2NADA 2NZWA 4WBNA 2BGRA 1KZ7B 3GARA 3WYNA 5BMVF 3GUYA 4JLPA 3JQFC 4TSRA 1Z5GA 2COEA 1EUCB 1XJQA 3LCJA 2DHRA 4V2UA 1BWQA 3UEOA 2HJHA 2IA5A 3X1MA 3VZCA 4WBNB 2CZCA 2CSUA 1L4GA 1N5LA 1VCIA 3GEDA 4NNOA 2C9ZA 4PSUA 1ZIDA 1GP2A 3LT1A 4LXQA 2V7EA 5EMNA 3GDGA 5IF3A 1WUJS 2BFBA 3H6HA 3W06A 1RCTE 3SG0A 2AX3A 1LBSA 4L28A 4MUHA 3WK4A 3R8XA 4BQRA 4YP7A 4DQLA 3KJNA 1Y3AA 3KUDA 4CYMA 5BNWA 2YMMA 1JBQA 2H9YA 1NA5A 2OGSA 4D92A 2YQ5A 4EIWA 2DHDA 4ZZ1A 4IFIA 2PMKA 3P32A 1DQRA 1LQTA 2G67A 4RKFA 4P98A 4TWRA 3JRNA 4Y9RA 5HF5A 2GEJA 3WLRA 1XLVA 4PVCA 4YRBA 1KZHA 1K8YB 4AKIA 1P2SA 2I4MA 2KYRA 4Q9HA 3BE5A 2X0DA 3D3KA 4XSVA 1I8TA 4DIBA 4FBGA 1PR6A 5DLEA 2JEYA 3ZCXA 1DC6A 1HQYE 1GUFA 1NM5A 2C8VA 1U2RA 1NC1A 4MCHA 2HY7A 2ENWA 4Y67A 2G4CA 1GNVA 3A26A 4DUYB 1SXIA 2H5LA 1Y9ZA 3FNEA 4EITA 4U63A 2R6JA 3LC0A 2QRVB 4HTFA 4Q3OA 4RE5A 2K2QB 4H7IA 1YZTA 4YBZA 3SYTA 4QAJA 1XZ8A 4H31A 3FTFA 4TKUA 1EGQA 3MAAC 3AVXA 1RP7A 4B35A 3G2OA 4AD8A 4ARSA 3PJFA 1JLKA 1II0A 4S3MA 4XWYA 1O54A 5I9BA 5G0WA 3TCKA 3DXYA 3NFYA 2C5GA 4MB6A 1YBFA 1TUBA 1YJAA 4JVNA 3QIVA 4BMSA 2P9FA 3TSOA 4A8JB 4X66B 2LCIA 4HNVA 4CUZA 5KJ6A 2Q7OE 4KUEA 1JE0A 1X14A 2YC4C 2GJ8A 1JT2A 4LZNA 1SBCA 5JVDF 2XF2A 1MKYA 1QDUA 1GRVA 4LJ4A 1RJGA 4ZC8A 3UHJA 4U0KA 3FRJA 1LTHR 5H82A 4RSHA 3ZCRA 1KI4A 2PLNA 1JQAA 1TLTA 1VE1A 2XNJA 4PAMA 4PO1A 3KR1A 4RPHA 2IHVA 3RFVA 2OXFA 5CR9A 3E9MA 2I33A 3FDZA 4NBUA 3B7GA 4RHCA 5TE9A 4QHSA 3WLNA 1FA9A 3U5ZB 5JH7B 4R3UC 4C43A 1YCDA 3PKJA 2GEVA 5L6LB 4RORA 3BILA 4IL5A 4RYLA 2I8LA 1SVKA 3L7LA 5T4EA 1W94A 1KEWA 1BG6A 2IYVA 2WFMA 3CPEA 3I1IA 3IR7A 2HI0A 2XNKA 4KOAA 4A82A 3MGCA 2KBEA 5AP9A 1TXGA 4JMPA 1W29A 2BBWA 4P4UA 3K6KA 4E2FA 1BVRA 2Q5LA 4Z4QA 4YMWA 4H1VA 4R8RA 3EWSA 1EE2A 1NMXA 3OQMA 4I8XA 3WK7A 1G6OA 5BPFA 4EKYA 2ORVA 1YRBA 1KK0A 1PGPA 4N54A 5SY4A 1ESDA 1OXMA 1KMIY 1GGEA 1TK2A 2OZPA 4YT8A 2PKQP 3D4PA 4OP1A 4UBLA 5F2NA 2YFQA 2QMHA 4I4TA 4B6QA 2C4MA 1P77A 4AULA 4K9NA 4PXSA 1BD3A 3PTZA 5CJJA 2XZOA 4P4GA 3T3OA 2M6LA 3EF1A 4FFWA 5IVKA 1SIBE 1OZGA 1CB7A 1PEKE 3K73O 3RVDA 5IM4A 4RHYA 5EIBC 2JBWA 2Z2KA 3AXSA 4P80A 2CYCA 4RV9A 4JOBA 5KYXA 1ONOA 4KVFA 2YTZA 3CN9A 1XVUA 2WIFA 1Z2EA 2YIDA 1PQ4A 4R98A 3RAJA 4C03A 1NKVA 2VDQB 4LMAA 4NIMA 1QRRA 1QGZA 1VI2A 3MWYW 1HUQA 1JS1X 4NV3A 3RSLA 3TL3A 4TMYA 4EH1A 1IRIA 3HUTA 2XH8A 1AS0A 3CPSA 4DT1A 3TUIC 4TRJA 1QORA 1QG0A 3LKVA 4JU8A 4TTIA 3RJZA 4JVOA 4K1LA 3S1LA 2ZZMA 1JIUA 1G60A 3W2HA 1P2TA 4RK6A 1SPXA 1RYNA 2MCFA 1JHOA 3UJ9A 4OYLA 3M0EA 3PFKA 3HDTA 1JDSA 2P3OA 1HKHA 3M6IA 1EFVB 2VBFA 4X9XA 3W3AD 3ASVA 1U0LA 1YDWA 3RQIA 2ZJ7A 3IESA 1H69A 4JP5A 2QRJA 3D54D 1BH2A 1CQIB 2O5RA 2R6DA 2D4AA 2N47A 4F3RA 1V39A 1JXMA 2H51A 2XOEA 4WZAA 2JK0A 3GUZA 4ZEWA 2DPLA 1RM5A 3DDNA 3T8YA 2Z8XA 3PT9A 5AJZA 4G5GA 1GXSA 2JGFA 2OV4A 5GZ6A 4C89A 3DDCA 2B7BA 2OESA 3T38A 5J5AA 4CETA 3O4GA 4X1YB 1OC2A 1KRWA 1U8EA 3I32A 1S3SA 5I9LA 3ELDA 1V26A 1X2BA 3GCDA 3W79A 1CQJB 1I4LD 4YRDA 1I24A 3ECAA 3QFSA 1JR4A 3P45A 3EQ7A 4M7RA 3HKCA 1DKPA 2RK4A 3QI7A 4R9RA 3U3XA 3C7TA 3B78A 3DLPX 3LF2A 3JSAA 1VPEA 3T7DA 1E1YA 2CCKA 5B3KA 4AX8A 1NLMA 2WA2A 4BP8A 3UJ8A 2H1VA 2VAPA 2WDPA 3T1QA 1A2KC 3I6QA 4N7RA 4Z6KA 3RUPA 4BLOA 1WTAA 2NUAA 1ST2A 3EMBA 4DMCA 3MWDA 4L6AA 3VR4A 2VH1A 4GWGA 2EV9A 3QMMA 5FWDA 3L0OA 1Y7HA 4F9TA 1OUMA 3NYIA 5L3ZA 4YACA 4BNIA 4DILA 3WE7A 4M9CA 4D9GA 2OBFA 4G1MB 1VA5A 2DECA 4HNRA 1QIHA 3S2IA 2PZBA 3VHXB 3AW8A 2X7JA 1U2EA 3FR8A 2OT3B 5G40A 4FFSA 2ZG6A 1ZK1A 3DLIA 4M1WA 1FS5A 3RRFA 4E03A 1FFDA 5HMLA 4H7HA 1QONA 1GZSA 3AFGA 1ZH8A 3C6QA 1G4AE 1AGXA 3DXZA 2YOFA 3P9PA 4GU5A 3EK2A 1XZFA 3JQDA 2QL7A 3DOOA 3OIGA 3HO1A 2CXRA 2C4NA 4M38A 5JQGF 2WIKA 2VDOB 4V0LA 1ZO8A 1TK3A 3TEJA 1PGQA 1R0SA 3PHCA 4Q47A 3C6KA 1D1TA 3F8TA 4RGQA 3RKRA 4DCCA 4QXRA 4MV7A 4YRTA 5CFPA 4BLPA 1IVSA 2XA2A 4CKWB 3GJSA 2HZBA 1SD5A 5KSPA 1WR8A 1PJAA 1NT2A 4HS4A 4DOMA 1B8UA 1W30A 1OZ0A 2QE7A 1VP9A 2XE7A 4ER5A 3K6SB 1AXGA 1A4UA 2ONCA 3ITKA 1E1NA 2VVTA 3LUPA 4GXTA 4OH1A 3EWAA 3FSEA 3IV7A 1NHWA 2H2FA 2OD2A 2QA5A 2WYUA 5E7QA 5ED4A 3PVZA 2REBA 3WB9A 4BEBA 4NE2A 3HJAA 3URMA 3N58A 4EPXA 3ZNOA 1A4RA 4OPMA 2HBRA 4NDZA 2R8RA 4E1VA 3QVOA 1K3UB 3E3OA 2OHFA 3A3KA 4BKUA 5TNXA 1Q0UA 4QA9A 1KTIA 2VYVD 3ZHTA 4DLSA 3IGFA 4H1HA 5C7LO 3A1DA 4I55B 1WBDA 5JALA 1AV6A 1T34A 4GI5A 3DNPA 4Z5XA 3K09C 4ZQHA 1GNRA 3SJAA 4AJPA 1UAYA 4KQKA 3OH8A 1M5RA 2OFXA 1KYXA 1T1RA 2WOOA 3PVCA 3G79A 2B7LA 3BB3A 3MJSA 2MYUA 2OHXA 4TWIA 3TXAA 1EXMA 2PBFA 4RELA 3VU0A 3H16A 5CW1A 4HGQA 4IAOA 5IYZF 1PE0A 3M5DA 1J2TA 4YN3A 4DVJA 2RARA 1T4DA 4RL6A 2V8BA 2Q6VA 3DMTC 4B33A 2BCEA 4EJ0A 4RZ2A 4EW6A 1QVAA 1V95A 4QUAA 1OX5A 1MVOA 2BVNA 4MVJI 3FNBA 4UASA 2CNDA 5E9QA 3TNDA 3RSQA 3R3VA 2IHNA 4LJKA 4UAVA 5JAHA 4YIHA 3TOVA 1W8IA 3EXAA 4YLYA 2X0JA 3OJ0A 5BSVA 4GVXA 2MSDB 4UPDA 3OJOA 1W19A 3G8AA 3KQWA 5G41A 3I2KA 4ZYZA 2H7CA 5L4NA 1T26A 2FZLA 2XCQA 1BHQ1 1UOOA 2JEOA 2VSXA 3P2OA 2FW0A 4KRFA 4RMJA 2P9BA 3ILXA 1ZUNA 3O94A 3V7FA 2YWRA 4UNIA 4CV2A 3LXMA 3KOWA 1D07A 1SXQA 1IB0A 1UUFA 2AQ8A 3A6DA 1UC8A 3L01A 3QRWA 2ZUVA 2AOWA 1KI1A 4NICA 2JIZA 1Z75A 3IVXA 4D7AA 5KBYA 3IQZA 4UE6A 2CJPA 2FX2A 3O7MA 1ECCA 1Y9JA 2PD4A 3AOEA 4TUYF 5J1TB 1V5IA 4KJXA 3UG7A 4XIYA 2NXCA 3ZCUA 5IKPA 2JRLA 5DASA 3QKIA 2H1CA 3LDAA 3OPVA 4M0LA 5AOVA 1W36B 1FNDA 1B2RA 2X1LA 3IYLW 1L5LA 1KFKB 1EQ2A 1L1QA 1OBFO 1IY9A 2H8KA 4KAAA 4CM1A 1Q21A 1GGKA 2VYNA 4A0FA 4MUBA 4OHVA 4YK7A 2QRNA 1WHTA 2BKAA 2V6IA 3KWMA 5I4BA 2GVZC 1SHJA 3H7AA 3KUXA 1PS0A 3MRTA 5M29A 3EA4A 2RI0A 3OZAA 3GBVA 1M66A 1TEXA 4CL0A 6CHYA 5KQRA 3TW8A 1KOGA 1JFLA 3UAOA 5IDYA 1NI5A 3U4GA 3PC4A 4ZCLA 5EJ6A 1EK2A 1KEEA 5BRNA 4DNXA 1ULUA 4RVGA 1SZCA 5F21A 4HJXA 3VX3A 1KJQA 2UUCB 3WRYA 2G1PA 3OJFA 3S29A 3TIVA 5CFRA 3KHSA 1N2EA 3QI2A 3BK2A 2B7CA 3QTBA 3WVNA 2BFAA 4PGMA 2FP4B 1A7KA 3DVAB 3IIMA 3I8OA 4BVHA 5DTRA 5KNBA 2H0AA 3H0KA 2DX7A 2EXXA 3CW9A 1IJKA 4FFMA 4YUVA 5EIWA 1CERA 2VK2A 3SZLA 2PSDA 1YACA 3V2IA 1YJ8A 5HE9A 3FA2A 3DZHA 3LO8A 3SKVA 1JEYB 5CYFA 1WB9A 2E18A 4EI8A 3L8HA 3KDAA 4NZMA 2JC3A 1UADA 1X7YA 5M5BA 3CNOA 2X76A 4OP2A 2AZ4A 4J76A 4D6XA 3BJMA 3FSRA 3T0FA 4AJNA 5JAQA 1NQAO 1G5FA 3QVUA 4DUZB 2XA1A 2GBPA 3OAAA 4UVEA 4MJ3A 4OJQA 4HVAA 2HMVA 4ND5A 3W6OA 1YQTA 2RHTA 1FP2A 4XFKA 2ZKLA 4O4JA 3BCRA 2PS9A 5TQ2A 4UOZA 4L6CA 2M6KA 3V3KA 4GBED 3EXFA 5CIQA 3FPLA 3NU1A 4LGMA 2IEDA 1HQKA 1UK8A 3DYVA 4R16A 4REOA 2Q4RA 1CE8B 4L9RA 3ROMA 5BUQA 1C9KA 4UEQA 5I7RA 3EBLA 1RADA 2CMDA 3EYAA 3SMQA 3T4PA 1GL3A 2XVZA 3HC7A 3LZCA 5CA1B 1I6LA 1YE8A 2RI6A 1G2QA 5LVAA 1QYVA 3GWZA 3CJQA 1S3GA 4YMLA 3AETA 3GRAA 1H0KA 1UWVA 5BRAA 2Z2JA 4R83A 3CF4A 4TLBA 2RAPA 2IYYA 5HRCA 1C3VA 4MQLA 1I2BA 3SX0A 1GU0A 3M1AA 2YHSA 5D3ZA 1YQQA 1Z6GA 2FEOA 3P4YA 1KZ6A 1X1AA 3CLUD 3VHLB 2OV8A 3L5OA 4URHA 4PO8A 1NNLA 4S1OA 1MQ8B 2BHLA 2IBMA 3TIFA 3KQLA 1NJGA 2IIPA 2WDZA 4GW3A 4IJKA 2FZGA 1N2CB 3A4IA 5DNDA 2NPOA 2CF6A 2AI2A 2XOKA 4RPCA 5C5EA 5G53C 5KDDA 3S40A 1I7NA 5KYTA 1RPNA 4QOGA 3ANXA 3V8PA 2B1QA 3OJCA 1U94A 4UEOA 2F00A 4ZJZA 1MR3F 3C6MA 1IJBA 3CJTA 2IPLA 2Y27A 3P2KA 3SR0A 5BSHA 1JFRA 4FB5A 1SC9A 2ZIXB 3TMAA 5FUBA 1P39A 4PYLA 4F6RA 2VLIA 1PIWA