1I3MA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
b'AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3mA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3mA01
7MDHA 1EQUA 1I24A 4G81A 5U9CA 4YQZA 2VHXA 1JA9A 5ICMA 4YVFA 2RHCA 2ZJ0A 4J43A 4TVBA 2AQ8A 1MA0A 3ASVA 3KSZO 5B37A 1VLLA 1M67A 2C5AA 4ZQBA 3GDFA 2Q49A 1A71A 2NQTA 4AFNA 1SNYA 4XD2A 1IUKA 3ANLA 3UAGA 3I9MA 5KJ1A 3IL2A 2QX7A 1EE9A 5MDHA 4FFLA 2Q4BA 3DHYA 4RVHA 5IJZA 3HN7A 4IDGA 3W8EA 1P74A 5G0UA 2WYVA 2YHIB 4JBGA 3OECA 1HWYA 4HUJA 1E3IA 3LLVA 4EZBA 3BMNB 3AM3A 4IZHA 3G1UA 3L6DA 3QWIA 5K6AC 3W6ZA 3WGYA 1PL8A 2XF8A 1I0ZA 3E03A 4DMLA 1VE9A 4EUEA 2OZPA 1ISGA 2FZEA 4ID9A 3R6DA 3HDJA 1PJQA 3MOIA 4RZIA 1K6JA 1PZHA 4PLWA 3RFXA 4ND2A 1E7QA 2YV1A 4WASA 3D3EA 3KYCA 1QP8A 3HFSA 3H3FA 4E3ZA 3S8MA 1B8PA 1E77A 1GEGA 2W2KB 3JYPA 3AOEC 1PTJA 5KTKA 1WDKA 4EBFA 3S1LA 3PHLA 1NHGA 4DPMA 4B7UA 1M2WA 1D7OA 4MPDA 4L0QA 4RVUA 3RUCA 4CUZA 4D3FA 2GN6A 2VHVA 1LX6A 4HFRA 1H9BA 3TNLA 3HADA 2DAPA 3TZCA 4ALLA 4DMMA 2X5OA 4N54A 2CFCA 1LU9A 1J6UA 3RIHA 1T26A 4FIZA 1PQWA 3PDUA 3FHLA 2VHWA 5DN9A 4I1IA 3VHRA 3AUSA 3EW7A 1B3BA 1NM5A 3GVXA 4MVJP 4YRAA 4PG5A 2CF5A 3KYBA 1E3LA 1R66A 1DXYA 1T2AA 5BQFA 4AJ1A 1KERA 2WYUA 2JJYA 3QJ5A 3E9MA 4FBGA 2OP0A 1DC5A 1LDMA 5CG1A 2RHRA 4D41A 1OI7A 1LLCA 3MWDB 4A10A 1O94A 4K26A 5KVSA 2PH5A 5T5QA 5IAAA 1PS8A 3IQDB 2OMEA 2WDZA 2CD9A 1BDBA 4RLHA 2PKRA 2Y66A 2D8AA 1B8UA 2WSBA 3M2TA 4YTEA 3FNFA 3PYXA 2YJZA 1A9ZA 1V8BA 2JCXA 1FDWA 1G1AA 2XAAA 2GN9A 3OJEA 2BRUA 3ZV4A 1SPXA 3X2FA 3JQ7B 2GYYA 3WBBA 2H6EA 1RPNA 1QG6A 2R2GA 1Q7GA 4CLXA 5KVQA 2PZLA 3GF4A 4UUNA 3VPFA 1M66A 3IKVA 5JBIA 1GQQA 3O38A 1DAPA 3KRTA 2NV6A 3GMSA 3JQEA 3K5PA 3UF0A 3TN7A 1QV6A 4ITUA 5A5FA 4ONEA 3WQSB 1O6ZA 3CKYA 3FI9A 4N7RA 3FPLA 1ZK3A 1CDOA 3C3XA 4B3HA 5TSDA 1U1IA 4E2WA 2G82A 4L4SA 2DTDA 3UOGA 4OJNA 1ZZEA 3UKOA 4ROSA 4YQYA 4YEDA 4L75A 4BGEA 2HMTA 1PS9A 4B8ZA 4AG3A 3JD2A 2Q99A 1YE3A 3E1KA 1NASA 4UUOA 2Q1UA 2HDHA 1GR0A 3NKLA 4XCVA 3QWHA 1CQIA 3CZMA 4R5MA 4Z0PA 2C7VA 3ZNPA 4K9DA 1H6BA 1DEHA 4BO0A 5CDYA 1NQOA 4GQAA 3G0OA 4YJGB 2OBNA 3W4IA 4P8RA 1ISJA 1O9BA 4TVOA 1XU9A 4D0SA 4CV3A 5F1PA 2NM0A 4BKPA 4MIEA 1EVYA 2NWQA 1GUZA 1PQPA 3LC2O 3LLSA 1MP0A 3GG9A 4WKGA 2X0RA 2EGHA 2O2YA 4UVHA 3C7DB 4ND4A 3MJCA 2HJSA 3K92A 5IZ4A 2NVWA 4YJDA 5CDSA 3CMMA 4XIYA 2C2XA 4YR9A 5CDUA 1U5AA 2NSDA 3OEWA 4YB8A 3WGGA 2X8LA 1JDJA 4R54A 1LDYA 3CEAA 4E4YA 3DTYA 1DHTA 3FRJA 1Y1PA 1YL5A 4JGBA 2FPPA 4DREA 4NJMA 1NNUA 3EDMA 3B1JA 2XOXA 5A02A 4F6LA 1ZSVA 3OEYA 4JJIA 4CM9A 1UXJA 3JQCA 2OXIA 3B1KA 2AEMA 4AVYA 4MDHA 4ALJA 2C59A 3A1NA 3DWFA 4OL9A 4QECA 3I52A 5BSHA 1N2SA 5JYEA 2FMUA 3NJ8A 5AXDA 5JXWA 1M6WA 4LMRA 1R4NA 5EN4A 1U4OA 3BMOA 3ZU4A 3JQ9A 4AJIA 4PG6A 4XKJA 4UVGA 1T24A 4BNHA 1G0OA 4P4LA 5JDCA 1ENZA 1PGOA 2QYSA 3NGLA 3OF2A 3OSUA 2QRLA 4L4XA 4CM3A 2UUPA 3H6KA 5JNLA 3D64A 3JQ8A 4LVCA 3MWEB 3NUGA 4J7UA 4BNVA 5GZ1A 2J5QA 1ZMOA 4E6PA 1YDEA 2Y05A 2HK8A 4JROA 5G0VA 1DIGA 1XEAA 3QRWA 4XWYA 4BMSA 4B8WA 4XYMA 1LSOA 5TQVA 4U8GA 5L4NA 1E1LA 4HY3A 3Q3CA 3C1TA 1F8FA 1Z7BA 4Y6SA 5GZ3A 2JL1A 1BW9B 4S3MA 4D43A 3WGIA 2PD3A 1HLPA 1LUAA 2ZJ1A 3LT2A 8ADHA 5KOIA 1X0VA 2FN7A 3VDRA 5A3VA 5TF4A 3N7UA 1Z7EA 2B36A 1GCUA 2I99A 4R5HA 3WFJA 2BELA 5ITVA 1V3VA 4D0RA 3ZNNA 3AM4A 4FFOA 3WGHA 3HNPA 1H0KA 2B5VA 1LDNA 4WCFA 1JLLA 1YJ8A 1R4NB 1YB4A 3ZHZA 4YAIA 3BMOB 4WLVA 4PZEA 4J1QA 4AJNA 4NR0A 9LDTA 4W9NA 1NFRA 2QQ5A 3WMXA 5BNTA 2P68A 4XJSA 2NU6A 2CDAA 2DKNA 3PHGA 1XU7A 2PNFA 3RROA 1UP6A 2A4KA 1GYRA 2AEJA 2GN8A 3I9OA 1NPTO 5L4LA 1B26A 3OBBA 1J4AA 4OAQA 2BFAA 5DNAA 4BNYA 4H16A 4KP7A 3F4LA 4XRRA 3GFBA 5U1PA 5EINA 3SEFA 2PK3A 4I08A 5THKA 3ICCA 3UCEA 2J5KA 3WDSA 4ZRNA 3QVOA 1N7GA 4WLEA 5EL0A 3EZLA 5KKAA 5IN4A 3GT0A 3H7AA 1NP3A 4ZVVA 3RQSA 3KLPX 1C0KA 3NT5A 1SC6A 3SVTA 1I3MA 1UDBA 3OHSX 1W4ZA 4IUYA 1MFZA 2P5UA 2J3IA 1E6EA 1VSVA 2VYVA 5FFFA 3DOCA 5KJ6A 3DHEA 3JQAB 3HB4X 1IULA 3FNGA 4PLGA 4QEDA 3R3JA 1SAYA 1DC3A 5AYVA 4IQ0A 1I01A 1TVEA 2GGSA 4RL6A 4IGFA 1IB6A 1U7TA 2O48X 5CAEA 3MTGA 3DXFA 4Z3DA 3GEMA 3VVBA 3HN2A 1K6XA 5CDTA 2BF7A 2W90A 3HJAA 1ZK4A 4NMHA 4B3JA 1LLDA 3FPCA 1V35A 3DZJA 4KDEA 3JQ9C 1P0CA 3QVWA 1PZFA 4PGFA 1C1XA 2IEDA 4BGVA 2QIOA 3MJEA 3GZ4A 1DO8A 5JDCC 1UP7A 2HAEA 4DRYA 1QKIA 1XQ6A 2VRCD 1HDOA 1PJTA 2BD0A 2EP5A 3P7MA 4YAGA 4J7CA 3TL3A 2UDPA 1LXCA 3ON5A 1B7GO 5JYDA 4FGSA 2VN8A 3PWKA 4P22A 3IAHA 4BNGA 4A27A 4CQMA 4QXMA 2X22A 4C7JA 4XX0A 5IFLA 1GYPA 2PGLA 3FN4A 4TWRA 3FBGA 3JQAD 3OIGA 1HL3A 2FSSA 4QX6A 1GPDG 3TF5A 3JD3A 1PR3A 2NNLD 1E7YA 2YDYA 4QO7A 3ZHBA 1LJ8A 4N5LA 5IDYA 2VHYA 2DTXA 3TZ6A 4WCFC 3BIOA 4QQRA 3GDOA 3ENNA 4OH1A 4Y8VA 5EERA 2HMVA 3VZQA 4ZRMA 2YFQA 5FWNA 1X1EA 1QYCA 3EC7A 5BT9A 2IE0A 3B1FA 4GGOA 4B4UA 2NTVA 4Q3NA 4W9NC 3GNTA 2X0IA 3RUIA 4UEKA 4L76A 5C7OO 4J4HA 4DQXA 3AJRA 5B1YA 3E6AA 3DBHA 4R41A 3K8ZA 3GZNB 5I7FA 4PLFA 3DZHA 4XYEA 1UDAA 4PZDA 1IHXA 4IDEA 1SOWA 1R0LA 4UVDA 2B4RO 3RKRA 3WICA 1KIFA 1N8KA 1PJCA 3VPHA 1JTVA 4WEQA 3RASA 2DBRA 1X1TA 3JQFA 4AICA 1DPGA 2AMFA 3IP3A 3PQEA 3GNSA 3IOYA 3V5NA 3L4SO 4JXKA 8LDHA 4XR4A 4BNZA 2RCYA 4BO4A 1DJQA 4BO2A 1KEPA 1WXDA 3WGTA 3G3EA 4CMBA 2FP4A 4LVUA 1GD1O 1LLQA 4XB1A 3ASUA 1MLDA 1PU2A 3O8QB 2B5WA 5U4QA 1C14A 5TGDA 2X9GA 1HDRA 4D42A 4J7XA 1I2ZA 1AHIA 1Y8QA 3LZ6A 4O6VA 3GHYA 3WR5A 4TKMA 1B14A 2I66A 1R0KA 2H9IA 1HDZA 3DBHB 5KWEA 5LDGA 4IJVA 3DZFA 5G0TA 2IODA 3L77A 5A03A 1WPQA 1IZ9A 3KUXA 4PLYA 1ISMA 4QO8A 4CLDA 5G2OA 1EBUA 5B4UA 3EK2A 3BMCB 1UR5A 5TT0A 4BQRA 1OC4A 3KO8A 2CUKA 4YRDA 4XYGA 3PLRA 2YZ7A 4IQGA 1LSJA 4DGSA 2W2LD 4FJ1A 4N5MA 3UXYA 2D0IA 4AJOA 3QQPA 4GX5A 4IDCA 1C0PA 1PX0A 4BNJA 4FFRA 1OOEA 1ZK0A 1ZIDA 3PIDA 4E32A 1HZJA 5ER6A 1EMDA 5DCUA 1E5LA 1DRVA 1YBVA 3ABIA 3GUCA 2X9VA 4K28A 4RQUA 3JD4A 2P9GA 4S1VA 5DT9A 1U3TA 4FSHA 3FWNA 4EGFA 2BFMA 1GL3A 1U3UA 4GI2A 3DBVO 1E3WB 1ZVMA 3H5AA 5ER9A 3Q9UA 3WOHA 1GV0A 3QHAA 1Y8QB 4NBTA 2J8ZA 2GERA 1ONNA 1BRMA 4L73A 2Y0DA 1VJTA 1Y81A 4NQZA 2UAGA 2RAFA 1WAMA 4Y9DA 4ALNA 2PTGA 3DONA 1RM4A 1GUYA 5THQA 1MXHA 3KYDA 3KSUA 4MO2A 2EP7A 4LCEA 5F1KA 4FCCA 3HUDA 5K6AA 3KHUA 1UUFA 4DQUA 1LNQA 3Q6IA 3PPIA 4BNUA 3MTJA 1NQ5A 3VKVA 3TSCA 1XG5A 4D3DA 4CJXA 3ROKA 3FNHA 3S2FA 3HDYA 1N9GB 4AJ2A 4JK3A 1XA0A 1KOLA 2NU8A 2G0TA 2ET6A 1VL6A 3FTPA 3JCZA 5BNFA 4TRMA 4WLUA 2VWGA 5TX7A 3WXBA 2EF1A 5L53A 1T25A 4QSMA 4BO6A 3EY4A 2YHUA 5ITWA 4CMJA 3W4JA 4J6FA 1LI4A 5IDXA 2HUNA 3C24A 4NPCA 2B4TO 4RCVA 2P2SA 3F47A 4I5GA 1I8TA 2DBZA 4HV4A 4LGVA 2BFPA 5JAQA 1MV8A 4MIYA 4K6CA 5KJEA 3IKTA 1Q7CA 3AFNA 2WM3A 2O7QA 1JVBA 3LT4A 3PHIA 3GQVA 1KVQA 2OGUA 1R16A 2ZKLA 3FD8A 5G4KB 1NWHA 5CP8A 3UH1A 3LYLA 3AWDA 4PVDA 4CQLB 1P44A 3L9XA 3JYNA 5FYDA 1T2DA 3U5TA 2FY8A 2YV3A 7ADHA 4CR6A 1ZFNA 3ANMA 3ADPA 2C07A 2DTEA 4B4OA 2YHIA 3PHJA 5I9NA 4BO3A 3MJTA 3VZPA 4BOYA 2QYTA 2PY6A 3BMNA 4RDIA 1PJ4A 4Z9YA 4IJWA 5B4VA 2YFHA 3C8MA 1KC3A 4GH5A 4NK5A 2YQ5A 4CMEA 3GY0A 4GX1A 3G49A 1EVJA 1YB1A 1GZ4A 3GGPA 1AUPA 3RC7A 4KMSA 4BNTA 3OFSA 1NVMB 2B0JA 1IPEA 2JCVA 2QZ9A 3I9NA 4J1SA 2R00C 1HYGA 4BNLA 1T2EA 4FOOA 1NR7A 5A4DA 3NGXA 3W4KA 3ZU5A 4GKVA 4MJLA 3DFUA 1XQ1A 3VPXA 4AJPA 4EUHA 3BZUA 3RI3A 2W2KA 4XEHA 2E4AA 1UXKA 3AI2A 4RPHA 5F21A 4ZD6A 1AXEA 4JX8A 3I23A 2LDBA 1M75A 1U8XX 1EUCA 2I3AA 2BGMA 4BB6A 1T2CA 5C7IO 1Q0QA 3KEOA 5A04A 2RH8A 4IIUA 4CLOA 4RF5A 3MJVA 2JFGA 1YQGA 4CM4A 4XDZA 4TQGA 4BS9A 1DJNA 4NNJA 2W8ZA 3ROQA 4CR7A 1P31A 3E9NA 4IS2A 1YBMA 3VKUA 1ISHA 4OXYA 1Y9AA 2VYND 2CNBA 2EW8A 1HEUA 2NU9A 2FHSA 2BMAA 2Q2WA 3SX2A 4BNIA 2EJVA 3KB6A 1HYHA 3PDJA 5IN5A 1NBOA 2X58A 2J3HA 4M54A 3DTTA 3P2OA 3RUEA 1P1IA 4R01A 2C29D 3TZKA 2X0JA 4M8SA 1PIWA 1YKFA 3AUUA 3IMFA 1F17A 5IDQA 4BB5A 4A0SA 4KQXA 1DLIA 1H9AA 4CV0A 1BG6A 4YJHB 3SC6A 2DLDA 5AXCA 3H3JA 1Y6JA 5AQ1A 3I9JA 3DZIA 1E1KA 4ZJUA 4I9HA 2OHXA 3BTSA 1UJMA 3RU9A 3U4HA 3Q0EA 3FBTA 4K6FA 4MVJH 3JQ7A 4CLOB 3RJ9A 2DUWA 4E33A 4CM4B 2IZZA 1XCBA 4R1NA 5KJFA 4RF2A 3IP1A 3PHHA 1DB3A 5B12A 1HE3A 1PJ3A 1XWFA 5IF3A 3I83A 1PWXA 4J2OA 5FEUA 1V0JA 5CFZA 1N5DA 1YOVB 4OYRA 4YJFB 3ZWMA 2E37A 4I5EA 3VZRA 3CH6A 2Q4EA 2V6MA 3B6ZA 3VTFA 3JQGA 4GPD1 4RQTA 3ZWOA 4CMKA 4LRSB 3AUTA 2GLXA 1JKJA 1E7RA 3AY6A 2V6FA 1U28A 2Q3EA 2GSDA 3G79A 5JDIA 5TC4A 5F3RA 1WMAA 2WE7A 2VQ3A 3HWRA 1IOLA 1HDGO 3H9QA 5ES3A 1QLJA 3QP9A 4Q3DA 4CMEC 1UAYA 2ZB7A 2VUUA 3FR8A 2EKQA 4RV9A 5EQFA 1NPYA 3TOXA 3HB5X 2Y1DA 1E1MA 4RVFA 3WMWA 2EG9A 1PJBA 4UUPA 1KEWA 1VC2A 1ORRA 3F5SA 1EQ2A 3D7LA 3NTOA 3RU7A 2HSDA 3ROMA 4FW8A 3W1VA 4Z0HO 4NHEA 1DIAA 1AGNA 4M87A 2JFHA 4YJGA 1E6UA 4GGPA 2QHXA 4FOSA 2YYYA 4R3NA 1UZMA 3JQBA 2GZ2A 1KVUA 4M86A 1LRLA 1KVSA 3JQGB 1CETA 4TZTA 3TWOA 3DAGA 3U0BA 3SLGA 4MINA 4R69A 3VH4A 4H3VA 1HETA 1FXSA 1B16A 2UV8A 4L9RA 4E2ZA 1DFGA 1PEDA 1XLTA 1JAXA 1K2WA 3I4FA 5DP1A 1I2CA 2FSVA 2UYYA 4DL9A 3GHHA 2VNAA 4K1LA 1JWBB 1YONA 3F1LA 3MZ0A 2EGGA 2A92A 2GZ1A 3HHPA 2H63A 3D5TA 4GAEA 2GR9A 4OIMA 3FF4A 3P2YA 4BNFA 5T57A 1YRLA 4AL4A 4HFJA 3I6IA 2IRWA 3U09A 3TJRA 1DDOA 1EDZA 4E5PA 3OJLA 4R1UA 4CM8B 2UUOA 1PGJA 4J9UE 2O3JA 2IDZA 3WJ7A 1ZNQO 2NACA 3CZRA 2GASA 3TRIA 5JFOA 1BVRA 5AOVA 2D5AA 2WD8A 2NTJA 3EHEA 2OL4A 4FS3A 4M1QA 3P5SA 2VRBA 3AI3A 1LRJA 1SEPA 1JN0A 5C5IA 1GPJA 3GVPA 3ZWWA 3UN1A 4DWVA 3BXXA 4R1SA 4J9VA 5AXAA 4W6ZA 5TJ9A 2JD0A 3ZWXA 3DR3A 4RDHA 3WLEA 3DL2A 3JQDA 1NQTA 1SCUA 1PJLA 3VPSA 3WTBA 1VL0A 3VC7A 1VKOA 4XYLA 5HRUA 1E6WA 1YL7A 4KZPA 4NBVA 4B4WA 1T2FA 1DSSG 3BHIA 4DYDA 4U7WA 4IIVA 4M55A 3PEFA 1BW9A 4OHUA 4IMPA 1SBYA 5JDIC 3ITKA 1QYDA 3M1LA 1D4FA 2WE8A 1XR3A 1O0SA 3ZGYA 3IUPA 5C3MA 3PGXA 2NADA 1X7DA 4G65A 2FRDA 1VPDA 1F06A 2DU8A 4XQ9A 2QRJA 4LSMA 3W8FA 3FWZA 3OA2A 1DIRA 4HX5A 1SO8A 5JO0A 2QRKA 3L4BA 5TNXA 4JN6B 4PIVA 4E30A 1U3WA 5ILGA 1LQTA 1JKIA 1PS0A 1ARZA 1SZJG 1NTOA 4P4NA 1U9JA 1ZK1A 1F14A 4FPXA 3CIFA 4JJGA 5FI5A 3S2EA 2QZZA 3OQBA 1CEQA 4TKLA 4W99A 4HP8A 4YT8A 1GYQA 2IYPA 3STHA 3KVOA 3QV1A 3GPIA 5DCWA 2ZYDA 2HRZA 2FR8A 3DO5A 3JQBC 5A1TA 1X0XA 2NLOA 2EV9A 1U2DA 3OIDA 3ZH2A 5DBIA 1WWKA 1TA4A 2X86A 4RVGA 5TS3A 1DRWA 6ADHA 1SMKA 3AY7A 4RJTA 1LSSA 4NU5A 1PR9A 3I1JA 1Q7BA 4IXTA 1TT5B 1ADGA 2CZCA 4BNNA 5TIIA 2QW8A 1YL6A 4O1MA 3NDJA 1ZEMA 5JY1A 2JCYA 3DBRB 2AE2A 1CIVA 4FR5A 2IZ0A 5EIOA 3WQRA 1ADBA 1ZSYA 1P1FA 1GU7A 4HNGA 2Q1TA 3JQAA 1Q2XA 1T4BA 4NH4A 2NVUA 3PP8A 3PGJA 4G5HA 3D0OA 5L3ZA 3WJAA 5DZSA 4GVLA 1RM3A 3Q1LA 3RD5A 5FI3A 1I30A 2Q1SA 3TOZA 2P4HX 4R3WA 4JIGA 4LRTB 2VOJA 2I3GA 1H6AA 2R6JA 2HJRA 5FF9A 3RAJA 1IL0A 3W8DA 1HE2A 1UXGA 1PGPA 3GEDA 3DMTA 4U0JA 1ADCA 3K2EA 1N92A 2OP1A 3KEQA 5A05A 1K5HA 4XYBA 4D44A 5KVCA 4I9NA 2HCTA 3L6EA 1P45A 4BKOA 2VT2A 3V1TC 6LDHA 4RLSA 5GMOA 4XGIA 1C0IA 1N1GA 4DBZA 4FDAA 3ETDA 3B20A 2WJPA 4RORA 1VJ0A 4WECA 2E6UX 3UUWA 4ZA2A 5BNIA 4PG8A 1MXFA 4BUCA 4CV2A 1ZKMA 3ZWYA 1OC2A 1UXHA 3DOOA 4NBUA 5EQDA 3ULKA 1H6CA 3K9QO 4YWJA 2OUIA 3H8VA 3GMDA 2P91A 1H6DA 2A35A 2NVUB 3W6UA 1Y7TA 5MGBA 1MGOA 3PYLA 2WYWA 4TMFA 3X2EA 1GCOA 4UAGA 4XIJA 3PQFA 4CLEA 1H5QA 5EJ2A 5IG2A 2DM6A 3F1KA 3DZGA 3PJGA 4ALMA 3CINA 4UREA 4A26A 2ILTA 3CUKA 1XHLA 3QY9A 4FFNA 1DFHA 1JKFA 4IJKA 4BHTA 1R4MB 3V2UA 5ENDA 1OZAA 5I9MA 1Z6ZA 1H2BA 1MG0A 4GVXA 4NIMA 5F1OA 5IZCC 1F8GA 3QWAA 4F45A 3L4BC 5IXYA 1A7AA 2O4CA 2B37A 3ZU3A 4R9SA 2D59A 4MVJE 2Y1EA 3PLNA 4BV9A 2PZMA 1Z73A 3VPGA 3ZNOA 1TI7A 1XSEA 3ROPA 5I7VA 3PFWO 2G5CA 1F0YA 3RFTA 1ZUD1 4UVIA 4IDBA 1ZSNA 3ICPA 1V9LA 4GX2A 5DCYA 4KDFA 4DBVO 1QORA 3GZNA 4MP6A 4DYVA 3C85A 2VUSA 2VT3A 3GPDG 2BLLA 3KXDA 4F6CA 3GOHA 1DFIA 3EAGA 5JC1A 2W2LA 2VWPA 1R6DA 2GRAA 3GLQA 2CVZA 4B3IA 3F46A 5CEEA 2HKIA 4YDRA 5JY6A 4A03A 3C1AA 4IQ8A 4DA9A 4NG5A 4E2YA 1KEVA 1U8FO 3A9WA 1BDMA 3OQ6A 2EERA 2Y1FA 4J3FA 1A4UA 1QR6A 1A7KA 3PZBA 5TJHA 3PWZA 3GG2A 2AQHA 4KWIA 3WSWA 1ONPA 2C5EA 4J1NA 4TRRA 3O8QA 2H5LA 3OM9A 1P9LA 1IE3A 4HBGA 1SB8A 1G0NA 1P33A 2PZKA 1YQXA 2D5CA 4JCOA 2VWQA 3TFQA 3KTDA 5HTOA 3O9ZA 1TXGA 1UP4A 2I9PA 2VWHA 3HZZA 1P1KA 4DIOA 5HWSA 3FR7A 4KTVE 3DMTC 1DLJA 2P9CA 3GGGA 4QUKA 4WEOA 4B79A 1Z82A 3BMCA 3DB2A 4IBOA 1LLUA 4M49A 1ZW1A 2TMDA 4KQWA 4G2NA 2GNAA 1LC0A 4W7IA 1YVEI 3CE6A 4IMRA 4XDYA 1F12A 4A2CA 1H93A 2TMGA 3V1YA 1ZK2A 4RPLA 3TZQA 1E3EA 4AJ4A 3PTZA 4JLWA 3QSGA 3ANNA 4YA6A 4Q39A 1HRDA 1MFPA 3GFGA 1EUDA 4BO5A 1YXMA 4CUJA 4YYZA 1X14A 1X7GA 4GSKA 5BSEA 1KVRA 3U3XA 4PLCA 1E3WA 5I7SA 5JS6A 5ILOA 3BHJA 4WPGA 3HSKA 1EUZA 4YPOA 1LRKA 4CODB 1JW9B 3WB9A 3C7CB 1Y5MA 2XXJA 3MJSA 1GQYA 4YACA 3NV9A 3IUSA 3WS7A 4RZHA 4IJUA 2V7PA 4BKQA 2V6GA 1PGQA 1NHWA 3IDSA 3KBOA 5A9RA 4FFMA 4DTIA 2Y67A 4MVJF 1FMCA 2PWZA 2BGKA 3K30A 4PCVA 1FDSA 2I76A 4PLZA 5F5LA 5L45A 1V6AA 2RBEA 2CVQA 2XPCA 4MVJD 4UVEA 4WOJA 2R00A 1ISFA 3IJPA 4DIFA 1VRWA 1R37A 4CL3A 1N9GA 3EZYA 3GK3A 4E12A 3Q2KA 4M89A 3TPCA 3BHMA 4CV1A 4PRLA 4J4TA 4YAEA 4YRBA 3ZCXA 4RVSA 2GDZA 2JFFA 4MKZA 3RBVA 2WEKA 1WMBA 1FK8A 2G1UA 1WP4A 2J3JA 3R0IA 4HNHA 2D2IA 5IDWA 2GD1O 4WK6A 2AEFA 4GL4A 3OMLA 4AJEA 1GEEA 1J49A 4CMCA 4PFJA 3ZHYA 4CLHA 3VZSA 1V3UA 1I32A 1CERA 1WDMA 5DP2A 3GEGA 3NTRA 3D3WA 3QVTA 3HFGA 4GMGA 1V3TA 3BMQA 4NFHA 5I8WA 1NAIA 1P0FA 3K31A 4QFDA 5LCXA 4XQEA 5G4KA 1A5ZA 3E9QA 2JAHA 3WQQA 3GGOA 3M2PA 4Y98A 4CQLA 3JYLA 1UXIA 1QLHA 1UZLA 4II2A 1BXGB 1P77A 3AUAA 1QYWA 2GF2A 5A5EA 4OO3A 3AW9A 3BYZA 1LQUA 3RUDA 4JQCA 4EITA 4CM6A 3OA0A 3E48A 2VZ0A 1JAYA 1D1TA 5IXSA 3E8XA 5TRTA 4WGGA 4BO9A 2CMDA 2Z95A 3EVNA 3TZHA 1T4DA 1EK5A 4IY1A 2Z1MA 2VYNA 4URFA 5K9ZA 5ENVA 4DLBA 2NVBA 2PD4A 1LC3A 3COSA 3LVFO 2P5YA 4PVCA 1ENPA 2ZQYA 2DPGA 4GX0A 5T8KA 1I5RA 4LW8A 2OOSA 3D3WB 1VL8A 3BMQB 1OMOA 4IDAA 4BQPA 5HA5A 1Y8RB 2E48A 3E82A 1EFLA 1GUFA 2PA3A 3NT2A 4XQGA 2IYOA 4E5NA 2VHZA 3WGOA 1MC5A 5JE8A 5L4SA 1YO6A 2AA3A 2YW9A 4GSLA 4XQCA 3H4VA 3BTVA 4KWHA 4DVJA 1TT7A 3GC6A 3PYMA 1TB4A 4L74A 1DC6A 4MVJG 4IM7A 3CXRA 2PFGA 5CHEA 1S7CA 4NJOA 4JBIA 1HZZA 3LF2A 3LK7A 1DIHA 3F9IA 4J0FA 4Q3EA 4CM7A 1IHYA 2NTNA 2EW2A 4GKBA 1M76A 2PD6A 3L07A 2VTDA 1PJ2A 4B7XA 3VOSA 4E5KA 3DZBA 3QVSA 4HFNA 5JCXA 1OFGA 2GN4A 4OMUA 2DVMA 1UZNA 5JSFA 4TRNA 4GMFA 2AG5A 2HK7A 1Q0HA 3LC7O 3P19A 1HE5A 2F1KA 3RJ5A 1LTHR 1ZCJA 4J91A 2AXQA 1QMGA 4ZQHA 5KJCA 4WCDA 1GV1A 1GAEO 3OJFA 2Q2QA 3C1OA 4GWKA 4FB5A 3OJOA 3JD0A 3WWYA 4OM8A 1ZJYA 1PL6A 1EVZA 2FPGA 3CSDA 1R15A 3O4RA 2HQ1A 3FTNA 2Q50A 4MP8A 5C37A 3KZVA 1LSUA 4ALIA 4YJHA 3CTMA 1HYEA 4FJ2A 4MKXA 2BH9A 2OFPA 4R68A 4O59O 4J1TA 3RC2A 3DMYA 3TQHA 4PLHA 2NQ8A 2O3SA 1W73A 2EWMA 2G76A 3QA9A 3T4EA 2AW5A 3QW2A 2Q45A 3L0DA 5COBA 5BSFA 3Q2IA 5DULA 1KVTA 1BXKA 1O5IA 2A94A 2VUTA 4OQZA 1YOVA 3GAFA 1NR1A 4YJFA 4DLAA 2JHGA 3OP4A 5DBGA 4LISA 2PKQO 1H2HA 4LCJA 4LMPA 1OBFO 2O4UX 3R3SA 2HMWA 4HWKA 5F5NA 3JTMA 3AOGA 3ETGA 4RF3A 4Z9FA 4JJFA 1K3TA 2V6BA 3GA0A 3IC5A 4NBRA 4CMAA 2EEZA 4OQYA 1HKUA 5DF1A 1MUUA 1O89A 3WSVA 1Q0LA 1B15A 5A9TA 3F3SA 3TFOA 1J5PA 2AE1A 1KY5A 3KV3O 3MOGA 1NX6A 5GZ6A 4XA8A 1A9YA 2B83A 3D4PA 3I5MA 4MP3A 5A9SB 1DC4A 4OXKA 1RJWA 1H94A 4BV8A 3EUWA 5T8KC 2EHDA 3NYWA 5CPFA 2O3TA 3K96A 3IIEA 1MB4A 3INGA 1BSVA 4R1TA 4R51A 3ZU2A 3WG9A 1XGKA 5BSGA 4XB2A 3GR6A 4KUEA 3AU9A 3ZWPA 3WYBA 2HO5A 5K0ZA 1GQ2A 1N1EA 1N7HA 2WWRA 1S6YA 4I5DA 1YQDA 3WLFA 3WTCA 4L4RA 4KOAA 4IXWA 1ZXBA 2Y68A 5JAIA 1ENYA 5DOZA 3OJ0A 3A06A 2DT5A 3UICA 1Q1NA 4CM5A 3ZWCA 3NDRA 5A9SA 9LDBA 3RFVA 4WNCA 3E5RA 1WW8A 3KETA 4CLRA 5KCZA 4ND3A 4R16A 3AU8A 3DAFA 2DBVO 4NBWA 2BI8A 5JCJD 5COQA 1GFSA 2WTBA 3K73O 2PR2A 2YUTA 2IXAA 4N5NA 4KTTE 3M1AA 3KYCB 4OOEA 1P1RA 4CM8A 2AQKA 1HE4A 3PJDA 1EEHA 1L7DA 2D3TA 3K6JA 4FC7A 1FDTA 1ID1A 2DQ4A 4D7AA 2EXXA 2H1SA 1NPDA 1ENOA 1LDBA 3OICA 1NVGA 4DIBA 3CPSA 5JO9A 4GLOA 2VNSA 1I3KA 3JQ6A 5DDIP 3V8BA 2V65A 1EZ4A 1HSOA 1YGYA 3ZWNA 1K0UA 4BIIA 1J0XO 4NU6A 3WGQA 4OSOA 2FPIA 3S2GA 5I7EA 5L51A 3B70A 4CLRB 4D45A 1HDCA 2CVOA 1W6UA 1ULSA 4FJ0A 5DBFA 4WLFA 1YS4A 1TEHA 5HS4A 4GLLA 3RCBA 4QT0A 2Y1GA 4NDNE 2C2YA 1PSDA 4XJTA 2Z1NA 4HFMA 4Q3BA 1KY4A 2DC1A 2FOIA 5JLAA 4ESOA 2DBQA 3KSDO 1BXZA 2Y93A 3U49A 1LDGA 2BFOA 3EYWA 2D1YA 2Y99A 1K6IA 5KVVA 4RF4A 2JAPA 1PZGA 3DC2A 4YT2A 4R4JA 3RC9A 3ST7A 1BHSA 1WZIA 4AJLA 3FSRA 1D8AA 1I3LA 1KC1A 2SCUA 4UEJA 3LF1A 3NAQA 2X6TA 1VSUA 5KNLA 4FFPA 3L6OO 1Y5RA 3V2HA 4FGWA 4FQ8A 3T7CA 1IPFA 1HT0A 3L9WA 2ZB3A 3WIEA 1NFQA 3GNQA 2NU7A 1VI2A 3JV7A 4OXNA 2FWMX 5HM8A 4AJJA 1YBAA 2BHLA 3U4CA 1U3VA 3RBZA 2WMDA 3MEQA 5TT1A 3DDNA 4TRJA 4I9UA 4CR8A 3GH3A 5EPOA 1TT5A 3D5QA 1NVTA 3F4BA 4RPJA 4U6QA 2X4GA 4BKRA 2I67A 4ZU3A 2HU2A 3UCXA 4X54A 3AY3A 1Z74A 3WWZA 2JKVA 2YDXA 3GRPA 2C20A 3DBRA 2X1HA 2JD1A 5IZCA 3RUHA 1QXSA 1LA2A 2PV7A 4YT4A 3ORFA 3WIDA 4XR9A 4ZQEA 4DPKA 3H2ZA 2YQ4A 3DFZA 3UW3A 4GWGA 3UGKA 1I10A 1CQJA 5L40A 1WDLA 1T1SA 3BTOA 4F46A 3DHNA 4I5FA 1WLYA 2X23A 3BA1A 3ZV5A 4EJ6A 4J90A 2ZQZA 5T67A 4YT5A 1FDUA 4OKNA 2P4QA 4BMNA 1XIVA 4ZICA 1EK6A 4BL5A 3UHAA 3RBXA 5H82A 3IJRA 2EKLA 4ILKA 3QE3A 1D3AA 2E49A 3ZI0A 3ZDFA 2JD2A 2IXBA 4U5QA 5B4TA 2J6IA 1QRRA 1ZXLA 5HS6A 2X5KO 2E82A 3ZN2A 4DC1A 3PJFA 2VRCA 3GAZA 3G17A 4EI2A 3K2BA 3H9GA 1HXHA 2OBYA 3Q9NA 4WLOA 1Z45A 4RO0A 4YAJA 3I9LA 4II3A 4E5MA 5CDGA 2ZYAA 4ZQGA 4NZ9A 4NJMB 4IDFA 1U5CA 3F5QA 2VZ8A 3NX4A 4XGNA 2POQX 5JMPA 2OO5A 1WZEA 4TZKA 5ADHA 1GADO 2P9EA 4C7KA 4OSPA 2AQIA 3GN1A 3D4OA 3TDKA 1FDVA 4F3YA 1ONOA 1VKNA 3U4IA 4BKUA 3BAZA 3PIIA 2O3QA 2PH3A 4U6SA 2Y0CA 2JHFA 4FN4A 4A5OA 4WNIA 1JWAB 1MX3A 4EEZA 4JBHA 1KS9A 1AN9A 5JC8A 5L7TA 2Z5LA 4IZIA 1I33A 3KM0A 3GVCA 3I3OA 1DOHA 4IINA 2O7SA 1R4MA 3LU1A 3SBOA 2O3UA 2XXBA 4CL8A 3HDQA 3HQ4O 3G1TA 5H83A 2G17A 4WE3A 3PJEA 1L1FA 4DLLA 1UH5A 3UVEA 2CDCA 2EJWA 4CM1A 1W0CA 3AFMA 3DAPA 1FF9A 3RVDA 3D4NA 4IDDA 3QWBA 1GDHA 4E21A 3JQ8B 5I9LA 1E7MA 5L7WA 1LEHA 4NFYA 4D79A 3E18A 2Q46A 1CJCA 1P3DA 1GZ3A 1ZMTA 1X15A 2O3RA 3S55A 4ZQFA 1YWGO 3EMKA 3UFXA 1UDCA 4CUKA 1C1DA 3PXXA 4GBJA 4EUFA 4LN1A 2BKAA 1U2GA 1KYQA 1X7HA 4ZHSA 1YDWA 2ZB8A 4DUPA 3A4VA 1HTBA 3JD1A 5KKCA 3GRKA 4H7PA 4P38A 1AE1A 4EDFA 2QG4A 2AG8A 4CM9D 1P1JA 2ZTMA 3RC1A 3WYEA 4JNKA 4B7CA 2X9NA 3EVTA 4KUGA 4WCFB 1E3SA 1CF2O 1NXQA 3H5NA 4Y6RA 4OGWA 2FZWA 2PGDA 3DBLA 3RUFA 2J5RA 1RM0A 4R9RA 4MVJI 4B4VA 1ULUA 3MJ4A 5JW6A 4IS3A 5LC1A 1D1SA 3WNVA 5GY7A 4PN3A 1HLDA 4BNKA 2Y1CA 2ZATA 1CYDA 2FR0A 2NUAA 1PZEA 3DEYX 4BVAA 5G0WA 1WNTA 4PLVA 4Q3CA 2C54A 5HBRA 4CMIA 1LDEA 3GVHA 4HKTA 3ONEA 3NDIA 1C1DB 1BWSA 1DAOA 1BTOA 2HMSA 2Y0EA 1E7SA 4E2XA 3QLJA 3S2IA 4NFSA 4D3SA 2ZCUA 1PGNA 4CMGA 4MVJA 4LSWA 1Z75A 1KBZA 3MCVA 3OIFA 1A72A 1E0DA 2WD7A 4JP3A 2I6TA 3DBLB 2VZ9A 2VCYA 2HK9A 2ZIZA 1C0LA 2RH4A 2B69A 1HDYA 3H5RA 1ZO8A 1E3JA 1QSGA 4FC6A 2ZTLA 3WFIA 4Z0TA 4OKIA 1QYXA 4I8XA 4EW6A 1EBFA 3GDGA 4AJHA 3AI1A 4PG7A 4BGUA 1U7HA 4PRKA 4Z9XA 4XZ3A 5J23A 3FNEA 3O26A 1KETA 3M6IA 1KEUA 3NRCA 3OQ1A 4CMIB 3JYQA 1B8VA 1IZ0A 4BO7A 1GY8A 3RSHA 3PFFA 1O8CA 4BMVA 5JAZA 5L95A 1G6KA 1C1XB 3ONFA 4YXFA 5G4LA 3A28A 1T1RA 3LQFA 5JAMA 2B4QA 1XELA 1ADFA 1NFFA 1A4IA 4NK4A 1UAGA 3WYCA 4PLTA 1RYDA 1I2BA 1NWCA 1XDWA 2BI7A 2HLPA 2WD7B 2X5JO 4DXHA 3D1LA 1IYZA 4CQMB 3OETA 5CPBA 5EMHA 1I3NA 3N58A 2UVDA 3NTQA 2ZTVA 2C0CA 4J49A 1SEVA 3QWFA 4CPDA 2VYVD 4YBZA 4E5YA 4J0EA 2ZCVA 4MKRA 2RIRA 3U62A 1JU9A 2BGLA 2D4AA 3EGOA 3U9LA 4WOKA 3U4DA 3ZZNA 2AHRA 4BO1A 4EEXA 1DHRA 2B35A 4IPTA 2X7HA 3ONDA 4KUHA 4UEOA 4QFCA 3V1UA 3I6QA 3I4CA 1GZ6A 3Q11A 3RKUA 3NJ4A 1I36A 1OAAA 3PRJA 4RPGA 2EKPA 3ZV6A 4UUMA 5BR7A 3HG7A 4H15A 1WVGA 3A14A 5CEJA 5L7YA 1W8DA 3ZW9A 1PJSA 5EESA 2HRBA 1PQUA 3DQPA 3VH1A 3WGZA 4AJKA 4Q3AA 3N74A 4UULA 2Y1OA 1U4SA 2GPTA 4L8VA 2C7GA 4EYEA 1AHHA 4TSKA 1ISIA 2DFVA 3VH3A 3AM5A 1SB9A 4QTZA 2W98A 1BGVA 1NYTA 1E7WA 5A3JA 3INRA 2GCGA 4HXYA 2CSUA 1BXGA 2O2SA 4YAKA 4IGEA 1AXGA 3H2SA 3TL2A 1R12A 3LT1A 4DC0A 1NQAO 4O0LA 5JPIA 3F6YA 3LSYA 3R1IA 4CQMD 5C7LO 4OOFA 1EDOA 2DUUA 3AK4A 3IS3A 3UCFA 3NEPX 1C3VA 1LBEA 3H9EO 4MVJM 5DOVA 3SLKA 5KIAA 1HSZA 3PVZA 1B0AA 3JSAA 1CWUA 4J2HA 1RWBA 2YV2A 1HF3A 5AVOA 4P4GA 3GUYA 4W82A 1B2LA 3CMCO 1QV7A 4XGKA 3VVCA 4RVDA 2PGJA 2GZ3A 2LDXA 4RGBA 4BNXA 4ALKA 2DPHA 1YH3A 3I9KA 3VDQA 1Y8RA 1RKXA 2IEBA 4D46A 3DZKA 3SXPA 3PZRA 4PLPA 2X0NA 3HDHA 3PWSA 3H9UA 3ZHXA 3QIVA 4E0BA 1EFKA 5L9AA 1CRWG 4WUVA 1JVSA 4Y67A 1Y9EA 4U0KA 1PWZA 3KLMX 5T6BA 4BGIA 4BNMA 3DOJA 1E92A 3ITDA 4BO8A 1M6HA 3SC4A 3V2GA 4W4TA 2A9FA 3GN2A 1E1NA 4O5OA 2Q1WA 3GVIA 1JQBA 4JP2A 4NI5A 5A06A 4MIOA 3PK0A 3PQDA 1ZBQA 4ZGWA 4E13A 1O95A 3ZW8A 4ZN6A 2OORA 2ZTUA 2PZJA 2O50A 3OH8A 3KOUA 5I8ZA 1QYVA 1GTMA 1MG5A 3LC1O 5T64A 5G0SA 4MOWA 1ML3A 2GO1A 3VH2A 3LT0A 1VJ1A 1XYGA 3FCOA 4Q9NA 3WX0A 3RWBA 4DPLA 2DFDA 1PL7A 5JMWA 4Z3KA 3PI7A 2EIHA 3LDHA 3HE3A 3T7EA 1HDXA 4E31A 4HADA 1DRUA 2O23A 3H9JA 4A7PA 4INAA 2I5PO 3AOEA 2C82A 3ETEA 1B3RA 1YB5A 4J4BA 3O03A 3JQFC 2VOEA 4YCAA 1NAHA 1ZJZA 2CDBA 4LK3A 4ND5A 3T4XA 5CEFA 2PKQP 4Y6PA 1MC4A 5AXBA 4WJZA 5COAA 3ZWBA 4XRGA 5H81A 2J3KA 3KYDB 2CF6A 4J16A 2PLAA 1BVUA 4EJ0A 4PG4A 4DQVA 1X13A 3WNQA 3C7AA 1EVIA 5CG2A 2CY0A 4A73A 1SOVA 1A27A 2ZYGA 1FJHA 3NT4A 4W7HA 1ZEJA 5LDHA 1ZH8A 1YJQA 1VM6A 2F00A 1XKQA 4CMHA 1R0SA 2W4QA 4PZCA 3BTUA 1L7EA 3SJUA 1P1HA 3WBFA 3ZWVA 5ICSA 4ND1A 3ENKA 4N18A 4EJMA 3QVXA 3SJ7A 4O63O 4C4OA 1BMDA 2VTEA 3VAZA 1IY8A 1RM5A 4BNWA 4WLNA 3ZV3A 3VTZA 3JYOA 3ZNQA 1E5QA 4RPKA 1EE2A 2HMUA 4TROA 2YY7A 2Q2VA 5TLSA 3INTA 1RYEA 3E5MA 3ZWAA 1DBVO 1TLTA 5JCJA 3RUAA 2I65A 3H65A 2GUGA 2ZB4A 1DIBA 3ADOA 1K89A 2IZ1A 2ZK7A 4Z6KA 2FR1A 4FD3A
chains in the Genus database with same CATH superfamily
1P5JA 7MDHA 5L45A 4DZRA 3WRWA 2J7PD 2JGEA 3ZPXA 4G81A 1NI5A 4YQZA 1HOTA 1Z3CA 3BQNB 4KRGA 1SCQA 1S3FA 2AOUA 4YVFA 2EIXA 1LB1B 4JQOA 1MA0A 1TQHA 5CYGA 3ASVA 3KSZO 1DBRA 4FEYA 4KXFB 2NQTA 3W2TA 1SNYA 1JFRA 3EISA 3I6ZA 4ZGGA 1IUKA 3ELWA 3NWEA 4I3GA 2L82A 3UAGA 3I9MA 1N36B 3QPUA 5AI8A 1RFLA 1PT6A 2F8LA 5MDHA 1CUWA 3LQ4A 2WSLA 3CT4A 4O2LA 4RK4A 1NBHA 3ER9A 3WYNA 3DHYA 1N4DA 5IJZA 1P74A 2DFKB 4ENSA 5IC6A 2B6HA 2H9YA 1M72A 4HUJA 4WJKB 1E3IA 4OF4A 3AM3A 3WFZA 3L6DA 3QWIA 4RYDA 3W6ZA 2CUZA 3WGYA 1PL8A 2XF8A 1SVKA 4OJMX 4DDWA 3W5DA 4WZAE 4COOA 3L8YA 5FQOA 3R3HA 3ENZA 3JX9A 1NXTA 1ISGA 2OZPA 3PD1A 3FRHA 4ID9A 3H3XA 4V3CA 1XALA 1LNZA 3AGQA 2V9PA 4RZIA 1ZN8A 5BWLA 4W9RA 1MC1A 3Q7PA 1EHIA 1OWOA 1EFCA 2WWGA 4K9MA 3WB0A 4EF4A 1ODKA 2YV1A 1V9CA 4WASA 2C5LA 1QP8A 3HFSA 1SQ5A 3H3FA 4E3ZA 1C3EA 4TT3D 1E77A 1GEGA 4QWWA 4ZEXA 5CW1A 5KTKA 5HFNA 3JZAA 4F2HA 3ND9A 4N39A 4EBFA 4MRVA 1JJ7A 1IHDA 2P62A 4B7UA 1D4ZA 1M2WA 1R3UA 2J45A 2VK8A 1D7OA 3K16A 4MW9A 4MPDA 3T9FA 1SFRA 4CUZA 5BQOA 4D3FA 1ZUWA 2ZJAA 3C3CA 1KWGA 1KS2A 1Z28A 1DXOA 1UWKA 4HFRA 1H9BA 2DUJA 2GFHA 4Y1RB 2WAYA 2P8SA 2Q5IA 3C39A 4EHHA 2OHHA 1T26A 4HCJA 3D0RA 3FIUA 1W4LA 3UAVA 3ADCA 4F92B 4LF4B 3ZLTA 5B57C 1QOQB 1NM5A 4H4CA 3PU6A 4RK1A 4NU0A 3VOAA 1FP7A 2CF5A 1TNDA 2YWDA 4KIUA 5H16A 2A5FA 2I2WA 3ECCA 3NATA 1ZN7A 2WYUA 2WYIA 4CDGA 2JJYA 3QJ5A 4BZWA 2OP0A 5BQ5A 4R9NA 4DA0A 1LDMA 3JAWB 2O57A 5CFNA 1LV8A 1CIJA 2ZYHA 1PF7E 1PI3A 4D5GA 1K7SN 4QUIA 5K3FB 3GXBA 2WZBA 2PH5A 1NVEA 5IAAA 1YASA 4RGQA 1CEXA 4ZEWA 3OEEA 4KXWA 4R71A 3K35A 3WC4A 1GM5A 1GTSA 5FO1A 1CRPA 3AP2A 4OK6A 2WSBA 4YTEA 1E2EA 4WZAB 2YJZA 1P2SA 1A9ZA 1QM5A 2JCXA 1L7NA 2QR3A 1XZEA 3K1TA 1LK0A 4ZOLF 2AXPA 2DPXA 3OJEA 4A15A 2ACWA 3UGJA 1YJBA 3ZV4A 9GPBA 1SPXA 4NBNA 3ZGOA 1F5NA 3A6JA 5CH3A 4K9PA 4EMSA 5IJ9A 3W3ZB 2P6RA 2H6EA 1SIBE 1A1SA 1QG6A 2Z9BA 1LLFA 2HEGA 3ZU6A 2O6HA 4CLXA 4NTZA 2PZLA 3WB2A 1P60A 3GJ4A 2IDMA 3LXMA 3QEMB 1EKXA 2ZUFA 4FWBA 3ES9A 2H4FA 4JOQA 5JBIA 1GQQA 1OLUB 1WM1A 2IHJA 2NV6A 3JQEA 3KRTA 3UF0A 3E3MA 3TN7A 1G21B 3OWOA 1QAQA 4ONEA 1O6ZA 3FI9A 3C3XA 1MO3A 4K81B 4B3HA 1M2VA 1IQPA 4BFCA 3DAOA 2G1AA 5K0BA 1Y3BE 2PBRA 4M8IA 3NRBA 4YH1A 3UKOA 2DZDA 3KIPA 3HB9A 4ERXA 5BN3B 3VR6A 4L75A 5C8YB 4LA4A 2ZIVB 1XL1A 1T0JB 2ATVA 1TKBA 1J1UA 2X0KA 3E1KA 1PRYA 1NASA 3OJXA 4PN7A 1VPWA 2Q1UA 2HDHA 3MT8A 4AS3A 1P2BA 3M1YA 4B87A 3IPYA 1M1NB 4AC9A 4XCVA 4UD2A 3QWHA 1H2XA 1ACJA 3C6KA 5NULA 3RTAA 3IEMA 3STVA 4GO1A 3JR3A 4K9DA 2ISCA 4AU1A 1DKPA 3TKLA 2VPYA 4HZIA 2P0AA 2OBNA 4YJGB 4P8RA 2BJHA 5D51S 4DLVA 1XU9A 1Z4QA 4CV3A 4BUZA 3MXOA 4Y9UA 1E66A 2Z30A 3OFKA 1K8XB 1P91A 2J48A 1CVRA 1JYEA 1SXIA 4WKGA 4INOA 4TMKA 2Y6UA 3WL6A 2X0RA 1E1DA 1Q0SA 2MDTA 2VTVA 2HJSA 4UHCA 4A0RA 3TECE 3HN6A 3HL0A 3DEZA 1M2VB 3LVQE 1QGZA 4YIKA 2O2CA 1H1TA 7REQB 4XIYA 5HHTA 2C2XA 4S1NA 1QCZA 3RB8A 1EXMA 3K6KA 1KDPA 1IIBA 4GRAA 4LECA 4OFWA 1BWPA 4TTQA 2XDQA 5HP4A 1JDJA 3PGKA 4R54A 1LDYA 4CIYA 1KYVA 3DTYA 1XYVA 2FMFA 2PZAA 1W4RA 2BM9A 1XXLA 2RJ3A 3IAAA 3QOWA 4JGBA 1C41A 3UWMA 4EBBA 2V98A 4ZAVA 3EDMA 5IAJA 1JG6A 4OXXA 3NM4A 4Z7QB 1L8LA 1QLWA 4KN9S 2JW5A 2BTOA 2BM0A 2H3EA 3C8HA 4F6LA 3AL0C 3IRVA 1R9MA 1PVOA 1DX9A 2X1MA 1XZNA 4FR2A 1YVUA 1M33A 2WWHA 2OVFA 2OXIA 4EAQA 3LD9A 4BCDA 2B98A 3A1NA 1NXVA 3I52A 3H2KA 3CC8A 4EI7A 4L9WA 1NX9A 3DCIA 5E1BA 5JYEA 2X2PA 4KN8A 1FSFA 1H85A 3V4OA 3KQLA 1R4NA 5EN4A 4A6EA 2GTIA 2OK7A 1U4OA 3BMOA 2E4UA 1M2KA 2FDRA 3ZU4A 1Z6AA 4P2BA 2YJ6A 3EZ9A 2ECQA 1A95A 1OQAA 3ND7A 4XKJA 2IYYA 5AVTA 3I2FA 1XUOA 2BRUC 2EWVA 5JDCA 3WAGA 4L4XA 2VXYA 2QYSA 3EFBA 1VG1A 3VSCA 4ZEVA 4LVCA 1V1JA 4URVR 1COWA 2I4LA 5EJ9A 5JATA 3ZE2B 3GLSA 1IH8A 4KITB 5G0VA 2TMKA 2R7MA 3PDHA 1JX6A 3CGGA 3CQ9A 3ESBA 4BMSA 1TZKA 5TQVA 1FJXA 3GJ3A 1KFKB 1MNQA 2A1TR 4ZQCB 3Q3CA 3C1TA 4CU2A 4KLNA 2ZP1A 4S3MA 4HDRA 2PSHA 4P36A 4AK9A 3LT2A 1XPUA 1SC9A 4IVRA 5U4XA 2UZ4A 1U2RA 1R5BA 3LCVB 1QUEA 4GZLA 5A3VA 3LKZA 3I62A 3LT5A 1XJCA 2JZCA 2HJWA 1UINA 2BFCA 1RI4A 2I99A 4GXNA 4LDNA 3LBIA 5G1NA 3TLCA 3WFJA 4D0RA 4DR2B 2HSJA 3MFYA 1CHNA 4M1EA 4IGIA 1ZN2A 5TGZA 4UEWA 1JIKA 2HLDD 3JZIA 1R4NB 4MX8A 3BMOB 5FA6A 1PK7A 4WLVA 2OVBA 1YT5A 1BX0A 4EX7A 3VX4A 3AB7A 3R4CA 3V4PB 1CT9A 4RMJA 2G7ZA 4W9NA 4YLEA 2IHBA 1QPZA 3RYHA 3WMXA 3N59A 2P68A 3K5HA 4B2LA 2I2XB 4FKBA 4NEHB 1UFVA 4IWXA 4F8YA 2RJNA 2QW1A 2DBYA 4IOKA 3RROA 4E11A 4ZCMA 2A4KA 3GH1A 2AEJA 4Q82A 3R7BA 4F97A 4FNMA 3URMA 2XUZA 3ICVA 1MABA 4C5AA 1L9KA 1HURA 1XO1A 4LDRA 3MILA 1AH2A 2P9JA 3FAZA 4OAQA 5DNAA 4R8RA 2WAAA 4XRRA 2HT6A 2NW6A 3LLUA 3H83A 4FR0A 4HDRB 1OAOC 1L7VC 1OWPA 3ICCA 1EX1A 3KL4A 4FHDA 2J5KA 4FMDB 4P32A 3QELA 4ZRNA 1D8TA 3OZTA 4H7FA 1WETA 2QM8A 2VJQA 2D62A 3Q3VA 3IXMA 4GZ3A 4NEGA 5KKAA 5IN4A 2OGSA 3H7AA 2OV1A 3L2OB 1Z0AA 4ZVVA 3KLPX 3EAFA 5AD1A 3ZIAA 3NT5A 1SC6A 3S5UA 2V0NA 1I3MA 2VP5A 4IUYA 1W4ZA 4PGAA 3L05A 3QVLA 3N8NA 1VL5A 1MFZA 4QGFA 3EG5A 2P5UA 5FFFA 1V7PC 2VYVA 3RUPA 3EPLA 3JQAB 4Q1AA 2QVCA 1X42A 3SICE 4RHUA 4R83A 4CHGA 4L3OA 1I0LA 1YIDA 2ZIXA 3BKWA 4PLGA 3PPXA 3RYHB 3URKA 1VIMA 2PUAA 5FOSA 2DR3A 2R8BA 4ROTA 5IBRA 1TVEA 1I7DA 3GFOA 3B1VA 1F3LA 3V1MA 1PR2A 1YA8A 2J9FA 4H60A 4C5BA 3DLPX 1NONA 3OQPA 1WXXA 1DI0A 1YGPA 5E6RB 5BV7A 3AX6A 3PGLA 1Q7TA 3P27A 1KMHA 5A6SB 2O2XA 3MTGA 1M54A 5GONA 3VVBA 1RHRA 3HN2A 4G5QA 4H6WA 2ZUUA 1ZK4A 2DB3A 1LLDA 1LPBB 3DZJA 3J7AC 4KBYA 3JQ9C 2ZB2A 3PTLA 1OVMA 2ZAOA 4A8HA 4B48A 3QELB 2QIOA 2F64A 1I6KA 2AN4A 3GJQA 3O8BA 1UP7A 2HAEA 2AX4A 4UUQA 1WXQA 3LQRA 3ILYA 2XW6A 1U02A 4B09A 5BMOA 5BNZA 4XARA 3ZWKA 1KZ4A 4YAGA 4BVGA 4EPVA 1XLUA 5JSZA 2KSQA 3DMGA 2A9PA 4P22A 4CQMA 4A27A 3IPXA 3MELA 4QXMA 1U2DC 3TRFA 1QP4A 4G0MA 2OAGA 3SEAA 1PKEA 3G8YA 3UC5A 4RACA 4XX0A 1GYPA 1YF3A 2K7ZA 2ZIXB 3IDFA 4DR4B 3OIGA 5L8VA 2FWNA 1HL3A 1BJTA 1N2BA 4MI1A 3VJMA 5HKLA 1OKKD 4OQLA 4DCSA 2IYUA 2J9FB 4MAAA 1D6SA 3EBPA 1QB7A 3MQ4A 4HTFA 2Z8XA 1H8ED 3LX6A 5IDYA 2WSMA 4HR7A 2EBUA 2VHYA 4FLEA 5BSRA 1KMHB 3RSCA 1IBRA 3L0PA 3BIOA 5K0JA 2VNIA 4Y8VA 4NENB 1MHTA 3WIOA 4NG4A 1Z0FA 3ZD8A 1G1MA 3GA7A 2PH1A 3K0HA 5J2UB 3VBEA 2ZIUB 1QYCA 5BT9A 4KIGA 3D4LA 4M3NA 2QY9A 3AKEA 2X0IA 3E7XA 4B73A 1GDDA 3CX8A 5LU9A 5DLPA 1H2EA 5KDLA 1CY4A 1Z15A 1SZCA 2AL7A 1KO1A 2OXFA 5FBQB 2FNAA 3O8CA 4R41A 5T4HA 3GZNB 1RWNA 1JBEA 1FDOA 3DZHA 4ZVPA 4XYEA 2NMVA 2XXAA 2NO1A 4I1PA 2N75A 4OXRA 4ZVRA 3C6MA 3KKMA 2QJOA 1Y3FE 4XX0B 1JKXA 1SOWA 5FUXA 1J2TA 2B4RO 5FV4A 2NAPA 3WICA 1N8KA 3PTAA 1AF4A 2WOOA 3VPHA 3PCTA 4DSNA 1A69A 1ZAYA 2DBRA 1SVWA 1X1TA 4AICA 3L92A 1IVYA 3F6BX 4HB3A 3CT6A 3GNSA 1LCIA 3H97A 3L4SO 4JXKA 4C04A 6YASA 1LGYA 4BPBA 1N6KA 2F8MA 1KEPA 2X3YA 2FPSA 3QF7A 3ASYA 4OLJA 4RA6A 4AKGA 4AF7A 2H06A 4GNKA 4XB1A 4U7JA 5EXTA 4E08A 1VJGA 2WP0A 2GEBA 4XIGS 2AYZA 2QGNA 4Z1MA 1QYRA 5IAKA 3MTQA 4GI5A 5G41A 1JNXX 1KYXA 2VNHA 3WDKA 1AHIA 4O6VA 3LZ6A 4PRYA 5EIEA 4EKYA 3VI4B 1ZAKA 3C6ZA 4L9AA 2I66A 2VHJA 1R0KA 2I8CA 2VJPA 2PS0A 1SK8A 3HJUA 5KWEA 2QSUA 4FIDA 3BXOA 2YW2A 4P58A 4V2IA 2ZIEA 2HRQA 3HMKA 1OXTA 5SYAA 4TQAA 2RHMA 1WPQA 1RS0A 2KS6A 3KUXA 1F9AA 1SOMA 3OOJA 4HQ6A 2O54A 4WFQA 3SYNA 4PO8A 5G2OA 4CLDA 3EK2A 3ZLAA 3BMCB 2BYTA 5LDDC 3A2KA 4OK5A 4YRDA 4F5DA 3ZCQA 1EYZA 4IQGA 4C03A 3NYRA 1IUPA 1W75A 1XDBA 3HDTA 4FJ1A 4MV5A 4QU9A 3W04A 3QQPA 3EPPA 3EWAA 1M0WA 2R84A 4BZXA 1PX0A 1RIIA 4FFRA 1ZK0A 2AMYA 2VA9A 2IV7A 5JWRA 1GG9A 1HZJA 5ER6A 2NYRA 1JR3E 4YUXA 5TDHA 1YBVA 1B42A 1SU6A 1UPBA 2UVPA 1FU4A 4RQUA 4HEA6 1K8RA 4KR6A 1JR6A 3HMQA 3C3BA 1XKLA 1Y1KE 1E2IA 1GL3A 1KJQA 3FGOA 4XUEA 4A16A 1E3WB 1BRTA 1ZVMA 5ER9A 2ZT7A 1U8TA 1ZJ5A 1AMOA 4G9BA 4QGGA 2FUKA 1ONNA 4LXQA 2RI1A 1KMCA 5K3CA 2Y0DA 4FINA 1H2ZA 1VJTA 2B0CA 3D9QX 4MS1A 1Q17A 2E5WA 4RD2A 5JBQA 2UAGA 5ISMA 2RAFA 4DR6B 1WAMA 4JITA 4PIMA 5EUMA 2M6RA 5CRIA 3ZCTA 1RM4A 3H1BA 4D9EA 4U02A 5LA6B 4NYJR 2GZRA 2ZJBA 4LJLA 4RD1A 4ARCA 1XZHA 2J6CA 3AETA 4JSYA 4MWSA 4R84A 1EJBA 3HB1A 2UYQA 2J0QA 1WUKS 5K6AA 1T5OA 3PHCA 3SM9A 1PUIA 1LNQA 2HQBA 4TKUB 2JJ8A 4S0XA 3TCNA 1R6BX 2N47A 5EXSA 4B3TB 2E3JA 4JP1A 1ZIYA 4A8JC 3E4CA 1MX9A 3AHJA 1PFGA 1Z4OA 4MUIA 2YZMA 2Q0QA 5SYNA 4AZWA 1XMVA 2QTHA 2UVPB 4OX9Y 3UMSA 3KYIB 2ET6A 3JWJA 1N3YA 2IWRA 3JCZA 2UXDB 1UKZA 3SK0A 1UODA 3CTPA 4HNRA 1VBFA 2XDYA 2BI4A 2W58A 2QVBA 1CNMA 2AEEA 3DMDA 3Q8XB 2A9RA 5AW8A 1RCFA 1W4CA 5ITWA 4GGMX 4CMJA 3W4JA 3AZQA 4J6FA 2CC2A 3AF0A 2HUNA 1X1DA 2KYRA 3C24A 3LUKA 3OJCA 4O4JF 2R5NA 1KDVA 4B84A 4YR7A 3F47A 2XJ9A 4X7PA 5LOVF 1NQUA 4Y2VA 4DMHA 1WHSA 1G3IA 2X3FA 3V8QA 3H99A 5ECYA 5H9VA 3LFHA 4K40A 4EARA 5C2JB 1CZHA 3O21A 3PQ4A 1XTUA 5C1OA 1JALA 2B78A 1Y8CA 2FVXA 3JU3A 1YAJA 2OGZA 3L6BA 3O4IA 5DSZA 2WM3A 2O7QA 1HFKA 1W30A 3F8SA 4LUCA 4N9QA 4P3YA 3RRYA 4BYGA 3WGUA 1KVQA 1R16A 3OWXA 2QTTA 3B1WA 3FD8A 2Y1XA 1NWHA 3L5OA 3MJFA 4YNBA 4C2AA 1J7KA 2JJ2D 3U13A 2QN6A 2A1UA 3N86A 4ND7A 1FUKA 4HAWA 2WNHA 3AWDA 4J0DA 3F6RA 3F90A 3U5TA 4HUQB 2PZGA 2VDRB 3CURA 3G7NA 4Z8XA 1GR1A 1JEAA 1SHLA 1NP7A 3OZIA 3PQ2A 1ZFNA 2JPDA 1DWQA 3W7BA 3LUFA 5KQLA 1CRZA 5KSZA 3CZ9A 2XUGA 4QPJC 2YHIA 1T6NA 4TL8A 5I9NA 5JARA 5DEIA 4BO3A 7YASA 2QYTA 1AXRA 3BMNA 2YY6A 5B4VA 4ZPXA 1ZD3A 1YTUA 4AZSA 5HOEA 1YMVA 4B40A 1KK0A 4MWZA 1JHDA 1XZMA 4RXMA 4YI3A 4M0FA 4CG1A 3GGPA 1ZGBA 4F3TA 1JYSA 5AVRA 3WLNA 4C0KA 1IAQA 1NVMB 2ZT6A 5E95A 1K75A 2ZI9A 1OLOA 1RZUA 1AGRA 4J1SA 3IOMA 1XQ9A 3IDAA 5ARCA 3W7AA 1T2EA 2JIZA 3CW8X 3EBLA 4FOOA 4BNLA 1TQ6A 2FUCA 3G0CA 3NGXA 4IHJF 3RS2A 1FSSA 1WB6A 3VX3A 1S89A 2A9KA 2A86A 1OTXA 4GKVA 1FS5A 3MCUA 4R2MA 5KEIA 1XQ1A 2OQIA 4YDSA 5CYPA 2F9MA 1R8SA 1G8SA 4WKCA 1HG1A 2OFFA 4FT2A 1FFEA 1E9DA 3K2QA 3DTNA 4X8MA 3STUA 4A2PA 1NATA 5JQGF 1GVNB 1WXHA 2A1UB 2OB1A 4I6EA 5K8TA 4CN9A 1MAWA 4DLZA 4W8GA 5D7BA 2LDBA 1Y37A 4GOOD 4L5AA 4BPRA 4CF5A 1W7AA 3PE6A 4K46A 4K88A 5IP5A 1EDBA 1RI5A 2I3AA 5FUYA 4YDQA 3EA4A 4ZAFA 4BB6A 2AK2A 1CUAA 1T2CA 1XTIA 1CIPA 1P4HA 1YHYA 3SS8A 5KC9A 4HRYA 4KX5A 2LVBA 4IG9A 4YMIA 2ATEA 4TLBA 3TO5A 2RH8A 3TGWA 1HNZB 1KDTA 4GE0A 4CLOA 3CCFA 1UBMS 1XRSB 1EGVB 1JVNA 1G16A 2QX6A 4MQ5A 4XDZA 2CNNA 1SUDA 4I8DA 4YASA 3ER8A 1V47A 4EELA 1N2CA 1ZP6A 4GBGA 4DY4A 3UKJA 4OAPA 1LI7A 3TLGA 4QHSA 4BATA 4DIDA 1T4CA 2B92A 4HPJB 1ISHA 4PSUA 4JI1B 1PZMA 4E88A 3B6IA 1TIKA 4W5JA 2FHSA 2Q2WA 3EN0A 3DT9A 3PC4A 2C94A 3KB6A 2WF6A 4LOKA 4RVOA 1PNOA 5EGSA 4BLSA 2CW5A 1HYHA 1Q21A 2RFLA 3PDJA 3TLJA 2ZUEA 4F96A 4M54A 3DTVB 3K72B 2PUEA 1EWQA 1SA0A 2F4VB 5K4GA 1P1IA 1QS0B 4R01A 5EP2A 3FYHA 4M8SA 2FPGB 1YKFA 3AUUA 1UPFA 3FI0A 4AKSA 4PXAA 3LO5A 3HRHA 1DLIA 4DJDC 4DXDA 1H9AA 1MO6A 1BG6A 4YJHB 3S2YA 2DLDA 5CA0B 5JANA 1JF8A 4X6LA 4MV1A 2JFOA 4MZXA 3RIYA 2IV3A 1FC0A 2H4ZA 2R25B 4LY0A 2OHXA 3FMPB 3ZZTA 4CF4A 1HC7A 4MDEA 1L5VA 3Q0EA 3P0RA 1DX4A 1I80A 2IOFA 2ZE5A 4CLOB 2QLBA 1XCBA 2FPMA 1EHCA 4RF2A 4BE7B 4GM4A 2IXEA 1ECPA 4BZZA 4DNOA 1PJ3A 1V1RA 1XWFA 1JHRA 2PYDA 5KQSA 3Q3JB 5FEUA 1YRWA 2QD4A 2VJAA 1YOVB 3X1ZA 4YJFB 5EJIA 5LD2C 1EH5A 3VZRA 2V6MA 3VTFA 4WOCA 1T4CB 2B2XA 1UT8A 1ZIPA 3JQGA 3KT3A 4AWAA 1G8HA 3P9CA 5L3QA 1I7NA 1U9ZA 2FMKA 2GLXA 1RXCA 3PQ8A 5HR5A 5DTRA 5LYYA 2Q3EA 4GPEA 3AR8A 4KYTA 4QUDA 4V0RA 2WE7A 1KKLA 2WA1A 1G8PA 2B1GA 3H9QA 2GB4A 3TQCA 3QKSA 4YRSA 1LS6A 2QV7A 2OCLA 5ES3A 1L4EA 1ACLA 4H6VA 4CNQA 1QLJA 4DE5A 1MQAA 1YBHA 1KH3A 1SBTA 2ZB7A 5A3RA 4HVLA 1WNFA 1Q0UA 2WT8A 1Q1ZA 3B3AA 3IBCA 1FIUA 5ULLA 2OXEA 3JVUA 4RV9A 5EQFA 3VYVA 2Z2XA 4ED9A 3Q98A 2OGWA 3HB5X 5KYXA 4JVLA 2L2QA 2C4KA 2FPXA 1E2MA 2IHKA 2IK8A 2VJLA 1DC7A 3A1UA 3WMWA 3O90A 4NVRA 1F38A 4HF7A 3G9QA 5ALEA 1NLYA 3F5SA 3NTOA 2EX0A 4EMTA 4PCLA 1T9CA 1IY9A 4ZO4A 2QI9C 5A3SA 5D6NA 4Z0HO 4NHEA 4EKEA 5KTNA 2JAQA 1RRCA 3I9V1 4RLQA 4M87A 1U0LA 3R5SA 4B43A 5JZMA 1G5TA 1V1RB 2H18A 4FSXA 2B94A 3PLAE 3TK1A 5K3EA 1UZMA 1U6JA 2O52A 3QXJA 4RD3A 2R6FA 4OM7A 1KVUA 4PHGA 1LRLA 3EMVA 3NHBA 3ZE9A 3JQGB 3F3YA 1J7JA 2ZGVA 4TZTA 2X0FA 4DDUA 4R69A 3FKSD 3NEJA 3JATA 1HETA 5H3CA 2BJVA 3I42A 4A82A 4RHFA 2YWGA 2P1ZA 5AVVA 4UNRA 4G2TA 4BQIA 2I7DA 3ZH9B 2CUTA 3I4FA 1UMBB 2FSVA 1C7RA 4QQ8A 4DXAA 3F1LA 2ZREA 3EEQA 3ORYA 4IRMA 4JL5A 1P2DA 4YRCA 1IN5A 2IHVA 2GZ1A 3HHPA 2H63A 3D6FA 4KFRA 4GAEA 3WRXA 3R7SA 1TM2A 3UBTA 5KYXB 4C0AC 5TR9A 4KO1S 2TSYB 3UA4A 3RHFA 1AGXA 1QZUA 3FH0A 3GLRA 4M9ZA 1ZD1A 5FOTA 3LHDA 5T57A 1L5GB 3U17A 4DEVA 4CTKA 3EWNA 4P98A 4DLTA 4AL4A 1W88A 5LXTB 2V1UA 5AO9A 4F2DA 1QQ5A 2HH9A 4DA4A 3FTFA 1RWXA 1VHWA 3OJLA 1YE5A 2DUMA 2ADMA 3UWDA 1FYEA 4IUBS 1NZJA 1ZNQO 1ILEA 1D6JA 2J4CA 3CZRA 3T7TA 5JFOA 3QENA 5HUHA 3TL6A 6GPBA 1TJ5A 5AOVA 1XEWX 1USWA 1TEZA 2GX6A 5B2EA 1W5EA 4NAHA 5BSWA 2P11A 3I0NA 3QPBA 4JXJA 1V5EA 1THTA 4E5VA 3JATB 1LRJA 2OZKA 3C14C 4D5EA 5C5IA 1D6MA 1PR6A 3R5XA 2HNBA 4P5PA 1AQUA 1N2EA 5FPTA 3G2NA 1Z7YA 3ZBTA 2VP4A 4DWVA 2RHWA 1RQ7A 4FTWA 4R1SA 2I6FA 1CUYA 3GV0A 3ID6C 5AXAA 3RGWS 1I6MA 1NKTA 2R6ZA 5JROA 1KEZA 1T5IA 3VISA 1XVLA 4O2AB 4RDHA 5JZOA 1BA2A 2PMCA 5L3SA 3OPYB 1NQTA 3HXKA 1G8FA 1PJLA 4YP7A 3A6GA 1MW8X 2AZXA 2PUCA 3WRYC 3O7MA 3ITEA 3IURA 2QF7A 4KZPA 3P20A 4H7KA 1PLJA 4HLUA 3BHIA 1MRSA 3MXTA 2C7BA 3PEFA 3U7EB 1BEZA 3AEUA 4F06A 3WLJA 1JT9A 4IMPA 4Q7JB 3IPCA 1IPHA 2AKYA 1QYDA 4OFZA 4XX1A 1G8KA 3GP8A 3BZWA 1JB9A 4WA7A 5FBZA 3FDZA 3DMHA 1K0FA 4YUVA 4Y2TA 1A5AB 3PGXA 2NADA 3HGMA 5B36A 3JQQA 4PZUA 2HCBA 3PE3A 4B6OA 3CCBA 4PWYA 1VGVA 1O8BA 1UWCA 1TKRA 1U99A 2OZLB 3KPWA 4I4TB 4LSMA 4PSKA 3DLCA 4XQ9A 3W8FA 1DBPA 4ZCTA 1SO8A 5JO0A 1A9QA 3P9YA 4MRSA 4NZNA 1R5NA 3WHLA 4E30A 4ECAA 1AS0A 4JR0A 3B6EA 4KIFA 3BK1A 4ND8A 3T9AA 2HA0A 5KNCH 1GNQA 1Z2AA 3QF4A 5FI5A 3MRXA 3TG8A 3N8DA 1E32A 4HP8A 2H5JA 1J2EA 2A9QA 5L3SB 4LMBA 2QTGA 2JLSA 2GM3A 2FR8A 1CS0A 3DO5A 4LTNA 4OHBA 3SJAA 2O07A 3SI7A 3OIDA 3FJYA 3KHSA 5DBIA 4JNGA 2BMVA 4MVCA 4EIWA 1K97A 3QZUA 5K0LA 4O4LA 3JVDA 2FFAA 2XB6A 4OHXA 2P2CA 6ADHA 1SMKA 4B32A 4NU5A 2LZ0A 3I1JA 1TT5B 3M5PA 2OC9A 2AD1A 2CZCA 2IOFK 5AM0A 4EB6B 2IUSA 1N6LA 3NASA 5DHRA 5TIIA 1QZ3A 4AUEA 1KAMA 4LXXA 4UPEA 1ZEMA 1RPTA 1T0BA 4GMHA 4LZAA 4C76A 4OU4A 3HWWA 4X93A 5E4TA 1S2OA 5JY1A 3MS2A 3DBRB 1K5DA 4FR5A 3E84A 2IZ0A 4KXMA 2ZI7A 4KVAA 4OXIA 5D84A 3WQRA 4ZI7A 1N0WA 2FFHA 4KH0A 3U4QA 3G2IA 1SUPA 4HNGA 3WKAA 2GAIA 1Q2XA 3FLMA 2IF0A 3MD0A 5IK2D 5DMXA 1UJ5A 4N4AA 2QPLA 4MUFA 5FTKA 4JKOA 1KP9A 1MB3A 2QSJA 4JP8A 3H8WA 4OUKX 5FI3A 2Q1SA 4ENVA 3GPLA 3E1GA 3D7SA 1UBLS 2ZRMA 3ASZA 3LL7A 4QRIA 5HSGA 2IKSA 3QFCA 4W5WA 4IIJA 2VOJA 1GAQA 3NTXA 2HJRA 3QBTA 1CUHA 4YGXB 5EIXA 1P7PA 2QXTA 2XRMA 4GI3A 3UAYA 4BVHA 2ONJA 5HKKD 2H1LA 1LZKA 1OREA 3BL6A 3CN7A 2W6JA 3HLKA 4RS4A 3GEDA 4M38A 3A04A 4U0JA 3AG6A 2ADFA 3UJPA 3PC6A 3QUTA 1DVRA 2RHDA 2WNSA 4HAYA 4N5HX 2OP1A 1L4UA 5C8ZA 2ZM5A 1XNHA 5J5VA 5I7UA 4OPMA 3RREA 1G3RA 2QUKA 3REOA 2HCTA 4IJSA 2X41A 1CJUC 2Z58A 3HBAA 2XMSA 1F7VA 5CBKA 5GMOA 4XGIA 1YS1X 3NBFA 3YASA 3IBSA 2MU1A 4BNDA 4FDAA 3W2HA 3EFOB 4CGYA 4EL0A 4DVGA 3ETDA 5H59A 3QFFA 3AIIA 4WECA 3UUWA 1J8QA 2UYCA 3N53A 4BMYA 4H4DA 2XWPA 4D4IA 1VLJA 1ZKMA 2VAMA 3BMXA 1JJFA 5EQDA 3U4QB 1OPXA 2A58A 2WIKA 4BWVA 4CIWA 5AW6A 2OUIA 3IBYA 3S44A 3V55A 3W6UA 3WL5A 3FYUA 10MHA 4UQPA 4B9EA 3PYLA 5E8JA 3FUCA 2XB4A 2C03A 4UAGA 2FQ1A 3EY9A 4LBZA 3FOCA 4HDMA 2DM6A 1M5RA 3KPUA 4ZVUA 1NW8A 3DZGA 4OP2A 2I9KA 4JDUA 4JLDA 3WIUA 5EMLA 3CUKA 1Z25A 2W2MA 3QY9A 1DFHA 2HF8A 2WSSA 3HVUA 2WUFA 2NVOA 3LZDA 3ZQ4A 3SNHA 1ZIOA 1Z6ZA 1H2BA 1MG0A 2ZU0C 1F8GA 1NVDA 3QWAA 1ZIXA 3L4BC 5IXYA 4NYJQ 1J23A 2B37A 4TLLB 5KO2A 1PFVA 2ZRIA 2V7EA 3KEGA 3ZU3A 2V0GA 2D59A 4MVJE 1JSXA 4I1UA 1FMTA 2BOVA 1JQDA 4WADA 1JFFB 2H2HA 3ZKAA 1WRBA 1XSEA 1YZUA 2HWYA 3AERB 1F6DA 3ROPA 5JRJA 1RJFA 2G5CA 1NDQA 1F0YA 3PFWO 2LP4Y 4G0OA 3RFTA 3AHCA 2HM7A 4TWJA 4BN4A 5FLEX 5BSVA 1V9LA 1CUJA 5DCYA 3K20A 4KQIA 4Q4JB 1U9CA 5K0FA 4JVOA 3PNBA 5L6MB 4Z7JA 4MS3A 3EQ2A 1MAHA 2QNIA 3PC2A 4I2NA 2P2GA 1E5DA 2QL5A 2GXSA 1RTKA 2F1OA 3C5CA 1CF9A 1ZX1A 3K3PA 4FNGA 4HWSA 1TM3E 1FYXA 3MWYW 4KO4S 4IX1A 1DFIA 4ZT7A 1IFXA 4B6FA 4BBZA 4DIMA 4ZJZA 5B7QA 2QTCA 5C52B 2XF2A 4KSYA 3GLQA 1NTRA 1DQYA 2PUJA 4RM3A 3F46A 2O5CA 1WXEA 3QUQA 4F4IA 4A6XA 2H5IA 3C6QA 1KF0A 3PUIA 4OY3A 3CF4A 2A7QA 5D3ZA 5D1HA 4D92A 1KEVA 2INGX 4C14A 2Y1FA 1IBMB 4EW1A 3GLIA 3D1VA 1J33A 2HI0A 5TJHA 4TYPA 4ZCIA 3PWZA 3GG2A 2AQHA 2OO5C 1DV1A 4J1NA 4DBLC 2QMZA 1M7HA 5F2KA 3W79A 3O8QA 3SHQA 4A5SA 2P35A 5ED0A 5EP4A 2WHRA 1VI5A 1VIYA 2Q9AA 3C98A 1SB8A 1TU0A 1PKXA 4L6CA 2LD4A 4RFSA 3P97A 1ZG3A 2C5GA 3LPAA 4LOJA 4C29A 5DMHA 3RK0A 5DYYA 5DTQA 1RZRD 2X19A 3GCGA 3HWSA 5HTOA 1N5RA 1TXGA 3OY7A 2IEGA 4U7DA 4MS3B 4JI8B 3HZZA 2RGGA 2ZT8A 4LVNA 2WU3A 4A2WA 4DIOA 3O8NA 5I7RA 5CCBA 1P61B 5CB4A 3MINA 4KTVE 4NARA 2GNPA 1XD8A 2P9CA 3GGGA 5IAOA 3ORQA 4WEOA 1QG2A 4C7OB 1TA0A 1WMSA 4BJHB 16PKA 3T1YB 2A8YA 2CFOA 4G86A 2YIJA 1ZQ9A 3AEXA 1MIHA 1WZ2A 1YDMA 3WRVA 4D97A 3QFRA 4N3AA 1PE0A 1WY5A 3GW8A 3R24A 3W1EA 3EIUA 5DI9A 2PRYA 5LNK6 2WK1A 1PAUA 1EX6A 1W49A 3NETA 4JVSB 4MUYA 4B6JA 3D1JA 3TZQA 5HKBA 1KI8A 5DXJA 1EFHA 4DB4A 2R1ZA 3RF6A 2QRHA 1W0JD 2ZDQA 1POXA 4CF6A 1UM8A 3OZFA 2YCBA 1YXMA 4FMCF 4BO5A 5CA1B 1JI3A 1X14A 3O4FA 1L4HA 4LVOA 4EI8A 4YYZA 4LWZA 2GAFA 3U44B 3TI7A 1YIAA 3AR7A 3S40A 2HNAA 3TE6A 2XEXA 3TB4A 1RLTA 4FCWA 1LRKA 2KE5A 3N2ZB 1YFLA 1W1UA 3OQHA 1N78A 1KJNA 1R5OA 3C7CB 3KVRA 3MJSA 4XVRA 1Z0DA 5JSYA 2VDOB 4EK9A 3NV9A 3IUSA 3NMUF 3ZC3A 4EVSA 3S8YA 4DCCA 2WM9B 3MINB 4XPZA 4ON9A 4AXBA 1ZD4A 3KBOA 1OZ0A 1T1GA 4Q21A 5A9RA 1QH8A 4I2VA 1FMCA 4Q4DA 2BGKA 1YQ9A 4UHHA 3OPNA 3VR6H 5FNVB 1E0JA 3KB2A 1TJ3A 3MRSA 4AYWA 3HV0A 3GJ8A 4QM6A 2CNWA 2J3MA 4IDNA 3D6TB 3MBKA 5HE9A 3RYIB 1P8AA 3LMKA 2VDQB 3G89A 4WOJA 3DMPA 3DVAA 3HKCB 3OG9A 5DNCA 1M6YA 4CL3A 4E1VA 4NF2A 3EZYA 3V4FA 5EHZA 3IESA 4EY6A 4LTDA 2GHQA 1JXQA 2CDRA 5EJAA 1QIKA 4W9MC 3ZS8A 4CV1A 5IYZB 1QVWA 2H2DA 4PRLA 5JIBA 1CZUA 5DN6A 3KT8A 1QCCA 3KOOA 3KXPA 3QMVA 4J4TA 2XADA 3QYAA 1DWUA 5CT9A 5FV7A 3GUHA 4DJFC 4C3UA 2GDZA 2EYUA 3I0MA 3PUKA 2EF0A 1JILA 4H7HA 1WMBA 1WP4A 3R0IA 3VHQA 4DSTA 3PUHA 3SS7X 4UASA 3W0LB 3AEKB 1D0SA 2GD1O 4WK6A 4WFJA 3RV4A 1H5NA 3KOMA 1GEEA 1J49A 2C9MA 4CMCA 1IZ8A 4PFJA 4NONA 4HZUA 3VZSA 1V3UA 4BLQA 4RTLA 1CERA 1WDMA 3DNMA 5DP2A 1XRPA 3OQIB 4KR7A 3LUDA 4IEEA 3HFGA 4NFHA 2P6NA 5I8WA 1LD3A 1CR0A 3CLVA 4UXIA 5E6UA 4AO6A 4FUTA 4XQEA 2WF7A 5JRZA 4FONA 4QJ5A 1PFKA 3VGJA 3WQQA 6REQB 4DOMA 3N07A 2JLRA 3H18A 4Y98A 1P8JA 4PTYA 1PV2A 2RB4A 1OXSC 4QWMA 1GKYA 1GGNA 3FNBA 1J1ZA 2XV1A 4M1OA 4TS3A 4ZAGA 1P77A 2CHGA 1QYWA 2GF2A 3AVXA 4OO3A 3AW9A 5IJXA 3ZCSA 3CS3A 1VPTA 3I9FA 4EITA 4CM6A 3OA0A 3N2EA 3DVSX 2VZ0A 1Z4KA 1EM8A 3L0YA 2Q6TA 3L8GA 3PUVA 4Q7MB 3E27A 3S68A 3UK2A 2IH4A 2O8BA 1ZD8A 3IYLW 4HGQA 1EAYA 3E8XA 4WGGA 4BO9A 1KQOA 1M8JA 2QRVB 1QJ4A 2ISSD 1CY7A 2Z95A 4O2BA 3G2LA 3NVMB 5ENVA 4H08A 1K86A 3QMWA 2NXJA 1G59A 5EA2A 1GCIA 4CI9A 1ZMBA 2QRPA 2DPGA 3L7KA 2MTBA 2OOSA 4HQFA 3T4UA 4B46A 5FB3A 3HJGA 4Q4CA 5I4BA 1FMLA 1V4BA 4KH1A 4BQPA 1Y8RB 3DAYA 4OQMA 2V6JA 4H18A 1GUFA 1OTHA 1CR4A 2RHLA 2WW8A 3EXIA 3WI7A 1DTWA 4US2R 3WGOA 2F8SA 4QOFA 1A9SA 2RGAA 4IVQA 1YO6A 3F98A 3M4YA 5ALWA 4ZVOA 2Q6OA 1TK9A 4BP3A 4QGBA 1AKEA 3H4VA 1IN1A 1GKLA 4ZYTA 3G8DA 3GC6A 3PYMA 1DNPA 4QGAA 4RTQA 1O6BA 5CIQA 4MVJG 4IM7A 5SZKB 1D2GA 1T8SA 2BW0A 2FGKA 2PFGA 2Q3DA 2R8ZA 3D8BA 4LQDA 1S7CA 4E14A 1PDWA 2YZKA 3LF2A 3LK7A 4JBIA 1JIQA 4LKOA 1CHDA 4UQOA 4CM7A 4O0MA 3ICWA 1FQOA 1SC1A 2NTNA 2EW2A 3P26A 4P2GA 2J3EA 2CFSA 2PD6A 3PI6A 4TSRA 2IP4A 2J3DA 4QHYA 1W0KD 4HS4A 4OREX 1PJ2A 1I6WA 2ZDHA 4HQKA 4OCZA 3TQFA 4B7XA 3VOSA 4AI6A 2WB2A 3O8RA 4BQEA 3AR6A 3DZBA 3QVSA 5JZ9A 1ANKA 2ZE7A