1I3MA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3mA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3mA01
4EJMA 5A3VA 1OAAA 3RJ9A 2D5CA 2QYTA 4FFRA 1PGPA 4WASA 1QMGA 3WJAA 4J7UA 1IY8A 4AJOA 4JLWA 4QECA 3CUKA 3FD8A 4L74A 1EBUA 2AQKA 2IZ0A 4DPMA 4Q3EA 3KLMX 9LDBA 4IS3A 5TJHA 4BQRA 4JX8A 1C1XA 2GZ3A 3WQRA 4RCVA 3DONA 3QLJA 4RVGA 5ENVA 4B8WA 4PN3A 3ASVA 1PJ3A 5TSDA 5HA5A 4CMAA 5JAZA 2NLOA 5EL0A 1C1DB 4I8XA 3MCVA 4YQZA 5CAEA 1PZEA 1ZXLA 1LU9A 1SEVA 2VTDA 4FGSA 3WOHA 1NQAO 2QX7A 3GAZA 3PLRA 3JQAB 3RWBA 2AA3A 1ZW1A 1NHWA 3A14A 3F9IA 1HTBA 3M1LA 3GGPA 1K6JA 4CM4A 3AUAA 1ULUA 1P1IA 3NUGA 3GZ4A 2J3JA 5JCJA 3VPFA 5BSHA 4RVSA 3NDRA 4ONEA 2HJSA 4Q39A 4FOOA 1DBVO 3ZWAA 5L51A 3K30A 2O3RA 4R9SA 5DOZA 3FBGA 3TRIA 1FJHA 3RU7A 2Q99A 2RBEA 4AJIA 1CF2O 2D3TA 2O3JA 1F8GA 5G4LA 1KS9A 1F06A 1A7AA 1N7GA 1ONOA 4OM8A 1Z82A 4U0JA 3V1YA 5L40A 1HT0A 1XHLA 5KVVA 1DLJA 2GLXA 1H93A 4E5NA 4YCAA 2VWHA 3H5AA 2GF2A 1LSOA 2OUIA 4NBVA 3PYXA 4DQVA 3AU9A 3DZIA 2UYYA 4RPGA 4URFA 3V1TC 3BTOA 2DBQA 4ZRMA 4OMUA 1HL3A 2BFOA 1BXKA 3V5NA 3LF2A 1GEEA 1HWYA 2VWQA 3AM4A 3GUCA 3VOSA 3ZWWA 5LDHA 2RHRA 3ZN2A 4RF4A 5IDXA 3PDUA 4IXTA 3DWFA 4IQGA 1HYHA 1VL6A 1O8CA 5EINA 5JY1A 3ADPA 3ADOA 1CDOA 3JD2A 3F46A 2J8ZA 4HXYA 3G79A 3GLQA 2DQ4A 1XEAA 3B1FA 2WJPA 3DMTC 2PH3A 3PWSA 1CEQA 1U2DA 3R0IA 2D8AA 4NFSA 1A71A 2ZYDA 4Q3NA 5F1KA 1GADO 2HK8A 4NG5A 1HEUA 1B16A 2NSDA 3DMTA 3RC2A 4BGEA 5A03A 3I9MA 5MGBA 2VT3A 5FI5A 4C7KA 5EQFA 3JQ9C 4CM9A 5EERA 2DBZA 3D3EA 5JDCC 1B3BA 1PJCA 2PR2A 3JQ9A 4AJEA 4RVUA 5JDCA 1BG6A 1H5QA 4AVYA 3GFBA 1Y5RA 2J6IA 2PZJA 5FEUA 3CE6A 5COAA 2PV7A 1X7HA 3R1IA 1U3WA 3GEDA 2I3AA 1BMDA 4B4OA 3H9QA 4WNCA 5ILOA 1LEHA 1F0YA 2YFQA 1WDMA 3DZHA 3T7CA 5CEJA 2E48A 1U3TA 2LDBA 5CDSA 1EVIA 5K0ZA 2P91A 1UAYA 2GN4A 2FPPA 3D7LA 3I3OA 3I52A 4IBOA 2X0RA 5AXDA 3JQGA 2X9GA 2A92A 5JMWA 5BSGA 5DDIP 3NGLA 1KOLA 4A73A 1ZCJA 5TNXA 1QLJA 3I83A 4JK3A 5LCXA 4LMRA 4JBGA 2YHIA 5HS6A 3L4SO 4MVJI 1TT7A 3AUTA 2R6JA 2R00A 1KVSA 1P1RA 1KEUA 4J43A 4S1VA 4LN1A 5K6AC 3W8EA 3AM5A 1HXHA 1WDLA 2W90A 2EKQA 3GN1A 4LVUA 3ZH2A 1GTMA 4CR6A 1OOEA 3S2FA 3OJEA 5K6AA 4XR4A 4LRSB 3WYBA 4MIOA 1WWKA 1CQIA 4JROA 1WNTA 3RASA 4NH4A 4NU6A 4ND4A 4XYGA 4Z0TA 4BO9A 1I33A 5JW6A 1C0KA 2EEZA 4XA8A 4DQUA 2DUWA 3JTMA 3TL2A 2Q2VA 3FPCA 4I5EA 4EJ6A 2P9CA 2V6FA 2ZQZA 2GYYA 4EI2A 2O7SA 4PLVA 5I8WA 4PRLA 3N74A 4XRRA 1U4SA 1T2EA 3PXXA 3OQBA 3PVZA 4OXKA 2VYVD 1A4IA 3DBRB 1E77A 3GEGA 3ZHXA 4YAKA 3RC1A 2QYSA 1DB3A 5T8KC 2OORA 3ANMA 5T5QA 3FF4A 3WLFA 2AQIA 4Q3AA 3F5QA 3VPHA 1T2DA 5T8KA 1PSDA 2EW8A 3HQ4O 5TX7A 1NR7A 1ORRA 1KY4A 1R0KA 1ZEJA 3GVPA 3Q2KA 4U5QA 1MB4A 3WLEA 1TEHA 2WDZA 2C7GA 4XDYA 4EEZA 1KC3A 5DBGA 3PFWO 3HB4X 1GUZA 1QR6A 5A9RA 3HDHA 1R0SA 4BNTA 3AY6A 5TRTA 3EC7A 1G1AA 1O6ZA 1K3TA 3BMNB 4ZQEA 4B3IA 2AG5A 1JDJA 3UHAA 1PGJA 1ID1A 1PZGA 2Y99A 4TMFA 3SVTA 2PTGA 3W6ZA 1GZ6A 3QVTA 4UULA 4KDFA 4FQ8A 4TROA 4U0KA 4O1MA 3WBFA 3V2HA 2I76A 3SC4A 2IXBA 2XF8A 3PZRA 4KUGA 4N5NA 1TI7A 4XCVA 4MVJF 3KTDA 3QSGA 5KJ1A 3VH2A 4BO7A 2CF5A 5H81A 3JSAA 4R1NA 5AYVA 4RVHA 2J3IA 1YQXA 4PG4A 3QV1A 2C2XA 3WQQA 4R1SA 2AQ8A 5F3RA 1Q7CA 3OIFA 1EVJA 4IS2A 5KJFA 4PG7A 1EEHA 1UP4A 3F1KA 4PLHA 4R9RA 4CLOA 5KJEA 2VN8A 3UVEA 1LQTA 2PGDA 2HCTA 3SXPA 4BO1A 1IPEA 1JVBA 1UZMA 3H3FA 4BO5A 5B1YA 4YWJA 1Y8RA 3O03A 3ENKA 2C29D 2B69A 1JQBA 1UXIA 1VLLA 2WD7A 4J1NA 4KUHA 1X15A 3DZKA 2JD2A 1LNQA 5A5EA 1DHRA 1NQTA 3OFSA 1Y81A 2XPCA 5L3ZA 3AUSA 1ZBQA 2FR8A 5THQA 3TF5A 3OA2A 3ZWCA 1PJBA 4ROSA 3ZWPA 5I7SA 4GLOA 1XGKA 3K31A 1E6WA 4NJMB 5F21A 3WGYA 2H6EA 1E7YA 3DAPA 5CP8A 3W6UA 3O8QA 1B8VA 2IXAA 2ZYGA 3H2ZA 2BRUA 1EUZA 5ES3A 1W6UA 2NU6A 4NK5A 3DHEA 5GZ1A 1PZHA 1P77A 1WMBA 1Y9AA 3VTFA 1RKXA 3MOGA 4XKJA 5L9AA 3D3WB 1P0CA 4NNJA 3GMDA 1HDOA 3MJTA 4E4YA 5BR7A 3GGGA 4BNUA 4NJOA 4DL9A 5A4DA 3TFOA 1NPTO 2DUUA 1ZFNA 5JO0A 3WMWA 3LYLA 3JQFC 4WCFB 4YQYA 2Q1TA 3HG7A 1YGYA 2C59A 1PJSA 2BFPA 2DTXA 4L4SA 5ICMA 3TZ6A 1JLLA 3JQFA 1ZSVA 1O95A 1VSVA 3GT0A 2OGUA 1JKJA 1LTHR 3QVOA 3D0OA 1Y7TA 4CLHA 1YRLA 1CYDA 2EIHA 1NYTA 4MVJG 1NFFA 3A1NA 2I9PA 2FP4A 4UREA 4IDFA 4TKMA 1I2ZA 1MFPA 3D4NA 4RVDA 2VT2A 2P9EA 3RU9A 4OGWA 3VVBA 2EV9A 1BHSA 5FF9A 5JAQA 5ICSA 4J4TA 3OSUA 4OIMA 1U9JA 3M2TA 1KEPA 1V0JA 4E5YA 4GWGA 3VPSA 3WB9A 2PLAA 4AJNA 1DXYA 4MPDA 1QORA 5ILGA 1D3AA 1NFQA 3H9GA 4TRRA 4UAGA 5GY7A 1OMOA 2NU9A 3OJFA 4DLLA 3Q1LA 1C0IA 2TMGA 3ZNOA 5BNIA 5IF3A 2H9IA 3GF4A 1YONA 3ZWBA 3ROMA 4XYEA 3AOEC 3ASUA 3UUWA 1CJCA 3Q9UA 3PIDA 4L0QA 5JNLA 2FR1A 3AOEA 2BD0A 2WSBA 3KYBA 4H7PA 4GSKA 5IJZA 3PJEA 4IDBA 2EKPA 3C3XA 4IXWA 3D5QA 4BNZA 1ZJZA 7MDHA 1BW9A 1YXMA 3Q3CA 1IUKA 1MUUA 2AE2A 3ONDA 5TGDA 3INTA 3VDQA 1PL8A 3R6DA 2VZ0A 3PEFA 4MVJE 4CM3A 2H63A 4NBWA 5L7TA 4QQRA 4GLLA 5DOVA 1ZMOA 2WD8A 3GEMA 4UEOA 4DBVO 4K9DA 1BTOA 3MEQA 5G0SA 3I6IA 4DA9A 1LRJA 3UF0A 3C7DB 1UXKA 3CKYA 1B2LA 3TZCA 1YBAA 3FI9A 5BQFA 1B8PA 4D46A 2W8ZA 3TZKA 4XQ9A 2X5OA 1PGNA 4L9RA 3C24A 1DIRA 3CXRA 3I9KA 1LI4A 4ND1A 4XD2A 3V2UA 3L6DA 2PY6A 3AY3A 3BIOA 1UP7A 2AEFA 4GWKA 5KOIA 4LSMA 3RC7A 4GAEA 3I1JA 5JS6A 3KYDA 4CR7A 4DMMA 4HV4A 4XIJA 2ZB3A 5G2OA 4Z9XA 1NTOA 2X23A 4Z0PA 1G0OA 1BVUA 1KIFA 4PLFA 3QVWA 3GG9A 1T24A 4TWRA 3ONEA 3GDFA 3IAHA 4DWVA 4RQUA 1EFKA 3K8ZA 4HFMA 3MJSA 4KUEA 1KEVA 5HTOA 1U7HA 2FZEA 2QHXA 3COSA 4BS9A 1PZFA 4PZDA 3HDJA 3JQ8B 3DOCA 3PK0A 4A10A 2Z1NA 4L8VA 1FDSA 2WMDA 5DP1A 4G2NA 2O3QA 1DSSG 3AW9A 5A5FA 4OXNA 1GZ4A 1W0CA 2RAFA 3IS3A 3FNGA 3ZGYA 3GN2A 4ZRNA 4JGBA 2CF6A 3DTYA 3W4JA 3LLVA 3RD5A 4ZD6A 2Q50A 1BXZA 1Z75A 4I5DA 1LSSA 1JW9B 4DLAA 4ID9A 4AJLA 3ORFA 4XQGA 1CERA 1A7KA 2GN9A 4WLFA 1A5ZA 3N58A 3GDOA 4BMVA 4JJGA 4XRGA 2NQ8A 1GYPA 4JP3A 4YT2A 3KYCA 2OP0A 4MDHA 1DFIA 4CQMD 1V8BA 1XWFA 2IEBA 4RF2A 4IDEA 4I1IA 3SLGA 4CLRB 2NU7A 3GVCA 4BL5A 2IDZA 2HKIA 3CH6A 1FDVA 1NASA 1HDGO 1BRMA 1ZUD1 3IQDB 3JQ7B 1XR3A 3OH8A 4QXMA 2OXIA 1HDZA 2Y1GA 1VE9A 4MP6A 3W8DA 2R2GA 4TSKA 4CODB 1X0VA 3BMOB 5EJ2A 3RVDA 1LXCA 2CSUA 3PRJA 3RROA 3WQSB 3AI3A 1HDCA 1E3WA 4J3FA 4ZQFA 1LRLA 2BGLA 3WICA 2BGKA 5C37A 4ZGWA 1H6BA 1YVEI 3D1LA 2PGJA 4RDHA 4YAGA 3OM9A 3UCEA 2A94A 4YA6A 4CQLA 2ZKLA 1PIWA 1WVGA 5IXYA 4J1QA 2YUTA 2VHXA 2CMDA 4IMRA 5EMHA 2ZCUA 3D64A 1R0LA 3M6IA 3WX0A 1NVMB 4FFNA 5JCJD 4D42A 3C7AA 3DHYA 1AHIA 1PL7A 2VZ9A 3ITKA 3ROKA 1QYXA 3PQEA 3BYZA 3C1TA 3ZV4A 1SNYA 4XZ3A 4GKBA 3T4EA 2HQ1A 3B70A 1NVTA 4IGEA 2IE0A 1D1TA 2HMUA 3CMCO 1GV1A 3C7CB 4BNGA 1UXHA 2OMEA 3GZNA 4J9UE 2VHYA 4NPCA 2V65A 2X86A 2NVUB 3RIHA 2BFAA 1JTVA 3SX2A 4R69A 1T1SA 3NKLA 3MJVA 5KCZA 1IL0A 3F3SA 4H15A 3E9MA 3WYEA 4WLOA 4I9NA 1YOVB 1R4NA 2HJRA 3WG9A 3ONFA 1HLDA 3U0BA 3P5SA 1NHGA 4MVJA 4RQTA 2D0IA 3NDIA 1SEPA 1PWZA 4EUHA 1NP3A 4F6LA 1A27A 1AUPA 3WGOA 4ALNA 4IUYA 1PJTA 3IP1A 4MO2A 1IHYA 2H1SA 1N5DA 5G0WA 3RCBA 3VZQA 2DU8A 3WIEA 1VI2A 4CM8B 1HKUA 4HP8A 4BNFA 4WOKA 4YRBA 2JJYA 5G0UA 1AE1A 3ZU3A 3FWZA 3NTRA 4AJPA 2HRZA 1NXQA 4YT8A 2CVOA 5JY6A 5A06A 4J7CA 5IFLA 1UXJA 4IDAA 5L4LA 2BI8A 2PKRA 1ISJA 3L9XA 5COBA 4CM9D 3WSVA 1U1IA 4UVHA 3ZWNA 4J2HA 3L0DA 4U7WA 3C1AA 4BNKA 4FFPA 1VSUA 4BO3A 4IGFA 1V3VA 4BNNA 4BUCA 4NBUA 2Q45A 4J0EA 4DIFA 5IZCC 4CQMA 3QVSA 3V1UA 3VH4A 3AFMA 1X1TA 4WLUA 3U49A 1JWBB 1LLQA 5KVCA 4C4OA 2NACA 2HU2A 4A0SA 4N7RA 5B4VA 5IZCA 4Y67A 3FR8A 3RUDA 1I3LA 5AXCA 1IYZA 4XQCA 1MC5A 1QV7A 1C1XB 3ABIA 3FWNA 1W4ZA 1PGOA 2GSDA 3PDJA 1XCBA 1RJWA 4M55A 2ZTMA 4BB6A 1EK5A 2C54A 1GPDG 2G1UA 4WGGA 2FRDA 3UOGA 3F5SA 4XWYA 4DYDA 3BTSA 4D3FA 5KTKA 4OQZA 2FY8A 3V8BA 4F6CA 4MP8A 1HRDA 1N2SA 1MG5A 1ZK1A 3PLNA 4MOWA 3CZMA 4Z9FA 3IP3A 1IULA 4G5HA 5HM8A 3RQSA 5KJ6A 3L07A 1DIBA 5C7IO 3DOJA 5JDIC 4DBZA 2X58A 4HY3A 4OSPA 1EMDA 1XA0A 3PZBA 5B37A 1X7GA 4NU5A 5JDIA 5AXAA 4ZJUA 1M75A 3IJRA 4P4GA 3SBOA 1DRVA 4FC7A 1PJ4A 4FIZA 4AL4A 4FFMA 3HNPA 3MJ4A 3G0OA 4Y9DA 5LC1A 1E7RA 2C5AA 3E82A 1ZSYA 5JSFA 1ONNA 1RYDA 4JIGA 4CMJA 3MTJA 4WLNA 1K5HA 1U28A 3FSRA 3LLSA 3PJDA 3BHMA 1ZK2A 3BTUA 1U2GA 1E3JA 1ZK4A 1JWAB 4ZU3A 4D41A 4YJHA 1LC3A 2Q4BA 4F45A 3ANNA 3PFFA 1LDNA 1ZO8A 2DPGA 2DFVA 4D0SA 1UAGA 2DPHA 2YZ7A 2I99A 3EDMA 3OMLA 4YAEA 1I3MA 1DO8A 3FBTA 5TQVA 2RHCA 4PG5A 2JAHA 2JHGA 5TT0A 3RUIA 1B0AA 2VQ3A 3SC6A 2NU8A 3TL3A 3ZU5A 3L9WA 2ZTVA 1HYEA 3EHEA 4BO8A 1XQ6A 2VHZA 3ZV3A 2AW5A 3VC7A 1EUCA 3E18A 5IDWA 2YHUA 5ADHA 3H9UA 4P22A 1HE4A 3KZVA 4CR8A 1DC4A 4W7IA 4CLEA 2Q46A 3AWDA 2WEKA 1P1HA 4MINA 1P1JA 4ZHSA 1KEWA 4RZIA 2Y1OA 3I9LA 2F00A 5F1PA 4KDEA 3WGQA 2I65A 4CL3A 1EFLA 1S6YA 3RAJA 3MWDB 4YJFB 3LT2A 2HMWA 2O3UA 4HNGA 3NTOA 4MKRA 2YQ5A 3N7UA 1AN9A 1YKFA 4XEHA 3IL2A 1OZAA 2RH4A 1I8TA 3HWRA 2FR0A 2QQ5A 3BAZA 3JQGB 5JO9A 1E5LA 1LDGA 3FNFA 5FFFA 2GR9A 4IDGA 2X0NA 4E5MA 5DT9A 4RJTA 2B36A 3QJ5A 3NT5A 3JQCA 3T7EA 2OO5A 4FC6A 1EK6A 4S3MA 4MVJP 4XGIA 2WYVA 3ZWYA 4E2YA 1RM3A 3F1LA 2P2SA 4KTTE 1HSOA 1P45A 3G17A 3I9NA 1TA4A 2JCXA 3MZ0A 2Y05A 3RBXA 1ZK0A 3GA0A 1X14A 3EW7A 8LDHA 2NWQA 4EDFA 5IDQA 3OQ1A 3H9JA 3OJ0A 4YAJA 2HMTA 3ZHYA 4PZCA 2OBNA 4PLGA 3KRTA 3JYOA 4A26A 1P33A 7ADHA 3BMQB 3TZQA 4Q3BA 1KVUA 1PS0A 4XYBA 1TVEA 4YTEA 6ADHA 1N8KA 5L4NA 1QYCA 2E4AA 2SCUA 1WP4A 4BV9A 1PQUA 1LQUA 1HF3A 4YB8A 1E1NA 3LT1A 3UW3A 1Y6JA 1YJ8A 2X5JO 3KOUA 4RPJA 1XYGA 5KKCA 2NTNA 2POQX 1BDMA 5ITVA 4DMLA 4AJ1A 1ZH8A 1NWHA 4UEJA 3H5RA 4M89A 1DFHA 4PG6A 3KSZO 1P74A 1PR3A 1NVGA 1IOLA 4JBHA 1QYWA 3EZLA 4II3A 4JJFA 1KVQA 4N5LA 3ZHBA 2J5RA 2HMSA 2I66A 4N5MA 4BNLA 4HFJA 1U8XX 5A02A 5JAIA 4IM7A 4FDAA 5DNAA 3AUUA 4A5OA 4MIEA 3RBZA 2AQHA 1Q0HA 4FW8A 4Z3DA 4RLSA 2ZK7A 1YQGA 4M86A 3WBBA 3T4XA 2FN7A 4ALIA 4B4WA 2DBRA 2G0TA 1OI7A 1UZNA 1TT5B 4IQ8A 4J49A 4KWIA 4YBZA 4Z6KA 1HETA 4OOFA 3K5PA 3GY0A 6LDHA 2Y93A 4WKGA 2YY7A 1F12A 1C0PA 3WWZA 3W8FA 1UP6A 3WTCA 3NT2A 4HX5A 3X2FA 1PEDA 3K96A 3L6OO 3L4BC 3GQVA 4R51A 3QHAA 4BGUA 1T4DA 3G49A 3WWYA 1GQYA 3BZUA 3L4BA 5DF1A 3RUFA 1ZNQO 2O2SA 3G1UA 5HWSA 1SMKA 4OOEA 2NM0A 1LX6A 1T25A 2ZJ1A 3NV9A 2O4CA 3G1TA 3INGA 5L53A 2FWMX 2GNAA 3GHHA 1I5RA 3H8VA 4CLOB 2GRAA 4ND5A 5H83A 1ZK3A 3JV7A 1KBZA 2HLPA 4D43A 3E6AA 4JBIA 2Y0EA 2Z5LA 2FOIA 3B1KA 1Y8RB 3TDKA 4FD3A 3INRA 4CUKA 1O0SA 3TOZA 4GI2A 3GUYA 2UVDA 3VHRA 3HJAA 1BDBA 4EITA 4B8ZA 1DJQA 1HZJA 1SOWA 4EW6A 1I30A 3O4RA 4CJXA 1RPNA 4CL8A 3GNTA 5T67A 3E48A 2I67A 1NQ5A 2OZPA 2VTEA 5U4QA 4GBJA 1M2WA 4CMIB 2NADA 3VKVA 4ALJA 3O8QB 1CRWG 5F5NA 2FPIA 2VCYA 4CUJA 1VM6A 3EYWA 1E3SA 2D59A 2V6MA 4HFRA 3WXBA 1K0UA 5DCWA 2Y1EA 3UAGA 5CEEA 5DBIA 3FRJA 2PWZA 1X13A 4IMPA 3ANLA 1BXGB 3L77A 2J3HA 5I7EA 4GGOA 1ISGA 1PGQA 3KSDO 1SB8A 2VNSA 1ULSA 3DOOA 4J1SA 3AOGA 4PCVA 1WPQA 3ITDA 4ND2A 1K6XA 2GERA 3UCXA 3IUSA 3WS7A 3KV3O 4DYVA 3UCFA 5KNLA 2JFHA 1EE9A 2C82A 1GD1O 4FPXA 3ZWMA 1XELA 1U5AA 2X5KO 2D4AA 3C1OA 3TPCA 4J0FA 5I8ZA 5MDHA 3RKRA 2HK9A 2FSVA 3LQFA 1J4AA 4W99A 2V6BA 1GQQA 2QIOA 3SJ7A 2C20A 4CMEC 2PH5A 2G17A 4J16A 2HO5A 1GPJA 5F1OA 4CPDA 3P2OA 2VOEA 3D3WA 1P9LA 4CMEA 3PPIA 3OETA 4WCFC 1F17A 3GRKA 1XDWA 4R54A 1PS9A 1FDUA 3DBVO 4YJGA 3WNQA 4CM6A 3OF2A 4WCFA 5EESA 2ZJ0A 1E7QA 4BMSA 2E82A 2X6TA 3DZBA 2EERA 4XB1A 2Q1SA 1LSUA 4GPD1 4IJVA 2Q2QA 3NRCA 1U4OA 1JA9A 3DTTA 4HWKA 4PLPA 4YXFA 3ICPA 1GUFA 1H94A 1E1LA 1C14A 4RORA 5C7OO 2FZWA 3JD0A 4ZICA 1NQOA 4BNXA 1EDZA 1GCUA 1DAPA 1DC3A 3OA0A 4RDIA 4WOJA 5TT1A 4AFNA 1GYRA 1E0DA 2JCYA 5TC4A 1AGNA 2Z95A 1PL6A 3K6JA 4FN4A 4EEXA 1ZKMA 4CMGA 3G3EA 4B3HA 1YL7A 2PNFA 2W2KB 1O9BA 2X1HA 4J4BA 3TZHA 4HKTA 2DAPA 4MKZA 2JFFA 4W82A 4FFOA 4PG8A 4CMCA 1MG0A 1GY8A 1HLPA 2A35A 3VTZA 1GCOA 1KYQA 1P1KA 5JLAA 1I3KA 4JXKA 1BWSA 4LW8A 1HSZA 4Q9NA 1XKQA 3VPXA 4LGVA 2HSDA 1N9GA 2RH8A 1V3TA 1PTJA 1QSGA 3C8MA 4UUPA 3U62A 3PHHA 5KWEA 3VPGA 5BT9A 5A1TA 1EZ4A 5KJCA 4J2OA 1YDEA 1DPGA 2EHDA 3ZZNA 4RL6A 1GQ2A 1JKIA 5EPOA 4IZHA 2W2LD 2JD1A 1IB6A 3LSYA 4PLYA 1GYQA 2NVWA 3KYDB 5ER6A 4E5PA 5CEFA 2CVZA 3ZU2A 2Y1FA 2DM6A 1E6UA 4ESOA 4ILKA 1JU9A 3HN2A 3KEQA 3DZFA 4NBTA 5CPFA 4XJTA 3TOXA 2CDCA 1YBVA 1DC5A 1R4MA 1RWBA 4MVJD 4XQEA 4BGVA 3HUDA 5CG2A 2DVMA 4JN6B 5DZSA 1R12A 4CM7A 4FJ1A 1V9LA 2EJVA 2Q1UA 4E13A 3ETDA 4DXHA 4R5HA 1H9AA 2Y68A 1E3IA 5KKAA 1R66A 3KBOA 3ZNNA 2VZ8A 3ZW9A 1E1MA 4DUPA 1LSJA 4IQ0A 4NDNE 3I6QA 4E2ZA 2XXBA 4MIYA 3WIDA 5BSEA 1QV6A 1GL3A 4R68A 1ML3A 3LC2O 3BHJA 4P8RA 1L7EA 9LDTA 2VRCD 3CEAA 3GMSA 1F8FA 3S2GA 1TXGA 2PK3A 5G0VA 5COQA 5EN4A 4XX0A 5I7FA 1ZSNA 1WW8A 2CVQA 3AK4A 3IMFA 1MC4A 5JE8A 4OSOA 1NWCA 4OKNA 3IDSA 2WYWA 2E6UX 5HBRA 5IXSA 1DHTA 1J6UA 4B7UA 3IUPA 3OHSX 1UDBA 3UFXA 1YS4A 5CDYA 4WEQA 1JVSA 3PYLA 1ZIDA 4GX0A 4FOSA 5A9SB 1R15A 4QEDA 3JQ8A 3FTNA 5IAAA 4Z0HO 2F1KA 2GO1A 3PGJA 3MJCA 1UDCA 3NJ4A 3HADA 3RBVA 2FHSA 2PZKA 3ST7A 3JCZA 3WGGA 3PP8A 2GASA 4KOAA 4XR9A 3I4FA 1LLCA 4ZN6A 2D2IA 1E3WB 5HS4A 4NMHA 4GVXA 1Y1PA 1LDMA 3RFVA 3U4CA 1MP0A 4BO4A 2ZTUA 1LRKA 3GC6A 3MTGA 4U6SA 2BFMA 3ROPA 4XGNA 2BH9A 4PLTA 2YDXA 1PR9A 2JL1A 4CQLB 4EYEA 1PJQA 3EUWA 3ICCA 2BMAA 1P3DA 3S2EA 5L45A 4KP7A 2QW8A 3V2GA 2OFPA 4CLRA 1G0NA 4TVBA 5BNFA 4B79A 4QO7A 2D1YA 3PHGA 2HMVA 3ON5A 1YH3A 4I9HA 3JQ7A 2C07A 1QG6A 4OH1A 3O9ZA 4R5MA 4OXYA 1OC4A 2NNLD 3JD1A 1EVYA 5TIIA 2B35A 4NBRA 1GAEO 5H82A 2UV8A 1HDRA 2EXXA 4EUEA 1D8AA 1CETA 1B7GO 1MV8A 1PS8A 2LDXA 3I5MA 5B4UA 3FPLA 1HE3A 3H2SA 1BSVA 3WNVA 4K6CA 5FI3A 4IY1A 2GD1O 3WR5A 4CLDA 2VHVA 1E6EA 4PLCA 4A27A 2AG8A 2W2LA 3HDYA 4E30A 3JQAD 4E21A 5DBFA 3QY9A 1ADCA 3QRWA 1VJ1A 4J7XA 4O63O 3SEFA 1R4NB 2FMUA 2FSSA 4E12A 3DEYX 4L4XA 3GVXA 1QYVA 1WLYA 4OAQA 1P0FA 1EQ2A 2DKNA 2QRLA 3A28A 2B4RO 5B4TA 1GDHA 3WTBA 1NAHA 4NZ9A 1YB5A 3DBHA 3ETEA 4L4RA 5GMOA 1HE2A 3GNSA 4RPHA 1K89A 3D5TA 1HYGA 1MXFA 3RUCA 4WPGA 1F14A 1JN0A 2PZLA 3DL2A 2G82A 1LJ8A 3AJRA 3E1KA 4NFHA 3LU1A 2NVUA 4OHUA 2GZ2A 4UUOA 4W9NC 2UUOA 3RSHA 1I2CA 3L6EA 3DB2A 3VH1A 4AJ2A 1M67A 1ZMTA 4W9NA 4E5KA 1Z73A 4JCOA 1EE2A 3LZ6A 2NVBA 3MWEB 3ZDFA 1YOVA 3RUEA 1A72A 4RZHA 3KETA 1YJQA 2VRCA 2AE1A 1IPFA 4QFDA 1QLHA 3JYLA 3I4CA 4NR0A 3WMXA 1T1RA 3BMCA 4J1TA 4ZQGA 1BVRA 2PD6A 3IOYA 2YYYA 4GQAA 1Y8QA 4CQMB 2G5CA 3DZGA 3K92A 1XIVA 4TVOA 1U7TA 4BKQA 3P7MA 1KY5A 3E9NA 3WGZA 2Y0DA 4JP2A 4TZTA 4DIBA 2VWPA 2ZTLA 4JJIA 4UUNA 4W4TA 5G4KA 4UVGA 4CLXA 1B14A 2CD9A 3X2EA 3DBLA 2O2YA 3JQEA 2P4HX 3I23A 4LCEA 5L95A 2CNBA 2AXQA 3DHNA 4BMNA 4PIVA 4BKPA 3NYWA 1M6HA 1YE3A 2YJZA 4TRNA 4WLVA 3S2IA 4MVJH 3WDSA 4D45A 1B15A 1U3UA 3GG2A 4N54A 3QWIA 4Z3KA 1V35A 1Q7GA 3KM0A 2RIRA 3Q6IA 3JQDA 3RJ5A 2CY0A 2Y66A 2D5AA 3KSUA 4P4NA 2OL4A 5T6BA 1PWXA 3O26A 3QWBA 1EVZA 3SLKA 1DEHA 4TRJA 3AM3A 3JYPA 2AMFA 3MOIA 4MJLA 1I36A 4CM4B 4DGSA 4DLBA 4BNWA 1K2WA 2PD3A 4DREA 1K6IA 3H7AA 3U9LA 2IRWA 4IDDA 3ZW8A 4NHEA 3EK2A 1D1SA 3TQHA 4GVLA 1MGOA 3AU8A 3D4PA 4Y6RA 4DPKA 2PGLA 4BNVA 3A06A 1NBOA 1KETA 2YV2A 4B7CA 1ISFA 1ADBA 1DRUA 4O5OA 5JCXA 3IKVA 3AFNA 3FTPA 2X0JA 4XYLA 1U8FO 4C7JA 1CWUA 5EIOA 4AJKA 2VUUA 3K73O 1C1DA 1V6AA 3D4OA 4K26A 4PLZA 3UKOA 4YYZA 5JAMA 1IHXA 2I3GA 2GDZA 4NI5A 3LT4A 3JQAA 4XJSA 1E3LA 4AG3A 4BO2A 3A4VA 1H2HA 2WTBA 4YJHB 1CQJA 1J0XO 4INAA 1B3RA 3EZYA 3ZNPA 2B5WA 2PA3A 3H4VA 4J91A 2E37A 5IN4A 4QFCA 4O6VA 4UVDA 3OQ6A 1A9ZA 1FK8A 1VKNA 4PGFA 3AY7A 1QRRA 4ZA2A 5JC1A 1SZJG 1DAOA 2PKQP 4O0LA 1W8DA 4YRDA 4UVIA 3WGHA 4FGWA 3STHA 3DXFA 5F5LA 4AJHA 3VKUA 4IDCA 1PX0A 4FJ2A 4GKVA 3F4LA 3ZHZA 3HFSA 1ZVMA 4ALMA 3EVTA 1ENPA 1YDWA 1RM5A 1VC2A 2DBVO 2NTJA 4J4HA 3WSWA 1E1KA 4XB2A 1MFZA 1P1FA 1EUDA 3FHLA 2O7QA 5LDGA 2DLDA 3ZV6A 1Z7BA 3U09A 4KZPA 1P44A 1MXHA 4YT5A 3H5NA 2EWMA 2G76A 3UXYA 1H6CA 3W4KA 3S55A 4BNHA 1ADGA 1FMCA 4GX5A 2ZCVA 3EAGA 3DDNA 3TFQA 4HUJA 1T2CA 2YQ4A 5JXWA 1I01A 4RLHA 1Q1NA 2GUGA 4PRKA 5JYEA 1B26A 2BHLA 1JAYA 2Q3EA 2VYND 2EGGA 1YBMA 2X9NA 3C85A 3DZJA 3HB5X 3HZZA 2QRJA 2GZ1A 3P2YA 1Z74A 3KB6A 1YO6A 2CFCA 2E49A 3OJLA 2PZMA 1SB9A 2WE8A 3EVNA 4M8SA 1RM4A 1B8UA 3QIVA 4YVFA 4BNIA 3H9EO 4E31A 1WDKA 2O3TA 2HK7A 2P4QA 3DO5A 4YDRA 1AHHA 1D4FA 4QTZA 4CM1A 2YHIB 1M6WA 3IJPA 4XGKA 2B4TO 2X8LA 5JC8A 3PWZA 2UDPA 4GGPA 4Y98A 2VUTA 2B37A 4GH5A 3OBBA 2DTEA 2CDBA 2PFGA 5KVSA 4YJFA 1ISIA 4O59O 3OEWA 2PD4A 1KVRA 1GZ3A 4OYRA 1PQWA 4CUZA 1NR1A 3F6YA 4OL9A 3H6KA 2EF1A 1U3VA 1A4UA 4BKOA 3TJRA 4CV0A 4I5GA 4DIOA 3AI2A 5C3MA 1VRWA 4QT0A 2R00C 4WECA 3ZI0A 1H6DA 2IZ1A 1DIHA 2IYOA 1PJ2A 1UUFA 3OEYA 4UEKA 4I9UA 3HFGA 4IIVA 1TLTA 1N92A 1HE5A 4R16A 1T2AA 2OBYA 1H2BA 1DOHA 2Q4EA 4IINA 4KQXA 4RVFA 4R01A 4D44A 3RC9A 2C5EA 3JD3A 3R3SA 4JQCA 5L4SA 4R4JA 4UUMA 5DCUA 5A3JA 3EMKA 4NK4A 2BELA 3B6ZA 1ZXBA 3QW2A 4FS3A 1HZZA 4LISA 2RCYA 2ET6A 2NTVA 3LDHA 4R41A 3WGTA 1X7DA 3JQ6A 3ETGA 3QVXA 1C0LA 4QSMA 3HSKA 4P38A 5TJ9A 1O89A 3BMQA 4R1UA 2A4KA 5U1PA 4YEDA 1Z6ZA 5DN9A 3KVOA 4XYMA 1T2FA 4W6ZA 2DFDA 4R3NA 4U8GA 1NX6A 3JYQA 5U9CA 4L75A 3OIDA 1MA0A 4E3ZA 1YB1A 3PGXA 5CDGA 5GZ6A 2EGHA 2OP1A 1FF9A 3DBRA 2EJWA 3JD4A 3NEPX 4X54A 4R1TA 2Q2WA 2X22A 3TSCA 1N7HA 3FNEA 4BQPA 2YV3A 1O94A 2Q49A 1D7OA 3GR6A 3B1JA 4R3WA 2ZB8A 3OJOA 2FPGA 5AQ1A 2DTDA 2OHXA 1GV0A 4L76A 4GMGA 1YQDA 3VDRA 2I5PO 4FCCA 3RFXA 4BO0A 5BSFA 3IKTA 3DAFA 4J6FA 1YWGO 5GZ3A 5JBIA 4DQXA 4D3DA 4RF5A 4CV2A 3PYMA 1IE3A 3GHYA 1TT5A 4U6QA 1N1GA 3PI7A 2W4QA 1LDBA 4HFNA 1GFSA 2C2YA 4E33A 5HRUA 2ZYAA 4IJUA 3BMNA 2VYNA 4N18A 1H6AA 3HE3A 4TRMA 1I2BA 1ENYA 3F4BA 1UH5A 2O50A 2WD7B 3FN4A 2O23A 1LDYA 3E03A 1J49A 3GOHA 2GGSA 5CG1A 2O48X 1M76A 4RV9A 3I9OA 5B12A 1VJ0A 3F47A 4CMKA 4IJKA 5CFZA 2DT5A 2IODA 2Y1CA 1TB4A 4ND3A 4CV1A 1VKOA 3DQPA 1XG5A 1WZEA 1C3VA 4B4UA 4YAIA 3QWHA 1PQPA 3RI3A 2J5QA 2O3SA 1KERA 1DIGA 3GNQA 3GVHA 4FFLA 4IIUA 4XDZA 3TN7A 4DTIA 5I9MA 4BIIA 1GU7A 3IIEA 1VJTA 5KIAA 3GPIA 4II2A 3JQBC 1J5PA 4EUFA 1DJNA 5EQDA 4PLWA 4AICA 4WUVA 5DULA 3ROQA 2H5LA 3BTVA 4KTVE 8ADHA 2YDYA 4RPLA 3JQBA 4B4VA 3UN1A 1WAMA 1SBYA 3Q11A 4CMIA 1E7SA 3RUHA 1X1EA 4GMFA 2P68A 5I9LA 1U5CA 3ENNA 4H3VA 4ZVVA 4L73A 1V3UA 3U3XA 4DVJA 3LT0A 4OJNA 1LDEA 4NJMA 3ZWXA 1SOVA 4OO3A 1E3EA 4CM5A 1EDOA 2QZZA 2J3KA 3NJ8A 1ONPA 3CIFA 2NUAA 2W98A 1BXGA 1DIAA 5L7YA 4WE3A 5BNTA 3BXXA 5G0TA 1NNUA 1NM5A 4YJGB 3LF1A 4KMSA 4W7HA 3RKUA 5IG2A 3OIGA 3U4IA 1EBFA 4NIMA 2XXJA 2Z1MA 4KWHA 1XU7A 1Z45A 3JYNA 1PU2A 3PIIA 4LMPA 2JHFA 1ISHA 2VYVA 1VPDA 4WLEA 2B4QA 1DC6A 3CZRA 2WYUA 2V6GA 3AI1A 3DC2A 2HUNA 3GRPA 1X0XA 4PZEA 4YPOA 5TS3A 5A04A 1Q0QA 1OBFO 3BA1A 1UJMA 1SAYA 1S7CA 3DMYA 2X0IA 1H9BA 4D79A 2HRBA 4TKLA 4Y6SA 1BGVA 1LLUA 3QQPA 3RFTA 2C7VA 3P19A 4CV3A 2X7HA 4CMHA 2EKLA 1QYDA 3LC1O 1XLTA 5AOVA 3WYCA 4DPLA 2Y0CA 3PJGA 2VRBA 4E32A 4D3SA 1VL8A 3GFGA 1BW9B 3SJUA 4QUKA 4EGFA 3WGIA 3W1VA 1H0KA 1SC6A 1FDWA 2B5VA 3HN7A 3KHUA 3K9QO 5TLSA 2C0CA 1N9GB 3DFZA 4P4LA 4FR5A 2JCVA 2GN8A 4RPKA 3I9JA 1E7MA 3NAQA 2VOJA 3PHIA 4GSLA 5A9TA 4K6FA 4PVCA 1KC1A 1YB4A 2UAGA 4CMBA 2P5UA 1SPXA 1W73A 1UDAA 3CTMA 3ZWVA 4M54A 1JKFA 4G65A 2Y67A 2PKQO 2B0JA 3CSDA 4DRYA 4HNHA 2AEJA 4BGIA 2W2KA 1UZLA 4BB5A 3H65A 4I08A 3QWFA 4M49A 1QP8A 4A7PA 1SO8A 1ZJYA 3M1AA 4Q3DA 1NPYA 4ALLA 1GEGA 1R4MB 3H3JA 1SCUA 2GN6A 1E92A 1N1EA 4LSWA 1T26A 3ZNQA 1ARZA 3E9QA 1GUYA 2TMDA 3R3JA 5AXBA 1RM0A 4BNMA 1Q0LA 3U5TA 3LK7A 4NFYA 4OKIA 4BNJA 4TZKA 3QA9A 5ER9A 3U4HA 3ZU4A 1I32A 3HDQA 3BHIA 4YRAA 1R37A 2BGMA 2EP5A 5ENDA 4FB5A 3UICA 2JFGA 1CIVA 3OICA 1AXEA 1ENZA 4WNIA 4WK6A 1WXDA 1WZIA 2NQTA 4LCJA 4M87A 3GPDG 4BVAA 5ITWA 4FSHA 3UGKA 2YV1A 5IZ4A 1R16A 1LBEA 5CPBA 3ULKA 5A05A 1Y5MA 5C7LO 1IZ0A 5CHEA 4K1LA 3FR7A 4OQYA 1I3NA 4YR9A 5JPIA 2ZB4A 4Z9YA 3Q9NA 3WFIA 4PVDA 1JAXA 2VNAA 3LC7O 3PWKA 3DAGA 4B7XA 2EP7A 1NFRA 3A9WA 3QP9A 1RYEA 1T4BA 2OOSA 4Y8VA 4GL4A 1OC2A 4WCDA 2QZ9A 1E5QA 3KYCB 3ZWOA 5T57A 1UR5A 1MLDA 1LUAA 2X9VA 4E2WA 2P9GA 3PHJA 4MKXA 4A2CA 5JYDA 4WEOA 4AJJA 4RF3A 3VZPA 2EW2A 1AXGA 3DFUA 1I10A 3ZCXA 2AEMA 4IPTA 5C5IA 3PQFA 4HBGA 3E5MA 2GPTA 2BI7A 1XQ1A 3KO8A 2ILTA 3GVIA 3PTZA 1ZZEA 3NTQA 4LRTB 2P5YA 5FYDA 4D0RA 1UXGA 1KVTA 2HDHA 4E0BA 3RUAA 1HDXA 3O38A 5A9SA 1ENOA 3Q2IA 3E5RA 3MJEA 4F46A 1Z7EA 1DFGA 1NAIA 4F3YA 4YT4A 2VHWA 3KLPX 1HDYA 4LVCA 1L7DA 4BKRA 3B20A 5DP2A 2O4UX 3KEOA 4DC1A 3PQDA 3E8XA 4AJ4A 4BOYA 4I5FA 4XIYA 2BKAA 2CDAA 3TWOA 3UH1A 3GK3A 2HAEA 1A9YA 4G81A 3OECA 3EGOA 1XU9A 2ZB7A 2XAAA 3NDJA 5I7VA 2UUPA 4MVJM 4LK3A 4YJDA 4ALKA 1G6KA 4YACA 3BMOA 1Y9EA 4Q3CA 2CUKA 2EG9A 2XOXA 4BV8A 3GH3A 4H16A 1M66A 1OFGA 3PJFA 1GR0A 3CMMA 3EY4A 2AHRA 2Q1WA 2DC1A 1QXSA 2X4GA 3GZNB 3HHPA 3U4DA 5JMPA 2ZQYA 2JD0A 1YL5A 1I24A 5AVOA 3VVCA 4EBFA 2BLLA 4FBGA 5CDUA 1ADFA 2JAPA 3NT4A 2WWRA 3NX4A 3PHLA 5DCYA 1DDOA 3GDGA 2IEDA 3NGXA 5K9ZA 4BNYA 4J9VA 3DBHB 3M2PA 2GCGA 2BF7A 4TQGA 4DC0A 3WJ7A 1NPDA 4IJWA 4ITUA 4QX6A 3CPSA 4A03A 5I9NA 5L7WA 2NV6A 4UVEA 1FDTA 1ZEMA 2CZCA 1R6DA 4ZQHA 4B3JA 1Q2XA 1EQUA 3QE3A 5TF4A 3FCOA 5KVQA 3Q0EA 5CDTA 2ZATA 4FJ0A 2WE7A 2YFHA 5J23A 4BKUA 2IYPA 2J5KA 3VZSA 3FNHA 2Y1DA 4KQWA 1LC0A 3OP4A 3QWAA 1DLIA 5THKA 2B83A 2IZZA 4M1QA 3VAZA 1Q7BA 3DR3A 3BMCB 3CINA 3K2EA 2I6TA 4NQZA 3ZV5A 4Y6PA 1VL0A 4K28A 1Y8QB 4MP3A 1XSEA 4WJZA 1L1FA 3S8MA 1MX3A 2JKVA 3K2BA 4J90A 4PFJA 2ZIZA 2YW9A 4IZIA 1P31A 1DRWA 4RGBA 2VWGA 4CM8A 4EZBA 4ZQBA 5JFOA 5G4KB 4E6PA 1QKIA 5FWNA 1WMAA 1ISMA 3GGOA 4BO6A 4RO0A 3DBLB 3IC5A 2QRKA 4BHTA 2QG4A 3TNLA 3KUXA 5T64A 1FXSA 1E7WA 3VZRA 3KXDA 4GX2A 3VH3A 2V7PA 4GX1A 3LVFO 5IDYA 1I0ZA 4D7AA 3S1LA 4HADA 1LLDA 1PJLA 3W4IA 4JNKA 4EJ0A 3GAFA 1O5IA 1YL6A 5IN5A 2A9FA 2VUSA 2WM3A 4QO8A 3WFJA 4E2XA 1LA2A 1IZ9A
chains in the Genus database with same CATH superfamily
1K88A 4ZALA 3KAJA 4US2R 4N76A 2ILVA 4UU7A 3TEJA 1K7SN 1OT3A 1S9DA 3B3AA 3HL4A 4Z4EA 1YVUA 2I7XA 1FP6A 2O2JA 3MSCA 3HKCA 4PHGA 3W9YA 3CQ9A 3L05A 4G0QA 4GOXA 4F9GA 2ZT7A 4KMOA 4FX5A 4AJOA 2VA9A 1FTNA 4W5QA 4QECA 3SNKA 3FD8A 4L74A 3PTLA 3VHXA 4PIPA 4LX0A 2IZ0A 3GEHA 3KLMX 1ZN2A 1BMFA 1SUBA 1HT2E 4BQRA 2P5SA 1KK3A 4JX8A 2DLCX 1TJ4A 3DONA 1CNFA 1OX4A 4RVGA 5JXJA 2GRJA 3LW8A 1UINA 3V8MA 3H84A 1GP2A 2FNAA 3N2LA 1PWYE 5K8LA 3K70B 3USES 1DUSA 1ZD8A 4UTNA 4MYDA 2WW8A 1C1DB 2YMMA 3D8TA 3DE1X 3O4IA 5ES4B 2Z6UA 1TW2A 5CAEA 2PVCA 1PZEA 4U8HA 3O7WA 1ZXLA 1LU9A 3EB9A 1QP4A 1PO7A 1MDFA 1RQNA 3WOHA 1FFCA 2QX7A 1CZUA 3MK31 3S0JA 5JT1A 3ZL9A 3OCVA 4HRAA 4Y1EA 3HA5A 3F9IA 1CIJA 1IZ8A 5DMXA 3GGPA 3IQEA 3AUAA 4OLAA 1ULUA 4G9EA 1D4ZA 1WHTB 2J3JA 4N49A 4M9QA 1F5NA 3WRVA 3NBAA 2HJSA 2VDMB 4HLUA 1Y4SA 4FOOA 4Q39A 4U2FA 2IBSA 1M83A 1QDUA 3AF3A 3PITA 3MJHA 3CY6A 2DF8A 4HB0A 1FW6A 3QMMA 3FBGA 3PE3A 4B6FA 1W46A 3E2PA 1F8GA 1B2RA 4FYYA 5EUQB 4WKNA 1BGXT 1E4YA 1KS9A 2ZRAA 3CX8A 4MWGA 2WHQA 4DMRA 4NBNA 1Z82A 5E9WA 3RVSA 3QELA 4Q3LA 3P94A 2W6OA 4HN9A 5K0GA 1E2BA 3L8CA 2ZT5A 2C4NA 3I2GA 3MPOA 4CQNA 3H5AA 4IIXA 2PKWA 4DM7A 1LSOA 3ITEA 2OUIA 1R10A 3DMFA 3DZIA 2HA2A 2AWNA 2WFMA 1S5PA 2OQIA 1VBMA 2KYRA 3DVLA 3N8NA 2UYYA 5ARDA 1R6TA 3JVDA 1OI4A 2C3YA 1ATZA 4HYYA 1N6RA 1EJBA 5F76A 1FYVA 3QKSB 1X1AA 3NEYA 4Z4QA 1B42A 1X1DA 4QG7A 5DM60 4ZRMA 1ZOLA 2P1ZA 3QTBA 3ESDA 2BFOA 4OMUA 2FFRA 2Y1LA 3DXZA 2WMYA 3UIEA 4F92B 1HWYA 4NRDA 1HRKA 4JZKA 2V45A 1IG3A 2UUCB 2H0AA 1QIJA 1JHUA 3RKSA 2W22A 4IXTA 4KQKA 3DWFA 2EBWA 4IQGA 4QNMA 1Z5UA 1XL0A 4TPKA 4YRJA 5BN4B 1XKTA 2H92A 1VL6A 5EINA 6YASA 5CTAA 1YJCA 3ZS9A 4ADSG 2A5GA 4MQ6A 4IUDS 1U2DC 4XVRA 2WJGA 3T99A 5K8JB 1FXWA 2EZTA 1T3HA 3G79A 3RSQA 3SQDA 1PNQA 1YHYA 3B1FA 2PH3A 1M1YA 2R6DA 4Q3NA 1FJGB 3V7UA 2QK4A 3ABZA 3H1FA 5LQCA 3DMTA 3G2KA 2GF0A 2JKYA 5IUKC 2HSJA 1L4UA 5A03A 5MGBA 3KDSE 1ZOOA 3KC2A 3WLJA 2DBZA 4UTXA 2QAGA 2Q41A 1GKLA 2H1VA 3LCRA 2ENWA 2W6CX 3QLTA 1K6EA 5CCDA 3FWYA 1PJCA 2KX7A 4O2AA 2AMYA 3HPQA 5CXXA 2O8FB 3UAVA 5B64A 4AJEA 4RVUA 2CNDA 5JDCA 1ZRHA 5K4GA 5C53B 3PNYA 5EJ7A 3KUDA 4EVQA 2EHJA 5COAA 1NONA 2ZIXB 3R1IA 1S1CA 1YZYA 4GM1A 5AHRA 5NLLA 5C81A 4YUZA 1V1MA 3UANA 3TAHA 2ZR9A 1TFUA 2ZYTX 1FJ2A 3I61A 4B4OA 5LLTA 3OIVA 2YFQA 3TM5A 1L3BA 4PS1A 2QLBA 3GD7A 3IAS1 5CEJA 5KSWB 1NW8A 4AIIA 3P0RA 3LTEA 5K0ZA 5EWJB 1AF7A 3JZFA 1RYNA 3FI0A 3OLCX 2GM4A 2FX3A 4RK7A 2FPPA 1G291 5AW3A 4PNEA 3I3OA 1F60A 2V7VA 1FTYA 1G2QA 2X9GA 5T4EA 1GLGA 5BSGA 4WY2A 3O1IC 4PAGA 4RA9A 3PXDA 1KOLA 5JWHA 4A73A 1E32A 3CUSA 4MVXA 4PFQA 4JBGA 1VBNA 4EKIA 3EA4A 2RBKA 3O0DA 3AUTA 2R6JA 4B81A 2FB9A 1KVSA 1RS0A 3OKAA 3DVRX 2R97A 3AM5A 1EHCA 2PA0A 4L3VA 3M1YA 2OK8A 3QOXA 1T6ZA 3B5IA 4PRZA 5JS2A 2PX2A 4CR6A 2OVFA 2JLSA 3OJEA 1LZKA 3KQMA 3Q6MA 4O4JB 3KR2A 1DBSA 3HCAA 1FZQA 3OTHA 1WWKA 1QVWA 2G07A 1CQIA 3W78A 1WNTA 1F3OA 1QFSA 2DFLA 2G0NA 3BCRA 3EWNA 3FTQA 3OD1A 4MWEA 1TW3A 4ND4A 4NH4A 2WAXA 4NU6A 4ESVA 5JW6A 2VPPA 3IP9A 4F4CA 4LV6A 5I6DA 1I7PA 3C8DA 4KAAA 4DQUA 1BU8A 1GZVA 2ZB2A 3AEQB 2R4QA 2VXYA 2VSXA 4JELA 4I5EA 4JEHA 3MD9A 2D1RA 2ZQZA 4DMKA 3KJQA 5JMOA 3UT5B 1AQYA 1TK3A 1XXHE 3RHSA 4HVCA 3RSGA 3UGQA 4H2DA 4XRRA 1N5KA 4FHEA 1T2EA 4YN3A 2JFOA 1G6OA 5KNDA 3INYA 3PVZA 2O6LA 3M89A 4BECA 1D04A 3LWNA 1OIVA 2E87A 4INPA 3BIXA 2W2QA 3R5SA 3IBSA 4OXKA 4BRUA 1N2IA 1WUHS 4BVGA 5G1PA 4YAKA 2D2EA 5T8KC 3ANMA 2ZYUX 5T5QA 1S2NA 1PW7A 1XV5A 1Z0IA 1Z29A 2WU4A 2GKOA 1OASA 2X1LA 3ELWA 3ZQ4A 3V46A 2PFSA 4ON9A 1C3LA 4RMJA 4EX6A 3HQ4O 3NR2A 5TX7A 1URPA 4C7OB 1NBMA 4QPPA 1ORRA 4JV5B 1FFHA 3PL1A 1Q12A 4KYIB 1RDFA 4PYJA 2J7KA 4A0RA 2IP2A 3GVPA 3BQ9A 4G5GA 2JI4A 1MB4A 1L4BA 4U5QA 4UZEA 3ZY4A 4E88A 3SJAA 4IIHA 4XDYA 5TARA 3SEZA 1VSTA 4OHOA 4CKXA 2RKWA 5DBGA 1GGJA 2B3DA 3MTAA 5ALVA 3BSSA 3LA8A 1MJHA 4ZFNA 3QY0A 5FBHA 2I4IA 3PUYA 3ANTA 2GYVA 1CHDA 4D9EA 2C3PA 4IJSA 4OLHA 4C2TA 4C78A 5BUZA 2QDXA 1H2ZA 4TMFA 1E5XA 2PTGA 3WK5A 4M0CA 3NTUA 1GZ6A 2IK8A 3W6ZA 2Z2ZA 3TAUA 5E1DA 3AXSA 3IOEA 2AI2A 4PV7A 4F85A 3KQPA 2RJOA 3WBFA 4I4IA 3WLKX 4N0QA 2JIOA 2XQGA 1G3QA 1DXOA 3AP1A 3V1MA 1YFKA 1P4HA 1TI7A 5SZKB 3V32A 5IARA 4LI0A 1KIMA 3VR1A 2PHZA 3GW8A 4JT4A 4MVJF 3KTDA 2EJBA 4LXYA 3WIUA 2H7YA 3QSGA 4AUKA 2YBDA 1DJOA 2FOXA 4CKCA 3SXUB 1GRQA 3EXHB 1SWWA 3JR3A 4XIGS 2R68A 4AQYB 3FDIA 3A3KA 4PG4A 3KEMA 1E58A 1KKUA 4XOIA 4EFMA 1E69A 1WV0A 4Q4LA 2AQ8A 2QRVA 4R1SA 3OIFA 5KU7A 5AW8A 4F2HA 2ACKA 1EEHA 1UP4A 3G6WA 1PAUA 4R9RA 4WBSA 1D6SA 4KWCA 4URUR 1HNNA 3AHDA 5KJEA 5HKKA 5BN3B 2VDKB 1IPEA 1KY3A 3T1VA 1T8PA 4N8DA 3MCUA 1F9EA 3N8GA 2QJRA 5B1YA 1P81A 1G20E 3ABRB 1I4WA 1DAHA 2Z8YM 3HFJA 4KUHA 3H2BA 1M3SA 3DZKA 5EGSA 1Z4KA 4KFCA 3KZMA 4L9WA 5BMOA 1P2DA 2FR8C 4Q4AB 4F8JA 1RSZA 3QF7A 3IULA 1D09A 3H7IA 3KDPA 4CKYA 4OJQA 1ZBQA 4HH1A 1RPZA 1Z13A 5J1TB 2PL5A 3E4DA 1R00A 3OA2A 3TF5A 3KQHA 3UYLA 5FOXA 2JCSA 2QQ0A 3OF3A 5HF8A 2L0XA 3GT7A 4F9EA 2X2EA 3K4PA 4GI5A 4MGEA 1SVKA 3BPSA 4UFOA 1BCSB 5CP8A 3SKXA 4ILEA 4MUXA 3TX6A 3L7YA 4IO1A 2XUJA 2ZYGA 2QV0A 4TKZA 2VP0A 1RKUA 4A16A 5I9TA 3KWFA 4BKMA 2OE2A 4L9AA 4QIHA 3FUCA 2BIFA 3TW8B 2IUSA 3RG8A 8ABPA 1NUHA 4TTSA 4MW2A 5GZ1A 3B3JA 3GLSA 2WIJA 1EHYA 1TIKA 3FMGA 1ORDA 5E1MA 4XKJA 3FA2A 5L9AA 3D3WB 2VDWB 4UU8A 3V2IA 2XQJA 3CH4B 1M1NA 1W0KA 3GMDA 3RVRA 4E4YA 2UZ3A 2J3EA 2FFHA 4NJOA 3SZLA 5A4DA 5BR7A 2CXSA 4CEIA 1H5UA 5A71A 2DUUA 1ZFNA 2UXDB 2IZ6A 4IVPA 1ZL0A 5CCBA 521PA 3JQFC 3SIRA 1T1IA 1AM4D 3E35A 3EEIA 3IURA 3QEJA 4XJVA 4PTLA 1YGYA 2OKCA 3EVAA 3R6TA 4L16A 5ICMA 5DIFA 3MHPA 3KSRA 5KNCH 4V1CI 3NTLA 1OWNA 4K9LA 3EGXB 1ZSVA 1YR7A 1O95A 1XVLA 5JS7A 1NSFA 1EK2A 1N75A 2OGUA 5LJLA 5EJ8A 3GCZA 3ZVKA 2PWBA 4EMUA 4TTAA 2QXUA 1IU9A 2R44A 4D56A 4N8EA 5CITA 1Y7TA 4CLHA 1RXSA 1R6UA 1CYDA 1QM5A 2PRZA 2EIHA 3GH1A 1IXKA 2VF4X 4GP6A 4QD3A 4DLKA 1B0PA 4S1PA 3CF4A 1ZJWA 4TKMA 3ZGOA 4N8SA 3V7FA 2P1RA 2VT2A 5TMPA 1I3CA 2P9EA 4QGFA 1QRSA 2W6IA 4DLZA 3D8RA 3JRWA 3NEJA 4RPCA 1DC8A 3VVBA 2EV9A 1BHSA 2WNIA 4G26A 3Q3GE 1M8FA 1Y1KE 3IUNA 4YRNA 2H4FA 3M2TA 1MOZA 5F12A 4GWGA 4KR2A 2PLAA 3ZUGA 1IM5A 4HGQA 3QLUC 4FS8A 1HQKA 3AUXA 4IXMA 1H2EA 1CD5A 1LWOA 4GEGA 4L5IA 4EG5A 5LXTA 1NFQA 3CIOA 5ALEA 3KQLA 2ECPA 1W48A 5GY7A 1OMOA 3QE0A 2QM0A 3TLAA 1C0IA 2ZWIA 5IKMA 4I8DA 4O29A 4M36A 3WKDA 5B1HA 4D9MA 1YONA 5KYNA 2Z0MA 2VKTA 1Q50A 3JZAA 4QTUB 4W5OA 3QPBA 3TO5A 3ASUA 3UUWA 4JY7A 1UEIA 2EF0A 2EKZA 3PIDA 5FA6A 1YZTA 1G8MA 4UE3S 4L0QA 4UBJA 4RH3A 4JP1A 3ZE9A 3O75A 3AR4A 4MVWA 4IXWA 2EKPA 2X7XA 3S5JA 2YZNA 3HACA 1ZJZA 1AZSC 4LY6A 2I33A 1BW9A 2VCEA 2ZAOA 1IUKA 1E1QD 1E64A 2AE2A 4TN5A 4C6SA 5BUQA 3BVPA 3ONDA 4A8HA 4FDMA 3DYBA 3INTA 4KGXA 1G7SA 1U9IC 3S27A 1PL8A 1QANA 2E4ZA 2EFCB 4Z86A 4PSCA 1D6MA 4DMGA 3PEFA 4BLPA 4GF5A 1WOMA 2H63A 2QF7A 2XUFA 4NBWA 4PHHA 4TXLA 3R4CA 5JEDA 3G68A 3ICQB 2WD8A 1YU9A 1YS2X 3GEMA 1G64A 4UEOA 1NNEA 2QVBA 3M8KA 4GO1A 4IGIA 4X92A 4IIEA 1TZKA 3TZKA 4UQLA 4RMIA 2E9SA 2HIAA 3I9KA 4ND1A 4MUHA 3ZCSA 2QTCA 3GLIB 4IEEA 1XNRB 2BUBA 1XTPA 2AEFA 1QZUA 2BL4A 2Q9CA 2CKDA 5AM2A 5KOIA 2QMYA 2PKYX 5JS6A 3U3RA 2QG6A 3MCTA 3MELA 4XIJA 2FSUA 1II9A 5G2OA 2HV8A 3O2NA 4Z9XA 4HV4A 5MFZA 1G0OA 1R0XA 2EBUA 2BI4A 2YOFA 3P45A 1KIFA 3QVWA 1G5HA 2H00A 2RSLA 3QJYA 4KNVA 4OAOA 2R48A 4JUBA 4A0HA 4POOA 5I8PA 1ZR4A 2VDLB 4JLAA 5C1DA 1QH8B 1ETHA 3O5AA 1TEVA 4HGYA 2B3TA 3IPRA 3EW9A 1O97D 4MTLA 2CJXA 4MKHA 2QHXA 2VC2B 3COSA 5HKAA 1M0SA 3H16A 4PZDA 1EFDN 2DCMA 4YRMA 1NR5A 3T9EA 3PK0A 1XL1A 3T7JA 4ZQIA 1SC3A 2QTBA 4L8VA 2ZI3A 1WJGA 3B6JA 3QVGA 1G60A 5D01A 4BZZA 1RRCA 1MMFB 3EGDA 2D2VA 3AW9A 3OWOA 4PC1A 4D3ZA 4OXNA 4I50A 4RHCA 4EPWA 4ZAGA 3IS3A 3NHUA 5HJ2A 5HZGA 1RXWA 1TPZA 1UT8A 3PX7A 1VIDA 1Z4JA 4V0MA 3W4JA 5HX7A 3LLVA 3L43A 4XDGA 4CW7A 6Q21A 1J0AA 5EWMB 4ZD6A 1N2CE 1OTYA 1Z75A 1RHQA 4PHFA 1A04A 4HS9A 4ID9A 5IM5A 3ORFA 1H8HA 1TDJA 4IDQA 2OY0A 4HAIA 3VPBA 4MGZR 4UTZA 1A5ZA 2NQ2C 1QQTA 1G3MA 4WLFA 2WIKA 4TSFA 4QXQA 2HR1A 3K0SA 4NBSA 1RRMA 4Q1CA 1X7XA 4LRQA 2W6MA 5U4XA 4TVSA 4ZCIA 4C21A 1T1EA 3RG2A 3B3FA 1AKUA 5B1EA 4IHJF 4YT2A 3UB4A 5AVVA 5KYTA 1VIVA 2RGDA 4MDHA 1RC8A 5KYYB 4NYMQ 1X39A 1XRQA 3U7QB 2IDZA 5TY0A 1Y3HA 4MW1A 3AHGA 2ADMA 1FDVA 1JG6A 2YMLA 3JX9A 5EKTA 3FIJA 2VDUE 3OG9A 2AG6A 4IH1A 4RKWA 1G98A 1XR3A 1IQ0A 2FCRA 4LZWA 4DLPA 5F4BA 1YNSA 2XVZA 1A5AB 2FWIA 1N7IA 3W8DA 2R2GA 4JUCA 3OFJA 3IB3A 4RTSA 1BMFD 2XUHA 3A1VA 2OQ2A 3QOYA 3PRJA 2CCKA 4P58A 1XKLA 3AI3A 1VHLA 3W5DA 4L4ZA 1TO1E 3C6BA 2YXNA 2AUMA 2FSIA 3L04A 4M7RA 3VRHA 5A5GA 1LRLA 2WAOA 2HLDA 5ICSA 4C05A 2ZIWB 3DT9A 4Y6LA 3TOSA 1H6BA 4EARA 1Q20A 1YVEI 5BR1A 2PGJA 2GZMA 3MVEA 2GD0A 3PKZA 2A94A 4YA6A 2ZKLA 1YJ5A 1DX4A 4TKUA 4W6QA 1SC4A 1TZJA 1L4HA 2ZBQA 5F7XA 2VHXA 4TM8A 2CMDA 3MINB 3NBZC 5EMHA 3V4SA 3TGLA 1R0LA 3LG2A 5M04A 3M6IA 3HO6A 2I2DA 1Z2AA 1Q1GA 1W5FA 5TV2A 4FFNA 5HCNA 5KC9A 1XC7A 1IBSA 4GKJB 3C7AA 3OLWA 1PL7A 5FNZA 4HB4A 1AVTA 1DEXA 2OYCA 5D8DA 1LPAB 1XVIA 1WMDA 2Q5JA 2XEXA 2Y9MB 3AP3A 4LHEA 5CGQB 3ZV4A 4BPRA 4BQIA 1SNYA 1SULA 4GKBA 4B7AA 3K8QA 3NV7A 4CN9A 1H4SA 3KHSA 1XNQB 3L84A 3EIQA 1T0PA 1JDSA 1VBKA 1XU4A 3LV8A 4BFVA 3DS8A 1SCIA 5JRDS 1D1TA 2JDID 4X20B 3Q7IA 1VCOA 1GV1A 1ONSA 3C7CB 4PY2A 5ICGA 4GPEA 1BDHA 5CMLA 1JZQA 1ZVJA 4J9UE 1NXVA 2VHYA 2XTNA 3P26A 2V65A 3EDYA 2CZGA 5DX0A 4PONA 3QX3A 4B87A 4RHUA 3SX2A 1AA9A 1T1SA 2BM9A 4HGRA 2Y6UA 3NKLA 3RIXA 3SXJA 3V34A 3OD5A 5EP2A 3L1HA 1H66A 4X1IA 3TNFA 1C29B 1C9NA 1EKXA 4H15A 4F2GA 2ZBRA 2AN3A 2CK3A 2OUKA 1IBRA 2BPOA 3IDQA 2HJRA 4LRUA 4EY3A 2HF2A 4YCMA 1U99A 4RQTA 1Z56C 2BYTA 4LJ5A 1SEPA 1KKMA 1O97C 1PWZA 3RRJA 1W75A 3E53A 1NP3A 3PR3A 2VHEA 3D02A 2A3RA 4YPVA 3OQJA 3KVVA 3HJCA 3SSOA 1BJRE 2XOKA 2J9GA 3IP1A 5AJTA 4ALNA 3SBEA 4YRZA 1N5DA 1MNQA 4RMGA 1UC4B 5IWAB 2VP5A 5FL3A 1QFXA 3WIEA 1VI2A 2G80A 1M2VB 2AYXA 5K4AA 5SY6A 2GBLA 2WIGA 3RW9A 3WQHA 2V1XA 3AETA 5AI8A 4AJPA 2HRZA 3UXMA 4PHCA 2CVOA 4J7CA 4IDAA 1HG0A 1JA1A 5EKDA 3FPFA 2BI8A 3CCFA 3L9XA 5COBA 3OQIA 2VXBA 4BVBA 5DNWA 2LGJA 3WSVA 3L7CA 2GX6A 4OYYA 1S4QA 4R2KA 3ZWNA 2AR9A 4GQBA 4TN1A 4M0KA 4US0R 1HX7A 5BXQC 1LPSA 2IY8A 3C1AA 1EINA 2QY6A 1ESZA 2XUQA 3DUFA 3KEFA 4Q7EA 2PWAA 4LRYA 1PKXA 4BO3A 4IGFA 4WK2B 1R6AA 2NXNA 1Z36A 4QNRA 4BNNA 3PS9A 5EP1A 4GMDA 3WO1A 2XWJI 2J9YB 2H18A 2EYQA 2QR2A 3NVDA 3QPAA 4N65A 4JI1B 5A4IS 5KYWB 2H59A 3L6UA 3AFMA 3P9KA 3LKBA 3F73A 5IKXA 4P92A 2HU2A 5IZCA 4FZRA 3CZAA 1U0SY 1GRNA 2ZXFA 3RAEC 3MXTA 5HJEA 2VZLA 4TXHA 3SKVA 1Q84A 3CSSA 3PQ5A 1K06A 1R3DA 4LQCA 1UQTA 1C1XB 1HLGA 3FWNA 5CLJA 4WVFA 3VU9B 2GHRA 4QWMA 3MGCA 2RG7A 3VOBA 3Q72A 4IH9A 5LMZA 4Y2YA 1JSCA 5LP6B 1DJMA 1RJWA 2DFTA 1X2BA 1S7GA 2HXYA 1P9RA 4Q4CA 1WW2A 2B8WA 1JGTA 4FDVA 5EMKA 2JG3A 2FV8A 2G1UA 1ZI9A 4WGGA 3WMRA 4RTJA 4LQ4A 1DAKA 3A4TA 3HSYA 4JR0A 4OQZA 2FY8A 2JJMA 2QN1A 5EZSA 3V8BA 1N2SA 1VG9B 3CSUA 1MG5A 3GJ5A 4NYIR 1GL6A 2OXTA 3ZXYA 3CZMA 4DXAA 2RB4A 4PX5A 3D59A 1UJNA 3IPXA 2A1TR 3RSLA 1L5YA 1FP7A 3W5SA 4KOEC 4P5PA 4QTYA 3RQSA 4MUNA 4KN9S 4TQ9A 2O1WA 4MDEA 3QKIA 5A4MS 1Y1QA 4DUGA 4HY3A 4KIGA 4OSPA 3V1LA 2PX0A 2RI0A 3HMQA 3ZZMA 5I3CA 2XT9A 1YQTA 3PZBA 3TBKA 1VCNA 2QUBA 4D74A 1L7PA 3FCEA 2BFNA 3IVRA 2H48A 1ZONA 4TL7A 1E0KA 4UZSA 3ZI4A 1NP7A 1NW3A 1K4KA 2HF9A 4YK7A 1CRLA 4LC1A 3SBOA 3F5MA 1YRBA 1Z6PA 4MZDA 1DRVA 1ZM9A 4LJ7A 1U9YA 2PM8A 4R0NA 3O21A 5KNDD 1ZC4A 1NIPA 3WP0A 5IS2A 4FIZA 4QU5A 4OHXA 4AL4A 1T9GR 1T43A 5DGDA 3HNPA 4YFYA 5AVUA 3U7HB 1MORA 1PT6A 2DGDA 3CX6A 3DW1X 4TV9A 1U28C 1Q15A 4YAFA 2C5AA 2PCLA 1ZSYA 1JU3A 1ZAKA 4YDSA 1ONNA 4QNNA 1APBA 3T3OA 1U2GC 3O0TA 1JAIA 2UU9B 4JLBA 3C3DA 4WLNA 1WZNA 1RPJA 3E8SA 3FSRA 3RRNA 3LLSA 1O87A 1WUIS 3PJDA 2OV1A 3BTUA 4UZFA 5FI1B 3A1SA 1ZK4A 1M0WA 1S4MA 2H2GA 4YJHA 4ZU3A 2C4HA 4ZVKA 4B1FA 5BV1A 4CGZA 3IALA 3ANNA 1B4DA 4CRWB 6NULA 1LDNA 5L8VA 2DPGA 3TTVA 3DO8A 4JJAA 2DFVA 3BM5A 1PT8A 4V3BA 1EFUA 2DPHA 2YZ7A 3OMLA 2QB5A 1W35A 5BWBA 1KTVA 2XKJE 5CLFA 2RMKA 5EIBD 5TQVA 2YZKA 3X1YA 3A3OA 4L27A 1JHRA 1JEDA 4G4IA 4HRVA 4YUXA 3GLHE 3ODGA 5TT0A 3RUIA 3MUOA 3ZTYA 1C7IA 3OT1A 4QULA 3PNQA 1BC5A 4Z5XA 1VZ2A 1HYEA 2X3FA 4XCQA 1XQ6A 3ZV3A 2SKDA 5LA6F 5JVDB 1TCAA 3RVLA 1JQ5A 3TDNA 3VC7A 1CJKC 5IU6A 1N9KA 3QKSA 4BX8A 3T1TA 1O8BA 2DWCA 4Z4IA 3VC1A 4X66B 3MMZA 1UKYA 3G5LA 1EFAA 2XUOA 3RRMA 4CR8A 5DM1A 4X1KB 4FZ5A 3S2UA 4CLEA 5GVSA 1NU6A 4DE5A 3DNPA 3SC2B 1JG1A 1QB8A 5KYVA 2WEKA 4CWAA 1II8B 4YRQA 5JFOA 1Q2UA 3UTCA 1NF9A 1YMUA 1MIOB 2Q4OA 3P9SA 3ITNA 2Y1OA 1YGPA 4ENPA 4WOCA 4H77A 2JIRA 3WL3A 3FOEC 3VR4A 1GTRA 2W2OA 3M5DA 5GIOE 1EX7A 1Z37A 4I5IA 4IW3B 5HHTA 2W7TA 4TL8A 1Y4AE 3B5JA 4ITRC 4OBWA 5J5CA 2XI4A 1QZZA 1JDBB 1V48A 1I8TA 3HWRA 2QQ5A 3JQGB 4QBKA 1GVHA 1NMYA 3TNJA 2HLHA 1DTEA 3DE4X 3CONA 5FFFA 1WO8A 4JLPA 3RK4A 2HRCA 4ZVLA 3T7SA 1PBTA 1OXKB 1WPXA 2X0NA 4PIMA 4RJTA 4E5SA 3QJ5A 3CO5A 3FTEA 5EKXA 1NW7A 2OO5A 3LKZA 2X2OA 4MR9B 4MVJP 3ZWYA 4DLRA 1IUOA 1GSOA 5A3RA 1XOIA 3WLOA 5EHIA 4K9SA 4HDMA 2PUEA 5BR8B 5KUTA 2ZVQX 4KTTE 3HCEA 2X0KA 2C2ZA 1GDDA 1L1EA 2JGEA 3Q12A 2ZIXA 4B17A 1TA4A 1ZNZA 4W8OA 5CBPB 4ZYVA 1RHMA 2Y05A 1XMPA 4PE5B 3SP1A 1O03A 5I01A 2FMIA 4CGYA 3GA0A 1X14A 3E84A 3EW7A 8LDHA 3Q8MA 3MT9A 2C5SA 2WYOA 2NZXA 4HK4A 4NDAA 2OYSA 2Q4RA 5IDQA 4AYXA 4MRMB 5TE9A 2AT1A 5IYZA 3AEUB 2OBNA 2DSNA 3UJPA 3TVTA 3ZQ6A 2REXB 1OWPA 5FL7D 5AMXA 1SU8A 1MDBA 4AF7A 7GPBA 5KTPA 3ZVNA 1TU4A 3TZQA 4Q3BA 1CVLA 1PS0A 2CLSA 4GOND 2NTEA 3OZFA 1P1BA 2XRZA 3FTCA 5T3UA 4FYJA 3CBQA 1YRAA 5DBHX 3C4QA 1VHTA 2HFKA 3KOUA 1J33A 3SVLA 4RPJA 1O95D 2C03A 1RQ7A 1R5NA 4NJEB 4DMLA 4AJ1A 4L8WB 4H3SA 1NWHA 4LG1A 1IPHA 3H5RA 1NN3A 1GSAA 4LK2A 4WFKA 4M89A 1Z33A 1CUZA 3JAWB 5AVXA 3KSZO 1P74A 2HT1A 4KDCA 3R9WA 2YXBA 4QQ8A 1TQHA 4ALIA 1KH3A 3FMPB 1KFKB 4II3A 4DJTA 3BB4A 4TMZA 3B6MA 5FUMA 4MMZB 4N5MA 2O20A 2J33A 2WJHA 1VP9A 5F64A 5HMLA 5K1ZA 4JI3B 3U5ZB 4OU4A 4LZOA 5JD6A 1WBDA 1LB1B 3RBZA 1KORA 2VT7A 4H6PA 2W6ID 2QLLA 3ZY6A 4Z4CA 2ZK7A 4IIJB 3LCVB 5D51S 1P7ZA 2FEWB 1UZNA 5EIBC 4YBZA 5IMBA 1U80A 1YQUA 1WIWA 3WL5A 1FQKA 1EPUA 5JTTA 2YFKA 4BFUA 2R84A 3QFRA 1PYOA 2JGIA 3CZPA 3IUYA 3PGLA 1RRKA 3OU7A 1T2VA 2ZYHA 4ID3A 3CPEA 3FDZB 4V0NA 3TECE 1KAEA 4CTNA 1H2AS 3L4BC 1EYZA 4B76A 1RI4A 4BGUA 5E7QA 3G49A 3HXKA 1BH6A 1JLSA 4NG4A 4MJXA 3X2SA 4DUYB 4C7OA 1QGYA 1CUFA 2RH5A 1Z2DA 4PGMA 4KQHA 4KC0A 1E9EA 4C7XA 3S81A 2UXCB 3C3YA 1Z8FA 2WVAA 1JSRA 3MF4A 4MPRA 4UHBA 4UM8B 4KNWA 2X2FA 3S7ZA 2J3QA 3OZUA 1WE2A 4F3TA 2UYQA 2ZJ1A 3Q9SA 4FCWA 2Z8ZA 1PFYA 1RQLA 2PRKA 3ZK7A 4C3OB 2YJNA 2O1EA 2ST1A 5IK2A 3EZGA 4U7TB 3GHHA 3G2QA 3H8VA 2XGMA 3KSBC 2ENUA 4NY1A 3NC0C 4PRYA 3QEKA 3OIUA 5H83A 1MD9A 4C0KA 2LWIA 4FW9A 3FUUA 5GJCA 3CNLA 4IMJB 3RTEA 4OFBA 2AKYA 3KB8A 4DLYA 3OOSA 2GTIA 1IVYA 4F4IA 2QKYA 4KGZA 4ABTA 4EITA 4HXFB 3HJAA 4FGJA 1DJQA 4EW6A 1SOWA 5I7SA 1S2MA 3D0RA 3O4GA 5DSTA 3AKZA 3HUEA 4YRCA 3B36A 2O57A 2RARA 2VK1A 3GNTA 3L8FA 4Y9RA 3E48A 1A8IA 3NHYA 2OZPA 2VTEA 2VDPB 3EXHA 1AKMA 3GLVA 4Q82A 5U4QA 4FR2A 4DWOA 4EP1A 4LYEA 1M6NA 1PP4A 2NADA 3OX2A 5BN5B 2IF2A 3VSAA 1O77A 1W88B 3ZJ5A 4NBLA 2ZW9A 2PX8A 3U81A 1A1VA 2CDNA 3O8QB 3ILYA 4JYZA 5F5NA 2BHTA 4CUJA 5H80A 4D8VA 1JDTA 4EW3A 1K0UA 5DCWA 1UKCA 2QN6A 3KFXA 1CUWA 4RE6A 1WKCA 4PBRA 1U98A 3R0JA 3RANA 3JALB 1ZS9A 3IFSA 1QTQA 5LL6P 3QUCA 4IMPA 4MQ5A 3ANLA 4QBGB 5BYAA 4LC0A 1OH7A 1GGMA 4GGOA 1DKLA 3UJ3X 5BUCA 3R7WB 1ISGA 1PK9A 1PGQA 4C76A 3DOOA 1YCFA 3LBIA 2R11A 4CKZA 1N6OA 4C6RA 4TQUS 4ND2A 4RM2A 4DYVA 2R87A 3KV3O 3K7EA 3B38A 4LMAA 3UCFA 4KPEC 1ZUHA 4G1CA 2QI9C 4D9GA 3KQTA 4EELA 4LDQA 4E6EA 4WL0A 3BGIA 4WZBE 3U26A 5JCPA 2X5KO 1VL2A 2NYUA 3ZVRA 3SZUA 1Z6XA 4J0FA 3HKEB 1OXTA 1SBIA 1YZFA 2YVKA 5L3VA 2QT0A 2FSVA 3R7AA 1R64A 1DDIA 1SXJE 1QV9A 2QIOA 3LO8A 5F1YA 3B1XA 2FQQA 1L8QA 2Z8YA 3A3YA 4PZ9A 3QVKA 1MA3A 3PDIB 2LIVA 4J16A 2QSJA 1DMRA 3A4LA 4CPDA 2OZKA 3U7EB 4JVMA 1E79D 3UMBA 2VOEA 3HDTA 4QWWA 3D3WA 3UAYA 3DZDA 2WJ4A 3DTVB 3NUZA 4E94A 1R0WA 1XDWA 2J4DA 1U8ZA 3MT0A 1FDUA 4YJGA 5FWXB 5C18A 1Z39A 2IZ7A 1RLOA 1XQVA 3OF2A 1U7DA 5EESA 1TKAA 3TQCA 1AKVA 4BY9E 1SZPA 3H3XA 3BXGA 3CRVA 2MOKA 4DQKA 1JI0A 1KK2A 3LFHA 3OCWA 5T6MA 1U4OA 1KPIA 2IW3A 1XZQA 2W71A 4HWKA 4RPIA 2X41A 3ICPA 3A6GA 1H94A 3UV6A 1U3GA 2FDRA 1C14A 3BL8A 1FLDA 3RTAA 1SXJD 2FZWA 3O8OB 4ZICA 1NQOA 5C7OO 4MJ7A 1L5HA 4EG4A 3OA0A 3QLUA 4LYHA 2HLDD 1DCFA 2BKXA 5GADl 2OHHA 2O8BB 4BCDA 3M5PA 1PL6A 4YP9A 4FN4A 3TDMA 2OCKA 4LJYA 1QX4A 3LQQA 3V4OA 1SRQA 3G3EA 3HEAA 4FWBA 4CF7A 2J0SA 1YL7A 5E6RA 1AKQA 1JF8A 2OHOA 4U2CA 1OBCA 3WSTA 4W82A 4MKZA 2R1TA 4FFOA 3CURA 3L7BA 3PRYA 2FEPA 5H9WA 2A35A 2QBYA 2RBGA 4EG7A 2P90A 1GCOA 1KYQA 1YVDA 2JEOA 3FVWA 4OQXA 4TLCA 1I3KA 1ZJ5A 5F33A 4ZV4A 1SCUB 4BMZA 4RABA 2JVIA 2OOKA 3NWPA 1XCGB 1I6MA 3K8YA 1XKQA 2Q3HA 4Q9NA 1PTJC 4G67A 4LGVA 3VYSB 1ACLA 1EQAA 4XI9A 4KRYA 3QUAA 4DB2A 3A1CA 1V3TA 1GNLA 2WUVA 4RKFA 3C8MA 4XUEA 5BW4A 5BORA 5GIPE 3KPVA 5IMSA 4GXNA 4W9MC 3FAKA 3MBOA 1EGHA 5KJCA 1KWGA 2UYHA 3THXB 3NHSA 1LK7A 1AZTA 1Y1LA 4RL6A 1JKIA 3ZZNA 4B6JA 3I9V1 1X80A 4BJ3A 1IOWA 2ERXA 1STOA 2HCBA 2QMZA 3DFFA 1GYQA 5EMJA 3VX3A 4ZTUB 2DB3A 3PDCA 2Y1FA 1EWQA 1ZGHA 2IOFK 3ZDQA 3ZDDA 2CJPA 2E5FA 4BMOB 2PS3A 1U6KA 4BXOB 2CK3D 5C9ZA 4JC4A 5HOEA 1QG0A 4XJTA 1WPGA 2YN4A 3BE6A 2PBZA 4IQFA 1ZM7A 4KFSA 1DWUA 4JI0B 1W2HA 2ALJA 2XB4A 4C4ZA 3IODA 4ER5A 1EWKA 1IUPA 2W6JA 4ENTA 2X3UA 4FJ1A 4QICA 4RIFA 1DPFA 1R3UA 1VLZA 1UJ5A 2EJVA 1CE8B 2WFLB 3R8XA 2Q1UA 2I91A 2P1DA 3AKYA 4R5HA 2XVMA 2PX3A 1GR1A 2OHIA 4PZZA 1R66A 4ODIA 2JARA 3R6GA 1E2IA 4OV6B 2FG5A 3QPUA 1ZH2A 2VZ8A 2OLEA 3G9ZA 3CNNA 4U63A 4LTDA 1IN1A 1L4YA 1T35A 2Q0SA 1M2HA 4C29A 2WSSD 4RMHA 4BZWA 1JEQB 2RK3A 4MIYA 4Y7DA 5BSEA 4R68A 2PH7A 4IDNA 2JJ2D 2PRYA 4LRXA 4J8PA 5BWLA 4RFLA 4B6EA 2QMUA 5IT4A 2BFDB 2QRNA 4QXAA 1SIWA 2GN0A 1U3FA 2W2VA 4EB8A 1CUBA 3U7IA 1YNOA 4XX0A 3VV2A 1YB6A 4CIXA 3IA2A 5JE8A 4QJ3A 1WF6A 4OSOA 1QH8A 1E1CB 2WYWA 2ZAIA 3NM6B 1NMEA 4CIAA 1LBSA 3FHCB 2E3JA 1J8YF 3Q87B 4MV1A 5K3SA 4ZYTA 1UDBA 2AD5A 1YS4A 1XJWA 3GUZA 4PR3A 5CDYA 3W6PA 2X8JA 3CS3A 3QX9A 4B32A 4F11A 1VLJA 3FTNA 2JIZA 4JB8A 1IZ7A 1Z28A 3K9FC 1GNSA 1I9GA 4QDUA 1A7JA 2VHUA 3RLFA 4OHRA 2I71A 2Q5CA 2H4WA 3PGJA 1KQPA 3KQNA 1WEHA 3KT8A 3HADA 3UNXA 2FHSA 3PCTA 4IDPA 5IT5A 1FBNA 3PP8A 3OURA 4LJAA 1PNTA 1DRKA 1JXQA 4M1WA 4XR9A 5TVKA 2EWVA 3EMDA 3GJTA 3M6XA 4H1UA 4P86A 1NY5A 3I4FA 5EWMA 4ETIA 1LLCA 4ZN6A 2J67A 3BFPA 4BAGA 3PXGA 4KPUB 1SXJC 1OZHA 1NP6A 3MRTA 2IPNA 4NMHA 4GVXA 1RXUA 4W1PA 1LDMA 4EYKA 3OIYA 4C2UA 4BO4A 1FB5A 4EG0A 1UM9A 4U6SA 3SKYA 4G24A 4XGNA 4CETA 5LOVA 4R1OA 3AVWA 1JIVA 1MQ8B 2Q3MA 1NVVR 3IHWA 4AJ9A 1PR9A 2IS1A 1SUSA 2JL1A 4EYEA 1PJQA 3ICCA 2BMAA 2A33A 1P3DA 3DZ8A 3PWTA 2QW8A 4JVNA 3U7QA 3ROZA 4TVBA 2A1IA 5ALLA 3N8HA 1B00A 3H9CA 3K72B 4B79A 2SKEA 5M29A 4QU9A 2D1YA 2PVPA 1OPRA 3R5TA 4QPZA 4I9HA 4POAA 1FSFA 1XZEA 2C07A 3HZOA 2BJWA 3Q3VA 5DM4A 4QUHA 2HWWA 5G53C 4OXYA 4DUGD 3RABA 4YHHB 2E4UA 4O3FA 4HUTA 1IFXA 1N5JA 1PR5A 4EK9A 4QBTA 2WRZA 4EYGA 4CEJB 1ZCBA 3GCGA 3Q6NA 3CX3A 3WHIA 4TMVA 3HCNA 3RFFA 2OV2A 3W90A 5JI2E 4OHYA 3I5MA 2GKSA 1RYZA 3K70D 3G5TA 4I9GA 1D1PA 1E8NA 1GPLA 5FPKA 1E6LA 1JDVA 2WT8A 2HBYA 4PSAA 3ZJYA 4ASUD 1E6EA 4Y6OA 4HHEA 4MEAA 2W2LA 3HDYA 4IDUB 3SM3A 2QTMA 4N9QA 4RA6A 1ADCA 3MINA 2QMHA 1J0BA 1T5SA 4J7XA 1R4NB 1KGDA 1IVNA 1YCGA 1BHQ1 2WZDA 3ER9A 1YI8A 4L4XA 5HQ3B 2EFDB 3PC8A 2G9NA 5AM5A 4OAQA 1PHRA 1Q77A 4ZEXA 2DKNA 3A28A 1QIDA 1Q7EA 2ZYIA 3UFBA 3TR6A 3PQ6A 4MLPA 3WTBA 2P7HA 4BRWA 3A6EA 4BRSA 1YB5A 3HLYA 3I5UA 4N7BA 5ARCA 5GMOA 5J2UB