1I3MA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3mA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3mA01
3ZN2A 5COQA 1HT0A 3GUCA 5KWEA 1E5LA 4GPD1 3OQ1A 1SAYA 1KY5A 2HUNA 2EERA 2DPHA 2X22A 5MGBA 1E1NA 2VYNA 4U6SA 2X1HA 1GTMA 3OA2A 4O0LA 1UXIA 2EXXA 3FTNA 5JBIA 1LLDA 4MINA 3GUYA 4S3MA 3MJTA 2Q4BA 4U0KA 4HFRA 3VZPA 4UVHA 3WWZA 2Y67A 3LLSA 3LDHA 1YB4A 1FDWA 1TEHA 3DZFA 3MJVA 4WLEA 5A9SB 3C85A 4ND5A 4LCEA 3LK7A 5JS6A 4PZCA 3I9OA 2UDPA 1E6UA 2D3TA 2X58A 1VC2A 4MDHA 4QFCA 3OP4A 4A2CA 2Q4EA 2C54A 3ROMA 3TNLA 4A5OA 4DL9A 4BO4A 4CM4A 3MJEA 3E5MA 3FNEA 4XDZA 2HMWA 3I52A 1M66A 1U2GA 4GX1A 3T4XA 1H93A 3JYPA 2P5UA 4KUGA 2H63A 1M2WA 4HV4A 1YONA 3ZW8A 4UEKA 4FIZA 3T7CA 5L95A 3DTTA 2I5PO 3N7UA 4RO0A 1NFFA 3HNPA 4QT0A 4RGBA 4I9HA 4RLSA 1BWSA 2ZTMA 3ITKA 5BNTA 4FN4A 1U1IA 2D59A 4IDDA 1R4MB 3TPCA 1HTBA 4IZIA 3P19A 4TZTA 4PLPA 5IDQA 5A03A 2PGJA 3OJEA 3O8QA 1TLTA 3JYLA 3KYCA 1MXFA 5JY1A 3SVTA 3G0OA 4ZRNA 4HP8A 3DMYA 1Y7TA 1ML3A 2HSDA 2DTXA 4CM9D 3DAPA 4NJMA 2FR1A 1NQOA 4BO8A 2J3HA 5B1YA 3ZWCA 3PTZA 4XA8A 3GHHA 5KCZA 3LU1A 2DM6A 1VJTA 3KXDA 4AJLA 2AQKA 2BGLA 4DMMA 3DZBA 3ZNNA 1FDVA 2J8ZA 3E1KA 4CM3A 2PTGA 4B7XA 1S7CA 1DO8A 4CLOB 2YDXA 3ANNA 2FZWA 4BGEA 3VPXA 1QRRA 3DBRB 1ZEJA 3U9LA 1D3AA 4K28A 1L7EA 4YXFA 5HS4A 4YAEA 3ROPA 2A94A 3FWNA 1UR5A 4NBVA 3ZWMA 4NZ9A 2OMEA 5KKCA 1PS8A 2BFOA 5B37A 4Q3AA 3NDIA 2IEBA 5DCWA 3WNVA 1NFQA 4BL5A 3DOOA 3AU9A 2EG9A 1CERA 2D5AA 1DXYA 5GZ6A 4ZJUA 1Q7CA 2X23A 1VI2A 3LZ6A 1GU7A 2XPCA 1A4IA 1HL3A 4BV8A 1G0NA 5TS3A 1O5IA 4FGWA 4W99A 3STHA 4L74A 3V1TC 3S55A 3U4IA 4WPGA 1DIBA 4E32A 2AE2A 1NPTO 4INAA 5CFZA 4FFMA 4HNHA 4MJLA 1IHXA 2GZ3A 1HDYA 1A9ZA 2DQ4A 1H0KA 2E82A 4IMRA 4RPLA 4DRYA 1DHRA 3OEWA 3JQBC 7ADHA 2XXBA 1GQQA 1YKFA 2QW8A 3OETA 2AE1A 4UREA 3MOGA 5C7LO 2ZB4A 1CYDA 1VE9A 4TMFA 5HBRA 2WD7B 2JCYA 4R41A 4YVFA 4CLXA 5ITWA 1ORRA 3HFSA 4MVJP 2VWQA 4YBZA 3QVTA 1LDNA 2X5KO 4URFA 5J23A 4A26A 2AXQA 1Z73A 2Y99A 3A14A 3LC7O 4XEHA 5JDIC 2BH9A 4WEQA 3NDJA 1NAHA 4GMGA 2OHXA 3JQ9A 1EDOA 3R0IA 5JY6A 3ZV3A 2B36A 3FRJA 3VH2A 3N74A 4BNGA 4GX0A 3UAGA 2PZJA 2Q2QA 4NBRA 4N7RA 3HFGA 3DBHA 5FEUA 1ZMTA 3PHJA 3F4LA 3ZWXA 4IIVA 5JCJD 4R1NA 5EIOA 1E7SA 3ETGA 5HWSA 2Y1OA 5B4VA 2GO1A 4R69A 1YBMA 3K30A 2Z1MA 3KETA 2ZCVA 2RCYA 4OL9A 1DDOA 1A5ZA 4AICA 3L4SO 4YAIA 2VRCD 1DEHA 4Y8VA 2RBEA 3DFZA 4XQGA 4CUKA 3OQBA 3QVXA 4YJGB 1P0FA 4IPTA 3VDQA 1DIRA 2PFGA 2O2SA 1NR7A 1QKIA 3I9MA 4Z0TA 4DBVO 4OYRA 1RKXA 4PRKA 4DQVA 3DMTA 3WQQA 5C7IO 3GLQA 1X1EA 1BHSA 1PL8A 3ANMA 3Q2KA 4PVCA 5JW6A 3A9WA 3RFTA 1FDTA 3ZV5A 2P91A 2NTVA 1RJWA 5A05A 4BS9A 5JAZA 3RIHA 3WSVA 4K6CA 4E5PA 2P2SA 2Y1FA 3DZGA 4YQZA 3RI3A 4HADA 3B20A 3G3EA 4MP8A 2HO5A 3HG7A 3COSA 3JYQA 3NJ8A 4FFOA 3ZU2A 2YHIB 4ZD6A 4JQCA 1LDYA 5T6BA 4ZQFA 3GEMA 5DCUA 4R3WA 3ZWWA 2C20A 5B12A 2GN9A 5HA5A 1E5QA 2YQ4A 1IPEA 1UZMA 2X0NA 5DNAA 4CM9A 3AU8A 4CMEA 2VCYA 5AXCA 4BKOA 2O3JA 1EE9A 2PKQP 3V2UA 4DPMA 4QFDA 2WMDA 4M55A 4Y6PA 4C7JA 3AOEA 3F1LA 4LMPA 3EZYA 2DBQA 2GDZA 4PN3A 1O94A 2HRZA 1U7TA 1Y6JA 1KETA 3V5NA 1VL6A 1WDKA 1M75A 2O7QA 4NHEA 5EINA 3FSRA 2V65A 3PPIA 5C5IA 5KVQA 4UVDA 4RJTA 1ZW1A 3DDNA 3DZKA 4CLOA 2ZTUA 3RUHA 3F3SA 1TI7A 2ET6A 4AJPA 2W90A 3GRPA 3JQ6A 3DBRA 4Q3EA 1DIHA 4MVJG 3I9JA 3GH3A 4CR8A 5KKAA 1DHTA 1WZIA 3OBBA 4FFLA 5FI5A 1NM5A 4XWYA 4BQRA 4FDAA 2EW8A 2VHYA 4E21A 1BDBA 2UV8A 1JWBB 1HDGO 3P2OA 1GPJA 2B35A 2GF2A 3GN2A 5EQFA 3I9NA 3ULKA 3RC9A 1PZGA 5KJEA 5C7OO 1C1XB 4OQZA 1P77A 2Y1CA 4WEOA 3ZV6A 1EK5A 1EVZA 2PR2A 1UP6A 3GR6A 3GPIA 4U7WA 4LVCA 1PU2A 3BMOA 3BMCB 4IGEA 2NM0A 5DF1A 4IDCA 3M1LA 2VOEA 4NU6A 4TZKA 5ER9A 3BYZA 1IOLA 1HDCA 2ZB3A 1DB3A 2CF6A 4KOAA 2BFPA 2VNSA 4NG5A 1RWBA 3RAJA 4RVFA 3AK4A 4GL4A 4EUFA 1F8FA 3WBBA 3WQSB 2PD3A 1LI4A 5AXAA 3W8DA 3CMCO 1MX3A 2CNBA 4HFJA 4CMKA 2HKIA 3TL3A 5CG2A 1IULA 4PVDA 1ZSNA 1PL7A 4OOFA 5IDXA 4CPDA 4IDBA 3WFJA 3WMXA 4B8WA 3WGOA 1Z45A 4I1IA 4BV9A 5B4UA 4DWVA 4XX0A 3S2IA 3NX4A 1ISHA 3WLEA 2Z95A 2OXIA 3DQPA 3DXFA 3UH1A 3QVWA 3SBOA 4MIYA 4AJIA 1T2EA 3FBTA 1Q0QA 3BAZA 3E48A 4OAQA 1NTOA 3HN7A 1P45A 1GQYA 4AJJA 1A72A 1K89A 3CZMA 3H9UA 2IZ0A 1AHHA 2YYYA 1R6DA 4BNIA 1YH3A 1O9BA 3TOXA 3EVTA 3DAGA 4PG7A 5F3RA 2Y93A 4BNVA 4BOYA 3AFNA 3PGJA 1ENOA 2PGLA 5JCJA 3UN1A 1ZJYA 3RUDA 3DO5A 3LF2A 2IZ1A 5EESA 2PA3A 3H2SA 1UAYA 1Q2XA 3TFQA 3BTUA 2VRCA 1JKIA 3E5RA 3VPFA 4BMSA 3C7DB 1ZK2A 1Q0LA 5JAQA 1TXGA 3WTBA 2BFAA 1VJ1A 1BXKA 3HDJA 2AMFA 4YJGA 1ZBQA 5A5FA 4ZQGA 4B3IA 1WZEA 4PLWA 4LSMA 1XKQA 2G5CA 4I5FA 5DT9A 1EUDA 3VPGA 4XGNA 3BZUA 4CLRB 4RQUA 5ES3A 3E9MA 3JQEA 5DP1A 3GDOA 5H82A 3SX2A 2ZJ1A 1GZ3A 3U62A 3HDHA 4U5QA 1Q1NA 5CDGA 5K0ZA 1ADBA 4ZVVA 5ICMA 2B83A 1N9GB 4FFNA 4R1SA 3KVOA 4NJOA 4NPCA 4IUYA 3PJGA 3C8MA 3IJRA 4YT8A 3NT5A 2BMAA 3V1YA 2HMVA 2EJVA 1HSOA 2Y0DA 3JQ8A 4BO5A 5I7FA 2VT3A 4JP3A 2QQ5A 3WSWA 2YHIA 2DT5A 4CMHA 1T24A 3DBLB 4RVDA 5EPOA 2PV7A 3WNQA 4JP2A 1A71A 1PJ4A 1PEDA 1ZKMA 4GGPA 3LYLA 2VHXA 1BXGA 5DN9A 2DPGA 5JMWA 3BTOA 4AJOA 5IXYA 4OQYA 4J4HA 5I9NA 1KEPA 4NU5A 5CAEA 4YDRA 1PJSA 3QV1A 4ND1A 1TVEA 2EV9A 3DZJA 1VSVA 4GMFA 4RVSA 4WK6A 4D3SA 5F5LA 1DLJA 1ZFNA 1YJQA 1ISJA 3JD1A 3E8XA 3Q2IA 1PZFA 3QWIA 2I67A 3OIFA 3UXYA 3AY3A 1NNUA 3ZNPA 3WXBA 4YA6A 3VTZA 2J3JA 5TSDA 4CV2A 3PWZA 3UKOA 4OKIA 3PHHA 4R01A 4BVAA 4ND4A 4BGIA 1VLLA 5L45A 4RQTA 1JAYA 1DJNA 4L4XA 1PGNA 3PHLA 4LISA 2OOSA 4PZEA 2ZYDA 2NQTA 4WLVA 1YDEA 3JQBA 3ZHZA 1WLYA 1NVTA 5IG2A 1CDOA 1DC3A 1QXSA 2DU8A 1ZXBA 3TDKA 4BKRA 3UUWA 5A5EA 5KJ6A 4EUHA 1QSGA 2VT2A 2YJZA 3NTOA 3UVEA 2EKQA 3EC7A 1LLCA 1HXHA 3M6IA 2X7HA 4PLGA 4RF4A 3LT1A 4DA9A 5JDIA 3JD2A 5COAA 1HE4A 1OZAA 1DFHA 4OO3A 4RZIA 1N1EA 3PJEA 2PNFA 4YJHA 3VKVA 5JO9A 3INRA 3PLRA 3H5RA 3D7LA 5EERA 4O5OA 3MZ0A 5IN4A 1QLJA 4E30A 1P1IA 1HLPA 1XDWA 4MO2A 3O8QB 3RASA 2NVUA 1NVMB 2OORA 3KYCB 5KNLA 1WDLA 1CQJA 5EMHA 1ZK0A 4NFHA 3PK0A 3OJLA 4TVOA 5GMOA 2OUIA 2YUTA 1QMGA 3H9JA 4NJMB 5HRUA 5JCXA 4Z3DA 3RUEA 3RVDA 2QRJA 1NPDA 1OMOA 2NLOA 1PS9A 1AE1A 1MLDA 1VL8A 4I8XA 4DC1A 1Z82A 2NV6A 4YR9A 1BVRA 1I3LA 4ZQBA 3DFUA 3K9QO 3G49A 4CV0A 3EUWA 1PGJA 3IJPA 3K6JA 5JDCC 1QLHA 4DIFA 2YFQA 1E7QA 3IL2A 1Y5MA 2E4AA 3LF1A 1N7HA 3PJFA 4XB1A 4EDFA 4HBGA 4CMEC 2WYUA 4OIMA 4DPLA 1JKJA 1JVBA 4CV1A 3GK3A 4GWGA 4DXHA 4D79A 1MB4A 4G65A 2JHFA 4M89A 4CUJA 1UDCA 4RPJA 1GUFA 1E1LA 2J5KA 3RCBA 1H6CA 5CDYA 1XCBA 2NACA 2IZZA 4YCAA 2V6BA 2X9GA 4KTVE 4CLRA 3DEYX 1GUYA 3ONDA 4XIJA 3WYCA 3WGIA 5KJFA 1IL0A 1WW8A 3JYNA 1UZLA 1P33A 2JKVA 1M67A 1UJMA 1Z7EA 2AEFA 2QRLA 2ZATA 5DBGA 4EBFA 2E49A 3F9IA 1U3UA 4OH1A 1MC4A 3GA0A 4XQ9A 3JQ7B 4W6ZA 1HEUA 1YL7A 2HQ1A 3HQ4O 4GLLA 4J9UE 4J9VA 3TZ6A 4DQUA 2QZZA 4GH5A 3RU7A 3QLJA 4PLFA 4NQZA 1RM0A 2FSVA 1R0KA 4AJEA 1LJ8A 2HDHA 1CETA 3GT0A 4R1TA 2Y1DA 4CLEA 1LDMA 3PDUA 3ETDA 2O3QA 2FPPA 3DBLA 1TT5A 3WOHA 4ALMA 4DPKA 1YQDA 3W1VA 5TX7A 2ZK7A 1LXCA 1M6HA 1HYHA 1J5PA 3AI2A 3CINA 3R3JA 5LDHA 1DIAA 3GF4A 3M2PA 1BRMA 1TB4A 4KTTE 3GY0A 1HDOA 1KC1A 5EN4A 1XYGA 4XD2A 4RPKA 3E9QA 5F5NA 3CTMA 3D5QA 2AG5A 4BUCA 1J0XO 4RF3A 2ZQZA 1ZNQO 3PQFA 5IZ4A 3DBHB 4L75A 1RYEA 3EZLA 2W98A 4RDHA 3IKTA 1WDMA 2GLXA 2O3UA 1XU9A 2C29D 4XYLA 5IAAA 2CDCA 3MJ4A 3GAZA 2Q1UA 4ITUA 3GVCA 4JJGA 3VZRA 4BNKA 5JXWA 4MOWA 1NX6A 3WMWA 3WX0A 3NGLA 1LDBA 3ZNOA 5T8KC 1UXHA 2FSSA 1JVSA 3U4DA 2O4CA 4ONEA 4QSMA 1XQ1A 4J4BA 4OXNA 1YQGA 4RLHA 1XSEA 3MJSA 1EZ4A 4J7XA 4A7PA 4YRBA 5IN5A 5GY7A 3D4PA 2Q46A 2AEJA 4TSKA 1IB6A 5DDIP 2HMUA 3W8FA 5JAMA 1UUFA 2R6JA 1VL0A 3KLPX 3WBFA 3HB4X 3NT2A 2I9PA 4J7CA 4B4OA 4CM1A 5G4KB 3B1KA 1WWKA 1OFGA 1BW9A 2Z5LA 3SLGA 3JQGA 4J90A 3ZHBA 4TQGA 2EJWA 4LRSB 1OOEA 1LDEA 3CPSA 2PGDA 3HSKA 3HJAA 3WG9A 4A27A 1PWZA 3LVFO 1DOHA 2GGSA 3GNSA 5K6AC 1F17A 1CIVA 1VKOA 1K6XA 4FGSA 4IS3A 4RZHA 3JD3A 2GZ1A 3HDQA 1U5AA 5L7YA 2DFVA 1DSSG 3PZRA 3I6IA 1DRUA 1X7GA 1E77A 2DBRA 3ADPA 3GFBA 1CF2O 1C0LA 1EUCA 1C14A 1WXDA 1SC6A 3LC1O 1T2CA 3QY9A 4GVLA 4M8SA 3UOGA 2CDBA 3WJ7A 3D64A 3HDYA 1LNQA 3BHMA 1ZMOA 5IZCC 2GZ2A 4PG4A 4R9RA 4LRTB 1NR1A 4R3NA 1FJHA 3ZW9A 5I7VA 3RBXA 3L4BC 4AJKA 3PLNA 3LT2A 3AJRA 3NDRA 1CRWG 3VVBA 1GPDG 1YL5A 1DAOA 2B4TO 4IJVA 2QRKA 1GQ2A 5C3MA 5ADHA 4GLOA 1KEWA 3JV7A 4UAGA 3GRKA 3SXPA 2BI8A 2YV2A 1B16A 1EVYA 3I4FA 2Q3EA 4LGVA 4J43A 2WJPA 1K6JA 2HK9A 5B4TA 1I32A 1U4SA 1DJQA 3LT4A 1NWCA 3RWBA 2POQX 3EDMA 3ZHXA 3WGGA 3HB5X 1YBAA 4IZHA 3OICA 5IDWA 5LC1A 4FQ8A 1YVEI 1VKNA 3U49A 5A04A 1KEVA 4YEDA 3RBVA 3KYDA 1DAPA 1Z7BA 3BMQA 3AI1A 2HJRA 2O3SA 1EK6A 2CF5A 4I9UA 2WD8A 3MWEB 5CEEA 1GCOA 4L9RA 3O4RA 1KOLA 2AQ8A 1J49A 1UDAA 2VZ0A 4MVJE 2C7VA 2RHCA 4ZICA 1P0CA 1W73A 4IQ8A 2NVBA 2OBNA 3BMOB 3JD4A 4BNJA 1PGPA 3JQ7A 1PJTA 1U2DA 2VHZA 4P8RA 3U4CA 4BNXA 3P2YA 4XJSA 4XIYA 4M87A 5DBIA 3VOSA 4XB2A 1JW9B 2Y1EA 3FNHA 1I33A 3JSAA 4XQCA 2IODA 5DBFA 2D5CA 4EEZA 1NXQA 2VOJA 1P44A 2YV3A 5IF3A 4B3HA 1I3MA 1SOVA 2CSUA 2O48X 3O38A 2PH5A 3W4JA 1DC5A 2W2LD 3GG9A 1P1HA 1FDUA 2NQ8A 5I7EA 1ZK1A 2DKNA 2V7PA 4IQ0A 2JD0A 4IY1A 4RCVA 5HM8A 3AM4A 3JQAB 5AQ1A 2JL1A 3I9LA 3X2FA 4YRAA 5TQVA 1A9YA 3JQAD 3OQ6A 5G0VA 5BSHA 1HYGA 4Z0PA 3VAZA 1ISGA 4XYMA 2PKRA 4EW6A 1GZ4A 1KS9A 1LTHR 4D0RA 1NHGA 1DRWA 1SO8A 2FR0A 4Z9XA 3WDSA 4E4YA 3OFSA 3DAFA 3WS7A 3VH1A 1SZJG 4A73A 3T4EA 4WLFA 3FCOA 2Y66A 4E2YA 1E6EA 5CEFA 5ENVA 4F6CA 1B8UA 2C7GA 5AOVA 3L9XA 5CG1A 4OSOA 4GWKA 1R12A 3M1AA 2TMGA 3T7EA 2ILTA 5DOVA 4M1QA 1N8KA 3F6YA 3FPCA 3TJRA 3IDSA 2ZIZA 3VKUA 1N92A 4F3YA 3IOYA 4BNFA 3VH3A 1BTOA 1W8DA 4XGKA 4ND3A 3QHAA 4NK5A 4DREA 5JC1A 4PGFA 2QHXA 4J1NA 2CVOA 5CHEA 5G4KA 2BHLA 1JWAB 2I99A 4IGFA 1U8FO 4G81A 1H9BA 1MG5A 4UUPA 1E3WA 1NQTA 4WCDA 2FWMX 4XGIA 3GVPA 4C4OA 4ILKA 1SNYA 3VZQA 3ZU4A 1T4BA 4PLHA 1YO6A 1EFLA 5U1PA 2QX7A 5I9LA 4IDAA 2DLDA 3L77A 4IM7A 3RKRA 2PZKA 1VPDA 3IUPA 3WB9A 3ENNA 3JQ8B 2YY7A 4J0FA 4MVJF 3ZNQA 3TF5A 5F21A 1PJLA 1E7RA 1EBUA 1P1JA 1R15A 4Y6RA 2PD6A 3TQHA 5JDCA 4WE3A 3Q1LA 4BNWA 2EKPA 4DQXA 2PLAA 5KVVA 1YRLA 1LA2A 4DIOA 1A7KA 9LDBA 1BXGB 4OJNA 4E3ZA 1RYDA 1EUZA 4Y67A 5LDGA 3K92A 3I3OA 1ZSVA 3MTJA 1H6AA 4KQXA 3WGZA 1XA0A 3FNFA 2X8LA 3QVSA 2BGKA 3HWRA 2VZ8A 1N5DA 3KB6A 1I5RA 3IQDB 4D41A 4RPHA 3ITDA 4GKBA 5TLSA 3K96A 5TT1A 4GKVA 1FF9A 3AUAA 3BIOA 4BMNA 4WOJA 3RKUA 1MFPA 2B69A 5FWNA 5HS6A 5DZSA 1OI7A 2PK3A 1HZJA 1SBYA 4XR9A 5FFFA 4FB5A 3H5AA 1XELA 3I83A 1JAXA 2Q45A 3BHIA 1Z6ZA 2VUTA 1GYRA 1IHYA 3E6AA 3DL2A 3F5QA 2C2YA 3PFWO 1NFRA 2X9VA 1PL6A 2O4UX 5H81A 4BKUA 4XDYA 3KSZO 4RPGA 2BF7A 1YB5A 4ZU3A 3AUUA 1WPQA 3ONEA 4E13A 5L3ZA 2NSDA 3V2HA 4E2WA 3OSUA 1ZVMA 4CM8A 1T2FA 4IJKA 8ADHA 2P9EA 2FRDA 3BTSA 1K6IA 2Z1NA 2A35A 3LQFA 3PJDA 3PRJA 3GNTA 3ZCXA 4CV3A 2E37A 3ONFA 4YJHB 1ENPA 2OGUA 4MP3A 1UP7A 3A1NA 2Q50A 2YQ5A 3FWZA 2W2LA 4W7HA 3WTCA 5L4NA 2VWGA 1K3TA 4NDNE 3VPSA 4UULA 3FR7A 1ZCJA 2Q1TA 2PY6A 3ICPA 2NVUB 4IDFA 4RVUA 1P9LA 4Q9NA 4B4UA 1R16A 3D3WA 3JQAA 2AA3A 1B7GO 5KJ1A 1F06A 5T8KA 1GD1O 4I5EA 4ZA2A 3QWAA 5H83A 1YL6A 1EVIA 5ICSA 4PG5A 2V6GA 3OA0A 2JAHA 4YB8A 1E3JA 1ADGA 1Y8QA 3G1UA 2Y05A 4G2NA 1AXEA 3RBZA 3ZU3A 4AJ1A 4IINA 5K9ZA 1T2AA 4XYEA 2ZKLA 3NT4A 2HRBA 3PYMA 3CSDA 3DOCA 5FYDA 4N5LA 4KUHA 3TN7A 3U09A 5AYVA 4F45A 5GZ1A 3OM9A 1F14A 1DLIA 2D1YA 2EW2A 2B4QA 2P68A 3H3JA 4XZ3A 1GADO 4D3DA 3NKLA 4UUNA 4Y6SA 1LSUA 4D46A 2VZ9A 4LW8A 4E5MA 1H6DA 5K6AA 3Q6IA 1C3VA 3FD8A 4CMGA 3NV9A 4UEJA 2RH8A 4NBUA 2NU6A 3E9NA 4IQGA 3GN1A 5I8WA 2GRAA 1YGYA 5I9MA 2XF8A 2E6UX 2OBYA 3KZVA 4D0SA 5T67A 4H16A 4MIOA 3CXRA 3HZZA 1LQTA 3DHNA 2HAEA 4N54A 5IZCA 3LT0A 4D44A 5BR7A 4CQLA 1KIFA 1LLUA 1V6AA 1ZSYA 1W0CA 3B1JA 3H4VA 3L4BA 4AJNA 5KVCA 2ZTLA 4BNNA 1U3WA 1BMDA 3W4KA 1LLQA 1SPXA 3QE3A 3C7CB 1T2DA 5JO0A 1ZEMA 4NFSA 4KDEA 1D7OA 3GNQA 1LSOA 3W8EA 3NYWA 1R0LA 3D4NA 3O03A 5THKA 2BD0A 2C5AA 3VC7A 3QWHA 5JFOA 1TT5B 4E6PA 2I76A 2JFHA 3K8ZA 3FR8A 2ZYAA 2FZEA 2TMDA 4AFNA 1E7MA 4FC6A 4YQYA 3PYLA 1E1KA 4I5DA 1EMDA 3PGXA 1DPGA 1JDJA 1Y9EA 4K6FA 1H9AA 3H65A 2GN8A 2IEDA 3GG2A 3KV3O 4EGFA 5G2OA 2OFPA 3W6ZA 4GAEA 4CMCA 4E5NA 4WOKA 3IP1A 4ALLA 1PIWA 1CEQA 2J3IA 2JCVA 3NJ4A 1X1TA 3LLVA 3WGTA 1IE3A 4ZRMA 5CDSA 4QX6A 3A28A 3BMNA 2FOIA 4HFMA 1GEEA 5KOIA 1KVRA 2C2XA 3V2GA 5BSEA 3IAHA 4JXKA 3NEPX 5IXSA 3RUIA 4YAKA 4WECA 1SB8A 4WNIA 3RUCA 1LU9A 2VHWA 4E5YA 5GZ3A 2GN6A 2AQIA 4CMIA 2DC1A 2J5RA 1ZK3A 3FHLA 3P7MA 4JX8A 2WTBA 4UUOA 5CP8A 4YTEA 2X86A 1YQXA 1BW9B 3JQGB 2EGHA 4DLAA 4EJ0A 4BNHA 3RC7A 4ZHSA 4M54A 4U0JA 4N5MA 1GY8A 2ZYGA 3WGYA 1PQPA 2B5VA 4CMAA 4IBOA 5IDYA 4D43A 3WJAA 4TKMA 1IYZA 1DC4A 1FXSA 2FR8A 5DP2A 4BO6A 3GPDG 1VRWA 1I2CA 4R9SA 2BGMA 1CJCA 2OL4A 2C0CA 2GYYA 4DVJA 1ID1A 4YAGA 1C0PA 1GR0A 4XYGA 4BIIA 4FD3A 4MVJD 3I4CA 1ZIDA 4UVGA 4WUVA 4W4TA 2V6FA 4ALIA 4QO8A 5ILGA 3FF4A 1Z75A 1PGOA 1LX6A 5JMPA 4EEXA 4JK3A 3B1FA 3H6KA 2P4QA 3HHPA 3VHRA 1I10A 1ZUD1 2FHSA 4PFJA 2PZMA 5BSGA 2G82A 3QP9A 4XCVA 4BGUA 3FN4A 4BQPA 1YJ8A 2NNLD 1EEHA 3GVIA 3ZI0A 1QYXA 5THQA 2DBVO 5EL0A 5U9CA 1B8PA 1Y5RA 4OM8A 1H2BA 2O3TA 3I23A 4R16A 3UCXA 4CM5A 4ZQHA 4LCJA 1PSDA 4TROA 3KTDA 3SEFA 5FI3A 4HY3A 4Y9DA 5DULA 4L4SA 2NU8A 3WYBA 1V0JA 1VSUA 3KYDB 3LSYA 2JFFA 3BMQB 1LBEA 4FPXA 1SCUA 1WMAA 1YOVA 2ZQYA 4BO1A 1R0SA 4DMLA 5T57A 3PYXA 1D4FA 1ENZA 3QW2A 3RUFA 3R1IA 3ASUA 4ALNA 3RD5A 3S2GA 2G76A 3PI7A 1V9LA 4J6FA 1E6WA 5KJCA 1Q7BA 3H2ZA 4XR4A 5TC4A 3WFIA 1O95A 1V3TA 4QUKA 4WLNA 1HE3A 2PD4A 3ENKA 4MVJH 2G1UA 4BNTA 2NADA 2HK7A 3V1UA 3S2EA 4YYZA 3BTVA 1V35A 4PG6A 1I3KA 4B7CA 1P1KA 3C24A 4Z9YA 1KC3A 4J0EA 2B4RO 1LRJA 1Y8RA 1ULUA 2JD1A 1UP4A 1ULSA 4YJDA 1EDZA 2E48A 2J6IA 1U3TA 1U5CA 3JYOA 4S1VA 5BQFA 1ENYA 4CL8A 4PIVA 4K26A 3VTFA 3EGOA 3F1KA 2WE7A 3I6QA 4WNCA 1LRKA 2CZCA 4P22A 3WICA 4A03A 5ENDA 4BO3A 1UXKA 3O9ZA 4FJ1A 1A7AA 1E92A 1GYPA 3VH4A 5T5QA 3UF0A 5TT0A 2WDZA 3W6UA 4KWHA 5DOZA 2W2KA 2ZCUA 6LDHA 4CQMD 3TFOA 3WWYA 4CM7A 1NAIA 1E0DA 1LRLA 3NAQA 1E3LA 1XWFA 1XEAA 2IXAA 2Q2VA 3GFGA 3R6DA 5F1PA 1BSVA 4LK3A 4DC0A 1YBVA 3F47A 1E1MA 2AQHA 3QVOA 1P74A 4YPOA 1KY4A 4HUJA 1LC0A 2QYSA 1DFGA 5BNIA 1TA4A 2Y0EA 4YACA 4CUZA 2QG4A 2EP5A 3O26A 4K1LA 3GGGA 4P4LA 3JTMA 4TVBA 3GEGA 3JQCA 4FBGA 2BRUA 7MDHA 3C1OA 5I7SA 2JJYA 4FC7A 3UW3A 2J5QA 4GX2A 1LC3A 2H6EA 4PG8A 1D8AA 3PQDA 4WCFC 1PJCA 2I3AA 4MPDA 1XGKA 4PCVA 4PLTA 3NTQA 3RSHA 3U4HA 4E12A 4FOOA 3H9GA 1R66A 2X9NA 1B8VA 2DVMA 4WKGA 3E18A 1U3VA 4AVYA 2Q99A 1NYTA 4BB5A 3PFFA 1QV6A 4N5NA 2FPGA 3OF2A 2CVQA 2I3GA 3ORFA 3RJ9A 3KEQA 4CJXA 1O89A 4NIMA 3GGPA 4JGBA 2EHDA 3U0BA 1JKFA 2VUSA 4KQWA 1C0KA 1NPYA 2CY0A 1QYWA 4OGWA 5TF4A 4FS3A 3QQPA 1GV1A 3GGOA 4B3JA 2PKQO 4J1TA 2GD1O 4FR5A 1E3WB 3EAGA 4D45A 3WQRA 3H9EO 5A02A 2G17A 2VQ3A 4FFRA 2JD2A 4B7UA 4DUPA 1T1RA 1J6UA 2GCGA 1PS0A 4G5HA 3GDFA 2X5JO 1GV0A 1FMCA 3SC6A 2XXJA 3H8VA 3KSDO 1I36A 2FP4A 2UAGA 2QIOA 3RFVA 4TRRA 5JYDA 1LDGA 1AN9A 2HU2A 2W8ZA 4MVJA 2O3RA 3NUGA 1HF3A 2AW5A 3M2TA 3OIDA 2VWPA 1GL3A 1PJ2A 1RM5A 1HKUA 3AI3A 1N7GA 3KSUA 2P5YA 1QYDA 3R3SA 1GEGA 1R37A 3RC1A 4J16A 3ANLA 3A06A 4ALJA 4AJHA 4MVJM 1IUKA 2H1SA 5I8ZA 1B14A 4W9NC 2J3KA 1YE3A 1T25A 3DOJA 3DZIA 4OXKA 2Y1GA 5G0TA 4HNGA 4A0SA 4CLDA 1HDZA 5C37A 1PWXA 1ONNA 5L51A 1NQ5A 3K31A 4CL3A 1B26A 4CMJA 3FI9A 4HKTA 1S6YA 4YJFB 4PLZA 4Q39A 2VUUA 2WE8A 5L40A 1F8GA 1LEHA 1MV8A 1KVQA 1GCUA 1NQAO 3PWSA 3PIIA 2IRWA 3ZWOA 5A4DA 1A27A 1RPNA 1AUPA 3TWOA 5KTKA 1U7HA 4P4NA 3GHYA 4XRGA 4ROSA 2F00A 1UXGA 3ICCA 1KEUA 3GDGA 4L8VA 4YWJA 4RDIA 3VDRA 1WNTA 1UXJA 4X54A 1WAMA 4J1QA 4MIEA 3W4IA 1E3EA 2YZ7A 4P38A 1ISIA 2AG8A 5A9TA 2CFCA 1NP3A 1HWYA 3B70A 1X0VA 4FJ0A 4JN6B 1HLDA 4IMPA 1X14A 1GYQA 2LDXA 5JLAA 3RC2A 3EYWA 4CM8B 5TIIA 1UDBA 2RIRA 3ST7A 1B0AA 1LUAA 4GSKA 4MVJI 2WYWA 4EJ6A 5G0SA 4RF5A 3C7AA 2C07A 3OIGA 3U3XA 2BLLA 3CEAA 3OH8A 1YDWA 2GASA 1ADFA 2O50A 2B5WA 3GVHA 4IIUA 4BNYA 1LSJA 1MP0A 3JQDA 5HTOA 3PVZA 2RAFA 1DBVO 2R00C 1T4DA 3IKVA 3ZHYA 1I0ZA 4FJ2A 1ADCA 2FMUA 1ISMA 3PHGA 4QEDA 3RJ5A 3ZZNA 3ASVA 1PQUA 3D3WB 3KRTA 3CKYA 5A3JA 4GX5A 1V3VA 2X4GA 1WMBA 4CQMA 4NNJA 4WCFB 3GEDA 3I9KA 4NMHA 5A1TA 4OKNA 4EITA 2D8AA 5T64A 2NVWA 3SJ7A 1M76A 1Y8QB 1HRDA 1ZK4A 3H3FA 4L76A 1P1FA 1LSSA 4L4RA 4YRDA 4B79A 3P5SA 5L7TA 2RH4A 4IDGA 3EMKA 3EY4A 1YB1A 4D42A 1AHIA 1PR3A 4OHUA 4NK4A 2OO5A 4K9DA 4CM6A 3MCVA 4R54A 1PTJA 1XLTA 2DFDA 3QJ5A 3S8MA 2JAPA 3L6EA 4I08A 3RROA 4KDFA 4ZQEA 4W7IA 1GDHA 4U8GA 3TSCA 2GR9A 1ZXLA 1HE5A 4ZN6A 2QYTA 1M6WA 1GZ6A 3C1TA 5F1KA 4MKZA 1U9JA 3QRWA 4RORA 3H9QA 3VPHA 3CE6A 2PH3A 3A4VA 1MXHA 4NBWA 4J49A 4YAJA 2OZPA 4GQAA 4RVGA 4QECA 3BXXA 1FDSA 3S1LA 4E5KA 3NRCA 4Z6KA 1Y9AA 3L6DA 4I5GA 2O23A 5G0WA 1JN0A 4U6QA 4C7KA 2A92A 3OMLA 1BGVA 3GZNB 3DC2A 2D4AA 5A9SA 4CQLB 2UYYA 4MKXA 2GERA 4R4JA 3TZHA 2A4KA 3WYEA 2Y0CA 1B3RA 1GFSA 2FY8A 2YHUA 3KO8A 3AY7A 3EW7A 4PLVA 2D2IA 3OHSX 4Q3NA 1O6ZA 2JCXA 3K5PA 1EE2A 3SJUA 4NR0A 4H15A 2IXBA 2EEZA 1O0SA 3N58A 3UICA 2DBZA 4HFNA 1AGNA 2GNAA 1WVGA 4BGVA 4LSWA 1XG5A 4BNZA 1ZZEA 1JQBA 4UUMA 1NVGA 3WGHA 4LMRA 1T26A 4DGSA 2X5OA 2VYVD 2GPTA 4WASA 3QA9A 4CR7A 4BMVA 4II3A 4ESOA 1E3IA 3L6OO 4LVUA 2B0JA 3Q9UA 4J2OA 2VWHA 5AXDA 4L0QA 1RM4A 5TJ9A 1VJ0A 1I8TA 4EYEA 5A9RA 3G79A 1W6UA 1R4MA 3DBVO 4WJZA 4MKRA 4R1UA 3JQFC 3GMDA 1G0OA 4OMUA 2Q1WA 3D3EA 4N18A 5LCXA 1CQIA 3GQVA 4JJFA 2GN4A 4YJFA 4XYBA 3CH6A 3BMNB 2XOXA 5FF9A 5A3VA 4BNUA 1Q7GA 2R2GA 4B8ZA 1MG0A 1OAAA 1ZO8A 1KVUA 1YWGO 1GAEO 2QZ9A 3PEFA 3ABIA 2CUKA 2EF1A 3AFMA 1SEVA 4QQRA 1L7DA 1XHLA 2DUWA 1I01A 1QYCA 1V3UA 1I2ZA 3FPLA 3KYBA 3TOZA 3KOUA 4E0BA 4UEOA 4CMIB 5ITVA 3KUXA 4Q3CA 1X15A 5TGDA 2GSDA 3WIEA 2CD9A 1PQWA 3C1AA 5DCYA 3UHAA 5KIAA 4F46A 5ILOA 2PWZA 3AY6A 4TRNA 5BNFA 1PX0A 2FPIA 1L1FA 4DTIA 1NBOA 1PZHA 2I65A 3H5NA 4HX5A 5COBA 4BHTA 4E31A 1K5HA 1Y81A 1RM3A 4KUEA 2NTNA 3BA1A 2EKLA 4XQEA 5BT9A 4NI5A 2EIHA 4DYDA 3L0DA 4PRLA 2DUUA 2X6TA 4YT2A 3ROKA 1BDMA 1YS4A 2Q49A 5TNXA 1DC6A 3BHJA 2Y68A 4EZBA 4EJMA 1HSZA 2RHRA 4OSPA 4R5MA 2A9FA 1UH5A 3K2EA 4O1MA 5AVOA 3TL2A 3SC4A 1E7YA 4AJ2A 4BB6A 4IJUA 1OBFO 5BSFA 4XKJA 4HWKA 4IS2A 1FK8A 5G4LA 1TT7A 3NGXA 2H5LA 4E2XA 3KLMX 1B15A 1B3BA 4WCFA 1NHWA 1EQ2A 2PZLA 2VHVA 4Y98A 4CMBA 2HMTA 1JTVA 2NU7A 2X0RA 9LDTA 3K73O 3PXXA 4FCCA 4I9NA 3PWKA 1MUUA 1HDXA 3ROQA 2Q2WA 2DAPA 2NTJA 4R51A 4BO7A 1HYEA 4OXYA 4DYVA 3ADOA 2WD7A 2P9GA 1BG6A 4XJTA 5IJZA 3TZCA 1XQ6A 2AEMA 1AXGA 3ZDFA 1DIGA 1XU7A 3EK2A 2ZJ0A 4QO7A 3INTA 4ID9A 5CPFA 4IXTA 2UVDA 2Q1SA 1ZJZA 2ZB8A 4EI2A 5JC8A 2X0IA 1E3SA 5JPIA 5CPBA 2HJSA 1I30A 1YOVB 4NBTA 2AHRA 2C59A 4E2ZA 4JBHA 1KERA 1I3NA 3MOIA 8LDHA 2JFGA 4FW8A 1UAGA 1BVUA 4RF2A 1JA9A 5L9AA 1NWHA 3FTPA 4GBJA 4WLUA 1VM6A 5CEJA 3MEQA 4AL4A 1HETA 1PJBA 3DZHA 1NASA 2CMDA 4WLOA 2FN7A 3X2EA 4ZGWA 5JYEA 3QIVA 2NU9A 3E03A 3IUSA 3GZNA 4TKLA 4YT4A 1PJ3A 3ZV4A 3IIEA 1SMKA 4H3VA 3I1JA 4W9NA 1U28A 1Y8RB 1UZNA 4KZPA 4A10A 4JBGA 4O59O 1D1TA 3AUSA 3UCEA 4L73A 4BO9A 1QYVA 3C3XA 3IC5A 2WM3A 1ZH8A 4LN1A 4M86A 1P31A 1DFIA 1QORA 1ONPA 3HADA 3ZU5A 3AW9A 2ZTVA 4J3FA 4M49A 4NFYA 4FFPA 4JIGA 4JROA 5F1OA 3CUKA 4PLYA 2IYPA 2VYVA 3H7AA 3NTRA 1X13A 1F12A 2VRBA 1V8BA 3OJFA 1BXZA 1SOWA 4J1SA 1P1RA 4BKPA 1G6KA 1CWUA 1I2BA 3K2BA 4Q3BA 4XRRA 2W2KB 1MFZA 1QP8A 3RQSA 2HK8A 2IYOA 1MC5A 5L7WA 4B4VA 1R4NB 1C1DB 2JHGA 1PR9A 1KYQA 2HMSA 3DR3A 3Q3CA 4IXWA 2GUGA 2D0IA 5EJ2A 4E33A 4J7UA 2DTDA 3D5TA 1X7DA 1K2WA 1EFKA 1ONOA 4RV9A 4ND2A 4W82A 1H94A 3AM5A 2NWQA 3GAFA 2B37A 1SB9A 3DHYA 1N2SA 2DTEA 1H5QA 3TZQA 5L4LA 4DIBA 4Q3DA 3G17A 2EWMA 4WGGA 2VN8A 4EUEA 3PP8A 4D7AA 3VVCA 2UUOA 3D1LA 5JNLA 4R68A 3OECA 4BO2A 3JD0A 3QWFA 3HE3A 2R00A 3AOGA 3GOHA 1MA0A 4UVIA 4CODB 5L53A 3GVXA 5TJHA 5IFLA 2VYND 2V6MA 3PQEA 1P3DA 1U4OA 3ETEA 2EGGA 3MTGA 4TRMA 4R5HA 4AG3A 5CDUA 3ZGYA 4CLHA 4UVEA 1T1SA 4MP6A 5A06A 3PDJA 1U8XX 4JLWA 2O7SA 1SEPA 3EVNA 5U4QA 3RU9A 3JQ9C 3HUDA 3IS3A 4Z3KA 4BNLA 3OJ0A 2HCTA 3L9WA 3LC2O 5TRTA 4TRJA 4J2HA 2CDAA 1C1XA 4YT5A 3RUAA 1A4UA 3HN2A 3WIDA 3DWFA 4D3FA 2YV1A 2G0TA 1HZZA 4IJWA 6ADHA 3PHIA 3KBOA 4QTZA 4CM4B 3BMCA 1N1GA 5ER6A 3ZWBA 1GUZA 1HE2A 1KBZA 2BI7A 1K0UA 1MGOA 3B6ZA 4DBZA 5JSFA 4JBIA 4RL6A 1OC2A 1IZ0A 1XR3A 3DONA 5CDTA 2P9CA 4KP7A 2BKAA 2C5EA 1OC4A 2YW9A 4O6VA 3RFXA 4II2A 5JE8A 4PZDA 4AJ4A 1I24A 2ZB7A 4NH4A 1G1AA 1ARZA 3GC6A 4DLLA 3AM3A 1H6BA 2BFMA 1ISFA 3WGQA 1X0XA 3JCZA 5MDHA 3DMTC 3Q11A 3F5SA 3WR5A 1W4ZA 4J91A 2WEKA 3G1TA 4HXYA 4BNMA 1KVTA 4Z0HO 3SLKA 4GI2A 4JJIA 1JLLA 3GZ4A 4KMSA 2SCUA 3IMFA 2WYVA 1H2HA 3KEOA 3TRIA 1O8CA 4TWRA 1EQUA 3KM0A 4PLCA 3E82A 4GSLA 5JAIA 4P4GA 1XIVA 3OJOA 4JNKA 3QWBA 1YXMA 3KHUA 1C0IA 1QG6A 3L07A 3MWDB 3VZSA 1LQUA 1EVJA 3UFXA 4QXMA 2VTEA 2LDBA 3MJCA 4BKQA 3Q0EA 3CZRA 3Q9NA 2VTDA 3ZWPA 1IZ9A 3DHEA 3F4BA 1F0YA 4DLBA 4B4WA 4J4TA 4FOSA 1KVSA 3AUTA 4JCOA 3AOEC 3CMMA 3ZWVA 2O2YA 2YDYA 1JU9A 4F6LA 4KWIA 1IY8A 3PIDA 3U5TA 3JQFA 5G0UA 2WSBA 3ZH2A 2BELA 2F1KA 3DB2A 4IDEA 3D4OA 4RVHA 1IPFA 4O63O 2IE0A 1PGQA 5EQDA 1B2LA 1EBFA 3EHEA 2HLPA 3ZWYA 3IP3A 5KVSA 4GGOA 3INGA 4OOEA 2OP1A 1N9GA 2W4QA 1HDRA 1D1SA 2P4HX 1PJQA 3ON5A 3TZKA 3ZWNA 3AWDA 4CQMB 5AXBA 2CVZA 3FNGA 1QR6A 1Z74A 2I6TA 2IDZA 1Y1PA 4BO0A 2XAAA 2X0JA 1X7HA 2EP7A 4Z9FA 3UGKA 1R4NA 2YFHA 1C1DA 4H7PA 3S2FA 3UCFA 2UUPA 5L4SA 3OEYA 2C82A 4CR6A 2WWRA 4GVXA 2I66A 1E7WA 1J4AA 3DTYA 4ALKA 3PZBA 3ZWAA 4FSHA 2NUAA 3GMSA 1DRVA 2H9IA 3CIFA 3QSGA 3I5MA 3V8BA 2VNAA 3F46A 2OP0A 1WP4A 3D0OA 1PZEA 1Q0HA 3FBGA 3WLFA 1QV7A
chains in the Genus database with same CATH superfamily
1ITZA 2I22A 5COQA 4MRSA 4RZ3A 5KWEA 3CZQA 1I7NA 4GPD1 4MWDA 1HLFA 3DHVA 3T1YB 1IG0A 1C4WA 3C3DA 4HEA6 4BQIA 4C2TA 4JB0A 2ZTSA 2PUTA 4M98A 3K1YA 2BONA 4G8DA 4KBYA 1M8GA 1TD1A 1WL8A 2ISCA 4JBNA 1CR4A 5KHAA 1RW4A 2QMYA 5CM8B 5IVPA 4C0BA 4MINA 3ILSA 4CWAA 2IUSA 2V98A 1QGDA 3MJTA 4IO1A 3DKVA 3ORYA 4U0KA 1MZPA 2V7GA 3WWZA 4UVHA 1OFVA 3JARA 1F4LA 5EESA 3EDRA 1UZUA 2C92A 1YB4A 1FDWA 4MPJA 2IXDA 3O21A 5EMKA 1D0VA 3ZI4A 3OX1A 2VI5A 4LCEA 4PYMA 1NXTA 2YRWA 2V59A 5H5JA 5JS6A 4Q03A 1RRVA 4EECA 1RADA 2ACWA 3AI7A 1H8HD 1FA9A 2REOA 3THRA 4ENPA 1Q3TA 1QX4A 4UQLA 3LPAA 5K5EA 1R8SA 3NMUF 1VC2A 3IX7A 1U3FA 1W0JD 3EIFA 1K8RA 3O2SB 3WK8A 1YRHA 2TS1A 1R6TA 1RBYA 4QM7A 3A0UA 2PJZA 3AESB 3DE6X 1P7YA 1GARA 3IDOA 3FYSA 1AZLA 2MSCB 2XD4A 1E1RD 1OA1A 2OLKA 1CB7A 4GX1A 3RNLA 1DAHA 3C5HA 3FB1A 1LY1A 2DFLA 1CUCA 3FMOB 2P5UA 3LUPA 3DEAA 4OVKA 4KUGA 3OJWA 3KCNA 1FLAA 3N7TA 4B0OA 1VYTA 2ZUEA 1PVOA 4ZCSA 3MQFA 4B84A 4NV0A 4D9JA 3CLVA 2D2EA 4M6WB 3DTTA 5L95A 3P94A 2GHRA 4RV4A 2B1QA 1OQAA 3HNPA 3U6KA 5HJ7A 1QDEA 1IHDA 2O6HA 4B46A 2IU6A 1DX6A 2CLOB 1D2RA 3C3PA 1X70A 4MS1B 2J3QA 2Y1XA 2ZTMA 5CW2A 4N1AA 1ORDA 1U1IA 5JWOA 3MMPA 4YPFA 1R4MB 4IVRA 4V0KA 3RLFA 4CU2A 4IZIA 3WLNA 6YASA 1ECGA 2EC5A 4LRQA 1DAMA 4UFOA 5FPQA 2NAPA 5A03A 1TK9A 5I6DA 4D2IA 1USIA 5LU9A 3G0OA 1KO8A 3O8OB 3SS9X 4QU8A 3WKEA 1Y7TA 2GVZC 2I7DA 3KV1A 2PNJA 4CKEB 3DAPA 3GJRA 4IEFB 1MH9A 1G5PA 4TLEA 2IHZA 4NJMA 4C2UA 2L17A 2OQ2A 4NH0A 3WYGA 5BUCA 1HY3A 1TTHA 3NM5A 4JC5A 2G36A 4A0RA 3TPZA 2D1SA 1XNJA 2IW1A 3GHHA 4AO6A 8ABPA 5LIPA 1XAIA 1GPKA 4AZSA 3ZQ6A 1NKSA 2YIDA 1Y1TA 2O59A 3H18A 2C31A 3T1QA 2GTPA 3P0RA 3L41A 2XBUA 5AM4A 3ZNNA 1K5DA 2QM3A 2ZKIA 2BEWA 2GAAA 1FB5A 4IGAA 5CURA 5ALTA 5CBPA 2OD7A 3ANNA 3BE8A 4BTVA 5LKRA 2IH4A 4FEYA 5DM4A 2QJRA 2QNBA 4HWTA 4YGXB 2B6HA 4ND6A 3OCJA 4YCCA 1Y9DA 1JDNA 2ZP1A 2IFTA 1L7EA 1DKUA 2FPIB 3QKRB 3ROPA 3WC4A 2P75A 1NE7A 2EP8A 2J5BA 1TGVA 5FOUA 3K9FC 1XZAA 1UR5A 4MVXA 3MT0A 4ZU1X 4AYXA 4BAZA 2OMEA 1DT3A 3JZFA 2BFOA 2FPWA 5F7ZA 3SK0A 1ZIPA 1E2FA 2OG1A 4Q3AA 5DCWA 2ZUSA 2JIDA 4XARA 5AKEA 4UNSA 2FWJA 1PT8A 4MVWA 2Q8NA 1FBNA 1Q7TA 1YR6A 3R2JA 4FGUA 3TM5A 3DOOA 3R5SA 3AHDA 4MAFA 2I03A 4KR0A 1CERA 2D5AA 1YIAA 4NSNA 4RY9A 2IZ5A 1VI2A 2J0EA 5C80A 2XPCA 3EPHA 5D87A 2QN8A 1Z68A 3VU9B 2Z2IA 2GCOA 4DLRA 3W7BA 3HHEA 5D85A 5EZYA 4LJ4A 5LUBA 4L74A 3V1TC 3S55A 3IE0A 5DM2A 1MNAA 3GELA 2JFZA 1NPTO 4INAA 2WU4A 1L2TA 621PA 2G8NA 1DAEA 2I0FA 3GLGA 1W5BA 3M89A 2GZ3A 3N70A 5JD5A 4RPLA 2QD1A 1KYTA 1BIFA 2F3PA 3G0GA 5KKNB 5AWFC 3I5UA 3L4KA 1DHRA 3OEWA 2FQ1A 4JLPA 4U02A 2VDKB 1CXZA 1GQQA 2YJ3A 4BN0A 3D6HA 3RAGA 5ELXA 3OETA 1JAIA 4TYQA 1J0BA 3FPJA 5C7LO 3MOGA 1VE9A 1E5DA 4PR0A 2J4DA 1EPUA 5DGTA 5HBRA 3AVVA 4Q00A 3VOAA 1IC6A 5CTJA 5DE3A 5ALHA 4YVFA 3EWNA 3TS1A 3PE3A 4CLXA 1S01A 2WKPA 3HFSA 2J3LA 4JLOA 4MVJP 5ITWA 1H66A 2VWQA 3QVTA 1JQ5A 1ZJ4A 2X5KO 4G9EA 4P7BA 4URFA 3ZGOA 5E9QA 1ZJ5A 2ZXFA 3TGWA 4RTNA 2WILA 5HM6A 1E5XA 2QVBA 2QXUA 3M1YA 5HIKA 1U7WA 1IAVA 4GMGA 2B94A 3KR9A 1TU0A 2VPWA 5JY6A 3VH2A 4OL0A 8AT1A 1B6RA 1ILWA 1V16A 2GF9A 1BKSB 4BNGA 2ZRMA 3GJ3A 4GX0A 5LP6B 2B99A 2N75A 3T1NA 1QGUA 1IEQA 2VP6A 3OX2A 4NBRA 1BZYA 5FEUA 4I55B 2BFEA 3PHJA 3SU8A 2AOTA 2BBTA 3GRVA 2QMHA 2VCHA 3F4LA 1CK4A 4Z8XA 5FA6A 2A9VA 5GGXA 1UADA 4EUNA 1E7SA 2B5OA 1ZIYA 4TMWA 4B6RA 4F2GA 3D0KA 3LXMA 1X7WB 3K30A 2JEOA 2Q9BA 3F96A 3WL8A 2RCYA 3HCAA 1DDOA 1TZ2A 1RI3A 3CS3A 4I0WB 1KRWA 4K8RB 5IVIA 5GJVC 3L0ZA 1P8JA 2Q9CA 2NU9B 3RRFA 1M2GA 2RI0A 4Q4JB 4WWHA 3PICA 4YJGB 3V33A 1P0FA 3QE2A 2AJLI 2NN3C 5CNKA 5SZIA 3UJHA 2ZIEA 1EWTA 1MTZA 3VU0A 1DIRA 2PFGA 1RQPA 3LNTA 3O92A 3PPYA 4JI0B 1TF7A 2ATVA 4KIUA 2IX9A 5EXPA 5HIMA 3I9MA 2AX4A 1VOTA 3UIEA 4CEIB 5DTQA 5BQOA 4N4AA 4OYRA 1S1MA 2P77A 4B48A 4REOA 4BBAA 4K03A 4PRKA 5C7IO 3AB8A 3DMTA 3UENA 3WQQA 3WLJA 3GLQA 1J8QA 1BHSA 2GAJA 4Z7NB 3QX3A 3BFKA 3CKKA 3FSGA 4HRXA 4ABTA 3RFTA 3K53A 2RONA 4DLNA 1VMAA 4I50F 5CCXA 3ICVA 1XXHE 2QE7D 4WFJA 1V11A 3NP9A 4CFZA 5MN6A 2KLHA 3NR2A 3PFCA 3UT5B 2P2SA 1I6MA 3BRCA 2WUDA 3BHNA 4YQZA 4DR5B 1ADJA 3AUXA 3L92A 3B20A 3W5AA 3G3EA 5GQSA 4TL8A 2HO5A 1G64A 3H1FA 1EGAA 4Q02A 1Y4ZA 1C9JA 1H3EA 3BE5A 2EFDB 3BORA 1N4AA 2C99A 5LA6B 3ZWWA 2XYHA 4NV1A 1EWVA 1IPEA 1UZMA 5DNAA 1CDEA 1Z6GA 1CY4A 3AU8A 4ZO9A 1FPQA 4MEAA 4CMEA 1N5MA 3K4QA 4KZKA 3AL2A 2O3JA 2LNDA 3O83A 3P9YA 1YR9A 3PJRA 2PKQP 4NMMA 5AJUA 1T5BA 1G17A 2X9QA 3FETA 3X1ZA 2MHCA 4EVRA 4EYKA 3TBKA 3WIVA 4XWKA 3E58A 3HB7A 3U39A 3FVTA 2DWPA 4YJ3A 3F1LA 1LK0A 2DBQA 2GDZA 3BEOA 1OHHA 2XNCA 4R8LA 1U7TA 4C4XA 1LJUA 5FPKA 1VL6A 1WDKA 2BEJA 2O7QA 4NHEA 1U5BA 1FFGA 4UVDA 1VZ3A 2XRZA 1KZ6A 1AKYA 4RJTA 5BVGB 3DZKA 1W25A 4ZDWA 4FI3C 3OC6A 3TEMA 3ZGVA 3JQ6A 3AEUA 3L4JA 1DIHA 4CG2A 1H22A 3GH3A 5KKAA 3OBBA 2YN2A 3KOYA 1AUQA 2JLXA 2AMYA 3I05A 4FDAA 4LC1A 5HIIA 4BFYA 2OT3B 4QG7A 1BDBA 2PWYA 2WNHA 3A6LA 3K0CA 1YCDA 2JIPA 4M53A 3TLYA 1CD5A 2B35A 3GJYA 2GF2A 5DNVA 3ECAA 1PZGA 1SK9A 2Q0SA 1C1XB 2CV1A 2IOFA 2Y1CA 3ZY3A 4MB2A 4Q1BA 1LWNA 3ZHUA 1BXRB 3I0ZA 1Y6FA 4MH0R 1SVIA 3GR6A 5KOHB 1M7BA 2R8OA 3NBZC 4M3NA 4ZOEA 1E66A 3K5WA 3S27A 1DQPA 3FYTA 4E4TA 4F1WA 3P2KA 5CT5A 1HDCA 2ZB3A 1DB3A 3CJRA 1RQGA 1NU6A 3IP8A 4KOAA 4D92A 4EW1A 1OVMA 1RWBA 2XVZA 1IN7A 1XA4A 1F8FA 3AR8A 2HK6A 3WBBA 4Y7DA 4MW1A 1LI4A 1MX3A 4GOJA 4PR3A 3U9TA 1XCGB 3I37X 4QKQA 1SXQA 4CMKA 2HKIA 5CG2A 1YVDA 3Q8MA 1P17A 1QVRA 1IULA 3ZBQA 1RAAA 5DBEX 2I9KA 2B25A 2J31A 1P62B 5AM1A 3WMEA 1FSFA 4D4KA 1YZUA 5B2FA 5JVDF 2NZ2A 3ZLTA 4YK7A 1KTIA 2DETA 4V1CA 1I1OA 4DSOA 1ISHA 3ZD9A 1PEAA 3Q6NA 1KYYA 2D54A 2OXIA 3DXFA 5EKTA 3I28A 3PDCA 1PP4A 2AN4A 4AJIA 1GNTA 1T2EA 3BAZA 3E48A 3I73A 3ZTYA 1TKBA 2C2HA 4Q6BA 2N42A 5H8WA 3KQSA 4Q19A 2VYFA 1F7UA 3ZE8A 1XN1A 2QMEA 3T9BA 4AJJA 3GJ8A 2HSEA 1K89A 1GKYA 1Z34A 1KKUA 4M1TA 2W43A 1SH7A 5K0EA 1E32A 5K4GA 2EVWX 2IZ7A 1RLOA 1O9BA 3T15A 4MQ4A 1CC1S 3EVTA 2NG1A 3DAGA 1JYSA 4BOYA 1YFLA 3II6X 3R4CA 1B43A 1ODJA 2ZT5A 3PGJA 3MS7A 3ZXXA 1ENOA 1JEYB 2PGLA 3BE4A 5JCJA 3UN1A 1C0EA 5CA1A 1FMTA 5I5EA 4KWCA 2DQZA 3DO5A 3UPUA 3TFQA 1CUDA 5CB0A 5HXAA 5K4HA 1LBHA 1RMTA 3RKSA 3OZ7A 3E5RA 3UC9A 2RHTA 2X2OA 5JQWA 4BMSA 1KAMA 2JHAA 3T7TA 2BFAA 2OAEA 2WJHA 4KDCA 2WHPB 1QO9A 3VV2A 3HDJA 1SU6A 5EHGA 3S7ZA 1FTSA 1X7YB 2HHJA 1IWOA 3HR7A 3OZSA 4RTOA 1E9CA 1DKRA 3PQ3A 1WZEA 1KK3A 4PLWA 4NDAA 2Y1LA 4LSMA 3DUFB 1GRRA 1OYYA 2GZSA 4I5FA 5DT9A 4QPZA 3VHXB 3K0BA 2A84A 3I1IA 3QU5A 5U4XA 4B17A 3WHLA 2VRWA 4YMLA 4CLRB 1TC1A 3R44A 2I54A 2Z04A 3RBAA 4KR3A 4Q82A 1RJFA 5HQ3A 1KA9H 4RTJA 1HG0A 1V5GA 3D8TA 2P2LA 2HLHA 3GDOA 1GZ3A 3JQEA 4JLBA 5BN5B 1OH8A 3EZ7A 3OC0A 4FUTA 3HDHA 1Q1NA 1SULA 2BEUA 4I6JA 4Q1EA 4WZBE 4G0YA 3ZLAA 2JBHA 3B6IA 3FI0A 4MO9A 5ICMA 1WO8A 4FFNA 3EIOA 5BN4B 2ODEA 2Z2XA 5KYTA 1PWEA 4IUYA 3PJGA 5HK8A 5TVGA 3IJRA 4QYSA 4YT8A 1IIRA 2BMAA 2O14A 2HA7A 2HMVA 4Z8YA 4DJEC 3CUSA 1L8LA 2R5WA 1HSOA 3JQ8A 2AYZA 2QQEA 3F90A 2VT3A 1MGPA 4JP3A 2XYGA 4ER6A 5I7FA 5KQRA 3U40A 1OILA 2YHIA 2DT5A 1UANA 3U3KA 4H6PA 3DBLB 4PNHA 3WNQA 5KYXB 3M5DA 1ZKMA 1GJRA 1YJCA 3TOVA 1QO0D 2FWNA 3IUBA 2DPGA 5DN9A 3ZIUA 2JLQA 4AJOA 1N6PA 2XT0A 4LRUA 5I9NA 5I4KA 5CAEA 1AQUA 4IMJB 2IIPA 4ND1A 1UIMA 4GBED 4YN3A 4TVSA 1S0UA 2PGIA 4HWOA 3VJLA 4D3SA 1YFJA 3TQTA 3FDJA 1OROA 4PHGA 1J33A 1YJQA 1ISJA 3JD1A 4DNPA 1KNXA 3FDXA 3QWIA 5TGZA 3VSBA 3G9XA 3SF8B 1RPTA 2GAFA 4NRDA 2W7TA 2B8NA 3EEYA 3PC6A 4LJ8A 4YA6A 5BMVA 3U4AA 1R5BA 1PG5A 4L8WB 5CDFA 1DAFA 3BAFA 4TV9F 4CV2A 3CVYA 1QU3A 3UKOA 2V1UA 4HPWA 4RESA 5JNSA 1FIUA 2X15A 3PHHA 1WTAA 4ACAA 3PHBE 4Q16A 3AEYA 3LTNC 5JNVA 4ND4A 2D2VA 3D3QA 2PCLA 5CFQA 2FU5C 5L45A 2NZVG 3ZE9A 5GVRA 2HQBA 2J33A 1LBQA 2MSWA 3R4VA 3S2YA 5FI1B 3PHLA 3TUIC 4H1WA 5M5BA 2OOSA 4MW0A 1U8TA 2I4TA 2NQTA 1MO5A 2QTCA 3FYDA 3JQBA 3ZBTA 1QF9A 3DDCA 3MT9A 3ZHZA 3L7BA 3ZDCA 3KSMA 1FX0A 1KPIA 5ALUA 4ZVLA 1UDXA 1WLYA 2Q9UA 1NVTA 1KMNA 5B1SA 1CDOA 3EG9B 3I42A 2FVYA 3LQYA 2FEXA 4Y2VA 1L5GB 2DU8A 2FEOA 1TIPA 1GLGA 3H2KA 4BWVA 2VF7A 2PG3A 2PYIA 2ZWVA 5IEJA 3BIJA 1Y4AE 4PX5A 3AXTA 5SZKB 5LSAA 4BMZA 1J5EB 3C74A 1QSGA 1ZQ9A 2VT2A 3NTOA 5ELMA 3UVEA 2G5TA 1LBSA 2X7HA 2ZRIA 1EFVB 3LT1A 4NMWA 2QE6A 3JD2A 3T7RA 4JT2A 1JMVA 4RZIA 1G8HA 3AEZA 3TKLA 2ZRGA 4I50B 3ZGLA 3ZIAA 1Z2PX 1DQNA 2YNMC 1XDUA 1PV1A 3VKVA 1NU8A 1AM4D 2CEAA 1GILA 2C97A 3A6EA 5HKAA 3LUKA 3EXFA 3KALA 5SYMA 3H5RA 4ZZ0A 1K5GA 4O5OA 4EHHA 4PO1A 1EX6A 1T2UA 1P1IA 2AUTA 2OB2A 2WJAA 1JEAA 1HLPA 1I1HA 2LR0A 5GJWC 4ZEOA 1DAKA 1XDWA 1XRSB 3AHIA 3D31A 4EJSB 1WSWA 4B6GA 3O8QB 3I2YX 1NJ1A 3EVDA 1CQJA 1U65A 1Y9ZA 3KQOA 4OBWA 4OIFA 3PDWA 3PFGA 2NO5A 2V7UA 4G1FA 4MHOA 4Q6WA 4IV8A 3VR6A 3W90A 4E3WA 2YUTA 2I2WA 3C6MA 4L7QA 4WNAA 5DX0A 2QSJA 1SKQA 4HH1A 3DO6A 4XPIA 1C50A 4Z3DA 3TKYA 3RVDA 5C18A 5JCXA 1NPDA 2ZS9A 3DYIA 4CDGA 1OMOA 1WHSB 2NLOA 1PS9A 1VL8A 3KB8A 4I8XA 1NVDA 3BKWA 2UVPB 1F60A 4QXAA 3MTQA 5HG0A 4LOAA 2WVHA 3ZKWA 3E3LA 4DWOA 1I3LA 4ZQBA 1GPH1 2I4MA 3B13B 3I8XA 3K9QO 5KX5F 1ZDMA 5M29A 3A32A 5AVQA 3J80A 2ZSDA 1PGJA 1SA0B 3IJPA 2JLBA 4Q4LA 4XVHA 3D4LA 3K6JA 1BN6A 5DNEA 5LZ9A 3N2KB 3Q40A 2WG1A 3CRRA 2ZCJA 2OV8A 3IKJA 1PFUA 3BCSA 1G3QA 3A25A 1N7HA 4N3AA 1DTWB 4ME6A 1XFDA 3PXAA 2LTAA 4S1WA 4HBGA 3T3HA 4CMEC 4G0VA 3EDQA 1V1RA 2J4CA 3WYNA 4EABA 4CV1A 2CK3D 1TZBA 4GWGA 4DXHA 2I7XA 5CFMA 3NFRA 4D79A 1F1BA 1ZD3A 1TMKA 4X1IB 4MARA 2IHJA 1UDCA 2VNKA 2H1FA 4ZAWA 3ECSA 2J5KA 5T4FA 2IHYA 1C30B 5CH8A 4EIWA 1XTPA 5TPZD 5EKSA 5CDYA 4FE3A 3OP1A 2JLSA 2IZZA 5IX8A 1DBWA 1LH0A 4GYYA 2HFKA 4TL7A 2BFFB 5B30A 1HQYE 1ZHHA 4X65B 1J9ZA 2BMEA 3WGIA 2PUBA 3AR9A 3OTGA 4BQEA 1MC8A 3LCJA 5EJ8A 2JKVA 5DBGA 2H2DA 4LXUA 3AEKA 3W5HA 4ABYA 3IFSA 4PRYA 3W05A 4EFNA 5LOVF 4DQUA 1C3OA 1QH8A 1L5KA 3K5IA 3UB2A 3UB3A 4KE9A 3RANA 4UBKA 721PA 2WSSD 3JZDA 5FHRA 5CYPA 4BBZA 1JSZA 4D99A 1RM0A 2FSVA 1R0KA 1YZTA 4EH1A 3BXOA 2HDHA 1ESEA 1VPLA 2H1CA 4YMSA 3GT0A 4M0PA 4R1TA 3W5CA 1LDMA 1TJYA 2NYAA 4YP0A 5T7BA 4GS5A 4K81B 2FZLA 3ZGNA 1OD6A 1UBCA 2BFNA 2HLDA 3DOHA 4C87A 1NW5A 3MF4A 4ALMA 1TPZA 3BF8A 4D4JA 1HORA 3PUHA 3A9RA 2VXBA 3W8NA 5ED4A 1SHTX 5L8VA 3AI2A 3HZRA 2PAAA 1I9CA 2JJQA 4KXVA 1YHYA 2GN0A 3B3FA 3M7IA 3PXUA 3R9IA 1AKUA 4XWOA 3QVGB 1BJTA 2EFHB 1BRMA 2MSNA 4ZFNA 4A6PA 1RXUA 4RPKA 4Y1FA 3GRFA 4KSBA 3HACA 5AVYA 2QVYX 2AG5A 2A5YB 3Q9SA 2I71A 4LZJA 2DR3A 4XM1A 2ZQZA 5F7XA 2XWJI 2JGDA 1P7CA 4R1MA 2PXHA 4D26A 1MA3A 4H2DA 4BMYA 4MQEA 2O3UA 3L5OA 4FWBA 2F9LA 2YFKA 4ITUA 3NHLA 4JJGA 4BNKA 2O2JA 5K8UA 4MOWA 1NX6A 1TKRA 2A6PA 2NXEA 3BXHA 3NGLA 2ZJZA 3QE0A 4KNWA 4KXUA 2HJVA 4QBGB 4R3UC 1EG2A 3KJZA 4FHEA 1A9OA 3P2IA 1UXHA 4S05A 1E0AA 3CVUA 3G2NA 1YK1A 1W19A 2PM8A 4J4BA 3CO5A 1CZRA 1YQGA 2WF5A 1DQRA 3ASYA 2QTTA 3OKCA 4IDXA 4A7PA 1ORIA 4DMKA 1QC5A 5GY7A 4YAUA 4C29A 2VJMB 4TSKA 3ACDA 3C6QA 5T41A 4RULA 5JAMA 2O0HA 4HNRA 5HRAA 3KLPX 3MJFA 4FWIB 1V3QE 3NT2A 3WBFA 4J7CA 4B6OA 3CVJA 3L0BA 4P08A 4UDOA 4EPXA 4IG9A 1BW9A 3ZHBA 2YWJA 4LTNA 1BE0A 1OOEA 3DM5A 3Q7SA 5BV0A 5D84A 3WLHA 3LFHA 3HSKA 2PGDA 4G07A 2P9YA 3HJAA 4NPAA 5CMLA 4FZRA 1GITA 4PWZA 3EODA 1DOHA 2XOEA 4X91A 4EO7A 3GNSA 4HRAA 4NECA 2AFHA 2QP4A 1B76A 1VKOA 2QR2A 3QXGA 3CRQA 4RZHA 3B6KA 1BEEA 1SKAA 3TW8B 2QX9A 3RU2A 3IEMA 3P0HA 3OOWA 4U7HA 1DSSG 1XRQA 5DSXA 3AVOA 1JHAA 2UZ1B 3I6IA 5CA0A 2NZWA 2G70A 1WZ2A 2OEPA 4CIYA 2ZPAA 3FE2A 4JJ6A 4JXZA 4GR4A 5DGDA 2RKBA 3C5EA 3GW8A 3D64A 3HDYA 4ZODA 2ZW9A 3HCDA 4OV6B 1F0PA 2YZMA 4H6VA 4KPEC 4ZWNA 4QM6A 3KR2A 4J1JA 1RIFA 2R8BA 1MCZA 3U44B 4RHXA 4HB2A 1VPTA 4G37A 4BVEA 1RRFA 3LGAA 1TM7E 5I7VA 1XTKA 4O29A 4YONB 3C70A 4LOHA 4RM3A 4EF6A 3T5DA 5AW0A 1Z83A 4RY0A 1UWLA 4HUTA 3IHLA 4LZOA 3VR3A 5ADHA 4LBWA 2GHIA 4UAGA 3GRKA 1E9DA 4RD0A 2BI8A 3SXPA 3W8RA 1K4YA 1B16A 1EVYA 3I4FA 5I01A 3WB1A 4LVNA 4IUDS 5BWCA 3O2NA 5FOXA 3Q41A 4P3OA 4RCYA 3HZHA 1V71A 4J3NA 1PNOA 4IKEA 5FOVA 3LPMA 2BFCB 1ISSA 3IEIA 3QK7A 1I9GA 3ZHXA 1TYEB 3I04M 3HB5X 4DCMA 3ADCA 1YBAA 3DAYA 4ES6A 1T36A 5LC1A 1N2CA 2P2CA 1E3QA 1YVEI 4TV9B 2PUGA 1VKNA 2GD2A 1NVXQ 1DPFA 1N6OA 3IQEA 4V0RA 4YEDA 3PD1A 4DV6B 1Y42X 3AI1A 2O3SA 1I94B 2UYQA 5ADVA 5G1OA 3TOSA 4I9UA 3OTHA 4LHZA 2CYCA 1FUYB 2BE9A 1FRZA 2A1TR 2BM0A 2OLEA 2Q5JA 2WD8A 2BHNA 4G1BA 1OLUB 3THSA 2QAJA 3PD0A 3O4RA 4L9RA 3VNRA 2AQ8A 3RTGA 3CE9A 3OWOA 2P4SA 3HB1A 2C7VA 1N2JA 1UQTA 5JS2A 3IGFA 1K8QA 3KB2A 4BASA 4IQ8A 5AI8A 2NVBA 1KQOA 3REQB 4JFAA 2YXBA 4JKOA 821PA 1ORWA 1EFHA 3T7AA 4AKEA 4BNJA 3GCGA 1LNZA 2KE5A 4LV8B 3EGWA 4RWZA 1KZ1A 4EI8A 3VGPA 3U4CA 4X44A 2FUCA 2HIAA 1LF0A 3VOSA 1Z3CA 3EASA 5HMMA 5DBFA 2D5CA 3WDMA 5IF3A 2C7RA 1K7XB 3DD1A 3N87A 2GILA 2V7QD 1I3MA 3URKA 4UBIA 5KPJA 1JFRA 3DP9A 3FOZA 3THYA 2O48X 3O38A 4Q34A 5JT1A 3SQDA 1IXYA 4G8JA 3U7GA 1DC5A 1WG8A 1QMPA 4ZI7A 3HMKA 5KNDH 2XTAA 1OU0A 3BFPA 5F73A 1DTEA 5I7EA 1THGA 5LMZA 5JALA 4IY1A 4EPWA 2AC7A 5AQ1A 3BRWD 3KELA 5BV8A 3WGMA 2P9JA 2WF6A 4WV3A 4YRAA 1XPUA 3OQ6A 2ZIFA 5BSHA 1OT5A 4AYTA 1HYGA 3AIMA 3GJ6A 4UOEA 4Y1EA 2R84A 3K8OE 1E61A 1JSXA 4GOND 4N7JA 3HBMA 3ZZTA 3H5LA 3WDSA 2FR0A 1SO8A 3FNRA 4C3OB 1E8NA 1GNSA 2BIFA 5K2OA 1FSZA 2YBEA 3DDSA 3R5XA 4BP1A 1GRQA 8MHTA 1GGVA 4FYMA 5BV7A 1PT6A 2PGOA 3V7WA 2QN2A 4F12A 5KX5B 1PDOA 4A73A 1L4GA 5KYNA 5JXJA 4NL4H 2Y66A 5D7BA 2E3JA 5JUWA 1QHXA 5ENVA 4F6CA 4XVUA 4CCAA 3L9XA 5J2TA 1NNEA 4GWKA 4PQGA 2NGRA 4F4CA 3SR0A 5EWJA 4QJ4A 3CLTC 2C78A 4K2AA 1OKKD 3FDIA 4ZYZA 3DNMA 3FDFA 5TEWA 1N8KA 1YR7A 4PYIA 3SF0A 2WAAA 3FPCA 3UAVA 2FQXA 2V7XA 1N0WA 4HNAA 4NONA 3ZY5A 4DM3A 3LLCA 4MRPA 4DWWA 2JH3A 1ZVKA 2NU6B 2RGGA 2OWEA 3N2GB 1EUDB 1NQUA 2ZI3A 4GXNA 2FSGA 4O4HA 3WISA 4N3GA 1X1DA 3LXUX 3TINA 1BWQA 2Y9MB 5JXHA 1XD8A 2R0QC 3BQ9A 4CETA 1Q2UA 5G4KA 4MUFA 4IGFA 2XHEA 2D62A 3F5MA 3PUYA 2F17A 4UUPA 2F62A 5EOVA 4WCDA 4ZK2A 3GP8A 3SYKA 1C8VB 3GVPA 5A2QA 2W11A 4ILKA 1SNYA 2HXGA 3QPAA 4GPZA 3ZU4A 1CJVC 2RGNC 3S1AB 2FX5A 1GL6A 4PU0A 3WK7A 1E2QA 1Q19A 2RAUA 3NHYA 2OKCA 3KOWA 5EIBD 1E2HA 1FUEA 5F21A 4Z1MA 1E7RA 1P1JA 1XD2A 1Z5VA 4QUEA 1OXSC 4PC3A 6ABPA 1U3GA 3Q1LA 4D96A 1NKVA 3AR7A 2G0AA 1O95C 4C6TA 3Q7RA 5BY2A 3DC7A 4JFRA 5DWVA 4QZVA 4ACBA 4RW0A 1XEXB 4B31A 3NBKA 1LA2A 2V7VA 4INPA 1A7KA 4HUQB 1DG1G 2H85A 3EIWA 5F4BA 5LFAA 5IM4F 1ZNXA 3WLPA 4A8JA 1GZVA 4XSGA 5KINB 4Q1DA 1KWKA 1WOMA 3K92A 3WK9A 2UUCB 3DOUA 1H6AA 1IRIA 1TZMA 1P5ZB 2H2FA 3BCRA 3F4KA 1CY1A 2KHZA 1F1JA 3QFSA 4EFKA 3TW6A 3CWQA 3HWRA 2CFIA 5EUBA 3ZXSA 4X5OA 3ER6A 3VR5A 4Y2RA 3LCRA 5BN1A 1I5RA 1SCAA 2YJ6A 4N6GA 1DT5A 3A10A 5IK2A 3C3BA 2CXTA 4DC9A 1DXQA 1PFGA 2A57A 4MULA 1H0HA 1LZLA 1NI4A 2PANA 2PX8A 3M6MD 1SHKA 1G6OA 1CRQA 3KFVA 2FCRA 5E6UB 4CW7A 1EDEA 2O1SA 3U7QB 1R9JA 1HH4A 3F97A 4QTTB 2CXNA 2RK4A 3T5CA 3A6KA 5HS6A 4EAQA 4TWZA 3FNIA 4DHEA 2G4VA 2QNRA 4LTMA 1J97A 2HGZA 4UNPA 3FOCA 3H5AA 5AO9A 3VR1A 4UTRA 3W2GA 1QFZA 3BHIA 3CRMA 2LXNA 3EBLA 3KT8A 2XT9A 3CW9A 1PTKA 1URPA 1YQTA 1VL5A 3KPYA 1JQAA 2LBPA 2X9VA 2ZVJA 4IDUA 3DE5X 3RSZA 1XHFA 3DL0A 1OH7A 1M9NA 2Z8YM 5AESA 5H68A 4YP9A 2Z8ZA 3K2QA 1VLZA 2R8PA 2V7BA 3FBWA 3AUUA 1WPQA 4LZAA 2EZ9A 3EGXA 3ZUGA 3PR2B 4K3UA 4K40A 2Z2JA 4E2WA 3GLFE 1E0SA 4NCHA 3BDVA 3A1FA 2XTZA 5T6MA 2IBSA 4MUKA 1M2JA 3OQMA 3FX2A 2BDUA 2I78A 4GXTA 1EM6A 3BTSA 1GG9A 1K6IA 1FP2A 4XSHA 3L46A 4JC4A 1QS0A 3R7SA 3A6HA 3BRSA 4EA7A 1APBA 3W78A 2ZPUA 5JNWA 1JX6A 2DQYA 3ZCXA 3TLCA 4OATA 4IGKA 5H3LA 1FYFA 2BMDA 2QL5A 3EXIB 3ISJA 2QL7A 3QI7A 1ENPA 5B7NA 2GM4A 1OLSB 2GB4A 2OGUA 1UP7A 3AL3A 3YASA 5AVRA 5DGCA 4HMPA 2HHAA 1W5SA 1C7QA 1EWYA 3FWZA 3FWHA 3FCYA 5D5HA 1SK8A 4LNUB 2PJDA 4NDNE 1N8SA 3JVDA 3JATA 1GA4A 4H7IA 5J4KA 2CHFA 1C2TA 2PY6A 1I14A 1YKSA 1HOTA 3KWFA 1MEOA 1UM8A 3IB3A 2NVUB 3ZHTA 1RXVA 4Q9NA 3E81A 3D3WA 3JQAA 1EXNA 1AG9A 2B1JA 2IQ5A 1BX3A 3KKLA 3PNVA 3UMSA 1CP3A 2YWFA 4LK2A 4XFKA 4AU1A 3AL0C 2V3VA 1M2OB 1JHYA 3EZ6A 3RSFA 1YL6A 5DTIA 3RK0A 3TUZC 1DGQA 5FBLB 4ILEA 1QZUA 2BE7A 4PN7A 3NNSA 1ZOLA 1YRQA 3LY5A 1E3JA 1ECBA 3BWXA 4YB8A 5JECA 4D80A 2GAIA 4G2NA 2G6TA 3TW0A 4UASA 1ELOA 5AJWA 4WZAB 3RNOA 4HQLA 1KSGA 5IUKC 2VATA 2M2IA 3DOCA 3N7AA 5FYDA 4KUHA 1XWIA 4AW9A 2NUTA 4E09A 4F45A 1JL3A 1Z37A 2W2NA 1WF6A 4FCWA 2VNJA 1F14A 1DLIA 4I1UA 2ORED 1X19A 3QU4A 2P68A 3H3JA 3HGMA 4MWZA 2G04A 4UJ5A 1GZSA 4D3DA 4EQZA 1KMCA 1W47A 4UUNA 5FAXA 1JKJB 1RFLA 4C6RA 1CEYA 3FIUA 3X1MA 1OJ7A 1E89A 2WC1A 4OMCA 4BE9A 2NU8B 1OR8A 3HL0A 1BDHA 4GLJA 2GEKA 4CMGA 1A4XA 4ERXA 1SCUB 3G88A 2AMVA 1CCWA 3NOOA 4LBYA 1QIMA 4BZPA 2RH8A 1LK7A 4WFQA 1IG3A 4C88A 3DVRX 4PC1A 4G2TA 2QDXA 1MB2A 2GRAA 5I8WA 3ADBA 2CLFB 4MUNA 5I9MA 2D0PB 1K98A 2V6IA 4I5IA 4AMYA 2OBYA 1VE3A 5A6SB 1IK6A 2JK0A 2KM1A 4O8CA 5T67A 4KREA 1CU1A 1K88A 1RCUA 5HZMA 4LF9B 3QEMB 2GZDA 5AH0A 1P2GA 3I0MA 2HAEA 4YV0A 4PPFA 1O57A 1QIGA 1TLFA 3MS2A 2AF4C 2Y2VA 4UARA 3MA0A 5C9ZA 4CQLA 1KIFA 1ZSYA 3DYBA 4KI7A 3DTVB 3KUCA 3W6PA 4PS1A 1OX4A 4CIXA 3H2IA 1R4AA 1XMVA 5IKOA 4BNNA 3L8HA 5CLHA 3MCAA 1R0XA 3IXQA 2H4YA 3RK1A 3W4KA 1SPXA 1FZQA 1PNRA 4JV5B 1T2DA 1ZEMA 2YBDA 4RA9A 3ANTA 1D7OA 4BFTA 1LSOA 1U0TA 1S2NA 3ZLBA 3OIVA 4CKBB 3NYWA 2GCIA 1R0LA 4EGCB 3O03A 3FCXA 1OLXB 5THKA 2C5AA 3NIFB 1CY7A 1CUJA 1E5TA 5F23A 4UUQA 1Y1SA 1VIVA 2DEUA 2NOAA 2IF2A 4DDMA 5BNZA 4DS3A 5AW2A 4KVFA 2VA9A 3O8BA 4HSEA 5FBRB 3E70C 1E7MA 1K5PA 4YIHA 1RAFA 3DKPA 1PT7A 2GPYA 2N3ZA 1RKBA 2FKAA 4F71A 1ISRA 3EGIA 5A7HA 3V4VB 3K70D 3TAHA 1D9XA 1LPOA 4G4GA 1SVWA 4WIAA 4QUGA 3UMGA 3ZJVA 1MHPA 1Z6XA 4P2GA 2B9VA 3LBYA 4HNQA 2GN8A 4JI5B 4FQ7A 5L3QA 4EGFA 1F48A 5G2OA 2G9UA 1AUXA 2HRRA 1LPAB 1W9MA 1TRKA 3KEMA 3GLTA 3R6TA 1RTTA 4RE5A 4O4JF 4CMCA 4E5NA 1PIWA 4R1LA 5FWDA 3WGJA 2JCVA 1IOVA 3WGTA 4TOIA 4B47A 5HUQA 3G7SA 3QF7A 2TSYB 3HBFA 1IJFA 4PPYA 3FVWA 2JI9A 3X1YA 2FOIA 1ZQ1A 1GEEA 2XCTB 5KOIA 1KVRA 2C2XA 3V2GA 1NJ6A 1NOJA 5LQJA 2XOKD 3IAHA 4LNHA 2II6A 2L82A 4ZKDA 2WICA 4ODIA 3FLBA 5KTNA 1E9EA 1XTSA 1SB8A 3LA6A 3NCTA 4E94A 4WNIA 1TQDA 2C4WA 1SBZA 5K1ZA 5K3DA 3OEHD 1OAKA 2IEYA 3PGVA 3IEXA 2EL9A 5SV2A 2QUHA 1Y3AA 4JX8A 4LGMA 4UU0A 4C4PA 2AUNA 1R18A 1PSZA 1ZR2A 4S1PA 4M1MA 1G4AE 1YQXA 1TJ3A 2HCBA 2PMCA 3H99A 4QARA 5EZSA 4EF4A 2EGHA 3U1TA 13PKA 4G4IA 5B58C 3JWJA 4U0JA 4R6XA 4ARZB 3RS7A 3IURA 4N5MA 4WY5A 1STOA 3D8NA 5J63A 3WYDA 3ZK8A 3ES9A 1G19A 3I2GA 2ZR0A 3ZVMA 4CMAA 4IBOA 1P0MA 2V9ZA 1CW2B 5K51A 6GPBA 2RHMA 5H4HA 1AQLA 4PONA 2A9OA 2ZDHA 3E5NA 2AH5A 4PRZA 5DP2A 4ZIRB 4BO6A 4TT8A 1VRWA 3HC7A 3M70A 1PV2A 3NIWA 4EX6A 2BGMA 2OL4A 4N5DA 3HDTA 1F3OA 1RLMA 1RI4A 3W5JA 3AILA 3ANSA 2YWRA 4MR8B 1FNBA 3B2NA 1JHRA 2V03A 3L1IA 3VO8A 5EXTA 3NHAA 1JS1X 1R0YA 4WUVA 1KSJA 1S96A 1ZIDA 2XDQB 4UVGA 4W4TA 2VP9A 4QGFA 3H83A 3L8FA 4ALIA 2R65A 4K0KB 4QO8A 4DCNA 3I5YA 2J3DA 5AVZA 3RSQA 1D7AA 1L7AA 3DEJA 1RWWA 5TR9A 3B1FA 2P4QA 2NXNA 3TD9A 3VHRA 1UQUA 3BCHA 3PUXA 1I10A 2FHSA 4HQ0A 4I1YA 2F1HA 2XUJA 4RD6A 4IILA 2AK3A 2PZMA 4PFJA 3T1HB 2YTZA 5BSGA 1Z6QA 1GNVA 1NLZA 3VO9A 4JLNA 3C3JA 1NOIA 1M6NA 1H3NA 1V8OA 2I33A 3KJIA 5THQA 4AJ9A 1OX5A 4KVGA 1UMDB 2Q7DA 4NULA 1T35A 1Y5RA 4KKVA 2O3TA 3TMYA 4Q21A 1O6FA 5DGIA 1BNCA 2GO7A 2P1RA 2V58A 3LO5A 4QXOA 4BLSA 5IF9A 2C8JA 4ZQHA 4G56A 4ZCQA 3WRYA 3ZLJA 2OD2A 1L5RA 1YJXA 2NT3A 1IY9A 3D6AA 3DMHA 3G5TA 3B38A 1YRBA 2XUGA 3QYFA 4YYZA 1TF5A 2AOWA 1R0SA 1BMFD 3K9HA 3NWEA 3PYXA 1DJPA 3QW2A 4P3YA 1VYHA 4FFWA 4LECA 4ALNA 3RD5A 2G76A 2VDJA 1ZD9A 2OILA 3PI7A 4BVLA 1C9MA 2XZDA 3HKEB 3A1TA 4Z1OA 3D2AA 3WFIA 1Y7LA 4HB0A 1SXJA 5CJPA 1O87A 1HE3A 4IJ5A 4MTCA 5FTKA 3TG8A 2G1UA 1L8XA 4BNTA 1JTFA 2Q4OA 4B4KA 2ZWMA 1PEKE 3C43A 1V35A 2C42A 2X5NA 4LDRA 2HI0A 5BN3A 4PG6A 4RC9A 4ZOQI 3FWYA