4LYHA

Crystal structure of small molecule vinylsulfonamide 9 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lyhA00
4LV8B 3SN6A 4E22A 1TQ2A 2V1UA 4PSVA 1M7HA 3PEYA 4LHYA 3AVXA 1OXUA 4U7DA 3CPJB 5J4HA 4RKEA 3KJGA 3PUXA 5K8TA 3KJHA 4QHSA 3ZS9A 1R5OA 3GLFA 1ZD1A 3C5HA 4TT3A 3TJZA 4PFSA 3EIHA 5H70A 5HZKA 1NSFA 5A4JA 2O52A 2AN9A 2WIAA 3F5FA 2QBYB 3RANA 2QZ4A 5EUMA 1EFRA 2JLZA 5HR5A 3HPRA 3R9XA 1E9DA 4M53A 4OJQA 1II9A 1EFTA 3CUEF 1KNQA 3IEVA 1E0SA 2N46A 3WMGA 3AKCA 4Q4AB 3VX3A 5E3HA 1XTJA 2R6DA 4KHZA 2ZYTX 2WWWA 521PA 4QFMA 3FKSA 3IPXA 5KDOA 4BFZA 1W49A 1AKEA 2OG2A 1AGRA 1RJ9B 3CWQA 3K09A 3UK6A 2A5GA 1OXSC 2CHQA 4TTRA 4TLAA 2FOLA 1M2OB 5TXGA 2P0EA 1IOZA 4EPVA 3GLGA 2VSFA 2WKPA 4XOIA 4WOPA 5FUVA 1AK2A 1FPMA 1ZW6A 5J4LA 1KZ7B 4QM6A 3QKUA 3QPVA 421PA 1LFDB 2ZM5A 3AF3A 3RLFA 4JVNA 1VECA 1U98A 1YKSA 3ZH9B 3FWYA 4Q4JA 2QUZA 4AWXA 4DLWA 3QOFA 1II8A 4AD8A 1TNDA 3OHMA 3ZJYA 4I81A 1N5JA 4QHYA 3LXXA 4GFDA 4PC6A 3QF7A 5CIWA 4AURA 1E9BA 3I32A 3FFAA 4D25A 2JIZD 3WY9A 4M22A 1KI9A 1GWNA 1TPZA 4E5UA 4A36A 4F93B 5L3QA 3S1AB 1WXQA 4JLPA 3LXRA 5EXSA 1X3SA 1ZU5A 2HDNB 5CDFA 1IJEA 2ZRFA 1OXVA 3K0FB 1XMIA 5AUOB 1KO7A 3CZQA 4TLEA 4BE7B 2GHIA 1GKYA 2ZRLA 1PV4A 4LWZA 3FOZA 4OKSA 2AFHE 4XVRA 3NH9A 3QIAA 4RFSA 1WQ1R 1N0WA 1R7RA 2JDIA 3I1FA 4LRWA 2QMEA 1E0KA 2VHJA 4FD2A 4DT1B 3TR0A 4PSKA 5KHOC 1VG9B 3P4YA 4B48A 4RVCA 4NL4H 1ONBA 4P4UA 2Q6TA 1UPTA 4P3YA 4DSNA 4B3XA 4HLQB 1SXJA 3U6BA 1HY3A 2DWQA 5IDVA 3ZS8A 3LA6A 4F4IA 1WMSA 2ATVA 2IYYA 3EARA 4A9AA 3U3MA 5KNCA 4OQFA 2CLDX 5C18A 2OCBA 1MR3F 4TMZA 4OHVA 5CB8A 2OFXA 2G88A 1NJGA 4JSTA 2ZYVX 1CJVC 1TUEA 4E09A 2RMKA 1NNEA 5FL7D 2HJGA 1KDOA 1ZD9A 2VIIA 5AK0A 5FI1B 3B6EA 1KO8A 2IYUA 3WNDA 5LPNA 2ZJYA 1C1YA 4TWZA 2EU8A 4EUNA 4MH0R 2ZU6A 2OM2A 1IN4A 4J0QA 3RRYA 1TX4B 5DIFA 4Z51A 2ZAMA 4B2PA 2C96A 1XRJA 4JJZA 1FW6A 1KI6A 3FB4A 2FF7A 2XNDA 2CK3D 1W4AA 2GJSA 1KGDA 1Z2CA 3TSWA 3QKSA 2J0SA 2QAGA 4DUGD 4B6EA 3BERA 1OW3B 1JPNA 4V0OA 3IO3A 1VYTA 1DAIA 4DCVA 4MYUA 3OIVA 5LDDC 5BN5A 2FSFA 3R8FA 2N42A 2P67A 3AF2A 2IYLD 3MCAA 4FMDB 4JLMA 3VU9B 4MDFA 4M4SA 1S96A 3RHFA 2ZE6A 4TL9A 4Q9IA 2YOHA 1NMYA 2H16A 4TSFA 4F91B 1YR8A 3A8TA 1TUIA 4IJMA 1HQYE 1QVAA 1NBMD 4FCTA 1XXHB 4Q7KA 2ZRDA 2NMVA 4JBYA 3AF1A 4DEYA 5FOWA 2J0QA 4XJXA 1Y63A 1PUJA 2QGNA 4Q9HA 1N3BA 4PPNA 3V4RA 5KNDA 1G16A 2B8TA 3BJIC 2BBWA 3TSOA 4NPHA 1P62B 2XZPA 1UADA 4TTPA 1G3MA 5FPHA 3TUJC 3AVVA 3LW7A 5KPJA 1QZXA 2R6AA 3BOSA 4N3NA 3CRRA 1CKEA 4WA7A 3IUYA 4HATA 3U7HB 1L2TA 1SVSA 2R65A 5D3MB 2GILA 2IYVA 5JS8A 2NO0A 1JEDA 2CNWD 1V43A 1N25A 3PCRB 3G5UA 5BN4A 3W5JA 2ZXUA 5FBLB 3Q72A 4Q19A 3NDPA 1U2RA 1XJ0A 4Q1AA 3JZAA 1XEWX 4EFMA 3GLFB 1VYVA 1P4SA 2JLXA 2HEIA 2VQSA 1UKZA 1ZYUA 4FMBB 3TVDA 2KBEA 3KKOA 3R8CA 2Q9AA 1Q12A 3CKLA 1T8TA 1CP2A 2ZR7A 5AUNB 1J2JA 3X1WA 1VMAA 1D8TA 5CM9C 3WMFA 2GBLC 4YQFA 2HLDA 3VFDA 4KI0A 1ZIOA 1T9HA 3ZYCA 1CF4A 1EWRA 1G41A 1I4DD 3LQQA 2ODBA 3ZLJA 1UFQA 4IOMA 3GLGB 3T61A 1VCOA 1IN5A 1D2NA 1GRQA 1V5WA 2IBMA 3LX8A 4HZUA 4IXNA 4QGAA 3ND8A 4PQRA 2FU5C 4O3MA 4QNRA 4ZKEA 3IQWA 1OH8A 3RRZA 3GJ3A 1E2MA 4LPSA 4NKRA 3A4MA 3KKPA 4BFYA 4TT3D 3K70C 4Q4JB 5SZJA 3RS0A 1ZRHA 3FHCB 1U9IA 4LJ8A 2REBA 1RZ3A 1II8B 1GL9B 2ONJA 2C03A 1EFRD 1DADA 2BDTA 4KVGA 3GJ7A 5CJ2A 1KJWA 3VX4A 3L0PA 4PHGA 3VR2A 1KMHA 2HF9A 3LDAA 1NF3A 2YVUA 5BYJA 2V54A 2FWRA 4OQLA 1NSTA 3FKSD 4M9QA 4OI4A 1US8A 2GCPA 4WAUA 4YMWA 5G3YA 3U3KA 4KFUA 3QKRA 1EG7A 4PC3A 5L3QB 2PCJA 1WP9A 3NWJA 1YR7A 3NKVA 1G5RA 5EUQB 3R9IA 1RYHA 1N6IA 3DZ8A 1ZC3A 1EK0A 4DHEA 1Z8FA 1QRAA 3IKJA 4CW7A 2F3TA 2RB4A 3ICEA 3NIBA 4JBWA 3BRWD 2C98A 5EP2A 3X1YA 2VEDA 1TADA 5JJIA 5DH9A 1SULA 3A58B 4CDGA 3PQCA 1XBTA 2O0JA 4JBXA 1KI8A 4C30A 5IF9A 2ZE5A 3P4XA 1OB2A 3BH7A 3VAAA 1AQYA 4DB2A 1SXJB 4V0MA 1TF5A 1YVDA 3MWKA 3T35A 4TYWA 1CJMA 2FFHA 4HSEA 2ZYWX 3JZMA 3VR3A 1ZD8A 2I4IA 2GK7A 3SDZA 3W34A 1G8GA 2GJ8A 2D3WA 2JLSA 4JLJA 1ZU4A 3U3OA 3PFIA 1F2UA 2FH5B 4M1MA 2G83A 3KUDA 2MSEB 1W7AA 4G01B 4US2R 2ZRNA 1B0UA 1Z0DA 1KDTA 2JDID 2ZEJA 4HAVA 4MA4A 3PUYA 5EP3A 5FUYA 4FINA 2V7QA 3EG5A 3TW8B 1P2TA 1PLKA 4DKXA 2QORA 3AH8A 2JJ8A 4OQXA 3WHLA 3BB1A 2IX3A 3FYHA 3SJCA 2ATXA 1R0XA 1E79D 3ZD6A 2SHKA 4L9WA 5AJYA 1P6XA 2A7QA 5F9HA 2QU8A 3N2IA 4OL0A 1F2TA 4ASUD 4KYIB 4I1SA 2GXSA 1KI6B 1SXJD 2HYDA 1W44A 3D3QA 1F5NA 1FFHA 3P27A 4D0LB 2ANCA 1FQJA 2K5UA 3GCGA 1E2PA 3MMPA 4Q7LA 4B2LA 5JCPA 2QAGB 2QL6A 2YJTD 3QI2A 4DSUA 1JJ7A 1KK0A 1YZKA 4OK5A 5JCZA 4IRUB 4JS0A 4NCNA 4ZDKA 3QPWA 4NYJQ 2I1QA 4M1SA 5EP4A 1QF9A 1YZLA 5GADl 4JYCA 2GVZC 5B30A 2HYIC 4QGHA 2YHSA 2XTNA 4KLZA 2UZIR 2AK3A 2O8BA 2QAJA 2IA5A 5BW8A 1Z6TA 2GK6A 2WOJA 4PC2A 1KY3A 5GJVC 1U8AA 2WJHA 2GCNA 3T1TA 1QHXA 1T5IA 4Q47A 3H84A 3BWDD 4LUCA 2BC9A 4XWAA 1UM8A 3TIFA 1GIAA 4L4UA 4RD1A 4TMXA 5KYKA 5TB5A 2OUKA 4LJ5A 5A5GA 1XPOA 1G3IA 1ZAKA 2W0MA 5FPKA 1W48A 1BO6A 1DEKA 2VA8A 1VYUA 3TW4A 5KDLA 4AK9A 2O8EB 2PT5A 3AVYA 1KOFA 3CR7A 1GL7A 1SKQA 2OSBA 2OAQ1 1N6NA 3BC1A 2FFBA 2EWVA 1YRAA 3NH6A 1ZM2A 5CITA 2QBYA 1YZQA 3KL4A 2IHBA 1M6NA 2QP4A 2A2ZA 1UEIA 5FOSA 3Q5EA 4XTRA 3EASA 1OH6A 2RGNA 1N0VC 2FNAA 2A3RA 3EZFA 4QJ3A 4P0TA 4XD7D 2CCJA 4Z54A 1XZPA 2ZJ5A 3U7GA 1YZUA 2QP3A 1TTTA 4JL5A 4B47A 3QSYA 2XEXA 3CPHA 3GD7A 4IVQA 4JYBA 2GETA 2AX4A 2NOAA 2WIBA 1N6KA 3ECCA 1T0HB 4CGZA 2E9SA 5L3SA 5FTLA 5C4MA 1AN0A 2VP9A 4JLKA 1ZNXA 4GNKA 4MGYR 2BMEA 3HPQA 3LLMA 2FV8A 2PT7A 1KHTA 4HI0E 4NMMA 4TYPA 2AWOA 2WWXA 2BBOA 4LDJA 2CBZA 3D8BA 5BN3A 1KNXA 4XVQA 2ZI7A 3QPUA 2ZVQX 3SI7A 3TNFA 1N2CE 1ZM9A 3RS2A 3EZ7A 3DDCA 4NCJA 3TRFA 3VR5A 3X1XA 2OEPA 4W9MC 3QEJA 1KMHB 1N6HA 2HLDD 4UNSA 1NY5A 1RKBA 2FEMA 3CO5A 3GLHE 3K0EA 4H1UA 2P6RA 3GMTA 5CLQA 4F4CA 4HDQB 1US8B 2QT0A 4XSGA 3QXSA 2VP2A 3K0FA 1PVOA 4EDHA 2ZSEA 3TQCA 1E2KA 2VRWA 4NYJR 4RZXA 2ONKA 5HE9A 1T8UA 1LNZA 2JJ1A 3THOA 1RRCA 4Q7MB 1OXTA 2W00A 4DT1A 4KYUA 1TQ4A 3GJ4A 3SHWA 2ZUBA 4NE2A 3I4LA 1OF1A 4V03A 3U4QB 2GA8A 3IEUA 1U90A 1R8QA 3OIYA 3CRVA 4TTQA 2BMJA 4PQFA 5FBQB 1E94E 1SVKA 1GDDA 1I4TD 1PZNA 1SHZA 1LY1A 5JFGA 1X86B 5EZ5A 5FR2A 3CX8A 1TAGA 2Q0HA 1TF7A 4LC0A 1JAIA 3E2IA 4A6XA 1I4LD 2PZFA 2ZITA 3WYFA 1XDBA 1OV4A 3CNLA 3M1IA 3QUSA 4G0NA 1XZQA 1H8HA 2W2VA 1KMQA 1ZBDA 2W0SA 3QBVA 4Q9KA 2AR7A 1E9AA 3WRXC 4CZ2A 1M34E 5B57C 2PX3A 1R4AA 2YWGA 1AKYA 1F2UB 1QHIA 3TQFA 3KQKA 4IVPA 5FR1A 1DBSA 1GKUB 3K53A 3IO5A 1G64A 2RHMA 3WP1B 4C0BA 1KI1A 1BH2A 2W6ID 4ITRC 4B71A 4W5WA 2FSIA 4BEJA 2BKEA 4JSYA 4Q02A 3OZXA 1E2JA 5DGXA 1ZM4A 2LKCA 4Q9JA 5FTKA 1PLJA 1ZP6A 2OBNA 4WZAE 4F7WA 1W0KA 4A0FA 2Q9CA 4V02A 3U5ZB 2BJVA 1F2TB 4QNMA 1OH7A 1F6BA 1MABA 3Q5DA 2I1VB 2RGGA 3WNCA 4BECA 5CYOA 3SFZA 3ADCA 4LHZA 4A1FA 3UPUA 4PX9A 2VP0A 3UIEA 2VF8A 1KDRA 4C7OB 1K5GA 1T3LA 3AVPA 5J4VA 1X6VA 3TAHA 1KK1A 1XEFA 1G3RA 4C4PA 2I3BA 3ZIAA 5J47A 2EYUA 3AF0A 1CR0A 2C04A 1X8JA 2YYZA 1IN6A 4HAYA 2GF0A 2JLWA 2YWEA 2IUUA 3TMKA 4B76A 2LWIA 3AVQA 2OLJA 1UJ2A 2ORIA 2WMOB 3AKDA 3FE2A 1OYYA 1ZM3A 2PJZA 4KBGA 2XJ9A 4DZZA 3FMFA 1KJYA 1OSNA 4ZPXA 2C2HA 1RIFA 4JT4A 1OKKA 5TMPA 1JPJA 1NIPA 1MKYA 3A4LA 2XAUA 2IS2A 3LNCA 3QJYA 5D3MA 4IDNA 3GEIA 2ANBA 2F1RA 1ZINA 3W5IA 4EFNA 4OHXA 1DPFA 2YNMA 3PITA 4MGIR 1IXSB 3DMDA 3TUZC 3H2YA 3K0AA 2OV2A 2ZS9A 4HB3A 4YDHB 3CWZA 5B64A 3HU2A 2B8WA 2WKRA 3I5YA 4BRUA 4OBEA 3FTQA 2XJ4A 2YWFA 3ZGXA 4E07A 4QC2A 5DI3B 5F98A 2AD1A 1YR9A 3GJ8A 2VH5R 2F9LA 5GJBA 2XSZA 4LHXA 3Q3JB 4IDOA 3EW9A 1OPXA 2L0XA 2RKOA 4A2WA 1BYIA 1D2MA 1G18A 1OFTA 1G8FA 3AP3A 2A5FA 2P5SA 4A15A 5CK5A 2ZI6A 1FP6A 1HE1C 2DFNA 1OFUX 2D2FA 3TGPA 4OHYA 4IVRA 3W8NA 1M74A 2XB2A 1JEEA 3NVAA 3K09C 3LLUA 2WZQA 4UNRA 2IS6A 4IEIA 1CULC 2ZRHA 5L3SB 2W2TA 1YE8A 3KQUA 5G3ZA 2IWHA 4Q1EA 4LC1A 1OH5A 2EFCB 2ODWA 5DI9A 3TUIC 3GFPA 2O8FA 4NYIQ 1HA3A 3A6PC 2NZ8A 2OCPA 1VTKA 2VSOA 4HLCA 1BKDR 1PUIA 3UWKA 2GJAA 1JB1A 3K8YA 2QSYA 2GXAA 4JVMA 1WB9A 2CEAA 4ACAA 3QXJA 5EXPA 1IXZA 2A30A 4BEBA 2HT1A 2JLUA 621PA 1N6OA 1L8QA 3I8XA 2O0HA 4B43A 821PA 1VG8A 2V6IA 3C15C 2HUPA 3C7KA 1NI3A 2IYSA 2VBCA 3M6AA 3T5DA 3PG5A 1VIAA 3VNVA 1UKEA 3RSOA 4IDPA 4GBMA 1CBUA 2G3YA 2VL7A 4PO8A 4UXJA 1GITA 2GKSA 3BBPA 1E1RD 2REXB 3KXKA 3GQBA 1SHKA 1UBGA 4LHWA 1A5TA 4RSGA 1ESNA 4DEXA 3ADKA 1NMZA 2FSHA 3A1WA 5FTJA 1GILA 4M1TA 3IILA 2IYTA 2QN6A 3VKWA 1RYFA 1LF0A 1D9XA 2J46A 2WWYA 3Q7PA 3LBIA 5JJKA 4LJ7A 1B23P 4G5GA 1E2DA 1GRRA 2OE2A 1E0AA 4BWYA 2WJJA 1SVWA 1Z6GA 3UMSA 3ONWA 5KTYA 4GMXA 3PEVA 1CRQA 5JSZA 2WSSA 3ZVRA 5F9FA 2BVNA 5DYGA 4A92A 3B85A 4LJ9A 1U94A 2BIFA 1G4AE 1E79A 3CX7A 3EZ6A 4LX0A 4QRHA 5LBIA 4DDVA 4TN1A 4V0LA 2IS4A 2CHVA 1N6PA 4ASUA 3EXAA 5AJXA 4MKHA 1Q1ZA 1DG1G 1SXJC 2ZI4A 2BHRA 3KDSE 1DAFA 2BEJA 5DLQC 1Z83A 5KUTA 3M0EA 3ZVLA 2H5EA 1Q1EA 1NP6A 4PAMA 1DE0A 1S9HA 4PHTA 1XTRA 3UMFA 1NN1A 4IEEA 4LBYA 2IYQA 1AS3A 4Q48A 2QA5A 2ZREA 2JJ1D 2WTUA 1DAMA 1Q21A 1W1WA 3SQWA 4RD3A 4MRSA 1GKIA 1DARA 4TYYA 1HQCA 3NBXX 3EPKA 3T15A 4D26A 3K9HA 5AR1A 2QNRA 3GEEA 4FMCF 2J87A 3ZZ0A 4B3BA 4I4LA 2ZTSA 1S2MA 4IFBA 4MQBA 2YINC 3W8RA 1KSGA 2ZSDA 1KKMA 2MSDB 1R0YA 2H18A 1YZTA 2IW3A 2QE7D 3ASZA 2N1BA 1P9WA 3W6PA 3QBTA 1MH1A 1MABB 3MWJA 3EA0A 4AC9A 2XTZA 5IK2A 2QAGC 1H8HD 1IN8A 2ZI5A 2ZAOA 4R7ZA 5KSYA 5EE0A 2JCSA 3CRMA 2EW1A 3K0CA 1A82A 2CXXA 3U3RA 4NYIR 3K0CC 4DLSA 3QVVA 1E4YA 1T91A 4UJ3A 4B75A 3X2SA 1TQDA 3LFUA 3PUZA 4ZCIA 1NVUQ 1XB2A 1W5SA 4OI1A 5CIQA 2ZU0C 5AUQA 4ARZA 2YOFA 1HEIA 3FKQA 2GRJA 4LHVA 1I2DA 4B44A 5EE1A 3RABA 4A8JA 3LVRE 4GP7A 4KBFA 1Q3HA 1AZSC 4UNQA 5TY0A 2WMNB 3A1VA 3AM1A 1W0KD 3B7GA 4XD7A 1Z0AA 3VHLB 5EP1A 4CEHA 3M4YA 3LH5A 4DJTA 4A0HA 1N5IA 1KZGB 1I2MA 4Q00A 1Z3IX 2GDJA 4PPQA 3T5GA 1FTNA 221PA 2XOKD 4EJSB 3IHLA 1A4RA 3ADBA 2DFLA 1K8RA 4PC1A 3L0IB 4X8MA 4A0RA 3KB2A 2O8EA 3H86A 2QPAA 1FOEB 2NO6A 2X77A 1W36B 3K0AB 3OEHD 3Q9LA 1W47A 3U6KA 3WYGA 3SNHA 3PEWA 4BLTA 3ZIAD 4PHFA 1BMFD 1E2EA 2BEKA 4CVNA 3CRW1 4Y0AA 2OLKA 3A36A 2OESA 5AJWA 4PAOA 2BMDA 1Z08A 4MUBA 2V55B 2ZJ2A 4BASA 2CE2X 2PJRA 1IJFA 2GNOA 3QQ5A 4DLUA 5F3WB 4W5JA 2Q9BA 2FZLA 4M2LA 3PJRA 1M7BA 1NLZA 2R2AA 4RD6A 4JT2A 4DIDA 2GJKA 3HYRA 1OKKD 2YWHA 4TQAA 3WMEA 4LZZA 4IDHA 1G7TA 4NCIA 4KSCA 2RAPA 3W9YA 4D4KA 3W3AA 4DRZA 5A0FA 4YLGA 4MKGA 3THYB 1JJVA 1ZNWA 3IQXA 2QGZA 1YRBA 5GVRA 4M21A 5JSZB 3Q7QA 4TQ9A 4L9SA 4LJ4A 3EIQA 1W36D 4R2HA 3OE7A 2IYXA 4FWIB 2C95A 2PEYA 4GZMA 5SZHB 1EFCA 1E2LA 2FFQA 2WOOA 4TMKA 3REGA 1E2QA 4MKIA 4EFLA 2O8FB 1G3QA 4M9ZA 2G0TA 3K9NA 2IXGA 1FL9A 2FPLA 4ZCLA 5JECA 4FCWA 5CYPA 1IY2A 1U9IC 2XSZD 1OYWA 2ZRJA 4QKQA 1R2QA 2Z4SA 2G1JA 1YZGA 3CW2A 4WVFA 1OIVA 4XH9B 4XIGS 5H68A 4DVGA 3KQHA 3FDIA 1WBDA 4TZ0A 3W6NA 5C4GB 1T0JB 4JKYA 3TK1A 5H8WA 4XWOA 3PV0A 3K9GA 3PXGA 1W4BA 5FPTA 2QTFA 1W4CA 2GEVA 4I1UA 2DCUA 1W5TA 1KKLA 1CS4C 1T3SA 1ZNZA 3BH6A 4TMVA 3TR5A 1RPZA 4PPGA 2QEQA 3E5HA 4ZI2A 1LTQA 2AXNA 3UANA 3N2EA 4PO1A 4QBFA 1UBEA 4NBSA 3U44B 4LPKA 2DWPA 1Z22A 4X8HA 2F1HA 4K8OA 3ETLA 5KNBA 3NDBB 4D2IA 3U4QA 2XXAB 2W6IA 3NG1A 1AJEA 2X1VA 2OAP1 1Z06A 1VDZA 2WWFA 2EFGA 1BIFA 1CJUC 4JL6A 3EC1A 3GLFE 1G1MA 4LY6A 3SE0A 2Z6VA 3OEEA 1WRBA 2O8DB 1CR2A 2ZJAA 1OXXK 4AG5A 2R6CA 5JRZA 1F3OA 3EA5A 3CX6A 3NHBA 2J1LA 2QTVB 4Q4LA 2XNSA 3NEYA 2CLSA 1E4VA 4HB4A 3AV0B 3FGNA 2PLFA 5BXQC 1X8LA 1G291 1YZNA 4TL6A 4H1VA 4UXIA 4RZUA 4E03A 8OHMA 1W2HA 4MRVA 1OIWA 5SZKB 4N0EA 5FI0B 2A5YB 1OFIA 3AVWA 1RW4A 4BFTA 4ZDJA 2QY9A 5EXTA 4A2QA 2FDCA 5L8VA 1C9KA 3SYKA 4O0MA 2WSSD 4TYNA 1G7SA 1S1CA 2ZS8A 2ZYUX 3OFNA 4OK3A 1XCGB 2QQ0A 2CDNA 3BGWA 4MGKR 1G5TA 2F1JA 2VSXA 1U0JA 2ZQ5A 2MMGA 3ND9A 4Q01A 2Q21A 3SZRA 3L43A 3QXHA 2J7KA 4POAA 4FN5A 3F3YA 1A2KC 4ON9A 4PZYA 5JLJA 1DO2A 1T6NA 5D3QA 4GRAA 4C7OA 2KSQA 1OIXA 5TARA 2ZJBA 3G82C 1E99A 2DBYA 4IW3B 2B21A 1TL7C 1UF9A 2CVFA 4CT5A 3PEUA 4IKEA 1IONA 1DAEA 5DO9A 5CDFE 4BZPA 4A82A 2ZPTX 4M1OA 1GUAA 2BBSA 3B2EA 1MV5A 4KU4A 2V6JA 2O5VA 2AHOA 1G8PA 4MYHA 1G17A 3TH5A 2ORWA 4DCSA 1JNYA 2DFKB 2WJIA 3HWSA 1ESMA 1U0HC 4ARZB 1FNMA 1KK2A 2J0VA 3KUCA 2ZS7A 3V00A 4CEJB 3B1XA 1CIPA 4BUJA 4A8JB 3AGPA 1UAAA 4DIEA 2CJWA 3CR8A 2EFEB 1RRPA 3BFVA 4JLAA 1GG2A 4CEHB 3DM5A 1EWQA 2WWHA 3KTAA 1YHNA 3C16C 3THWB 3SJAA 4BFSA 4RCYA 3V9PA 4GL2A 2JAQA 2JGNA 3O8DA 1FMLA 4WIAA 3RRMA 2ZRBA 3GFOA 3NHAA 1RRGA 1SXJE 5IK2D 3SFVA 1CJTC 1BS1A 1SGWA 2P65A 3TVTA 4AYTA 2REOA 1S3GA 3CLVA 2W6JD 5HCNA 4O25A 4OI2A 3KXIA 4B3FX 3FHTA 2J7PD 3GLHB 2KJQA 1VIYA 2W58A 4U5XA 5CLLA 2BCJQ 3AQ4A 3FMIA 1EFUA 2D4HA 2JASA 2NPIA 2QRZA 2R62A 5DI3A 2CLCX 3FVQA 4URVR 2IUSA 1E9SA 1KY2A 3Q85A 4RZ3A 1OE0A 2QM7A 3ZVMA 4BRWA 1KO4A 4LYHA 4NYMQ 5JHHB 1IN7A 2CCGA 2RGNC 3DL0A 4DLRA 3GP8A 3KX2A 3IHWA 2QQEA 2D74A 3O8CA 2P3SA 5G40A 1COWD 1GNRA 4AIIA 4PZLA 4V0NA 4QGFA 3WBKA 1ZUNB 3WRYC 3HU3A 1OJLA 1GL6A 4WW0A 4QJ5A 2VYFA 2WHXA 2IXEA 4LYJA 3TBKA 1E1RA 121PA 2IHYA 1WA5A 1VHLA 1Z0KA 3SEAA 2PMKA 3QEOA 4FWTA 1Z07A 1LS1A 2IC5A 1X1SA 1G6OA 2V8OA 2Q3FA 1L4UA 3LX5A 4ZIRA 3PVSA 1M7GA 1EFHA 2OHFA 4TQUS 1G8YA 3OIUA 2D62A 3AUXA 3VHXA 3MRSA 4KLNA 2ZI3A 3FHOA 4M0LA 4A6PA 1TEVA 2EFDB 1NN5A 3A1SA 1NIJA 3TE6A 1VG1A 2QROA 2VP4A 4DLVA 4TLBA 1WDTA 2XB4A 1Z6YA 2ZVPX 4GDFA 1GM5A 3BE4A 3NEJA 1IM2A 5E7JA 3EPHA 3SS8A 1BOFA 3FFBA 5JWOA 4NONA 1KO5A 4P4TA 2P6NA 5FH9A 2GESA 3QG5A 3WBJA 4HLDA 3OE7D 4KFRA 1KI4A 2OFOA 3LY5A 2J0UB 5GJCA 2ZR9A 3JVVA 4Q1CA 2DPXA 3P20A 1TEXA 4TLDA 4MYCA 2OBMA 2D7DA 5ANRB 1XWIA 3MG9A 1JR3E 5B2ZA 3SR0A 1K5DA 4R2IA 3KJEA 2VP6A 4DSTA 2A78A 2G0NA 1KI3A 1VPLA 5HTKA 1N0UA 5HKKA 5IHPA 1A1VA 1PLLA 4JLVA 1ZM7A 4C3ZA 2QE7A 1KTVA 1XU4A 1S8FA 1Z28A 2QRNA 2ZUCA 2NPFA 2C9CA 5JBQA 3RC3A 3KKNA 4P31A 5KOYA 2PX0A 1E2IA 2A9KA 1II0A 3PR1A 4UKDA 2Z83A 3UKDA 2NG1A 1MRSA 1G9XA 4NZYA 4D80A 3C5CA 4Q66C 1SKYE 4URYR 2ERYA 4D82A 1HH4A 3P26A 2F55A 5G41A 3OAAD 1XF9A 3RYTC 1NKSA 2MSCB 5DE3A 4BLQA 2NO7A 4BFUA 2G6BA 1IY1A 1EXMA 4EKDA 5KPDA 4TYQA 5FOXA 3VR1A 4NDZA 2O8CA 2F7SA 1LS6A 1HT2E 4ABYA 1FTSA 2JA1A 1NN0A 4G3XA 4NYMR 3B8HA 2WJGA 3UATA 3RWOA 3MFYA 2GZHA 3D7MA 5EXXA 3CH4B 3B1VA 1HURA 2QG6A 3OEED 4RCZA 3RWMB 4TMWA 3I61A 2IT1A 1AM4D 2PBRA 4A4DA 4C0HA 5HPYB 3QXXA 2GWHA 4C0SA 4YONB 1E9RA 3MWYW 1X1RA 2KB0A 3FMPB 1NMXA 1Z6XA 2XOKA 1XJCA 3AKYA 4DLXA 1VKJA 3ZQJA 5FOTA 2KI5A 4XSHA 4P32A 5FTMA 2AK2A 4LI0A 4N1AA 3I62A 4ZDIA 2FSGA 1Z0FA 3F0TA 3H0KA 1ZMXA 3LD9A 3ZZUA 1E6CA 4UXHA 5JWRA 3DM9B 3OEHA 3AVTA 2V4ZA 1IQPA 5JJLA 4YDSA 3BK7A 4Q1FA 1ZUHA 1VCIA 4LJAA 4M1YA 4Q4HA 3U60B 1BMFA 2NQ2C 3ZDQA 1XPRA 2KWIA 4BFWA 3VKHA 1Q0UA 3DPUA 3K0SA 5KO2A 1QDEA 5UKDA 1R5BA 2E87A 3OFND 2C99A 5CB6A 4WZ6A 2OILA 2FPKA 4WBSA 4CEIA 1DAGA 3T1VA 2J45A 2CJWB 3CF0A 721PA 2WWIA 4I1VA 3GFTA 3KTAB 4EJSA 4KFSA 2JLQA 2F43A 1QBKC 3BD9A 1H8ED 4EJSC 2ZR0A 4JJKA 1TF2A 4PPFA 1N6RA 3B82A 4QXAA 4G5QA 2XGJA 1W46A 4JKIA 3BAFA 4QBGB 1VCMA 4OQNA 2AXPA 3KXLA 3WHKA 4HAZA 1W36C 2MMCA 1GAJA 5DISB 1MRNA 4F38A 2YC4C 4L8GA 1A7JA 1LVGA 3DMNA 3U3JA 4D6PA 2AFIE 3W3ZB 1FQKA 1D6JA 4P33A 4GOXA 4QG7A 4U02A 3IIKA 2PL3A 4CF7A 3P32A 5K8LA 1XJQA 2X2FA 5TDHA 4NH0A 3SU8A 4D0GA 3CF6R 4DSOA 3DKPA 4XTCS 2WBLC 1FP7A 3QY0A 3CIOA 3OF5A 2HCBA 2VF7A 3O47A 4HDCA 5LD2B 1VHTA 2D2EA 2EFHB 5C46F 4PC7A 2NGRA 3VQTA 4IOKA 4OHZA 2QT1A 1L7VC 3AP2A 3B1YA 4FI3C 3MAAC 4MRRA 5DYIA 2F9MA 2PLRA 1DO0A 1GNQA 3W6OA 4D4LA 1CEEA 2YV5A 3THYA 2HCJB 1AS2A 4GOJA 5GVSA 4NHOA 4A0GA 3VTKA 1GP2A 2QSZA 2C78A 4O2LA 2UKDA 3A1TA 3EC2A 4WXPA 1E2HA 2GCOA 2QMHA 2XITA 2ZROA 3AUYA 5DHAA 5B58C 2OCYC 3CB4A 2WSMA 3MSXA 4MGZR 4URWR 2C5LA 1P9RA 2HJVA 2OXRA 2W83A 4PQYA 2GTPA 1G7RA 3AP1A 1DVRA 4O2RA 2CCKA 3B60A 2JJ2A 1XP8A 4ZIRB 1DS6A 1NLYA 2RGXA 2ZUDA 4B32A 3GLIE 2R44A 5AJZA 4FMCB 2QTHA 4LOAA 3D6TB 1QHSA 3DZDA 1QHHA 1GVNB 4LJYA 2FX3A 2VTKA 5E7MA 3CPEA 1XMVA 2ZIAA 2ZSAA 3LO5A 4KXFB 1C4OA 1ZIPA 4OHWA 2IS1A 4GZLA 1N6LA 5C1BA 4C2UA 1D9ZA 3CZPA 3KQLA 3NC1C 4BLRA 4DDUA 2OFWA 1W4RA 5ELXA 4B33A 2IEZA 2DYKA 3SYNA 1D5CA 1P9NA 1XMJA 1XX6A 4HAWA 2H57A 1R0ZA 2C9YA 1E2FA 2QI9C 4S2EA 1OB5A 2ODEA 1S4QA 4B3GA 2QENA 4RD2A 3U44A 4KVAA 1GOTA 4LBZA 4LV5B 3RS4A 4KODA 3WP0A 5IT5A 1XEWY 2XXAA 1CU1A 1Z2AA 1G21E 1RFLA 2VPPA 1YR6A 2ZRMA 2CL0X 2FEOA 1D2EA 5CJPA 1MO3A 2V1XA 5BQ5A 2W2XA 3QNUA 1Z6AA 4JLBA 5FUWA 1XEXA 3EZ9A 4L16A 5FPYA 2HXSA 2O8DA 3UMRA 1NJFA 1CLUA 2J41A 2WVJA 3R7WA 2OZEA 1NLFA 3CRQA 2F3RA 2ZRCA 4EAQA 1ELOA 1JXMA 3T12A 4Q21A 1KO1A 2B6HA 3K9LA 1P72A 2Q3HA 1IXRC 1GZSA 1TMKA 2Z0MA 1A2BA 1G5PA 1Z63A 4KCGA 3IIMA 4P4SA 1MO6A 2H17A 3KZ1E 4TL8A 3I5XA 3MJRA 4II7A 3E1SA 2XZLA 4HB2A 5CM8B 4N0DA 4QJ4A 4ERNA 1RRFA 4ILEA 2QMUA 2ODNA 3A4NA 3AVUA 2OXCA 3DEFA 5EJEA 4B2IA 4Z1MD 5GJWC 2HV8A 2PMDA 3AB3A 3L0SA 3QXCA 4IFEA 1AQUA 5G53C 2G9NA 3SQXA 3SOPA 4Q5IA 2O8CB 2DWOA 1KAGA 2B7BA 2WPDD 3DO6A 3QKTA 3CONA 2ZSBA 3IBGA 4YXWD 2X19A 5HCIA 1J99A 3VKGA 1OHHD 4A2PA 4K46A 4AYXA 1NKTA 4HUTA 5HKKD 1CR1A 4MDEA 4B3DA 4URUR 1P3JA 1IAQA 5EE3A 1NVWQ 3I92A 4GP6A 1FNNA 2BV3A 4IOJA 1JAHA 6Q21A 1Q57A 1P73A 4LCBA 3IBYA 2GZAA 3RS3A 3UG6A 3K1JA 3PUWA 4Y0VA 2IWRA 4CT4B 1NG1A 2H1LA 3VMFA 3MWLA 3A37A 1XCPA 1AGPA 2H8KA 4QBIA 4AI6A 5DN6A 4DCUA 4PSAA 2WM9B 1PJRA 2UZ3A 2W6JA 2Y8EA 5DNYB 1LW7A 2GF9A 5K8UA 2J7PA 2EVWX 1IHUA 1Q1BA 3IDQA 5E7IA 4LJ6A 2Z43A 1QHNA 4KV9A 4ZDWA 3SHFA 4Q4HB 4DLZA 2G77B 2WWGA 1Z47A 2WAXA 4QOSA 1NRJB 2NO1A 4D4MA 4C0LA 2J5XA 3DKVA 4KFTA 4CEJA 1ZCAA 2EQBA 3AEZA 3BORA 3EX7C 5EE5B 4A8JC 3LWNA 1MO4A 2ZRGA 3T1OA 2ZRIA 2R6GA 2IK8A 3EIEA 4AKHA 4BFXA 1R0WA 3THWA 4HLUA 1COWA 4EPWA 4CEIB 3DHWC 2RGBA 4HLUC 5C2JB 2JLYA 2B7CA 2IYZA 4G1UC 1U8ZA 1GTVA 4JVLA 2FZ4A 4S35A 1QG2A 1DTSA 2G1KA 1ZVQA 1S1MA 1R6BX 2AD5A 2PZEA 2ZRPA 3I8SA 3IPYA 3SJBA 3T1QA 2F43B 4B3CA 3T34A 2GVDC 1SVOA 1CRPA 2AWNA 4EPXA 2PZGA 1RC8A 3GLHA 4BLPA 1CJKC 1WCV1 4OYHA 1EX6A 1T4GA 2VO1A 2Q3MA 2RGDA 4AKGA 2ZSFA 1HTWA 4LSGA 1MT0A 3SYLA 4R71A 5J4YA 3ICQB 3PUVA 4QBHA 4GOKA 4HUQA 2VHUA 3HR8A 3QF4B 3Q8XB 5L3RA 2FE4A 3I73A 1NBME 2FGJA 3KJIA 1ZNYA 4DDTA 1JR3A 2NIPA 3WXMA 3T06B 4ZKDA 4WXRA 3B1ZA 1XD9A 4DDWA 1P7CA 4RY2A 1U0LA 3H1TA 5EQTA 4ESHA 1ZC4A 2JLVA 5JI2E 2F1IA 1Z5ZA 4JMPA 4XVUA 2PH1A 4IHQA 2GCOB 2JATA 1XTIA 2RGAA 5KDDA 1XD8A 2ZJZA 3BXZA 3MD0A 3OESA 4C0JA 5J40A 3WNBA 2GBLA 4CRWB 1JR6A 1E98A 1U99A 4FXPA 1G6HA 4M8NE 4TMTA 2DFTA 1P5ZB 4RJLA 4XWKA 1HYQA 3HYTA 4DLYA 1Z29A 4ACBA 2GEUA 2GXQA 1KSFX 3BS4A 4D0NA 1QHHB 3PENA 4KO8A 4PTLA 5K8IA 1DELA 1XXHE 1WBBA 1R10A 2V9PA 2RGEA 5JEDA 4PANA 1HT1E 1IBRA 4NTZA 1W0JA 1SZPA 1XD2A 2FG5A 3DOFA 1CTQA 4LYAA 1GNPA 5TV2A 4DLTA 1N5LA 2ZRAA 1KAOA 2YKGA 4QM7A 3AKEA 4HDOB 2YOGA 3UWOA 4PAQA 1XTQA 1UBCA 3NBZC 1G3UA 1GRNA 1NY6A 4FMDF 2D06A 1FX0A 5AUPB 1UEJA 1KI7A 3QVUA 2IL1A 3OAAA 5FUXA 2YC2C 3GJ5A 1O87A 2J0UA 2ZE8A 3ZVNA 2QPTA 3L0OA 4IXMA 2KE5A 3I72A 4GT1A 3THXA 4D4JA 2JEOA 3B9QA 2ZJOA 4LV6A 2WJYA 3BH0A 4TZ6A 4LYFA 4NU0A 1E2NA 4JL8A 4Q18A 4YMTA 2JJ2D 3U7FB 1J8MF 2RGCA 1WE2A 4W5HA 5EZ6B 4C0KA 1EGAA 4BPBA 2PCLA 1KK3A 1XEXB 3MLEA 1FUUA 4B34A 3RAPR 1XCMA 4URZR 1EESA 3HR7A 2CVHA 1JXOA 5KSOA 1ANKA 2ECKA 3R7WB 3X1DA 1AA9A 2BBTA 2ZRKA 4YMSA 3CBQA 3L8ZA 5FBWB 4OI0A 3REFA 1RE0A 4C2TA 4RFSB 1EX7A 2HXYA 3LVQE 3RSLA 1G19A 2J9RA 4MUAA 3ZD7A 3LV8A 1SVMA 1LV7A 2FN4A 3WYAA 3B78A 4P4SB 1E32A 3JVUA 1NL3A 2FFAA 1RVDA 1X8KA 2BWJA 4IOLA 4URXR 2BCGY 1J90A 4RZ2A 3VNUA 1J7KA 3GLGE 4GPTA 2C77A 1OT3A 5JS7A 3NBYC 3PIRA 1P75A 3CNNA 3KQNA 2Z5FA 5FFMA 1E1QA 2ASEA 1XMSA 1AS0A 1KSHA 2BOVA 1KDPA 3NXSA 1E0JA 2D7CA 1T3HA 1SVLA 5JEEA 3U61B 2IXFA 2LKDA 3E70C 1UKYA 1UDWA 1FZQA 3RRNA 2IYWA 4HEJA 4US1R 4ESVA 2DHRA 1UKVY 2VLIA 1AZTA 2UVQA 1M1YE 1P2SA 4B35A 3O8RA 3ADDA 1H8EA 1R5NA 4BGDA 4YMUA 2WKQA 4FCVA 4BFVA 3B13B 3GPLA 1E9EA 3ASYA 4DCTA 1UBFA 3O8BA 5EE9A 3X1ZA 4MKFA 3KFVA 2RHDA 1TU4A 3BIFA 1P61B 3GEHA 4RD4A 2ERXA 4BQSA 2E1RA 4DXAA 3L8YA 2AL7A 2XX3A 4M1WA 1W2GA 4TLCA 2C9OA 5BYKA 1ZJ6A 4HAUA 1ZCBA 2R8RA 1E3MA 2HF8A 5P21A 2QPOA 1KJZA 3QKSB 3VR6A 3OIWA 2A5DA 5FOVA 3EZ2A 4X8LA 3SC3A 4Z8YA 3U7EB 5LB4A 1XNJA 1E96A 1AIPA 4WZBE 4V0KA 2ORVA 5DSZA 2LCFA 2H7VA 5JHGB 3FPAA 3GLIA 4EQ6A 4JLDA 2IYRA 4HB0A 1S3SA 3I3SR 3A1UA 3TSZA 2AKAB 3RVBA 2RCNA 3TKLA 3H4MA 1Q20A 3BB4A 2XTMA 5DN6D 4D81A 1E2GA 2KBFA 4MYTA 4CIDA 3J81k 1JQJC 1G4UR 4B6FA 5JMTA 2EYQA 4MITA 4ZV4A 5E95A 1DAHA 1QVRA 2BM1A 4NP6A 3CM0A 4AG6A 3CF2A 3C8UA 2BKUA 2GEDA 2XNDD 1TU3A 3CNOA 1P2VA 2P2LA 5IRCD 2DB3A 2B92A 4UNNA 5JI3E 1HV8A 4PHHA 4AYWA 4RFVA 3AGQA 1Y3AA 4FIDA 2GAAA 4HUQB 3QE0A 2Z4RA 5LD2C 3SJZA 2X8AA 1NVVQ 1G7CA 2DY1A 3G0HA 4KJZA 5KSZA 4OK6A 1OLOA 4M1KA 2YZ2A 2IF0A 4HZIA 4LK2A 4OJKA 4MRNA 1GSIA 3EPLA 2J3EA 1QG4A 2ZI9A 2J59A 4NCHA 4B73A 4M9SA 1LB1B 3RC8A 3HDTA 4JLNA 2X2EA 4TSFD 1M8PA 2GZDA 1SVIA 1MOZA 4Z8XA 1DOAA 5SZIA 2BMFA 3LAWA 2P6UA 4QHTA 4Q4AA 4I99A 3NC0C 4EIWA 4CYMA 3LQRA 3UXMA 3RS7A 4UJ5A 3MJHA 3ZZTA 4C9BA 3SBDA 3QENA 2JIZA 3QG1A 3ZQ6A 1BYUA 5LB2A 3HP1A 3W90A 1RJ9A 5E4FA 4C0QC 3NTUA 3P1JA 4BLOA 3V4FA 1SKYB 1U81A 4KSBA 4ZCMA 1TQ6A 2CL7X 4IDQA 5FBRB 5FL3A 4AY2A 1J8YF 1UDXA 1F60A 5F2EA 4QGGA 1KI2A 4RKFA 2GAOA 1SQ5A 1NG9A 1FMJA 1JR3D 4UNPA 2R6FA 1Z0JA 3IGFA 2GJ9A 4HZUB 2C8VA 4PR0A 3VR4A 1XD2B 4TL7A 3TLXA 2OCAA 3LBHA 2GXUA 2IF2A 4JLOA 3K70B 4LBWA 2VP5A 1E9CA 5L3VA 2BJWA 1YJ5A 3EWSA 2ZETA 1FX0B 4EPTA 1FUKA 1HE8B 4Q03A 4Z1MA 4R98A 1MO5A 3HU1A 3THXB 4PO9A 2BM0A 3MGCA 5KSPA 1ODFA 2F6RA 2ZJ8A 3S1AA 2WPDA 4BZXA 4Q1DA 1HUQA 4YXWA 5FOUA 2OBLA 4UQOA 3QKRB 1Z0IA 2O0KA 2ZANA 4L15A 1OHHA 4G5RA 4GI7A 2VHQA 4NCKA 1GFIA 1LF5A 5FL7A 2XZOA 3AVOA 2RH5A 3BFKA 5J5CA 4LBVA 1W0JD 4W7SA 3RNLA 1P60A 2CMKA 4Q1BA 1F48A 2ZE7A 4Q9LA 4KITB 1DAKA 5M04A 3K70D 2FGKA 4R9UC 4EPRA 4GSYA 3GJ0A 4DC9A 5BWMA 2QMOA 1XTSA 4X8OA 4DB4A 2WJVA 2FA9A 3BFXA 1XPUA 4HAXA 4AKEA 4DWJA 1E69A 1KSJA 1L4YA 4ZI3A 5J4KA 3RDPA 4AKIA 3LW8A 1R8SA 1NN3A 3D31A 4DCNA 1ETUA 3DVLA 4M9XA 1XTKA 2DR3A 4F4JA 4Q7JB 1Q3TA 4JIMA 4JVSB 1YU9A 2CK3A 2NTYC 2PEZA 5JWHA 5KU1A 3GJ6A 1CXZA 1S0UA 3EAQA 4DUGA 4ZO4A 5DHFA 5FBVB 4EPYA 2P5TB 3C4JA 3TAUA 5JZVA 1NVVR 4KAXA 4L5BA 1YQTA 3DOEA 3N70A 3KKQA 1KIMA 4B74A 2EWWA 1QHYA 4BLSA 3R20A 4FW9A 3IIJA 4HYYA 5JRJA 1O3YA 3U2QA 5TVKA 1T5LA 4DBLC 1DG3A 3UG7A 1NBMA 1JALA 2R9VA 1J70A 2CHGA 5HE8A 3B1WA 4PXAA 3GJXC 2FJUA 2JLRA 3B5JA 5HZHA 1N5KA 1Q44A 3B9PA 1VG0B 3KB1A 2CE7A 1U8YA 2A5JA 2AKYA 1OFHA 2VHCA 5FPSA 2HT6A 1E1QD 4F92B 1KYIA 3KFXA 4U00A 1ZUIA 4G5OA 2TMKA 3N5CA 3KKMA 2IUTA 1Q1QA 2FPMA 3NBFA 4H9GA 4YC7A 3C41J 1G8HA 4I1OA 3C14C 4LGMA 4PZZA 2CNWA 1JBKA 4GMDA 3HJNA 3VU9A 3GLIB 4BZQA 1QHGA 3EPJA 1XFAA 2WAYA 5CK4A 4EQ6B 3AF4A 4US0R 2WV9A 3LRPA 2V7QD 1S9DA 2VHTA 2WICA 4V0ME 1XXHA 2OT3B 1Q22A 2FMXA 1JI0A 4OQMA 5H1YA 2O8BB 3LBNA 3RS5A 5AWFC 1JQLB 2QM8A 4C0AC 3L82B 5AJVB 3CH5A 1K6MA 1IY0A 5FTNA 1E9FA 3FMOB 3BB3A 4K81B 2NO9A 2QP9X 1P2UA 2NZJA 4JZKA 1VCNA 4QL3A 2CL6X 2V3CC 3EWAA 2H92A 2OO7A 3F8TA 4MRPA 1NVXQ 4RD0A 1JECA 3QF4A 1WF3A 4YMVA 3L2OB 3SBEA 1G20E 3MUFA 1CR4A 1H65A 2IEYA 3R9WA 4G5SA
chains in the Genus database with same CATH superfamily
1RI3A 2V1UA 1O94C 3AR3A 1M83A 1RE1A 3WKCA 4O2AF 4U7DA 2YBEA 1RS0A 1XQVA 3DFUA 1L4HA 3PUXA 1YJ8A 4G1VA 4WVLA 4E1VA 5K8TA 1A8PA 5BWOA 3TD6A 3C5HA 3WGJA 1YQEA 2AE2A 5H70A 3MWFA 5A4JA 5KKNB 3F5FA 1LD3A 16PKA 4LZJA 1QUFA 5DCYA 1PHRA 3RANA 3ZCUA 2JLZA 2PUWA 4S2UA 1D03A 4WACA 5C0OE 4TRJA 1XNQB 2DC1A 2QL9A 3A4IA 1YB4A 3AKCA 2ZOSA 4NU6A 3LTNC 1R18A 4URFA 2YY6A 1FVHA 1PWEA 2WWWA 2IBTA 3KKZA 4N65A 2X0DA 4HGNA 4BFZA 2C7BA 4D8YA 1AHNA 2QYSA 1ORWA 2E3JA 2NNLD 5JCJA 5BMVB 2PUGA 3ZCXA 1RJ9B 4RDHA 1I1OA 5EGNA 4X7PA 4TTRA 4D3YA 1T0UA 1M2OB 5TXGA 2P0EA 2JCYA 4EW2A 4G0UA 3GYBA 2WFAA 1UP6A 5C3UA 5A7FA 3G5TA 3W6ZA 3HJAA 1JPVA 3BXFA 4QDXA 4XFJA 2HF7A 5L3ZA 2AI1A 4HFJA 4MOWA 4U9UA 3JQPA 1YDHA 4JVNA 1MTOA 3MS2A 1YKSA 1U98A 2GN1A 2H3EA 4RLQA 4B82A 5L4SA 1C7JA 2RC6A 2VXOA 1W9MA 3QOFA 4H60A 4MRAA 5DOVA 4ND6A 1RZRA 1II8A 4AD8A 2QLJA 1J06A 1X1DA 1Z26A 1N5JA 3A9UA 3DZHA 5TPWB 1QB7A 4GFDA 5AKGA 3HNRA 3HY6A 2BHTA 5CIWA 4AURA 4ZHQB 1W88B 2ENWA 1E9BA 3NNDA 3OWHA 4MQUA 5TMBA 4NZPA 4K1XA 4M22A 4N8EA 1KI9A 5K9ZA 2QSJA 4X94A 4Q9AA 3U31A 3Q15C 2P9FA 5ALYA 4F93B 2VQEB 4JLPA 4E15A 1GUYA 2W6QA 1F8GA 1HE5A 5LA6A 1TAUA 3LXRA 2HDNB 2OQ2A 2OYSA 2W8ZA 3G3EA 3JAWB 1OXVA 3K0FB 1K98A 3CZQA 4NXMB 4F84A 3JQEA 4G36A 2ZRLA 1J49A 3NBUA 3BZUA 4H35A 3FOZA 5GGXA 4XVRA 3CVXA 1QANA 3VTFA 3O4GA 3IQEA 3H2BA 3J7AC 2A9PA 3D6MA 3I1FA 4PYRA 3DT8A 4EY6A 2QTTA 3H2GA 3O4JA 3H3JA 4FD2A 3MS4A 4QTTB 5ESXA 3WBFA 4BP9A 3ZC3A 2HLNA 4IDCA 1IHOA 4RELA 3SK0A 3CEJA 4UBIA 4DCMA 3EC7A 4H6VA 4NL4H 1XMOB 1XDUA 1S3IA 4LFBB 3DKRA 3I42A 3IBCA 4FDTA 4QEZA 4DV2B 1RWNA 2HJSA 3RUDA 4DLAA 3CO0S 4D5GA 3BBLA 4HGZA 2HCFA 3CG4A 3DL2A 5FAXA 4L51A 1P44A 4NMXB 1HY3A 2C4NA 4LYYA 4DV3B 2ACEA 3EH1A 3KE8A 1C30A 4RHUA 3CC8A 3EARA 1RNLA 2I1LA 4FNMA 4GXTA 4FHDA 4AY4A 2CLDX 3L7BA 5FA6A 4DCOA 5BY2A 4AUNA 5HRAA 3K5WA 1K3UB 1IUNA 2R11A 4MUEA 4NARA 2OFXA 4OHVA 4PR3A 4R2WA 4LK3A 3UBMA 1NJGA 5G0UA 1AHIA 1NZFA 2M9MA 1HBJA 4ZO6A 3M2TA 3ML1A 1C8LA 4LZWA 5JQGF 3COZA 4XE5A 1FFXB 1KDOA 1ZD9A 2GYUA 1J0BA 3BHNA 3PGLA 4NFYA 3NV7A 1KO8A 4O8ZA 5AK0A 3TI9A 3FYUA 2BSXA 2I34A 1TKRA 5FNVB 1RJFA 2GFQA 1FU7A 4XI9A 4P5PA 1J21A 1QYCA 3GUUA 3X2EA 3RQIA 2M6LA 4G67A 3AYXB 5IJAA 4Q37A 2P0AA 1LZLA 4UCQA 2EL9A 4Z51A 1TX4B 1EEHA 3ZHCA 1QGUA 2QQFA 3BG5A 1B41A 2ZT5A 4IH9A 4CKEB 3ZWWA 2EKBA 3FB4A 5K0LA 4BP3A 2DHCA 1W6UA 3UK0A 4H1TA 4TGLA 3A0UA 1RYEA 2CK3D 3MQ2A 2GJSA 1KGDA 3TSWA 4BNMA 1V8FA 4OGGA 4AB1A 4DQVA 2ZZMA 3BERA 4GEGA 1GZUA 1PS8A 3MGKA 1LUAA 4NOKA 3DAGA 4DRXA 3P2MA 3A4VA 1SCUB 3ASVA 5JZSA 4HQFA 4L7QA 4FM9A 1XZBA 1GKLA 1T4CA 3OIVA 3ZY3A 3FAKA 1DEHA 3AF2A 2P67A 2AZ4A 3VU9B 4DZRA 5E1DA 3B3FA 1QFJA 2ZE6A 2GKOA 3PK0A 3RHFA 1NMYA 4P3PA 1IY9A 3PHBE 4KR3A 1TXGA 3RASA 2NZUG 2Q5EA 2Y1OA 4IJMA 1QVAA 4LDQA 4Q7KA 3UGJA 2ZRDA 4L0QA 1WETA 4GOMD 4DEYA 4OQQA 2ADMA 5JCOA 3V4OA 4W5OA 4BNJA 4XJXA 4HGQA 5THKA 2J0QA 1PUJA 3K2BA 4Z4CA 3GZTB 1G16A 4B7XA 1I4WA 4PG8A 1G98A 3BX1A 3G0OA 2P1ZA 4NPHA 1CPYA 4LXHA 2XZPA 1UADA 1G3MA 5EIHA 3AVVA 3E5RA 5DBGA 3LW7A 5F52A 5KPJA 1ND6A 3C5VA 3W77A 2GZMA 3VAZA 3BOSA 4MV7A 2JGFA 2K87A 3CRRA 4PSCA 1CKEA 5KCMA 4C4RA 2Y3IA 2ODTX 1L2TA 1SVSA 1YR1A 4F0JA 2IYVA 1Y1KE 4Q3DA 3TL6A 1KZ6A 1KQFA 4KXVA 2PG3A 1D4ZA 4DYHA 2EZ4A 3PCRB 4K88A 4QOIA 3U0BA 2YICA 1Z2EA 2R751 4EHHA 2OCXA 3HJCA 1UKBA 3Q72A 3B48A 3QLVA 3ZNNA 4DLXA 3E4CA 1H0SA 1U2RA 1XJ0A 2COKA 3FZEA 1XEWX 3JZAA 4P4GA 3GLFB 1VYVA 2BGJA 3KT6A 3HXMA 2VQSA 1LBQA 1UKZA 1ZYUA 2WFLA 4ND5A 4HT3B 3TVDA 2KBEA 3KKOA 2E0IA 1Q12A 2YMPA 3A27A 1GLVA 4KHPB 2K7ZA 2C9DA 5JXGA 3HXOA 3NM6B 1SXHA 3WMFA 3HTXA 4ZAFA 1RCTE 1UBOS 2GBLC 1EWKA 1KJ9A 2PMBA 3OZFA 3DMFA 4ZOCA 3DDZX 4DT1B 1N77A 1MA0A 3WOHA 1G6Q1 3ZYCA 2CKDA 3CXUA 1EWRA 4F3KA 2FQQA 3R0XA 3BJZA 2RK4A 4AS2A 3M8KA 5KWSA 4WQMA 2R8XA 3DOOA 3WAJA 1WS6A 4P9NA 3OH8A 3ZLJA 1N1EA 5ER6A 4IOMA 3EIUA 3K6JA 4YRSA 1LXCA 3A6JA 3PS9A 3M4NA 1U5BB 3T61A 1VCOA 4KPYA 2V7WA 3OF2A 4N6OA 5CDUA 3CT4A 5KTSA 1CY4A 5MN5A 2XV1A 3ND8A 3LM8A 2OB1A 4IF6A 1YAJA 4EK9A 4DE5A 2G0AA 1H1LB 3H2HA 4WLVA 4X7RA 3RRZA 3IEMA 1OH8A 4NS4A 5K7SA 3A4MA 2OCLA 3PC3A 3A6ZA 4TT3D 3OPYB 4X90A 4BFYA 2XPCA 4Q4JB 3FOAA 1OUMA 1LBEA 1SEVA 1XCJA 1ZRHA 5JAMA 2ONJA 4KLCA 1EFRD 1DADA 1V3QE 1TUBA 4ARCA 4AS3A 2PAAA 3O1IC 4WJLA 5CJ2A 5GV7A 3TI7A 5FLXA 4PHGA 1KMHA 1DRJA 1QLWA 3OIDA 2PPLA 3KTOA 2WAOA 2YVUA 5BYJA 1BA3A 2V54A 4IVNA 2FWRA 2PYDA 1SC4A 5K2MA 1NSTA 1TZ2A 2YTZA 4K6MA 4K05A 3FKSD 4D44A 2C5FA 1US8A 2GCPA 4Z1OA 4RTPA 3LG2A 1OZFA 5G3YA 3NYIA 4OEHA 3F5MA 4B2YA 5LMZA 1DJPA 1U2EA 3ELUA 3D9QX 3AERB 3T7CA 5HKLA 3VBEA 5KSWB 1UPCA 4B6SA 2FWMX 3DOJA 2NP7A 2K7FA 3G49A 2G5CA 1MUUA 1IBCA 5T3YA 1E6WA 5ICCA 5EUQB 3R9IA 3TG2A 4LJKA 5AVQA 4I1RA 3DTYA 2ZBDA 4DGQA 3G8DA 3MMZA 1QRAA 2NZVG 2QRUA 4RK4A 1QIMA 2H6EA 1DZ3A 4YP9A 2BE7A 3CXRA 3HACA 3ICEA 1P1CA 1AXGA 4ZOBA 1HL7A 1IB0A 3HZHA 2BSAA 5DASA 4F86A 3UAVA 3UTCA 4YRDA 1KETA 2B69A 1QYWA 2JD1A 4OH7A 3X1MA 3UGKA 2JAXA 4MO2A 4II3A 4CDGA 5TPZD 3VOBA 3G5LA 3HO6A 1NXTA 3Q0EA 2O0JA 4TKUA 3CLSC 1UJCA 4QEDA 5KVVA 4Q3KA 1L5HB 2FXVA 4O59O 3QX8A 1LBIA 4IV0A 3TE7A 1GUZA 2GJ4A 3JD3A 1SXJB 3RHTA 1VL1A 3RUCA 3SQLA 2DH5A 1ODCA 4CKWA 3GDGA 4W7IA 4X65B 3R24A 2FFHA 3UYLA 5KQMA 3JZMA 3L6BA 2AHRA 2RHHA 4MVJF 2OOSA 3VR3A 1NQOA 2WZBA 1PJ2A 4UAVA 2GK7A 3SDZA 2WSBA 3W34A 4HN2A 3ZW9A 1P9OA 2R86A 3DV0A 1ZU4A 1E1YA 5T5QA 3PFIA 3RVRA 1P8JA 3LYLA 3RE1A 4P35A 3C3AA 3S70A 2WF8A 2V98A 3KWLA 5U1PA 2BT4A 4G01B 1AQ6A 1YDGA 2ZRNA 3IBSA 4BGEA 1W76A 1G20A 4LY0A 4CKZA 1XRMA 4FINA 4BZZA 1Q91A 3AFGA 2Y1GA 4K9OA 2JZNA 1FNBA 4G0MA 2CUZA 4E5SA 2JJ8A 4NEHB 4OQXA 1PEYA 1ZI6A 3SJCA 2VDNB 5AHXA 3O31A 1WJGA 3LUHA 3SPXA 3ZD6A 2B37A 4LFAB 4Y7DA 3QWIA 3AUSA 3N2IA 2D6FA 1K7SN 5DKFA 2YWRA 3IAAA 2RG7A 2GXSA 4I1SA 1KI6B 4KYIB 4ASUD 1SXJD 4Y6RA 5BSHA 5F5NA 1EM8B 3ZJ5A 3ZHXA 5AK6A 5AKHA 1AK1A 3Q11A 4MDHA 2B4AA 3C5WP 4DILA 4E2ZA 4EZBA 3OE5A 4IWNA 5KNCD 3L49A 2ETXA 1IH8A 2ZJ7A 2VH1A 3MMPA 2YJTD 3ABRB 4JYMA 5CDTA 4DIBA 4UAGA 5E1OA 2ZYDA 3O4FA 3OCVA 4GL4A 4JS0A 2AMFA 4IHAA 3I6MA 3HK2A 3EEQA 3MOSA 4GM0A 1YZHA 2XNCA 5G0TA 4NYJQ 1XNRB 2XYGA 4QFDA 1PE0A 2JBAB 4PNEA 1NFRA 1YULA 3RJ9A 1YZLA 3IQGX 2MR5A 4QWMA 2HBQA 2PVCA 3MT0A 4GHWA 3UHJA 3LJKA 2HYIC 1UP7A 1SUFA 1D4OA 3AUJB 1KKUA 2QJTA 2AK3A 1EFPA 1FYFA 4M0CA 5AI4A 1TPYA 4EEKA 1PZEA 2IA5A 5BW8A 1Q14A 2WOJA 1QFSA 5ECWA 2XRFA 3GP5A 3G9TA 1WUKS 2GCNA 4OMCA 2I87A 4UEJA 1QHXA 9ABPA 4AJJA 2A4KA 3H84A 3L01A 4AN0A 1CUXA 2PN1A 4MAMA 4P7BA 2MWMA 4XWAA 1FDVA 3MILA 5FIUA 3G02A 2JRCA 3ETJA 4E2WA 2MINB 1PGQA 3EDYA 3HCOA 1BFUA 2ECQA 4RD1A 3LRTA 2OUKA 1SB9A 2PT9A 4LJ5A 4OQYA 5DT9A 4DMCA 5ES4B 1LRLA 4ZV9A 4TKZA 3SP1A 1ZAKA 2BFAA 4GKVA 4X62B 4ARUA 2EARA 4MTCA 2Y2UA 5FPKA 1DEKA 3QVWA 4F56A 1VYUA 1SG0A 1QRDA 1Y8RB 2B35A 3KVYA 3TW4A 2PT5A 4F8EA 4IIFA 4WJKB 2M1XA 2OSBA 1U0RA 2E85A 1ZL0A 5I45A 2O59A 1GNSA 3ZGYA 3D8TA 2QBYA 2Q3BA 2MSKA 1P0CA 1N2JA 1PQYA 1MFPA 1SUPA 4E4YA 1BHJA 5KYYB 3DMHA 2YHIB 2ZQZA 3Q5EA 5IANA 1PJTA 1OH6A 2RGNA 4MR7B 5BSMA 1O8CA 3OPQA 2A3RA 1BOOA 1QKIA 1NJ2A 2CCJA 3M89A 4PLPA 4F45A 4YR9A 3KLMX 1U7XA 1R74A 4HRXA 3E53A 1TTTA 1FX1A 1DTWA 3II6X 4ZJPA 2NUPB 3L6UA 3BSWA 2ASVA 2WIBA 5JQGA 3ECCA 4CTNA 5GZ3A 4WASA 5C7LO 4CGZA 4UVHA 5L3SA 2QIOA 5FTLA 5C4MA 2YYAA 2GARA 2XVAA 3BJMA 3FDZB 3FNBA 4UM7A 1YB6A 2PBFA 1ZNXA 2ATEA 2CC2A 3KYCA 4I2NA 3WA7A 2BMEA 1CZRA 3L4BA 2NSDA 5EKTA 2PTHA 3UO8B 1PG2A 3KYIB 4HI0E 1KHTA 2PMCA 3O82A 3O94A 1YQDA 3K7EA 1KZYC 2WWXA 4R1SA 1SQ6A 1PR2A 2P2SA 3P9RA 5J59A 4R9SA 4AP9A 4ALKA 3SR4A 5ARCA 2B99A 3T0GA 3SAJA 1KQ3A 1N2BA 4NZOA 1H0RA 2DQZA 2JFXA 3TNFA 3VZCA 3RS2A 4J0CA 2DBZA 2FCRA 3V7UA 1U65A 1DKUA 1ZLXA 2EIHA 1HGXA 3Q3HA 1C80A 4IX1A 3TRFA 2OEPA 1WSAA 4AMGA 5EZYB 1FSGA 3MRVA 1C2TA 3DE2X 4MX8A 4UNSA 3QVTA 4S12A 3CO5A 1G2OA 4NVRA 1RC1A 4MUIA 1TQHA 2BKXA 4EL5A 3PE6A 2VTVA 3QVSA 4HDQB 2C7RA 3CKYA 3CX3A 2FK8A 2R84A 2WUDA 3LT2A 2PWYA 1CJCA 2W6ZA 1C3EA 4F72A 1PQUA 3IE0A 3U39A 5G0SA 4I1IA 2R1ZA 5CNIA 5K3OA 5BQ3A 5JPDA 1BJKA 2IUEA 3NYWA 2BN4A 4MI3A 4ZGWA 4QIHA 2WM3A 1UMDA 4HBGA 4IIYA 4MUHA 3U40A 2ONKA 4ZK2A 2XQGA 4CM9D 4Z0TA 3WQRA 1RRCA 4MKZA 1PR1A 1YQWA 3JQCA 3GJZA 5DCUA 1OF1A 1VA5A 4ZYZA 3WDMA 1JHYA 2GA8A 2XH8A 3IEUA 3IYLW 3EPRA 4M98A 2JGDB 2I29A 3E9MA 2Z1NA 1N9GA 1DPGA 3I1JA 2BTQB 3OZIA 2BMJA 4PQFA 4WK4B 5FBQB 2XIQA 2P2YA 2OOKA 1MX1A 2D0PB 2RHRA 1PZNA 2I78A 2C29D 3IX7A 1QUEA 1NXQA 3M6XA 3NIGB 3O3OB 5ALNA 4Z9FA 4ZTBA 3TLJA 3W5CA 1X86B 2GHTA 3UC5A 1L5WA 3EXHC 1TAGA 1YIOA 1TF7A 3E2IA 2UAGA 4EAAA 3FCSB 2XCTB 1JSLA 2JFQA 1CUCA 1TJNA 1UBSB 3H2SA 3M1IA 4HXEB 4MW1A 1XZQA 3U9TA 3UHOA 4CNBA 2O1WA 3PP8A 4JUFA 3QBVA 4LDNA 1EGQA 4Q9KA 1E7MA 2AN4A 3PR2B 2HY7A 3NUZA 2GBIA 2CJXA 2NU6A 3WJ1A 2B3TA 3GJSA 2D1YA 1CUZA 1GKUB 3JV7A 4HFMA 1G64A 1P1HA 3AYZB 4N54A 5FR1A 4BUZA 3EF0A 4F6CA 1BH2A 4ITRC 5KNBD 2X3YA 1MG5A 4IUBS 5CHEA 1GD1O 2PWAA 4B71A 2UZ4A 4W5WA 4D46A 2CL5A 3G6WA 2V4MA 3L7OA 3IHKA 3H2JA 4DA9A 2XUZA 3NUGA 4Q02A 3WAGA 1MW8X 1YTLA 4EJMA 2QN9A 4RHCA 4NJOA 1U2GC 3O84A 3VC2A 3E84A 4F7WA 2XMGA 1PLJA 1ZP6A 3HKBB 2RONA 3IJRA 2QT9A 3LUDA 4UBKA 2W2KB 3UFXA 3GN1A 4DVJA 1DT5A 2Q4DA 2UV8A 4JOBA 2PUVA 2W2PA 3Q2KA 5K20A 4QNMA 1OH7A 3OC0A 3KR0A 4Y0NA 3C97A 4R31A 2WU0A 1P4JA 2I1VB 1Q0HA 3WNCA 2MTBA 3NBKA 2ZCJA 4PNPA 3EK2A 2QYHA 1V95A 5AK5A 2JFBA 1USGA 2EBWA 5EJIA 5IVDA 4C6HA 3QUTA 2ONZA 2VP0A 3RSSA 1KF0A 4TVKA 1JDNA 1I7PA 4RKWA 3TIXB 2H06A 1K5GA 2Y1KA 1EXNA 1GT6A 3L7AA 1M54A 4UDXX 1RAEA 4A16A 4P80A 1X6VA 1YVRA 1UXJA 3TAHA 1O0SA 4K6KA 4LYGA 4OBXA 3VSCA 1VXOA 2P4UA 3K8QA 4UTVA 3SF8A 1CR0A 2Q0SA 3QY9A 2C04A 2CSXA 1X8JA 1Q74A 3KQTA 2YYZA 1CB0A 4HAYA 2GF0A 1MVLA 1L5NA 1FUYB 2IUUA 3G1UA 3PNLA 4Q3NA 2D0OB 1IZ7A 2OLJA 2ORIA 3KK0A 3CWCA 1TAQA 3FE2A 4KMMA 3CPSA 4IS3A 4EY4A 4B3TB 3RVNA 4DNXA 2YASA 3BF7A 3ODPA 4QJIA 3V48A 4DEVA 3DEKA 2P2CA 1XI2A 5IBRA 5IJ9B 1K63A 1OKKA 4GECA 1NIPA 3WB2A 3RIHA 1OX4B 1CWUA 3A4LA 2G9QA 5BW5A 1WZCA 4A03A 2HXGA 2BYTA 2L82A 2ROQA 2JCBA 3LNCA 5HUJA 1ZVJA 3MLBA 4IDNA 3GEIA 3ND5A 3ZLVA 4D6YA 3R5TA 5JLAA 1DPFA 4QGBA 3QVLA 2OGSA 5KVAA 1DKOA 1W2WB 3K0AA 2ZS9A 4WBXC 1DC4A 2F3QA 2ZIXB 1OR8A 3CWZA 4YDHB 4YRLA 4EZEA 5KQRA 1D2HA 3D8HA 1IEXA 3C2QA 1OLUB 2P0YA 1VKNA 2B8WA 1VLZA 5ALKA 1H6DA 4R3NA 3ZGXA 4RUKA 4TV9B 5A1TA 5LOVA 4QC2A 5BSUA 2WFMA 1HRKA 2RJNA 4YV7A 4PE5B 2F9LA 4U0KA 3VO9A 5KB3A 1QK3A 1USVA 4JQCA 3G6KA 3IQIX 3KPUA 1HTTA 4IDOA 2ENUA 3EW9A 4ZQGA 4BJ1A 1P5HA 1HLFA 1I9GA 1DWOA 3TLMA 2AFHB 1GQYA 1UPAA 1UWKA 2R6R1 3F71A 3LYHA 4KGZA 4MJ3A 2ZSIA 1W93A 2VQFB 1B14A 3QVMA 2JNWA 3QFHA 3RC2A 2Y1DA 2XQVA 3HLTA 4DAOA 2PNJA 4XPZA 1KVQA 5B6JA 1J1UA 4HH1A 4I3FA 4IQFA 3ZG6A 2H4FA 4OHYA 4PLVA 4KXUA 1JEEA 1JDPA 2WK1A 5GV8A 2IXAA 1X1EA 5IKOA 4CHTA 5JZMA 2Q1SA 4FW8A 4DYDA 2NT3A 3FNQA 5G3ZA 3O2JA 3BULA 3LKVA 1JRLA 3CHYA 3EGOA 1HZZA 3G5MA 5E1MA 3IMFA 5DI9A 4F5EA 1WPRA 4JJ7A 4ZK6A 3GFPA 1D6MA 1HZZC 4B8ZA 2O8FA 4EGQA 3NKLA 1SXIA 4RF5A 3C6QA 5CG1A 5F7XA 1JQAA 2QMZA 5F76A 3IMCA 5KJCA 1Y4UA 1N5RA 3LYAA 3UWKA 3KJXA 2Z04A 5MDHA 3GZ4A 2QSYA 4JVMA 4MVCA 1EVQA 5BNIA 2CEAA 1IZ8A 2I2DA 4B6JA 2IU4A 3OTGA 4QLAA 1IXZA 3T5TA 2VXBA 1PDWA 1GJRA 1OLXB 2HAEA 1F0PA 4WMLA 5JNUA 3QOWA 1ZH2A 3I8XA 2HH9A 4B43A 5JYEA 4HV4A 3U1BA 2QJRA 3T5DA 4FPXA 3RKRA 2WIGA 1GN9A 4CIXA 5A4FS 2GZRA 3VNVA 1RWXA 3EMBA 4LRUA 3NAQA 3I1YA 3U0VA 4D98A 1E61A 2G3YA 4PO8A 1L7QA 2VWPA 2BGMA 2GKSA 4ZAZA 3TGWA 1V16A 2C42A 3EVGA 3BBPA 1ECBA 5DBIA 1FDOA 3SHQA 5J2TA 2RB5A 2FF5A 9ATCA 1PD1A 1ESNA 3DFMA 1L7PA 5FJJA 4BC1A 3ADKA 1NMZA 3MBOA 4NNOA 3DLAA 4ZT3A 2IYTA 4KR9A 1RYFA 1LF0A 1AKTA 2A1TS 4HSGA 4HXGA 2R85A 3LBIA 4BIMA 1B23P 5JJKA 3U44B 4UREA 3IT2A 4WKNA 2FW6A 3UMSA 4P7JA 1N8KA 1DBQA 3L5OA 4EZIA 1CRQA 3M6FA 3KSRA 4BJ6A 2WSSA 3ZVRA 3DMTA 3MTEA 5DYGA 5HNKA 3B85A 3U80A 4MVXA 4NV3A 5SICE 4N7JA 4LX0A 5B7NA 3W5BA 4TN1A 4GGOA 4V0LA 3UEOA 1N6PA 4R1PA 1PZXA 5HOQA 1JQ3A 1D7AA 1YR2A 1Q1ZA 3NVMB 1GSAA 3OSZA 1FSPA 3OO1A 1ZGZA 3KDSE 1DAFA 1T2AA 2E21A 5DLQC 3IBTA 2NSJA 3M0EA 4CLDA 1E3EA 1EDDA 3M6VA 4WOKA 5T4HA 4O5OA 3GA5A 4P3XA 1NUTA 2CKMA 3WZLA 3UMFA 1V71A 4IEEA 1VHDA 3ABIA 2IYQA 1AS3A 4Q48A 1W96A 1PT7A 2J8ZA 2EX0A 1KYQA 3T5PA 2JJ1D 3PA6A 3I39X 4TVSA 2WTUA 1QKKA 4WLFA 1W1WA 4CWAA 3SQWA 1AF7A 2CYBA 3ORQA 4RD3A 2J3LA 2VDQB 5EWMA 3TW8A 4ZZ0A 3DOIA 4YASA 4TM7A 3R8XA 1HQCA 5EKDA 4RTRA 1E64A 4I4TB 1FIUA 1DXOA 5I7OA 1BX3A 2Q3DA 1ZH6A 2QNRA 4AMUA 1E20A 1YQ9A 3AV3A 4U3JB 5AOVA 3WTBA 4I4LA 2PXXA 3X0DA 3ZZ0A 4KKXB 1VSBA 1RCUA 2AGVA 1HYBA 4EYEA 2ZSDA 1KKMA 4PRLA 4HG2A 2H18A 3F6CA 1L4NA 1YZTA 3ASZA 4XJTA 1WIWA 3C45A 3U7IA 2NU8B 3WHPA 4DUZB 4YECA 5HK8A 1MVNA 4WK0B 1F0KA 3M81A 4FYMA 2QAGC 2NP6A 1IN8A 2L17A 1N2HA 3DBVO 4BKUA 1VLVA 2XRYA 2FPPA 5AOBA 2HA0A 5I7VA 1MDFA 4NYIR 1JI3A 4ZVUA 3L3BA 4DLSA 1N3YA 3SC6A 4UEQA 3ZH2A 1E4YA 3LCJA 3K9BA 3P19A 4W1QA 4LVUA 4PVCA 4NEQA 3JYLA 5AUQA 2ZTVA 1AK9A 5SV2A 4IIEA 5IYZB 1K7YA 3M1LA 4UUMA 3OI7A 4RL4A 4ARZA 1EZZA 3KVNA 4LTNA 3NETA 5DW3A 3FPEA 3ZK8A 3RABA 4YAKA 3G85A 4GP7A 4XGNA 1U7HA 2I66A 2OGUA 2ZKLA 4ZFNA 1Q3HA 2FDRA 5ALMA 3A1VA 2V59A 2KQUA 1W0KD 3T7AA 1Z0AA 4PBSA 1HKUA 2W48A 4DJTA 1I6KA 3B12A 3PKZA 5COBA 1SG9A 1ZPDA 1C9NA 3S27A 5IMSA 3DP7A 3KUUA 3R4CA 5CG2A 3GAFA 3GDHA 1U7PA 1JAZA 4G8BA 3QWFA 4MI6A 3SHTA 1M67A 1K97A 2G8NA 2ODQA 4X8MA 5AVKA 4D41A 1FOEB 2NO6A 4IZ6A 3SNHA 4I3HA 3PEWA 4YJ2A 1JAYA 4FBGA 1N7IA 3ZIAD 3E35A 1TA4A 1KOGA 1BMFD 2R5FA 1E2EA 5IN4A 4CVNA 1U7TA 2AG0A 2OLKA 2OESA 5AJWA 2BMDA 3UH0A 1A9PA 4MUBA 3KQWA 2V55B 2ZJ2A 4YMGA 1E4OA 4CQJA 3JD4A 3QQ5A 2ZBGA 3ABSB 1Z0SA 2ZIEA 4X64B 2Q9BA 2ZAYA 3WYBA 1NLZA 2R2AA 1QH9A 3OZUA 1O89A 3IEXA 1CQIA 4EI7A 1SCIA 2VDRB 4GBED 1BRMA 2CNDA 1KAMA 3KQMA 3WMEA 5ILQA 1MF7A 2ZT6A 4NZ9A 2W6OA 2A57A 4HDMA 3A6DA 1DC5A 2Z2ZA 4DRZA 5BQFA 4MKGA 4D9GA 3HJUA 5JAQA 2QGZA 3H8JA 5A9SB 3PDHA 2OFFA 1KZHA 1PW5A 3Q7QA 2YNMD 3UJ6A 4LJ4A 3OTOB 2J9FA 1PL7A 1CHDA 2FWAA 4Q12A 1SA0A 2GZ1A 5SZHB 4KAFA 3WADA 2ZJFA 3KKLA 5DRYA 3REGA 2IHZA 3JWHA 2GPAA 1N2GA 1WMBA 1SXPA 4J16C 3GIWA 4D99A 3CLTC 5K3SA 2DKNA 3K9NA 2FPLA 4ZCLA 3I9FA 3SZLA 4I6GA 3UUFA 4H6WA 3ED5A 6AT1A 1EFDN 4HAIA 2ZRJA 4X85A 4MCJA 1R2QA 4HMQA 5IEBA 4G0WA 3F5QA 4CDNA 1R8XA 4C4XA 4LWQA 1KYTA 2DF8A 3CW2A 5FLEX 5E9QA 3PGJA 5FWYB 2NZYA 5A4KA 4OUDB 4ROTA 1WBDA 5JBIA 1V4BA 2WUWE 3I9MA 2HQOA 1VPTA 2X40A 3W2GA 4EP1A 3PV0A 3EMKA 4I55B 3UMMA 4BGIA 4A10A 5IFLA 5JARA 3K6RA 3P9PA 3COWA 1H6BA 3U4IA 1CS4C 4TV8B 3RJZA 4OHPA 3BWMA 2QQGA 3C87A 5DHPA 5TF4A 1P7YA 1X7DA 4M46A 1LTQA 5CFOA 5D5HA 1XIVA 3GQBB 2ABWA 4E33A 3OD1A 3NTRA 4LPKA 3RYHB 4G4JA 4QFCA 1PW7A 3TIGA 3HB9A 1S2GA 2F1HA 4K8OA 1JN0A 4X8HA 4DJJA 1EFLA 3NG1A 5C8DA 4YPOA 4CNQA 3T1HB 1A5AB 2OAP1 4LSZA 2WJWA 3MC1A 1Z06A 1E3DA 3T9CA 3D7RA 3QU9A 4BGUA 1Z2DA 1G5QA 4DS3A 3EAFA 3S5JA 1G1MA 4S1WA 4EQZA 3V8EA 2O54A 1Q92A 3SE0A 1DQSA 3UJ9A 1WRBA 1A9QA 1Q2UA 1HEUA 1CR2A 1MJNA 2BFWA 4N49A 1CHNA 2ZJAA 3KD3A 2IY8A 2V9CA 1X13A 3LDFA 3QVGB 4YJHB 4AG5A 2R6CA 2H0QA 2QIPA 1DV1A 2IOFA 2JZOA 1X1TA 2WYWA 3LC0A 3FB1A 4MUMA 3DBRB 3NHBA 2J1LA 3RTAA 2AOWA 1CS0A 4P38A 2EKDA 1QU3A 1NP7A 2XNSA 3D0RA 1BCRB 1OA1A 5DXAA 3AV0B 3CCBA 4M1QA 3L8DA 4LTDA 2YIDA 3ROGA 5KYWA 1L1EA 2HMYB 1FLNA 1G291 1YZNA 5JAUA 1X19A 1UKCA 4TL6A 5HG0A 2FPRA 4E03A 1GFZA 4RZUA 1ULTA 1SOVA 2YHUA 3OZ7A 1Y81A 5BNFA 4O2BF 4EF4A 1Y0BA 2EQ5A 3WQQA 3AVWA 1N92A 3QYPA 5FI3A 2AKEA 4BFTA 4ZDJA 5EXTA 4A2QA 1NOKA 1JU4A 2FDCA 1Y9ZA 3NBAA 4ZAVA 5I7HA 4TYNA 2FR8A 1QLHA 2R60A 3T0FA 2ZAGA 4B40A 4K9SA 1GAQA 1XCGB 2FR8C 3G2HA 3LP5A 1AUXA 3UW1A 4JJAA 5CGZA 3AR2A 3DLPX 2YXPX 1MC8A 3WWPA 4H31A 4PIPA 2F1JA 1BJRE 2R2GA 3KZCA 1IHYA 3ND9A 1HE3A 3NB0A 3QEKA 4G0XA 3L43A 4Q01A 4UBOA 4WNCA 4E4TA 5KYXA 2VJOA 3EF3A 2VTBA 2DTXA 2HSGA 3QOYA 4FN5A 4J7CA 4BVBA 1FVXA 1A2KC 3LT4A 1K68A 4EUKA 1C7RA 3RIXA 2ZBEA 3AHFA 1E3IA 1UC8A 5KJ1A 3ETNA 3LMKA 2AEMA 3COSA 3HI4A 5TARA 4MUJA 1KZ4A 5FHRA 2QJWA 3B36A 2I4LA 3N39C 1MU0A 1N2OA 3L8CA 4IW3B 1UF9A 1QIEA 4K3UA 3EEOA 3IH5A 1NRWA 1SU7A 3I64A 2ZPTX 4FFMA 4RNDB 4KU4A 1MV5A 4PV7A 1USIA 4LOKA 2AHOA 3JPWA 4MYHA 4OHMA 1KEEA 1A7UA 3G89A 1NYTA 2BFMA 4LS3A 2DFKB 2WJIA 8GPBA 1H3FA 4IV5A 2P6PA 2WTEA 2GEFA 1R50A 4BNYA 2FFRA 2ZS7A 4OREX 4UTOA 4BUJA 4TUYF 1HDRA 3V3TA 4A8JB 5KQLA 3ED1A 3H87A 4B45A 5ADHA 2R6JA 3OBBA 3IR5A 4M54A 2AG5A 4CEHB 3D4NA 3C16C 3HBFA 3O4VA 4BFSA 3ZKWA 1YD7A 4KUHA 4URXR 3DL7A 2FLVA 2FVXA 5IJ0A 1NPDA 2ZRBA 1P1FA 4H0NA 1JLLA 4AULA 5KZMB 3Q98A 1N2CB 2REQB 5IK2D 1EFVA 2HSEA 2VJYA 1KH1A 3A3OA 3TVTA 3PYLA 1JTEA 4AYTA 1V11B 3E9QA 1S3GA 4MW0A 4ZO7A 4K6CA 2QNBA 2HWUA 2ADOA 2HEGA 4HTFA 4JU9A 4OI2A 2CXQA 4RHFA 2J3MA 4B3FX 5J43A 1DFGA 2FRDA 3FHTA 4WKPA 3PZBA 2KJQA 2X6RA 2VDVE 3GUCA 1VKRA 4U5XA 4YRPA 4YT2A 1YZYA 3VPXA 3B3JA 1NPTO 2D4HA 1GPJA 3LLCA 2BFNA 3Q7SA 3GU3A 5J9FA 5DI3A 2G08A 3WJ2A 1G2QA 3FVQA 1M5UA 1T26A 1WHTB 3JW8A 2HRDA 3K1ZA 4YA6A 2QMQA 2AOVA 2IUSA 5AM1A 4J3NA 3HN6A 4EVIA 4WY8A 2BISA 4D97A 3G2OA 3ES9A 3OM9A 1D2AA 1G42A 1YL7A 5L7WA 3TXAA 2OBXA 2AXQA 1IN7A 1SUDA 2CB9A 5F2OA 2IDKA 3DL0A 3ROTA 1JIQA 4DLRA 1M66A 1ZIXA 3GRAA 2X8JA 4JJIA 3IHWA 1U0EA 4MAAA 3O8CA 1XQXA 5KYUA 3JRXA 1COWD 5E2AA 5F77A 2O3QA 1V4NA 3HJBA 3I2IA 4XW2A 2I99A 4FKZA 4N7MA 4L3OA 1ARZA 4V0NA 2XUPA 1JT9A 4RQTA 4QGFA 4TRRA 3WBKA 3ILSA 3PUIA 7REQA 1L7BA 4WW0A 3QJ5A 1J2EA 1QG0A 3KUXA 3CUWA 3EZYA 3NI2A 4U9HS 1F1JA 1GZ5A 3AUFA 5AVSA 3I5MA 2V7PA 1RHMA 2YDYA 4KK3A 4UAUA 121PA 2VZLA 3D3KA 5DK6A 4R5HA 4ZU3A 3UJCA 3OQNA 3B89A 2YXBA 2CMDA 2HPZA 4OAOA 3QEOA 4CLOB 3PRJA 1BCSA 4XLTA 3UCXA 1NBEA 4TTAA 1SUCA 1E1DA 1YB7A 3Q7TA 3LX5A 4QDTA 1JFVA 5H4GA 3ANLA 2NW6A 3OM1A 3W2TA 3DE6X 2JIDA 2HK7A 2YMLA 4PVDA 1FMFA 4M8LA 3OIUA 4QDJA 5KVSA 1JH8A 5ARDA 2AQ8A 3LUGA 3MT8A 3B1JA 2IYPA 2ZVDA 3FHOA 3KJQA 1YS7A 4M0LA 4NV1A 3EUWA 4QUEA 2XECA 3S2EA 5J4VA 3O9MA 2NU7A 2CD7A 2FMHA 2J3KA 2PMWB 2PO5A 4BMCA 2ZIWB 1M2FA 3A1SA 3R6GA 5KOJB 4BU1A 3AXSA 1GG5A 2W42A 2XB4A 1Y6FA 3GRRA 1Y8QB 3NDJA 3NRBA 2XODA 1CIVA 3VNBA 4N01A 3AT1A 1IM2A 4YRRA 5AVWA 4NIMA 4R1UA 3DTTA 3FFBA 4WXMA 3SS8A 5K4HA 1JKMA 1FJXA 1REQB 1YS2X 3AJAA