4LYHA

Crystal structure of small molecule vinylsulfonamide 9 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 59
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lyhA00
2IS4A 2J59A 4ACAA 3KKOA 4LX0A 2F6RA 3DPUA 4IFEA 1IY0A 3PIRA 3E2IA 4TT3D 1N6PA 4A2QA 2AX4A 1TF7A 1N25A 3FYHA 3B60A 4JLJA 2KBEA 2HV8A 4LJ9A 5DISB 3E5HA 1CJTC 2H18A 3V00A 2CE2X 2QP3A 5E4FA 1RZ3A 1IJEA 3NBFA 1CTQA 4XVQA 3GFPA 5B64A 2GEUA 3C4JA 1OIVA 4R2IA 5SZKB 5JS7A 3OHMA 3ZH9B 1SXJE 4UNNA 4TQAA 1YZGA 2GXQA 2V6IA 4QXAA 4FMCF 5DYIA 1Q3HA 1SULA 3CM0A 1VG8A 3W3AA 3C16C 3WMGA 4TL8A 4BFWA 2B92A 4ZV4A 3QUSA 3I5XA 3CZQA 3DDCA 3K0CC 4YXWD 3KJEA 3N2EA 4D6PA 3DMNA 2YWGA 1RYFA 5KDOA 2WWFA 3WYGA 3UG7A 2D2FA 3B2EA 4M1SA 4DJTA 1SXJD 1G5PA 1D9XA 1ZCAA 1GZSA 3FMIA 3V4FA 2V7QD 2J5XA 2O52A 3GLGE 2I1QA 3PQCA 4E5UA 2ODEA 1KNQA 1ANKA 3BWDD 4IEIA 3CH4B 3U6KA 1PV4A 1NMXA 1T9HA 4A15A 4LJ4A 1J99A 2GJSA 1Z6YA 4U00A 2FN4A 4EPWA 4D2IA 5FUXA 4N1AA 2FU5C 4IVPA 3J81k 2CVFA 2PX3A 4I1SA 1M2OB 1FZQA 1SVMA 1ZU5A 1EFUA 2HF8A 1P75A 2QP9X 4W5JA 4Q7JB 1E0SA 3CX7A 1KDPA 4RCZA 1JXOA 2FZ4A 4LJAA 5HKKA 5JJIA 1CP2A 1KI7A 1DO0A 1Z08A 2A5DA 2HCBA 3N70A 1HQCA 3NXSA 3KJHA 4PSVA 4Q1CA 3VNUA 3N5CA 4FW9A 1XTQA 3KUCA 4LPSA 4LV8B 4CW7A 4EPRA 4KSBA 3IEVA 2O8CA 2TMKA 4I1VA 1L4YA 3CNNA 3F5FA 5FPHA 2NO6A 3C15C 2QSYA 2ZRDA 3BFVA 4QNMA 1XB2A 3KKNA 4MGKR 1M34E 1ZIOA 2VSOA 1E0JA 3FKSA 4M22A 2O8CB 1DG3A 1ESNA 3BB4A 1KYIA 2GZDA 4NYIR 1VDZA 2UVQA 5KDLA 1T6NA 2CHVA 3TUJC 3M4YA 2C5LA 4JT4A 4P31A 5JCZA 2JLQA 3LDAA 1I2MA 1D8TA 1OIWA 5CIWA 4AK9A 4D82A 3LBHA 3FE2A 1VHLA 2WBLC 2FPLA 2CVHA 4DCTA 4DLVA 1WMSA 1W0JA 2IWHA 4LYFA 1KI9A 2UZ3A 1IHUA 4HLCA 4L8GA 1GL6A 2ZI9A 3O8CA 4RZUA 4IOJA 5EP2A 4NCJA 1SVWA 4RFSB 4KSCA 5F2EA 1XP8A 5JHGB 2VSXA 3K0AA 2WOOA 4F4CA 2YNMA 2J46A 1NY5A 2QGNA 4Q4AA 1B23P 3UWOA 2IYQA 1E96A 3DO6A 4RJLA 3EG5A 1CKEA 2Q3MA 1KSFX 3K0AB 1T91A 4ZCMA 2CK3A 1U9IC 1WQ1R 4HDOB 4A6PA 2O8DB 2W6JA 1ODFA 4PC7A 1KKLA 2ZVPX 4Q4AB 3EA0A 2UKDA 1U94A 5FOVA 2OFWA 4NH0A 3GLFE 4ZO4A 2R65A 3ND9A 2QAGA 2QY9A 4U7DA 2A7QA 1YZQA 3QXSA 2IC5A 3HDTA 4W5HA 4B32A 1UBGA 2AK3A 3U60B 5F9FA 2OEPA 4GP7A 4HAYA 4DB4A 3RC8A 3NBZC 2QAGB 2EQBA 1LS6A 5FOWA 3UK6A 1W4RA 4R9UC 2FWRA 3TSZA 2H17A 5A0FA 1LNZA 1R0ZA 1W49A 3KB2A 5P21A 3CF2A 3HU3A 2ZU6A 4BGDA 5EP3A 2FA9A 2GXUA 2IF0A 5CYOA 2F9LA 2JASA 3A36A 4FWIB 4RKEA 3ZYCA 3GJ4A 3PUYA 4OQXA 1G8FA 3B82A 4M1YA 5FR1A 1QRAA 1DAGA 5AJZA 4L4UA 4IDHA 4A0RA 4R71A 2QU8A 2RKOA 1NVVQ 5G53C 1NN1A 3A4NA 3MWLA 1OPXA 1UBEA 2CEAA 1Q1BA 5FI1B 2C9YA 2A5GA 2BDTA 2ZEJA 3B1YA 3PEVA 2BHRA 2W6ID 4FMDF 5G3YA 2FPKA 2ZTSA 4CVNA 3EPJA 2ZXUA 2YWEA 1P73A 4NCKA 4E07A 3SEAA 3OEHA 3AVVA 2QGZA 4OQMA 3I72A 3SJCA 4UNRA 3AVWA 2QTHA 1E9BA 3WBJA 1DBSA 1CR0A 1IN6A 3QVVA 2AWNA 1A2KC 4EJSB 3QG1A 1DE0A 4JL6A 4Q66C 2BMDA 5E95A 4GNKA 4JIMA 2WZQA 5FTNA 3SN6A 5GJCA 4K46A 5C2JB 1VTKA 1KJYA 5TY0A 3L8YA 6Q21A 1GP2A 1XPOA 1WB9A 2O8BA 1VCIA 4UJ3A 4V0MA 4Q1DA 4L9SA 2YVUA 5K8TA 4O2RA 1E6CA 3FOZA 5FTJA 4B2LA 3CPJB 3AKDA 3K70C 3EIQA 1LW7A 3BAFA 5FBLB 4DLXA 2O8BB 2KI5A 2J0SA 3KQKA 1P9NA 2O8FA 2LCFA 4L15A 4C9BA 3X1WA 3C14C 4EAQA 4A4DA 1J8YF 4YMTA 1K6MA 4MGZR 2IWRA 4A8JC 4QBGB 4U02A 1U8YA 3EC2A 2C78A 2FMXA 2VL7A 3OEED 1H8EA 2OV2A 4LC0A 1S1CA 4JLMA 4B3XA 1NVUQ 4FXPA 1U98A 5JEDA 4QFMA 2Q21A 1ZINA 4JL8A 4XSHA 5AJVB 2QZ4A 3AVOA 1ZM3A 3CF6R 1FP6A 4BFXA 4URUR 4I81A 4LYAA 2W00A 3KFXA 4WXRA 3A58B 4RD2A 4TT3A 4B34A 4QKQA 1UBFA 2Q9AA 4IW3B 2ATVA 2HXSA 4GL2A 5KHOC 4URVR 2EFDB 2RGCA 3IBYA 3QPUA 1PVOA 3ZVMA 3P1JA 3WMFA 2EFGA 4HB4A 2ZPTX 2DFTA 5IK2D 4IKEA 4NCIA 4GBMA 5FUYA 1LV7A 3HU2A 1E9DA 2Q3HA 4LPKA 1KK2A 2DB3A 1SQ5A 1I4TD 3EZ7A 1JBKA 3CUEF 3KDSE 3O47A 1CJMA 1P2TA 4WBSA 3KQUA 4HLUA 1A4RA 4OK5A 5LBIA 2NPFA 3TQCA 3AUXA 3OIUA 2F9MA 2XNSA 5JBQA 1PJRA 1ZP6A 2ZREA 4QBIA 4TMTA 2AL7A 4RSGA 2GETA 1Z6AA 4YXWA 2FGKA 4ESVA 2XEXA 2OILA 2HYDA 1S4QA 2OM2A 1ONBA 221PA 1Z83A 4LUCA 2WJHA 4B3BA 2WJJA 2ZE7A 5J4KA 1DAEA 4BFVA 2RGNA 4TMXA 3UANA 5K8LA 1G20E 3QG5A 1X8LA 2BWJA 3U44A 2IYZA 1BOFA 1P60A 2HDNB 1XD9A 4PTLA 1PZNA 2BM1A 4BFUA 1NG1A 2GJ9A 1G7SA 3SJZA 4PHHA 3B1WA 2H8KA 4QJ4A 3OAAD 3D31A 4KLNA 5DN6D 3U44B 2FNAA 3FTQA 2JJ1A 1CRPA 2QMEA 1ZMXA 4OHZA 1VCMA 4KCGA 4PZLA 3TRFA 2QM7A 4OHWA 1UFQA 4N0EA 3LW7A 2P2LA 5EP1A 4A6XA 4DBLC 5FBVB 2V54A 3Q8XB 3BJIC 4B6FA 4IDNA 3GLGA 1S9HA 4C0QC 4V02A 4G5OA 3CF0A 2QMOA 1QHXA 4NU0A 3V9PA 2IA5A 4A2PA 3EA5A 4P4TA 2VA8A 1UKZA 2VHUA 3MJHA 1KK0A 4M53A 2G6BA 3RS5A 1KIMA 4DRZA 3AKCA 3GLGB 2GTPA 2IHBA 1DELA 1LTQA 2WWYA 1PLKA 4Q1BA 3LV8A 5FL7D 3GP8A 3LFUA 4ZI3A 2BMJA 3FWYA 4NP6A 2DBYA 1Q1EA 3OFND 1R5BA 2VP0A 2OSBA 1Z28A 2DHRA 2VQSA 4X8HA 3QEJA 2PZFA 2CCJA 2QAJA 1B0UA 1RKBA 4KAXA 1J2JA 1XTSA 2QP4A 3QKSA 4B71A 3PR1A 3MWJA 2ZJ8A 3JZAA 3NWJA 3GFTA 1QG2A 2IYXA 1SVSA 3CX8A 1ZNWA 1XXHA 4HZIA 4DLUA 4BLSA 5FPKA 2F3RA 3QKSB 5HR5A 4WOPA 4PANA 1XTJA 2C95A 5DI9A 1A82A 4NYMR 3THYA 1Q21A 2H57A 3PV0A 3Q3JB 5FOUA 4QHTA 1N2CE 2VH5R 3W5JA 1XXHB 3VR6A 2J1LA 1MOZA 4MRNA 2PLFA 1AQYA 3GJXC 1D6JA 4ERNA 1XMVA 1Y3AA 3THYB 3CW2A 2PLRA 2X8AA 5CLLA 1E9CA 1UADA 2DPXA 2MSCB 2ZRCA 3U3OA 2IEZA 3EAQA 1GL9B 2G1JA 3FKQA 1RRGA 721PA 2KJQA 4KJZA 1G1MA 4AIIA 4EFLA 3BH0A 3FMFA 4ZCIA 3CWQA 4HB3A 3ZD6A 4IOKA 1W5SA 1NVWQ 1KTVA 1R7RA 3GLIE 1VYTA 3K9GA 3QVUA 5UKDA 3UMRA 4ZIRA 1E2DA 4GZMA 5EP4A 2X2EA 4LHYA 3KUDA 4B2PA 5J4VA 1AQUA 4PPFA 2ZUDA 3NC1C 3QENA 1DARA 3VHXA 4AKIA 4I1UA 2V3CC 4ZIRB 4D80A 4XTCS 2HUPA 2ZQ5A 1K5GA 1NP6A 2R2AA 2X2FA 1G4AE 1II8A 5D3QA 3I4LA 3VR3A 3GLFA 1RIFA 2E9SA 2OBNA 5AJYA 4RD3A 1U81A 1WBDA 3KX2A 4IFBA 3T5GA 5H8WA 2FPMA 1II8B 3BC1A 1E1RD 1G7TA 4JVNA 4MQBA 3WHKA 3GLFB 1NNEA 1FUUA 1P4SA 3CR8A 3L8ZA 5FI0B 2QMHA 1FW6A 2CJWA 3LX5A 4G5QA 2IS2A 2EFCB 2W6IA 5CJPA 3BS4A 4Q03A 2J9RA 3R9XA 1XF9A 1N0VC 1VYUA 3F3YA 1Q12A 2PZGA 1E2PA 1XZPA 1NIJA 2H16A 4HATA 4PC2A 4D0NA 1MRNA 3LW8A 3T1VA 2CJWB 2GEDA 2CMKA 2J0UA 1GFIA 2ZE6A 5JCPA 1R5OA 2J0QA 2KSQA 4C2TA 1NLYA 3QPVA 4O25A 4DIDA 1KNXA 2OG2A 5SZJA 1GTVA 1HE8B 3CWZA 2VP2A 3HU1A 4UXJA 4WIAA 3SNHA 4TZ6A 1N0WA 2J0UB 4NONA 2P5SA 4MYTA 5C18A 4D4JA 5KSPA 1YVDA 1FNMA 1QVRA 3R9IA 4Z8YA 5FOXA 4D25A 3ASZA 3CRVA 1XX6A 2JDID 1KMQA 4A82A 3QXJA 2FV8A 1A7JA 4C0LA 4EPTA 2HJGA 5L3VA 3KQNA 4LBWA 3RS0A 4TYNA 2J3EA 1E2GA 2DYKA 4DC9A 4TL9A 3AF0A 1GILA 2Q9BA 4UNQA 5EZ5A 3B1ZA 1X3SA 1E9AA 1W4CA 4V0LA 2IXFA 3TAHA 3Q5DA 1XTKA 3B1XA 2GA8A 5FPTA 4YDSA 3AQ4A 2Z0MA 1MO3A 3QF4B 4PR0A 4G5SA 3OEEA 4IJMA 4V0NA 4EFMA 4HDQB 1YRAA 3DM5A 2NO9A 3L43A 4Q4JA 4XVRA 1OKKA 2PX0A 3DL0A 3GJ5A 1GAJA 2YWFA 3TAUA 5TDHA 1MR3F 4HUQA 4F93B 4DLRA 4O3MA 1P2VA 4Q4JB 4DDVA 1XCPA 2QA5A 1VG9B 1DADA 1IN8A 4CT5A 4D4KA 4N3NA 4MKFA 5IK2A 4HUQB 4JLVA 5KDDA 4Q48A 4IDPA 1YZKA 2GHIA 1NRJB 521PA 2WJIA 1E79D 5EZ6B 4Q02A 1KJWA 2ZJ2A 3UIEA 3KJIA 1TF5A 4J0QA 2P67A 3MRSA 2VF8A 2ZJBA 1KO8A 1P9WA 5HCNA 4URZR 2RAPA 1G41A 5ELXA 1G19A 4TYPA 5IHPA 821PA 1W36C 1YR7A 3CBQA 2OCYC 5TXGA 1W44A 2HEIA 2W0SA 1G7RA 2ZSBA 4RCYA 4AWXA 4PQRA 1G8HA 3PJRA 4V0ME 3AF3A 1DAHA 1E2MA 5DHFA 2CL0X 2HXYA 3C8UA 1JALA 2F43A 3I73A 3K0CA 1FQJA 4EPYA 2IYRA 3NKVA 2ZRBA 1WP9A 4KFTA 4GFDA 5DI3A 4M9XA 5KTYA 2FSFA 2V1UA 2F43B 1G3IA 3BXZA 2GCNA 5KSZA 3OAAA 3RRYA 5DN6A 3NEJA 3Q85A 5DI3B 3X1YA 4A2WA 1C1YA 3T12A 3ZQ6A 1KOFA 3VTKA 3IQWA 3LH5A 3A4LA 1O87A 2B7BA 2ODWA 3RWOA 4B6EA 4DSNA 3TIFA 5GVSA 1VPLA 4LJ5A 4M1KA 1XU4A 2NZ8A 1N3BA 4MGIR 4W9MC 2QPTA 3QSYA 3X1XA 1IONA 4Q21A 4HAWA 4OJQA 5FBWB 3OZXA 3KKPA 3VQTA 5CB8A 4BRUA 1FOEB 3GJ3A 4RVCA 1EESA 1SKYB 3B78A 1OV4A 1W4AA 1QF9A 4TLAA 4M8NE 2HT6A 4MDFA 2WWGA 2DWPA 5FL7A 1H8ED 1OFUX 2EYQA 3GEEA 3ZZ0A 3BRWD 1GG2A 4EDHA 2WTUA 4IXMA 2FZLA 4KU4A 3A1SA 2WM9B 1NVVR 1AS0A 1EWRA 1SVOA 2X77A 2RGDA 4Y0AA 2ZRMA 2OFOA 4DWJA 3IIJA 1N0UA 2ANBA 4HAUA 4M1TA 5FPYA 4US2R 4E03A 3FPAA 2OLJA 5CM9C 5AUNB 1Z63A 1ZUIA 1YZLA 5SZHB 2RB4A 1XMSA 2ZUCA 4C0BA 1IN5A 4EUNA 2VPPA 2OXCA 1M7HA 1VKJA 3K0EA 2Z83A 4MRSA 2R62A 2JIZD 1T0JB 4BZPA 4MRPA 4O2LA 4ZDWA 5C1BA 3JVVA 1N5KA 4TMZA 2REOA 4YMSA 1MO6A 2QENA 4JKYA 3GD7A 4G5GA 1KSHA 2BKEA 3SFVA 2QNRA 1R0WA 2L0XA 5IT5A 3I5YA 4D26A 4IRUB 3KKMA 4FMDB 4FCTA 4AG5A 1E0AA 5D3MA 1DS6A 2ORWA 1KZGB 2R6GA 2X1VA 5H70A 4QC2A 3RS7A 3TH5A 4I99A 1ZYUA 1ZM9A 2NZJA 4Q9KA 1IN7A 5D3MB 1T5IA 1UM8A 4B48A 1CR4A 1YR9A 2CDNA 5J47A 1N6LA 3OIVA 4LZZA 2I1VB 1U8ZA 1U9IA 3L0OA 3PEUA 4P0TA 3ZIAD 3ZD7A 3H86A 3SE0A 3W6NA 4Q9IA 1MABA 2GWHA 2YC4C 2WIAA 2BEJA 4ZKEA 3UMFA 3RS3A 5L3QA 2OCAA 5EUMA 5BYJA 3KQLA 3TVDA 1NL3A 2JJ1D 3KL4A 1MABB 2B6HA 3ZVLA 1F2UB 1NVXQ 4PC3A 4XD7D 3B1VA 5L3QB 4KYUA 2GCPA 5EJEA 3NBYC 5JEEA 1IJFA 3MD0A 2REBA 4Q19A 3HYTA 2A78A 4C4PA 2WOJA 1Z6TA 1NI3A 1R0XA 5JZVA 1XZQA 3GLIA 1AN0A 2RCNA 2IUSA 1P72A 3BORA 4TMVA 4DDWA 1E1RA 1FMJA 2ERXA 4OHXA 4YMUA 1OT3A 1Q1ZA 1TX4B 1KI3A 1FNNA 4EQ6A 5DLQC 1N5IA 5FOTA 1QVAA 5EE9A 1XXHE 3MMPA 3A1VA 3GLIB 2RH5A 3HJNA 4O0MA 5JRJA 1E2FA 1YZNA 1BYIA 4MYCA 4EQ6B 4TQUS 5G3ZA 4TMKA 1WBBA 2V55B 5KSOA 2AKAB 4B3FX 3QBVA 3VU9A 1UAAA 1H8HD 1TAGA 2FSGA 3MCAA 4H1UA 4BASA 2BVNA 2JJ2D 3MGCA 4PXAA 4KITB 1KI8A 5AJXA 1AK2A 1N6HA 1ZCBA 3K09A 1M1YE 4LV6A 5G40A 5KNDA 4DDTA 2BBTA 1V43A 2FSIA 3TGPA 1P2UA 2ZAOA 2PCJA 1K5DA 2YWHA 3IO5A 4LJ6A 3TUIC 5J40A 3VU9B 3ZZUA 2A3RA 4D0GA 1J90A 2VHJA 4B73A 1GVNB 5FTLA 2AD5A 5JJLA 2JDIA 1KI2A 3EZ6A 4RFSA 4JBXA 1NY6A 2F1IA 2IT1A 3W5IA 4GZLA 1Z0KA 1P6XA 4JLKA 2PJRA 2MSDB 2JLSA 4ASUD 3QOFA 4LOAA 3KXKA 4A0FA 1F2TB 2AFHE 2O8DA 1FQKA 3IBGA 2OO7A 2ZRKA 2V9PA 3VX4A 1LS1A 3EIEA 1VCOA 4JVLA 4YLGA 1IY2A 2I3BA 4IOMA 4R7ZA 5BN4A 1QHIA 2PZEA 1GITA 4US1R 2IHYA 2DWQA 4BPBA 3K70B 2AD1A 2YYZA 1SHKA 3KJGA 1KO7A 2WAXA 4W7SA 2CLCX 5JLJA 3TLXA 3D7MA 3BIFA 4KFSA 5KUTA 4Z8XA 3BH7A 4A8JA 3IPXA 2PEZA 4KBFA 3THOA 4X8LA 1N6OA 1XWIA 2H92A 1D2EA 2CNWD 4RFVA 2OUKA 5HE8A 1YKSA 1NKTA 3LWNA 4BZXA 3UXMA 1U0JA 2XTMA 4PSAA 5KPDA 3OESA 4NL4H 4A8JB 4DXAA 4F4IA 1OE0A 4NZYA 4PPNA 4IVRA 3UPUA 1ZU4A 2EU8A 3K53A 3SJAA 1XNJA 2OXRA 4QNRA 4WVFA 4LHZA 3K8YA 3H1TA 4MRVA 4HSEA 3SI7A 3IO3A 4TQ9A 1E79A 4B74A 1NMYA 4YC7A 1R8SA 1QHYA 4PZZA 4B47A 1VECA 3B5JA 3FMOB 3EXAA 3GJ7A 4LWZA 4B35A 1E2LA 3PCRB 4DLWA 4DUGD 4ZI2A 4QGHA 2BBWA 2O0HA 4XJXA 4D0LB 3HWSA 3LO5A 1R2QA 1P7CA 4NMMA 1IXZA 4B3DA 4RD4A 5EE5B 4D4MA 4Q4HA 4GMDA 4WXPA 5JSZA 1SVKA 3E70C 4EJSA 4QRHA 3SYLA 2YOGA 2NO0A 1ETUA 1VCNA 2WIBA 4B75A 1EFTA 2CL7X 5BN5A 4C3ZA 3IILA 4NE2A 4Q4HB 1WF3A 2BC9A 4JLNA 1OXTA 4U5XA 5JSZB 3DHWC 4TYYA 5BQ5A 3SZRA 1KKMA 1E2KA 2JGNA 2VIIA 2ZRAA 3B8HA 3DOFA 4Q1FA 1MT0A 4M4SA 1WXQA 1TEVA 1QHGA 3NHAA 1FL9A 4BRWA 4JLAA 1MV5A 4JJKA 4EPVA 1NSFA 1COWA 2E87A 3BOSA 3FHOA 3OF5A 4MUBA 3IQXA 4BEJA 4TWZA 1JJ7A 4PO9A 3TR0A 4PAMA 4FWTA 1Z22A 1TL7C 4PFSA 3ZVRA 5HE9A 3W34A 4E09A 3I8XA 4ESHA 3A37A 4M2LA 3T06B 2ODNA 4ZKDA 4B3GA 4ARZA 2XB2A 1Z5ZA 5CIQA 2ODBA 2PMDA 4Q7MB 1E9FA 4TYQA 2GF9A 3G5UA 4IVQA 4G01B 4P4SA 2A5FA 4BZQA 1CJKC 4DCVA 2AHOA 1G18A 3LBNA 4ARZB 2JCSA 3EPKA 2QTVB 2RGAA 3QE0A 1M7GA 4HAXA 3MLEA 3VR4A 4P4SB 2PJZA 1AS2A 4ON9A 3M1IA 1W2HA 4F4JA 4FINA 3EWSA 3TR5A 1XTRA 3EARA 1OKKD 2ZRJA 3EZFA 4I4LA 4CYMA 4PAQA 4OI1A 3OE7D 1VMAA 1UKYA 1QDEA 4DEXA 2QRNA 2D4HA 2CXXA 3L0IB 3VNVA 5KSYA 2QPOA 2WAYA 4UNSA 3VHLB 2JIZA 1C4OA 2JAQA 2YZ2A 2FJUA 1OH6A 3CX6A 3T1TA 1OYYA 3MFYA 1G64A 2JLVA 3KFVA 1E1QD 2PEYA 1FMLA 4NBSA 4C7OA 4CT4B 2OCBA 2WMNB 1AJEA 2ZS7A 2QN6A 4NHOA 4QBFA 2FG5A 1UEIA 2Q6TA 1Z0AA 4KI0A 4OHVA 2CLDX 2XGJA 4GRAA 4EPXA 3AVQA 2UZIR 5FUWA 4C7OB 1S3GA 4Q1AA 2ZIAA 4PC1A 4AKGA 2DY1A 2WV9A 2AKYA 4X8MA 3H4MA 1Z06A 2Z4SA 3SHFA 5F98A 3SOPA 1ZJ6A 4QJ3A 1L4UA 3ZIAA 1XPUA 1SKYE 3Q72A 2N46A 4PHTA 4HUTA 5JJKA 3D3QA 3ZS8A 1JJVA 3EIHA 4JYCA 4PQFA 1OJLA 4TN1A 1JQJC 4NPHA 1F3OA 2OFXA 3K9NA 3DOEA 4JVSB 4S35A 4C0KA 2WWIA 3NVAA 4AKHA 2YC2C 1A1VA 3GJ0A 2C9OA 3PEWA 2NGRA 1JAIA 4XD7A 2ZRNA 1F5NA 1J8MF 3Q7QA 4BFTA 4DLZA 3AM1A 2ZSAA 1FUKA 3W90A 3CNOA 2VP5A 3Q7PA 3BK7A 3IIMA 2GEVA 3DKPA 4S2EA 5K8UA 4DIEA 2GZHA 2Z4RA 3I92A 5BN3A 2A5YB 5LD2C 4MUAA 1GUAA 1U0HC 2NO7A 3LRPA 2W2TA 3WYFA 4BE7B 4K81B 2EWVA 1C9KA 2KWIA 2PMKA 1Z47A 4JLBA 3O8BA 2E1RA 2RHDA 2OLKA 1VIAA 3EW9A 3BD9A 3THXB 1H8HA 1HT1E 4TMWA 2NG1A 1TU4A 2JJ2A 1G3UA 2Z5FA 5TB5A 1OH7A 1Z07A 2C04A 2ZRHA 1PLJA 3CLVA 5C46F 1KY3A 1TADA 1TQ2A 1GRRA 3LNCA 3P4YA 1P62B 4TTRA 4JT2A 3VFDA 2OBLA 3I61A 2GKSA 1M74A 2CHGA 2AN9A 1NN5A 4TL7A 3MUFA 4P32A 2IF2A 5LB4A 4MRRA 3U2QA 3TSOA 3WRXC 1W4BA 4Z1MD 1QHSA 4UJ5A 2BMFA 1II9A 3ZLJA 2GBLC 1OHHD 1OXSC 4AYTA 2WSMA 4ASUA 3OIWA 3WXMA 5TARA 4FCVA 1E94E 2QL6A 2IS6A 1CBUA 4JLPA 1YHNA 2G83A 3SJBA 1YZTA 2Z6VA 1YZUA 4C2UA 2VP9A 1R10A 2P6NA 3FVQA 4BLQA 3I1FA 2ORIA 2ZITA 3L82B 3U61B 5EXXA 2CCKA 1DPFA 1E9EA 4CEJA 4QGAA 3W8NA 3E1SA 2WKPA 1W46A 5M04A 4HLUC 1KAGA 2QBYA 3TK1A 1GRQA 4OK3A 5KU1A 4NCNA 4AY2A 4JZKA 2BKUA 4QJ5A 4OI4A 2GJ8A 3CZPA 4CEJB 2CNWA 4LV5B 4BLOA 3NEYA 3TQFA 3BB3A 3WMEA 2QBYB 1T3SA 2FE4A 5BYKA 1KI1A 2ZI7A 1SHZA 4OQNA 5IDVA 3U5ZB 2RGNC 2SHKA 5TV2A 1SXJC 3CO5A 3RAPR 1EWQA 1IBRA 1N5LA 5CM8B 1KZ7B 1ZNXA 1VHTA 3QF7A 1G8GA 3IPYA 3QQ5A 3RRZA 3LAWA 1LF5A 2IX3A 1TUIA 2ZROA 5AUQA 1D5CA 4QM6A 1ZD1A 4DUGA 2XXAB 2GJAA 1RPZA 1TMKA 1OF1A 1P2SA 4LYHA 1N6IA 3I32A 4DT1A 1W1WA 1GKYA 2ZRPA 4TLCA 3WRYC 3FHCB 3W3ZB 4KYIB 3KKQA 1KGDA 4RD1A 4DT1B 3DMDA 4DSTA 4WZBE 4XWOA 3ND8A 2CLSA 2WVJA 4AYWA 3M6AA 4GI7A 5JI2E 4JL5A 4G1UC 1G7CA 2BBOA 3PEYA 3FDIA 3CPEA 2XB4A 1W36B 2XZLA 4HAZA 1Z0JA 4V03A 2JLUA 1W7AA 2JLRA 1ZUNB 2R6AA 4Z54A 3WNCA 1UJ2A 5HZHA 1EX6A 2GJKA 3WBKA 5L3SA 1G3MA 2IUUA 3P20A 4IDQA 3W8RA 2OHFA 3IHLA 3HYRA 1TU3A 2WJYA 3CRRA 1Z29A 2O5VA 5L3SB 3TVTA 4FMCB 3AVPA 4WZAE 4CIDA 3ETLA 1I4LD 1DAIA 1EG7A 2NQ2C 3QF4A 4MYUA 1OB5A 1XFAA 4WZ6A 4V0KA 2WHXA 2PH1A 3RC3A 5KNBA 1WCV1 3K70D 2H5EA 4LGMA 3TJZA 2ZJAA 2YJTD 5DH9A 2I4IA 1AIPA 2D74A 2VRWA 1XD8A 3NBXX 4I1OA 5F9HA 2RGBA 3DVLA 2XJ9A 1BMFD 2BJWA 4CEIA 1T3HA 1F48A 4OJKA 4DEYA 4OQFA 2J45A 1G291 2NO1A 1VIYA 2GZAA 1NN0A 4BLRA 4PQYA 1HTWA 5DHAA 3ZDQA 4Q5IA 2YOFA 3OE7A 4CEIB 4JMPA 4BQSA 1G17A 1CR2A 1FP7A 4JLDA 2YKGA 4BFYA 5FTKA 1X8KA 1ZAKA 4POAA 1YR6A 1X8JA 4QHSA 1T0HB 4KV9A 3WNBA 3GCGA 4JLOA 3IDQA 3KQHA 4A0GA 1UF9A 3CH5A 2QT0A 2VSFA 4AKEA 1G6OA 2XAUA 3VKWA 4PAOA 1KK1A 2IW3A 3C5HA 2O0KA 1MO4A 2ZI6A 1R4AA 1E1QA 4LBVA 3PFIA 3QJYA 1MO5A 2RGGA 4YMVA 3RRMA 1UDXA 3DM9B 1KO5A 3VKHA 2X19A 2RGEA 1XD2A 2KB0A 3LQRA 2Z43A 4F38A 1CIPA 1AKYA 2JLXA 1E3MA 1D2NA 4OBEA 1MH1A 3K1JA 3DZDA 2ZI3A 3LLUA 5J4YA 1KDTA 4CDGA 1XCMA 2ZRGA 3AF2A 3T35A 1Z0IA 1XD2B 2WWHA 4C0SA 2JLZA 2GILA 4IHQA 4XWKA 5FR2A 5BWMA 5GADl 1OH8A 1JR6A 4IOLA 4PSKA 5DE3A 5DO9A 4G3XA 4RZ2A 5AR1A 4A92A 1JPJA 2FX3A 4ILEA 3D6TB 4L9WA 3EC1A 1DG1G 4OHYA 5CJ2A 3U7GA 1AS3A 3EPHA 4L16A 5IF9A 1X6VA 4US0R 1COWD 4GDFA 1W5TA 3QI2A 2V6JA 2F1JA 5DSZA 3REGA 1N6KA 3AF4A 1AGRA 1QZXA 3A8TA 1M8PA 2RMKA 4C0HA 1EFRD 4PO8A 4GOXA 5DIFA 3SQWA 1Q57A 2P3SA 3AUYA 3AGQA 1TTTA 2HYIC 2GAOA 3NHBA 2YV5A 3LBIA 3LVQE 4DCSA 1D2MA 2J7PD 3BERA 2IYSA 2G0TA 3CRMA 3SYKA 3WHLA 3C41J 4Q00A 4QL3A 5AK0A 2ZYVX 1S1MA 1XCGB 2DCUA 3CIOA 4UQOA 4XIGS 4ZPXA 3HP1A 1GOTA 3Q5EA 2GCOA 5DNYB 4LCBA 2BBSA 4HDCA 3FGNA 1E99A 5H1YA 1HH4A 1XEFA 2YINC 2AWOA 3R20A 1EFHA 2GCOB 1AKEA 2ZETA 4JJZA 3ZGXA 1I4DD 1HURA 2ZI4A 3U6BA 2QROA 4NCHA 1CS4C 1ZW6A 3R7WA 4F92B 2H7VA 1G3QA 1Z2CA 2OT3B 4JBYA 4NDZA 5AUPB 1BS1A 4MKIA 3AVUA 3LD9A 1M6NA 2W2VA 1HV8A 1OFTA 3CNLA 3VR1A 2KE5A 3R7WB 4JYBA 4ACBA 2ZM5A 4Z1MA 2ATXA 1DEKA 4OYHA 5HTKA 3WYAA 2JLYA 1UKEA 4B43A 1DAMA 1OHHA 3MSXA 1XEWY 2WSSD 3D8BA 3PITA 3ADBA 2R6DA 1RE0A 2NPIA 4FI3C 2FFBA 2J41A 2ZUBA 5CDFA 4B44A 4A9AA 1S96A 2FSHA 3IEUA 2JATA 3WP0A 1Z6GA 1KI4A 3K9HA 1EK0A 3GPLA 1FPMA 5HPYB 2QUZA 4C30A 2VTKA 4LDJA 3SC3A 5F3WB 2GRJA 1OFHA 3QNUA 1Q20A 1SVLA 1IOZA 1WDTA 2C2HA 2YOHA 1BH2A 2WPDA 3CRW1 3K0SA 3A1UA 4X8OA 3CPHA 2IXGA 4II7A 3P4XA 4JSYA 5FBQB 2ZS8A 1ZD9A 2ZAMA 1Q3TA 2QE7D 2IUTA 1P9RA 3TBKA 5KYKA 1W48A 3WNDA 1GKUB 1F2UA 1LF0A 4LJ7A 3SU8A 5G41A 3JVUA 1LVGA 2PBRA 2V8OA 1BYUA 3GEIA 2FFQA 1OW3B 1NG9A 1Z0FA 2N1BA 2W2XA 4DSOA 1TPZA 1YQTA 1JEEA 2ZJYA 4OL0A 2GK6A 5GJWC 1GNRA 1XEXA 2G3YA 3ADDA 1K8RA 5SZIA 4AURA 2GXSA 1W0KD 5E7IA 4HAVA 3AV0B 3KB1A 1JEDA 2D62A 5EE0A 3CONA 4ZCLA 1HEIA 1AA9A 2FFHA 5EE1A 4RD0A 1XEXB 4JVMA 1OH5A 3T1OA 3QY0A 4LHXA 3LVRE 1YR8A 4TTPA 2WJGA 3VR5A 3RS2A 3IKJA 3ZVNA 3RANA 2A2ZA 2G1KA 4F91B 3DKVA 4XWAA 3RYTC 1T4GA 1CEEA 3GJ8A 5C4GB 3U3MA 5KPJA 2IYLD 5AJWA 3AEZA 4BECA 1RVDA 4DSUA 4ZDJA 2GXAA 4JKIA 4AD8A 4LBZA 5IRCD 2J87A 1T3LA 1AGPA 3IHWA 121PA 4GT1A 1JPNA 1ZIPA 4DDUA 4NYJQ 1I2DA 4M1WA 3RRNA 4MYHA 4URYR 5FL3A 3AP2A 4W5WA 3O8RA 1JNYA 1LB1B 3TUZC 2Q9CA 1T8UA 5J5CA 4WAUA 1NKSA 4B76A 2D2EA 4AI6A 3H84A 3U3KA 2VHCA 3PUZA 2FF7A 3AP3A 4KO8A 4WA7A 1US8A 3MG9A 1Z8FA 3ADKA 3BB1A 4CF7A 4QM7A 1OYWA 3PVSA 1F2TA 4GPTA 1XPRA 4DVGA 2CE7A 2NIPA 4KFUA 3T1QA 4RZXA 1QG4A 4YONB 2QMUA 4LI0A 3B9PA 3NTUA 1US8B 2XTZA 5CB6A 1DAKA 4G0NA 3W6PA 1KK3A 4IEEA 2HT1A 4AYXA 1E98A 1RW4A 3WY9A 2D7DA 1CF4A 4URXR 1BO6A 2IS1A 1FFHA 3GLHE 3TKLA 3PUXA 1KO1A 4M21A 3TNFA 1TUEA 1BMFA 1S0UA 2R8RA 2IYTA 5HCIA 1V5WA 4RZ3A 5JMTA 3LX8A 3U3JA 4N0DA 4OK6A 1CR1A 1MKYA 2C77A 2ZRLA 2OCPA 4UXHA 3QKTA 2XJ4A 4BUJA 1HY3A 4OI0A 3A1TA 4D81A 1VG0B 2V4ZA 2VP4A 3MJRA 3U7HB 3I3SR 1S9DA 1XJ0A 3NH9A 3FHTA 2HJVA 3THWA 4NTZA 2DFLA 1NBMA 1RJ9A 3BH6A 1XJQA 1E69A 3SDZA 2QEQA 4LBYA 3MAAC 2P0EA 1VG1A 1TQDA 3SBEA 4ZDKA 1IXRC 1WA5A 3DEFA 1PUJA 2XOKA 2GVDC 3THWB 5KOYA 1RJ9B 1JECA 3RS4A 1KSJA 3SQXA 2GAAA 4DZZA 2ZRIA 1OFIA 2ZJZA 1U90A 3T61A 4LJ8A 1JR3A 1RRPA 2EYUA 2WMOB 2WJVA 1JXMA 4R98A 1HYQA 5FUVA 3F0TA 5A5GA 4UNPA 3U4QA 3QXHA 5CITA 2ZR7A 2GNOA 2W0MA 1G21E 3G82C 4LSGA 4PX9A 3T34A 1S2MA 3IIKA 4KXFB 4HYYA 4XTRA 2ZYUX 1S8FA 4TLEA 4BWYA 1W36D 3U4QB 1PLLA 4PC6A 2B8WA 3RWMB 3HPQA 3UATA 2P65A 4NKRA 4C0JA 1KDOA 2ZRFA 4LHVA 3GQBA 4RY2A 2OE2A 1R6BX 5DGXA 2GK7A 2QQEA 1IM2A 2Q3FA 4GOKA 1TF2A 5JI3E 1AM4D 3R9WA 1L2TA 3QBTA 4Q9HA 3RDPA 5L3RA 3SHWA 2QM8A 4BEBA 3K09C 1KAOA 4TTQA 1E0KA 2AK2A 1EFRA 1CJUC 3R8CA 3G0HA 3AP1A 4PHGA 4P3YA 3RVBA 1CU1A 3ZQJA 1UDWA 1HUQA 1NIPA 2IK8A 2J7PA 4Q9LA 3Q9LA 5B30A 4HB0A 1OB2A 2BJVA 1NN3A 1KY2A 4KVAA 2ZSEA 1QBKC 2HCJB 2WKRA 2FOLA 5FBRB 1ZM2A 3HR7A 3GMTA 2WICA 4V0OA 5ANRB 3BE4A 3BBPA 4IDOA 1S3SA 1KJZA 1ZNZA 1ZUHA 4TSFD 4QGFA 1ZC4A 2XTNA 2C8VA 5H68A 1Z0DA 3EZ2A 2QQ0A 1KSGA 2W58A 2ZE8A 1E2QA 4DLTA 1CRQA 5LD2B 3X1DA 1ZVQA 4MA4A 1J7KA 1ZBDA 2QT1A 5JWRA 2NTYC 2PCLA 2BIFA 2D3WA 2QORA 1E4YA 2XNDD 2EFHB 2QAGC 1NLZA 3B13B 4JBWA 3TE6A 5C4MA 1MRSA 2LKCA 1EFCA 3I62A 3SYNA 2O8FB 2FDCA 3ICEA 3RLFA 4KODA 1O3YA 2ZJ5A 3C7KA 3RSOA 3X2SA 1XTIA 2REXB 2B8TA 4TL6A 5E7MA 2WSSA 2NOAA 1X1RA 2VYFA 5E7JA 3T5DA 1KHTA 2ERYA 4GP6A 2ECKA 1OLOA 4MKHA 4A36A 4KHZA 3ZJYA 2F7SA 1GKIA 2ZJOA 2GBLA 3AVTA 2CL6X 1UKVY 2BM0A 3NC0C 3NDPA 3A1WA 2C96A 2RGXA 4P4UA 5CYPA 3UMSA 3N2IA 5GJBA 1ZRHA 5JHHB 1JI0A 2OBMA 2B21A 2KBFA 3GEHA 3FMPB 3NIBA 1JB1A 2A30A 1TNDA 2IYVA 4LY6A 1RC8A 4E22A 3W6OA 2QE7A 2VO1A 3QEOA 2IXEA 3QKRA 5FFMA 2GF0A 2JEOA 1W2GA 3HR8A 3O8DA 4WW0A 1E32A 2LWIA 5FPSA 4EFNA 4H1VA 1RRFA 2DFKB 2ANCA 2OESA 5EQTA 4EJSC 5LB2A 3TMKA 5JWOA 4MGYR 5AWFC 4B3CA 1N5JA 1ZD8A 5J4LA 3P32A 4L5BA 1HT2E 1X86B 4NYIQ 1T8TA 2HLDD 3QKRB 1G4UR 4JSTA 3FFAA 4M9ZA 2LKDA 4M9QA 2IYWA 1ZNYA 4LYJA 1N6RA 4BFSA 1ELOA 2RHMA 3UKDA 1HQYE 1XMJA 1P61B 5EE3A 1W0KA 3AKYA 2QTFA 4IXNA 2IL1A 4R2HA 3VR2A 4HB2A 1SXJA 1VYVA 4ABYA 2V7QA 3CKLA 2XSZD 3ONWA 2D06A 2OAP1 2VF7A 4DKXA 4CEHA 3K0FA 2O8EA 3NH6A 3BFKA 1SXJB 4TYWA 3THXA 2FFAA 4YQFA 4Q7KA 3AGPA 1OXUA 3P26A 4HEJA 4CEHB 4BLTA 2ZVQX 3K0FB 2O8EB 3UWKA 1IQPA 3ICQB 5LDDC 4OKSA 3W9YA 1II0A 3PUWA 1ZM4A 4CRWB 2F1HA 4DHEA 5CDFE 1XDBA 3EASA 3RHFA 4RKFA 3ZS9A 4AG6A 4AC9A 3L0SA 4Q7LA 2BOVA 4QG7A 1ZC3A 2G9NA 2Q0HA 5JWHA 1SVIA 2ASEA 5E3HA 3MWKA 1NF3A 4HLQB 1T5LA 1OIXA 5B2ZA 3TW4A 2AXPA 3B9QA 3AH8A 3ASYA 1TEXA 3TSWA 4LHWA 1ZM7A 4K8OA 4PPQA 2FH5B 1IN4A 1FTNA 2ZANA 1E2IA 1P3JA 4HZUA 4TZ0A 1OXVA 5CK5A 2GDJA 3LY5A 4D4LA 2OZEA 1R0YA 4QBHA 1SGWA 3L2OB 2VHQA 1CLUA 4KLZA 3HPRA 4HZUB 4QGGA 5CK4A 1DO2A 1F60A 4EIWA 3K9LA 3SS8A 3AVXA 3AKEA 4YMWA 1G6HA 4PZYA 2WPDD 1TQ4A 2A5JA 1NMZA 1N6NA 2QRZA 4M0LA 4TLDA 3VX3A 3QKUA 421PA 1RRCA 3A6PC 2WWXA 2ONKA 2DFNA 1GRNA 2MMCA 3BGWA 1YRBA 2VP6A 5FH9A 5GJVC 2WWWA 4CGZA 2VHTA 1YU9A 3I8SA 3MWYW 4JS0A 4Y0VA 1TQ6A 2C98A 1E2EA 4FN5A 1BKDR 3GLHA 4UKDA 4Q4LA 3CRQA 3AF1A 2F3TA 1UPTA 5KNCA 2FEMA 2XXAA 1M7BA 2MSEB 4FD2A 4KBGA 4DLYA 1Q1QA 3EX7C 3OIYA 4GOJA 2VBCA 3M0EA 1G9XA 2C03A 5EXTA 2EFEB 2ORVA 3GLHB 3QPWA 3S1AA 3AVYA 4M1OA 2GESA 3NDBB 4BLPA 4FIDA 1XMIA 2N42A 2V1XA 1U99A 3C5CA 5J4HA 5K8IA 3PENA 1E2JA 2VLIA 4LRWA 1CULC 1Q44A 1IXSB 4TLBA 4ITRC 3X1ZA 4B2IA 3S1AB 3U7FB 1G3RA 1IY1A 1U8AA 2CCGA 2O0JA 2EW1A 3IGFA 1GM5A 4P33A 2QG6A 2G88A 1GL7A 3TW8B 1NJGA 1NLFA 4MH0R 1YJ5A 2FEOA 1A2BA 2P6UA 5HZKA 1L7VC 1HE1C 3P27A 3EPLA 1QHNA 2ZI5A 1G5TA 1A5TA 1L8QA 3PUVA 1GDDA 3RSLA 4C0AC 5FTMA 1XEWX 5HKKD 2F55A 3FFBA 1KO4A 2PT5A 1JAHA 3VMFA 5AUOB 2ZR0A 2IYUA 1EXMA 5JFGA 1GIAA 2W83A 3EZ9A 3CR7A 3FB4A 3ZZTA 1SZPA 2OAQ1 1R5NA 1GNPA 3B7GA 3KXIA 4Q1EA 3A4MA 1CXZA 4OI2A 4UXIA 4LJYA 4Z51A 2JA1A 1YE8A 3IUYA 1CJVC 4XVUA 5TMPA 3FKSD 3GJ6A 1UEJA 3AB3A 5JRZA 1KDRA 3R8FA 5BW8A 1NJFA 1NBME 2H1LA 2P5TB 1GSIA 1G16A 3PG5A 3UG6A 1GNQA 2R6CA 2R9VA 3LXRA 3U3RA 2PT7A 4HLDA 5LPNA 1X1SA 4CZ2A 2ZS9A 1G8PA 4TSFA 1WE2A 1W0JD 4EKDA 4H9GA 3ADCA 2VEDA 1E9SA 2G0NA 2YHSA 4MITA 2G77B 1G8YA 1LY1A 4GSYA 2ONJA 3LXXA 4LK2A 4M9SA 5FOSA 4PO1A 3LQQA 1WRBA 2P6RA 2DR3A 4MDEA 2ZSFA 3LA6A 2QPAA 4BFZA 4PPGA 1QHHA 1NSTA 3H2YA 5L8VA 3BFXA 1JR3E 2BCGY 4Q01A 2R6FA 2XNDA 1R8QA 3SBDA 4LC1A 1Z6XA 1NBMD 1U0LA 2A9KA 4XOIA 3T15A 1F6BA 3KZ1E 3WP1B 2CK3D 3KTAA 5CLQA 1QHHB 2W6JD 1P5ZB 4NYJR 4KFRA 2CHQA 1GWNA 2XOKD 1E4VA 1SKQA 1D9ZA 1HA3A 1E2HA 2IBMA 1KI6A 1UBCA 3KTAB 1W47A 3U7EB 1IAQA 3JZMA 4DLSA 1Q0UA 3B6EA 2ZR9A 5GVRA 3DZ8A 1JR3D 2J0VA 3REFA 1RYHA 1KI6B 5B58C 4XSGA 2PL3A 1XBTA 5B57C 4ZDIA 2XITA 4URWR 1KMHA 1AZTA 1E2NA 4Q47A 3B85A 1AZSC 2K5UA 1EX7A 2Y8EA 1PUIA 2BCJQ 5EXSA 1KMHB 4PHFA 1ESMA 3VAAA 3VKGA 2AFIE 3GFOA 5EXPA 3QXXA 1EGAA 2HLDA 3NG1A 4GMXA 4F7WA 4OQLA 4DCNA 3OEHD 1J70A 3QXCA 2B7CA 1LFDB 1Y63A 2GVZC 8OHMA 3F8TA 4YDHB 2XZOA 2DWOA 1G5RA 5TVKA 1DTSA 3CB4A 1Z2AA 4FMBB 1JQLB 2WKQA 2XSZA 2ZU0C 3SR0A 621PA 4NYMQ 4QHYA 1DVRA 2EVWX 5BXQC 1E9RA 4HI0E 1DAFA 2J7KA 1H65A 2BV3A 1XJCA 4QOSA 2HF9A 5A4JA 2FGJA 4A1FA 4XH9B 2AR7A 2AXNA 2QSZA 3PXGA 4FCWA 2F1RA 4KVGA 1DOAA 3ECCA 2NMVA 1OSNA 4B33A 1Q22A 1U2RA 5KO2A 2JLWA 4A0HA 2MMGA 5EUQB 1OXXK 2XZPA 3H0KA 1RFLA 2C99A 2ZSDA 5JECA 3RNLA 5JS8A 2BMEA 1XRJA 2JJ8A 3RABA 4M1MA 1FX0A 3EWAA 3LLMA 4Q18A 1FTSA 4G5RA 2XX3A 3KXLA 2IYYA 2D7CA 5DYGA 1FX0B 4DCUA 4Q9JA 2CBZA 2BEKA 2ZYTX 4DB2A 3QIAA 3OFNA 2EWWA 3SFZA 4MKGA 2R44A 2ZYWX 3L0PA 1Z3IX 1BIFA 2C9CA 4RD6A 3V4RA 2QI9C 2ZE5A 2IEYA
chains in the Genus database with same CATH superfamily
1QG0A 3FHJA 2IS4A 4EG8A 3L4SO 1AUXA 3KKOA 5ADUS 1PT8A 4LX0A 1UMDA 4IQ0A 3WFJA 3H3XA 2Q0SA 2HSDA 2XNKA 1IY0A 2I4OA 3GGPA 3OZEA 1N6PA 2AX4A 2I7XA 3VC2A 2IYAA 3SS7X 3B60A 5JBNA 1FIUA 2NU9B 2LV8A 1VL5A 3PC7A 3V00A 3S0JA 1U7ZA 3IQZA 5E4FA 4N0PA 4P22A 4AY3A 2RSLA 5IKXA 1CQIB 1IJEA 1BA3A 4JH0A 4XVQA 4YRLA 3C4JA 1OIVA 3NBUA 2JGRA 2EATA 2WF9A 3I6QA 3IURA 1SCAA 1SXJE 2J3DA 3OZIA 4NARA 4BQEA 3MBOA 1YR3A 2X9LA 5FT9A 5JQGB 3FSEA 3RUAA 4G6ZA 4FMCF 3BT7A 5DM1A 3CM0A 4GM4A 4JQZA 4RY8A 3RH0A 1YXMA 1YVPA 2O4CA 1CUIA 2YFHA 1RYEA 1TKAA 4BFWA 5KWJA 3CSDA 3QUSA 4Q16A 1GGJA 4D9CA 2PRZA 3DDCA 3K0CC 3R0VA 3V5NA 2XUHA 4X20A 2QVBA 5GONA 4E3WA 2YWGA 5CA1A 5KDOA 1DMSA 1TZKA 5A04A 2PUAA 3WYGA 1PZXA 1N9ZA 1UOEA 1S2OA 2D2FA 3UCXA 3K6JA 1Y6GA 3C6MA 1Y6ZA 3VDXA 3VR2D 3WKAA 3GLGE 4P0PB 1N2CA 4AL4A 2UZ1A 3FMIA 3NANA 1GZSA 3DZCA 1U4SA 3NAMA 4E5UA 3LCCA 1E5LA 1EVYA 3R3YA 2NU8B 1O0BA 3ZGYA 3VNAA 4ZVNA 1DCFA 1KNQA 2L17A 1X7YB 1CUSA 4XJVA 1SCUB 2WM8A 4DILA 3CH4B 2BSAA 2R6ZA 4NG5A 5DIZA 3UB3A 5JZMA 4L50A 3CTPA 3IAXA 3AR4A 3GAFA 3KVNA 5G1NA 3GZ4A 5IXJA 4A15A 1OB2A 1J99A 3JQRA 1L5ZA 1Y3FE 2J9YB 1Z6YA 1KJJA 2RHJA 1EM8A 3UQYS 3ZDRA 4AO6A 1V39A 1C7FA 2PX3A 4E3ZA 4F5WA 1FZQA 3RSSA 4NBVA 5KO2A 3IV6A 4MW0A 4FFWA 5KTSA 3A6LA 1UEXC 4MVJA 4Q7JB 1T8SA 1E0SA 1ZESA 3CX7A 3T5MA 4RCZA 1JXOA 1Z5UA 2FZ4A 3C39A 4LJAA 1Y33E 3PEEA 4C1NA 1RZRD 4IMPA 2EQ5A 3T3EA 4H1TA 3G2OA 3LTEA 1SG9A 3IKTA 1Z08A 4Q1CA 3N70A 5FQNA 2QL7A 3KJHA 3SICE 4X1IB 3N5CA 4FW9A 5HS6A 3IEVA 2O8CA 5IX8A 4JGIA 1YQXA 3GP5A 2OUIA 4DLKA 4YRDA 3L07A 1CJSA 4KITB 1YHYA 1H5QA 4JYAB 2NO6A 1AHNA 3BFVA 3Q6NA 4MTLA 1IHXA 1U6JA 2VSOA 1Q17A 2CC2A 2E5FA 2FR8C 2QW8A 1ESNA 4X61A 1KYIA 3JWGA 4HWRA 4JB2A 2UVQA 1VKOA 5BSRA 1DWUA 4P6VF 4BNIA 1PD1A 4EMUA 4JT4A 4ND1A 5JCZA 2G70A 1OOEA 3IAUA 3U61B 3FE2A 3L7AA 3NHSA 3H11B 1STOA 4OYLA 2CVHA 3OJ0A 4DCTA 1T6ZA 3OKAA 1WMSA 3SDSA 1NT4A 2F3SA 3AXSA 4LYFA 3R7BA 2SKEA 1TE2A 1OBCA 1DQYA 2GPTA 2HRCA 4HLCA 4G86A 4RZUA 5E2AA 1HYHA 4NCJA 3AM4A 1XP8A 4W8GA 4QX6A 3VR6D 4DANA 4WRRA 5DGCA 4UFNA 1NY5A 4DYDA 5GAJA 2BFWA 3C6KA 1HDCA 5C5EA 4JP1A 3G9UA 4DYVA 4AMUA 1TYAE 3EG5A 3KZNA 1LX7A 3CVUA 2GPJA 4FGZA 1T91A 4ZCMA 1JG3A 1C81A 1WQ1R 2CK3A 2CXOA 2Q45A 3VPSA 4YALA 1RCFA 1KEUA 4N01A 2PFGA 3PT9A 4Q4AB 4J0IA 2JD0A 4OHCA 4LRUA 2QAGA 2QY9A 2IV3A 3JYQA 1WTCA 3STYA 2LUOA 5E2BA 5F4ZA 2P77A 1ZS9A 3OD5A 3N2YA 3NM4A 2ZTMA 4MR9B 3U60B 1KYTA 3IBTA 5SYNA 5F9FA 2GERA 3PHGA 2XLBA 4YS6A 2Z9BA 3B6JA 3H6KA 2YV4A 3R5TA 4BVBA 1CW2B 3L0CA 3HR4A 4D1YA 5C1PA 2BEVA 5A0FA 1JDTA 1OWPA 2OTCA 1LNZA 1WMBA 3CLRC 4XAQA 2VPXA 4X84A 1FLNA 3O94A 2BFOA 3ONEA 4YRQA 2VHVA 2QOEA 3M49A 4BGDA 1PSZA 2IRWA 5B53A 2FEKA 4XWGA 1YNOA 4RYLA 4JASB 1R16A 1T43A 5IUJC 3AG5A 3VR3D 1RLUA 2OV4A 3GJ4A 2GVNA 3DMTA 5JNRA 3THSA 1U8UA 4C4SA 3BN3A 3H5TA 5EMHA 1JXQA 1I3MA 5TQJA 1WKCA 4R71A 1NVVQ 3AOEA 4O4IA 2R8PA 1PJAA 2R4TA 1JMYA 3I5UA 1DFIA 2AXQA 2FZ5A 5E6SB 2C9YA 3B1YA 3PEVA 4FMDF 3VXKA 2BHRA 2W6ID 3H19A 3ZIDA 2ZTSA 4J3NA 5MFPA 4BC1A 1P73A 4H2DA 1A95A 2ZIGA 3RC1A 2G1UA 3UGQA 3UJ8A 4EY3A 1JEYB 3AVVA 1G55A 1JMVA 1TA0A 2C4HA 2VOEA 3RHSA 4B6SA 1E9BA 3WBJA 1B43A 2YVKA 4KIWA 4HO1X 4DXDA 3FLBA 2PUCA 1DBSA 1CR0A 3P9QA 2YR0A 1WKBA 3TM4A 4PV7A 3LC0A 4PYKA 4EP1A 1RYZA 4JL6A 2G04A 4OKNA 4Q66C 4BDTA 1C1DB 1LKZA 3DAGA 3QRWA 4TXMA 2BMDA 5BWOA 2AFIA 5K03A 2LZ0A 5TPWB 5BN5B 4JBWA 1JI3A 1UMKA 4L3VA 4K46A 4I4TA 4K1XA 4RWEA 2IHVA 2HIHA 3JWHA 4KO2S 1KJYA 4GR5A 5TY0A 4QYTA 2PLWA 4BO1A 4V0MA 4IILA 4ZEMA 2IODA 4MVJP 4BAUA 1QFMA 3PD7A 1TYEB 1K9VF 4WMLA 2ZJ4A 3AKDA 3ZE6A 1DMRA 3BAFA 3JATA 2KI5A 1HTTA 1LK5A 1TYCA 4KN6A 4DQ0A 4LF4B 4L15A 4WV3A 4YP9A 4C9BA 4LHEA 5TEVA 3X1WA 4FQ7A 4BE9A 5A4MS 3R76A 1J8YF 2Q4BA 4QWMA 4CI0B 5DPMA 2X4GA 1WVMA 1J0EA 3ZBUA 1CUCA 3CYFA 4NDNE 1V4VA 3K6RA 4MSUA 3K7EA 2OV2A 2GF2A 1TW2A 1AK1A 5BUSA 4IXTA 2QAIA 2X8BA 4JLMA 1KFBB 5DTJA 4WCDA 3PD1A 1FDIA 5JEDA 1E58A 2V5AA 1M8FA 3KYJB 3EG9B 4DLBA 4INOA 4HX2A 3OT1B 4ZP1A 2BFFA 1AX9A 4G1EB 3R5FA 4D3ZA 2XWBF 1BE1A 4IIYA 1DWOA 3I9V1 3KFXA 4KN9S 4LNUA 4U6QA 1PS0A 1SHTX 3RUDA 4Z4HA 2EOAA 4MVJH 3V6MA 1UBFA 4IW3B 2HXSA 2BSXA 1RWQA 4ZQFA 5IUNC 4GL2A 2OP1A 3IKLA 5J2TF 4TS1A 4AMYA 1JE1A 3IBYA 4OXQA 3ZVMA 3P1JA 1ETHA 2EHJA 2YQZA 5U4QA 3LOUA 3ZV6A 4JOQA 4F4UA 1DQPA 3PC3A 1AE1A 3U09A 5DASA 3UHOA 4E5MA 2HPVA 5LZ5A 2Z1MA 2CN1A 3ILHA 4EKGA 2YN4A 1I4TD 1TGYA 2IP4A 2Z56A 4QECA 7REQB 3U17A 2GZ2A 3QA3E 1J33A 1T4CB 5IANA 2X1MA 2MR6A 5BOVA 5THKA 3P8ZA 5DKFA 1A9QA 2IP2A 5GV7A 2I9KA 2F9MA 4BJ5A 3GFGA 4HG2A 1D1QA 4OGKA 4TMTA 4RSGA 1ORRA 2EV9A 2GETA 2FGKA 2OILA 4D6XA 1VE3A 4JB3A 4O1IA 1U3WA 2XMQA 5B3JC 5LQAA 5K8CA 1ONBA 3TRDA 1NVGA 4WHMA 3SHQA 1R6VA 1WCYA 2F3QA 2K87A 3LQ2A 3Q9UA 1JIVA 1YMUA 5EJ7A 4PHCA 1OFVA 2FQ1A 2RGNA 4ZD6A 4TMXA 4BFVA 4BMSA 4D74A 5K8LA 5LZ9A 3HVRA 5EIBD 1G60A 1P60A 4V1CB 3UJ9A 1KWKA 4QAQA 4PTLA 5IYZB 4BV9A 4F6CA 4JJAA 2BFEA 1MC4A 4MVJI 2IEDA 1GY8A 3V8MA 2GJ9A 3D2BA 1RKUA 3QE2A 3SJZA 1WPXA 3GUUA 1ZFNA 3HJGA 3PQFA 1GV1A 3CUWA 1SC3A 3OAAD 4KLNA 4RXTA 4WGFA 3UVEA 5H81A 4RTKA 2JJ1A 2QMEA 1AHIA 4P7BA 4OHZA 4E1BA 4RJTA 2WUVA 3EISA 4PZLA 3UMVA 1BC5A 1QGDA 1LBSA 1UFQA 3G0BA 3LHKA 4J0EA 4N0EA 4RYDA 5CM2Z 3EXG1 5MN4A 5LOVF 1Q83A 2PKQO 2WIDA 5EP1A 4A6XA 2AH5A 3AHJA 2HRBA 4QQKA 3IPCA 1H6AA 1K5HA 3BJIC 1VKHA 3X43A 3RJMA 4CKXA 1YS7A 4V02A 3O82A 5REQA 1FMTA 3JQDA 4D43A 4BYMA 3PI7A 4DNFA 1HETA 1KYZA 2EDAA 2IA5A 2VA8A 1B0PA 1T9ZA 3MJHA 4OHYA 3DAHA 1QHEA 2G6BA 1UOOA 4DRZA 3AKCA 3GLGB 3IUSA 2P79A 3MRTA 4QVGA 4RTOA 4ZANA 5IAEA 2EL9A 1C14A 2IOFK 3EGEA 4NBUA 5IJXA 2BMJA 4NP6A 2XYRA 3OUZA 3OFND 4IDAA 4M8SA 3VR0A 2OSBA 2QLJA 1Z28A 2NYVA 2RIRA 2DHRA 3Q3GE 3L01A 3KJXA 4RORA 4PYOA 4X8HA 3BWCA 3N28A 4ITUA 3MJ4A 4I9GA 4NNPA 1MVNA 3NBQA 1C3OB 3CUVA 5TQ2A 1UWLA 4IV8A 3LC1O 4UBLA 3EXIA 4MR7A 4WVLA 1XG5A 3JZAA 1FVHA 1GT6A 1UJBA 4RGYA 3IDFA 2NUTA 3Q41A 5DT9A 3RG2A 3KOWA 4S1NA 2AMFA 4HZIA 1N9KA 3ER6A 3QFSA 4K9DA 4XRGA 1SK9A 4W9RA 1L3IA 3MMXA 1I6KA 4FNAA 1UZMA 3FPEA 5BNTA 5DI9A 1PZEA 3VGPA 5IPFA 1Q21A 3OBIA 2WAAA 1GO2A 2VXBA 2YV1A 4QHTA 1AURA 1JN0A 3KQWA 1VE6A 4HWKA 4UBMA 3KHSA 4N8DA 4C78A 1MOZA 3E9MA 4RJIA 1SUAA 4MRNA 3UGJA 4JBHA 3QELA 2BGLA 3I52A 1FSZA 1M2NA 1CZLA 1IZZA 4Z53A 4HH1A 2X8AA 1GJRA 4FGSA 2BFPA 2WDZA 5CLLA 4AZSA 2DPXA 2FDXA 2JH3A 2Z95A 1J2EA 2J9GA 4TKZA 5AM5A 4D9KA 5CVTA 5JZBA 5K4HA 1LH0A 5LP1A 5DHUA 1SY7A 4KJZA 3ZX4A 4ANFA 4KNWA 4KVFA 1EBUA 3RG8A 2OSVA 1XQXA 4NJMA 4QLAA 5EQJB 1ZBQA 4JUBA 1KTVA 1YO6A 3GLIE 1VYTA 3KLPX 5UKDA 4W9NC 3UMRA 4C7KA 1E2DA 1V2GA 2RFLA 2R8EA 5JV5A 3EFOA 4B2PA 5J4VA 3KUDA 2OHOA 3PPYA 5CW1A 3IJ5A 2EZ9A 2G25A 3D6AA 5SY6A 1Z0SA 1V6CA 2CKDA 3VHXA 3HSYA 2WD7A 2E48A 3QVWA 3D7NA 4TV9A 4N3BA 4XTCS 4BX9A 5A4FS 3IPAA 1NUQA 4B6RA 3EY4A 4YMLA 1HDIA 1EYZA 1K5GA 3SY8A 3QY9A 1NP6A 5AKXA 2B2CA 3O1HB 4R2LA 5CA0A 5AOCA 2OBNA 4ENUA 3BF7A 3QVGB 2CJYA 3AHEA 1U81A 4U6NA 3BTOA 3OZ7A 4M46A 4TUYB 4IPTA 3EDCA 1EB9A 4JVNA 1G7TA 1ZIYA 2I8AA 1GQ2A 1OZAA 3NHKA 4G56A 1FUUA 4MQBA 3L8ZA 1XCBA 2QMHA 3OQVA 3WWPA 4F46A 2VPWA 3UFBA 2XR1A 1ENOA 2KLHA 5EWLB 5FPQA 1W5BA 2P2NA 2R8XA 4BNJA 4J9UE 5FYQA 3GIDA 5E2IA 2J9RA 4YR7A 3R9XA 2PZGA 1XZPA 2FSVC 1UFOA 1MRNA 5D8DA 2FN9A 3CVJA 1JPUA 5CPFA 2CJWB 2ZE6A 1QZZA 1FBNA 1OU0A 1GCAA 3O03A 4LNAA 3D0KA 1PNRA 1GAQA 4AF7A 4ZAVA 1KWGA 2OG2A 5COBA 3Q98A 4R40A 4WIAA 1UUFA 3ZHOA 1LPMA 2J0UB 1R8XA 1YRHA 5EJIA 4C5AA 5KSPA 1YVDA 2O2CA 4CL3A 3R6DA 3R9IA 1NYLA 4Z8YA 2BT4A 3ASZA 3CRVA 2PZJA 1XX6A 2WZDA 5FOXA 4D25A 1Y8QA 1MORA 3ZC3A 2WABA 1GUZA 2FV8A 3NYRA 1A88A 1CUJA 2HJGA 3F2VA 3OWXA 4L72A 3URKA 4YCSA 3GGJA 9LDBA 2IH4A 1SUIA 2XGGA 5CAEB 1PN3A 3RS0A 1BROA 1YAHA 2DYKA 3AF0A 3EBOA 3KDAA 2Q9BA 3VVBA 2CNLA 4M76B 2YNMD 3OTWA 1M0TA 3WV4A 4I19A 5CLHA 1W4CA 2JVKA 3HBFA 1QUFA 4V0LA 6REQA 3U16A 3V2IA 2CNDA 2QRKA 4YAUA 2M1XA 1NUPA 4C08A 1K5PA 3AQ4A 4ED9A 2JHFA 2X4DA 2Z0MA 3S2GA 1GG5A 5D3ZA 4PR0A 3G49A 4BO0A 4OXIA 1B00A 3VSCA 3RTDA 4HDQB 4TZKA 4ZI7F 1XAIA 1VLHA 4PR3A 2C1XA 1YRAA 4II3A 2TECE 1WOMA 2A9PA 1YL7A 2NO9A 3OQHA 3NAQA 5FFFA 2JCYA 2NTVA 2YWFA 3I58A 4MUKA 4W7HA 3SZ3A 1NQVA 5KB3A 5I7RA 3GXBA 1MR3F 3IKVA 3CF4G 1XT6A 3LUAA 3L7DA 2GN0A 2XVYA 4OQYA 4MYSA 2GK3A 4P58A 1PGQA 4ZHQA 5ITVA 1QQBA 2QA5A 3CLHA 1VG9B 3TGLA 5D5QA 3NMUF 1YQEA 1YVRA 1C7JA 1ZN7A 3WX0A 3R3UA 1ZMTA 4MKFA 2YCLA 4GR9A 1HKUA 1TCBA 3IMKA 4L27A 4Q48A 1EK1A 3MCTA 2OFPA 2AEMA 4GPZA 1YZKA 1PTKA 1VPVA 3V6LA 2P7IA 1E79D 3G8YA 4CWAA 2GA9A 1KJWA 4ZAFA 2JFGA 2DHEA 4X54A 4B2YA 1A3CA 2P67A 4AJ1A 2ZAYA 3MRSA 5AKGA 4ZOBA 1KO8A 5HCNA 2PZAA 2XZDA 2LDXA 1TYBE 4URZR 3S7ZA 2I0FA 2RAPA 3DZHA 1G41A 5CXXA 1AGXA 1HLPA 1L7MA 4TYPA 3D43A 3H2IA 1EZZA 2DEUA 3DONA 821PA 2P9BA 3I23A 2OCYC 4NABA 5TXGA 1KS9A 2GK4A 3UJHA 5AVZA 3RVJA 3COZA 1RP1A 3L06A 5AKZA 2VZ9A 1IWOA 4RY9A 1Z2DA 1DAHA 1WUJS 4L51A 5CB4B 3OT5A 5CIYA 4PEVA 2QVGA 1FQJA 4RESA 3V7FA 1WOYA 2IYRA 4L9AA 1R0LA 1F0NA 2ZRBA 4BFCA 1DC5A 1NE2A 1L5RA 2XKKA 3MWFA 3HKCA 5KTYA 5A4DA 2FSFA 2Y0PA 3EFHA 2LGJA 1G3IA 4L4YA 2GCNA 2P78A 1JLLB 3M5WA 5DN6A 4EEZA 1CJCA 4IGKA 2D13A 1NOJA 2DLDA 1C1YA 3GT7A 3T12A 5JCXA 3VTKA 4ND8B 4ITVA 3VH4A 2FQWA 1SOMA 2WKSA 2ETVA 1W5EA 1WCWA 4Y30A 3WYBA 3KBOA 2B7BA 3UJ7A 5MN5A 5J9FA 2O6HA 1LRJA 4DSNA 3EJ6A 1DAPA 1PBTA 3T9AA 3TIFA 5GVSA 1VPLA 2H4HA 2Y67A 3GOQA 4B8YA 4C6SA 2XECA 4YT4A 4MGHA 1N3BA 4K9NA 5FWXA 4W9MC 3QSYA 1Q19A 3ZVKA 3MHTA 5JCOC 5CB4F 3C97A 3PNQA 2DPLA 3JR7A 2JIQA 3PXCX 3HWX1 4RTRA 1ML3A 4RVCA 1G20B 1EESA 4MS3A 3NQ41 3ZHBA 1OV4A 1JBQA 1T36A 1EK5A 2HT6A 2DWPA 2REQA 1H8ED 4OFWA 5EHGA 2VDJA 5AI8A 4Z7JA 1WP4A 1GG2A 1XZNA 3QWAA 2P2SA 1B76A 1LVUA 2FZLA 3E6AA 3MT7A 4L22A 2HI0A 1RM0A 3DDNA 5A03A 3RAFC 3WVNA 4RTQA 2X77A 1SVOA 4IIVA 1AV6A 1NC3A 3D02A 1DSSG 1S2LA 4EOGA 2QV7A 4Y0AA 5NULA 2OZVA 2ZRMA 2VYVD 3PNMA 4FS3A 4GIBA 2HA0A 1Z5NA 2JFFA 2XXJA 4FOPA 5FPYA 2WRZA 4A7PA 3FPAA 4COOA 1VLLA 2FX2A 4HVAA 5AUNB 1EX1A 1P7WA 1MB0A 1Z63A 4ETWA 2F4VB 4UU7A 3FYUC 3CA8A 2ZUCA 1EFVB 5L7YA 5G0TA 5HBRA 2VPPA 1RAEA 2WMYA 3TB4A 3KB8A 3F5SA 1E7MA 4A5OA 3K0EA 1GTZA 2R62A 2PYZA 4MRPA 2X2PA 4HZGA 4I1YA 1A9ZA 2REOA 3DAPA 1GGFA 1OX4B 4V0SA 1J21A 4JKYA 3W5VA 3LXMA 1V47A 2ATEA 2WWRA 3GD7A 3IOMA 3DF7A 2ZTVA 1UP4A 4MUYA 4D3FA 5FJIA 3RAEC 3I5YA 3QUQA 4FMDB 3MBKA 1U6KA 1M6VA 3DJFA 2ORWA 4MJ7A 4BMYA 1HE4A 2X1VA 1HDXA 3OZBA 3D1LA 3K2EA 4G37A 4Y6SA 3RJZA 3TH5A 1LD3A 5BV1A 2NZJA 5JOQA 4Q9KA 3OP1A 3WB0A 2R6JA 3G5AA 1WPGA 3HY4A 1T5IA 4OV6B 4Q24A 4YECA 3ZZ1A 1CR4A 4JJEA 5ALZA 5J47A 4Z4QA 3X2EA 2I1VB 1U8ZA 1U9IA 2J3QA 2V0NA 3PEUA 4FDAA 4UEKA 4FR5A 3ZXXA 4IX1A 1ZA2A 3ZD7A 2YTZA 2I2DA 5C0OE 4ZYUA 3AR2A 1KKUA 4HTFA 1AKNA 3C3XA 4J1TA 2GO7A 4UOZA 3HO1A 5B1YA 1T5BA 2ID7A 3KQLA 4DCGA 3JARB 4DLLA 2EJCA 4I5DA 3T54A 3VYWA 4IHAA 1K2WA 3V42A 3DFZA 1NVXQ 3ANTA 3F7MA 5KC8A 1B8VA 1W5AA 3B1VA 3X1JA 2HFJA 3DG9A 3LU1A 3NBYC 3SXJA 5JXIA 3TG2A 3D81A 3MD0A 2REBA 4WK0B 1JHDA 5BOSB 5BQOA 3HYTA 2QI9F 2WOJA 1Z6TA 4BO7A 4IIBA 3EMDA 5E4TA 5JZVA 2J6BA 3GLIA 3QW4B 4OGFA 1AN0A 2JFPA 2RCNA 3G2LA 4TMVA 1ORHA 4UCXA 3VJMA 1FMJA 3HABA 4K6KA 4PX5A 5I9IA 1QVVA 1P81A 4X3CA 4LMAA 3TAXA 1GXSA 5J1SB 3C6XA 4TLMB 3N2ZB 2ZIXB 4CF5A 2FPIA 3A1VA 3K2QA 4GKBA 2R97A 5LQDA 1NI4B 1L5WA 3HJNA 3MCZA 1L1EA 4L73A 3MINB 5LMNB 3OX3A 1H2WA 1KEWA 4H7HA 2RBGA 3G23A 3R5SA 1SPXA 1T9KA 3OLXA 4N8SA 4TQUS 2EERA 2V55B 2AKAB 3HCDA 5DLYA 5AM2A 1NAIA 1TAGA 5ARDA 5KSOA 1N77A 3MCAA 1U2ZA 2YXLA 4H1UA 2JJ2D 3MGCA 5JMPA 3UWDA 4E5SA 4INPA 1B1AA 2D0IA 1AK2A 2AF3C 2NZUG 4FCCA 1NXWA 5HCUA 5A7HA 3REOA 1G9SA 5BV0A 1O4VA 1T2EA 5KNDA 4DDTA 2PGIA 3BJZA 5EG5A 3A3OA 4FSXA 1T9GR 3IO5A 3TUIC 4LJ6A 5JSQA 4YROA 5J40A 5J2TB 2MINA 2JBWA 3ET5A 1UBRS 3RV3A 1R27A 2JDIA 4RFSA 1CUWA 2PGOA 2VUUA 4NXNB 1JFFB 2BEUB 4PRZA 3L6BA 1IOVA 4MIYA 1YASA 1QS0A 2ZQZA 3H97A 3KYDA 4W82A 4TS9A 7MHTA 2XYVA 1T1GA 2MSDB 3HA2A 2C0PA 4ZT4A 4KQFA 3GH1A 4ASUD 4UTNA 1GPJA 3DDUA 1HFWA 3KXKA 1F2TB 5ALGA 5D7BA 5I7WA 3JALA 1FQKA 4WLVA 3MJCA 2V9PA 1VFPA 2NN3C 3L1VA 1IWPB 1MFPA 1XELA 1A98A 3FYSA 3TX6A 3U7RA 3VX4A 4DMRA 1XVIA 2BPOA 3MS2A 4YLGA 3WLPA 4AP5A 5BNIA 2NSLA 3KP1A 2VDKB 4E6PA 4UU8A 4QUHA 3WGLA 4YRRA 3FGPA 3ZJ5A 1I7DA 1QHIA 1BQEA 1JYEA 4US1R 1SXGA 3GO4A 1S8NA 1DC7A 1K8XB 1TZJA 2HDWA 3D6NB 3I83A 1SHKA 4H3SA 1KO7A 4N7RA 5AHKA 1Y7HA 4JJ8A 2IVFA 5BN4B 1EFDN 2VR1A 4A8JA 1LPSA 3PX7A 2FPXA 4D96A 4KFCA 2VOJA 1Z7WA 2H92A 1D2EA 1KP2A 2OUKA 5A6VA 4BNFA 1FXWF 4RZQA 1I0LA 5KPDA 1C7EA 4DXAA 3DDHA 4UVIA 4CV3A 4KMRA 3UPUA 3IVXA 1IH8A 4C4AA 3K53A 3SJAA 1XNJA 2E49A 4WZAB 4LHZA 3A70A 4N82A 3W5CA 4LVNA 1TDJA 2JGIA 1IYZA 2SBTA 3KPJA 1ZKDA 1Y6QA 4IRXA 1JE0A 4IIDA 5I9SA 2PAFA 4U2CA 3RPEA 5EY5B 3BSWA 3P0RA 3IO3A 4PGFA 3OZDA 1NMYA 4XYEA 3UHPA 1F9AA 3JYHA 4OAPA 1KJ9A 4B47A 2HQOA 2VNIA 4M0DA 4DLWA 2FQXA 4LWZA 4EO4A 4ZRDA 4ZI2A 3NZEA 1OWNA 3RIHA 1KDYA 3FCAA 3VAZA 3ZLTA 3ZWMA 2XRFA 1POXA 1ZGBA 5JNTA 5DN9A 4D0LB 3PTLA 3ZW9A 3LO5A 2WUGA 4JBNA 4D8XA 1N8NA 3SLRA 4HEHA 3ER9A 3LBAA 3KPVA 1E6EA 1VKZA 5EE5B 1M66A 3OZWA 2ID4A 4ZALA 3VSAA 5C32A 3MTDA 4GOND 5AKEA 2CHFA 3E70C 1WLYA 3JSAA 3KPUA 4TRMA 3TIXB 4QT0A 5IT0A 1MVOA 4AIRA 3SYLA 3TQQA 1YA4A 2XDAA 2YOGA 3QMPA 4RSRA 3HJFA 1RI5A 1EFTA 2AUNA 3IILA 4X7RA 1W5FA 1WF3A 4ER0A 1A9SA 2FZCA 1WBJB 2PU7A 4G1MB 4NC9A 1FTQA 2VIIA 3DOFA 3R0ZA 3ZHTA 1NQOA 3NAZA 4V2UA 2VDWA 1BW9B 2W6QA 4M4SA 1J8DA 3C74A 4RTPA 3NHAA 1FL9A 1K68A 4XYLA 1MV5A 4CXMA 4F56A 2GYVA 3SZMA 1JL3A 3I8OA 4TWZA 1TIBA 5THXA 1Z22A 2RAVA 3WFIA 4QEZA 2HKIA 3A31A 3I8XA 4TXLA 4XYGA 1NPYA 2VRBA 3ESXA 4M2LA 4KPFC 3T06B 3MNFA 3U1VA 1O94D 2R8YA 3TTTA 2VTDA 4HNSA 4OHKA 1U63A 4I4CA 4ZKDA 5K3OA 4RSMA 4ARZA 2QD1A 3BXPA 2J85A 4LZWA 4PCUA 1JHAA 3CSUA 3NYIA 4Q7MB 1OTHA 4TYQA 1N3LA 2ECFA 1AHHA 1HE5A 3HJAA 3G5UA 3P9SA 1Z8DA 4G01B 4Y18A 5CA1F 4P9NA 3MVEA 1M67A 3LBNA 1GT91 2J3HA 2O3SA 2R11A 3II6X 5BN1A 4Q39A 2YMMA 4I08A 3JYOA 1UK8A 2ZJ1A 1TYDE 4DTCA 3MLEA 4FWBA 4QFBA 5ERYA 4YRMA 1KR2A 2CLOB 3A9TA 4Z4FA 3SX0A 2GB4A 4FINA 3EWSA 2P0YA 1ZITA 3G3EA 5E6UB 4I4LA 3T7KA 4FGLA 1IZ9A 1SCNE 3BGDA 5JD6A 1X0XA 4FYKA 3GDOA 3DTVD 1Z38A 3LGSA 5TPZD 1ILEA 4OI1A 1ISMA 1TVEA 3OWOA 5FWAA 2ZUFA 3C6YA 3LK6A 1AA6A 4IR7A 5PNTA 1PD0A 2XT6A 5AVSA 5JY6A 2FP4A 4G09A 2CXXA 3SXUA 5H59A 4UM8B 2JGAA 5TIIA 3I76A 4I9UA 1XNGA 1W85A 2WAYA 3UF0A 1QLWA 1GPLA 1T0UA 3D2LA 3MC1A 1ZSYA 3SC2A 4JK3A 3CX6A 5F33A 1OH6A 3KFVA 4U2KA 1UT6A 4EMBA 1R74A 3EUEA 3RLIA 1FMLA 1GSHA 1DLIA 1Y5RA 1C3EA 1ZIDA 2YFQA 2ZT5A 3DLCA 2XWPA 3OIDA 4FKMA 3IQDB 1P1CA 1RQGA 5AM4A 3RTGA 4MDYA 4DCPA 4WDQA 1Z37A 2Y2UA 4BKOA 1Z0AA 4BYGA 2CLDX 1KIFA 3ECSA 1B8NA 1ID1A 5KNDH 1QQAA 3OH8A 1KERA 1S89A 1V8FA 2NSHA 2UZIR 2ZSHA 3CG4A 4U0JA 2X76A 1DIOB 2E3JA 5IFKA 3S7TA 4AKGA 3Q10A 1ZN8A 2L2QA 1KXJA 3FLEA 2WV9A 1Q0RA 1QH8B 1JHOA 2ZXFA 3NTVA 3H4MA 2XMGA 4HNRA 1YRQA 3FVWA 4M0KA 3WL8A 2V6FA 1A8SA 3D6HA 3PHJA 3ANNA 2AUMA 1SKYE 3HCCA 1KEEB 1JIKA 2N46A 3G9ZA 4PHTA 3PTZA 3S68A 4UTRA 5JJKA 1M6WA 1YSCA 2IEIA 3DWGA 1M2KA 3CV3A 1DXHA 2QYOA 3OOSA 1UANA 3QWHA 1CZKA 4MNTA 4TN1A 1ULZA 1FFAA 2PAAA 2P0AA 1W52X 5HUJA 4I2VA 1Z2OX 1T6XA 3V80A 3UUWA 1N8SA 4BVGA 3DOEA 2OZLB 2GPBA 2WWIA 3NVAA 1BXKA 4KMMA 2VK8A 2VP3A 4AFNA 4EA8A 4EUKA 4ZMRA 2Z6QA 4AKHA 5DGIA 2C9OA 2NGRA 1JAIA 4XD7A 3WB1A 2VH2A 4DLZA 2IGTA 2HA7A 2PT6A 1FUKA 4YX9A 5IKOA 3W90A 2CY0A 4PNEA 1O03A 3CNOA 2VP5A 1V2HE 1P1JA 1D5WA 2B9EA 1V4BA 3BK7A 4M98A 4RJKA 2C83A 1I32A 2IGBA 4D9GA 5LXTA 2OG1A 3G7SA 1LC0A 2NWQA 2ZVDA 3FOBA 4B7UA 1C4XA 1OAKA 2A5YB 3V48A 3ENNA 4HC4A 3ZD9A 2QQFA 4HNQA 4MUAA 3MTJA 5BSTA 4A0QA 2HMYB 1U0HC 3CN9A 1OFGA 3JSXA 1NR5A 1RYDA 2BE7A 2CVOA 3VM6A 1NZFA 5E9JA 2BZ1A 3NWOA 4X1OA 1YTUA 4JLBA 2WK1A 4IWNA 5EMKA 2OBFA 4Q0MA 5BR4A 4YK7A 3DWEX 3WK4A 3DOJA 2E37A 1Z13A 2M6SA 1H8HA 1HT1E 3R0IA 2NG1A 3UJPA 3THXB 4KW7A 3FOWA 3HUEA 2QX6A 1G3UA 3LFHA 4G1FA 3G5MA 2HQBA 1OH7A 2ZRHA 3CLVA 1MV8A 5C5CA 3LNCA 3DQZA 3P4YA 3L04A 1IBSA 2NW6A 4TKVB 4CKCA 3DMPA 3VFDA 2I2WA 4KX5A 2GKSA 2B98A 3HVIA 2AN9A 1NN5A 4IIGA 3MUFA 2RARA 2IE8A 2EDCA 3ZE0B 4MRRA 1W4BA 4KQXA 2PS0A 3RASA 4UJ5A 1Z5GA 1Y3HA 2DT5A 3VOSA 4TN5A 3U9SA 3ZDZB 1QQ5A 2FYTA 5BP7A 1PX2A 3GQVA 4ZT5A 5HOEA 4W5RA 2WSMA 1QORA 3OIWA 1RJDA 2AJ8A 3WXMA 5AW6A 4AJ2A 1RMTA 3ZK9A 1E94E 3MJVA 3ZOKA 1CBUA 4JLPA 2QYSA 1FLVA 2G83A 3BXGA 3G8DA 1GLNA 4OBXA 3SJBA 4J1QA 4WPGA 2O7RA 4OQZA 2PMWB 3TBFA 4X7PA 4WH0A 4C2UA 1YZUA 1R10A 1E4EA 2DBZA 2PKQP 3QK7A 4WCFC 3QJ5A 3ZZMA 4E33A 2O50A 4NV0A 1ZEMA 4JBLA 1EUCA 4GWLA 2W4QA 4WEOA 4W5TA 1S01A 3W8NA 3QW2A 4UAJA 3O84A 4LSZA 1KVUA 1W46A 2V4UA 3ZDXB 1GAEO 4PF1A 3TE7A 2VT3A 2X7HA 3TD2A 3W8FA 3TSYA 2AG0A 4OK3A 4REQB 3LZ6A 4NCNA 3OI7A 3QOYA 7AT1A 4AY2A 1WCIB 1CQXA 2VYQA 4X94A 3CZPA 2A67A 1FFSA 1QIMA 4I4TF 5CURA 4CRWB 4LV5B 3ISJA 3U9TA 1KYWA 2JGKA 2XYPA 3BB3A 3CFYA 3PUKA 3QVOA 4YJHA 1J97A 2YY7A 2FE4A 5K0LA 1KI1A 5TGZA 4RK5A 3ORQA 5JYCA 5IDVA 5CG2A 3PR2B 3U5ZB 2RGNC 4X45A 3F46A 3VVCA 1SXJC 1JIJA 3W5BA 1EWQA 5HF9A 3GMIA 5CM8B 1KZ7B 1Y4ZA 2I3GA 2J6CA 2Q1WA 1Q6ZA 2H5JA 3WL7A 1Q0LA 1NBIA 3QF7A 4LQCA 4Z7OB 1E62A 2XBUA 3HB4X 4BKPA 2QRMA 5HJEA 1LF5A 1MOPA 2FUNB 2DQ4A 1A96A 1FX1A 1TUIA 1UJCA 2ZROA 3KG2A 1IOWA 4D3YA 1D5CA 5BVHA 1SXQA 2OYRA 1UXHA 4QM6A 4FYXA 4TSRA 5K2OA 3ODGA 4UCWA 1ZD1A 3DDZX 3I0MA 1Q84A 2XXAB 1QKKA 2GJAA 1RPZA 3F6CA 1KMNA 5IJWA 1ML4A 1P2SA 2YWBA 1OYOA 3I32A 5DXJA 4DT1A 1W1WA 1VQ1A 1E5VA 2N47A 3HZZA 3PQ8A 1QRRA 4GSKA 3V9PA 3TTYA 1J8VA 4C6RA 3HB0A 3EXHC 4EATA 2ZT6A 4HEQA 3FHCB 1RXWA 3OF3A 3M34A 3FUTA 2W2OA 2ZBVA 3CXRA 3KKQA 1KGDA 5AH0A 4XZ3A 2AFVA 4TKLA 3DMDA 5H16A 4R5MA 1XNHA 4DSTA 1AF7A 1MVLA 2CLSA 2WA1A 3ND8A 1O9BA 2HY7A 1P33A 4HQRA 3I12A 1QDUA 3DMGA 3UAZA 5KTRA 2HA3A 1G7CA 2J9XB 3PEYA 3FDIA 3A6DA 4FUQA 5DGTA 1NDHA 1TRHA 3BMNA 4N4AA 2JLUA 2OHHA 2ZYAA 2CF5A 5ADHA 2R6AA 4Z54A 4FEAA 2CDCA 3M2PA 3NFYA 4EI2A 2IUUA 4LGVA 1G21A 2EX0A 3DEAA 2COUA 4DNPA 5L3SA 1T2DA 4LXYA 4IDQA 3IHLA 1EDZA 1JKFA 3EGXA 3EN0A 3R77A 3I1IA 3BAZA 1YE5A 5IAGA 3ZNQA 2G28A 3ZDDA 2V7XA 3NBKA 1P31A 3LQYA 1MIOA 4MA0A 5EZSA 3U80A 4HR7A 3ZGLA 4YUAA 5JJBA 1BU5A 3TVTA 1TT5A