4LYHA

Crystal structure of small molecule vinylsulfonamide 9 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
163
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
molecule tags Signaling protein/inhibitor
source organism Homo sapiens
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
total genus 59
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lyhA00
5BYJA 4PQRA 4BLRA 3OFND 2YOGA 1KDPA 1UBCA 3EZFA 2A5GA 4PC6A 2DHRA 3A6PC 121PA 1TX4B 2GAOA 8OHMA 3NTUA 3NXSA 2O0JA 2A78A 4AYWA 1RW4A 3U60B 1Z06A 2X8AA 5CIQA 2F1HA 2WWGA 2QN6A 2RAPA 4RKFA 3SN6A 4LBZA 4DEXA 2A5DA 5CYPA 2WICA 1U2RA 1FTSA 2QMOA 3UMRA 2PZEA 2YVUA 4MUBA 4D81A 2ECKA 2NOAA 3W8NA 4KU4A 3EZ7A 1JEEA 3BORA 1JPNA 4C2TA 4JSYA 4KV9A 4YQFA 5C4GB 2CLDX 3GD7A 2AD1A 2QT0A 4CT5A 3K9NA 3B1YA 3VX3A 5JJLA 1SVMA 1KTVA 1XDBA 4HDQB 5FBVB 3SHFA 1OW3B 1E2MA 1RPZA 3LNCA 4C2UA 4Z51A 3DVLA 2IXEA 4XIGS 1GDDA 3GPLA 4ZCMA 1F2UB 1XRJA 4LOAA 1AS0A 3I92A 1YR9A 2O52A 1I4DD 1YZQA 1TEXA 4FMDF 2BMFA 2D2EA 1NN1A 2WKQA 2OFOA 5G53C 3TE6A 4Q18A 3TVTA 4DLVA 2GXAA 4GOJA 2BBWA 4D4MA 4DLSA 1P4SA 4O2LA 1VG8A 1Z6XA 2KBEA 3KL4A 1HE8B 5EUMA 3KUCA 1X8LA 2AKYA 2VLIA 5B30A 3EIHA 3KKPA 4WZAE 4FWTA 1KAOA 1RRFA 3VU9B 3RS4A 1TQ4A 4Q00A 4ZO4A 4R2IA 4KFUA 5KYKA 5K8TA 3P27A 4FW9A 1R8SA 2J0VA 2IYVA 3AKEA 4Q9JA 2FN4A 3AVTA 2QSYA 2HEIA 1P72A 3NG1A 1RJ9A 1F48A 1QF9A 1OKKD 4Q1CA 2ZRPA 3QKRB 3ZQJA 1SHZA 4MQBA 4ZDWA 3H86A 2R6GA 3CLVA 4DSUA 3Q3JB 1U9IC 4URXR 3GMTA 1WDTA 3PV0A 1U0LA 3L0SA 3L43A 4OQNA 3A1WA 4Q03A 3AVPA 3QG1A 1T0JB 2BJWA 4C0JA 2W83A 3KXIA 1YJ5A 2Q21A 2GK6A 1ZM9A 1XWIA 2VTKA 4DCTA 5JSZA 1W2GA 4OHYA 3N5CA 5KDDA 4RD3A 3C16C 5KSOA 1DS6A 1GL6A 2P2LA 1S3GA 1JEDA 1DG1G 2R62A 2ZUBA 4HLUA 4MRRA 5EE9A 1KO8A 1E2NA 3HYRA 3FHTA 4F91B 1DO0A 5CK5A 1XEXA 1OE0A 1OIWA 1VPLA 4EPWA 1DAFA 1L2TA 1UKEA 1OHHD 1FNNA 4YDHB 3RRZA 5CLQA 2DWOA 1U8YA 3Q7PA 3AVQA 5CJ2A 3ZZUA 1WF3A 1TQDA 3RVBA 2GKSA 1VHLA 2ATVA 3K9GA 4Q1DA 2R6AA 2WM9B 4YMUA 3BFXA 3U44A 3RLFA 5K8UA 2FA9A 1E2DA 1G7TA 1F2TA 4US2R 1S2MA 3D6TB 1L8QA 1AS3A 2GWHA 3EC1A 3RNLA 2HCJB 2QI9C 3T06B 621PA 2R65A 4NCKA 2EFEB 2OBNA 5KNBA 4KJZA 2PMDA 2B7BA 5G3ZA 1NMZA 1VIYA 2O8DB 2KB0A 4AURA 2GCPA 2AK2A 1OPXA 4QFMA 5JCPA 5L3SB 4CDGA 4A15A 1S9DA 2OESA 3SQWA 3ZD7A 1NJGA 1A4RA 4LYFA 1NF3A 2J0UA 2DFLA 3AP3A 1E79D 1E2EA 2ODNA 2FFAA 3P4YA 4M1KA 3GLIB 1W5SA 1ZRHA 1I4LD 5AJWA 2R6CA 1W2HA 3RSLA 1VYVA 2VHCA 1MO4A 3CNNA 1FFHA 4ZDKA 2GF9A 1DG3A 1DPFA 4V0LA 4ZPXA 2FFQA 4PANA 1CR0A 4KCGA 1KNQA 5DIFA 1D9ZA 2JIZD 2YWHA 2ZANA 4P4SB 1FUKA 1KK1A 3AGPA 2BMEA 2RB4A 3PVSA 3TNFA 5JRZA 5TV2A 1GKUB 1GRNA 4DSNA 2PX0A 1UAAA 3QJYA 1N6PA 3NHBA 421PA 4C7OA 1OT3A 2IYUA 5DN6D 2DB3A 2V55B 1ZJ6A 2QE7D 3GLFB 3DKVA 3QXJA 4LJ8A 2VP6A 3CPEA 2FPMA 4H9GA 4LK2A 4R7ZA 1GNPA 1L4YA 4PC2A 4RZ2A 3W34A 1XB2A 3GJXC 2JAQA 1VG0B 4TYNA 5EP1A 1CEEA 2FU5C 2VIIA 2Q6TA 3TQCA 4PQYA 4BWYA 2XITA 1E1RA 2X1VA 4RD4A 2WOOA 3PQCA 2P3SA 4JL6A 4F7WA 4K46A 4ACBA 1SHKA 2R2AA 3EX7C 1W48A 3IO5A 2WWXA 4II7A 1GM5A 4AI6A 2Z4RA 4DEYA 4W5WA 1J90A 3PUWA 3X1WA 1NLFA 1XJCA 3ADBA 1U94A 5P21A 5FBWB 2W6JA 2REOA 2XAUA 3V9PA 4CIDA 3GEHA 1SXJE 5FPYA 2GJ9A 3CF6R 2YYZA 3HPRA 3QKSA 1US8A 1XXHA 2JGNA 2QAGA 2OBMA 5FOWA 5GJBA 4Q9KA 2RGNC 4D4JA 3FKQA 4JVMA 1CF4A 1G3RA 2WAXA 3E5HA 4D0LB 2FX3A 1EGAA 4EQ6A 4BFXA 3EWAA 2QBYA 3ZVLA 2H92A 1VMAA 1CRPA 5DSZA 2IYZA 1VDZA 2V8OA 4PX9A 1NN3A 1XP8A 5J5CA 1N5IA 4M0LA 4LWZA 4KO8A 1ONBA 3HR8A 5AK0A 2A5FA 3A8TA 3PR1A 1WE2A 2F3TA 2AWOA 4F4CA 3DEFA 1A2KC 5FBQB 1CR4A 2ZYUX 3CB4A 4B35A 3MWJA 4GSYA 4DXAA 2XGJA 2N1BA 1IM2A 1OXSC 4A2WA 3H2YA 3SJBA 2ZR7A 2ZRIA 4G0NA 4HAYA 3I62A 5JEDA 2DBYA 4GPTA 2QT1A 3QG5A 5DLQC 4CEJB 1R7RA 4CEHA 4A36A 2XNDD 4ZDIA 1IHUA 2F3RA 1UJ2A 1KI8A 3CZPA 1P61B 4M1TA 2AX4A 4BRUA 4PZZA 5HKKA 1QDEA 2YWFA 4HUQB 3D3QA 4XWKA 1HV8A 2ZSAA 2WSSD 3O8DA 1P73A 5H70A 4Q4HA 4JBYA 2QAGB 2AHOA 4NMMA 1US8B 1XXHB 1ZC3A 3SR0A 2WJVA 5J4YA 1KIMA 2JCSA 3KXKA 1W49A 1IXZA 3QE0A 1ZD9A 2V1XA 2O8FB 1JR3A 3HJNA 1N0VC 1TU4A 3KDSE 4JYBA 2KJQA 3QF4B 3ZH9B 1MO5A 4MUAA 1U0JA 2ZU6A 2HJVA 4KBGA 1IY1A 1D8TA 5FOSA 3FYHA 1JBKA 3KZ1E 1ZCBA 4ACAA 4TZ0A 2C98A 1T8TA 1N25A 4US1R 3GLHE 2XB2A 2DYKA 3PJRA 2J7KA 2J41A 4RD1A 4CT4B 5FTLA 1GRQA 1ZUIA 4G3XA 4EKDA 2V3CC 4JJKA 2E87A 1PJRA 2ZRCA 3K0EA 3TAHA 2ONJA 4E03A 1TF2A 2JLRA 1VCNA 1QBKC 2N46A 4NBSA 1ZNXA 2VYFA 4OI4A 4B3FX 3VNVA 4MKHA 4NP6A 1V5WA 4DRZA 1BOFA 2IK8A 1J8MF 4FXPA 4C7OB 3NVAA 2ZJBA 2AFHE 1AN0A 2H16A 1G5RA 2KE5A 3QUSA 3WMEA 2HUPA 1FQJA 1NBME 4P32A 3KKMA 2CMKA 1M2OB 3KB2A 3CRMA 4Q4AB 4G5QA 2VP4A 4HAUA 4LRWA 1DELA 2ODBA 3GEEA 4F93B 4Q1FA 4U02A 2ZRLA 3DDCA 3CH4B 3QXHA 4E22A 4NYJR 5B2ZA 2C9OA 2QP9X 5JRJA 3NBXX 2H1LA 2CXXA 4XSHA 1OFHA 3AB3A 2Q9CA 2EU8A 1NL3A 4D0NA 2YC4C 2IBMA 4NTZA 2GESA 1EX6A 2OFWA 4BLSA 4MDFA 1LB1B 2O8CA 3L2OB 4HAXA 1OV4A 1DARA 1MRNA 4V0NA 4XD7D 1H8HD 4ESVA 3I1FA 4GT1A 2IUSA 4PPGA 2ZE8A 2ZITA 3FTQA 2E1RA 2P5SA 3R9IA 4ARZA 4IHQA 3TK1A 4AYXA 4DLTA 3HYTA 4G5RA 4KLNA 3T12A 4JZKA 3ZIAA 4NYIQ 5E7JA 4LGMA 3A37A 1R0YA 1T5LA 4BFWA 1X8JA 3WHKA 1OKKA 2AKAB 1FOEB 4QJ3A 1AS2A 2ZU0C 1Z63A 3PITA 5EUQB 1G3MA 4B3GA 2QMEA 2XNDA 221PA 1Z6GA 5FUWA 3QENA 2WBLC 1NG1A 2ZRBA 3OE7D 3SNHA 3SS8A 2ZYVX 2WIBA 4DLZA 1E2PA 2FPLA 2FGKA 4TMWA 1MR3F 1SVOA 3AF4A 2OLJA 2LKDA 1OH8A 1KK2A 2G83A 4ZI2A 3DO6A 3KKNA 4I4LA 3CX6A 4LYHA 1OH6A 5EP3A 5JCZA 5SZJA 2C2HA 3K0FA 4ON9A 4WBSA 5E4FA 1E32A 2FGJA 1OIVA 4XOIA 5BN5A 2A5YB 5CB8A 1W46A 2YINC 3CM0A 1TEVA 2YWGA 1DAKA 1O87A 2PT5A 4GNKA 3SYKA 4TTPA 4PO9A 2XOKD 3RWMB 4M8NE 3U5ZB 4URZR 2Y8EA 1RC8A 5TY0A 3B2EA 4WIAA 3H4MA 2YWEA 3FHOA 3R8FA 5H8WA 4I81A 1VG9B 2F9LA 4POAA 1YVDA 5E7IA 4EPTA 4PPQA 4X8OA 2MSDB 3RC3A 3ZS8A 1A2BA 1HA3A 1L4UA 2FH5B 3I4LA 3OIWA 2Z43A 4KODA 4Y0VA 3TR0A 3SOPA 5HE8A 2YOFA 1OFTA 2GAAA 2YHSA 3H0KA 3BB1A 2IWRA 3MMPA 1XTSA 3ZVNA 5KHOC 3M0EA 3VQTA 3NKVA 3IQXA 5LB4A 3VR2A 3OAAD 4Q48A 1NLYA 2GJSA 4PC1A 1MH1A 3KKQA 4GMXA 4KI0A 3NIBA 1T91A 4I99A 3SZRA 1FTNA 1DE0A 2PJZA 1KI2A 2A2ZA 3UANA 3IHLA 3IUYA 2OG2A 3QVUA 1KSHA 4RFSB 4TMVA 5SZKB 4B2LA 3GFOA 3SEAA 1N5JA 1B0UA 2A5JA 4A6PA 1F6BA 4PPFA 2BHRA 3NH9A 3ZIAD 5DGXA 4LYJA 1QG2A 1IY2A 1ZBDA 4IOMA 2DWQA 3UG7A 3B5JA 1I2DA 1GL7A 4RFSA 1E2KA 2WWWA 5JWOA 1FMLA 1KI1A 1IN7A 1EFRA 2ZS8A 3FMPB 3L82B 3QEOA 5FH9A 4C4PA 3EIEA 2Z0MA 1LTQA 5FPKA 2EFGA 1KSGA 1FPMA 3X1DA 2VP0A 4TL9A 4CZ2A 3GLGE 3B60A 3RANA 3GP8A 5JJKA 3KQKA 5JS8A 3CF2A 2LKCA 2E9SA 2R8RA 2VSFA 2D62A 5F3WB 2IYRA 2GVDC 4P4UA 2CL6X 4WXPA 1PZNA 5EE5B 2QTVB 4IW3B 2W58A 3SJZA 4B6EA 2WJJA 2IS6A 3BFVA 4ASUD 5EP2A 5CM8B 4R9UC 5FOVA 5EZ5A 3AH8A 4PSKA 3U3JA 1Z0JA 1JNYA 1AGPA 2LCFA 4G5GA 1PV4A 3DL0A 2JJ1D 1QHYA 2EWVA 3K0CC 3UMSA 3AUYA 5JLJA 2MMCA 1W0JD 1N6OA 2VPPA 2JDIA 2PX3A 2ZETA 3O8BA 4IDNA 3ICEA 1KI6A 2IYTA 2QSZA 5CIWA 3D31A 4EJSA 1WP9A 5HZKA 1U8AA 1YKSA 4IXMA 1J2JA 1HYQA 2X19A 4URVR 4Q19A 2L0XA 2DR3A 2C99A 1E9RA 1I4TD 4ILEA 2JLUA 2ORWA 4UXIA 3EZ6A 3TUIC 3ZD6A 2O0HA 2FE4A 2FFBA 4KSCA 4TLCA 3BOSA 3THXA 4IVQA 3B1VA 2BEJA 3X1ZA 2B8WA 2ZJAA 3ADDA 2RGXA 2VHTA 4LHXA 3GFPA 4KITB 4X8LA 4MKFA 3ZYCA 2OCPA 5DN6A 3ZQ6A 1ZYUA 1WMSA 3CRQA 1CJMA 1Q21A 3MLEA 3AKCA 4JS0A 4LPSA 4BLTA 4QGHA 2F55A 2ODWA 3TW4A 2P6RA 3RS7A 2ZSBA 2FWRA 3CONA 2HT1A 3TJZA 3IIJA 3T1OA 3B1WA 1YRBA 1E6CA 3CPHA 4B3DA 1XU4A 4OQMA 1MRSA 3EASA 2QPOA 3IO3A 2ZAOA 3K0FB 1ZP6A 4FN5A 4TQAA 2BCJQ 1E1RD 4Q02A 5L3VA 1R5BA 2BCGY 2ZEJA 5FTMA 3TSZA 3T61A 1E9AA 2OM2A 2MSEB 3MRSA 5HKKD 3P20A 4Q9IA 1Q12A 2VP5A 4YDSA 3ZVRA 4QNMA 4GZMA 4AG5A 3RS3A 2I1QA 3VX4A 3H84A 1YR7A 2P0EA 3T15A 1E2HA 1KI3A 5EZ6B 4XWOA 5TXGA 5DYIA 2QU8A 4ZV4A 1KZ7B 5KU1A 4JLOA 4ERNA 4N1AA 3LD9A 4RD2A 2FSIA 3GLHA 4UKDA 2HCBA 1SZPA 4WZ6A 5GJVC 1G16A 4E09A 1YZKA 5LPNA 2NO9A 4KBFA 4KVAA 4YMVA 1DAEA 3MWLA 3EPHA 1D2EA 3EA5A 1ZU4A 4PHTA 1T6NA 4OYHA 1UF9A 1M74A 2IF2A 3V4RA 3KXLA 2QL6A 2XZLA 3PFIA 2ZRAA 5IK2A 1TF7A 1Q22A 1QHHA 4P31A 2JA1A 1OB2A 1M7BA 2FOLA 1WRBA 2Z83A 3KUDA 4BZPA 4W7SA 3W3AA 1W0KD 4HLDA 1P3JA 3SI7A 4OL0A 5KUTA 1ZM3A 1RYHA 2YJTD 3MD0A 4QOSA 4H1VA 2OO7A 1Q1QA 2Q3MA 4PAMA 4Q7KA 1E4YA 4B2IA 5IDVA 2RGAA 1ZW6A 2JJ2D 2A9KA 3SJCA 2RGGA 4C0QC 3EZ2A 2V54A 3UKDA 4LYAA 2XTMA 5LBIA 4QBIA 2HF9A 5KOYA 1GL9B 1LW7A 5L3QA 4C0AC 3SQXA 3CR7A 1R0XA 2WPDD 5DI3B 4RZUA 1CS4C 3HP1A 4JLPA 4J0QA 2BMJA 1E2JA 1S1CA 2ZYWX 3SYNA 1JJVA 4AKHA 3QKTA 2ZQ5A 4LHVA 5JECA 5FBRB 4TYPA 1Z83A 1RE0A 2WSSA 3ASZA 3GEIA 2W2TA 5UKDA 2QE7A 2ASEA 2J87A 1ETUA 4MRSA 4UNQA 3RRMA 2C04A 2WKRA 5E7MA 5BWMA 4WA7A 4WVFA 3J81k 1E2LA 4NE2A 2VHJA 2NGRA 4QKQA 4D80A 1H8EA 4QL3A 1KGDA 2GJKA 5C2JB 3C4JA 1OFUX 2XTZA 4EFNA 2P6NA 3FFBA 2QUZA 1Q0UA 4URYR 4NH0A 4QBGB 4Q7LA 1JPJA 1KOFA 1NP6A 3R7WB 1EG7A 5J4LA 1CR1A 2W2VA 3VAAA 4I1OA 3ZDQA 3KJGA 1R4AA 3TIFA 1EWRA 3FDIA 4W5HA 2WWHA 3LX5A 1KSJA 2D3WA 2EW1A 2JASA 1KI4A 2JATA 2WAYA 5DHAA 5DI9A 3ZZTA 1TTTA 1MABA 4ZIRA 2G6BA 1Z29A 3AUXA 4TWZA 1VYTA 1ZVQA 3T1QA 1N6IA 1YQTA 2JDID 2F43B 2GJAA 3ONWA 4L9SA 4N0EA 1X1RA 3LBHA 4LJ7A 3U7FB 4QM7A 1LF0A 2I1VB 3UXMA 1FUUA 1NJFA 1KO1A 3CBQA 4V02A 3L0OA 4GMDA 1KMHA 3P32A 2QBYB 4DIEA 1AQUA 3QXXA 2BIFA 4EQ6B 2TMKA 3VTKA 1M6NA 2EFDB 1IAQA 3AVYA 3NEYA 1KHTA 2GK7A 3NH6A 5G40A 4UXHA 4LC1A 1ZD8A 4LPKA 1N5LA 4HB2A 1N6HA 3BXZA 2OAQ1 1UEJA 2F43A 2MSCB 2V4ZA 2B92A 4ZIRB 2GXUA 5L8VA 1E9FA 1E9EA 1J70A 1XMSA 2HXYA 3LV8A 2A3RA 1LFDB 5DO9A 1SKYE 4XTRA 1YR6A 1P2SA 2RMKA 1D2MA 4R2HA 2GXQA 4PPNA 4XVQA 3R7WA 2CK3D 3W5JA 3EPJA 1JB1A 3C5CA 4AKEA 1M7HA 1Z5ZA 1II9A 1ZUHA 1OXUA 4ITRC 5C4MA 3SJAA 1ESMA 4FMCF 4M1MA 4PFSA 5DISB 3A36A 2FMXA 1WXQA 2ZJ8A 4RKEA 1OHHA 2OV2A 3WRXC 2GBLA 4MRPA 2QQEA 2B8TA 3FGNA 3PEVA 4G5OA 4GL2A 4R98A 1XF9A 2WV9A 2PBRA 3FE2A 3LAWA 2WMOB 4D2IA 1JR6A 2Q3FA 3OZXA 3U7HB 2P65A 2CE2X 2ZSEA 3NWJA 3THOA 1BYIA 4V03A 3UIEA 1QG4A 1JR3E 1XTKA 4OHXA 1ANKA 4DLUA 4W5JA 4Q1EA 4P4SA 3UWKA 1G17A 3O8CA 4LHWA 1NKSA 1YRAA 5DNYB 2DFTA 2CCJA 1Z0DA 2ZJZA 1W4BA 1SULA 1YR8A 5A4JA 1E2FA 3BK7A 5EP4A 5B64A 2ANBA 4LBVA 4M9SA 3WXMA 4L15A 3IHWA 4HEJA 5SZIA 4HZUA 3C41J 4TLEA 1HH4A 2REBA 3P1JA 4JJZA 3BWDD 5B57C 4B44A 1G64A 3CRVA 4MYTA 4TN1A 4EAQA 3GLFE 2J0UB 4C0BA 1Q3HA 1ZNYA 4CEHB 4IOKA 2QM8A 4W9MC 2JLQA 1K5GA 2IS1A 3SBEA 2XSZD 2ZRNA 3WYGA 2PEZA 4A0FA 1GNQA 1MABB 2BEKA 4JBXA 1AM4D 1OYYA 1UKYA 4GP6A 2W6ID 3A58B 2JJ2A 3EXAA 2GCNA 1JXOA 2HLDD 2WJHA 4F92B 1NIJA 3LH5A 1GKYA 1I2MA 2V7QD 2CE7A 4YMSA 3V00A 4HYYA 5JJIA 4Z8XA 4TMXA 2RGCA 4ZI3A 3LQRA 1KJYA 2F1RA 1IJEA 1C9KA 1X86B 2DWPA 2OUKA 1XTQA 1ZM2A 3W3ZB 3GCGA 2A7QA 3W6PA 3B78A 3KFVA 3KQUA 3QQ5A 1IXRC 4TQ9A 2ZXUA 1AKEA 5GJWC 1VTKA 3RS0A 1N6RA 1Z0FA 2PCJA 4EPXA 1KI7A 4JIMA 1KKLA 2QG6A 1MV5A 1XCGB 3VR1A 1D2NA 3QIAA 3TRFA 2QRNA 2XZOA 3F5FA 5FPHA 4KVGA 3WYAA 2NG1A 1G4UR 2O5VA 1SQ5A 1CJUC 4YC7A 3G82C 4BFSA 4A1FA 1KMQA 2IUUA 3MSXA 3WP1B 2ZJYA 4JMPA 1HQCA 4FIDA 2C03A 1P2VA 2LWIA 2VEDA 5DI3A 3AM1A 1M7GA 4LJ4A 5L3QB 2CHQA 1NSFA 4QGGA 4QJ4A 1G3IA 1DVRA 2PZFA 4A6XA 4B47A 3VNUA 1W4AA 5IF9A 4B34A 4AK9A 3HU1A 1Z07A 2YOHA 4LV6A 2HYDA 1W5TA 4OHVA 1G7CA 1GG2A 2CJWA 2QM7A 1OJLA 3TUZC 2QAGC 3MUFA 1R2QA 3OEHD 4IOLA 1KSFX 2FNAA 1Z2CA 1TQ2A 1W47A 4RSGA 4MGZR 2EYQA 4K8OA 1QHHB 3GLFA 1KK3A 1F5NA 4AY2A 4QGAA 1EX7A 1LS6A 5FBLB 3QSYA 3R9WA 1IJFA 5TARA 5ANRB 1T8UA 1YZNA 2XX3A 3U2QA 4IJMA 2V7QA 3GJ4A 1BYUA 1G20E 1NY6A 4PSVA 1YZTA 3W90A 3MJRA 3QEJA 3GLHB 4CRWB 4A0HA 5JSZB 3B85A 4TYQA 1KJZA 3E70C 2XOKA 1CJTC 4MH0R 2YNMA 4NKRA 2RGEA 4FD2A 2KI5A 3TSWA 4B76A 2ZIAA 1W4CA 4LHYA 4LJAA 1VCIA 3WBKA 3OF5A 5HPYB 5M04A 3BJIC 2ZSFA 1NLZA 4HB3A 2QEQA 4NZYA 4G01B 2CLSA 1FMJA 4B2PA 2IWHA 3LRPA 2Z4SA 3QKRA 4US0R 2ZI9A 4LC0A 1EFTA 5L3SA 1CP2A 1UBFA 2JJ8A 2OXRA 2FV8A 3I3SR 4Q21A 2IC5A 3LLUA 3AVVA 2C78A 2QORA 4LZZA 2OCAA 1S1MA 3CPJB 3TH5A 3GLIE 2IEZA 5EQTA 1W1WA 4CGZA 1XMIA 5AUPB 3BBPA 3VU9A 2UZ3A 1N6LA 4DCUA 1GZSA 3PUYA 3K53A 5KPJA 2AXPA 2FEOA 1H8ED 5FOUA 1V43A 3B13B 4FI3C 4PC3A 3R8CA 4A2PA 3U44B 1N6KA 2GNOA 1UPTA 2FSHA 3THXB 1FP6A 1FQKA 3X2SA 4D82A 3TGPA 3DMDA 4UNNA 4JT2A 4NHOA 4XVRA 3K0SA 4KSBA 1GITA 3WNCA 1GRRA 1NMXA 4V0ME 1XZPA 2OLKA 3Q5DA 4L5BA 3I73A 5KSZA 1P62B 1DTSA 2G0NA 4OKSA 4ESHA 1W7AA 4EJSB 1VECA 3ZS9A 3DOFA 5TB5A 4O25A 2VH5R 1P9NA 1E79A 4AYTA 1SVIA 1JJ7A 3ADKA 4N3NA 4WAUA 5AJYA 1NSTA 2KWIA 6Q21A 1S4QA 2G9NA 1LV7A 1Y3AA 3RC8A 2QGNA 5GVRA 1EFCA 4DHEA 2WWFA 1UM8A 2WZQA 2IUTA 2YKGA 4QBHA 4UNSA 3VKHA 3AVXA 1Z28A 5BN3A 1FNMA 3PEUA 2RCNA 3AF1A 4QHSA 3BERA 4GOXA 1SKYB 4TL7A 2BBOA 1AK2A 4IKEA 4KFTA 5IK2D 2OE2A 3RWOA 3T34A 1XPUA 2J1LA 4B71A 1RRCA 1S3SA 3IDQA 4P0TA 1AGRA 4NYJQ 2CCKA 5IHPA 1T3LA 3EIQA 1N0UA 2FFHA 4URWR 4A8JB 4C0HA 3TMKA 2CL0X 4BE7B 4BFVA 4UQOA 1MO6A 2X77A 3PUXA 5FFMA 2ZRMA 1JECA 5KSPA 3K0AA 3ZLJA 1KDRA 3K09C 2AK3A 1X8KA 2R6FA 5KPDA 2AFIE 3MCAA 1UFQA 4Q1BA 4TLDA 2ZS9A 5CDFE 2IXFA 2OBLA 2NZ8A 5F9HA 4YLGA 1JR3D 3PEWA 2AR7A 1OLOA 3DZDA 2BVNA 4O3MA 5JEEA 4Q4JA 4PAQA 4A8JC 3O8RA 2GBLC 5AUQA 2IX3A 1N2CE 3FKSA 3BIFA 5D3QA 4Q7JB 2HDNB 5AJZA 2GILA 1EFRD 1E1QD 1K5DA 5G41A 2GVZC 1IQPA 1G18A 4DWJA 1NRJB 5KNCA 1AJEA 4QHYA 2WWYA 1XCPA 1A5TA 4C0LA 1Z8FA 4LUCA 3NEJA 4ZCLA 5BXQC 821PA 1A1VA 4FCTA 3PIRA 2G1KA 4NCNA 1UDWA 1CTQA 3LA6A 3WNDA 1GWNA 3CW2A 5JWRA 4RVCA 4FMCB 4BFYA 1S8FA 1JI0A 3IBGA 3UG6A 2BJVA 4EPVA 3PXGA 1LY1A 2QROA 1KYIA 1NNEA 4NYMQ 4EFMA 3U3MA 2XZPA 2PCLA 1W36B 4TQUS 3BRWD 2B6HA 721PA 2G3YA 2CEAA 1UKVY 3DM9B 2ZRFA 1LVGA 1P6XA 2ZI5A 4MYCA 4A0RA 1ZC4A 2WVJA 1U81A 4XJXA 4IVPA 4DKXA 1XZQA 2RGNA 1LS1A 1T9HA 4DLXA 2F1IA 4KFSA 3DMNA 4LBYA 1U9IA 3NC1C 4L16A 3CR8A 3P26A 4BEBA 3F3YA 5KTYA 2OILA 1ELOA 1HQYE 2FSGA 1Z6AA 4JVSB 3BGWA 1TF5A 2NO6A 1X3SA 4TMTA 1WQ1R 4IDHA 3S1AA 4TT3A 4GOKA 1QVAA 2AWNA 3SHWA 4YXWA 2Q9BA 1KO4A 4JVLA 4Z54A 4IDPA 2H5EA 5FI0B 1IY0A 5HE9A 1KJWA 2ZE6A 3CX7A 4OK5A 2OZEA 2ZE5A 1G41A 1HUQA 2ZR0A 3VR3A 4JLKA 2QAJA 1UEIA 3W5IA 1R8QA 3REFA 4B73A 4DB4A 1YZUA 1AZSC 1ZM4A 2MMGA 4OK6A 1R0ZA 1XEWX 1X6VA 2QRZA 4QBFA 1J7KA 3BS4A 3JVUA 3FPAA 3U7EB 4DDVA 4QC2A 3UPUA 3SYLA 5LDDC 1JAHA 1SKQA 5CM9C 4DJTA 2ZREA 3VR6A 5C18A 2O8FA 3G0HA 1NIPA 5JBQA 4ZCIA 2XB4A 4NL4H 3A4MA 3B82A 5KDLA 1EESA 3EA0A 2WTUA 1TUIA 1M34E 3KJEA 4CF7A 2QPTA 3KQHA 4NYIR 4OI1A 4D6PA 3AP1A 4M4SA 3Q9LA 2VRWA 4EJSC 3VKGA 2GJ8A 2NIPA 5SZHB 1G9XA 4M21A 4OBEA 2F6RA 5FTJA 4JL8A 5J4KA 3BFKA 1FX0A 4PZYA 3B7GA 4GRAA 1FP7A 1ZINA 3T5GA 3GLGA 1WB9A 4MGYR 5AWFC 2JLVA 4D4KA 1E1QA 3VKWA 2Q3HA 1PLLA 3Q5EA 4ARZB 2P67A 4A9AA 3D8BA 2HT6A 1KAGA 4YMTA 2WJGA 3UATA 3AF3A 4U00A 4RZ3A 2NTYC 2PT7A 2CLCX 4TT3D 5CLLA 4Q01A 2V6JA 4HLUC 4EIWA 1RVDA 4P33A 2HJGA 4KAXA 2O8CB 1IN5A 2ZRJA 4JLJA 1OXXK 2PZGA 1SVLA 2KSQA 3K1JA 3K9HA 3TUJC 1E9DA 3I8XA 1Q3TA 1T4GA 1NMYA 3C7KA 5FTNA 3CH5A 5IRCD 2ZM5A 2J5XA 3B6EA 3T5DA 1PVOA 2XXAB 4QHTA 5JHGB 1EFHA 2WHXA 5K8IA 1XD2B 4Y0AA 3AKDA 4HI0E 4Z8YA 4Q47A 4OI2A 5E95A 4QNRA 1Z08A 3OEED 3QKSB 4RCYA 3U3RA 1Z6TA 5GVSA 1G291 1Z6YA 4FMBB 4K81B 1OIXA 4XTCS 4Z1MD 1L7VC 3CX8A 2FEMA 3P4XA 3QF4A 3DKPA 1YHNA 1EWQA 3CWZA 4RD0A 1KY2A 5F2EA 3THWB 4QM6A 2ZVPX 3IPXA 1Y63A 3GJ8A 2ZAMA 4OJKA 4Q4HB 1TAGA 2QTFA 3R9XA 4BECA 3THWA 2IS2A 4NDZA 4HLQB 4DBLC 3MGCA 4MGKR 4G5SA 4QRHA 2WWIA 3VMFA 4U7DA 3NBZC 1T0HB 4A82A 3L8ZA 3CO5A 2VSXA 3FVQA 4RD6A 4PO1A 2VQSA 4CEJA 4LJ9A 3OE7A 5HCIA 2J9RA 1E3MA 1SXJD 5JS7A 5EE3A 2XXAA 1DBSA 4E07A 3LW8A 2ZROA 2OT3B 1FL9A 3FB4A 3UK6A 3X1XA 3HDTA 2IA5A 1XMJA 2JEOA 3VR4A 2ZYTX 4GZLA 4RCZA 2QY9A 1P9WA 5HCNA 1BIFA 2NMVA 2KBFA 2ONKA 2QQ0A 4JL5A 1J99A 5H1YA 3OIUA 4UNRA 2Z6VA 2OAP1 1U0HC 3PUZA 3OEHA 4PQFA 1TPZA 2F1JA 2EWWA 5F98A 1T3HA 3TLXA 1E99A 3FOZA 1NVVR 2H57A 3RS2A 1E0SA 4M1SA 2OSBA 4PC7A 1B23P 3ZVMA 5D3MB 1RYFA 4UJ5A 1FX0B 4M9ZA 4HUQA 3TSOA 1WA5A 3CRW1 3OAAA 1WCV1 1YU9A 4UNPA 1KMHB 1RZ3A 1TMKA 3LBIA 1NKTA 2FSFA 3K0CA 2WMNB 4JLVA 3A1SA 1E2GA 1CXZA 2WOJA 1Z3IX 2VSOA 3CNOA 2IYXA 3M6AA 3CF0A 2PMKA 2FPKA 3IQWA 4ZKDA 1VYUA 2JLYA 1DADA 3MFYA 2QPAA 1DO2A 4IFEA 3AVWA 1G4AE 4N0DA 2W0SA 2IYQA 3AGQA 2QMHA 1CJVC 1KZGB 1Q1EA 4EDHA 1GVNB 1XXHE 5EXTA 1XCMA 2P6UA 4QJ5A 4TSFA 4XVUA 1UDXA 3CKLA 3KJHA 2C9CA 4Q1AA 1ZIPA 5LD2C 2G77B 4BZQA 4DCVA 2V1UA 3L8YA 3PEYA 1D5CA 1ZNZA 5FL7A 4OHZA 4LHZA 2CBZA 5DH9A 3EG5A 1OF1A 1F3OA 1GTVA 2EYUA 5EXPA 2VA8A 2R6DA 1KK0A 3WMFA 4WW0A 4P3YA 3VHLB 2W6JD 4DUGA 5ELXA 1SVSA 1G3UA 4KFRA 4MRNA 3ZGXA 4MYHA 1Q1ZA 1NY5A 2PLFA 3D7MA 4MKIA 4NCIA 5FTKA 3ZJYA 4E5UA 3S1AB 3AVOA 1G8YA 1Q20A 3RRNA 4DCNA 2IYWA 1CULC 1CU1A 3IIMA 3KKOA 4BLQA 4FCVA 4IRUB 2IF0A 4A92A 3F8TA 3HU3A 4B74A 1BKDR 3KX2A 1HEIA 1HURA 5G3YA 5KNDA 1RRGA 4LX0A 2GF0A 1E0KA 1XPRA 5JFGA 2ATXA 2OFXA 3BD9A 3LQQA 1YZGA 1XTRA 4WOPA 4XWAA 1H8HA 2QGZA 2ANCA 1II8A 2FF7A 2ZUDA 2ZR9A 3IIKA 3PG5A 2XNSA 1RJ9B 1N5KA 1NVWQ 5BYKA 2O8DA 5KSYA 2YC2C 4RJLA 4B6FA 1SXJB 2IYSA 3N70A 3AKYA 4BGDA 3HWSA 3VHXA 2UZIR 2W0MA 3LW7A 4MA4A 2EFCB 3W9YA 1W0JA 1QHGA 4B32A 3IILA 2Q0HA 3QKUA 4GBMA 2ERXA 3WNBA 1RKBA 1E69A 3BB4A 1F2TB 3QPVA 3T1VA 4PXAA 2BOVA 3FKSD 2XEXA 2EVWX 4DSOA 4MGIR 4BQSA 4Q5IA 1D6JA 4KYIB 5JMTA 4AIIA 2BKUA 2QENA 1KY3A 5TMPA 2BV3A 2QP3A 3W6NA 3REGA 1H65A 2VBCA 1GIAA 1Q44A 2VHUA 1XEXB 3A4NA 1KNXA 3G5UA 2VP2A 1F2UA 1QRAA 3ICQB 1PUJA 2RGDA 4BUJA 4MRVA 2IS4A 4LY6A 1S96A 2G0TA 4IOJA 4GP7A 1MKYA 4X8HA 4M1WA 4I1VA 2P5TB 3K0AB 3O47A 1NN0A 3DPUA 3WBJA 3BH0A 2ZE7A 3QBTA 3E1SA 4F4JA 1G5TA 2GCOA 3RDPA 3TQFA 4TTQA 2NPFA 1ODFA 2WIAA 3EPLA 2O8EA 1OB5A 2O8BA 3M4YA 3CWQA 3RSOA 4LJ6A 4EPRA 5CYOA 2OCBA 5E3HA 3FMOB 5CJPA 3U6BA 1PUIA 1X1SA 4JLAA 3AQ4A 1M8PA 1G8FA 3ASYA 3TR5A 1XPOA 1DAMA 5HR5A 1XTIA 2JLSA 2UVQA 5K8LA 4DIDA 5DHFA 2H18A 3I5YA 5TDHA 4ZDJA 1EK0A 4CW7A 2ZTSA 5C46F 3FWYA 1G1MA 2SHKA 3AF0A 3FMIA 3LBNA 4C0KA 4DT1B 3DOEA 2PJRA 4HATA 4FWIB 1E9SA 4HLCA 1U90A 4XD7A 4U5XA 1CR2A 2VF7A 4PR0A 2NQ2C 5FOTA 2O8BB 1KI6B 4JLBA 4FCWA 2C9YA 4L8GA 2RGBA 3JZAA 1QHXA 4DLWA 1TL7C 1E98A 2OXCA 1TADA 4JKIA 4PAOA 4AKGA 3GQBA 1KKMA 1E2QA 2H17A 4D4LA 3LX8A 2GZAA 4JLMA 2J46A 3I32A 2GEVA 4F4IA 3AEZA 4IXNA 2CNWD 2UKDA 2GTPA 1QHNA 2C5LA 3U4QB 1XNJA 2D06A 4DT1A 4TLAA 4BLPA 2ZJOA 5EXSA 2BM1A 3CUEF 3LVQE 4TYWA 1XEFA 4DLYA 2DPXA 2D7DA 4ABYA 3PCRB 5H68A 1XD8A 2VHQA 2J7PD 3THYA 4BRWA 1GSIA 5FPTA 2R44A 1HT2E 2J59A 2C77A 4HDCA 1ZD1A 2QP4A 3SFZA 5AJVB 1S9HA 3OIVA 4S2EA 2W2XA 1OYWA 3QF7A 2HF8A 4C9BA 3NC0C 2ZUCA 3Q85A 5FR1A 4ASUA 2BMDA 4AWXA 4LSGA 5A0FA 2GHIA 4NYMR 3THYB 4M1YA 5JWHA 3IBYA 4RFVA 1ZM7A 1R5OA 4A0GA 4URUR 1G8GA 2ZI7A 2IHYA 3LFUA 4H1UA 2GETA 4KLZA 1Z0AA 3HPQA 5GJCA 5KO2A 2ORIA 4C0SA 2FDCA 1OH7A 5IT5A 1E4VA 3A1UA 3U4QA 1XTJA 3BH6A 2V9PA 2AN9A 4LI0A 1UBEA 2ORVA 3DHWC 1R0WA 1RRPA 4TLBA 2HXSA 4DDUA 5FL3A 3BH7A 1IBRA 1BMFD 1YE8A 1Z0IA 3QXSA 3UMFA 2BM0A 3W8RA 5GADl 3U3KA 3HR7A 2BC9A 3Q8XB 4C30A 4LV5B 1QHSA 2JLXA 5FOXA 1VCOA 1CJKC 2RHMA 3X1YA 2Z5FA 2NO0A 1OH5A 2IL1A 2VF8A 4PSAA 2OCYC 1MT0A 5TVKA 3QVVA 1TUEA 2BBTA 1LF5A 3SFVA 1CRQA 3N2IA 4CVNA 1JQLB 1CKEA 4YONB 2ERYA 2B7CA 3EAQA 1NN5A 3VR5A 4PHHA 3B9QA 1A82A 1BH2A 1ZIOA 3U61B 2DFKB 1IN8A 4UJ3A 1W36D 3K70C 2QTHA 4JBWA 3B9PA 1AA9A 5CDFA 1HE1C 5C1BA 2H7VA 4NCJA 5DE3A 5HTKA 2JJ1A 1E9BA 1IXSB 1W4RA 1II8B 1N0WA 1KDTA 1G21E 1GFIA 3KTAB 3F0TA 4Q66C 1P75A 4RY2A 2CJWB 3MAAC 1F60A 4LDJA 4DUGD 4CYMA 1JXMA 3TAUA 4D25A 2O8EB 4HZIA 4F38A 2PEYA 1XJ0A 2RHDA 2O0KA 2GZHA 4IDQA 3RYTC 1SVWA 2IXGA 2GCOB 4JYCA 2C95A 1XFAA 4TL8A 3GJ6A 4B3XA 4HAVA 4DDWA 1G3QA 4M1OA 1XMVA 1D9XA 2G88A 3ZZ0A 1FZQA 3QOFA 3FHCB 2J3EA 3SU8A 3R20A 1GUAA 4JSTA 2PL3A 4DSTA 2GEUA 3OEEA 3SDZA 3M1IA 4PHGA 3GFTA 3B1ZA 3OESA 4XSGA 3I61A 3I72A 1MO3A 3K70B 1K8RA 4Z1MA 4OJQA 4A2QA 4HB4A 2NZJA 1R6BX 3JZMA 1G19A 2Q9AA 2AL7A 3LO5A 1KDOA 1AZTA 2ZI6A 1AIPA 3C5HA 1R5NA 1U8ZA 1GILA 2CCGA 3DM5A 4ZKEA 1QVRA 2CHGA 2WJIA 3L0IB 1KO7A 5FI1B 4Q9HA 3AF2A 3ECCA 4TMZA 1IN6A 2C96A 5J47A 4M53A 1CLUA 3K8YA 3BC1A 1NI3A 4PO8A 4WXRA 1VCMA 4CEIA 1E9CA 2CVHA 1IN4A 1G8PA 3IEVA 3Q7QA 1CBUA 1E94E 1SXJA 4PZLA 4M2LA 5CITA 4PTLA 3GJ7A 2BBSA 3QNUA 2GRJA 5FUVA 2B21A 1CIPA 1OXVA 1E0JA 3PENA 1AKYA 2FG5A 1XJQA 3EW9A 4X8MA 1ZUNB 3SBDA 3QXCA 1FW6A 4AKIA 3TBKA 4GI7A 1NVXQ 3RRYA 2CDNA 4FMDB 1P5ZB 3LDAA 4FINA 1HY3A 1DOAA 2IHBA 2J45A 2NO1A 2XJ9A 3A1TA 2RH5A 2XTNA 4HZUB 1QZXA 4Q4AA 4DDTA 5J4VA 3KB1A 4EFLA 3TVDA 5D3MA 2W00A 3MG9A 1KI9A 4P4TA 4JLDA 5FL7D 3CZQA 4TMKA 3WHLA 1ZNWA 4BZXA 4YMWA 2DFNA 3HU2A 1COWD 4JLNA 1J8YF 1RFLA 3JVVA 2JIZA 3T1TA 4OI0A 1TQ6A 3KFXA 1W0KA 4KYUA 4V0MA 3E2IA 3VFDA 4TSFD 4L9WA 2V6IA 4YXWD 1XEWY 2GDJA 3BE4A 5FR2A 1G5PA 5A5GA 1C4OA 4AD8A 5B58C 3T35A 4B48A 4DLRA 1HTWA 5BN4A 3NBFA 2NO7A 3RHFA 2I4IA 1VHTA 2ZPTX 1XD2A 2D7CA 2H8KA 3LWNA 3BAFA 2JLZA 2J7PA 1S0UA 4GDFA 4NPHA 3A1VA 1JALA 1GNRA 2XJ4A 3MJHA 1N6NA 1UADA 1G6HA 2C8VA 3SE0A 2WPDA 1E2IA 3EPKA 2ODEA 1M1YE 3B8HA 5JHHB 4MDEA 4AC9A 3ADCA 2DCUA 2ZSDA 4MITA 1E0AA 2JLWA 4HAWA 3KJIA 4DZZA 1G6OA 5BQ5A 2PLRA 1IONA 4V0KA 4V0OA 1Z0KA 4G1UC 3RABA 4BFZA 5JI2E 4BFTA 4IVRA 3EC2A 3GLGB 1W36C 1N3BA 2HLDA 4LV8B 3Q72A 2BDTA 4M9XA 3IEUA 1P9RA 4Q9LA 5LD2B 4DVGA 3AP2A 3SC3A 1DAHA 4OQLA 521PA 1W44A 2R9VA 1AQYA 1DAIA 1XD9A 4BLOA 3C14C 1SGWA 3I8SA 5CK4A 3WY9A 2YZ2A 4C3ZA 2WSMA 1UBGA 1R10A 4I1UA 2X2EA 2ZJ5A 2GXSA 4TL6A 3IPYA 5FUYA 3WRYC 2IYYA 4OHWA 3LVRE 4OQXA 3QPWA 4HSEA 3WYFA 1RIFA 2X2FA 3EZ9A 4TTRA 4AG6A 2A30A 4HB0A 4BEJA 1EFUA 3ETLA 2IT1A 3GJ0A 2CVFA 2NPIA 2WJYA 3N2EA 5FUXA 3OFNA 4LJYA 1K6MA 2QNRA 2ZRGA 4R71A 1GOTA 2K5UA 3TKLA 2FZLA 4JVNA 1U98A 4JT4A 4XH9B 1OXTA 5L3RA 4HUTA 1P2UA 4HDOB 5EXXA 4BPBA 2GA8A 2CK3A 4NU0A 1WBBA 1DEKA 2ZI3A 3CIOA 2F7SA 4D0GA 5LB2A 5JZVA 2N42A 2EFHB 1DAGA 1T5IA 3K70D 3QY0A 3ND8A 1G7SA 4DCSA 3TW8B 3RS5A 1GP2A 3GJ3A 5J40A 1TU3A 4KXFB 4M22A 5AJXA 1NBMA 1BMFA 2D2FA 2D4HA 4B33A 3IGFA 4WZBE 2G1JA 5DYGA 1NBMD 2IEYA 1Q1BA 1SXJC 4I1SA 1ZCAA 4IEIA 4L4UA 1O3YA 5HZHA 4TYYA 4NCHA 1T3SA 1KO5A 1NVUQ 5CB6A 3WMGA 3LXRA 1UKZA 1NVVQ 4QG7A 5AUNB 3IKJA 2HV8A 3EARA 2OEPA 4IEEA 4IFBA 1PLKA 5EE1A 1BO6A 3KTAA 2XSZA 3FMFA 4MKGA 3V4FA 1PLJA 3L0PA 2AXNA 1LNZA 3KQLA 1Z22A 2W6IA 2REXB 2J0SA 4O2RA 2BWJA 3AV0B 2IYLD 3EWSA 2D74A 1HT1E 1OFIA 1XX6A 2CL7X 4LCBA 2OHFA 1P7CA 3BB3A 2YV5A 3FFAA 1EXMA 3LXXA 1G8HA 4LJ5A 3NDBB 5J4HA 5AR1A 1GKIA 1P2TA 1XBTA 4TZ6A 4D26A 3I5XA 2CHVA 4GFDA 4B75A 2AD5A 3GJ5A 3OHMA 2PH1A 1BS1A 4A4DA 4MYUA 2F9MA 3NBYC 4BASA 1Q57A 2QZ4A 4QGFA 3WP0A 2BKEA 3GLIA 1MOZA 2VP9A 4LBWA 2CNWA 2ZJ2A 4Q4JB 3NHAA 2EQBA 2IW3A 4IDOA 1IOZA 2ZRDA 4QXAA 3ND9A 4RZXA 1A7JA 5KDOA 5FPSA 5AUOB 2GEDA 2VO1A 4Q4LA 2WKPA 1ZMXA 1JQJC 3DZ8A 2FJUA 3H1TA 1ZAKA 3OIYA 3A4LA 4O0MA 4CEIB 1P60A 4DC9A 1NG9A 5F9FA 1VIAA 3MWYW 4JKYA 4HAZA 1WBDA 4PHFA 3C15C 1E96A 1ZU5A 3U7GA 1G7RA 1II0A 3KQNA 1Z47A 3CRRA 2DY1A 2J0QA 2VL7A 3QBVA 2ZS7A 4NONA 4B3BA 1Z2AA 4EUNA 5BW8A 3QI2A 3B1XA 3RAPR 4DB2A 2ZVQX 1GAJA 3W6OA 5JI3E 4B3CA 4BFUA 2QMUA 1VKJA 2ZRKA 1SVKA 3C8UA 2RKOA 2ZRHA 1C1YA 1QHIA 1VG1A 3MWKA 4EPYA 3NDPA 1U99A 3K09A 1YZLA 1JAIA 1ESNA 4Q7MB 4B43A 3UWOA 2I3BA 2HYIC 1OSNA 2FZ4A 3CNLA 4KHZA 3LY5A 3QPUA 1COWA 4OQFA 4UXJA 3U3OA 5EJEA 4M9QA 3U6KA 2QA5A 4A8JA 4S35A 3AVUA 3PUVA 3K9LA 1TNDA 2ZI4A 5EE0A 2GZDA 4OK3A 3LLMA
chains in the Genus database with same CATH superfamily
2AFVA 1GQFA 2FW6A 3OFND 3DWFA 4I4CA 3FPKA 1DTWB 4XQCA 2YOGA 1KDPA 5DLEA 1L4BA 1GSAA 4PC6A 4PLFA 3A6PC 1VKZA 3BMQB 1CQXA 3NVKI 4WFQA 1RW4A 4KB5A 3U60B 4RPCA 1DC5A 2FP4B 2QRMA 4ZO7A 1M73E 4LGYA 1F20A 4WKBA 2RAPA 2A9VA 1U0RA 3P8ZA 2QTTA 3EA4A 2A5DA 4Q15A 4YXFA 5MGBA 3RYCB 1OC4A 5ARCA 3O73A 4QVKA 4ZEVA 1F0KA 2QMOA 2XYHA 2YVUA 3PA8A 3ABZA 4KPGA 4MUBA 4KU4A 1A9SA 4L3WA 3W8NA 1C29B 4MLDA 4Q12A 1I14A 5HGXA 5MDHA 5K3FA 3WO0A 4ALLA 3SQMA 5AD1A 1O6ZA 1B4DA 2PBFA 3WTBA 5M34A 1SUBA 1NXTA 1NBHA 1MD9A 1RMQA 5DW0A 3RSHA 4D9EA 3L41A 4HDQB 3H8WA 4XXHA 3UK2A 3LNCA 4Y30A 1ZI8A 2D59A 3DVLA 4RTLA 3T7SA 2WQZA 4WADA 4GR4A 4EY5A 3MLAA 5JMOA 4JJ6A 1AS0A 1T4MA 1YR9A 1Q83A 2WJ4A 1WY5A 1ZJ5A 4IMIB 4NNOA 4OIMA 4FMDF 5FORA 4ZI5A 4JJEA 3C3JA 1Y8QA 3D4LA 4PLHA 4YAGA 2E18A 2WKQA 7ABPA 4Z9FA 4Q18A 2GXAA 1NYLA 3HZOA 4WXMA 1IDOA 1XN4A 1JVNA 1I0LA 1P4SA 2Q49A 3TD9A 4O2LA 3W2EA 4B3RB 2C0CA 3M6VA 5EUMA 1X8LA 4L1KA 4CG0A 4B85A 1YDEA 4HVTA 4WZAE 4CF4A 1QR2A 2FJ0A 1FRNA 3H8VA 3R3WA 1IBLB 3V4OA 2OP1A 3IKMB 4DUYB 2J09A 1OMOA 3CRZA 2YJZA 2QXYA 3P27A 1XRMA 4CIAA 2CLMB 3BZBA 3AKEA 4LRYA 1ENZA 2Q3JA 4EGSA 1NJSA 4HS4A 1ECJA 3AU8A 2IW1A 2YJ5A 4ERXA 5INTA 1VE5A 1FS4A 2AN4A 3R2JA 4PXYA 4JYAB 3AEKA 1F48A 1QF9A 2JRLA 2AFHA 2JJYA 2OV6A 3IEPA 2UYHA 5HUJA 3AL3A 1XG5A 2BFNA 1SHZA 1RCFA 2XQKA 3HI6A 3PWSA 4UULA 4XYMA 3O31A 5AHOA 4YUWA 4UBNA 1U9IC 1GNVA 4XUDA 1WDTA 3L0SA 3L43A 4Q03A 4R2KA 1TYEB 2F64A 2ZBUA 1UXKA 2OHJA 1U04A 3TJMA 5A4IS 1L4KA 3D8SA 4M9RA 3AVPA 3DTVA 3QG1A 5AOVA 3D02A 5ED4A 2YHBA 1W0CA 1QZ3A 2I4LA 4N5DA 4V38A 1FSSA 3GCZA 3DZBA 1QSGA 1TXGA 3NIGB 1U2TA 1ILWA 4WK4B 3VMMA 1EZ4A 1SCIA 1CVRA 4DCTA 1Y5RA 2ONZA 2Y1KA 3KOMA 4JEHA 3F6BX 4AW9A 1XROA 2CFCA 4H0NA 4RF2A 3NETA 4G5HA 1FBNA 5KSOA 1S3GA 2R62A 1JEDA 4MRRA 4AB1A 3I52A 4GM0A 1KY4A 1RPNA 4P35A 1RBMA 2I66A 3FHTA 4F91B 1DO0A 1USGA 5CK5A 1KDYA 1OIWA 3LOUA 4FCCA 3FPHA 1OHHD 2X9LA 2FMTA 1Z4NA 3INNA 3U1TA 2CJXA 2JJQA 1D4ZA 3NW9A 3UMVA 1GPJA 1T10A 4F4HA 5JQGF 3GGCA 1WF3A 1PWZA 1DSSG 4D5EA 3PFKA 5A9SB 1ORIA 3ILSA 2HK9A 2ATVA 3GGJA 3K9GA 4LSWA 1YF3A 1GG9A 4IIYA 4E15A 2W90A 2WM9B 4YMUA 3EMBA 1U2SA 3RLFA 2GN2A 3C3KA 1I0IA 4BUCA 3L8EA 4G0MA 4AAYA 2WMYA 3AR9A 4DCGA 4ALNA 4I8DA 5K6AA 3AF6A 1B8PA 1JFFA 4BJ1A 3WBBA 4LVCA 1QH1A 5FUBA 1W4LA 4Z9YA 2DXIA 1EI9A 3E9ZA 1O97D 1V9LA 3PQ2A 5DCYA 3UT5A 2RG7A 3RVSA 2HCJB 4C6RA 5KTSA 2GUGA 5KNBA 2EFEB 3NRCA 5D7NA 4ZGWA 4PS0A 5TGZA 3QU7A 1JEYA 1ECCA 1Q2XA 2PMDA 4KJZA 2C5SA 5G3ZA 2PUJA 1FXWA 4IPTA 5SYNA 1HI9A 2G9VA 5TJ9A 3ZHVA 4K0KB 4QE3A 2DPYA 3JVIA 4LISA 1CZLA 4MTCA 5BSRA 4A15A 5ISMA 5I7WA 5EIWA 2WTAA 3NOXA 1NF3A 5CVJA 4FLEA 2CVOA 1VSBA 3AP3A 1E5QA 2I4RA 3VU0A 5HK9A 3ET5A 2R97A 1E2EA 1U0GA 4KZPA 2PZLA 4EY4A 1RZUA 3RU3A 5AJWA 1I4LD 1W2HA 4S1VA 1VYVA 3WIDA 2J9ZB 3QTLA 4ZK6A 1P77A 3ICWA 4DDHA 4QNNA 5JS1A 3HN6A 3TIVA 4UFPA 1RHMA 1DG3A 2I4MA 3DYBA 4LF6B 3ACCA 1CR0A 2I29A 1KNQA 1D9ZA 2LBPA 2WIDA 4O08A 4TS1A 1KK1A 1LH0A 1UBNA 3HLKA 4L0MA 2CXUA 1I51A 3FR8A 3PVSA 3M33A 2VJPA 5JRZA 1EFKA 3NWOA 1GKUB 4GI3A 4HGNA 1UAAA 3QJYA 2Y6UA 4K5QA 1X7GA 1F0PA 4EFDA 2W2LD 1OT3A 1JWLA 1Y9DA 2RAUA 2P4SA 1SBQA 2EP5A 2OBBA 2QTCA 2D8AA 2ZUUA 3CPEA 3FNRA 3JD0A 4H6WA 5C1DA 5JXWA 2YWCA 1YO6A 4H16A 3W34A 1PDVA 4YAOA 3JR7A 3L01A 1VG0B 1J4AA 4TYNA 5EP1A 1CEEA 2FU5C 1TM5E 1Y4ZA 4BMOB 5JAMA 3Q8LA 1MVLA 3TQCA 4BWYA 4F0JA 1IAVA 1U0OC 3IOYA 4ZVMA 4ECEA 1DQYA 5FP0A 5K3EA 1U9JA 1DOHA 4ENUA 3JQPA 3R7LA 5H0IA 4Z4CA 1W48A 4II7A 4ATNA 1PWEA 4AI6A 3UQYS 1YZ3A 3LYAA 3PUWA 1KQFA 3SSOA 3N8IA 1AC5A 4PAWA 13PKA 4TS4A 1XQ6A 4RU1A 1XNGA 3DQQA 3JWPA 2B37A 4F2DA 3L06A 3TQHA 4CLRB 1VA4A 3FAZA 3L04A 3WYCA 1B14A 4J2TA 5CXUA 3GEHA 2D7JA 2WZBA 5BQXA 3OU2A 3RH0A 5FPYA 2GJ9A 3GVXA 3ELYA 1EK5A 3HPRA 4F2HA 1US8A 5SY4A 4OQPA 5A71A 5GTDA 2Z6QA 3E5RA 4P7JA 4Q9KA 1B8NA 1KQ3A 4ZVLA 3C1UA 5A6VA 4JVMA 5AXCA 1OBOA 4D0LB 2O2JA 4RK5A 2P2DA 1EGAA 4U63A 5I9NA 1Z39A 4BFXA 3RSQA 3K9CA 1QOPB 4A5OA 2ZBQA 1JG4A 3FWHA 3V48A 4RDIA 2B61A 1W9HA 3I0NA 4FFVA 4CV1A 4Z7JA 1VDZA 5DBHX 1H5NA 4PX9A 1R5JA 3LXUX 4E4RA 1XP8A 2C3PA 3VYUB 2C5AA 1O1YA 3FB1A 2FG7C 1NLMA 3NWBA 4MQUA 4WERA 5J5CA 3C45A 1E6MA 1ONBA 3OC0A 3GFGA 1Y6QA 5AK0A 3FYUB 4BNZA 4WLNA 1A04A 2AWOA 4B7XA 3MF4A 4KNYA 5ALYA 1AKTA 2BGUA 2CBXA 2RARA 2VRBA 3NHJA 5AXBA 1EAMA 1LV8A 4RVSA 3MWJA 4GSYA 4TYMA 1IM2A 4KWIA 2Z2JA 3QKIA 5DGHA 5ICSA 5G4LA 3UM9A 5KYYA 1O7JA 3EHEA 1ISHA 1GGVA 5AHRA 3I62A 1ETHA 2VCEA 4HAYA 5JEDA 2PUWA 3AIIA 3QG5A 5DLQC 1PT6A 1XN1A 3TL6A 2VTEA 3NTRA 4LZAA 3V7YA 5T3UA 4ZEOA 4CEHA 1KZYC 1IY8A 4GYKA 3U9TA 1YZVA 4D9MA 1DKQA 2JFQA 4P93A 3T0GA 4J1TC 1E7QA 1IHUA 1T2VA 2KLHA 2QD2A 3IJPA 2XDQA 3A6ZA 5DCLA 4DJFC 3CZPA 1KI8A 1N57A 1P61B 4M1TA 4F96A 2PWBA 4MV7A 4YRIA 4BQQA 1Q5PA 4XWKA 1HV8A 2WSSD 4RMJA 5F5XA 3GV0A 5FJIA 3GA5A 3O8DA 4HDSA 1P73A 1E7YA 4FEYA 1T0UA 1XAHA 1US8B 1Z4QA 2DVMA 3SR0A 5J4YA 1KIMA 2JCSA 5CA1A 2W43A 4MVJD 3KAKA 2R66A 3QU5A 3DXZA 2O8FB 4KQXA 2NSJA 3KDSE 4JYBA 2BP7A 1MO5A 2GN0A 2WNSA 1DAPA 5BUCA 2ZU6A 3VC2A 1JA9A 1L5KA 3AYZB 4XYEA 3ROZA 4DA9A 1R4NB 3KSZO 2IH4A 1IY1A 4WPGA 3IPAA 4EKIA 1MOSA 2V45A 5B7PA 3T5MA 4E94A 1JBKA 3ZU3A 1K7YA 3V42A 4CETA 1N25A 1U1EA 2FR8A 2VKTA 3WFJA 4GXNA 2DYKA 2J7KA 2V3CC 1LKZA 4EKDA 3GR6A 3ZHQA 4NCXA 4MRAA 1SC1A 3FKJA 5CJJA 2JLRA 3O2NA 2QSUA 1QQBA 4EELA 1LSSA 4D92A 4L2IA 4ENQA 5IF3A 2A14A 1LJ8A 3CBGA 4UASA 4YRJA 1UQRA 3O1IC 1NT4A 4ZMSA 2HTEA 2G40A 3PYXA 2O7QA 3AR2A 3DTVD 2IK8A 3TZEA 3NVAA 2WILA 4KC0A 2H16A 1AN0A 2FEXA 2P1DA 3QUSA 3HA3A 4MINA 1FFYA 4P32A 3QU9A 1Y98A 2Y05A 5JISA 1M2OB 3KB2A 4KIUA 3KP1A 3W4IA 4AN4A 4BEVA 4YHHB 2V3VA 3N76A 5CT4A 4ZQIA 1P5FA 2H48A 2HREA 4HAUA 5DWVA 3ZQKA 2NZ2A 2L82A 3GEEA 3QEMB 1KAHA 5IM5A 3Q88A 3EF1A 2NZUG 2ETXA 3JQAD 4J7XA 4FYHA 4CQLA 5B2ZA 1P7YA 5JRJA 4XSHA 3ZBQA 1OFHA 2B36A 4AMGA 2CEKA 4HDNB 2JL1A 5T57A 1MORA 3OPVA 3O1HB 5DU2A 2VDUE 4LHEA 4PLGA 4ZP1A 2HC9A 2ZULA 4BIMA 4NTZA 1YWGO 4Y2UA 1E6EA 1EX6A 4UE3S 4MDFA 3LC1O 4N39A 1L1QA 2C2WA 2EBFX 3L6DA 4OYRA 4Y67A 5CVUA 3PDIB 1TUGA 1L7AA 2VF2A 3L2OB 5KNDH 4J6FA 3WKBA 1MRNA 4XD7D 4KYVA 4W9RA 3DXYA 2NXCA 4JNCA 3I1FA 2IUSA 2DUUA 3IUJA 4QEDA 3OKCA 4PYRA 4R54A 3HYTA 3VVLA 3DTYA 3EBLA 3PQEA 4KLNA 3ZIAA 4EFKA 4IDEA 4LGMA 3A37A 5FNVA 3TLZA 5I4CA 5F1KA 1V8FA 2WB2A 3EUWA 1XTUA 4E2YA 1FOEB 3EQ6A 3W05A 1AS2A 4PLPA 1JFFB 1Z63A 3V8PA 1CE8A 5D86A 1G3MA 3FDZA 3M5PA 5ULLA 3DLIA 2XNDA 4BBZA 2I99A 3PZBA 1A5BB 3DDNA 3QENA 1RM5A 3OY2A 2ZWAA 5EWLB 3SNHA 3VO8A 4DLZA 3ZD8A 5I45A 1E2PA 5AVWA 2EX4A 1ZSYA 2FGKA 4RL4A 1YAJA 2JCXA 4FVTA 4JHLA 4BNWA 4FX5A 3LK6A 1V71A 3DVAB 2OBYA 4L3VA 4I4TB 4S04A 4IYJA 1NNUA 1JMYA 2ZCUA 4ZI2A 2AMYA 4I5GA 4REQB 5DX1A 2HEGA 5JROA 4MMXB 2NUTB 3M6MD 1LDNA 2GBPA 3PXCX 3K0FA 4ON9A 1Q3KA 2WF8A 4WBSA 3R23A 4GMHA 4AO6A 1NONA 5TT0A 5CB8A 1TEVA 4DJEC 2WLTA 5HILA 1DAKA 1KQNA 1O87A 2PT5A 2R48A 3NEPX 1HDCA 1IG3A 3BQMB 2XOKD 2FW0A 3RWMB 1YMQA 4LXQA 4HQNA 2ODPA 1LSJA 3W6UA 2A0XA 1RBYA 2VRCD 4ER7A 2R7LA 2HIAA 2EDAA 3R8FA 3B3AA 2Z9CA 1U7OA 5AVQA 4I9GA 1PR1A 5JALA 1FFBA 4C04A 5E7IA 3JZIA 4PPQA 5KMGB 1O6BA 1A2BA 1B3RA 1HA3A 2AZ4A 2YWXA 5CD9A 5ALWA 3ROTA 5DSTA 2XUIA 2I54A 3R5KA 5TQ2B 1QM5A 3STXA 2AF3C 4IDDA 1C2YA 4WY2A 5LVAA 1X2BA 2EC5A 3M0EA 1TM4E 3GO4A 5KINB 3IQXA 5LB4A 2WA1A 2Z98A 4PC1A 3QE9Y 4GMXA 4HYQA 3ZLUA 2D1SA 4JEIA 4I99A 3JAKB 3T3PB 1DE0A 1Y3CE 2PJZA 1KI2A 1QP4A 3UMGA 3OI7A 3CA8A 3QVUA 2XH8A 2HSZA 2GEFA 3X1KA 5D6OA 1ENPA 1SBTA 4RFSB 4WBNF 1EXDA 1BFDA 2QZZA 2Z30A 1B8UA 4RMIA 3GAZA 3V2UA 1B0UA 1NT2A 1S2DA 4FLMA 1K9SA 4HWPA 4IS2A 4RV5A 1USKA 2YNMD 3A9UA 3NHRA 4M76B 5EKDA 4YUVA 1DT5A 1Q7TA 1BQ3A 4KL8S 3CUYA 5CLHA 1MO2A 3PX7A 1H1DA 5DGXA 3VV3A 1YIDA 4MW5A 4AP9A 1V48A 3A7DA 2P8SA 4IOMA 2C4KA 2WYUA 2Q29A 4W7HA 1GLGA 4M7PA 4YJHA 4ES6A 2WEKA 5K0CA 5EWMA 3QYPA 4XQEA 2X8JA 4IDCA 4YJGB 3OEWA 1GL7A 3UA4A 1I32A 4O2BA 4IQ8A 3TTWA 4TKVB 3UMCA 1C1DA 2VDLB 3KOWA 3U19A 1WB6A 2V58A 3DXFA 3KZMA 4ZJUA 5C8ZA 2Q7XA 1XTPA 2VYND 1EFRA 3LZDA 4R0VA 4ZU6X 3TSAA 2I6UA 3FMPB 2I7CA 5SYAA 3NU1A 2BFDB 4CV0A 1E0AA 1FDRA 1WR8A 2Z0MA 5KYXB 2V7TA 3U4CA 2HI0A 4WI1A 2EKDA 2HMSA 5EJ8A 3GLGE 2ZYRA 3B60A 3RANA 2GBGA 1NRWA 3CF2A 3MGKA 2LCIA 1FDWA 1WUHS 2E9SA 1O9GA 2D62A 3FUCA 4PZ9A 2B4TO 3E81A 3IP8A 4WXPA 4EHLA 4MWTA 4QELA 5EE5B 2P69A 3E3MA 2F59A 3LU1A 2X5KO 2B4KA 4IW3B 5DLYA 5JCJA 3U7JA 3SJZA 2IS6A 4AJ4A 4R9UC 3ZWPA 3L4JA 1XVTA 4P86A 3VC1A 3DB1A 4ZOBA 2LCFA 1B42A 3PRJA 4J2OA 1NQ5A 4NZZA 4EL0A 4G5GA 1C9YA 3NHKA 4BO5A 3D8RA 3DL0A 2EWVA 2HSGA 2MYNA 2PMFA 3E9CA 4PGMA 4WCFB 1PX2A 5TR9A 2AOVA 2GZ3A 1PGNA 2PD4A 2CYCA 4HFRA 1TO2E 2VPPA 3DO8A 5CXXA 4IDNA 4ND8B 1AHHA 3L8DA 5CIWA 4CKYA 1YZFA 1QKJA 2HLHA 2VR1A 1KOGA 1ILEA 1YJCA 3DLPX 4L4XA 5EIOA 3K20A 5KI6A 1NUPA 2IE8A 2LP4Y 4Q19A 4ILEA 2FPGB 3JD2A 3NXKA 3TTVA 3TUIC 3E5NA 3SYTA 2O0HA 2FE4A 1OGIA 4KQ9A 4MB0A 3UAWA 3ENZA 3KPVA 2DQ4A 3MSCA 1R0BA 4IDAA 4IVQA 3Q10A 3A32A 3UFXA 1V7QA 1QX4A 3CZCA 4Y9DA 3BA6A 3AHGA 3X1ZA 4Q82A 4GPZA 4YY3B 3ADDA 2DLDA 2QI9F 2AOTB 5LN1A 3I45A 3I04M 4XKJA 3TZQA 4U8GA 1L5VA 1MMFB 4Y2TA 5K0LA 3ZYCA 2IZ0A 3CEPB 2QN8A 3ICPA 1NDQA 3L6UA 1RACA 1L9KA 3LCVB 1BXGB 4L28A 3RF7A 4LPSA 5AI6A 4BLTA 4QGHA 2JI9A 1Z9BA 5H81A 5B58T 1J42A 2ZSBA 4HNSA 1QV6A 3CONA 4MPPA 2JGIA 4Q9AA 1EK6A 4W5RA 3RW9A 4GEGA 1XQVA 1YRBA 4MJ3A 5B1SA 1L6IA 3GJSA 3RC9A 3T1OA 4UQLA 3CPHA 4OQMA 3TLGB 4ALKA 3EASA 2QPOA 5MN6A 3ZJ4A 2G6TA 1WZEA 2HU2A 4TQAA 4G4JA 2BCJQ 5CA0F 5L3VA 1R5BA 2NUBA 4OATA 3TSZA 3VTFA 3OF3A 4H3SA 4F3CA 3PUJA 4JP2A 2J9FA 4EAAA 3H5AA 3HBJA 3D8TA 3ENWA 3U7IA 7GPBA 3ZVRA 2W4MA 4AG5A 3RS3A 2PUBA 2WT9A 2J4FA 2P0EA 3H84A 4MUHA 5ILQA 3L0DA 5EZ6B 3OSUA 3AQIA 3CVVA 4MZDA 4UPDA 4ZV4A 1DX6A 5JQWA 1X77A 4JLOA 2EZ8A 5DXJA 3RLIA 3DE4X 1WXWA 2J31A 3GGOA 3GY0A 4WFIA 5ALZA 2FSIA 1F8GA 1JDTA 3GLHA 5EEHA 1N4DA 2HCBA 2OHIA 4O2AB 1M8KA 3H05A 1JV2B 2BGMA 1N5DA 2ZTVA 5D5HA 1G16A 5LPNA 2NZVG 1YMVA 4KBFA 3MWLA 1JZSA 3OG9A 3UO8B 1ZU4A 1WWKA 4GE0A 2VJDA 4OYHA 2AXEA 3H7AA 3FTNA 1UF9A 3MMNA 2D1QA 4MR8A 2IF2A 3GBVA 4R8KA 2P9QA 2RK4A 3JQDA 4RHYA 3PFIA 5CEJA 1TF7A 1AGNA 2QN3A 3VDXA 2AKEA 1HWYA 1B6GA 3HL0A 4P31A 1J9ZA 1M7BA 1WRBA 3KUDA 2JFOA 4W7SA 2PYIA 3N9IA 1W0KD 2WFZA 1P3JA 3W3AA 3ZHCA 5B3KA 3DV0A 1X9GA 2C2MA 4QOSA 2Z2XA 3I9FA 4CNQA 1U0TA 2XUZA 3JV7A 2OCGA 4JP5A 5D84A 2IODA 1Q1QA 1BG6A 1Q0QA 4DYVA 1SKUA 2DC1A 4B2IA 3DS8A 1ZXLA 3TPCA 5A02A 4TXLA 1V95A 2A9KA 4ETMA 4OLHA 1D1QA 4IKPA 5U4XA 3DTNA 3CUUA 1EB9A 2CXPA 3BCHA 3PFFA 3IEKA 4QBIA 4LTDA 5DMHA 3AVTA 5J3JA 2OGWA 4YRZA 2WD7B 3C6XA 3NIWA 3RVNA 4D6YA 1W29A 3WMWA 4P7BA 1E2JA 2O05A 2HPZA 3FMGA 4O5OA 3ZW9A 4AKHA 4QXOA 2DQKA 3HGTA 2WC1A 1UZAA 1RXIA 2ZQ5A 1T2DA 5JECA 3IA7A 3ASZA 1RE0A 2WSSA 4NHEA 4RAOA 2XQIA 1KVQA 2EGUA 3M4NA 4OJMX 2PMBA 2BAGA 2O2IA 4MRSA 1SUAA 2C04A 2WKRA 3FW1A 5E7MA 4WVFA 1XLUA 4R8RA 1H0RA 1TLTA 2G1AA 2PXCA 4FS3A 4NE2A 3I28A 4RLFA 3P2YA 4UBJA 5EJFA 3O2SB 3QVKA 4L5AA 1ISPA 4V2IA 1H8EA 1KOJA 3PF8A 2GJKA 1CE8B 3W7VA 4J3NA 3IV6A 4CCSA 2H9IA 1ABEA 4EFNA 2WFLA 3FFBA 4WX2B 7YASA 3ITEA 1YFKA 2QUZA 3HCFA 2MSKA 1HEYA 3AIKA 3MINA 4U7FA 1CNEA 3V33A 4Q7LA 4H18A 1LLUA 1NP6A 5J4LA 1LK0A 3ZDQA 1TW2A 3KJGA 2C92A 3ANTA 3TNJA 3WLHA 1OLSB 1EWRA 3PQ5A 5LA6B 2WWHA 1OX6A 1LDGA 4EHIA 1Q0LA 3DP9A 5DHAA 4D6XA 4MQMA 3IT3A 2FN7A 3SWWA 4WZBB 1A88A 2BHNA 3OZCA 4BYGA 4GU5A 1ZOSA 1N6IA 1YQTA 2JDID 3QE2A 1JXAA 3JRXA 5KVAA 1X1RA 4PF1A 4DMLA 1T9AA 3KYDA 4IZHA 3U16A 1JLHA 2WUVA 4C0XA 3VNAA 1KO1A 4Y18A 7AT1A 4J3FA 1B73A 3BQ9A 4MQFA 3WWZA 3SIPA 2FG6C 3WGKA 2VZLA 5ER9A 2H5IA 1U7UA 2EGGA 2YN4A 1IAQA 3VTKA 3AVYA 5G40A 4MUNA 4J7AA 4UXHA 1MEEA 2OFFA 4LC1A 1J33A 1XKXA 3ZU5A 4EW6A 1N5LA 4LEIA 3OZAA 1N6HA 5BSVA 1F9AA 3QEMA 4QYXA 2MTBA 1UEJA 5HK8A 1DQZA 2QRJA 2G17A 4OB6A 3ZLBA 2VPIA 2BGTA 2VHXA 3PQ4A 4ZIRB 2CDBA 3CZ9A 2V6MA 3I5MA 1E9FA 3FPCA 3FCCA 4BNFA 5ECGC 5L8VA 1XMSA 4I9HA 3GD5A 1C4WA 2CJYA 1LFDB 5DO9A 3H6GA 2Y0BA 4I5FA 2AC7A 5ALOA 5LA6A 5TPWB 1YR6A 3T7KA 3A9VA 2WG1A 4OXYA 4BRSA 3TIIA 3NS7A 3EXIA 5HTOA 1JB1A 2PO7A 3WB1A 3QFFA 1UZLA 4LN1A 4Q3EA 5JSYA 1YVRA 4GX0A 1JLMA 3BGSA 3O92A 1WUTA 4N0PA 3K71B 1MC8A 4PFSA 3T9DA 5DISB 5KAMA 5AKEA 2FZ5A 1WXQA 4B3TB 1H5UA 1RT9A 1OFUA 1X7YA 5ILOA 3WRXC 1TE2A 4HRYA 4G09A 2X15A 2GBLA 3WLPA 1JEYB 2WAAA 1TJ4A 3DMGA 1KAQA 1DFHA 2B8TA 4MRMB 4UM9B 3FNEA 1L8LA 2CF5A 5EYPB 2WV9A 1XCJA 2GA9A 1HQDA 3LHDA 2WMOB 3TEFA 3H6KA 4D2IA 2Q5LA 1JR6A 3WZ2A 2Q3FA 1DIAA 2WHEA 3GBPA 3TQSA 2CE2X 1T15A 2GLTA 1FK8A 1DKNA 2WA2A 3NWJA 3SXUB 5C51B 2C59A 2F00A 3EFBA 4YWHA 4DOMA 1E3SA 1QG4A 3ETGA 1XMPA 3KOZA 3KVNA 4W5JA 4Q1EA 3B7WA 4OVKA 1G17A 4P4SA 4EDHA 3QQPA 5JJ5A 1XKLA 3ABOB 4GG1A 1YRAA 4M83A 2HK8A 3IJEB 3GP3A 1SKMA 2DFTA 3LYHA 1SULA 1F38A 2BONA 3HE3A 3SYMA 3VKFA 1YHZA 5CFQA 1R00A 2Q5EA 3H75A 4K86A 4L15A 4Q4DA 1I3CA 1QYRA 2G5PA 3C41J 1HH4A 5CEFA 1NHWA 1TU0A 2REBA 3BWDD 3O4GA 3JCZA 3I34X 3P1JA 3BMNA 3Q7EA 5IAGA 4N3GA 5KAPA 2J3JA 1F7UA 3DV0B 1JQ3A 2J0UB 3L07A 4C0BA 3K4PA 1PBNA 2QM8A 5A2QA 2JLQA 4W9MC 5A6SB 3UAZA 3WYGA 1FNBA 4CJXA 5HKKD 2PE5A 3AI2A 4EG3A 1MABB 2CLIB 2P3OA 4NENB 2VF4X 4G24A 1OYYA 1DJPA 3KSRA 1A27A 2W6ID 4XSVA 3G1WA 3UNXA 3EXAA 3VR2D 1I30A 1W25A 4BYMA 5FI3A 3ZW7A 2XQFA 1NIJA 3LH5A 3LWZA 3F97A 2V7QD 2NU6B 1OBHA 4HTAA 2X58A 1LBTA 3DBIA 1SIBE 3NM4A 2RGCA 4TMXA 4Z8XA 5DYTA 2F8MA 1KJYA 3LQRA 4M3NA 4PX3A 1M0EA 3W3ZB 2OUKA 5BNFA 3RG8A 3IVMA 1KORA 4DJDC 1PGQA 3QYAA 2YFHA 3EIWA 2ZB4A 3WA6A 5J63A 1OFGA 3EN0A 4L3OA 1AKEA 3ZG6A 5IFLA 4ITVA 1Z0FA 2PCJA 3TYXA 4EPXA 5AW2A 3EUEA 2HADA 1F17A 1GQSA 2YXNA 3ER9A 4RTSA 2DFVA 4I5DA 1XCGB 3HRKA 3ONNA 3VR1A 3V55A 1V8ZA 4YMGA 1K6XA 4WDRA 3MUNA 2COKA 3VHQA 2XZOA 2QX6A 1GVHA 3RSFA 4KGXA 3V97A 3C8ZA 2XRYA 1O58A 3G82C 2P2CA 4BFSA 4P5EA 2QUIA 3NJ8A 1KEVA 4YS6A 1HNXB 1HQCA 4DPKA 2OV4A 4AY3A 1LLQA 5JAZA 2VEDA 1RWOA 2JRCA 2R1UA 4LX8A 2O19A 3QUBA 4PTZA 3RVMA 4XYLA 5F2NA 1U8XX 2Z1MA 5IZCA 3E2PA 1G3IA 4X54A 3RK0A 2J9GA 4DLAA 2BYTA 3OJLA 3TO5A 3TG2A 1WB5A 2CMFA 3GNSA 3EDQA 4B34A 1AMOA 2SICE 1YONA 3ONEA 4PCVA 3H11A 3HU1A 4C29A 3L1IA 4WV3A 4E33A 3LY9A 3O90A 2DHQA 1AKNA 2YOHA 2JANA 1HBJA 2AVDA 4C03A 5AVOA 4FTWA 1KMNA 1W93A 4JBHA 1AUPA 1IZ0A 4OHVA 2CJWA 1AG9A 2WSBA 2JLCA 1MA3A 1A98A 1T13A 2V0NA 3R6TA 4P53A 3UT6A 1R2QA 2XUFA 3WGMA 1KSFX 4MSUA 1KYQA 2ZBEA 4UPEA 1IZ7A 1AKUA 5CDUA 4QGBA 5D00A 2WHPB 1QYXA 2FX2A 3OTQA 4TXJA 2I2CA 4EYEA 4GVXA 5JNLA 1P45A 4UBKA 4YAJA 1DKOA 1J2UA 1PJBA 1EX7A 1H2XA 3D6FA 5FNVF 4E11A 3AK4A 3HDHA 1T8UA 3FOWA 5EJMA 1PGPA 3U2QA 3PK0A 4IJMA 2WNIA 1IJKA 5AT1A 2RSLA 2AJ8A 2G1UA 1JIXA 1V45E 1MENA 1I9CA 1P17A 2QVYX 3G5TA 1NY6A 3AY3A 1YZTA 5YASA 4CRWB 3UAOA 5JSZB 2XVYA 5EZQA 3AO0B 5J5VA 4YRGA 2VH1A 2XOKA 3DWEX 2M32A 5K20A 2PUCA 5TQ0A 1H5QA 5DMXA 3URMA 1U9YA 2JIQA 1W4CA 1C7FA 4LHYA 4LJAA 1HLFA 1VCIA 4LY9A 5DCUA 5I9BA 5L53A 4IILA 1LSOA 5M04A 4DG9A 1CK4A 3BJIC 4TWBA 1NYRA 3UH1A 2QEQA 3LKVA 4DSAA 1H4VB 4F9EA 5ARBA 2XGMA 3UN1A 2WWVD 4RV9A 2IWHA 3QKRA 3C5EA 4WK2B 1DIBA 3SJ7A 1EFTA 6REQA 2ZT5A 1JEQA 2JJ8A 4BKUA 3NHLA 1WHSB 5JSFA 4Q3CA 5L40A 1U1DA 1W6RA 3UJAA 4J0CA 3JWHA 4KR7A 3AVVA 2QORA 4TWIA 3WAGA 2D2VA 3AB7A 4NU5A 2VUUA 4O29A 2QN1A 4XYGA 5IJ9B 3D4IA 2IEZA 1RLJA 3H5VA 5EQTA 4CGZA 1XMIA 4OHUA 4QUHA 3VU9A 2UZ3A 3V6LA 1N6LA 4D96A 3IUEA 1ODCA 4MVJM 4AMUA 1SEVA 3K53A 5ENDA 1MNQA 4QTYA 3C7DB 4MQ6A 1V43A 3NP9A 5EJ5A 4O6VA 1ODSA 2PSSA 4FSXA 2CYBA 2QG4A 2GNOA 4RE6A 5G0VA 4C7JA 2AW3A 2QE6A 1DHRA 1VKRA 1FP6A 1FQKA 3BD7A 2VAWA 3X2SA 4D82A 3DMDA 4IIJA 1A8IA 4GX5A 3RBXA 2IBSA 1JMVA 3FCXA 2A4MA 1GRRA 1XWFA 1NMXA 1RLOA 2PDAA 3GT3A 4V0ME 5EVCA 2IEBA 1XZPA 3L6CA 4FGZA 2IDKA 2XY4A 3FUVA 1P62B 4LFBB 4OKSA 4XDYA 4ZMBA 3F7MA 4EJSB 1W7AA 3ORFA 1QCDA 1WAMA 4CHGA 1EVLA 2VH5R 3U7QB 3EXHB 4F4UA 1C30A 1DBVO 1ORVA 1E92A 3ADKA 3DTTA 1UZNA 4HQFA 1ICIA 3TSYA 3ZE0B 3S29A 1WCWA 3LQFA 3SCZA 3ZK9A 1Z8NA 1Y3AA 2AC2A 3CFYA 3W2TA 4M0KA 1EU1A 3X2EA 4BVLA 5AVTA 5GVRA 4DHEA 1UM8A 2WZQA 4HWKA 3HKCB 5GONA 4CG3A 2BF4A 4QG3A 1T6BY 3CX4A 2RI6A 3TAXA 1LX6A 4IDFA 3H2HA 4QBHA 4QUEA 1H2WA 1KFCB 3RHTA 1FP4B 3S2EA 5SV2A 4B4OA 1JLLB 1J0EA 4EP1A 1GPWB 5F78A 3WL8A 1EHYA 1YB6A 1YA6A 2Z6UA 2C2YA 1NX9A 3D4OA 4OAPA 2VN8A 3HBLA 2QR5A 3QU4A 3WJ7A 2RCNA 2ROQA 2JLAA 3M6UA 4OH7A 4KOAA 1G8KA 3HKDB 2I91A 1JLLA 3DV9A 1SKYB 2OO3A 1FP4A 3KWMA 4IVNA 4TL7A 4XEHA 5AVRA 1QRTA 2BBOA 2H00A 3D2AA 4IKEA 1BXRB 4KFTA 5IK2D 1A0OA 2NX2A 3L1VA 3T34A 1XPUA 3IE0A 5K4GA 2BFCB 5A1JA 3UWMA 1N77A 3RKUA 2HBYA 4WESB 4DR1B 1T34A 1AUXA 4LYYA 4ROTA 2QZPA 3L8CA 3JVEA 4R0MA 2AG8A 5BT9A 1HRDA 1N0UA 1FCJA 4URWR 4PX2A 4FM9A 4KQGA 1GGEA 3TMKA 2CNOA 3NAQA 2WKSA 4RQUA 2Y1DA 4BFVA 2X77A 2OCKA 4JY7A 4JXXA 4L8LA 4AN0A 1E3IA 3ZWAA 3UMYA 1A77A 3MCVA 3ZLJA 4I4TA 2E5WA 2ECFA 4EO4A 1SA0A 3JAMA 3ZCRA 3TLEA 3JYHA 1PEAA 2BFEA 3MCAA 5TNXA 3A3PA 1V4VA 2ZK7A 1KBOA 4Q1BA 2IGTA 2ZS9A 3ZXYA 3LCUA 3LP5A 4BO7A 4YRKA 4I55B 3QVOA 4DIOA 4JJIA 4BB5A 1BC5A 3IQIX 3DB2A 4GHWA 4JBNA 1OLOA 2DKNA 1PYGA 3H2SA 3NUGA 1JWAB 4ZCRA 5IEJA 4DA4A 4Q4JA 4PAQA 3EULA 4G8CA 3MVEA 4A8JC 4DM4A 1OLUB 5HJEA 2CHUA 5LP6A 3BWXA 5D3QA 4N5IX 2HDNB 4PLZA 4D44A 1TI7A 3OO1A 2A1TS 1G18A 5TSDA 4EGJA 4PICA 1R8JA 4IWNA 5AFSA 4KWCA 1AJEA 4ICIA 4BNGA 4C0LA 3NEJA 3AZOA 1A1VA 3WAJA 1UWCA 3PIRA 6REQB 3IRUA 4R68A 4ZT4A 4AIRA 4CG2A 2XMSA 1WW3A 3IP1A 3UICA 2Z95A 3CW2A 4L07A 4LRUA 2J48A 5JWRA 3USCS 5JO9A 4D45A 3M3PA 3IBGA 1JI0A 2BJVA 3AWDA 2QPLA 2XBUA 4PE5B 2FRDA 2LZ0A 2XYQA 2XZPA 3O3NB 4MWSA 4HEQA 3KELA 2C2BA 4TQUS 1AV7A 3ELUA 3FPJA 4Y2VA 1W36B 721PA 1PKEA 1UKVY 2WIGA 2AW5A 3MLBA 1P6XA 3VGPA 4A0RA 1ZC4A 2AZDA 2WVJA 1L7MA 3NBKA 1KRWA 3RB8A 1N3LA 4MV3A 4X64B 2HMUA 5HJ2A 1MV8A 3RYIB 2Q6IA 4HNVA 3FPEA 1OZFA 3BSSA 4LAFA 2A92A 4GI1A 3HJRA 5A2GA 1BEUB 4KFSA 1DI0A 2FR1A 1ECBA 4LBVA 4BEBA 3VOTA 4D8UA 1M2VB 5KTYA 2YHIB 4D99A 4DJ5X 2FRDC 1ZI9A 3OQJA 1Z6ZA 1AHPA 4LRQA 1TF5A 4NQZA 1R9NA 3OZGA 3QX3A 5ES3A 1X38A 3HXOA 4GOKA 3UAXA 4EJ2A 1JAZA 4KAFA 4X7BA 3C0KA 3WRYA 4YXWA 2V03A 1CQPA 1NSYA 3H5WA 2Q9BA 5A04A 2AFIA 2VF5X 3G2KA 4Q34A 5F9MA 3GVHA 4IDPA 3ZI7A 1T9ZA 1IOWA 2G5TA 2H5EA