4LYHA

Crystal structure of small molecule vinylsulfonamide 9 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
163
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 59
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lyhA00
2PMKA 1QF9A 5DGXA 1G3IA 3U3OA 5FOUA 3VX3A 2ORVA 3KX2A 3NC1C 4NBSA 4QKQA 1KI7A 1XMSA 3IO5A 2JJ1D 1XFAA 2ZRCA 3I8SA 1A82A 2F9LA 1ZVQA 1II8B 4OJQA 3VR4A 1W0JA 4FXPA 5JS8A 1MABB 5P21A 2GAAA 2Q9BA 2K5UA 1S1MA 1KK0A 2ZU6A 1KY3A 2VL7A 3IHWA 3GP8A 3B85A 3D7MA 1W36C 3QJYA 1XMVA 1R8SA 5KHOC 3FGNA 3ONWA 4C0BA 4YC7A 2OLJA 2WTUA 3WYGA 3CO5A 4PR0A 2BM1A 3CF6R 3L0PA 1UF9A 1YU9A 3WY9A 3W34A 2BJVA 1K6MA 1P9NA 1KK2A 2AK3A 1NLYA 1LNZA 4PTLA 3D3QA 1W36D 1DAKA 3QKRA 5LB4A 2AD5A 1QHYA 2IXFA 3IQWA 3A36A 4LHWA 3A58B 2LKCA 1DTSA 4BGDA 5FI0B 2A5JA 2WICA 4HAZA 4ZV4A 1U81A 2FPKA 2YC2C 2ZS7A 3QNUA 1ZC3A 3X1DA 3R7WA 5EE1A 2CHGA 2ZJYA 3K0AA 4FIDA 4Z8XA 4B71A 1RRGA 1HQYE 2QTVB 2C9YA 1M7HA 2WWGA 2CNWD 5FBVB 4DLTA 2QZ4A 2Z43A 1BH2A 1ANKA 5JCPA 3KKOA 2EWWA 3FTQA 2QAGC 1AQUA 1WCV1 1GNRA 4A0RA 1YZTA 4D0NA 5AJZA 3EZFA 4L15A 2XXAA 2R6FA 4GPTA 4IKEA 1CULC 1BYUA 1P62B 3K0FB 1WF3A 2IT1A 3TH5A 1EX7A 2N46A 1WA5A 4TN1A 2MSDB 1TEXA 4Q48A 2EFEB 2YKGA 2QMOA 3GFPA 2RGEA 2G1KA 4N0DA 4RZXA 4XOIA 1T91A 2WHXA 3K09C 3Q3JB 1GNQA 2XJ4A 5C4MA 1TADA 4M9SA 3EA5A 1S96A 5EXXA 4RD2A 2R6CA 2FFBA 1A2KC 1P2TA 4LWZA 4M0LA 4WAUA 1ZBDA 3TK1A 1Q1ZA 5LD2C 3QXXA 5AUPB 3LLUA 1OT3A 1T3SA 4P3YA 4ACAA 1A7JA 1VPLA 4P0TA 4BPBA 2JCSA 4NYMR 2GCOA 4WA7A 1CLUA 1GILA 1ZP6A 5J5CA 1XNJA 2OXRA 3ZD7A 3GJ7A 3A8TA 5KYKA 2BV3A 1FOEB 2J1LA 4Q7LA 3ZZUA 3CRW1 3WXMA 4F7WA 4C7OB 4PAMA 3WRXC 2VP2A 4KBFA 1G20E 4LDJA 2ATXA 4J0QA 2RH5A 5KO2A 1JB1A 3QOFA 4RD6A 2VSOA 2LKDA 4JLKA 3R9IA 4AI6A 1E3MA 1V43A 1KMHA 2FU5C 3GD7A 5JJIA 1AS3A 4YONB 1KZGB 3OESA 3WNDA 1ZD9A 3WNBA 3F0TA 2GXQA 1GSIA 1Z28A 2ZR9A 4U02A 4GSYA 5D3QA 3THOA 3T12A 1R0WA 2CJWB 2XNDA 3OE7A 1OXSC 3F5FA 4PZLA 3ASYA 5JJLA 1TF7A 3B7GA 2BEKA 1U0LA 4Q4HB 4ESHA 3AEZA 3CH5A 2X77A 3KKQA 3TJZA 4OI1A 4JLNA 1G18A 1ZM3A 2ZRNA 4RKFA 1Z0FA 3RRMA 2Q3HA 2Q9CA 2WWXA 4IDOA 4KYUA 4Q66C 4C0KA 3R20A 3TUZC 2G6BA 3HDTA 4DJTA 3H4MA 5HCNA 1ZYUA 2BHRA 3U61B 1KI6A 3W6PA 3PEYA 4OI4A 3SOPA 3PUZA 4HI0E 3PFIA 4XIGS 2NG1A 4IEIA 4TYWA 5DSZA 4LBWA 1EFRA 2XJ9A 2ANBA 4KU4A 1G8GA 2F1IA 1UDWA 2AFIE 3NDBB 1JAIA 1ZNZA 1LVGA 2FF7A 2ERYA 2OCAA 1DO0A 1L8QA 1HTWA 1ZM7A 5G53C 2PT7A 2GZAA 5G3YA 1PV4A 4GL2A 2ZJ2A 3SBDA 1UBEA 4I1UA 4DC9A 5M04A 2ZE8A 4P4UA 2PBRA 1K5GA 5TARA 3V9PA 3ZVNA 5BXQC 2CCKA 2WJVA 2G1JA 5CM9C 3Q85A 1GL9B 5CM8B 5DO9A 2QBYA 5C18A 2JIZD 2O8EA 3UWOA 4UXHA 1E2FA 1NKSA 3KTAA 4C3ZA 5FPSA 2OBNA 1B0UA 4JBWA 2A3RA 3RC3A 1CR2A 4TYNA 3T5DA 2EVWX 2I4IA 2IYLD 1SKQA 3IIJA 2R6AA 2QORA 3AKDA 4Q02A 2HXSA 3KDSE 1Z0IA 2CLDX 3QPVA 5FBWB 4DHEA 4DUGD 4XTRA 2NO6A 2F1HA 5FBLB 3R7WB 3Q5DA 4BFXA 2ZYUX 1E2LA 1ESMA 3CX6A 3U3JA 4DSTA 3GJ6A 4A2WA 1HH4A 4D4KA 5TDHA 1E2DA 1JI0A 1G8HA 3HYTA 1NIPA 2XOKA 4RVCA 2GJ9A 3QXSA 4MYTA 1H8EA 1QRAA 4GBMA 5JJKA 1S1CA 3QKTA 1DAFA 1GKUB 1VIYA 1YZNA 1OFHA 4NYIQ 4JMPA 2QT1A 3UMSA 3AF2A 1XPUA 1NP6A 4JLOA 1P9RA 3EARA 1CR0A 2CBZA 3SNHA 2YWFA 2GZDA 1DOAA 4FW9A 4PFSA 4IRUB 1OH8A 4B3GA 1YQTA 3PV0A 4LYJA 4URZR 3QSYA 1D9ZA 1P2SA 2JLSA 1LF0A 2ZRKA 3AP2A 3CPHA 4GZLA 2P5SA 4NPHA 4Q03A 2EWVA 4KFRA 4C0QC 4Z51A 1NG9A 5TXGA 4PPFA 4Q4JB 1NBMD 3AKCA 4A2PA 2FPMA 2ZI4A 4A82A 1N6LA 4V0LA 4CZ2A 3VR6A 2ECKA 2OCBA 1N2CE 1FX0B 2JJ8A 4BFYA 3VKWA 2RGNC 4TQ9A 2J59A 3MAAC 4FCVA 2O0KA 5FPKA 4H1UA 2JA1A 3PEWA 4B74A 2D2EA 3U44A 5JEDA 4LZZA 2Z4RA 5FTKA 4DCUA 2RGGA 2J41A 1GDDA 2C99A 3S1AB 4FWTA 3ZJYA 4JT2A 1T8UA 1F2UA 4P4TA 4TYPA 2OCPA 4C30A 3SQWA 1BIFA 4XTCS 3TLXA 2F3TA 5CDFA 2ZYTX 1S9DA 3T1OA 4I1SA 3TW8B 5AUQA 3GLHB 4LY6A 4DDTA 1GRQA 3GEEA 2HV8A 3KUCA 3ASZA 4L16A 2EFGA 5K8TA 4FCWA 4Q1EA 3QQ5A 4FMBB 4EAQA 4HAXA 4XVQA 3MLEA 1FFHA 5DYGA 2JLRA 2ZANA 4DLSA 4CRWB 1NY5A 2GNOA 3Q7QA 4GOXA 3AKYA 3KJHA 3AGQA 1W2GA 2J45A 4YLGA 4DVGA 5AWFC 2RHDA 2VEDA 1CRPA 4BFUA 3H1TA 4RCYA 2Q21A 3K0CA 2DB3A 4EPVA 2RKOA 4PAQA 2W58A 1AS2A 2FMXA 4OK6A 4LX0A 5B58C 4MRSA 3OZXA 1FNMA 1U99A 4LHZA 4KITB 2W6ID 1H8HA 1YJ5A 1C4OA 4NONA 2BKEA 4FMDF 3ZLJA 4B44A 1FTNA 3THXA 3CR8A 4F93B 4Q1AA 2C78A 1W2HA 2ZRPA 4DDUA 1KDOA 2LCFA 2YYZA 4LC0A 1N5KA 4M8NE 4G0NA 3PUWA 4QJ3A 3BJIC 1AS0A 5EP3A 4R7ZA 2XTNA 2IUTA 2V7QD 1ZJ6A 5FOWA 4JL6A 4IEEA 2PZFA 4JSYA 4M1YA 1N3BA 3IBGA 4RY2A 3TSZA 1OFTA 3WBKA 4D26A 3A37A 1WE2A 4HUQB 4V02A 4EFNA 3L82B 3REGA 2J9RA 1XEXB 2CNWA 1VG1A 2OHFA 3W3ZB 1ZIOA 3DPUA 1G9XA 4U5XA 5CYPA 3CRRA 3GJ8A 1IBRA 2ORIA 2NIPA 2ZUDA 2WWHA 3BC1A 2ZU0C 1G5PA 3WYFA 4PZZA 2W83A 2WPDD 2ZI7A 2YOHA 3LBNA 3VAAA 3K0EA 3P32A 1D9XA 1NNEA 5CB6A 1KHTA 2QAJA 4OBEA 1XPOA 2J0SA 2IEZA 4A4DA 2CMKA 2V54A 3ZQ6A 3TQCA 2D2FA 4IDNA 3TRFA 4HUTA 2EQBA 2Q3FA 1XMJA 3G5UA 4I1OA 3VU9B 4V0ME 5AJXA 2B6HA 3WP0A 2PEZA 4CW7A 2MMGA 2P67A 3KQNA 5AJWA 3EWSA 4LBYA 5G41A 1XBTA 4DCNA 5EP1A 3A1SA 1E9EA 1Y3AA 1IY2A 5FUYA 2PX3A 1EFTA 4NYMQ 3DVLA 3TUIC 2HF8A 4Q9LA 2RGDA 4NP6A 1EWRA 3K09A 4TLDA 1J7KA 3TQFA 1R2QA 4Q18A 1R0XA 3VHXA 2DHRA 4ZDIA 5GJBA 4JVSB 4IDQA 5EQTA 5L3SA 4JLVA 3T1VA 4EJSA 5FL7D 4L8GA 2VLIA 2FJUA 2WJYA 4F92B 2D06A 4PSAA 1QHXA 2VIIA 3NBFA 1KI9A 2FV8A 3OFNA 2VHUA 3L0OA 2QTHA 3DMDA 3LXRA 1E9CA 4FMCB 2IYVA 3IBYA 4X8HA 1AKYA 2OAQ1 5A0FA 2IWRA 4MKFA 1SVIA 1CJVC 1IJEA 2O0HA 1K5DA 5FH9A 2QY9A 4LV6A 3NVAA 2RHMA 3GLHE 2YNMA 4YMWA 1JPJA 4PHGA 1R7RA 4OI0A 4LCBA 5F9HA 4ZCLA 3B1ZA 3M4YA 2EFCB 5HKKD 4WIAA 1COWD 5KPJA 3NIBA 1KO1A 3F3YA 3DDCA 2XSZD 5JRJA 4M1WA 1E69A 3PR1A 1NF3A 4FMCF 3LV8A 1T5IA 2PJRA 3IHLA 3GMTA 3NC0C 5BYKA 4Y0AA 3B13B 3WMGA 2WKQA 1KAOA 4QBIA 4QGAA 4A1FA 1E96A 3C15C 4B32A 4XWOA 3FMIA 4URXR 4NCJA 2H17A 4EDHA 3AP3A 1WBDA 3THYA 2O8DB 3NH9A 4Q47A 2OUKA 4H1VA 1V5WA 3VMFA 2FH5B 3B6EA 3GLGA 4YMTA 3V4RA 1JJ7A 3CH4B 2HT1A 2C5LA 2NZJA 3VNUA 3KQUA 1CF4A 3DO6A 4NCNA 2VSFA 2D3WA 2HJVA 1IXZA 3ZVRA 4KAXA 4X8LA 5CIQA 1W0KA 4KJZA 1XD2B 3CWQA 4A8JC 3BGWA 3LO5A 4TYYA 1NMXA 4PPQA 2OO7A 121PA 1KSFX 3O8BA 3OEHA 4US0R 4F4CA 4E03A 2V1XA 1ETUA 4HAYA 3LBIA 3SEAA 3AP1A 4BEBA 2L0XA 3D8BA 4EPRA 4MKGA 4OQNA 3ZS9A 2UZIR 2C96A 4DSOA 4Q7KA 4I4LA 4RD1A 2ZROA 1T3LA 1GRRA 2QGNA 3FMPB 3T5GA 2GEUA 3BE4A 2DY1A 1FPMA 2C03A 2DWPA 2HF9A 3DKPA 3W90A 4AIIA 2IEYA 5F3WB 4V03A 1VCMA 2VHTA 3L2OB 1NVXQ 1Q3HA 3BH0A 1JXMA 4FD2A 4G01B 2P2LA 3TSOA 3EXAA 4D2IA 2AX4A 5JHHB 3KQKA 1SVKA 1GWNA 1VDZA 2WIAA 5FPTA 1KY2A 1U9IC 3FE2A 3HYRA 4DT1B 2CLSA 4B2PA 5G3ZA 4TT3D 1F2TA 1R0ZA 4G5SA 1ZAKA 2FNAA 2KSQA 2QPTA 5E7IA 3EX7C 4HB4A 3IO3A 3PJRA 4M1SA 1KO4A 2A5FA 5DHFA 1VTKA 2GZHA 5AJVB 2F1RA 2Q6TA 3CW2A 2R44A 3IPYA 1YR8A 3KB1A 4QC2A 2WBLC 3OAAA 3MFYA 5EE0A 2HEIA 2QROA 3JVUA 5C1BA 4JJKA 3HU2A 2W6JD 4G5QA 3RAPR 4MYCA 4RZUA 3VHLB 3PITA 2VF7A 4ZCMA 3VR1A 3U4QA 1N25A 1P3JA 1HE1C 1QDEA 1R4AA 2P0EA 3KZ1E 4JLAA 1GM5A 3CF2A 1DEKA 4TZ0A 1L4YA 1U90A 1KI2A 1SVMA 1YVDA 3VKGA 1SVWA 3FFAA 3KQHA 821PA 1OFUX 1W46A 4RCZA 5EUMA 2IS2A 4EJSB 2XTMA 5BYJA 1ZNYA 2RGNA 2GXUA 3UG7A 4W5JA 2IX3A 2O8CA 1FMJA 2PX0A 3BXZA 3C7KA 5CK4A 4TSFD 2R6GA 2RMKA 4DEYA 4EFLA 2FOLA 3P26A 4OHZA 4HLUA 3PXGA 4QFMA 1E1RA 4N1AA 5BN3A 5KDDA 4LJ9A 2QN6A 2BKUA 2JEOA 3KKMA 4Q7JB 4IOLA 5L3QB 2RGXA 1CR4A 3W3AA 2FZ4A 4HAVA 1W4AA 3TAHA 2IYUA 2R8RA 4A0HA 3A1TA 4OQMA 3E5HA 1F3OA 4OKSA 1RZ3A 5GVSA 3MMPA 1RRCA 2WAYA 4CDGA 1OF1A 1G3MA 2HYDA 5TMPA 1SHZA 3EIEA 3CWZA 2YOFA 2OILA 3LH5A 3EPKA 4RFVA 4AYXA 5FR1A 1Q1QA 3NBZC 4D0GA 4JKYA 1KSGA 4ZDKA 4JYCA 1ZNWA 1JXOA 3AVOA 3SN6A 1JR3A 1ZRHA 2GBLA 2Z0MA 5KSPA 2OAP1 3QI2A 1YR7A 2NQ2C 2B7CA 1KI3A 4Q19A 2NPIA 1VG8A 1II0A 1X1RA 2WJJA 4AWXA 1E9DA 4N3NA 3EC2A 1CJKC 2GHIA 3C16C 1FZQA 4L9WA 4OQXA 5B2ZA 4C2UA 2MSEB 3TIFA 4DCTA 4E09A 1FP7A 4XWKA 1S9HA 3VNVA 2WVJA 3SBEA 4HEJA 1ELOA 1K8RA 2BCJQ 4PO9A 4BQSA 3B1WA 2W0MA 2QGZA 4AYWA 3QF4A 2WIBA 4IOMA 1E9RA 2X19A 3NKVA 2J0UB 3EZ2A 1IJFA 1P73A 1LS1A 2AN9A 1G6OA 4BLRA 1E9BA 2QA5A 4XH9B 2OXCA 3BRWD 3OIVA 1GUAA 4IVRA 4QG7A 3ZQJA 1KAGA 2ZI6A 4YDHB 4CEHB 3ICEA 3QENA 2C9OA 3NH6A 4YXWD 1T9HA 2OBLA 5FFMA 5GVRA 1IXSB 1YZQA 4GMXA 2ZRIA 4CIDA 2WWWA 2WPDA 1E2KA 4AKGA 3BB3A 3EZ7A 4FINA 2EU8A 5IK2D 1NJFA 1KZ7B 4Q5IA 4P33A 5CJ2A 3RNLA 1W47A 2XEXA 2J7KA 3E70C 5DISB 1YR9A 2ORWA 4D4MA 1Z5ZA 4NYJR 2ZRGA 5EXTA 1NN1A 2ZRFA 1M7GA 1E79D 4PANA 5HTKA 3CRMA 3WBJA 5C46F 1AM4D 1US8B 2VP6A 3AH8A 1S0UA 5JI3E 3SDZA 2JLUA 2PEYA 1ONBA 2ZE7A 1E2NA 1Z6GA 1OFIA 4NDZA 1QG4A 1E2MA 1A1VA 2EYUA 1OIWA 3O8DA 1CR1A 5AJYA 1DPFA 1KTVA 3OHMA 4P4SA 1W4CA 4II7A 3R8CA 5EUQB 1EFUA 5JS7A 1OXTA 3NTUA 4ZO4A 3QXHA 3QKSB 3K9NA 2O8BA 4BLTA 2NZ8A 4DXAA 5TB5A 4ZKEA 5F98A 2R6DA 1GNPA 2IYRA 4XVUA 3QY0A 2CVHA 1T8TA 1N5JA 4O2LA 2NO9A 4DLYA 3U4QB 2QPOA 3SU8A 1G16A 1WB9A 5KSOA 1ZW6A 3BAFA 3QVUA 3ADDA 4MDFA 2YJTD 4URWR 4Z1MA 1EX6A 1NMYA 5HR5A 1JEDA 3OIUA 5JSZB 3AKEA 3I4LA 2FSFA 4ITRC 2O8CB 2WOOA 1GG2A 2QQ0A 2HYIC 3A4LA 2P6RA 1LW7A 1Z3IX 2J7PD 1CTQA 1R8QA 5KU1A 3E1SA 3QF7A 1Q20A 4Q9KA 4B6FA 4TMXA 3GLFA 2P6NA 4CVNA 1IN6A 1HEIA 2IYSA 3CZQA 3EASA 4C9BA 5UKDA 4TLEA 5DI3A 2E1RA 3DZDA 3RS4A 4PO1A 2JLZA 4CEJA 5FUWA 2FSGA 3FHOA 1N0VC 2XSZA 4HZIA 1BS1A 1RYHA 4JLBA 1FUUA 1FW6A 1OXUA 1QBKC 1N6RA 2PL3A 5SZHB 3GJ0A 3ZVLA 1U0HC 4K46A 1WQ1R 4WW0A 4PAOA 1JBKA 1KJZA 2GETA 4LHYA 2BEJA 4DDWA 5J4LA 3CRQA 4GDFA 3A4NA 3L0SA 1IOZA 4ARZB 4HB3A 2FGKA 3A1WA 4Q9JA 4PXAA 4QRHA 1Q1BA 3TVDA 3G82C 3ADCA 4TYQA 4QJ4A 4DSNA 2H18A 3L0IB 2VSXA 2JGNA 1G8YA 3A1VA 4BWYA 4OQLA 3VR5A 4CEIA 3GLGE 1KJYA 4WOPA 3T1QA 4RJLA 5DLQC 5A4JA 4QBHA 3WRYC 4MGYR 2W2VA 3CPJB 5E7JA 4B3DA 3LQQA 2CHVA 3TE6A 1OYYA 1A4RA 1HQCA 4EQ6A 1FUKA 2G3YA 1XF9A 2ASEA 3DOFA 3GEHA 3NBYC 3SQXA 4OHYA 4A8JA 4B48A 1U8ZA 3MWKA 1Z8FA 3HPQA 3OEED 2KBFA 1GRNA 3Q72A 4GMDA 4HDQB 4P32A 2IS4A 1OSNA 2ZPTX 2QP3A 4IOKA 2BOVA 4BZPA 2HLDD 2REXB 2H1LA 1IN7A 5FUXA 4U7DA 1IM2A 1SKYB 1W48A 1XJCA 1BO6A 1E2QA 2NO0A 2IYTA 2DWOA 3K8YA 5FOVA 5KPDA 1J70A 3BB4A 4OI2A 4WXRA 3UKDA 4FCTA 5A5GA 1R0YA 1OH6A 5FR2A 4TT3A 2PLFA 1XB2A 1XCPA 3QKRB 4QBGB 3ZIAD 4AG6A 4B35A 2ZRJA 1I2MA 1XX6A 1Z6YA 1PLKA 1W4RA 3B9QA 2PJZA 2OBMA 3T35A 1XU4A 5E7MA 4D4LA 4DIDA 2XZOA 3UPUA 3NEYA 4RSGA 1OKKA 4L5BA 1HYQA 4TL6A 3WNCA 3ZGXA 4KVGA 3EIHA 3K0AB 2JAQA 3OIWA 4GZMA 3KXLA 3SHFA 2A30A 5ELXA 1G3RA 4AK9A 1IN5A 1IAQA 1E9FA 3WYAA 3PUVA 5H1YA 4DLXA 1TU3A 2IS1A 4XD7D 1ZNXA 3FVQA 4TLAA 2XXAB 1TEVA 5JI2E 1GKYA 4B2LA 3FKQA 1OYWA 1ZINA 1PLLA 3DM9B 4C2TA 3I62A 3RYTC 4DB4A 2DBYA 1QHHA 3CNOA 1G3UA 1SVSA 2G9NA 4Z8YA 2WWIA 2DFNA 5LDDC 4KODA 5D3MA 3RWMB 1G3QA 1U8AA 2ZRHA 2AWNA 3EZ6A 3IIKA 5TVKA 1VIAA 3TNFA 4DLRA 3DEFA 1BMFD 3TMKA 1TQ6A 5FOSA 4TSFA 2FFHA 1AIPA 1VYUA 2QE7A 1XP8A 2WJIA 3I5YA 4TMTA 3PEVA 1S3SA 4B2IA 2AXNA 1SXJA 5DN6D 3H84A 2ZJ5A 1CIPA 2H92A 4E5UA 2CEAA 1W7AA 2QRNA 2JLQA 2Q0HA 3FYHA 2YOGA 3DM5A 4KI0A 3UANA 4IVPA 5AK0A 1LY1A 2GCOB 1EWQA 3AVPA 4LJ6A 2JLWA 2F7SA 1D2EA 2O8FA 2X2FA 1NVVR 4M21A 2O52A 2GJ8A 2HXYA 1ZM2A 1D8TA 3LW8A 1VMAA 2ZRDA 1OHHD 3BORA 1G7SA 5KUTA 2D7CA 2IYWA 2WSSA 1DAIA 1Q21A 1J8YF 2BBOA 3BWDD 3N2EA 1KMHB 4QHTA 3TUJC 4PC6A 3WP1B 3UWKA 1NSTA 3K1JA 1MO5A 2UZ3A 5CLLA 3UK6A 2YZ2A 1OB5A 3GLIA 3SZRA 4WXPA 2VP9A 3QPWA 2WZQA 4R98A 4JKIA 2CK3A 4Q4AA 3VR2A 2J5XA 4KCGA 3IIMA 4A2QA 1KKLA 3L8YA 1EK0A 3X1WA 4A15A 1OH5A 1HV8A 4MITA 5KTYA 2JJ1A 2ZRBA 4XSGA 3LLMA 5KOYA 2KE5A 1KDRA 1O87A 2XZPA 3P27A 4GRAA 1AJEA 5C4GB 3EPJA 1MO3A 3WHKA 3W9YA 3LX5A 4HLDA 4Y0VA 4DCVA 1UKVY 5JHGB 1KI6B 2FDCA 3FFBA 2ZITA 5DIFA 4LJAA 2Z5FA 2QI9C 4GT1A 2IA5A 2ODWA 4EKDA 621PA 2BJWA 4X8OA 1CKEA 1EFHA 3AF3A 3GFOA 1OH7A 2ZTSA 1F6BA 2C77A 1KMQA 1GKIA 2ODNA 2ZVQX 3LWNA 4LPSA 5EP2A 4KHZA 3SHWA 3OF5A 3CZPA 1XXHA 4LJ8A 2A5YB 5J40A 1T0HB 1SKYE 2VP4A 2FFQA 1Z0JA 2VF8A 4KLNA 5JWOA 3GJ4A 2H7VA 3DOEA 5CLQA 4ZPXA 4NYJQ 3H0KA 3GCGA 1B23P 4Q7MB 1DELA 4RZ3A 2GEVA 2GILA 2V9PA 4JLJA 5HCIA 3O8CA 1OXVA 5DI9A 2I3BA 2QEQA 5J4HA 1YE8A 1PJRA 4ABYA 2QG6A 1BKDR 3I1FA 1NVUQ 4R2IA 4RD4A 1OIVA 4BFSA 3FOZA 2QBYB 2AR7A 1E79A 3EAQA 2O8EB 4QL3A 1M6NA 4XSHA 1Q57A 4DIEA 2CL6X 3KTAB 2ZIAA 4H9GA 3VR3A 3CF0A 1HT1E 3QVVA 4RFSA 4A0FA 1YZLA 3CLVA 4BRUA 5JRZA 1G64A 1Z0AA 3IUYA 1XTIA 3UG6A 1CRQA 2ZRAA 2WV9A 1E4YA 3SE0A 3X1YA 5J47A 4E07A 4MH0R 2JATA 4EPTA 4N0EA 2QAGA 3X2SA 3C4JA 3NHAA 1E98A 1N5LA 3U5ZB 3V4FA 2GK7A 3K9HA 3LFUA 3P1JA 1RE0A 1P2VA 4QHYA 1NVWQ 4D0LB 3U3KA 1FQKA 1VG0B 1VCNA 1D2MA 1UKYA 5H68A 2C2HA 2PT5A 5F2EA 4M9QA 1DAGA 2JLVA 4LHVA 2ZRLA 5J4VA 2ZYVX 4HZUA 2B21A 1T4GA 4MGKR 3PUXA 5DE3A 4JSTA 5IHPA 4JLPA 1SULA 2F6RA 4G5RA 4MRPA 1TU4A 4MKIA 3AVYA 2D4HA 2QUZA 1VG9B 2X2EA 1Z83A 5LBIA 1JR6A 4YMUA 5J4YA 4MGIR 2J7PA 4JVNA 4WZAE 5CIWA 3H86A 1CP2A 3QE0A 1G7TA 3HPRA 5GJWC 2IL1A 4JT4A 5HZHA 2VBCA 3GLFE 1VCOA 2R2AA 2R65A 3LD9A 4LBVA 4OJKA 4LJ4A 3LVRE 3RDPA 1W4BA 4UNNA 3RC8A 2AWOA 1GVNB 2EW1A 3AUXA 3U44B 1QVAA 3THWA 4P31A 4ZIRA 1G4UR 4PX9A 3HR8A 3LVQE 3ZVMA 4B3BA 5FOXA 3W5JA 1P2UA 2ODBA 4E22A 3MWJA 1VECA 1VYTA 1F2UB 4QGFA 4B6EA 3KKNA 3LW7A 4W9MC 2WJGA 5FI1B 4GP6A 1NL3A 4PHFA 1AK2A 1MKYA 4PPNA 4AG5A 1Z0KA 5EE5B 3W5IA 1G5RA 1UBGA 1DG1G 3QBVA 4HB2A 2QSYA 4F4JA 4CF7A 3GLIB 3SFVA 1KNQA 4HLQB 3W8NA 5IRCD 3M6AA 2OG2A 4DLUA 2PCLA 1T0JB 4O2RA 2HCJB 4Q1FA 4BZQA 2XTZA 4UJ3A 1RJ9A 2ZI3A 2PH1A 4DZZA 1XZPA 1PZNA 4NCIA 1XEWX 3B78A 3RS5A 4UNSA 3Q9LA 3CX8A 4GOKA 3IEVA 2ANCA 3REFA 4ILEA 1VHTA 5TV2A 5BW8A 3U6BA 1N0WA 1JALA 1SHKA 1S2MA 1WDTA 4RD0A 1MO4A 3RRYA 4LGMA 5EP4A 3VX4A 1E1QD 2KI5A 4PQRA 4TWZA 4BZXA 2QENA 2ZI9A 4B43A 2ZYWX 2XNDD 1W44A 2OT3B 4G1UC 2YWGA 2ZE5A 3MJHA 2F43A 1J2JA 2GJSA 3ND9A 1DO2A 3THXB 5L3VA 2Q9AA 1ZUIA 4AKIA 1JEEA 2JIZA 1IY0A 3CNNA 2ONJA 1TF2A 1QZXA 4V0NA 4EIWA 4LV5B 1WRBA 1G5TA 2GAOA 4BUJA 4MDEA 3AM1A 4ZCIA 3MCAA 4GOJA 1ZUNB 2C04A 3CPEA 4Q1BA 3IQXA 1F5NA 3NBXX 2AK2A 2ZJ8A 1II8A 1KI8A 1BYIA 2BM0A 1N6NA 1MRSA 4GI7A 3ZH9B 3ZS8A 4DUGA 4KVAA 3KQLA 3QG5A 4ESVA 1MABA 2J0VA 2CE2X 2WWYA 2VHQA 4A6XA 3LRPA 4JYBA 1W1WA 3GJ3A 4BFTA 2ZM5A 1H65A 4DWJA 3EG5A 1EFRD 2BMFA 2VO1A 3BK7A 1Z07A 1JNYA 2QQEA 4PC7A 4Q4LA 4R2HA 4XD7A 5B30A 2SHKA 4QOSA 3W6OA 1NSFA 2VH5R 1TUIA 2JLYA 3LXXA 4LV8B 2GKSA 3VTKA 3ECCA 2VQSA 1OB2A 2NMVA 2FX3A 1Q1EA 3UMFA 5JECA 1P5ZB 4LUCA 3QKUA 4TMWA 1SZPA 1M34E 3VFDA 1UKEA 4JJZA 1VYVA 2HDNB 4BFWA 1ZIPA 3C41J 4PC3A 1UEIA 2FG5A 2W0SA 2D7DA 2Z6VA 2NO7A 1E6CA 2ZJZA 3U7GA 1E32A 3O8RA 1NBMA 1SVOA 2RGBA 4JVMA 3BH7A 4PC1A 3VKHA 3DHWC 3MD0A 4MUBA 1NVVQ 1KSJA 3QXJA 5CJPA 3FPAA 5CYOA 1G21E 1NKTA 1PUJA 3KJGA 2IYZA 4TMZA 3K0FA 3LQRA 5E95A 5KNCA 3SJAA 1ZD1A 5L3SB 2V8OA 5AUOB 3QEJA 2OZEA 3NWJA 4LK2A 4QJ5A 2NPFA 3RABA 1LFDB 3RS0A 1KNXA 4A9AA 2DPXA 1N6HA 2GXAA 1AA9A 2PLRA 1EFCA 2CXXA 1KGDA 1T3HA 2XOKD 1YRBA 3QPUA 4LRWA 1ZCBA 4Q00A 2IK8A 2BBWA 2BIFA 2OV2A 3UMRA 1D2NA 4YMSA 4KBGA 1KO8A 5FPYA 1NLZA 1CU1A 2YWHA 4KFTA 1VHLA 3RVBA 4C0LA 5CDFE 5HE9A 5H8WA 1X8LA 2IUUA 2B8WA 2RGAA 1IN4A 2ZSEA 3GLIE 4IOJA 2QRZA 3IDQA 2ZSBA 1Z2AA 2YHSA 4C7OA 5EXSA 3E2IA 4I99A 2IF0A 2AKAB 2CL0X 2ZI5A 2W2XA 1OXXK 3F8TA 3JZMA 2BBSA 3B5JA 3DZ8A 4ZDJA 1XZQA 2ZXUA 3RS3A 2JJ2D 2VHJA 1C1YA 2ZUBA 2PCJA 4LHXA 4NHOA 5E4FA 2W6IA 2YWEA 2CJWA 1NJGA 1P75A 5HPYB 1OJLA 3MG9A 1P72A 4OQFA 1RFLA 1ZCAA 4OHWA 3AVWA 1G8FA 2IS6A 4Q4HA 4B73A 2P6UA 4Q1CA 3THYB 1II9A 1F48A 2DCUA 5IDVA 3QBTA 4D4JA 3GLGB 2GF0A 1A2BA 5JMTA 1DADA 1EXMA 1N6PA 4GP7A 1AZTA 2V7QA 4IXNA 3UIEA 1OW3B 1Q44A 1U8YA 4ZDWA 4BLSA 4D25A 2HJGA 4R71A 1KYIA 5JWRA 1MO6A 2CCGA 3N2IA 2VPPA 2ERXA 4W7SA 2Q3MA 3ZZTA 3SI7A 3X1ZA 2YVUA 3U7HB 3ND8A 5CITA 2HT6A 4LOAA 3EIQA 3K0CC 4B33A 1RW4A 2D62A 4B47A 2XNSA 2ZSAA 3RS2A 1HE8B 4JLMA 4RKEA 5GJVC 5JCZA 3EPLA 4YDSA 4JBYA 4UXIA 4GNKA 3NXSA 3FDIA 1HA3A 1DBSA 1LS6A 4MKHA 2FA9A 1UJ2A 5SZIA 3BBPA 4TLCA 1HT2E 4KV9A 5SZKB 2C9CA 3C5CA 3HWSA 4X8MA 1H8HD 1XWIA 5HE8A 2Z83A 5LB2A 1MT0A 4TLBA 1TQDA 2QMUA 1DAHA 2IF2A 1TMKA 1ZUHA 3N5CA 3CB4A 3IILA 3AGPA 5EE3A 4LC1A 5FTMA 2ZAMA 1F2TB 3BFVA 2BMJA 1CJUC 1E94E 4QHSA 4XJXA 3UATA 1FL9A 3MWYW 1XPRA 3PUYA 3I3SR 4UJ5A 1YZUA 2CLCX 2X1VA 1XEWY 4NU0A 2ZQ5A 5JEEA 3SYLA 1UKZA 4AYTA 3AVTA 1QHNA 1QVRA 3GJXC 4I81A 1Z22A 4BEJA 4MA4A 4CGZA 4ASUD 2A9KA 1FTSA 5EXPA 1X1SA 3W8RA 3ICQB 1Z6TA 1G17A 4UNPA 3GQBA 1DAMA 3K9LA 3B9PA 2UVQA 4K8OA 5FL7A 4O3MA 4M1TA 3TGPA 1U94A 2A7QA 2WKRA 2GVDC 3U3MA 3JZAA 3BD9A 2F1JA 1Q0UA 3B1XA 2GRJA 5B57C 2WMNB 1OE0A 1XD8A 5JZVA 2ZAOA 2ZS9A 3ETLA 2EYQA 5JBQA 1DS6A 2FN4A 3DL0A 1R5NA 1XRJA 1E2EA 1ZC4A 3UXMA 4ERNA 2DFTA 4V0MA 2ZR7A 3SYNA 4LYFA 4B3CA 2MMCA 3AUYA 4MGZR 1PVOA 1SGWA 4WBSA 3WMFA 5KNBA 1XTKA 3FB4A 3BB1A 2CVFA 3JVVA 3GPLA 4DRZA 1Z6AA 4AKEA 1NMZA 5HKKA 1F60A 1COWA 3ZD6A 1TQ2A 1N6IA 2OSBA 4Q4JA 4EPWA 5DHAA 1KKMA 3I61A 4KO8A 4UXJA 2V6JA 3TAUA 3KJEA 3BIFA 4MRVA 4JBXA 1XTJA 4EJSC 1FX0A 3CNLA 2ZRMA 4LJYA 1XCMA 1LTQA 4G5OA 1Z29A 1XEFA 2DFLA 2BWJA 3ADBA 1RC8A 1NN0A 2JASA 2R62A 2YINC 3LDAA 5L8VA 4EUNA 4PHHA 4IHQA 3S1AA 3TR5A 2XX3A 2DYKA 1P61B 3X1XA 5KNDA 2ZJBA 4M22A 1X8JA 5K8UA 2DFKB 1OLOA 2GK6A 2NO1A 2J3EA 2C95A 1UM8A 3OFND 2MSCB 8OHMA 221PA 1E1QA 3SYKA 4MRNA 4M1MA 3B60A 3GLHA 1KJWA 2GDJA 1MR3F 1OIXA 2IYYA 4UNRA 2REBA 2GJAA 1VKJA 1Z2CA 4MYUA 2Y8EA 1J90A 1Z47A 4OHVA 5BWMA 1X8KA 1N0UA 1P7CA 3T06B 2NGRA 1UEJA 2REOA 2GCPA 1QHSA 2P5TB 3B8HA 1FQJA 3QF4B 3NG1A 1G1MA 3C14C 3RWOA 1WP9A 4O25A 2WSMA 5FTJA 1E2JA 2ZVPX 4LSGA 1HUQA 4C0JA 2OM2A 4K81B 5JWHA 3RSLA 4JLDA 1X6VA 5FTLA 2FZLA 2V55B 2QT0A 4M2LA 4M1KA 3PG5A 1UAAA 4JL5A 2LWIA 2P3SA 4Q01A 1S8FA 1M2OB 4V0KA 3N70A 3A4MA 2RB4A 1KDPA 3R9XA 2OFXA 5ANRB 2JDID 2ATVA 1QHGA 4NKRA 4EFMA 1U9IA 2H8KA 2QPAA 2J0QA 1KO7A 4BRWA 1QG2A 5J4KA 4B76A 2FSIA 3P20A 3IPXA 2BBTA 1W0KD 2IXGA 1TNDA 2WOJA 3ZDQA 3CKLA 2KB0A 4IVQA 2W6JA 4NL4H 5DYIA 4HUQA 3OEHD 1ZM4A 1XEXA 2XGJA 3BOSA 2XB4A 4M9ZA 4ZKDA 3AQ4A 3LBHA 5EJEA 5SZJA 4PHTA 1IONA 1MH1A 1RVDA 3BFKA 4B3XA 3LY5A 1ZMXA 4QM7A 4IXMA 1XJQA 1AGPA 2B92A 1NBME 2B7BA 3GEIA 2XITA 3B1VA 4P4SB 3Q5EA 3Q7PA 3T15A 2W2TA 1GL7A 2AD1A 4JZKA 3PCRB 4RD3A 1DARA 1GZSA 4WZ6A 5JLJA 2VYFA 2A78A 4JVLA 1S3GA 2O8BB 4PQYA 4D81A 4NZYA 1G291 3VU9A 1CBUA 4NCKA 2QMEA 2GVZC 3AF1A 4Q9IA 2V6IA 4DLWA 4TTQA 5DH9A 1CJMA 4TL9A 1EG7A 1P4SA 2TMKA 3KUDA 3PQCA 5KSYA 3P4YA 3R8FA 2VA8A 3R9WA 1R5OA 2F3RA 4PO8A 1KDTA 5CB8A 3IEUA 1O3YA 2BC9A 1YRAA 2N42A 2ZSDA 4M4SA 3ZZ0A 2FPLA 1TF5A 3OAAD 2ZSFA 2CDNA 5K8LA 1P6XA 2OEPA 3GLFB 4MQBA 1RRFA 1X3SA 1P9WA 1ODFA 2H16A 5FL3A 5IF9A 2O5VA 1NI3A 3EA0A 3K9GA 1MRNA 3KB2A 2ZREA 3GJ5A 5DI3B 4CEJB 4IFEA 3VQTA 3PENA 1J99A 4DKXA 1IXRC 1WMSA 1ZM9A 4FN5A 4JL8A 1JJVA 4OHXA 2QP4A 1NIJA 2QU8A 1TPZA 4NTZA 1T6NA 1KI1A 4NH0A 2JJ2A 4CT5A 5BN5A 3SC3A 4R9UC 1A5TA 4HAWA 3PVSA 4HLUC 3KKPA 4C0SA 4QGHA 1S4QA 5AUNB 1IQPA 3SR0A 1X86B 2WKPA 3FKSD 1JR3E 1DAEA 3WHLA 4C0AC 4LYAA 1OV4A 5CK5A 2GWHA 5EZ5A 1UDXA 3I8XA 4B34A 1YKSA 3CIOA 1ESNA 1YZKA 3RANA 2WM9B 5KDLA 2QNRA 3BS4A 1E1RD 1HURA 4LI0A 4PC2A 5HZKA 2IWHA 2FSHA 3NHBA 1RPZA 2ONKA 4CEIB 4HDOB 4F38A 2QM8A 3M0EA 4FMDB 2BDTA 3BERA 2GESA 4F91B 2WWFA 1OPXA 2QSZA 3I72A 5B64A 2OFWA 3IKJA 4BLOA 2QP9X 4YXWA 421PA 1CJTC 5LPNA 2G83A 3RSOA 2VTKA 1E2IA 3U2QA 4EQ6B 4KSBA 2IXEA 2GEDA 2ZS8A 5FOTA 4A8JB 2AFHE 2O8DA 2GBLC 1XCGB 2BCGY 1BOFA 1LB1B 2GTPA 4QGGA 3K0SA 2OLKA 2IHBA 2N1BA 5IK2A 4DB2A 4DCSA 1JECA 2IHYA 3AV0B 1E0SA 1CS4C 1I2DA 1RYFA 1LV7A 2VHCA 1KOFA 2PZEA 4C0HA 2AL7A 2A5GA 1JR3D 4Q9HA 4MRRA 4S35A 1E0AA 1KK3A 4D82A 1E2GA 1DE0A 3LAWA 5KSZA 1XD2A 2ODEA 1Q12A 4NMMA 1GIAA 1GFIA 3C5HA 2XZLA 1NY6A 2OESA 3QG1A 2PMDA 1Z0DA 4DLVA 1CEEA 3PEUA 2IBMA 4CYMA 4YMVA 3D31A 3MRSA 3QUSA 1KIMA 5FBQB 2HCBA 1W5SA 3G0HA 1UADA 3MWLA 3D6TB 1KO5A 1W0JD 3RHFA 4BE7B 2EFDB 1SQ5A 2WMOB 5BQ5A 3V00A 3AVQA 3L43A 4ASUA 5DNYB 5AR1A 3T61A 3I73A 1PLJA 3KFVA 3T34A 1NN3A 4TL8A 2PZGA 4URUR 1AN0A 4DT1A 4KXFB 4US2R 1MOZA 1UBFA 2QL6A 4POAA 1W5TA 2IC5A 2D74A 2QTFA 3H2YA 1IHUA 4PSVA 3SS8A 3I5XA 1QHHB 3U7EB 2DWQA 3FHCB 3KL4A 3MSXA 4OYHA 1KSHA 3AB3A 4AC9A 3K70B 2A2ZA 3SJCA 5D3MB 4HYYA 2ZEJA 1GP2A 1W49A 4G5GA 2GCNA 2X8AA 4ZI2A 1AKEA 3AF4A 5FBRB 4TL7A 2G88A 2CHQA 4LBZA 3CRVA 4CT4B 2RCNA 2ZUCA 1Y63A 4XVRA 1P60A 4B3FX 1SXJB 3AVUA 1N6KA 2WJHA 1EGAA 1U0JA 1UBCA 2KJQA 3CONA 3Q8XB 3L8ZA 1UPTA 2WAXA 2V1UA 1I4DD 4TQUS 3HJNA 2R9VA 1DG3A 1R10A 3I92A 2E87A 4HB0A 1ZU4A 4IW3B 2O8FB 1LF5A 3B82A 4US1R 3TW4A 4MYHA 2IW3A 1G7CA 1NRJB 2CL7X 3BH6A 2W00A 3IGFA 4LPKA 1Q3TA 1Z08A 1G8PA 2GF9A 4BLQA 3O47A 5FPHA 3RLFA 1XTSA 4M53A 3B1YA 2IUSA 4D6PA 4HAUA 3HR7A 3QIAA 1NN5A 5E3HA 1RRPA 5JFGA 2BMDA 1GTVA 4QNMA 1GITA 2YC4C 3QEOA 4OK5A 4BLPA 4Z1MD 3LA6A 5L3QA 1QHIA 1EESA 1FMLA 3NEJA 1IN8A 2V4ZA 1U98A 4UNQA 1KI4A 3W6NA 3WMEA 4Q4AB 2IYXA 1T5LA 1M7BA 2P65A 4KLZA 4OK3A 4ZI3A 2NOAA 1L7VC 4EPXA 4HDCA 2FFAA 1E0JA 4BASA 1PUIA 2FE4A 5FUVA 5L3RA 3OEEA 4BFZA 3MJRA 721PA 1NLFA 1R5BA 1E99A 4KYIB 3U7FB 4B75A 4NE2A 1JAHA 2ZE6A 1N6OA 3SJZA 2HLDA 4G3XA 3LNCA 3OE7D 1N5IA 3KXIA 3EC1A 1J8MF 4JIMA 4DSUA 3EPHA 2F9MA 4IDHA 2VP0A 2OE2A 1M8PA 2JLXA 1XXHB 1D5CA 1YR6A 4AY2A 2Z4SA 1W36B 2XAUA 3P4XA 3ZIAA 4URYR 1M1YE 2B8TA 2JDIA 2OCYC 1D6JA 4W5WA 1I4LD 1U2RA 1KK1A 4A0GA 2ZJAA 1JPNA 2EFHB 2H57A 2J0UA 4TMKA 4EPYA 2RAPA 4JS0A 4YQFA 1M74A 4V0OA 1G19A 4HLCA 3HP1A 1XTRA 1XTQA 2VRWA 3AF0A 1JQJC 4CEHA 2CCJA 2OFOA 5C2JB 4A6PA 4KFSA 4RFSB 1YHNA 2AXPA 4PZYA 4OL0A 4QBFA 1XJ0A 2ZR0A 5F9FA 4IJMA 4C4PA 1TX4B 1ZU5A 3KJIA 4HATA 2QAGB 4KFUA 3M1IA 4Z54A 1E9AA 1HY3A 1XDBA 4URVR 1FP6A 2FEOA 4NCHA 5IT5A 2UKDA 1TAGA 4RZ2A 3CUEF 4TTRA 1BMFA 1I4TD 3OIYA 3CBQA 4QXAA 4O0MA 4LJ7A 3A1UA 2GXSA 1JQLB 3I32A 3TBKA 6Q21A 2IYQA 3MUFA 4HZUB 5FTNA 2G77B 5DN6A 3RRZA 1US8A 4AKHA 1Z6XA 3CX7A 4IFBA 3SJBA 3ADKA 2BMEA 1UFQA 3GFTA 1ZD8A 1G4AE 1L4UA 5H70A 1GOTA 1SXJE 1GAJA 2V3CC 2J87A 1WBBA 2QMHA 2BVNA 1OKKD 2NTYC 5GADl 3K53A 1CXZA 1Z63A 5LD2B 2ZJOA 4AD8A 1SVLA 1E2HA 4M9XA 1E4VA 3QKSA 2DR3A 4M1OA 2HUPA 1TTTA 5BN4A 1OHHA 4LYHA 4DLZA 3T1TA 2RGCA 3HU3A 4PSKA 4DBLC 4TQAA 3K70C 3KFXA 1RKBA 1H8ED 2CE7A 2YV5A 3EZ9A 4LJ5A 4I1VA 2H5EA 2AHOA 1NG1A 4WZBE 1L2TA 2GA8A 4ZIRB 3THWB 3QXCA 1FNNA 1TQ4A 3EW9A 3MGCA 2E9SA 4S2EA 4WVFA 3AVXA 3K70D 4Q1DA 3FMOB 4UKDA 2C98A 4TTPA 3ZYCA 5JSZA 3TVTA 3FHTA 3FKSA 5K8IA 1G6HA 1SXJC 1IY1A 3NDPA 4L4UA 1MV5A 4NYIR 3U60B 2O0JA 2QE7D 3TKLA 3TR0A 2J46A 4GFDA 1AZSC 2FGJA 3CR7A 4IDPA 4Q21A 1SXJD 4FI3C 2XB2A 3U3RA 3KXKA 4A92A 2G0NA 3EWAA 5KDOA 2C8VA 3TSWA 3DKVA 4L9SA 4U00A 1R6BX 4XWAA 4BFVA 4BECA 5EZ6B 4D80A 1WXQA 4ACBA 1E0KA 3FMFA 1AQYA 5EE9A 3HU1A 4QNRA 2I1QA 3BFXA 1XD9A 4TMVA 1GL6A 1RJ9B 3CM0A 5GJCA 2G0TA 1AGRA 4QM6A 4PPGA 3RRNA 3RS7A 3AVVA 1XMIA 2GJKA 4MUAA 4ARZA 1E2PA 1VCIA 1E9SA 2ZETA 4KSCA 2WSSD 1C9KA 2VP5A 2A5DA 3DMNA 2AKYA 2KWIA 2FWRA 1XXHE 1G41A 3C8UA 2KBEA 3LX8A 521PA 3U6KA 1Z06A 5TY0A 3A6PC 4PQFA 3FWYA 1Q22A 4ON9A 4FWIB 3SFZA 4A36A 1TUEA 4DDVA 4TZ6A 2FEMA 1TL7C 4DEXA 3B2EA 2F43B 2I1VB 1RIFA 3J81k 4F4IA 4HSEA 1G7RA 1YZGA 2CK3D 2QM7A 4UQOA 4AURA 1DVRA 4W5HA 5G40A 2F55A 3PIRA
chains in the Genus database with same CATH superfamily
1IN1A 3JQCA 2YZMA 1QF9A 3QIVA 3WHPA 5KKAA 2HBYA 2O1SA 5ETJA 3PCTA 1UDCA 3VX3A 2HF2A 1OLXA 3NTOA 4M76B 3GDWA 4L8FA 3I8SA 1A82A 7MDHA 5K0TA 3ZU5A 4CKCB 2DHDA 4NZMA 5JS8A 4E94A 3TQQA 3VYVA 4OV6B 2L69A 2B99A 5EJ6A 1MABB 1CYEA 4B0PA 3AILA 5JPIA 1KK0A 2ZU6A 2VL7A 3CKMA 3K2QA 3ZK9A 3B85A 3D7MA 1EX1A 2F48A 4II3A 1XMVA 1SEVA 3O94A 4RA6A 3A6EA 1R15A 3C7TA 5KHOC 4C0BA 2J33A 4MCHA 1X70A 5A0TA 1ZS9A 2YXBA 3CC8A 4PR0A 1CZNA 4ETIA 3L0PA 1PL0A 1J22A 3W34A 1P9NA 1KK2A 2AK3A 1NLYA 3OJEA 4V3CA 1W36D 4QOHA 1VPTA 3K72B 1BXZA 3JCZA 3LGXA 3KXPA 4N5MA 4QX6A 2HREA 1TJ4A 4WUTA 5F78A 2A33A 3W77A 3QV1A 2LKCA 4BGDA 1QGZA 3I28A 5HXAA 1LVUA 2WICA 3CKKA 4YRBA 2QSUA 4HAZA 2NLOA 4FONA 2FPPB 2YC2C 3C6KA 3QNUA 1ZC3A 3G7UA 4ZV4A 2WYWA 1JDJA 3V4OA 1QBGA 4JJFA 5EE1A 2PR7A 4Z8XA 4FIDA 4OQZA 4B71A 2QJWA 4MSUA 2QTVB 2RIPA 2RHGB 1MVLA 3IAFA 3MOSA 1XI2A 4I1IA 2C9YA 4MLPA 3LG2A 4NBLA 4RMHA 4DEVA 5FBVB 2ZCUA 3JQQA 1GGNA 1K7SN 5ECWA 5T41A 1ISSA 1IJBA 5JCPA 1WVGA 3DVAA 3DZJA 1AQUA 1WCV1 1GNRA 1XQ6A 1ZVJA 1XAGA 1MQSA 1RWPA 4K7JA 4L85A 4CUKA 4H4EA 5B3JA 3HACA 3C6BA 4HEA1 2R6FA 1JKFA 2XXAA 1BYUA 1C3LA 2VNAA 3WB9A 1FRZA 2EIHA 2NPOA 4H7HA 1PGOA 5J1TB 3D3WA 4Z53A 1WA5A 3MELA 2WDPA 5EVJA 2WE7A 3RT9A 3RU2A 5B6PA 1SBYA 1V0JA 2WUEA 2CT8A 4JR1A 5B1DA 3VPBA 4E2WA 3GFPA 2ZUFA 4NU6A 2ASVA 4PW0A 2E4VA 3H1FA 1B73A 3PXAA 3K09C 4CIAA 4X71A 3OTHA 3QY9A 1EIZA 3R0XA 1LTHR 1V48A 2QYHA 4YJKA 1N57A 2CMHA 2J30A 4DUPA 2DUJA 1N2XA 1P2TA 2P2YA 3I23A 5FWDA 4DZRA 2CXTA 4GPIB 1AHHA 1ZBDA 2I22A 2BPOA 3TK1A 5KTSA 1T1EA 3QXXA 1L8LA 2P9TA 4YRGA 4NMLA 3CLHA 3DPIA 4P3YA 4EHAA 1T8YA 5COQA 2FP4B 1VPLA 1DX9A 5IU6A 1KEEA 2BP7B 3D8RA 4KXWA 4TZTA 4BPBA 2JCSA 5DBOA 2I0FA 4WA7A 2X3FA 1GILA 5J5CA 1AU9A 1QF7A 3GJ7A 3RIHA 2CYCA 3OZBA 2XIQA 4Q7LA 4AUNA 1KS2A 4EKNB 2G7MC 1AKUA 2D7JA 3OFSA 3PQ8A 1G20E 4LDJA 2ATXA 4J0QA 2RH5A 1ZK4A 2QTWB 4RD6A 1WV1A 2C9DA 3B5IA 3FNHA 3L4BC 3FJYA 2GZMA 2JAHA 1E3MA 1KMHA 4LOIA 5AKJA 1NF8A 4MCIA 1CZLA 4XX1A 3ZTYA 1GSIA 4A27A 1NYLA 2OC9A 1ZVMA 4OLJA 3WOHA 2Z3WA 3T12A 1TVMA 2QRQA 2XNDA 3GDFA 3OE7A 5CX1A 3V7NA 2CBGA 4HRYA 4BNKA 3OPYI 1P1RA 1U0LA 2PMEA 5G02A 3GEBA 4Q4HB 2BKXA 1T29A 3CH5A 4Z9YA 5J3JA 4NE9A 3UYLA 1PUXA 4TXMA 1NTRA 3A26A 3TJZA 1U1GA 3PU6A 4BY9E 3O8QB 2HTFA 4BP1A 5K8VA 4HL6A 4UU8A 2IUYA 3C8MA 4ZCTA 5IT4A 4YS6A 1MAWA 4KMOA 1X7GA 4KYUA 4Q3DA 4TRRA 4C0KA 2A58A 1HOTA 2Q8QA 2G6BA 4K6MA 4CKEB 4LXIA 3HXTA 1HK7A 1KEZA 5EQFA 1QS0B 1ZYUA 2BHRA 2QR2A 3L1VA 4R69A 3CCCA 3HYLA 5F1YA 3GRPA 5MGNA 3U61B 3OFKA 4MP3A 3ER8A 3PFIA 3R3YA 3U3MA 4XIGS 2NG1A 4GXNA 1SZCA 4REQA 1ZH8A 1AQ6A 4LBWA 1XO1A 4N7MA 2ANBA 3HWWA 4HRXA 2M6RA 4NPAA 4G8BA 4N54A 3IUNA 4ZAXA 1HEUA 3ZWYA 2WHEA 2CY0A 4ZXPA 1JAIA 1ZNZA 2CLOB 3EEQA 5AVWA 4M49A 3DDUA 1Y1KE 3MRVA 3S2UA 1DKLA 2VF5X 3BYZA 3IXQA 3MYYA 4S0XA 4UVGA 2E1PA 3RRFA 5GINE 1CHNA 1DO0A 2RK6A 5DM70 1QLJA 4PCLA 4Z9XA 1LH0A 1ML3A 1PG0A 2CHUA 2H5JA 1HTWA 2YXEA 3CINA 4GGOA 2PT7A 4KWCA 5DTIA 3D7SA 1YQEA 1PV4A 2BEVB 3ICCA 1OYVA 4L0DA 4C29A 5ICSA 3GMSA 3OA2A 5COAA 3B3FA 2YV2A 3JU3A 2ZE8A 1IG3A 5BRJA 2PBRA 1JQEA 1K5GA 4ZEXA 2PUFA 1ZEMA 2FXIA 5JAOA 2CCKA 2IV3A 2WJVA 2JGIA 2FZEA 1CX9B 2GI4A 3FWHA 1GL9B 3ZWMA 2PO5A 5M2QA 5C18A 2QBYA 3T7DA 1YDEA 1ZD5A 4IUYA 4FHEA 1H05A 1RM3A 3OOSA 4TTRA 2R6HA 1B0UA 1FLAA 1Q92A 2A3RA 2Q2QA 5ALJA 4CIBA 4TYNA 9ATCA 4EHKA 4LF9B 2I4IA 1SKQA 2I1WA 2QORA 5CVEA 2X8BA 3IA2A 3KDSE 1TD9A 2CLDX 1QH1B 3QPVA 4LNAA 4XARA 3UXYA 4UBMA 4BNUA 4DHEA 3R7WB 5EPUA 2ZYUX 2YMLA 5JMPA 4E46A 3IUBA 2XA2A 4R01A 1ESMA 2CLMB 1LX7A 4DSTA 1H2BA 3GJ6A 4WNAB 3N3AC 3GLQA 1L7QA 1TUBB 1ZMTA 4D4KA 1T36A 2D5IA 3CO0S 3I3OA 1E2DA 4ZZ2A 1NWHA 1VLVA 3PD7A 3CHYA 2XOKA 3PT5A 4WCDA 4HEQA 2GJ9A 4HLNA 2XWPA 3ST7A 4JEIA 2QZ9A 1H8EA 1B3RA 5HUJA 1XVTA 3MINA 1LSSA 4P92A 3OT4A 1M34A 1NVMB 1RBMA 4Q3OA 2BM9A 3AF2A 1NP6A 4JLOA 5KX5B 2UUBB 4MUIA 2D1FA 3MHTA 1CR0A 2GD6A 4KGZA 2OGSA 3MZ0A 3WQBA 3OT1A 2CBZA 1U2DC 4YRMA 1J8VA 1OZGA 3H1PA 4IIJB 1QAOA 4IRUB 1OH8A 3H0EA 1ZD3A 3DB2A 4W1SA 3QSYA 1P2SA 3AP2A 1U2ZA 3QLVC 4XFKA 4D3XA 4DG8A 1P33A 1EA7A 2VJBA 1VSUA 3VVLA 5E1OA 1Y0BA 2HLNA 4EYSA 1E20A 4O4HA 4A2PA 4A82A 3HKDA 3LBYA 4X1YA 1XKXA 5F2OA 5JSKA 4CZ2A 4E2FA 5A3SA 2OCBA 2VDKB 1RWNA 2J59A 1A5SB 1GT91 4Z7JA 1E61A 5A9SA 4KWIA 1PQPA 3MAAC 2O0KA 3OI7A 5KREA 3J7TA 1MENA 2JA1A 4KRFA 4G0XA 5KSZA 3H97A 4G23A 3WTBA 1IK4A 2HPAA 2ZSUA 1PR4A 4MWCA 3IR6A 4TS1A 5H81A 2AZXA 2G07A 4I4IA 1KMNA 4F2WA 4E7PA 3CLSC 2GK3A 4FDAA 1F2UA 4TYPA 4PZPA 1H4VB 3AO0B 1FXWA 2RK4A 4CLDA 2RHTA 4OP2A 2F3TA 3DV0B 2BFDA 4R81A 4N6OA 3L0BA 3D7KA 1VL2A 3URMA 2HY7A 3T1OA 5B58C 1RXIA 1BW9A 1O6CA 1VBKA 1NASA 3OKAA 2AG1A 4MOWA 3RFVA 3AZPA 3Q3VA 2VN8A 1HFWA 1GL3A 3F8WA 3KUCA 3C70A 3RE1A 5E8JA 1M9NA 4FCWA 1A9XB 4A8TA 4FPXA 2EAUA 3PFNA 3ZWVA 4ME6A 4HAXA 4NJMB 3RC9A 4CM7A 4XVQA 1WSDA 2RHOA 3SIRA 1UZLA 3CUYA 3OZDA 1ST3A 2V0GA 1FFHA 4LYGA 1NBHA 4HEA6 4J0FA 4MO9A 4NFLA 3I9V1 4IDCA 3IAXA 3NHUA 1NY5A 1RWVA 1EUZA 2GNOA 2YV3A 2ZWPA 3Q7QA 4GOXA 2OZKA 3C3YA 5FBZA 1YS9A 2J45A 3O4VA 3UM9A 1YMUA 4S1OA 3EVBA 1N3IA 4F2HA 1IZ7A 5JATA 2RHDA 5JSQA 1CRLA 1Q7BA 2H1HA 3KOWA 4QNNA 4BJ3A 1DHTA 2IQ5A 2QDKA 1YA6A 1CRPA 4RCYA 1VHDA 3C4QA 3OKCA 4MUYA 2PD4A 3NJRA 1EFKA 4KQIA 1PTJC 4TWBA 4LX0A 3AEUA 3TPZA 4LTNA 1R6AA 4JOSA 3O90A 1H8HA 2VRBA 1WNFA 2Q1XA 5I9SA 4D8TA 4GL4A 2IYFA 4KIFA 4ZODA 4F5WA 3AFHA 4KDFA 3VO1A 5J2UA 2VHZA 1U7UA 2SKDA 1QQ5A 3L9WA 4OAPA 4B44A 3THXA 1BWQA 1RJGA 2JFQA 5JXIA 3KUUA 2GEBA 3PHGA 5J59A 4WBNB 1W2HA 4MMZB 4F93B 1QDLB 2ZRPA 4AQYB 1KDOA 4FJ1A 5E9AA 1N5KA 4M8NE 4UUPA 1ZUNA 2JAOA 2XBLA 4UEOA 5CDHA 1V9CA 2IUTA 2V7QD 3TLMA 3D4LA 3PGXA 1Z13A 3TIXB 4JQSA 1OC4A 1G8AA 1N3BA 2QLJA 4RY2A 4MEAA 5JPDA 3F98A 3HCFA 1B7GO 2AFRA 1H9BA 1NHGA 1WE2A 4HUQB 4EW2A 3A1FA 1MV8A 4V02A 2FCRA 5EHIA 3F8SA 2ID9A 1VJDA 1IBRA 2EF0A 4ZGBA 4DR3B 4ND8A 1FMFA 3BC1A 3WJ7A 4PZZA 2BKAA 1AZWA 2YOHA 3OZRA 3DMFA 4J0KA 1U7DA 2WNIA 3K0EA 3VAAA 4A5OA 4HMQA 5CB6A 1XPOA 3JQ6A 2IY9A 2CMKA 2Z6AA 5IFKA 3ZBTA 2CXHA 2Q3FA 3GZTB 5A7HA 3G5UA 3JR7A 2Z1NA 4J91A 1DV1A 3K35A 4U9HS 4EHDA 4HD8A 3VU9B 3LA8A 4V0ME 4BB6A 5AJXA 3CTPA 5IJAA 2K87A 5JVDB 4UQLA 5I7UA 2PEZA 2Z2XA 4QPCA 4CW7A 5KQMA 5AJWA 3O4HA 1RHKA 2ZTMA 4I50A 4BKRA 3T4UA 2VS1A 3GG2A 1G0NA 3MHPA 4DCNA 5FUYA 3OOEA 2PX3A 3KBOA 2DQSA 4FR0A 4TKUA 4B2YA 1SZDA 1YI1A 4Q9LA 2YHIA 1W76A 1R2QA 1J6UA 4Q18A 1R0XA 3D7LA 3E15A 4Y98A 1O7JA 3DFMA 4UZFA 4XQ0A 3KOYA 4WOCA 4YJFB 4IDQA 4HAOA 3ACBA 5AW8A 4JC0A 2P6OA 1XJWA 5FL7D 4O1IA 3PKZA 3TR6A 1A8PA 2GNAA 4F6LA 5BPHA 2A0UA 2YUIA 4WDQA 1BCSB 2BFOA 3OFNA 3MTBA 4OJMX 1WY7A 3L0OA 1QHEA 4FMCB 3RD5A 4AMYA 1P7YA 2P0AA 2IYVA 2VDLB 2GEJA 4ZYTA 3IVMA 5BN5B 4RHYA 2FMKA 5A0FA 4AZTA 3O2NA 3KE8A 4PS1A 2B36A 5BNWA 2NX2A 1IJEA 1K5DA 1R4MB 5FH9A 5FADA 4CE6A 4E5NA 4YIHA 3ENVA 3Q10A 1REQA 3NWBA 3F47A 4IIHA 2HWWA 4UATA 1S7CA 1JPJA 1A4UA 2CNOA 4W7HA 4YNBA 1BTOA 4Y1GA 1Z0UA 4LCBA 5ALTA 1RCUA 3B1ZA 2CLEB 4IS2A 3D4BA 2EFCB 3IOBA 1GTZA 2ZJ0A 4WIAA 5HKKD 1COWD 1GGHA 2WT9A 3QE9Y 2QDXA 1RQNA 2HMVA 4N3BA 4DSAA 3NIBA 5KPJA 4HTFB 1DZ3A 1E3QA 1JVNA 2Z2JA 2JL1A 3HJHA 2ZIUB 4L8WB 3LI2A 4QTZA 2MINA 1LFAA 4V2UA 3WK6A 4ITUA 5JRJA 3DBLA 4M1WA 5H3CA 1JWAB 4F3NA 5LZ5A 3T1HB 4LF8B 3ETNA 4FMCF 3M5PA 1QDUA 2O3TA 3PRYA 3E84A 2PJRA 2PUEA 2LIPA 3GMTA 1RWKA 3DULA 3OMXA 1EM8B 2QTNA 4OAQA 4BFCA 1P19A 5C32A 1RRKA 4OXKA 3QEBZ 3WMGA 3N0RA 3U7RA 2G4VA 1CY4A 2DTXA 2TMYA 4QBIA 2XE7A 3I2KA 5ALHA 3VNQA 1PG5A 1YQQA 3MXOA 4H35A 4HNAA 4B32A 4R1LA 1PJBA 4XWOA 5AJUA 2B35A 3VSEA 4H77A 2XWBF 5CB0A 3EOZA 3NH9A 3TINA 2ZQZA 3FHLA 4RORA 1WXGA 5JFOA 2OUKA 3L0CA 4U7FA 1YDHA 4DNFA 1QB7A 4PVCA 3LT0A 3GLUA 3DLBA 1JJ7A 1QYDA 3LHKA 4D9MA 3ITNA 3O75A 4ER3A 1CF4A 1EP9A 3WLNA 2VSFA 2O07A 1DIAA 3MGBA 2HQOA 3N6RA 2DXIA 3BMQA 2G1PA 1B8VA 5LXTF 3THRA 3FPJA 1VJGA 5CDUA 2O2IA 3OKPA 4A8JC 1EJ0A 4OJTA 1XZNA 1YVUA 4B84A 4TYYA 4QA9A 2OO7A 2QL5A 4PE5B 3QMVA 3ZDEA 4KGXA 3U4IA 1VP9A 5CYGA 3UFXA 1EXNA 1M2VA 3LBIA 1VGRA 3GXOA 1D7OA 1E66A 4OYYA 2L0XA 3D8BA 4AZ0B 4BNGA 3CX3A 4MHTA 1T8PA 2QUIA 2UZIR 4NQZA 4ZVNA 1JFTA 3H2GA 4EG0A 1JFFB 3OD5A 5IJZA 3OE1A 1R66A 1GRRA 2QGNA 3T5GA 4B17A 1QKKA 3RC2A 1WS6A 2C2GA 2O23A 5ESXA 3DKPA 3W90A 2CYAA 3PF9A 4LDZA 5PNTA 4DPLA 4V03A 1VCMA 2ZVJA 3DE3X 2XVAA 3L2OB 4F96A 1NX6A 5F3WB 1JXMA 4KYVA 4KR6A 4MQMA 2GN4A 4K6GA 2GX6A 4D2IA 1GDHA 2AX4A 5EXDA 3RROA 4BLVA 3RO7A 1KRXA 4HTAA 3AXTA 4KKVA 3KQKA 1DRJA 3WYNA 1VDZA 1GWNA 2F59A 1KY2A 1KAMA 3KQSA 4L9RA 4W99A 4NJEB 4EARA 2O7VA 4P93A 1FTWA 1KBQA 2Q4RA 4X63A 3NB0A 1MO2A 4B2PA 5G3ZA 1NFFA 3U4MA 4RWZA 3K1AB 3ELBA 1T35A 1ZAKA 4LMAA 4YDQA 5ICMA 4DMFA 4M1SA 4DC1A 3L0ZA 2NUTB 1C7QA 2GZHA 3R44A 4HGQA 5DHFA 2XMSA 2Q6TA 4KR9A 2R44A 3P19A 3SICE 3HVUA 5KBYA 1GXSA 3IPYA 3KB1A 2Q1UA 3WRVA 4UD6A 2HEIA 2EKPA 3I9FA 2FY8A 3JVUA 3RB8A 3ZDFA 5C1BA 3HU2A 3GJYA 2KYRA 4TV8B 1PZFA 2IHNA 2SKCA 5D2CA 3A27A 3ETJA 1K7CA 3KOUA 4MYCA 2GM9A 5FIUA 3WMWA 3N39C 1U8UA 1XNHA 3BQNB 1RWWA 4NAHA 5CUQA 5IS2A 3O73A 3ISVA 3G68A 1R4AA 1JDBB 2O3JA 3KZ1E 4OMFG 3CF2A 5D5HA 1Y82A 3V42A 4Z49A 1QTNA 3H5WA 3GGOA 2YY5A 5DBGA 2O5CA 3VKGA 4MW0A 2W8BA 2HF7A 3M82A 1Q2XA 5GPBA 1OFUX 4JGIA 5EUMA 4ENVA 5BYJA 2RGNA 3IBSA 5KVQA 4LJKA 1FMJA 3VTZA 4BQQA 3T4XA 4W5TA 3GA5A 3C7KA 4EKYA 5CK4A 1J2TA 4Q3KA 3TNJA 4AP6A 3D8SA 3P26A 1H2XA 5HIIA 3AUUA 1P7PA 4INJA 4QU5A 1HTTA 3VM6A 3V8RA 2QTZA 1U6JA 3U9SA 4CQJA 4HFMA 5BN3A 4RGYA 5DVZA 4YCCA 1XZJA 2IDMA 4IOLA 5L3QB 3VNSA 2X22A 4DG5A 1NDQA 4BVJA 4G4SO 4HAVA 2JK1A 2CVQA 2IYUA 2X9VA 2R8RA 1YZHA 2QTBA 3M4XA 3PE6A 5LA6B 3UMJA 3FKJA 2IZ1A 4OHPA 3K6SA 2JGRA 3D9QX 2Y1KA 1DBIA 1W35A 2EGUA 1P0CA 3CCBA 1ZOOA 1TIPA 2RAVA 3FNGA 2IW1A 1J0EA 3BD7A 3OU2A 2WLTA 2ZM6B 1Q77A 1U1DA 3IKLA 4TV9B 4CDGA 4DM3A 4I4CA 1P0FA 3LUPA 4L4YA 1G3MA 1JTEA 1KH2A 1U2QA 2II6A 4KR2A 3CWZA 4RY0A 2E82A 2OCXA 3LH5A 3G1UA 4ZP1A 1EVLA 5BYKA 2IGTA 2VA9A 3AK4A 5JY6A 1FA9A 1JXOA 3SN6A 1JR3A 2PMWB 1WSAA 2Z0MA 5KSPA 4QYMA 1DWOA 3HJUA 3OZGA 4G4GA 2YXLA 3DA8A 2NPIA 3H7IA 2HRDA 2UVDA 2IKQA 1VG8A 3QLJA 4G8JA 4MJ3A 5B3LA 4CL0A 4N3NA 3O83A 4K0KB 1H9CA 3CZ9A 1AUVA 4OY3A 3TZEA 5A9RA 3C16C 4BTLA 1VA5A 3CUSA 3EGXB 3MS2A 4L9WA 4I19A 1ETHA 2MSEB 3BUSA 4INPA 1FP7A 3QK7A 2G70A 3VNVA 4GZ6A 1ELOA 1RJEA 4IXDA 3RGGA 3VYSB 4L6CA 2QGZA 4E5MA 5LBUA 3I0ZA 4LC9A 4TWJA 5KMGA 1RCTE 1MH9A 4R8KA 4H3HB 4KSYA 1TJ3A 3U4AA 4BX8A 3UMGA 4BLRA 2AFIB 3C8DA 3FWNA 2G4LA 4WEQA 1FX1A 5I8WA 1DOHA 1GUAA 1IUKA 1R6VA 2VUIB 1KAGA 2ZAYA 4QG7A 4YDHB 3WGIA 3H13A 4S1NA 1ES9A 3DNFA 2OBLA 5AM0A 2G9VA 3DVQX 3A06A 3BJRA 5DULA 1C4WA 1HKHA 5IC4A 4F3RA 1YXMA 2J3DA 2ZRIA 5CHEA 1PGJA 2Q9UA 3PIIA 5EKTA 1E2KA 3DR5A 2G72A 4K3VA 1DQPA 3BB3A 4JYZA 3NOXA 1IPHA 6LDHA 3DF7A 3G9XA 4REMA 1FPQA 2Q41A 3G9ZA 2P11A 4N6GA 4P33A 3KO8A 1W47A 2XUGA 3O82A 2GSDA 4J0EA 3E70C 3ZK8A 1P77A 3D6NB 4HQFA 4UTXA 3U17A 1L7EA 1MEJA 1KQ3A 1R0SA 3K30A 3PXEA 4GSKA 2ZRGA 4FYIA 5EXTA 4BMZA 1SHLA 3AWIA 5HTKA 3CRMA 4XWWA 3A31A 1AM4D 3GRRA 1B1CA 3WBBA 2HU5A 4B8ZA 2RBGA 1SH7A 5EIHA 4ZYLA 5JI3E 1ODTC 2REQB 3RFTA 3LY9A 3DH0A 1ONBA 2ZE7A 1E2NA 4OGLA 1WLSA 3CISA 2JBAA 4NDZA 1QG4A 1E2MA 1OPRA 1GAQA 3O8DA 4DLPA 3I04M 3OHMA 2JD1A 5DHUA 5IDYA 2XI4A 1W4CA 4LMRA 4X7PA 1QAMA 2LP4Y 4II7A 3AOGA 3MWEA 5CVDA 5EUQB 3W06A 4AS2A 4D8UA 5C5DA 2FWAA 4RL6A 4G97A 4CIVA 1JPVA 4MZDA 2CLFB 2FOXA 3ZXSA 2O8BA 2LW7A 3ROMA 1Q1GA 4GICA 5BN4B 2R6DA 1GNPA 2ZOSA 4B7UA 2PUAA 5TMDA 4IXTA 3HRIA 1UINA 1T8TA 3FDZA 3IQDB 3JYOA 1WW2A 4O2LA 1JILA 3P5SA 4DIUA 4DLYA 1F9EA 3SU8A 1I0LA 3TJRA 1CQXA 4PNZA 4AJKA 1Y6FA 1BRTA 1G55A 2DPLA 3N0WA 3KZOA 4G8CA 4DY4A 1D1PA 4EGJA 4DKJA 4MDFA 1SQFA 4URWR 4Z1MA 4IJ5A 1ESEA 1NMYA 1ADFA 2PT6A 4G63A 3AKEA 3WFIA 2FSFA 3Q3HA 3EB9A 5C80A 1GG2A 1MU0A 3BHMA 5JMWA 4R2MA 1RWBA 1T9GR 2QQ0A 2JANA 3TI7A 5JYDA 3A4LA 3SAJA 3GUUA 3QF7A 5EIBD 1Q20A 2DVMA 3GLFA 1U4NA 2G63A 3L8MA 5JSHA 1HEIA 5CVTA 4EHIA 3HBFA 3HNOA 5FXMA 4GIBA 4PO1A 4QPZA 4RMJA 1SC3A 2FSGA 5CPFA 3AL3A 4FDMA 2J9FA 2UYQA 3RK0A 1BS1A 3ZW9A 1RYHA 4BMNA 5CFNA 1FLVA 2VLBA 1IB6A 4BO4A 2CN1A 1E3LA 4ZD6A 4C43A 3IAAA 2VJLA 5LYJF 1U0HC 1JWBB 3JYQA 1GU0A 1U3GA 5ENDA 1WQ1R 4OQQA 1N33B 1Y33E 3QLUC 4PAOA 3H5NA 4LHYA 1XXLA 4HDNA 2IXDA 3CRQA 1X38A 4GDFA 4HB3A 2EKBA 3DW3X 4BVFA 4JYMA 3LPLA 2GFHA 1UJBA 4OOEA 4K6CA 4ISCA 4Q9JA 4PXAA 3T9AA 4DMMA 3TVDA 2AT1A 4U6QA 4L22A 1Z4KA 3BXEA 2ZYHA 2W6ZA 3TN7A 4QJ4A 2FX2A 3W2EA 1R0KA 4DSNA 1H66A 2H18A 5CBKA 2WB4A 2PSSA 3LXMA 3R5XA 5KYYB 1NMQA 1WB5A 4MRAA 2EEZA 2V59A 3C85A 4DJDC 2Q3DA 1TYCA 2Y1EA 2XT6A 3VR5A 1AC5A 3B52X 3EISA 4WOPA 1VB3A 3BTUA 2XOEA 5BSUA 4RJLA 4QBHA 3HDQA 2W2VA 1WU8A 5AT1A 5FYQA 5A2QA 1OYYA 1V1JA 2E49A 3M2PA 3QFFA 1Z4QA 3VU1A 4EQ6A 1UMDB 5JCOC 3DOFA 4JR0A 3WGGA 4BS9A 3IE2A 4OHYA 4B48A 2R7KA 3EMVA 3GJTA 3JQBC 6REQB 2XB8A 1Z8FA 4Y9DA 5EPEA 3V2GA 2IX9A 2KBFA 4M9UA 3Q72A 1X1DA 4X54A 1MHPA 3AG6A 5MDHA 4K28A 3ZY2A 2B1IA 2QP3A 3FVVA 3IV6A 1LQUA 3KBBA 2BOVA 4BZPA 2HLDD 3V4ZA 1RP7A 3EYWA 3LYLA 3N8DA 1Z37A 1H23A 3IDSA 3V8NA 3ZHSA 4CLRA 1BO6A 3Q7SA 5TMBA 2W4IA 1KJ8A 4NCAA 2B5WA 1M1YA 2WYVA 3BB4A 4WXRA 2I4OA 5AM1A 5ILQA 3ZLBA 4ALLA 3NAQA 4D57A 3F97A 1MAHA 2QN1A 2B30A 3USES 4Y1RB 4TUYB 3FZYA 4V0SA 4MV5A 3COYA 2ZPUA 4QBGB 2Z3ZA 4R5MA 1Z6YA 1W85A 3E18A 1Z8NA 3GCWA 1IBLB 2NTVA 3UPUA 2P6PA 4R41A 1K8YB 3OY2A 3JAKB 2FUG6 3N2LA 3ZOKA 5IC5A 1HYQA 4PG6A 3N7TA 1SB8A 3K0AB 4OU5A 1CB0A 4XW2A 4QUDA 2VEOA 2DY0A 3SHFA 3T3IA 5KJCA 2VT7A 3PQ4A 5ELXA 1IIBA 1IN5A 4R2WA 2A9FA 3L77A 4ZARA 3BWCA 2W2OA 3GJRA 4BU0A 3QPAA 3ZWOA 2X5OA 4FR2A 3WLMA 1J1IA 5CNJA 2VDRB 2IP4A 3V8QA 1C9EA 3LYUA 1LDBA 1ZVVA 4U8GA 4KWEA 4W63A 1SAYA 1TEVA 3V2HA 1ENZA 3OG9A 2FW9A 4KOAA 4FNGA 4D9FA 4H08A 4DB4A 1EG2A 1G3UA 2NAFA 1O8BA 4MW1A 4D9KA 1NPDA 4ZJYA 4M8SA 1R88A 2OBXA 3OO1A 2C61A 4YRCA 1C14A 1G3QA 1U8AA 3IIKA 3CLRC 1P7ZA 1VIAA 1LW6E 1BMFD 3GT4A 4XPIA 3KVOA 1JL3A 2ODQA 2HA7A 1TYZA 2H3HA 1AIPA 1LSJA 1VYUA 3KALA 1Y5RA 4TMTA 4L73A 3W5CA 3B8EA 2J3QA 5KI6A 3TRDA 4F5DA 1BEEA 2AXNA 3H84A 4DBZA 4DMKA 4HADA 3MT8A 1RYNA 2XWJI 3QMWA 3FSRA 3HC7A 4JR2A 5CYFA 2KS6A 2Q7OE 4E5UA 1L7DA 2QRNA 1QCZA 4GAEA 4GF5A 3QEAZ 3B6KA 3NBQA 1SQ0A 2NAPA 2I7CA 2AG8A 4R31A 4IVPA 2XECA 4C89A 1EWQA 1P81A 1KOJA 5EIEA 5TX7A 3GGJA 3NRBA 3D7NA 4RKQA 1NVVR 4FTWA 4M21A 4Y18A 4YDRA 1V2HE 3V7WA 1YB6A 2HXYA 1PW5A 1D8TA 1KWKA 4I8IA 4UDOA 1QANA 1VMAA 3SF0A 2BFCA 3MK31 3VV2A 3BORA 3QRWA 4UEWA 5HA5A 2IYWA 2WSSA 4GGPA 1SIUA 3N2EA 4KPFC 5A03A 2WTBA 4K03A 4LZNA 4EO4A 3VYUB 2DUUA 2XE6A 4E6EA 1ADBA 3PQEA 1O58A 3TRHA 3MM4A 4MVWA 1NSTA 4FYPA 4RGQA 4XFDA 5JV5A 4ARBA 1OGIA 1MO5A 1IPEA 2X4LA 3W8EA 2YJ4A 1N3LA 2AA3A 3K9QO 1T3GA 1IG0A 2X15A 2BZ0A 4FDVA 4G85A 4QU9A 1Q3KA 2E4WA 3WDLA 3GNTA 3KSBC 1F2DA 3GLIA 4FFRA 2OFPA 3D2LA 4JC4A 4MIYA 4WLOA 3RYHA 4A23A 4X61A 1T2DA 1TYBE 1A2OA 3VR2A 5KQLA 3L8CA 1QE0A 1HORA 2ADOA 2AZMA 4AN1A 2BR4A 1KKLA 2FPUA 1L4NA 3X1WA 1NKVA 2JEYA 3OTGA 4TPKA 4CMIB 1HV8A 1OLSB 5FBKA 5FLYA 3COZA 5K7SA 2JJ1A 2Z5GA 2KE5A 1NAHA 1ZGJA 5I5EA 1O87A 2XZPA 4GRAA 5K51A 2ZT6A 1P0MA 3EPJA 1ZGAA 3W9YA 4LYYA 3PDUA 4Y0VA 5LXTA 1GTRA 2FDCA 2ZITA 5DIFA 4ZI5A 5FHRA 2C5FA 2Z5FA 2YQZA 2IY8A 4WJKB 4X8OA 1C7IA 4D9IA 2ETVA 4X90A 4MV0A 4K9KA 4TTJA 3T1NA 2FEAA 1Z5GA 4ZRMA 5JH7B 2YTZA 4S3MA 1KMQA 2YRWA 1OI7A 2ZVQX 4FSDA 4PIVA 4DR4B 1X9GA 3R3SA 1OT5A 4AUMA 1XXHA 4OGWA 3QVWA 1T0HB 2ZW9A 2HQ1A 3ESCA 1I3CA 1SKYE 2FFQA 3IURA 3OLWA 3IP5A 4B81A 4UTRA 5CAEA 2PIDA 4XYGA 5C1PA 4KVZA 2ZB2A 4Z0NA 1NX9A 4LY3A 5ALPA 5ITWA 3BIOA 1K27A 4UVDA 3GT0A 1T6YA 1V6SA 4Q7MB 2GILA 4QFDA 3OP4A 4G1CA 5HCIA 2WF8A 1OXVA 4MV4A 3K15A 5DI9A 2I3BA 4JEHA 4KEAA 2IBTA 4NENB 2XKKA 1XZLA 2OD7A 2R7AA 4ZN6A 1SWWA 1UK7A 3IIIA 4YRPA 5EWJA 3EF3A 1T1GA 4QUAA 3O84A 4Q82A 1ISJA 1XTZA 3VZCA 1MD9A 1JU9A 4H9GA 2G9UA 1DV2A 1JUDA 3QVVA 1APBA 3ZGNA 5JRZA 1G64A 1NT4A 4OAOA 3HYNA 5HK8A 2AMLA 1SOUA 3OUUA 5THXA 2QRKA 2JCXA 3KZCA 3VR4D 1ND6A 2V5AA 4CWAA 3ZHZA 1I0ZA 4G84A 1GGFA 5FRDA 4EA6A 2JATA 4JJ6A 4EPTA 5CNMA 1GQQA 5CBPA 4E30A 5KTKA 3W6UA 4WASA 2M6LA 3S28A 1JN0A 2QVXX 2Z9CA 1E98A 4NWIA 2O7SA 1RQXA 2DBZA 1RE0A 4TLMB 5EQJB 5B1HA 1R6UA 1FQKA 2ZBFA 1SZJG 3H2HA 4HJXA 5KVAA 2X76A 1NR5A 3TS1A 1A9TA 4C6TA 4OF4A 2PQ0A 1ZH4A 2D4AA 4MPRA 4HZUA 3WGNA 1T4GA 3WLRA 5HYVA 3DOHA 1XAJA 2E4AA 1L4FA 3IAS6 4GMHA 4JSTA 4EITA 4FZJA 5IHPA 1N77A 3ZKWA 3CEAA 2B98A 1RQ2A 2XV1A 5JBNA 8MHTA 2Z8YA 1PN3A 5F7OA 1ESDA 5J63A 2D4HA 1DLJA 2QUZA 4PR3A 4R1TA 1QYCA 3NIWA 5I7EA 1IEWA 1OVGA 5LBIA 4DL9A 1GZ4A 1TM7E 1ZJJA 3A9UA 1JR6A 1K92A 2XIJA 1WHTA 3HFRA 4WZAE 1NWCA 2JF0A 4I9UA 5IDQA 3UTDA 2G9RA 2R0QC 1O6BA 1F1BA 4LSMA 3HPRA 5E7QA 1DRVA 2SNIE 2NUAB 1G21B 5A5EA 1U1IA 2ZR8A 5DXJA 2YZNA 4L57A 2VBCA 3BMNB 4XRRA 3GLFE 1VCOA 2R2AA 3ETEA 3AJ8A 3LD9A 1MPXA 3EIWA 4LBVA 2OZVA 4OJKA 3ZGYA 3VU0A 4DARA 1W4BA 4A03A 3UJ9A 2I9KA 2EJBA 1NXOA 1GU7A 4ZQEA 5DTQA 1L1EA 2B2CA 3LVQE 4N65A 1V71A 4B3BA 1SXIA 4LHSA 2OUIA 3UWPA 1I5OA 4O8CA 1EP1B 4BC0A 3GD5A 3V8BA 3ZYZA 3MWJA 1O6GA 4B1FA 1K5PA 4QGFA 3IOYA 4BEVA 3KKNA 4W9MC 5FI1B 5BV8A 2P2GA 4GP6A 2DLCX 3BXOA 4RBNA 3WNVA 4YHBA 4YPOA 5EE5B 3WA7A 1KPGA 3R6TA 2FETA 1B14A 4ZOLB 2Q2NA 1UBGA 1EI9A 2IEDA 2XUZA 2J3HA 3TNYA 1N7GA 2UUOA 4CHTA 2H59A 4HB2A 1TW2A 2H0QA 1TO6A 4P7KA 4F4JA 4K05A 5IVDA 3SYMA 1SURA 3SFVA 1JV2B 4HLQB 2WP8J 1CUZA 2I8AA 3W8NA 2XE8A 3HY4A 3K94A 4O2RA 4RPKA 4R1MA 4UBKA 4AWBA 3M6MD 4RETA 2NUPB 4Q1FA 1MB4A 3LFHA 3UJ6A 4BZQA 2XTZA 4UJ3A 3V1TC 2H51A 3OJFA 4RJTA 5KYXA 1GCAA 4BNDA 4AMVA 1JR2A 4BO6A 1ZX1A 4MUKA 3FPFA 4A6DA 2R5WA 1D3AA 1ZWLA 2AYXA 3E58A 4N39A 1FYEA 5ENVA 5IAJA 5LQJA 2JAUA 2XLCA 3REFA 5TV2A 1VHTA 1A95A 4X20B 5BW8A 3U1TA 5MN5A 1SHKA 1U04A 2FMHA 4XB2A 1O5OA 3EC7A 5E9WA 5CA0B 5IUNC 5F35A 1B74A 3RUIA 1D7AA 2LZ0A 3TFOA 1J09A 5AW1A 4BZXA 2ATEA 2GASA 3L7KA 3W0LB 4B43A 2ZYWX 1FJHA 2ZG6A 1P0PA 2A57A 2YJ6A 1RBQA 2Y05A 5TNXA 3S2SA 4CM9A 1VBMA 3TTUA 2X6TA 3N8HA 1DBWA 3GVPA 4NBWA 3ND9A 4EA8A 3PC4A 2XUIA 3LP6A 1JEEA 2JIZA 1PI3A 2WFMA 1IY0A 5EJGA 1RRMA 4HFJA 1DRUA 4IDBA 4E88A 2GAOA 3QVGA 3H8VA 5L40A 3AM1A 4ZCIA 3EH2A 2AMYA 2C04A 2D00A 4KB5A 1I4OA