2QD3A

Wild type human ferrochelatase crystallized with ammonium sulfate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 143
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A01
4MK4A 2XWPA 3HCNA 3HCRA 2Q2NA 2XVYA 3AQIA 3M4ZA 1L8XA 2HRCA 1HRKA 2PO7A 2QD2A 2C8JA 1LD3A 2QD3A 4KLAA 2DJ5A 2AC4A 2XVXA 3LYHA 1TJNA 2XWSA 2AC2A 2XWQA 2JH3A 1DOZA 2QD1A 2PNJA 4F4DA 2HREA 2XVZA 1N0IA 4CCSA 2H1WA 3W1WA 2QD5A 3HCOA 1AK1A 4KLRA 2Q3JA 2HK6A 4KLCA 1C1HA 3GOQA 1LBQA 3HCPA 2H1VA 2Q2OA 1QGOA 2QD4A 4KMMA 1C9EA 2PO5A
chains in the Genus database with same CATH superfamily
1JEYA 3BB4A 3BCRA 3E23A 3BWBA 2Y05A 2WIAA 3R3HA 1MIHA 1NW9B 1VA4A 1TVCA 1E4YA 1F8GA 2WSYB 3M4ZA 4KJXA 1D2CA 2AWNA 3GD7A 4NMMA 3RTBA 4QULA 2B0CA 3ZZNA 3OESA 2ODAA 3GDOA 3A06A 3T99A 2EDAA 4G01B 4U7PB 1WDLA 2JI6A 3N0TA 1IZZA 1YNOA 2C4HA 3N76A 2CVHA 2A5DA 1EUZA 3T4XA 3V7WA 3WOVA 3F6EX 2EQBA 2WOJA 3PX3A 2I8AA 4KOAA 4MKXA 4F1KA 4MWCA 1J99A 4BWFB 1YE5A 4F96A 4BMSA 3Q72A 2UYQA 3AR4A 5KTSA 2G1AA 2GPBA 3EK2A 3GN2A 1JB1A 4WKGA 4AO6A 3OTOB 4E07A 4UBNA 1UT6A 2P75A 2O7RA 4JMPA 4KEAA 4DY6A 4CRWB 5IDWA 4B80A 1YVRA 2O3JA 2YY7A 3NASA 3AVVA 3IR5A 5C3UA 1E6EA 4ZZ0A 3MTDA 2WK1A 2WIGA 1EBUA 3NRCA 2I6GA 5HPYB 4GBJA 4C5BA 1Z5WA 2ONCA 4RHYA 2ZLBA 4XEUA 4HLDA 4ZQIA 4PSDA 5C5CA 5IJWA 1IM8A 4HF7A 2GF0A 3BMOA 3SHVA 4ZI7A 4BASA 1ZNYA 1FJGB 2YC2C 5F3WB 2RB4A 5K8TA 1CUCA 4F3RA 2ODQA 5CT5A 1DVRA 1V8BA 2Y6UA 3R6DA 2J3HA 1X77A 1QF7A 1JQEA 2LP4Y 2PEYA 1FF9A 1G5QA 2AOXA 2RKWA 1Q0HA 3GO4A 4OL0A 2R25B 3O2QB 5IYZF 2ECFA 5DULA 1CY1A 4DAEA 4RANA 2QUZA 1EQ2A 1SCAA 2P2SA 2ZSKA 5DHFA 3SYTA 4B9AA 3ZTWA 8ATCA 1DBVO 2GASA 3BX1A 1SCBA 3L8GA 5KYVA 3U7IA 5A06A 3GFQA 3S5UA 1K88A 4INJA 4FSDA 4JBHA 2X0DA 1Q77A 3RTDA 2D1RA 5UKDA 3ABSB 5IDXA 3IX7A 3I53A 5F23A 1XCJA 3KD3A 1H5UA 2PG3A 4UHBA 3NLLA 5C8DA 2RBKA 4JBIA 2BFCB 3AWDA 5E3IA 2VUHB 3ADKA 3EMDA 3KYBA 2JCVA 1UBSB 3VVLA 3WJ2A 4KNYA 3BDAA 3L43A 3EXIA 5CFZA 5T8KA 3VR0A 1KQOA 4MYUA 4B7ZA 2PAFA 3UJAA 3WHKA 3FNHA 1OKKA 1T91A 1THMA 1V47A 1YV9A 3H2JA 4PRYA 4J0QA 5TGTA 3ZV6A 3AKZA 3ZDDA 3O8OB 4OMCA 1AGYA 2I3AA 2GNPA 3STHA 2ORIA 1U6JA 1V3UA 4Y67A 4V0LA 5GJCA 1EXVA 5TGDA 1RJEA 4YX9A 5B5SA 4MDYA 1XXHE 1SXJD 5JHHB 1KZ1A 4BVJA 1XVUA 1TUIA 1Z0JA 3JX9A 1FXSA 1TO1E 3R0VA 4HS9A 5SZJA 3TD2A 4H4CA 2VNSA 4Q1VA 4BAGA 4E5UA 3UJNA 1SKAA 1IQ0A 1YDMA 2VF5X 2BI7A 3Q7PA 3TXXA 1RQGA 3JQGB 3RKSA 1RBZA 4BQEA 2FHPA 3OOJA 4HP8A 4EHNA 3AFMA 5A03A 3DVAA 3V97A 1RWKA 2GBPA 3ZTTA 4XIIA 5B4UA 1WW2A 3A1DA 5GGXA 4RTNA 1UDBA 3M2PA 2QJTA 5TF0A 5FFNA 4K9QA 4CF4A 5A2QA 2X5NA 1KEEA 3VNQA 4MWEA 4TSRA 4I55B 1G60A 2YYZA 5SICE 2AOTA 3G0CA 3AEKB 4S04A 3CX6A 4Q0MA 2UVPA 3DR3A 4MB6A 2B8WA 2A59A 1M8PA 4YUAA 4KLZA 1KR2A 3SGLA 4IKPA 2X13A 3DXXA 2RK3A 5ALMA 1ZUHA 1BAPA 4QX6A 1VLLA 4KAAA 3PEWA 2BEKA 3NWPA 2QD5A 1AN9A 2UYGA 1R7RA 4J07A 4J8PA 3TQTA 4DDKA 1BKDR 3IR6A 3GJXC 4HLNA 4MRRA 2C4UA 1QTRA 1X15A 4DYHA 1GUDA 4EKDA 5KYKA 5KTMA 4TQGA 1KI6B 1Y8CA 2CZCA 3F7NA 1J0CA 1SG0A 1SG6A 5SZIA 3C3AA 1SUCA 2OD2A 4IZHA 5JQGF 4RD6A 3U4AA 4OQZA 4NNJA 4Z8YA 4Z1OA 3AV3A 1CJBA 4G0OA 5I5EA 4BIIA 3LLSA 2HHAA 2AW5A 2CMHA 2E7ZA 4WLEA 3OPYI 4EG8A 4CM6A 3K1ZA 5KWEA 1EWRA 4IDHA 3ANYB 1NONA 3TQHA 1XZ8A 4ZOLB 2H4YA 2PQMA 2WKQA 4KX5A 4AU1A 4E31A 2JLBA 1DX4A 2YJ4A 4FMPA 4GYKA 4HPXB 4L0DA 5ARDA 3W5JA 2XW6A 5DNWA 4CLEA 5IVHA 1Z8FA 5JV5A 3HKCA 1UWCA 3K1AB 1SC6A 3BB3A 3WSTA 2QSJA 2OMEA 1N2GA 2YWRA 4JZKA 5EKUA 5THXA 4MW0A 4D4KA 3H1BA 1J7KA 1ZQ1A 1AF7A 3JV7A 4EDFA 1WB5A 4QTYA 3HBMA 5JFGA 3FWHA 3UJ7A 2IYLD 5IBCA 1Q50A 3ETJA 4JP2A 3CVOA 5E6SA 3ZU5A 1QHEA 3JYPA 1ZK2A 3P2YA 1PR5A 4X44A 3NYQA 3PNYA 1O5TA 1XZGA 1IOWA 2ZIWB 2CSXA 4K6OA 1ABBA 1N1GA 1TJ5A 2AEEA 3OC0A 3OCZA 4LZZA 4XX0A 1LQUA 5DX1A 4DWVA 1O6ZA 3IAEA 2CLMB 5EKXA 2VDLB 2ZKLA 4DJFC 5AM3A 5ISMA 1OXMA 3HA5A 1F17A 1VJGA 1XTZA 5DTMA 3G5AA 4B3DA 1J7JA 3DE0X 2NUBA 5E1DA 5C3MA 1TEXA 3IQHX 3LJKA 4AZ0B 2PSSA 4KYIB 3GCZA 2G40A 3EGDB 1PLKA 2ZB3A 5AVTA 5JRJA 2WQ6A 1YQWA 3A1VA 3FPHA 4FCTA 3C5WP 3KM0A 4WZAA 2I3DA 2HC9A 4M0PA 5TPWB 5CX4A 3K71B 1NAHA 3ETEA 4NS1A 3SQDA 3RHSA 3PT5A 4C9BA 4ZD6A 1NFRA 1EWQA 3GP5A 1NASA 2N0SA 3LUGA 2NGRA 1G7TA 2B20A 4RS4A 1HSOA 1RJDA 3C74A 4BYMA 1UMBA 2KHZA 1NQUA 3QIAA 4KX3A 3T6KA 4JVNA 4MRSA 3CURA 3WGMA 4NR0A 3ZOKA 1LWOA 4MS1B 4BWYA 4KSYA 4OM7A 2J7PD 2DLCX 4KK3A 2YKGA 3IIJA 3HJNA 2WB4A 5I7EA 5LLDA 3LPAA 4HQRA 5JSHA 4BAUA 3AW9A 4AT1A 2UUAB 4Y6OA 1YKGA 2G70A 2FPOA 1XK6A 1GG2A 4MJXA 4A2PA 2ZULA 3R0QA 1I3NA 1X7WA 1O95C 2HLDA 4LK3A 1M1NA 3JRWA 3UHAA 1L3CA 2QXYA 1T5IA 3ISTA 2M6LA 4LXQA 4JSYA 2PWYA 5HM6A 3V2HA 3S7ZA 4CMAA 3ACDA 4YDRA 3OJLA 1OHHD 5F4ZA 3U56A 1TTQB 1G21B 3A10A 1G6KA 2ET6A 3B85A 3I9JA 2BJVA 3KOXA 3PIDA 4FNGA 4WA8A 5CM8B 2J1LA 1EK2A 5AHRA 5IAAA 4FX5A 4ZXFA 2IKSA 4XPIA 4MRPA 1BOOA 1E3IA 1E1CB 1I1NA 1F2UA 3A0UA 3Q5GA 5FT9A 1P7CA 2DVMA 2JIPA 2P79A 4OKSA 1PL8A 2QN9A 3AKDA 3I6IA 4PXSA 1NJSA 5G4LA 4BIMA 1Y1QA 1RC8A 4JBLA 1E64A 1K8RA 4DC1A 5EZSA 1LPPA 3JWPA 4QDXA 4Y1FA 5DOVA 3U61B 2GTHA 1NXSA 1L5MA 1NE2A 2X1MA 4MV3A 1OB2A 2C04A 4ZA2A 1M54A 2P2GA 2PLFA 2XA2A 4FE4A 3LHFA 3TZHA 1CFZA 1W1WA 3GFFA 2AFVA 2HI0A 2PFKA 4JT8A 1WF6A 3UT6A 5JR3A 2ODPA 1DG3A 4IRXA 2C59A 2ZI7A 3AFGA 4ISBA 2PKQP 1E5DA 1RFGE 1IAQA 2G5CA 4KLAA 4MA0A 4MDHA 4RFSA 3RC3A 1H8ED 4MKZA 4G3XA 4Q18A 4RQBA 4TVBA 5F21A 1MJGA 1TYEB 4QGAA 2WWTA 3MAJA 5EJ9A 3W5CA 3FVWA 4NECA 2C1EA 2ONZA 1SOWA 3GJ5A 4I55F 4XYEA 1MHTA 3KDPA 1UBTS 3N1UA 4IXNA 4G4IA 1T9HA 3FFXA 4X54A 4DUGD 3K3PA 3UUGA 1ZN9A 1C7FA 2NO4A 3L8FA 1KORA 4GLFA 3WK6A 3KXLA 4TT8A 1MO3A 3DNFA 1T8WA 2FVYA 1JPJA 3GHYA 4FJ0A 4FYJA 4OLJA 2QB5A 3OZBA 3OZFA 1KU0A 3IMCA 4PINA 2XCUA 3AR6A 3D5QA 5DN9A 2H9IA 3LPMA 4RBNA 3RSLA 1S3SA 2BEVA 3AQIA 3EEYA 3KG2A 3RIMA 1JEYB 1XVVA 1TKAA 2XKBA 4FFMA 5K0SA 1T26A 2FE4A 1HL7A 1E8DA 4FT4A 1PHPA 3EEBA 2CLOB 3GFSA 1CUVA 2BKLA 4OQFA 3TL6A 4D6XA 5CB4A 1H4QA 4O29A 4UREA 5CFQA 2J59A 3TNFA 2QZJA 1AJEA 1KAHA 1ZNQO 2B6NA 3H8WA 4IL5A 1F2TA 1H2XA 1PR1A 1MJGM 1ZK0A 2BFEA 2H1WA 3KV1A 3CIOA 3P4XA 2C1XA 4MYRA 5CA0A 5KNCH 3KJIA 4PLPA 4OHMA 4ZOLF 3UA3A 1GV0A 2XCIA 1ZSYA 5F76A 2ZAGA 4RUKA 1Z4JA 3ND5A 3RM3A 1VHLA 1H0KA 4IYJA 5E95A 4AKIA 1GSHA 2G7ZA 3UUFA 1BDIA 4ZTZB 2RK4A 2W83A 1DE0A 2C9CA 4KNWA 5FBLB 2QSZA 2RARA 3JQRA 3BWYA 3E7XA 1L8XA 3KU1A 4GXRA 4B43A 3NNSA 4DEVA 3A58B 3LUFA 1U0LA 1E63A 5HCNA 1PDOA 1HEIA 1KK3A 2Y1CA 3QH4A 3RK0A 2WD7B 4XR9A 3WRVA 3L5KA 1CUUA 1E5XA 1GKYA 2EKDA 3FOEC 4N76A 2C4TA 2YXBA 2AXEA 3G9UA 3GK3A 3BGOS 3ON5A 5H4HA 3BMOB 4X97A 3STYA 5I45A 5C7OO 1JJ7A 1Z39A 5D3MA 2YJTD 3KBOA 5L3SB 3QNWA 5FBRB 1VCIA 5HS6A 1WM1A 4B2IA 1Z5GA 5ELXA 4V1CI 3C3BA 4PLGA 3RG8A 2H07A 1Y6QA 4PANA 1M6WA 4FYKA 1OAKA 1ZIOA 1VQ1A 1N1MA 2ZVQX 3ZCSA 5ER6A 4NXMB 4Y9SA 5EERA 3C8MA 1ORHA 2ID7A 1UT8A 1JHDA 3U3JA 4R1OA 1OMOA 1E7QA 2OORA 3EPHA 5B3JA 4XQ9A 4EY6A 4F1JA 1D8AA 2BGMA 5AM2A 4QOSA 4P2BA 1I24A 3BXFA 4ZKDA 3DE1X 3EIXA 2QUKA 4FYIA 1Y1LA 3VZCA 4DBVO 1YIAA 3ZHXA 5JH7B 1DIOB 1X8JA 3M6UA 1Y8ZA 3BWEA 1RPTA 4D43A 4FN5A 4Z4HA 3DXYA 2AJCA 1N2SA 2BMFA 2JCYA 3DE4X 4MHTA 4J43A 3VU1A 5KNCD 3RYTC 3T54A 4B83A 4E51A 3DTVD 1DXYA 4BWVA 3EXIB 2R8YA 4UMDA 4GOJA 4BKPA 5IUKC 1QH8B 3C3PA 5U9CA 4BO5A 4UQOA 1XV5A 1Z33A 5AVJA 3QBJA 2W70A 4KO3S 3USZA 3A9WA 5M29A 1IYZA 2OC9A 4X1IA 3VV2A 5AVRA 1EFPB 2OQIA 3F6RA 3CCCA 4KFUA 4AN4A 1TO2E 4EX7A 5LIRA 3HDGA 2OM2A 4L9AA 3WYEA 4RNCA 1MRZA 2QD1A 2ZATA 1E9FA 4QOHA 5DBOA 1ZFNA 2PD6A 2GN1A 3HQ4O 5CYFA 5K0EA 3ME5A 3KQUA 1OH7A 4EKEA 4R2KA 3OPYA 2ZUWA 4PCUA 1YR6A 3W79A 2OHJA 3KOZA 4UD2A 1LEHA 2ZT7A 2VPWA 2MSNA 1UOPA 3BMCA 1BX3A 4MB0A 4LJ5A 2RG7A 4C07A 4WRRA 2W00A 1HT1E 3MBOA 4AY5A 5LLTA 2CC2A 5BR7A 2FZEA 1CEYA 4QDTA 1H2EA 2C4KA 2P9FA 1APBA 2C0CA 2R65A 1D0VA 4GPAA 3D7NA 2J3MA 3O74A 4U8GA 3L7BA 3ZY6A 1Y5RA 5JZVA 3YASA 1FFBA 1IN1A 5AH0A 3KZOA 2X1VA 5AK4A 2OESA 3SSNA 2GN4A 5CXXA 2WF6A 4L51A 3Q2KA 1PDWA 1U3UA 1UC8A 1Z0AA 3IP7A 4KUGA 2QVYX 4JCOA 3RJTA 4EW1A 1U8EA 3A1CA 1YJQA 2J6CA 2ZOSA 3R8CA 1C9MA 3HUUA 4R81A 1BVHA 2ECPA 3OZCA 1RPZA 3BQMB 3KQQA 3Q3VA 2VZ0A 1HDIA 1NOKA 2PA3A 2XKJE 5K3FB 2LKDA 3ORQA 4HDMA 3JR3A 3QYJA 3R5JA 4JHXA 2EOAA 5THKA 1T5LA 2CV2A 3L02A 3S8MA 1TA9A 1VG0B 2I7CA 3EZXA 3LSYA 1GLVA 4MUIA 3QKIA 2I55A 1JQLB 5GZ3A 1QIDA 4FFRA 3RVPA 1GTG1 4LMAA 1E2EA 4Z9YA 4ARAA 2WYIA 2ZUSA 3E0XA 3FWPA 3H0CA 4C4TA 3OZEA 1YIDA 4BP8A 4YMIA 5BN4B 3GR6A 4X20A 4TV8F 2HU2A 5DJ5A 1MZVA 2FQYA 3IE1A 1X0VA 2AG0A 3UN1A 4ZJUA 2NUTA 1A9YA 3K53A 4W1RA 2YQ4A 5ELMA 3HKCB 5CFRA 4D9HA 2J9FA 5IABA 4KW7A 1NVXQ 2DH6A 4JWKA 2I76A 3HVUA 4XX1A 5IASA 1Q3KA 2V59A 1VRWA 4L50A 1JA0A 2Q2VA 3FNRA 3FYUB 4LE2A 3VPAA 1IBRA 3ISVA 2J0EA 1U02A 5C1DA 5HJ5A 2AIRA 3BXOA 5E6SB 1V39A 3IVAA 4EVSA 1MPXA 3ESAA 1G21E 4QTTB 4NYMQ 2QYTA 4EI2A 3IS3A 4Z6KA 1E66A 2HHJA 5DSTA 2DFTA 3VPFA 1WMBA 4F3YA 1MQAA 2PS1A 2C5GA 3K2BA 2Q1TA 3AUJB 2Q0XA 3CG0A 4LSZA 2WUVA 4X85A 2OV2A 4DB2A 3T7JA 2DT5A 2O2XA 1XPOA 4EO4A 1X86B 3CX3A 5LB2A 2VTVA 2UZIR 3Q15C 1VLHA 4RCYA 1Q0LA 2HY7A 5CFOA 3N58A 5KHOC 1ZIDA 5EJ6A 3PENA 4QFBA 5ICCA 1EGMB 1AKMA 1M2HA 4INZA 2B92A 5IM4F 1M7BA 4D4HA 1HYGA 4EKNB 4X93A 1XPUA 3LDUA 5LL6P 3HLTA 2VEDA 3VYRB 5FTLA 3DNMA 1PP4A 2QTGA 1V4BA 2EP7A 1ZNZA 4YIKA 4F4FA 1J24A 1K8QA 2GPTA 2Q4RA 2IT1A 3C7DB 3KUUA 5TMDA 1GDHA 3W2EA 3I8XA 4B09A 3G0HA 4EVRA 3O38A 1U81A 3A3PA 1MXFA 4AIIA 3WLKX 1PEYA 3T0IA 2J0QA 3WNDA 1P7WA 2C5EA 2CFCA 3DFMA 3OE1A 3QVTA 3GLIA 1L8OA 1CUXA 3UMFA 3WYAA 4JYCA 5CPBA 1RPJA 1SIBE 3A28A 1X7WB 1UBJS 1IL0A 5CM2Z 3LL4A 3MTJA 4M1OA 4M1KA 3Q88A 2Y6VA 3WOHA 4Z4CA 1BCRA 2ZCUA 3PUHA 1IVSA 1LQ2A 1T4GA 2CL5A 2WG0A 5AR1A 3ZE1B 2VCYA 1U80A 3VKGA 1Z28A 3PC8A 4RD2A 1GADO 3AETA 1L7XA 5FOSA 2GPJA 3EW9A 4BQFA 2P6UA 5F1OA 1ZSVA 2EF1A 2OECA 4F93B 5KU7A 1G5PA 4KO8A 3RKRA 1ABEA 4L78A 5JDIA 3F3MA 2GVZC 4XFJA 3HP4A 1FDIA 4XPIB 4YMHA 1OZFA 1YA6A 1V5FA 1AHIA 2AH5A 2O3UA 1Y9JA 3V8RA 3PEYA 4KRYA 2OLEA 2LWIA 3KJEA 5C52B 5KJ6A 1K68A 2HCRA 4OK6A 1X1BA 1BFDA 3HU3A 4PAQA 4U9UA 1U63A 4IGKA 2VH1A 4HGRA 4GWLA 2WI8A 1PKEA 2CE7A 3G2KA 4F92B 1R8YA 5L53A 1T0BA 3TZKA 3E8MA 2H7VA 2VSYA 4XEHA 1ZRNA 3AI3A 2CGEA 2EQ5A 2QYOA 3GWZA 4KH1A 5DTRA 1GQFA 1SKQA 3MRXA 1NZJA 1FUYB 4GPTA 3GLIB 4HADA 1B6GA 1P7PA 4M1QA 1JFVA 1WCWA 2ES4A 2EZ4A 1DRJA 4RFSB 2KBEA 2XUZA 5AW7A 5JAIA 3AU9A 16PKA 4YECA 3ZDRA 3EAFA 3NHBA 5HK9A 3U19A 1WZEA 3CEPB 3AZQA 1G41A 2LDBA 3GLSA 4F9FA 4ZEVA 2Z5LA 5A4DA 1WABA 4ZT7A 1K9VF 3PHBE 2G63A 2XUOA 3I9V6 1J21A 1P73A 2FI1A 2O52A 1ONOA 3DF9A 4KP7A 1M0TA 3JQBC 3OUTA 1V3TA 4LJYA 4KHPB 1EDDA 1T8SA 1IWBB 4G07A 5LZ7A 3CVJA 3LP5A 1FUUA 3LQQA 1KMNA 1WB4A 3OQIA 4BX9A 3RVBA 1YBAA 2O8FB 1SU8A 3WL3A 2XSZD 3D3KA 3ZW9A 1O08A 3GAMA 5G0WA 1A88A 3N2NA 4V1CA 1DOAA 3Q8MA 1YSCA 3R1IA 2DLDA 2LPMA 4KQGA 5FWDA 3K5HA 4RHFA 3SJUA 2ONKA 2L69A 1RXSA 3BF7A 1ZHFA 5BW6B 1WPGA 2FMFA 2I3BA 4JL5A 5DM4A 3TW8B 3IP9A 2CV0A 4DIEA 4KE7A 1GUAA 1AK1A 2OGSA 5AM4A 1F2TB 3WSVA 1GPUA 5ITZA 3Q7RA 3NBYC 4GL2A 2FEKA 3H5TA 3CZRA 5D8DA 1HURA 5CA0B 3MFYA 3WWZA 1NN3A 4CGYA 3H8SA 2JFQA 2ACEA 1NBAA 1DNPA 4KXLA 1QIKA 4WJZA 3VO2A 1U2QA 5AVZA 3AYZB 2P1ZA 2WICA 1N2CB 1DRWA 1QANA 1TFUA 4GEGA 4RVHA 2FZWA 2VKQA 5EKDA 1IZ8A 3C1OA 1JQBA 3SX4A 4D99A 2JLAA 3IOMA 4Z99A 1MH1A 3WYBA 2Q7XA 4H59A 1DC7A 3G2HA 3N2GB 1ZJJA 1CVLA 4EZBA 1P1RA 1KEZA 2UAGA 3COYA 5ALGA 3JQ9A 4XFDA 4CCSA 2FX2A 4TN1A 5J43A 4HXGA 5AMXA 3GGSA 3IKLA 1XMOB 4P3XA 3NVAA 3LC0A 3FUUA 5FYQA 3AB3A 3M3HA 3E7FA 3ZCXA 3WB1A 3C43A 3LX4A 1LW7A 2AFRA 4RENA 4XGKA 2PS3A 3ADCA 5D3MB 3RAGA 5C0OE 3ZU3A 2LR0A 2X4GA 3FPLA 3PG5A 5JHGB 1CYEA 1PGJA 1HDGO 2BFWA 2BSAA 4PPYA 4WGFA 5FO1A 2XZTA 1Z29A 3ETNA 3KPWA 4H6WA 2K6GA 1LBTA 3JZAA 4INAA 5D1NA 3IJRA 5FV7A 3AJ9A 1BU8A 3LVRE 1E6CA 3P0HA 3WGZA 1YQTA 3V00A 4GI3A 2XB9A 1GAXA 1VKHA 3O93A 4AP6A 5AW6A 1WSWA 3VR2A 4IIXA 4CIXA 4G4SO 1CRLA 1VIMA 2O0LA 5TY0A 3RH0A 4K9OA 4MEAA 3OCXA 4NK4A 3T4EA 1ORRA 3V4SA 1Z73A 2AHRA 2G06A 3B2QA 4I08A 3RSQA 1GGMA 5SYMA 2X5XA 1B74A 1NF3A 2XHZA 1ZD2P 3R5HA 1D4ZA 6CHYA 4E1BA 2C7VA 3GVXA 4D97A 2WM9B 4PU0A 2GFQA 2XJ4A 4JT4A 1TVKA 2VDOB 3H11A 3K09C 4V0MA 3SVLA 1E9RA 2C88A 2Q5IA 4G5GA 1XMQB 1JAHA 1T8TA 2WYOA 5C34B 2BN4A 2ZIZA 1G5FA 1IJFA 2VHQA 1KMHA 2XZDA 3R9WA 1U2GC 1AQIA 3FYTA 4TM7A 5KTTA 3CNOA 4HDSB 4D2IA 3VNSA 1GNLA 3R9KA 1S96A 1KAOA 1SM4A 4HFNA 4O0LA 4YQYA 4DDHA 1ZI6A 4I4IA 3OCJA 3EA5A 4MYDA 2A3RA 3TGWA 4LHWA 1VCHA 2ARKA 2JKZA 4DLVA 5COQA 4L6CA 1IUNA 1R6DA 4ALNA 3M4NA 2ZGVA 4GU5A 3TOXA 3MWGA 4GVPA 4HNQA 3CUUA 4BVKA 1MABA 2JLUA 2C5HA 2OILA 2QK4A 4ROTA 4OHZA 1TQ2A 1ULBA 2C3PA 1OLOA 2IEGA 1X80B 2IYOA 4G4GA 4KPFC 3H8JA 1FUIA 2GFHA 4DLUA 1EZ1A 1OA1A 3O8NA 4M76B 3WLMA 3H6HA 2QLMA 5JLAA 1L7DA 1R4ZA 1V7ZA 4ZVOA 1PSDA 4WBSA 3K0SA 1SVLA 5B3LA 1B41A 3M7IA 2W6NA 1CIVA 1B16A 1DPGA 1YT5A 2ZQYA 1CRQA 1UPXA 3DBVO 4JN6B 2XEXA 1ORDA 4JH0A 4WXEA 3ILHA 2GYVA 3QMVA 5A7FA 3AHGA 4ZAVA 2ZWVA 4FPXA 4RTSA 3QVOA 2RGRA 1KVSA 1NR5A 1GRQA 1H0RA 3OM8A 5E0OA 1DMSA 2RH9B 1NVVR 3CH4B 2OPHA 3OJOA 1RWXA 5KDDA 4A6PA 3Q0IA 4TWBA 3ZQ4A 1FZTA 1OFGA 2HDOA 1KNXA 3K32A 3LT4A 3V4FA 1KI3A 1FFHA 1L1QA 1FYFA 1S4QA 1T1SA 3K4PA 3TGLA 1WZ2A 5L3QB 1U7PA 3RS3A 4LSMA 1U0JA 5IP5A 2JARA 4MRNA 5HWSA 2OVBA 3FUXA 1LDBA 2J67A 2JGMA 3DZ8A 4NOJA 4MQLA 1W85A 2B9EA 121PA 3BFKA 1COWA 4FMCB 4KXQA 3HKEA 1GDDA 3G8BA 4O1HA 3S2ZA 4EHBA 5C35A 4AY6A 4YI5A 2IITA 1G2IA 2R2GA 3COJA 4XARA 3RE1A 4P4GA 1GEGA 2ZIEA 1EHCA 3PA8A 4LE0A 2R8XA 4FFBB 4WACA 3H2GA 4MVYA 2D7JA 5BWBA 1WU7A 4XWGA 1MV5A 2YV2A 4ERXA 3L7LA 3CKKA 4V0RA 5PGMA 3DR5A 2NUTB 3BULA 4UNSA 3IRVA 4ZT3A 3MINB 4Q4HA 4AKSA 1E2HA 4W5TA 2J9FB 2RSLA 5JSYA 4EENA 1QH0A 3O73A 5EJEA 4L4UA 2NUPA 1KQ3A 4GGMX 1DKNA 2UVDA 2ZYDA 3U9LA 1WRBA 3S5JA 3WLOA 2MSCB 4HYTA 1BQ4A 1OZAA 1QHHA 1LSSA 2Q50A 5K3SA 3TVTA 4BS9A 3AZOA 4EI9A 4R7TA 4GI2A 4BVFA 4BQOA 3R8XA 3B3GA 2WNSA 1XDWA 4MQEA 4NV3A 3T3NA 4IIUA 1ZRMA 3R24A 4P3KA 5CMLA 5ES3A 5JCJA 3CJRA 3CZ4A 3G6WA 3JWIA 3PNKA 3T7CA 1RYZA 1T0IA 2WBLC 4OYYA 3WZLA 1VE7A 1XG5A 4YRSA 3AJAA 4P08A 3DM5A 5B1SA 4ZHQA 5IF9A 3FCOA 5EEGA 1Q6YA 3SBOA 2DERA 5IEJA 1DAFA 5GZ6A 1D6SA 1Z4IA 5HQTA 2D8MA 2WWHA 3PR3A 1PJQA 4C0BA 2WJWA 1JG7A 2OCDA 2Z09A 2I4MA 2X7HA 1FMFA 3VMMA 4ZO7A 4L72A 4IVNA 4FNMA 3GRRA 4LKOA 3RFCA 3V7FA 1OKKD 2N75A 4P4TA 4BNMA 2CXNA 3N74A 2C9OA 2ZI4A 3WGHA 2NSDA 3FTCA 1H5QA 3PDHA 1JH9A 1ECFA 4XYGA 1FVXA 5BRNA 1AUVA 3BK7A 1FU4A 3K16A 4QARA 1ADFA 1P2TA 4IQFA 4A9AA 1X14A 4XSGA 1E0AA 4XCVA 4K1XA 2PLWA 5PNTA 5I9IA 2N9UA 3F8WA 2RE8A 1J2RA 1BNCA 3Q12A 2XQIA 2MMCA 3DLPX 1OT3A 3NR2A 4N12A 2W6OA 4GR4A 1EDEA 1B3BA 1VZ2A 4UATA 3M4XA 3H42B 2AEMA 1QH1A 2Z4SA 4AX8A 4BLWA 4CQLA 4DR5B 2L82A 1BCRB 3GV0A 4MP8A 4BMCA 5KS2A 3ZQUA 4A26A 1M67A 1P1IA 1VPDA 5EXPA 3AETB 1R0ZA 4CLXA 3U4MA 1T5DX 3WKDA 1P4RA 1PHRA 2PT9A 2YJ6A 5A3VA 1EXMA 4Q9AA 5J4VA 1RS0A 4ND8A 3H8VA 2VDVE 1YQGA 2OEPA 1GL9B 2WUWE 3QTTA 3WWOA 5CDYA 2P6NA 3OOYA 1TAGA 4JQSA 1OU0A 4CNQA 3AGQA 2OBMA 2PZKA 3OY7A 4WLVA 4OHYA 3VPGA 4YAUA 1TQ8A 3V4RA 2VRWA 1WUJS 1UKAA 3G2PA 5DHQA 1XEWY 1U1EA 4TRMA 3SDBA 4QJ5A 1RW4A 1HDEA 3MTGA 2O2JA 1FTSA 1RXYA 1C5KA 3N2KA 3AUKA 1QGUA 1SIWA 1SKUA 4HL6A 4RK0A 4V2UA 1RP7A 3N59A 5B4TA 2J5BA 3NZEA 1ZOPA 3C3YA 4V24A 3RBAA 4DNQA 4YMGA 3RVKA 3KSZO 3HO6A 1FRFS 1Q22A 4R05A 2Z56A 3K70C 1PV2A 4KFTA 3EEQA 4E5YA 3AEZA 1GQRA 3OM1A 3HDVA 4P4UA 4Q16A 4UEKA 1UIRA 4UULA 4PN7A 4JWTA 2PX5A 2YL2A 3AY6A 4HI0E 4UCQA 1E8MA 3WLQA 1QS0A 5IZCA 1EX9A 1LKZA 2GESA 2FH5B 5BV8A 3EXFA 1H2FA 2WKWA 3BH7A 4BRZA 4IHKA 4BO3A 1DLJA 4ZAZA 821PA 2I22A 5IM5A 1HO3A 1V1JA 2A9VA 2YZ7A 2P11A 2GRJA 4D45A 4EKIA 3Q6IA 1MC1A 3HFGA 2IA5A 3LY8A 2VT2A 3OQIB 4FYVA 5F12A 5I7FA 3EIFA 1IN6A 4YAOA 4GRDA 3PFHA 3VC7A 3WZMA 1P5ZB 3K4HA 1L4MA 4G5XA 2J3DA 3QXHA 3HHPA 2QX6A 1BHSA 2PLAA 2ZQ5A 3V4OA 4YH1A 3RIYA 1JIKA 1ICEA 3P2JA 1RXVA 10MHA 1ZGHA 4I50A 5JWOA 2FV8A 4J4HA 5ITZB 1NC3A 4FMCF 3W6ZA 2BKXA 2FMXA 4HB2A 1M10A 2ZVDA 4XM0A 2FPGA 2WM8A 2XUPA 4GBMA 1M34A 4YR7A 1XU9A 1MB3A 4FBLA 5JDCA 1CXZA 3Q8KA 1E1YA 4PRZA 3G17A 2PZMA 3F71A 4FI3F 3PQCA 1W96A 2HQBA 4MPJA 1VJCA 2IH4A 2OGWA 3HLKA 3BUSA 3GRVA 4U7HA 1EFTA 3KWFA 2V3WA 4KRGA 1NBIA 1OR8A 1TPYA 3DTNA 1JB9A 2IODA 5LBIA 3T61A 5KC9A 3N87A 1TM4E 1V8ZA 1NQXA 2UVQA 3BHNA 2QN7A 1C7QA 4Y2PA 3TBHA 4FLEA 2CJWA 1UBEA 3WC4A 1ZGBA 1NRIA 1AMNA 3VPBA 1T2DA 4TMZA 4QOEA 1IVNA 3NOOA 3SQOA 3QW2A 1VDZA 2WDPA 3BS4A 1P9LA 1GCOA 2PYDA 4Y6PA 4MHOA 4ZREA 2RJOA 5CFNA 5JALA 4R1NA 4MNTA 2IYXA 3RIXA 1AQLA 2YYYA 1D9XA 1O4WA 2IELA 3E1KA 4PSCA 1G19A 1AKUA 4JYBA 4YT5A 3E1GA 2CDBA 4KL8S 2COKA 3DOHA 4XTRA 5D6OA 4L0QA 2O1WA 4C0JA 4C4XA 2X6RA 5F51A 4JR1A 4RIEA 1UIMA 1U99A 5EJ2A 2ZT6A 1SD5A 1C9DB 3RF7A 2BMEA 1Z22A 1SD2A 2VCHA 3SM9A 1OIVA 2X0RA 1S3IA 2MSDB 1JE0A 2CHVA 2ZTVA 4H0CA 3HJCA 4IJUA 2Q5CA 4K5QA 4CDMA 1E2KA 1Z15A 4NBLA 1RRPA 3C7KA 4S1PA 2HJ9A 4Y18A 2YWHA 1DELA 1LB1B 4YJGA 2JFBA 1VI6A 3RWBA 2I2CA 2I6SA 3R3UA 1TA0A 5F73A 1HE8B 5K0JA 1D2GA 1P60A 4C01A 3QPVA 2FPUA 3UJHA 3WP1B 2I99A 3HGTA 3V9AA 1TVKB 3ZC3A 2FMIA 1UBGA 2AR7A 1Z6PA 4D4GA 1UADA 4B6EA 1RSZA 4R1MA 1JF8A 3M6WA 3IKVA 4FCVA 3UNXA 1GY8A 3LOPA 5F1YA 5BSMA 2X9LA 3QELA 4J7UA 3OMWA 2IP2A 3RRMA 1Q7CA 3NKFA 3OKFA 2NZYA 3RUAA 5DNYB 3BGDA 4A82A 6ADHA 4G0WA 4IOLA 1OAOA 4K9SA 5JXWA 5KJEA 3Q0EA 2OZVA 4OLAA 2MYUA 4CHTA 3FDZB 4LOAA 2NU6B 2PT5A 3ZHTA 4DG8A 1Z0IA 1FP7A 1MGPA 3HGQA 3IPYA 2XLCA 1QRRA 4JEHA 4TXNA 1U2TA 2M2IA 4URYR 5BYBA 4BLSA 4O2BA 3CUKA 2WIBA 1MABB 5H80A 3E03A 1DBIA 1L5WA 4Q03A 4TWJA 4UM5A 1ZISA 5FNVB 2AZMA 4OEHA 4U5XA 2JAUA 1W0KA 4MO2A 4QL3A 2QMYA 2G5TA 2VSNA 4RD1A 5JCOC 1OFUX 3ZUPA 4EB0A 4RY0A 1L1EA 3M9WA 1RM0A 4II3A 2QRUA 1FX0A 3GGDA 3GA0A 4GIBA 2DHRA 2ISQA 2OHHA 4HX2A 4QBFA 4PQEA 2NW6A 5F5XA 3ERCA 5EJ7A 4ISCA 5EHGA 4M60A 4ZEOA 1EM8A 1VL1A 3KCNA 1Z2DA 3QFRA 5DXJA 2RAUA 4DWJA 1KMCA 1K3FA 4N6NA 2MDTA 2PQ0A 4DLWA 2ACVA 4MA5A 3KZXA 2B5OA 5AKZA 4OP3A 3L0BA 3GI1A 1JMYA 4QREA 3LV8A 4D56A 1XVLA 4QAJA 2NTJA 4HFJA 4D8TA 1QU2A 2IPXA 1W85B 3RVLA 1RTKA 3TKAA 2HIAA 5HFAA 3HKEB 2QJOA 2EIHA 2ZRKA 3HDQA 2WVGA 4N3NA 1F48A 2O4CA 2W93A 3EEIA 1SCDA 3I04M 3PFKA 3SS9X 2PRSA 3MUFA 3WMXA 1NLFA 3FWKA 3H1EA 4ZDJA 3S4YA 4FHZA 4B45A 1ISFA 5KQLA 2ANBA 2A92A 4Q4HB 3ZE9A 4MAMA 4F3CA 3GLIE 1W6RA 4CEJA 4BL5A 4J1SA 2ZS8A 1IDN1 1LY1A 1Y5LA 3RUHA 3SNHA 1JAXA 1QFXA 2NUPB 1TW2A 4XIJA 2ZR9A 4XOUA 3F1KA 1JJIA 2QR3A 1P2GA 2ID9A 2YWGA 3MEQA 4FDTA 2PY6A 5FUBA 2YZ2A 2XOKA 2P69A 2EARA 1NSYA 1E1DA 1E9DA 2IPLA 3LDHA 2QTTA 1QHHB 3E27A 3OT4A 4JU8A 4MMXB 5EP4A 3VI4B 3FZYA 3L77A 3P26A 1GGFA 4B48A 1I0IA 1DJPA 3LPLA 2VJNA 1SQ6A 4EA7A 3V3TA 4ZP1A 4RPLA 4DLAA 4QBKA 3F47A 2GHIA 3IHKA 1M72A 1XTQA 1I2AA 1S2NA 4MV7A 2PBFA 4Z4GA 4CTMA 2FW7A 4WOJA 4Q3CA 4OQXA 1V37A 2CHQA 4YMLA 4B46A 5JS1A 2VIIA 1Y9DA 4X5OA 5DOZA 2WVHA 2CNWA 3DDCA 3VDXA 2VJKA 2WF5A 2FR0A 4WK2B 4WQMA 6AT1A 1H4TA 4X41A 4JXXA 3FYCA 5D5HA 5DM2A 1L9XA 1QXSA 1ZG3A 4UHDA 4BC0A 5AD1A 1B2RA 1KETA 3MFQA 4V0QA 2PMEA 1TF5A 3E3MA 1Q95A 1WW8A 3AUXA 3PD7A 5DLPA 1N7JA 3V80A 1NYTA 1Y3IA 1U5AA 3JSAA 3L0YA 1QSGA 2DQYA 5C4IA 3AKYA 4JYZA 4LOJA 4HGZA 5HE9A 3IBCA 4NBWA 1Z36A 2D13A 4ZANA 4WESB 1YZ3A 4RGBA 1IBSA 4I5EA 3KETA 3GFBA 3LUDA 4ZEXA 2GXSA 2GLXA 4G37A 3DVSX 1D03A 5C8ZA 4ARIA 3VAZA 1LS6A 3G2MA 2JCSA 4RLQA 1EIZA 2P3QA 2HWYA 1K4MA 1M6NA 1KI9A 3EC1A 3FFBA 4K1LA 5JARA 1ULZA 1YGPA 1JIJA 4FZJA 5BOSB 1IPFA 3ZU4A 4D3DA 3FMIA 1QH1B 1VIDA 1SU6A 4LZOA 3GJQA 1I6WA 2NZXA 1P33A 3W4JA 1N4DA 1H94A 2B1QA 2IHZA 4K26A 3SHTA 1AS2A 4HDCA 5TPZA 1DQRA 1RP1A 1E4OA 3FSEA 2QNIA 1ZN2A 2V55B 4ZXPA 1T2VA 3TTYA 3OPXA 1UJCA 1TUGA 3OQHA 3GOQA 3VZSA 4D4JA 1YZHA 1HT2E 1YI8A 2JRLA 5JZOA 3PWSA 1C2TA 1OFVA 1U0TA 1ZONA 4CM9A 5T41A 4AYTA 1A3CA 1DCTA 3I64A 1KEVA 1MIOA 1MVLA 2FY8A 1UL1X 2G09A 2X15A 2ZP1A 3EG5A 2VP9A 3GRFA 2JJ1A 1QVWA 4LGYA 4NJMB 1ATZA 2QX7A 4GKJB 4X71A 2VZ9A 1SBCA 4K86A 1OFHA 4ZVKA 3IBGA 2OHVA 4X90A 3AR7A 1K5HA 3G0OA 2E6UX 4YCJA 3Q0TA 4ARVA 4WNAB 3TE6A 1QGUB 1JWAB 1SWVA 5BNFA 4OP2A 4ARZB 1P8JA 5K4HA 1M1YA 3LUBA 5A0FA 2C61A 1AUPA 3AILA 3HNRA 4TTSA 3PL5A 5EJFA 5LLSA 1GZ6A 3A2MA 2DU8A 3BILA 5FNVF 2LCFA 5C18A 1YZFA 1A8HA 4G5SA 1CEEA 4GM4A 4Z49A 1LK0A 3ESRA 5IAOA 2J3IA 3KQKA 4XQCA 3MWEB 3ZZUA 5ALIA 3D2CA 2J5KA 5DLYA 2GEJA 4RPGA 4UBOA 2Q2NA 3OAAA 5ALRA 3PE6A 2REBA 3EXFB 4MW9A 3GY0A 7GPBA 4H7HA 2GZSA 3AP1A 3D3EA 3KPVA 1CG6A 1U8UA 2OQ2A 3OM9A 2YCBA 1CDZA 1YQXA 3CO0S 3R5TA 4U2KA 3CUYA 4PGMA 2I8CA 5JU6A 2F00A 4O08A 5AESA 2F55A 1BKYA 2IXGA 2IXDA 2Q5JA 1QGYA 5CNIA 4ZYYA 2C3MA 3HZZA 4JLUA 2C5AA 5L7TA 2JHPA 2IIVA 2OO5C 1SUWA 3JY6A 4C43A 4I50B 4CF5A 1XQ1A 2X9NA 3QTBA 4R1UA 1OXTA 1GRVA 2B4YA 3B7PA 4DV7B 4UXIA 5A1TA 1A9XB 2A9KA 4NU6A 3UWMA 1EIWA 4YRJA 2EZ9A 3HXLA 2FPGB 4V0ME 4MV9A 5BR1A 2WM2A 4WCFA 1M34B 2KLBA 1PGNA 2Q62A 4DPKA 2BEWA 3E35A 3LLUA 3A25A 1YR2A 1XA4A 1WP9A 5FDFA 3D3QA 3WLRA 5EIWA 1OI2A 2GK4A 1V0JA 2CUNA 5E6UB 1EXDA 1VSBA 1Z6QA 3ZWAA 3IVRA 1LPMA 3AH8A 4LQCA 4B7XA 2DPXA 4C7KA 2VSOA 2CJWB 3AB7A 4JLWA 3VH4A 4CG2A 2XMBA 1C14A 2YICA 2BDUA 2R6ZA 3HVKA 1HLGA 2VUSA 3U48A 3DV9A 4UNRA 3MLBA 2Q3CA 1HBJA 2I6FA 3QPCA 1S7GA 1ZZGA 4KQHA 4AYWA 4JI0B 1IONA 3SU8A 4AG5A 4JQCA 4WFIA 2WB2A 2CHUA 3EZGA 2BLLA 3NTQA 1Z07A 3NHYA 2QN3A 1L8QA 1KP2A 2ILVA 2QM8A 4FEGA 3TCKA 3X2SA 5A5VA 2HHLA 4ZMBA 1RQPA 3NRBA 5KMGB 1D7OA 4QXRA 2VHYA 1M2KA 3LMKA 2ZRCA 5FPTA 2I0FA 3O4GA 5AFSA 3C4VA 5H3HA 4OF4A 1ENZA 5IH7A 3GDWA 3HUEA 2WV9A 3FROA 4RQUA 1FRVA 3ZDZB 1I13A 2V5AA 3CV3A 2D1SA 4CETA 1RQRA 2Q5EA 4DV6B 3NV7A 3PNBA 2PL1A 1KRWA 1A7KA 1VSTA 5AOCA 1ISRA 1RWPA 5FLXA 1A5SB 2IKQA 4DBLC 4DLZA 4BGVA 1UAYA 4RV4A 3JU3A 1G291 2VTEA 3L7MA 1PL6A 4MIOA 1O0SA 1QBGA 2MHCA 1EUCA 2FP4B 3DOUA 3IAS1 2IUUA 3OFNA 4LNHA 2HA4A 3AI7A 1MDBA 1ODSA 1KDTA 2C2ZA 4I9GA 4IDAA 1CDDA 4LK2A 4NC9A 3MTBA 4ZT4A 4ANFA 1LZKA 1R6VA 4MZDA 1I7LA 3QELB 1HK7A 1CKEA 4FT2A 4M49A 3WK4A 2YN0A 4LZAA 4G9EA 3HRKA 2W8ZA 4G5FA 3KHTA 1ND5A 1T9AA 3LX5A 4LAFA 5B58C 1NDHA 1ZL2A 4P34A 3BBLA 3K9CA 4H4EA 3ZLVA 1BX0A 2C77A 2PKEA 1M5RA 3AIMA 5BSUA 3THYB 3EMBA 3C1AA 2D59A 2PGDA 5EG5A 4E5NA 2W98A 3HP7A 4LRXA 1RI4A 2BMWA 1MUUA 4MOWA 4G97A 4KREA 4TXLA 2YFHA 2H92A 3L7CA 1KOLA 3TFQA 1JPUA 3DQQA 1UC4B 4EEZA 3PITA 4FC7A 2AC2A 2WAYA 3OJXA 1W6UA 5FORA 5IT9A 1SHKA 5JWHA 2YVAA 3U0VA 1PDVA 3ES9A 2CNBA 1U0HC 4I4TA 3K6JA 3SOZA 4ZOCA 3MQFA 2B82A 2Y1LA 3L1UA 5DWVA 1FX0B 2QE7A 4AJLA 4EQZA 4DR7B 1E1MA 1T0HB 5JISA 4OB7A 2ZI5A 4R8SA 1YCGA 3A0RB 3F9CA 4QE3A 1C4OA 2BMJA 2XUJA 2DOKA 1XNHA 4PQFA 2JHAA 1XZHA 2O0KA 4OH7A 1G4UR 2BHTA 4H7EA 4U7FA 1ADBA 2JGDA 2PSHA 4PFJA 4WUVA 1SXJC 1BCSA 4BAZA 2MSEB 3P5SA 2C8KA 4DLNA 5BMOA 4BE7B 2YHAA 4M38A 4TTIA 2BGRA 2WVJA 1WMSA 1PSWA 3ZXYA 1JSRA 1B4DA 3PPXA 4IZOA 3BAZA 3FGPA 4DXHA 2W0MA 3QI7A 4NQRA 2OV1A 3GP8A 2IPMA 3QV1A 5FH9A 3K1YA 1KI8A 1HSZA 1YRYE 2JHFA 2WUGA 3TG8A 1PNTA 5ENVA 1PR2A 4XA8A 3L79A 2C0PA 1L5OA 1P2BA 1DWPA 2SECE 3W90A 3KOUA 4Z4QA 4G0VA 5K4GA 4U6QA 4Y2SA 4Q1CA 1W49A 2Q29A 3V33A 3FETA 2NPOA 4C7VA 5FFMA 1BWRA 5IXJA 4CEHB 2ZG6A 4YAWA 4QNMA 2QP9X 2RGBA 3EAQA 1K4YA 3ROXA 4I50F 2OYSA 2GQ0A 1J00A 3P94A 4PC1A 1QF6A 1N2BA 2M9MA 4LECA 3SQLA 3WDLA 1WSBA 3B1JA 4HDRB 3D0RA 3OIYA 2VQ3A 2V54A 2E4UA 1V5IA 3HCCA 2ZWOA 3VR2D 1NHWA 1NSFA 1QR6A 1NX6A 5EYPB 4Z4FA 1PFYA 4KPGA 2W5UA 4A2CA 4EELA 3EPRA 1EI9A 2HQOA 4TS9A 4ZOAA 3JWJA 1F1BA 1QQ7A 2PX3A 4BBJA 2OP1A 4BP1A 3PD1A 4X7MA 3V42A 4RABA 3QLVA 5FEMA 1BMTA 3PF9A 2WIDA 4G56A 1XU7A 5J2UB 3HCDA 3G9XA 5FPPA 1IHDA 4JFAA 3TLEA 4Q93A 1JDJA 1I2ZA 3KELA 2HEIA 2OHOA 3JQ8A 3UKOA 4M9XA 1HFJA 4WKPA 2V6JA 1L5RA 5AJTA 5IHPA 1FJXA 2EL7A 4NHOA 4Y0AA 2NPIA 4HDAA 4Z9FA 3TNDA 2OC4A 5LA6B 2Q7DA 4G5RA 1GN9A 4BEWA 4KO4S 2DKOA 1M33A 2P68A 4LV5B 1IQRA 3QG5A 4R8LA 4QOFA 3OCCA 3AVYA 1L9KA 4A03A 2PTHA 1RXCA 5EIEA 3H16A 2F1KA 2Q4BA 5DF1A 4J0KA 1N6LA 2HYDA 1P9RA 1ZIYA 4QYSA 1QCYA 1LVGA 1F8UA 4CL2A 1OLUA 1K7FB 3O94A 1RKXA 5HIMA 3GCGA 5IJAA 5KC8A 2GCEA 4GSKA 4ZDKA 3L4SO 4UUMA 5AHXA 3VUFA 4ZI2A 3LRXA 3UAZA 1GAEO 3EB9A 3ND9A 2V6BA 4PZDA 3THWA 3IRUA 4F2PA 3SQXA 1CZKA 4NX2A 4BFVA 3ZGNA 4C4AA 3MXTA 2YMMA 4RFLA 3T7DA 5A4JA 3TRHA 2HA0A 2ODTX 2HF7A 1V4VA 4YCAA 3K94A 1DRKA 4GZ5A 4J4TA 2GA8A 3VTZA 3OURA 4Z7QB 3GL9A 3EVNA 1M34E 1AXEA 1GNVA 1NBWB 1VG1A 3KQWA 2W6ZA 2JK0A 3LCJA 1MIOB 5FHQA 3D5TA 1JKJB 4HMQA 1ZN8A 4HPWA 1G5HA 3ROMA 4EW3A 5LN1A 1A2QA 4G84A 1N7IA 2FK7A 2CUZA 4DSTA 4XVUA 1ORVA 3QF7A 3EUEA 5FQOA 1COWD 2J6IA 3OQVA 1NP3A 3SLGA 2HLPA 1D6NA 1DG1G 2FUKA 1YS4A 3HU5A 3LUPA 3QSYA 3DXFA 2PZGA 3Q1LA 2AN9A 3BM5A 3BWXA 3F4LA 3I8OA 1QYCA 2HK9A 5E4YA 2WRZA 1NVAA 4EJ6A 5BYKA 1KMIY 3WKBA 2DFNA 3MQ4A 4FGZA 4N82A 3S29A 5EZ5A 4ZC1A 3CB2A 5KQMA 1KY4A 1YRBA 3D81A 3P9XA 3TFOA 5CVCA 4V3BA 2NNWB 4YRIA 4DMKA 1R1DA 4ZGGA 5L4SA 3TQQA 1OOEA 4RM2A 5EINA 7YASA 4EFDA 1XTVA 3P9RA 1EFLA 1ESEA 1N5DA 3UMCA 1U8XX 4IG9A 1QIEA 5KWJA 1CHDA 5B1IA 3VO1A 3WLAA 4R71A 3KQVA 1NE7A 2IV7A 1CUHA 4HXYA 1LBQA 4JB3A 5AI5A 5G53C 4MW2A 3X1WA 2NZJA 1YIOA 4I99A 1Q2XA 1NT2A 3GIDA 4LKRA 5JCJD 5ALXA 3RT9A 2XQFA 3UK2A 2QVCA 2RAPA 2C42A 4B1FA 2X40A 3DT6A 2Q27A 1O0BA 1GSOA 3BHMA 1J39A 4X3OA 3I9NA 4X95A 4EYKA 1ZGJA 2A4KA 4YI3A 3ZGZA 3K5PA 1PS0A 2W6IA 2BEWB 1I6MA 5IJ9B 4LXHA 4RL6A 1FVFA 1MP0A 5CT6A 3A27A 1BN7A 4ZQBA 5JMPA 4E94A 3PNVA 3AL0C 3MSCA 2ZRFA 2EJTA 3CUEF 3T5CA 3T5PA 1J23A 1KXZA 3H4MA 3PNPA 4HH4A 3N3AC 2DR2A 3AO0B 1ND6A 3NHJA 4JJEA 4RF4A 4BO0A 4KMOA 2FOIA 4GH5A 1K1EA 4OKNA 3MJDA 3KKMA 2FWJA 2ZSHA 2XZLA 1TX4B 4NBTA 4CIVA 1UM8A 3GJSA 2ZYRA 4C7MA 1LSJA 3ZU2A 5H3CA 3IV6A 4RADA 3WNCA 4YCBA 2FSPA 2Z98A 1X7ZA 1ABFA 1AE1A 4LF4B 4WASA 2L18A 2DP4E 2QAGB 3NT4A 3IAHA 2GI4A 2LNDA 1I2CA 1PGQA 1JDSA 1TVMA 2NO1A 1UMDA 1XTTA 3KKNA 3N75A 4G5QA 4OJMX 1M2GA 4RDHA 3T3IA 4ZMRA 2BRUC 5JC1A 2BV3A 3OLCX 4G81A 4U0JA 5J2UF 1QPZA 4N7MA 1LXCA 5AI9A 5L4NA 4WEQA 2W2LA 4RVCA 2H2IA 3I62A 4OBWA 2I1QA 2GAFA 3OWOA 2ZJYA 3JRNA 2A0KA 4ND3A 3AL3A 1XPRA 5JVDF 4GKAA 4OHVA 2IK8A 4RSRA 5MHTA 1KF0A 1ZXBA 3MWDA 5AK3A 4N4AA 2Z6VA 4DCCA 2VQ6A 1UDWA 1X19A 3FG9A 4OGWA 5BMVA 3EQ9A 4L85A 5LA6F 3ZCRA 1U98A 1GAWA 5C1IA 2YINC 3ITKA 3MELA 4K0KB 3B2NA 3LUHA 2HU8A 5EJIA 4BKUA 1NLZA 2VDMB 3CR3C 3A6FA 4X8LA 3L8DA 5DX0A 2XLBA 1RM3A 1JKFA 4R1QA 1A4XA 3STXA 4F72A 3EJWA 5KTOA 1RKUA 4FSXA 4M9SA 3ZV4A 1OQAA 3RAJA 4DR2B 1CJMA 1XLTA 1U2DA 4LF7B 1HL3A 4FQ8A 1WDKA 1UANA 4EG1A 1T4MA 5IVIA 1TI7A 3VR5A 5AK6A 4XAQA 3Q98A 5CVEA 5LSAA 4UBKA 5EHNA 1FY2A 1BMFA 4Q9DA 5SY6A 1XD2B 3TPCA 1P5RA 5TQJA 2IU4A 1QHSA 2CDRA 1O57A 4WJLA 1M6YA 3EWIA 4PICA 2PKYX 2V0NA 3LYHA 1N32B 4UAJA 2DHQA 2QVXX 3IILA 2HXYA 3CLSD 3I2GA 3W77A 2NXWA 2HQSA 1FSGA 3KVNA 1JECA 3IBYA 3VQTA 5A4KA 2I4NA 2UKDA 4KQ9A 2ZI6A 2H4WA 5ALLA 3ANNA 3HJFA 5ALFA 3SEQA 5AW0A 3DPIA 3CNEA 1U11A 3BHIA 3C1UA 3NWOA 3OY2A 1B73A 2PIAA 2P8SA 4B3CA 3UPDA 1XL1A 3ADPA 1NU6A 5JRDS 3EF0A 3ZHRA 4X84A 2CHGA 3TMYA 4B35A 3C97A 1W87A 3OHSX 1JDBB 3GJ6A 4UTPA 3Q6MA 1DWOA 4EHJA 2PUWA 4F8JA 1I1HA 1UQTA 3P9QA 4L16A 2RHBA 5AUPB 1EK6A 3PGLA 5ECDA 1XB2A 4BY9E 4NBKA 1ZH0A 4KPUB 3REFA 4DMFA 3IJ5A 2YWCA 4YVFA 4B79A 3R4VA 1T8YA 4QYWA 1Q19A 2EJCA 4JENA 1XKTA 4NTZA 5EZQA 3T0GA 1UJ2A 2XNCA 4DILA 5JBIA 3ZX4A 2A7XA 4AUMA 1FCJA 2X0JA 3FDFA 1UEIA 1ZP6A 2Z0MA 3IBFA 3OZ7A 1KHHA 4L6IA 3DEFA 2ZYWX 4J2OA 3OX4A 4M9RA 4ZVMA 2OBFA 2LIVA 1F6BA 3T1HB 1RWMA 2IBTA 3GMDA 4OU5A 1T8PA 4WPGA 5DP2A 2P5TB 4L8VA 5EZYB 4XKJA 4DZRA 4MVJD 2GBLC 2GOYA 1HR0B 3QA9A 3QVWA 4DNFA 3LYLA 4H3HB 4BTVA 4P0PB 3KQMA 3S28A 3SEZA 4CQMD 5HKOA 1LNZA 2BH9A 2NTVA 2ZWMA 4HY3A 5KUTA 1I3MA 3ZH9B 2W11A 4DCGA 3FB1A 4ENSA 3ND8A 4UTRA 1EB8A 4JITA 5HM8A 1KZHA 3LQRA 3PHLA 1EUYA 2ZSFA 3R09A 5D3KA 3QXJA 5KDOA 3QWBA 5CIQA 4MVWA 1ISHA 4C3UA 2JLYA 4EA6A 2X14A 1OE0A 4MX8A 5I7WA 1NNLA 3EH1A 2FX3A 3B51X 3GHHA 4D82A 3DAPA 1IUPA 3Q7EA 2PGIA 4I81A 4B8ZA 1IEXA 3TD9A 3DM9B 4HZIA 1PR9A 1SWWA 1DEHA 3NT5A 3N8GA 1CYDA 1ZGGA 4LJKA 2YWXA 3UHFA 1DKRA 3NPAA 4J1TC 2O5RA 4LCJA 2JAPA 1E59A 5C7LO 4Q5IA 2NP7A 3TTSA 2FFHA 4JBXA 4Y2YA 4DA4A 4D98A 4CMJA 1I3KA 3B2EA 3JQ8B 5K7SA 1PFKA 2R86A 1M1YE 3TLKA 1BEZA 1K0UA 1QONA 1VJRA 2IXTA 2MYPA 1V3QE 3CS3A 3KBBA 4N0QA 4X61A 1JLLA 1ZNWA 4BNZA 2FFRA 4YIHA 4E46A 5E9WA 3W5BA 1RWQA 1CZRA 1Z17A 4DRYA 1XFDA 1C8LA 2ZIGA 1DUSA 1QO7A 1V1RB 2XWPA 4EF5A 4ZCMA 4UNQA 1OWOA 3EBLA 4N40A 1SCUA 1FTGA 4OJNA 3WY9A 1G2QA 1LD3A 3OQ1A 1Y81A 3QE9Y 1O2DA 4DJAA 2WWYA 5GQSA 4UM7A 5C1OA 1EESA 1PVVA 1T36A 4ALJA 4LOHA 1E20A 1MA3A 2PKCA 3F97A 2XY4A 3P2OA 4N5IX 1OLUB 4NVRA 1DC6A 1FBTA 2VH2A 5SYAA 2X76A 4P53A 5E0KB 2W42A 4TXMA 1K8ZB 4CMEA 1W0KD 5LQCA 1D2NA 1GG5A 1Y63A 5JD6A 3L6DA 2O7NA 3HBAA 4WXRA 4WLOA 4GS5A 3CXRA 3JYOA 1ZJ5A 2X8AA 4IIJA 4YLEA 1SOMA 1T1JA 3N2IA 3WRXC 3THWB 3I9FA 4Y2QA 2XMQA 1UFQA 2R87A 4M1EA 3CR7A 3GJZA 5KVVA 2QN6A 2JA2A 4R41A 4LWQA 4MUXA 4LSGA 2IPAB 3H5AA 4F3KA 1GQOA 4MV6A 4P7JA 3WZ2A 2XQKA 4FEYA 5TQ2B 4ZYVA 3S1SA 1JYEA 4UM9D 2GZDA 1DRUA 1D8TA 1R6UA 2J3EA 4P35A 4A0QA 4TQ9A 4LHVA 1TK3A 2D1FA 2O2GA 3KLBA 3Q7IA 4X24A 4OHXA 3CY6A 1Y80A 2J0VA 2VP5A 5CIWA 3ASVA 2PMWB 2V5UA 1YK0A 4P92A 3QPBA 2IL1A 4CIWA 1DKUA 5BSHA 1JGTA 3VR3A 4ZJPA 1VA5A 1Y7LA 2FZCA 1DZ3A 3LKVA 3PBKA 1WD7A 2C07A 3HYCA 3RBVA 2ATEA 5HX7A 2PO5A 2XDWA 4S05A 1XZNA 3QU7A 3S7TA 1PUJA 2AQIA 2ZDHA 3W8NA 3T9CA 4TGLA 4P5EA 3ENVA 3I1YA 2H5LA 2ZYIA 4V03A 1GM5A 3U4QB 5DHTA 4B3RB 1DXOA 4IEIA 4KR7A 1E0JA 3BSSA 4L3WA 4PRKA 5A3SA 1YKFA 3NGLA 1ZXLA 3QHPA 2M1XA 4QFDA 4TZKA 2V7VA 2NZ8A 4QM6A 5F5NA 4HQNA 4OHOA 3V1MA 1UT5A 2B34A 2P4UA 3IUEA 4K8OA 5F98A 4P82A 3UWSA 1MO6A 1G6Q1 2NO5A 2XT0A 3ZD6A 4R0MA 4B6RA 1CJTC 2C97A 2XOKD 4MR7A 1L4NA 3U3OA 1VGVA 4OGGA 1OBFO 3JASA 2HPVA 2FNAA 1RRCA 4NKRA 4DSNA 2B5VA 3LKBA 2PZEA 2VWQA 4H3KB 4KSCA 4QTXA 4R0VA 3REOA 3TTVA 1QQ5A 1E6WA 4NZMA 1XBTA 2XGMA 3G2LA 1UDXA 1XJWA 2X1HA 1U3VA 4RESA 2ZIAA 3ZHQA 5KX5F 1G3RA 3QVGB 5DP1A 2AV6A 2H11A 2IVZA 2O6HA 2XIQA 3UYLA 2VP2A 1TIBA 4GVLA 3Q41A 1WS6A 4MRAA 5AQEA 4RK5A 4UFOA 5FJIA 4CDRA 3DC2A 3G85A 3BFXA 2QTMA 1LJLA 221PA 2CNWD 2ICAA 4CEIA 3IT3A 1N2XA 4RJIA 1I01A 2ZRLA 2EF0A 3SXUA 1OW3B 5LQJA 2JIQA 2QPLA 3L41A 5KIAA 2KI5A 4PQRA 1MJNA 2V1XA 2P5SA 5EZYF 1BDHA 2R7NA 4GUAA 3PB3A 1WXHA 4LCBA 1JIIA 2J6HA 2PN1A 1Z6AA 5CG2A 2CJXA 4KWHA 5K0CA 2X8WA 5CH8A 4MW6A 2JI9A 3BEOA 1GL7A 1NUTA 5KYWA 3VZBA 2P0EA 2XAUA 4LC0A 1QO0A 1DTSA 1W44A 2Z43A 3JQAA 5TX7A 3NOXA 3V8MA 1RWVA 4AULA 3NO4A 2H1OA 3UF0A 5ICFA 3OIUA 4IGEA 1X7ZB 1U7ZA 4E2YA 1IQUA 1ZRSA 2G67A 2CD9A 2X4LA 3DKIA 2WJVA 5HRAA 3HC7A 1XRLA 3KUXA 7MHTA 3FBWA 1PQWA 3O8QA 3NBKA 1UMDB 1MV8A 3IIMA 1F5SA 2PCLA 1KERA 1Z06A 3DSRA 4RSGA 5G0VA 1RACA 2EQAA 2XOEA 3QWHA 5G4KA 2QZ4A 1VLZA 2ZRIA 2YZKA 2ZAIA 2WTEA 4LJAA 4QOGA 3O9VA 5TPZD 1NW3A 1E99A 1E2DA 1G3IA 3R7FA 3PC6A 1FJHA 1YBFA 4GHWA 1VYUA 3U37A 3MWKA 5CHEA 3ROPA 4DGQA 4OJTA 4CM9D 3TW6A 2O9JA 5BMVB 1W5AA 3GLGA 3ECSA 1R16A 2OD9A 3L46A 3QEBZ 1SRQA 2JJ1D 1J97A 1BWSA 1G20B 1I4EB 1MDFA 3OIFA 1TJ4A 1I3OA 2Y2VA 4OREX 4N18A 5IBQA 2HK6A 5C8YB 4TYNA 1M2OA 1B76A 3CMMA 3E3AA 4GOMD 2F64A 3SR3A 1ZIXA 1CETA 4XWAA 1E3LA 1I7NA 2QAIA 4G5OA 4J0EA 5E9JA 3NWJA 4LDNA 3WGTA 3EISA 4TMYA 2JGFA 4H1WA 3ENQA 2GF2A 4PLYA 5ALTA 4D8UA 4W5NA 4JLMA 5AI0A 3IJPA 1Z2NX 3NYRA 4NAVA 3HKDA 1GYQA 2WG1A 3QE2A 1OX4B 1T0PA 2C2OA 2H4JA 3OKAA 4IDBA 5IG2A 4W5QA 4Y2HA 2IUFA 4QJ4A 3HGMA 4UASA 3QBEA 3LQFA 4ZYZA 4OLBA 3OX1A 1CWUA 3CEAA 1NRXA 4R51A 3WRYC 2BH2A 3OWHA 4UCXA 5E3JA 4IZ6A 4M9UA 4HUQB 5IARA 4DV1B 3QLTA 4JYPA 1ESZA 5K05A 1JHQA 4B3FX 3A32A 3CONA 1SXHA 3F74A 1I9CA 2ZWIA 3GBPA 1BWPA 2BI4A 3IPXA 1GR0A 4QU5A 9MHTA 3HN2A 1MMFB 2GCPA 2IJGX 1LS1A 5FOUA 1Z5UA 5GPBA 5LP6A 1E5VA 4MWSA 5FP0A 4HNAA 4MW1A 1S8AA 4YJ2A 2PX2A 2XB4A 1OA0A 4YXFA 1I94B 5L8VA 1RLJA 4D0SA 2CFIA 3UO8B 3ENNA 4GC5A 4S24A 4QWWA 5HFJA 4FLMA 2CB9A 3EY9A 1U9IA 1V71A 1Y0BA 1XEXA 2VHZA 3CUVA 5CH5A 2PKQO 2QTZA 3E8XA 1RIIA 4KDCA 5TEWA 3WWCA 3IVGA 4EL0A 1KFCB 4REMA 4W4TA 4I1PA 4EI7A 1V96A 4EG6A 2JRCA 5JRZA 5K0ZA 4DSOA 3AJDA 2I80A 2PKWA 1W35A 1AKWA 3WMGA 5A6SA 2DBYA 1GCIA 2Q4TA 4LIPD 1SUFA 1W5BA 2Z9CA 3VYTB 3UGJA 5C53B 4RY2A 1UINA 4S0XA 3K0CA 3GB9A 5LQAA 2XHEA 5KTPA 4C22A 1ENPA 1L3IA 3EFOA 4L5AA 3GLGE 4UVGA 3SC4A 2WHPA 4ZC8A 1VIYA 3W9BA 4A0RA 2PRKA 3RSOA 4I8IA 1CLEA 3WICA 2YY5A 5C7IO 2EKLA 2H29A 1GR1A 1NWCA 3AR9A 3OD1A 3OHMA 1IOLA 2XBLA 2V8BA 3H19A 3HY4A 4KKVA 5CJJA 2O8CA 2ON6A 1EVJA 2Y1GA 5IAGA 1QB8A 4PFKA 5TQVA 3SDZA 5IKEA 2D8AA 2OE2A 2E9SA 3GT7A 2NAFA 5JD3A 4TKVB 3C6YA 3BFPA 3B1FA 3KYCB 3Q2OA 1TJPB 1GTMA 4Z5XA 3T9BA 4CMKA 5D5QA 3SJBA 2DQZA 2JJ2A 4JBNA 3PF8A 4WLFA 3H2IA 3OZRA 4FGJA 4RLFA 4R31A 4B5LA 4D4LA 3FHJA 2CLEB 2VHUA 1DUVG 1SCIA 4D5GA 2B78A 2FQWA 1NMZA 2OCYC 3S2FA 4TS1A 2AMVA 3AVTA 4R3WA 2HZBA 2C2YA 2L0XA 4REQB 2JBHA 3GX1A 5KQRA 1EFVB 4FEEA 4LVOA 5KYGA 1IN7A 1SBYA 5KPDA 1ODIA 1JJVA 1Z45A 4J2HA 4LJLA 5ECWA 1PJAA 2KYRA 2OAP1 1GNTA 2OV8A 4E32A 1WL8A 2EU8A 2FMUA 3A9CA 3DT9A 4EY4A 4QLAA 5CUQA 1JLLB 3ZVLA 3T35A 3H5VA 3EY4A 1J2TA 1NULA 4QGGA 2IHNA 2I54A 1C0EA 3EZ2A 2ONJA 1J5PA 4NH4A 4BTEA 4QAQA 1YZUA 2XZOA 3ZLUA 3O1JC 4LZJA 2QD3A 1AUOA 5LYJA 4LY0A 1SCUB 4ZT6A 5LR6A 1UEXC 1WNTA 1PYGA 1VBNA 4PCLA 2AQKA 3ZI4A 1XP5A 3LX6A 4ZCIA 2VRNA 3TG2A 3RS8A 1DIHA 5BWOA 4K9KA 1WETA 5AJWA 1VG8A 4X91A 4OL9A 4ER7A 3GLHB 3JD0A 1AMUA 2VQSA 1QUFA 2Y8EA 3R7WA 3A6JA 1AM4D 1EG7A 3TAUA 1NM5A 5EPUA 5BXYA 5AKHA 4FOSA 3KE9A 4P81A 3F49S 3BE5A 3BD7A 4HYEA 1QHYA 4LY6A 4B71A 5CB8A 1YB1A 2EG5A 3PXEA 2VOEA 3E7WA 4RIGA 2DM6A 5AK5A 3VOTA 5BMVF 1Z63A 4XRRA 1PGOA 4GZMA 4AJJA 5BR8B 4IIJB 4O3MA 3VX4A 1K2WA 2QE7D 3T3DA 4M98A 3FYSA 4O4IA 4BO2A 3SVTA 2AEFA 2L42A 2P5UA 3VISA 5K5EA 3OJWA 4AZ3B 3D1LA 4C30A 5C8YF 2Z57A 4A92A 1RXWA 2FOXA 1K86A 3U4GA 3LOQA 1Z5NA 1H1TA 4A91A 4RF5A 4Y2VA 5EGSA 4EFMA 3TIFA 2AVNA 1MC8A 2G8LA 2ZRHA 3DDSA 3ECCA 3GMTA 1S8OA 1GA6A 2AXPA 4WFJA 1IMOA 1AURA 4FQ5A 1QK3A 1KO7A 1SC3A 1KYXA 2V7TA 2ZUBA 2H4XA 3MG9A 3O1LA 3OIWA 4I6JA 4KLCA 5T5QA 3WXMA 1ZMRA 4QYTA 2CLCX 4UXJA 4XIGS 3LGXA 4D25A 1VLVA 3NTRA 1BS9A 3GT3A 1W48A 1ORWA 4DSUA 3AM1A 3WYCA 3AHFA 3U44A 3RC1A 1OYYA 4CLHA 3PYMA 3CB4A 3HCRA 3RC2A 2GHRA 3TGPA 2IP4A 3QLUA 2DETA 3SOPA 3NANA 2GD0A 4LGCA 2G9RA 3G0IA 1F38A 1A8IA 3TR5A 1P2VA 4OHKA 5H9VA 1XWFA 2GR9A 3MBIA 3H5LA 4OXKA 3ESYA 5ALUA 1IWOA 2ZETA 2VP4A 2ZRQA 3G59A 2WJGA 3K6KA 3S2GA 2VJPA 1TQHA 1WPQA 4FGSA 5CEJA 4ETWA 4JOSA 4CN8A 3INNA 3B6EA 4GGOA 1FMCA 2HT6A 4K6FA 1XAIA 1JVNA 1PL0A 1TZKA 3ZGYA 4F5WA 3JZFA 3N6RA 4II7A 4MR7B 4Q3NA 1MB4A 1YK1A 3ZE7A 1XVIA 4W1SA 1EP3B 1JEQB 2MWMA 2NYVA 3PPYA 3TZEA 4OPMA 4DWOA 3VU9A 4ZVVA 5CNKA 2DFVA 4G1MB 3ZVNA 1NJ6A 2A33A 3ZW8A 3X1JA 1B15A 3KKKA 5B2ZA 2Y9PB 4BO6A 4JAVC 4M83A 3X3HA 3V55A 3WBFA 1QCDA 2Y0CA 1JFSA 1PG2A 3LK7A 1GFIA 1FS6A 2XB8A 1SCQA 3AF4A 3AVOA 1JXQA 1JU4A 1SC4A 3D4PA 1HWYA 4XLTA 4D80A 1GYRA 4Q24A 2BGWA 3ZJYA 4BCCA 4FFDA 4I5GA 5LMZA 4R2JA 3CX8A 3JQPA 3BJEA 2B9VA 1ULSA 1XK7A 2BGNA 1XYVA 3BRCA 3LRPA 1TDJA 4GF5A 2XUHA 4YRZA 5KYXB 1QGZA 3KQPA 1R2QA 4RAOA 2H2GA 2E21A 2R66A 1Q1AA 1MZPA 4TVKA 1GKIA 4QGBA 2PXAA 4JI5B 3W8EA 2ZJ0A 3KE8A 4XFKA 5JIBA 2HDWA 4WBNF 1H2ZA 3FIUA 2YW9A 5MN4A 4WLUA 5KYWB 5JJCA 3S2IA 4BB5A 1WPRA 1Q0PA 5EIFA 1JHVA 2KB0A 3KO8A 4H15A 2OQVA 3WLPA 3L01A 4E33A 4BMNA 5CX1A 4XYMA 5F35A 1A04A 3T3HA 2A84A 4PTZA 3F3SA 5TB5A 5TDHA 2PLNA 2VG8A 3QVVA 4B2YA 1CC1S 3P32A 3AJEA 3ICQB 1QYDA 4HBGA 2R97A 4Y6LA 4H6PA 1JBEA 1L8LA 5IT5A 2QLFA 3HDYA 2Q3EA 5H83A 3D6MA 3VHLB 4QYMA 4YFYA 4UBJA 3QENA 4EY5A 1D9ZA 2OB2A 5LQMA 5G4KB 3LBIA 2B21A 5KNDA 2DFPA 3N2EA 4JJ8A 6Q21A 1J4AA 4EA9A 2O19A 3TLYA 2Z2IA 3BXPA 3QEKA 2PD3A 3KRTA 4O1IA 4HWOA 2C82A 2G9UA 2OM6A 1I7DA 1YMVA 4LA4A 3IGFA 1U2PA 1RQLA 5FEUA 1NAIA 1TJNA 1QHNA 3BL6A 5C80A 1NJ5A 2IXBA 2CXTA 5KWSA 4PF1A 4F6CA 3PSHA 1HKHA 4JZYA 2GH1A 5F7JA 3U39A 3ACCA 2UZ4A 5E6RB 1TD9A 4YJFA 2O3SA 6REQA 3DV0B 3EGOA 4ZQEA 3W6UA 4B3XA 1RJ9A 1FOEB 4AJ4A 3AEUA 2ZRPA 1KXJA 2BAGA 3NHFA 4Q7EA 3S1LA 3G2JA 1Z2AA 3HDHA 3QF4A 4BMDA 5BQXA 3A05A 1M2OB 1IPEA 3HUTA 3ONFA 3D6UA 3FLEA 3E9YA 4LNAA 3O2JA 4I1YA 1E2FA 3C5CA 3GH3A 3PCRB 2Q2WA 3MVEA 1E7WA 1MT3A 1JBQA 4XGIA 1X0XA 2JIMA 5FLKA 2RBEA 2DR0A 4AWAA 1KBZA 4BEBA 4ENRA 1E1LA 5E1MA 1POXA 4RAQA 1P91A 3H9EO 3UYKA 4IIJF 4NENA 1RRKA 4D9MA 3HKDB 3O8DA 5D01A 1VP9A 4LQDA 3ZNQA 3P9IA 1I36A 2A58A 2GUGA 2V0GA 2BKVA 2X7XA 4EUFA 5JANA 2B5WA 4O0MA 3BZBA 1HQDA 2Y66A 5FA6A 1GP2A 1W5SA 2X5KO 1K6XA 1ZWKA 3NV9A 4ALLA 5FBZA 1R00A 4MHSA 1QM5A 1ZGAA 3KVOA 4FHFA 4LJ6A 4YJHB 3RPEA 3VNBA 4YO7A 2F4NA 2QU8A 3DHNA 3MLEA 1SKYB 2ORVA 4I1SA 5HS4A 5SZKB 2CV1A 1T34A 3A9VA 2DUJA 1JG6A 3FD8A 2QD2A 1SQSA 1ZYUA 2C7BA 3KLNA 4WBXC 5K2OA 1TUEA 4ZN6A 2YV3A 3NIGB 1I1OA 3WFIA 2IHYA 4AMGA 4HNAB 4YJ2B 4TROA 2C7GA 1XMJA 2EW8A 3GEBA 3JQ6A 4YUXA 3N2YA 4R3NA 1LX6A 2ZPUA 4L5IA 2PMKA 1TCBA 3AU8A 2WHEA 4U7TB 3D4LA 2XXAB 4BFWA 5TR9A 3UC9A 3VNAA 3H5NA 2RHRA 1FTQA 2HRZA 3HMQA 1CY0A 4E5DA 5JJKA 2ZUUA 3R9XA 1SURA 2IYQA 4EBFA 4RO0A 4UVDA 5DE3A 5KJCA 2WWRA 1GPWB 5KYYA 1LVUA 4YREA 1WUHS 2BE9A 2ZJFA 3T9DA 1DFHA 2XKAA 3VR5H 3GNLA 2K5UA 2A9RA 2JGLA 1YS9A 4G8JA 5A6SB 5MFZA 2FJUA 1CX9B 5H1YA 5LZ4A 1ULHA 5JSKA 13PKA 4EUNA 3MGAA 7REQA 3EFOB 3O1IC 3FKJA 4B3TB 2APJA 4OJQA 1TW3A 2WHPB 1WTCA 4UZSA 3LX8A 3RTAA 4PNEA 4AFNA 1UFRA 1F5NA 4P54A 2P4EA 3IIEA 3N2ZB 4KACA 4R40A 4WMLA 5CA1A 4B7CA 5C8XA 3ITNA 2H48A 4HN2A 2VVTA 1O5OA 4UU1A 4JOBA 2H57A 3CTMA 4JOQA 4Z53A 1XI2A 5I8ZA 3TSYA 2JKVA 1L4HA 2FR8C 3B1ZA 1RLMA 3IAS6 3JALA 3G68A 2WSSA 1X1RA 2ZB7A 5EJ5A 2R48A 4TYQA 3V8BA 2FLWA 2JI8A 4BNUA 4Q34A 1IRXA 4LSWA 2R44A 4B0PA 5EQFA 4R6XA 1LPOA 1H4SA 1UZAA 3OMLA 1RI5A 3I4FA 2DEUA 2WM3A 1OJ7A 3DE5X 4M0UA 4YWJA 4B8WA 4JEUA 1KHTA 1ZCFA 4KQCA 2O59A 2AI3A 1NTRA 4CPDA 3K15A 2BTQA 1YAJA 4U2EA 1QHFA 2AWOA 1UOQA 4TTJA 1QZUA 4WDRA 5IJ0B 2Q41A 1OGIA 4Q4JA 3RLFA 2C58A 4J94A 5EMJA 5KQGA 5BQ3A 1U0OC 4P80A 4UDOA 3NXKA 3QGMA 2ZAMA 1FFEA 4YMVA 1EVLA 4I3GA 3BRSA 1X1CA 2XCTB 4IJMA 3CR8A 3EXHB 3UAWA 4JLAA 3PS9A 4QTUB 4DR3B 2MSWA 1IY2A 1L4FA 2I4RA 2RC5A 5IKMA 1PO7A 2ZBQA 1RHMA 4EMTA 3VZDA 5F7XA 1K92A 4L8FA 4PG5A 3VR5D 4CDNA 1TCVA 3SZLA 5LYJB 2OORC 3CT4A 1BMFD 3N8NA 1SA0A 4ZAXA 1HMPA 3QEMA 3RU3A 4UU0A 3PXUA 1VCOA 4D9EA 2QLLA 3FNFA 4ND2A 2N42A 3QVSA 1K4KA 1OXKB 2ODEA 3RIHA 3SYLA 3W1WA 3ZE0B 2IDKA 5K0GA 3R7WB 2J0SA 4TZTA 1CDEA 1JEJA 1GSAA 2VK4A 5C1BA 3UH0A 1GQSA 3FBGA 4LQ4A 1H3FA 1XF1A 3BVPA 2BWJA 1RHJA 1SCKA 3SC2A 3VKVA 5GGYA 1YZLA 1YBMA 2NO7A 1YRLA 3FDIA 4M36A 2ETXA 2GZRA 4OSPA 4S3MA 4OX9B 4O4IB 5EIHA 1K75A 2F48A 2ZIFA 1T10A 2MMGA 3BH6A 3EN0A 2ACWA 1FEZA 3NHPA 5GWXA 4ESOA 5HQ3A 2DG2A 1MLDA 5FI1B 5HFNA 2GB4A 1I14A 2IHBA 4FK8A 3I2HA 3VC3A 3I30X 1EHYA 2QWXA 2OGTA 3NW9A 5EJAA 2PNFA 3SJZA 1Z8HA 3QQPA 3QW4B 4JVSB 4G1FA 4RIFA 3O82A 2D0PB 3UC5A 2E4AA 2B61A 1NQTA 3CMCO 4R9SA 5DT9A 2HCJB 1NKTA 1OV4A 3HR4A 1L7OA 2IYWA 1AC5A 1FTYA 2M6RA 2HL6A 2PXXA 3QBVA 4RMIA 3TOCA 2DSTA 1B00A 3TWOA 3GU3A 1NVWQ 2OMKA 3W78A 2WP0A 3FDJA 4CBVA 3KYDA 5KU1A 3LO8A 1Q12A 3JVUA 3O84A 4FDLA 2YTZA 1RCTE 3NETA 2JAQA 4H4DA 2IYTA 5GJWC 5IXSA 1E2PA 1NXVA 1OVMA 4HYQA 1WY7A 3Q3JB 4JEMA 2J32A 1D6JA 5D3QA 4FFOA 2ZXFA 3FNBA 5BN1A 4P32A 3VM6A 2BJWA 1R9MA 4GR9A 5I7RA 4ZQCB 4CTJA 5AVSA 2DWQA 1IUOA 4MMYB 5EIBD 3TIIA 4N5NA 3N7TA 4FBMA 4LUCA 3R23A 3H13A 2O05A 4TQAA 4DA9A 4QKQA 1IJKA 1Y89A 2UDPA 5FOVA 3VU9B 1IXKA 3TVDA 2X19A 2OHFA 2ZB2A 3VPXA 3B1YA 3KS9A 1G16A 2VNIA 3NM5A 4YCMA 1P61B 1QQ6A 1AK2A 1W8DA 1T2UA 1VE3A 4IQGA 4TRJA 1NX9A 2CLKB 2H2DA 4ZVNA 3UHJA 5DH9A 3IYLW 4OUKX 4ZIRA 4M1SA 3GZJA 5EKSA 2AX4A 4IIEA 3S70A 1O8CA 3K30A 4KIWA 1JBKA 3WL7A 3JR7A 4HJRA 4MQ5A 2C1ZA 5IUNC 2LUOA 3PXDA 2FGKA 4UEWA 2A1UA 2D5IA 2AT1A 2BE7A 2HWUA 1EP1B 5U4QA 4DKJA 4O2AA 4RDXA 5AKJA 1JUDA 5EQTA 3WYFA 4PS1A 2GETA 4O5OA 1E2LA 3AP2A 1SBZA 4TV9B 2FEXA 2C5FA 1NVFA 2Z8YA 1FBNA 3TSWA 2QTVA 1CZOA 2ZBEA 4F6LA 5FPQA 1Q92A 2E89A 2ZRDA 3KDSE 4F3TA 1XTIA 4PXAA 2EGUA 2ECOA 2JCXA 1DINA 2BPOA 3WL8A 3ZV5A 3DP7A 3O4FA 4X00A 3D2AA 1S5PA 1VC2A 2BHRA 3HXKA 3HFJA 2IDJA 4KR9A 2R8ZA 2XUFA 4NCKA 5CX1B 1YH3A 3EGEA 4QEKA 4BNGA 4N5HX 1YQQA 3CXUA 5DLEA 3DAHA 1W52X 1E1KA 1CPYA 3EQZA 4JB2A 1EJBA 4HQ0A 5ED0A 4YRNA 2E5LB 2GFIA 4YB8A 1ISJA 4QSMA 1GCUA 3DW3X 3FDXA 3ZWYA 2XYRA 3RYIA 1SKYE 2R751 5KSPA 2ZR8A 3B7WA 5B7GA 2I4LA 4Z0PA 3PFNA 1OBCA 1JQ5A 3UMBA 2GXQA 5KOJB 2ATVA 2IHKA 3OECA 3U1BA 1NDUA 2VYND 4HJXA 5CNMA 2LV8A 2CKMA 4Q9IA 5FAKA 1WDMA 3FOCA 3GRZA 4NHEA 3SBDA 1S3GA 1T5HX 2Y1FA 4NYJR 4Y9DA 1XRRA 5AM5A 3ZLTA 1C1XB 4TLAA 2UZ3A 2X3FA 4LTNA 3TO5A 3KKLA 3DKPA 1A8UA 5HYVA 1I30A 2I71A 2XNDA 3ZS9A 3HG7A 5JS8A 1T2CA 5JNRA 3OI7A 3IQDB 4YJFB 1OFIA 3QE3A 6REQB 5LYJF 5DGIA 2H2FA 3AEUB 5B58T 3R3WA 1TB4A 2QROA 3FXAA 2OD7A 2P8JA 3QF4B 3AF5A 3QOWA 3VR3D 3BIJA 5JCPA 1UODA 4DAOA 3EAGA 4G0MA 3T0FA 2XADA 5BR4A 4RE5A 1E2JA 1G5TA 4CQJA 4RX1A 1IOZA 3PC8C 4V38A 3A4YA 3F0TA 2HO5A 4OJYA 2DUUA 5I51A 1SUEA 1ZJWA 3WIOA 2I4TA 4E5VA 2AQ8A 2YUIA 4CIDA 4QYXA 1ESCA 5JDIC 3VR1A 2XUDA 2QSUA 1BDMA 1PFVA 3KJNA 3MB5A 4JLOA 1A7JA 4O4IF 5HDQA 2J85A 2GBGA 3A26A 4BBAA 4GQBA 2NT3A 5HIKA 5CB6A 5FWXA 3KWJA 4KO1S 2HQ1A 5JZ9A 4KN6A