2QD3A

Wild type human ferrochelatase crystallized with ammonium sulfate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 143
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A01
2H1WA 1L8XA 2H1VA 1DOZA 1N0IA 3HCNA 2XVZA 2AC2A 2QD1A 2HK6A 4KLCA 4MK4A 1C1HA 2AC4A 3HCPA 3LYHA 2Q2OA 4KMMA 2XWSA 3AQIA 1LBQA 2DJ5A 2XWQA 2Q2NA 2C8JA 2XVYA 2JH3A 3HCOA 2PO7A 2QD4A 3M4ZA 2PNJA 1QGOA 1TJNA 2HREA 3GOQA 4F4DA 1LD3A 2XWPA 3HCRA 1C9EA 3W1WA 4KLRA 1AK1A 4KLAA 1HRKA 2PO5A 2Q3JA 2XVXA 4CCSA 2QD2A 2QD5A 2QD3A 2HRCA
chains in the Genus database with same CATH superfamily
3KOZA 2D62A 5K6RA 2Z4SA 1UAGA 3HJNA 3SIWA 4JUBA 1PZMA 4D9NA 1DMRA 4ZQFA 1OOEA 3HKBA 4HWSA 2PMFA 4EW6A 4M0CA 3UANA 3DAYA 2OM6A 2YOFA 2RH4A 4M0FA 3KQVA 1R3DA 1S2NA 4BIMA 1EFHA 1RFGE 1ONPA 1T5SA 2J45A 5JMPA 4QREA 2R84A 2PV0A 1XPJA 2DE0X 1PWXA 1IHXA 4RULA 1E1RA 2RI0A 4HB2A 4YWJA 5FUMA 4LSGA 4XQGA 4HDKA 4O4HB 2GEUA 4BFCA 4DXHA 4JLJA 1AK2A 3V7UA 4EHFA 3EYWA 3AEKA 1KQ3A 2BCEA 2G4CA 2HOQA 4WTOA 2I4TA 4P34A 3Q5EA 2BUBA 4CMCA 3KQNA 5F7XA 3AF2A 3QGMA 4G89A 4NESA 1EBUA 1SB8A 2QY9A 3IE0A 3O8QA 1A9XB 1XBTA 3V3KA 3ANNA 1YD7A 4Q7EA 3OJLA 5GJWC 4AG3A 4CQMB 2X2PA 3T4UA 2J3KA 1XU9A 1PWEA 3ZHQA 4OHPA 2WD8A 3HVRA 4IBOA 1E1MA 2J5QA 5KYGA 1HDCA 4WV3A 5L8VA 3Q1LA 3GEPA 5FRDA 1YS1X 1N1EA 5IEJA 3PF9A 2FPWA 1D4OA 3A2KA 1RPNA 1F1JA 3L4BA 1GAWA 2OB2A 1DHRA 3NHKA 3TG8A 2P35A 1X8LA 3JU3A 4OFZA 5JQGF 1K4MA 1E0JA 4PTZA 1WUHS 4RF4A 2BCGY 3VTZA 5A9TA 3NEPX 3QFRA 4BLPA 1I8TA 2XOKD 2W37A 2QXTA 4UHEA 3ZV6A 3IQZA 4Y0VA 5TMPA 3EAGA 3ESDA 1CS0B 3CLRD 1ND6A 3HU1A 1E9BA 3WBFA 1FC0A 1Y4DE 4PEVA 1J0XO 1NATA 1U2GC 1YR3A 3V4LA 1S0UA 1JI3A 4I46A 2R8BA 2R1VA 4MV9A 3PQ3A 5ERXA 2OV3A 2CZCA 1G8KA 4LRTB 5DJ5A 5IRCD 2C4UA 3HKEB 5KSZA 1DDIA 2X9LA 4QBHA 4CE6A 1KR2A 3OCXA 2LD4A 3LT0A 5CT6A 1MAHA 2XNJA 5HKLA 2J5XA 2CMKA 3EZ9A 2G82A 1CHDA 3RF6A 3ANLA 4FYJA 1IE3A 2WZQA 5AK3A 4BDSA 3PFFA 1DU4A 7MHTA 5TY0A 4XQ9A 1JIVA 3NBFA 2WU3A 5BXQC 3BL8A 2I4RA 4PBRA 2GFIA 3GZNB 1PFYA 2FW1A 2WFLA 1WAMA 2NXEA 1J23A 4HTFA 4K9SA 3DHEA 2ZGVA 5IZCC 1FQWA 2VHTA 3EVTA 1DC4A 3R3XA 4FX5A 3GRFA 3HEMA 1BXRB 1NXTA 4CKEA 4RFSB 1RJGA 1E96A 2ZRBA 3A1DA 3CZMA 4AY4A 5ISMA 2CF5A 2Y05A 3P71T 4JDUA 4QBKA 5AKEA 3R7SA 3RRBA 2CSXA 3R09A 2A59A 1DFHA 2AYZA 3ZE6A 5JS6A 4ZDWA 3MTJA 5LUAA 2IYYA 2GK6A 3ZEIA 4EJMA 4ND1A 1HFJA 3PC8C 3CR3C 1UK9A 4Q1BA 3QWBA 1E2GA 4Q47A 4R6XA 4ALIA 4PN7A 4O2AF 5BWMA 3U5TA 3FSGA 2W2PA 4M38A 4YJ3A 4BJ1A 4M0UA 3JAMA 4RX1A 5TQ0A 3RH0A 3RRYA 1JG2A 1C3JA 3M2PA 1P1FA 2N1BA 1CUEA 1XZJA 1F17A 2Y2UA 2O06A 5A3RA 4EVSA 2DCMA 1QGOA 3TR0A 3IX7A 4M2LA 2JI9A 1WXHA 1M2OB 4K87A 5B3AA 4EVQA 1NY6A 1HQCA 2HCBA 3KB2A 3JRWA 4H27A 1IBLB 3KB8A 1JAZA 1YACA 2NW6A 4UKDA 3FMOB 1R8YA 4OHVA 3T52A 5TGZA 4EF4A 1SQFA 1CQZA 3ZDXB 2CUNA 3AHGA 1UBCA 1OW3B 1LDBA 1ZCZA 1K3UB 2JGDA 3K1ZA 2AFIE 1JG1A 2VSXA 2ZBPA 3C3YA 3P0HA 4I4TF 5KJFA 4KN8A 1C7IA 3M9LA 4OH1A 4QUAA 4RACA 3DMTC 2JI8A 2OFWA 3MW8A 3ZLUA 3IVMA 1JFFA 4TS4A 1L4FA 3OZEA 2Z95A 1YGPA 3L7KA 3B89A 2I34A 4C2BA 1ZPDA 1N6OA 3GX1A 5LSAA 2NQ8A 4PLTA 2Y4NA 2Z9CA 3B9PA 1RXYA 4QPJC 1HNZB 1OQAA 3CRQA 1Y1TA 3GGDA 5LXTA 4EABA 1FRZA 3GLHB 1VE9A 1XAJA 4CIYA 3G1TA 4QFDA 5AM5A 1I3LA 4IGIA 4BZWA 1F5NA 2Z5GA 3N8DA 4W63A 4YMVA 3EZFA 2C8KA 4C07A 5ICFA 1Q0UA 1QTIA 2EIXA 5EXPA 4EI7A 2VBIA 3OE1A 3K73O 4TKMA 4RESA 3T6KA 3W8NA 4NXNB 2Z1NA 4TLDA 3RFUA 1CNMA 2DSNA 4XDGA 3O8QB 1Z25A 2XCUA 3LDAA 1QYCA 1GJRA 1UFQA 2IOYA 2OOSA 2VOJA 4PGFA 4MVJM 2WFLB 2R62A 2NP7A 3HZZA 1NQTA 2WB4A 3WBJA 1OGYA 2IYUA 1WCV1 5P21A 3NDPA 3ZCSA 2C04A 3DE0X 4D3XA 5JRDS 3UXMA 5FBVB 2A9VA 3KQLA 1TKRA 1Q15A 5GONA 2P6PA 2FF7A 3OTIA 4YRGA 1DWUA 1GPUA 3NCTA 1NVVQ 3RU7A 3W5DA 1IZ7A 2PQ0A 4EF5A 2XUZA 3AL2A 2PUGA 4LJSA 4P4SA 1I7DA 2Q07A 3PUHA 1TJ3A 2O2HA 1WBDA 2C59A 1KA9H 4U1RA 1YWGO 1EEHA 1U0EA 3GEIA 3QWFA 4KV9A 1V35A 2PKEA 3AHFA 4LJ8A 3RIXA 2ZR0A 3O4VA 4RANA 5IAEA 3BWEA 1VRCA 1GU0A 1VPWA 4D4IA 1F2UB 4HAIA 2EKBA 3TSAA 1OV4A 3KPJA 4QU8A 5HXAA 4J2HA 4NBWA 1FP2A 3WLHA 3H4IA 3AESB 1K7SN 1REQB 1YZ3A 3HVIA 4IILA 4L72A 4TL7A 3MAGA 4UVIA 3WOVA 1WCYA 3H1EA 3MCUA 4QQNA 5M7EA 5FR2A 4RTQA 5JCOA 3A4VA 4H77A 3HYRA 3DTNA 3UMBA 3WDKA 4BJ5A 1E2PA 2GNAA 3PNYA 3ETEA 3HDJA 4P3YA 1NLYA 2J87A 3KUXA 1XMSA 2VJMA 5J9FA 3ASYA 3CLUC 4B35A 4F2GA 4Q1CA 1V3TA 1YE3A 2O8BA 2ODPA 3QWHA 2YIMA 2XNKA 4QDJA 3JTMA 3PE4A 3BXXA 2VA9A 1C1XB 4L5AA 4N0PA 3W1EA 2O7VA 4PGAA 3QLTA 3CF2A 2V7QA 3LE8A 4YCNA 3L1UA 3KPVA 5KI6A 1HF3A 4YLGA 1CJUC 3V1UA 4X3PA 1QIMA 3W06A 1E94E 4LZAA 4LGMA 4QL3A 1E4VA 3YASA 3GGSA 3NO4A 4BLWA 2ACVA 1L7VC 4NG5A 3H9UA 4EI8A 4MPJA 3PEUA 4V24A 4WXMA 3WKBA 4C0HA 2DLCX 1UWKA 4M3NA 4BEJA 3MT8A 4AY6A 2NTEA 2XCTB 1G8HA 2HPHA 1MJNA 4NPHA 3HI6A 1Z6XA 5ELMA 2Y93A 2IUTA 2PWYA 1KAMA 5CLGA 1RQPA 2AV6A 3GFRA 4A7PA 1E2QA 4EX7A 4A5OA 5K20A 3A70A 2GZ3A 3B51X 3F2VA 3VPHA 3NTOA 1NXOA 3JYNA 4FCVA 3REQB 1FUYB 2BR5A 3BDAA 4I1OA 4TV8A 1YRBA 4I9HA 4CLXA 1XWIA 4LMRA 2WKSA 1GPH1 3K53A 3KE9A 2AG1A 4J3NA 5IFLA 4BZPA 3BTUA 3FKJA 3RYIA 1VA5A 3TQRA 4DDKA 2XMGA 4ZCMA 4MWSA 4UCXA 1RRFA 4NS4A 2BGRA 2BHRA 1SBCA 5LQCA 3MWJA 1UZMA 2YWCA 1WO8A 4PX5A 2W4MA 5I9TA 2AQIA 2HJSA 2EFHB 3PENA 2IZ0A 1T9GR 5EWJB 4BO9A 4F4CA 2W2VA 3DKRA 4U02A 1U4SA 4H18A 1Y8RB 3K2IA 3LQYA 2VCEA 3CX8A 2XI4A 1LTKA 1UP4A 4IUCS 2B4RO 3A7DA 4DIDA 5L4SA 3IH5A 4IUYA 3IOEA 2IOFA 2A1UB 3EASA 1EVLA 1F2UA 4JNKA 4KVZA 2RGCA 1TAHA 3GVHA 4LY3A 5DKFA 1Y5IA 2CFIA 3FLEA 4J94A 4GNRA 1QE5A 1SKYE 2GPYA 2GZ1A 3LF2A 4ZO6A 4IAOA 2JLWA 3UXHA 1HL3A 1NF3A 2WWIA 1VBMA 4JC5A 5M2QA 1PT5A 1R4ZA 3HMQA 4TSFD 1IH8A 4RK5A 3QLEA 2OYRA 1IJEA 4IFIA 2QTHA 1OH5A 3U7RA 1E66A 4MLCA 3DMPA 3G2KA 1ZISA 1WD7A 4X5OA 2R1TB 1B0AA 4BP3A 3GVCA 3PXAA 4RABA 3E3OA 4DNOA 1KFCB 1R6XA 3HEBA 5ADVA 2HO4A 4V1CI 2G71A 2Q5JA 2GZHA 3DOJA 4UHCA 4NCHA 3ZJ5A 3F78A 3VFDA 3GLVA 3R7AA 3SAJA 1B1CA 4J16C 1VM6A 2FZKA 2O2XA 3K6JA 3RSQA 1ISRA 1Y5RA 2GSWA 3A7EA 4JJ4A 4CG2A 4Q03A 5A1TA 1T2AA 1AXRA 2V7WA 3LLMA 1U2DA 1RPJA 2VDKB 2GTIA 4LF6B 4OBWA 4CLRA 2PUJA 4IHAA 1Z13A 1RXWA 4LDNA 2LCIA 1Z7WA 4F4UA 1MOPA 1OF1A 5CXXA 3AR3A 1G6OA 4JVMA 2UUCB 2AOTA 5AHKA 4L5YA 2WHQA 1PF7E 3JQFC 3VR3A 1G2PA 3IVXA 2GEJA 2MMGA 2P69A 5BPHA 3U44A 5JBNA 1JIUA 1F4PA 2PGJA 1INLA 3CBQA 4YRRA 3ZCTA 2PMKA 1W4LA 2ZB4A 1N25A 1EDEA 2F90A 2IPAB 5ULLA 3VDXA 4E88A 4TZ6A 1SNYA 1P0QA 3D4OA 4UTNA 1FEZA 2R85A 2J0QA 4FYWA 2VCHA 4I3GA 2BGTA 5JXIA 1T5TA 2QMEA 4EY5A 1GFZA 4B8ZA 4QVKA 2ONZA 2FK8A 1RQGA 1QTRA 4F3YA 2X8AA 3OC6A 1QNFA 1G2IA 3P27A 1J20A 1EVKA 1YQ9A 2HWXA 1DAIA 2Z83A 1P9LA 1RPAA 4B3IA 4PSDA 4JODA 3UT6A 3EPKA 1DUIA 3LQFA 3IQHX 3ZY3A 2BKAA 4AZWA 2B2CA 1UP6A 4LUCA 4LXUA 3HA5A 2CNWD 4WK4B 3PE3A 3U3MA 3QPWA 3AFGA 1E3TA 3G2IA 2DJIA 1GA4A 3NTQA 3R3UA 1A0OA 1XXHE 2OBYA 2AEJA 4TLBA 4XD7A 2XDYA 4LXXA 4BVJA 4EA9A 5HIKA 4KN6A 5JCJD 1U7DA 2GCIA 5HF9A 5DYTA 2N3ZA 4XEUA 2BEUA 1W59A 1N3BA 1XHEA 1PFUA 3A2MA 4JC0A 4JUAA 2KI5A 4PGGA 4CCYB 1P44A 1ODTC 1XA3A 2Z5VA 2QQ5A 2IELA 4LTDA 3ZGNA 2ZSIA 3EWIA 1ZSYA 3S2ZA 4PSKA 3N1UA 2I7XA 1P4SA 2R47A 1Z2OX 4TM7A 5D3ZA 1XE3A 3RAPR 3ZJVA 1H0KA 3KUCA 3QG1A 3S99A 3P2IA 4LHVA 3WYAA 4PZYA 4QQRA 5B1EA 1FPMA 1YQDA 2AOVA 3A04A 3JYPA 5I7HA 2A94A 4LBVA 4EPXA 4E22A 1A4RA 1I32A 2R6AA 2QL7A 2GEFA 2KBFA 2VXOA 4H7JA 4L02A 2IGTA 3BGWA 3DWGA 5C7IO 1WPXA 1DOZA 3MS7A 2PWAA 2QTFA 4CEIB 2OC9A 3K5HA 4QDOA 3IKLA 4OP3A 4Q4HB 4ZEWA 2MSNA 5GINE 4K6HA 4KYIB 1M54A 2OM2A 1DXQA 1X7WB 3KSBC 2W6NA 2JC3A 3U4CA 2TYSB 5AOVA 3M81A 3KFLA 3EEIA 4WXYB 3NPAA 3KHKA 4EB0A 2DR2A 1MBZA 3HUTA 3PFKA 4C1BA 4AX8A 5HQTA 3WK7A 4D9GA 3V1NA 2EZTA 4URVR 2GM5A 4FONA 5DPMA 2RGYA 2CC2A 1R74A 2AZTA 1KJIA 4KEAA 4OJYA 4DGQA 3VC7A 1AA9A 4M37A 4P54A 1C3VA 4J0IA 2VPQA 1TCUA 3MJDA 1NYRA 2UYQA 1N5OX 1Q77A 3TJMA 3ZWVA 3UJAA 1NLFA 5A4MS 2OFFA 3N0XA 3EMDA 2AMLA 3IGFA 3ODPA 1KDVA 4EI2A 1AVTA 1Z5PA 1Q14A 3DB1A 4DRZA 4KLCA 2NUBA 3HN2A 2R7NA 2IXAA 3B7GA 2VJLA 4GZMA 1HTWA 3U7JA 4RXMA 1Z38A 1T4BA 2GRJA 1X77A 3HZRA 3OKFA 4JH0A 4DL9A 2B8JA 3TIFA 3KJHA 4DUYB 1FXWA 2JFYA 4U3JB 4G63A 1FPQA 3I6IA 3L5KA 3C16C 4EFNA 3K4PA 2WEKA 4QHTA 1LB1B 1T1JA 2FJUA 3BMNB 3G3EA 3OM1A 3QH4A 4HZIA 3UWDA 1BW9A 5B7NA 5L7TA 1MORA 5DN6D 4GMXA 4F4HA 2OHGA 4HRXA 3OY7A 3H05A 4B6RA 5GTDA 4EKGA 4J43A 1EHYA 2XE7A 4P80A 5FAKA 1CYEA 4L73A 2GBLA 2HPAA 2J5RA 2ISQA 3WGUA 1KI6B 3CX3A 2R1TA 1TVKB 4HNSA 4JXJA 4D0RA 1PNTA 1NONA 4YDHB 1QHNA 2PKYX 1KEKA 3OFND 4MJ3A 2YOGA 3N9IA 1DAMA 3MJCA 4M1WA 1QO9A 1KMHB 2HMTA 2JDID 2N0SA 4M9CA 4F1WA 4ENUA 4FDMA 2Y0PA 3QE9Y 1SB9A 3QLUA 2O5VA 4DV0B 2ZRKA 3ZLVA 2C7GA 2J31A 4RO0A 5B1SA 2A9JA 1JH8A 2IYZA 3GPIA 4NENA 2V59A 1NVUQ 3UW3A 3R6GA 4ZI2A 2XIJA 5KNCA 4GGMX 3CXRA 4Q48A 4U2FA 2HA6A 2W2QA 3F6YA 3OLYA 4GLLA 2X0DA 3QI2A 3W4IA 4UHDA 5HE9A 1UDCA 4BLVA 3WNQA 5B6IA 4UCFA 1U6KA 3G2OA 5FPPA 3WOHA 3UPUA 2JFZA 4PTLA 1JVNA 3TOVA 3WGGA 4BFXA 1VKZA 3ZKWA 4W8OA 1T3SA 3TE7A 3ZHVA 5LP6B 3E53A 4GKVA 2OXTA 1WQ1R 4BWGA 1W96A 1KVTA 1V8PA 4CHGA 1UOEA 3GNLA 1IPHA 3LT2A 2QRLA 2KPOA 1WHTB 5AVOA 2BMEA 2EJUA 1AKMA 3ASVA 3QY9A 4KTVE 1YIDA 4LXYA 3QEAZ 3ZXIA 3F0TA 1KE2A 4HVLA 4BCDA 1IXRC 5BVHB 1G21E 2VHEA 1BH6A 4ZGGA 3INYA 1Z62A 5KJCA 3DBHA 3E7DA 1U7HA 3WS7A 3ZW9A 4HUTA 4DB4A 3ETNA 3N2KB 1N2EA 5TVKA 1W8IA 3IIMA 2F55A 1UKYA 2PSEA 1XQ9A 4AJ4A 3OZBA 4BDTA 4GOXA 4R1TA 3LY8A 4NFYA 3TB4A 2XCOA 1KOFA 4GBGA 4URUR 2YWDA 1GQSA 1P0PA 4GF5A 1KDZA 3CF6R 5HDBB 1ECLA 2JK0A 1W7AA 2FJPA 1IG0A 1ODJA 2IVZA 1N5KA 1P75A 3CV3A 3BRCA 4U2DA 3TL3A 3BXEA 3C2QA 4CDGA 4EL5A 3WL4A 5A4KA 3GLHE 2JGJA 1PR5A 2P68A 2Z04A 1EWVA 2ZYRA 1TFUA 2FEAA 2XOEA 3OIYA 3DOOA 1EBFA 1QZXA 2HRQA 4W1QA 2OZKA 5TF4A 3N76A 2OPBA 3CVXA 3KVOA 1JS1X 3FROA 4GR4A 5EEHA 5A2GA 2YC4C 2C61A 3P9SA 4HYTA 5KYYB 1ISSA 1OZGA 2UVQA 2JFXA 3GEDA 1ZNQO 3BJEA 4ETNA 1SQGA 2BGMA 2HSDA 1XP8A 1DADA 1PJ4A 1IUKA 4OHUA 5JS1A 1BS9A 4PF1A 2J9XB 2P6MA 1V1RB 3CN7A 1WEHA 2ZRCA 4KQ2A 1XDGA 5FD8A 2A5JA 1X8JA 3PQFA 3F4KA 5EMNA 5HGXA 3G0GA 4N03A 1QHXA 1QKIA 3W6OA 4V0KA 4PV7A 4GI5A 3ZQ4A 3LK6A 3SSNA 3PQ8A 1X1DA 2PH7A 3HC7A 3L0IB 3NJ4A 2K2QB 5FWNA 1KAOA 1QRRA 4V0LA 1CZHA 1XDWA 3D6AA 1U7OA 1XAIA 1T0PA 5A4FS 3D8TA 1KSHA 4BOYA 4F96A 3IEVA 1NBME 1ZM2A 3HUFA 1UJ4A 4Y2HA 2OZLA 4TQAA 2VK4A 2IK8A 5FUWA 1QYVA 1NI4A 1E4EA 1WMFA 3GA7A 3TRDA 3UMSA 1YZKA 2AQ8A 3QX8A 3MT0A 4XARA 1ID1A 1U8CB 4QYIB 4B6OA 1YGYA 3PWTA 4CL3A 3IUQA 1KRXA 4DREA 2YMMA 2XWBF 2YNMD 2R96A 4EO4A 1I3KA 1VCHA 2RJOA 4CTMA 5EYPB 3TLCA 5F78A 1Z8DA 1N3IA 3VMMA 3TW0A 3IP3A 3KQSA 3V80A 1L7OA 2ZYVX 4D4LA 4ED9A 1YUNA 1DC3A 3EQ7A 4QOSA 4GG1A 1FNCA 3K6RA 4N0DA 5KCMA 2BN4A 1EIZA 4MROA 4G0WA 5LQRA 2ANBA 1ZGAA 5AK0A 1NL3A 3K4HA 3ZK9A 1CRPA 2IW1A 4YJ3F 3RS0A 2HSWA 2KJQA 2FMIA 3OIWA 4PX2A 3AM5A 4A27A 1SXJE 3RT7A 2EWVA 4O4LF 5UKDA 3UXYA 1EFUA 3NTUA 1RVV1 4GEKA 4EGFA 4JIMA 1N36B 1VCOA 4X84A 3BSYA 2JBAB 5E6SB 2LCQA 2ZUEA 4CV2A 5HE8A 1J99A 3ZQKA 3GFGA 4EB3A 4LE0A 2DZDA 3ZGOA 4NENB 1CJBA 1ZGBA 3A6EA 2BGUA 2F3RA 4XWWA 4N65A 4WOKA 4CKWB 4D5EA 1P1CA 3LA8A 1BHSA 5CURA 1UBMS 1LPBB 3QBVA 5U4QA 1G6HA 2DQSA 3FNBA 1R0WA 4WINA 1CC1S 3KQKA 4Q1EA 1DCFA 2JHGA 1WIWA 2ZWAA 1TPZA 1QDUA 2O3SA 4MVXA 3G23A 3KJIA 3LX8A 3Q2OA 5EWMB 1K0FA 2B98A 4UEOA 3PNBA 1VMAA 1CY0A 3FR7A 3ELUA 4HQLA 4JUIA 5DRYA 1BWQA 2FDXA 2RHRA 1SM4A 3FRIA 4DVGA 3VR6A 4ZIRB 3HPRA 2L18A 3IB3A 3Q9UA 1X9HA 4G8DA 4MYRA 5FT9A 5HGJA 3RT1A 3STYA 1E79D 4HQRA 5FWYA 3U3DA 2CDBA 3VR6D 1AU9A 1NN5A 2EZ4A 2VT2A 4D8VA 1DOAA 2NMVA 4URHA 1X7XA 2NO5A 1IULA 1ZLXA 4Q19A 3KYCB 2QTLA 4DABA 3C3PA 5HNKA 4RH0A 5KNBD 3SXUA 1JAIA 1PKEA 1JXAA 3LLCA 4CLEA 5LKAA 3TZCA 2VL7A 1MDFA 1XJ0A 4B34A 1CRWG 1RBMA 2JGMA 2ZWOA 2VLIA 2H4XA 4I9FA 1NBMD 4YQEA 5KKCA 1Z0ZA 2B1QA 4MWZA 4Y30A 4NU0A 5CVCA 4MYUA 1X2EA 2ZIVB 2PK3A 2R6ZA 4ZYVA 2QSZA 3TAUA 4TS3A 3OHSX 1Q2UA 1ZXLA 5LD2C 1T24A 4IV5A 5J3JA 2WG0A 1QBKC 1SVKA 3OWOA 3R75A 1C2TA 1XK7A 2FEKA 4H7IA 3W5UA 5AW6A 1W6RA 4BO5A 4B8YA 2ZRIA 1NOJA 3A4LA 2VH1A 2JJQA 1IN8A 1DT5A 1C7ZA 1K27A 3COSA 4YH1A 4O2AA 4OQDA 3WHKA 1CUAA 3UEOA 1MQ9A 1P31A 2OECA 1N2GA 3QKTA 2VP3A 4JT2A 4MCHA 2GBGA 4BRZA 1M7HA 4JXXA 4GMHA 3HDVA 4UMVA 1UR5A 1OB2A 1W5SA 1AQNA 2H1LA 2IPOA 1ACMA 3OURA 5B4TA 4O33A 2GKSA 5LMZA 5D6NA 2WWYA 1R9MA 4D5GA 1OIVA 2Z09A 4YBRA 2ONKA 1UEXC 2ZB2A 3WWPA 3DLHA 5FLKA 3FTCA 2XZTA 4NXMB 1H8EA 1K89A 5K0ZA 1EGHA 1H2FA 3RS4A 3ZEAA 2ZWPA 4CQLA 3K0CA 2WIKA 2HU8A 2NT3A 4TT8A 4I1PA 4FC6A 4Y9DA 2PLNA 1A4IA 1UBSB 1ULAA 3NV9A 1VDMA 3DE6X 1KJJA 2GVDC 1X0XA 3EODA 3LJKA 3OPVA 4GBJA 1BA3A 3G1UA 1K0UA 3BB1A 3T9CA 4FHZA 3OMWA 1PR6A 1D2HA 2IDJA 1J2EA 3KX2A 1IY9A 3WHPA 3KKZA 2X8JA 3MRVA 5IARA 3W9SA 5EZ6B 2V5AA 1MV8A 3HWWA 1JKXA 1TLLA 1UH5A 4OMCA 4INPA 3UAOA 2HDWA 1D6SA 3ZK8A 2HCTA 2OD9A 5B64A 5GGYA 1TTPB 4NJMB 3OIVA 4HEJA 3BWMA 3T3HA 4M55A 5CFRA 3Q5GA 3SLRA 2H1VA 1G2OA 3DO8A 4UATA 5AW9A 2PS9A 1JR4A 1LNQA 3ISVA 4XJVA 4LBWA 3M5CA 5KJEA 2V3CC 3BGSA 4RXUA 2G76A 2ZANA 4HPJB 1DPFA 2J3EA 4IJUA 5CHEA 2R0QC 3O2SB 5HCNA 4IIFA 2CT8A 1DCTA 1N33B 2QZJA 1LBHA 3DWIA 3G9XA 5EZYB 5TGTA 3KHUA 1F8GA 4HFJA 1HYEA 3ZW7A 4XKJA 5KTNA 4LHSA 4M0EA 3MOGA 3QX9A 2PLFA 2JD0A 2GJKA 4RKWA 4UBLA 2MTBA 3K7EA 3WIEA 1E9FA 2QRPA 4BFZA 1SQSA 3VKGA 2GT1A 5EUBA 1QH9A 4IIXA 2PL9A 3Q3IA 4PM4A 3RRMA 1W9HA 4IF6A 4LCEA 1FDUA 2C95A 4LYGA 4D8UA 4DIFA 1P61B 1KBQA 1K7YA 1BXRA 2VZEA 3FOBA 4IHJF 7REQB 3GP5A 5I51A 1NVMB 2C57A 2QMHA 3OU7A 2F1RA 5JLAA 4IDAA 2H16A 3H2IA 3NEYA 2IS2A 3A3YA 5TMDA 3TDMA 1QAMA 2HFKA 2G0NA 1K8ZB 1T0UA 3EGDB 1N34B 4II2A 2C3MA 2WWWA 2XNCA 1EPUA 3HFRA 4LQDA 1Y34E 2JIDA 2NTVA 2QLTA 4II7A 4PIMA 5AI6A 4HB3A 1UC4B 4MDEA 1T6ZA 3U3KA 5CTAA 5DHUA 4YR9A 1Q84A 2AX4A 4RSRA 1G2QA 3ZDRA 5FDFA 1KBZA 1U8YA 1WB5A 1XEXB 2EWMA 1XVTA 2Y9PB 2BM1A 1XTZA 3WNZA 4ZFNA 4C88A 2QD5A 3SKXA 3NAMA 3G9ZA 3HJBA 4G1VA 3RUEA 1TCCA 3GQBA 1Z4LA 4F5ZA 4OGLA 1JR3E 1WTCA 1XMXA 2EFJA 4DB2A 3SP1A 4P93A 2PZ8A 2FA9A 3PR2B 3LDUA 4WZBA 4Y3UA 3SR0A 3M5PA 3W8FA 2QD1A 4UZFA 5BN3B 3IDZA 1RNLA 3RBAA 2UXBB 5HKOA 3AFNA 3AZPA 1U0HC 1O6ZA 3LF1A 4IGFA 1VSVA 2HXSA 4QFCA 2V6IA 1H2RS 1ZNZA 3F98A 4IIHA 4JI7B 1KMIY 2FW8A 4URZR 4X6UA 2OFXA 4TYMA 4K1LA 1F3LA 2FWAA 5I8WA 4PQYA 4W7SA 3KZCA 3TF5A 2BH2A 4UUQA 4CM7A 4I4IA 1Y1PA 2HPZA 2B7BA 3W4JA 4A0FA 1ORTA 2QLJA 3PXUA 2GBFA 2ZDGA 4C3OB 1EDZA 4I6EA 3DD5A 1F38A 4IXDA 1SA0A 4CQJA 3H4MA 1K7EB 3PB3A 2AG0A 3WP0A 1VHQA 1XD2B 2UYOA 1LI4A 1Y37A 3H1TA 1W2WB 4XPIB 1QGZA 5A7HA 4DWWA 4IMJB 3T5GA 1EXDA 1FS4A 1EYZA 3N8GA 3T54A 2FGKA 3EEFA 1TZCA 1PHRA 2GN6A 1U0SY 4RH1A 1OPRA 2PUCA 3GT7A 2SNIE 4M46A 4TSFA 4AROA 1OH8A 1E64A 4JLAA 1WUKS 1P60A 2QV0A 1XZDA 1DSSG 2LKDA 3LBIA 3ESXA 1DJLA 5JNLA 3U60B 2XWJI 3PXCX 2PZBA 3TGLA 1ZK3A 5DBEX 5BT8A 3E5MA 1G60A 4N47A 3VR5A 121PA 4TRJA 5IH7A 2BGWA 4QPPA 3CJQA 1ISGA 5AH0A 3RHZA 4Y6OA 2RBGA 3ROFA 3CN9A 4JROA 4ZKEA 3TIVA 4NCAA 3RYFA 1H0HA 4W9MC 2QN6A 3OY2A 1I2CA 2A6PA 4GMDA 1DUVG 2VTVA 1YBFA 2YWBA 2AN3A 3DBLB 5EMHA 4CV1A 4E12A 1TFRA 2HNKA 3RD5A 3Q8KA 4N0EA 3D59A 3LFUA 3RVMA 2JFFA 2JHFA 4TTJA 3LPCA 1ZXXA 2GBPA 1MO5A 3FDXA 1FLDA 2Q0HA 1SCUA 4TZTA 1A8IA 1HZZC 1KQOA 1Y33E 3LC7O 4OP1A 1E4OA 1Y4UA 2CXQA 3WSTA 2PD3A 4J0QA 5LU8A 4J76A 3VO2A 1W46A 4LDZA 1XT6A 2NQ2C 6NULA 4LJRA 2GAAA 1B42A 2ZVDA 4F85A 1W29A 1LBTA 2GOYA 3F5SA 2W6PA 5A5FA 1EAYA 1QM5A 1AKUA 1EVQA 3A6PC 4MVJD 5EEGA 1QFZA 1U1CA 2Q9AA 3BF7A 4I8IA 4RIFA 2AW3A 2FUG1 3EVCA 3GW8A 1QIEA 5E7MA 1EVJA 3PX2A 3FPEA 5FOWA 4KWHA 3CJTA 1RYDA 5E7IA 3HLKA 3ERCA 1NF9A 3LUGA 4NDZA 1TO6A 4YFYA 4BEWA 2B8WA 2DFVA 2WIFA 3JASA 5DCYA 5ENDA 1L6RA 3WRYA 5BV0A 4XM1A 3JYLA 2O2JA 3LGAA 2XSZD 3OTHA 4KHZA 1PNOA 1T1IA 1RC1A 2H57A 3BD7A 2ZTLA 3LUBA 3LWBA 3TUIC 3VR2A 2PX2A 2W2KA 5ENZA 3CLUD 4B71A 3EXIB 1YIAA 4V2IA 5BSTA 4EJSC 4BNTA 1ZR4A 2IOHA 3AEZA 3GAFA 4PX9A 4RF3A 3PNOA 4RC9A 3K9LA 4LZZA 4HQ6A 4F93B 2D5CA 3DO6A 5JYEA 2KWIA 3E0QA 3L02A 3NALA 3PFNA 3EMKA 1URPA 1W8DA 4EHNA 1T9CA 2ZIEA 3A1CA 4H4DA 4HDOB 4PO1A 3WL7A 1NNEA 4LOAA 1E18A 1CY8A 4OYLA 1LX6A 4XD7D 1JDJA 3L6EA 4UU8A 4ASUA 5FPKA 3LZDA 1DJMA 3IQEA 1GGHA 1NFQA 4DY6A 1ZICA 2IXDA 2XECA 3QVGA 4QM7A 5BR1A 2FMTA 1TNDA 4KYTA 1X87A 3P0FA 4NYJQ 4Z7JA 1NQXA 1GTSA 2J7PA 2ZI3A 5DI3B 5B3JC 4NDNE 3NS7A 5KJ1A 2OR3A 2QQFA 1DG3A 2Z2XA 4A92A 4C1NA 4UBNA 1GPAA 4MWOA 4FDTA 1UKAA 2HJRA 5H4HA 1GZ4A 1Y4ZA 3BWYA 3A27A 3P2JA 2M6KA 2IHYA 4EFKA 3NHFA 2CMHA 3CLTD 3HYLA 3FXAA 4GC5A 3RYFB 3WB2A 1RHJA 2C1EA 3CCBA 2ZIFA 1BQEA 4BJHB 1LBSA 5T64A 2J6IA 2G5TA 4K9NA 4Q3EA 4XGNA 2RGDA 1QAQA 3E9NA 5LBUA 2ECPA 5B5SA 4BNWA 4K26A 3HU5A 3W9YA 1C2YA 3QVOA 4RGVA 4FMCB 2Q3HA 3HUDA 2ZTSA 3Q7PA 5LNK6 3SY8A 1JWBB 3BORA 2OO7A 3AM3A 1SHUX 3WAJA 3GJXC 3OIFA 1ECPA 2GCOA 2HT6A 2I1WA 3IR7A 3R3JA 3DOUA 4FQ5A 4MW7A 4Q4LA 2FV8A 2IZ7A 4JJAA 2JKZA 1JIIA 1HZZA 3A14A 2H1WA 4C29A 1WB9A 1QRAA 3JY6A 3L7CA 2DB3A 4DV2B 2VDQB 4X1IA 5CIWA 2B1JA 1W5EA 4IGKA 2Q2OA 4Q15A 2A9QA 4CV0A 1WLSA 4FP9A 4LDRA 1MEEA 2ZAGA 3MGAA 1GILA 3UICA 4PG4A 4YJFA 1TM7E 2W98A 5DCLA 3DUFA 1M2NA 2BKLA 4QGBA 2H1IA 4RIGA 1CR2A 3ENVA 4JWKA 3L49A 4WOPA 4KH1A 1ETUA 2YW9A 4MW0A 1I6LA 3DXYA 3HNPA 5B6JA 4HMOA 5IJWA 2Q4BA 3EZ6A 2I4NA 3BJRA 3RU9A 2ZS9A 5KB3A 4IDNA 2ZETA 3DLAA 2LP4Y 4OJQA 3NP9A 5ADWA 2R6CA 1M73E 1KYQA 4HH3C 4L6IA 3AKZA 4FI3C 2YXDA 3D3EA 3IT1A 1YDHA 2ZDHA 2GCPA 3LLUA 4RM2A 5DLEA 1DJQA 2PQ2A 3EXIA 2D5LA 3OQJA 2VKTA 1VBNA 3QA9A 2GKOA 1QGED 2LGJA 5D3MB 4KPUA 2CNNA 2X0NA 3E4CA 3HRKA 2JRLA 1E0KA 3BDIA 2OILA 4TS1A 5ALHA 1KEWA 1NQ5A 3OHMA 3PLRA 3OJEA 1WDMA 3KZ1E 4GWGA 1VL2A 3KTAB 4KDFA 4O4IB 3RJ9A 2AMJA 3Q8WA 2FFJA 5A3JA 1B8UA 4HGOA 1GU1A 1SN7A 1ESCA 5K0GA 3SYRA 2C54A 2VSOA 2XTNA 1WXDA 1NWHA 1TQ8A 1N2ZA 2X9NA 4BX2A 5JISA 3TQFA 4G5OA 1E3JA 1B0PA 2ZLBA 3KAQA 4TTTS 4O0MA 2REXB 2X8BA 3IAM6 1L9XA 5EIFA 4I5IA 1YF3A 2XNDD 3TDKA 1YCHA 2P3SA 4I50B 3MBOA 4JP5A 3HCBA 1Q92A 4NTZA 3PKZA 2ZI5A 4Q3DA 5DHTA 5EMJA 2X9QA 3CKMA 3TEFA 3UCXA 3B6MA 5ITSA 2BGIA 4UHKA 4CEIA 1BYIA 2VK2A 1OX4A 4H3HB 3ZCPA 4LW8A 5KNBA 3RREA 5CXQA 4YRCA 1UOOA 1NW7A 1G8SA 1VOTA 1BMTA 2P1DA 3RHFA 3ZV5A 5I48A 2VYND 1DEHA 1RLTA 1UPCA 2G1AA 4LNUB 1VYVA 4Z1OA 2JASA 5AW0A 4EY4A 3GJ4A 1I3CA 2G88A 2XGGA 3MVEA 3IDSA 4D8YA 3BOSA 1NVKA 5DGIA 2OL4A 4H7PA 3Q4GA 3M82A 3GFTA 2YYYA 5IDQA 2PA3A 5JMOA 3DAHA 1G66A 1RKBA 3AB7A 5FPTA 3ZDDA 2UXCB 4LXHA 4DLNA 1RLUA 4M9ZA 1ZR2A 4EPTA 2JI6A 2ZBUA 4P33A 1N77A 1YBAA 1XL1A 2QIPA 1OGIA 3IDFA 4FZRA 4BJ6A 1XZEA 3OQOA 3EW9A 4KK4A 5JJKA 3U7QB 2C7RA 5AJUA 2NUTB 1Z6TA 2X0JA 4UUNA 3RSCA 4ZOAA 3WGVA 4NDAA 2J0VA 2ILVA 5AJYA 4R31A 4MRSA 4RDXA 3HO6A 3G0OA 5DSZA 1D6MA 4L57A 2B5WA 4HVTA 3H9BA 5LXTB 3AYXB 4NK4A 5AVJA 1FVFA 2PFKA 2RGXA 3ZXUB 8GPBA 1YNSA 2E21A 1Q7CA 3DVAB 1F8UA 3UUWA 3KR2A 4LWQA 2I7TA 1CJCA 1DC7A 1WUYA 4QT0A 5BUQA 1NI5A 2BRUA 1PEDA 3P97A 1Q3KA 1RHUA 4INZA 1EGAA 2YJ5A 5BQFA 3EDMA 1V7QA 4G4SO 1EFKA 1KHTA 2FUNB 2BJVA 5E2AA 3WY9A 2PRZA 4FFBB 4MGHA 5HKAA 1KMHA 1QBGA 2PGOA 3ODGA 2R2GA 4YB8A 3FWNA 4JN6B 2PT5A 3WO0A 3PDIB 5CA1B 2OAQ1 3UMVA 3E48A 1H2AS 4YJ2A 1N0HA 2WLTA 1I1QB 3QFCA 3UJDA 1BXGB 1T0IA 2P41A 3EUWA 2ZRMA 3R7FA 3A6KA 1NHWA 3JPWA 3LHSA 5CT4A 2X2OA 4C04A 1GG5A 4WOBA 1Y63A 2BE9A 5JVDA 3CISA 1KP9A 1EXMA 4M1OA 4O4HA 2XKKA 2FX5A 1ST2A 3BK7A 3HDTA 3M6IA 2CHGA 4TLCA 5GQSA 3VPXA 4BEBA 4K6MA 4KSBA 2FUKA 1G21A 1CJMA 2AUMA 2ZRLA 2RKOA 4JY7A 4KXQA 2B3TA 4MAMA 1SWVA 1JLSA 2YHBA 3KQUA 4AMVA 1BJTA 5EC8A 2P77A 4M9RA 3T7KA 1H2HA 4JJFA 1NU6A 2QUKA 3BS4A 1SZDA 3IIJA 3DVQX 3NHSA 4MQLA 1LRJA 3F7OA 1QO0D 4UDYX 1XCLA 4HCJA 3HQ4O 3R3VA 1YXMA 2A3NA 4JEMA 4P7GA 1T3TA 4RWEA 1NW4A 2WV7A 4HQOA 3TLZA 3WWDA 4MITA 5DH9A 5FFFA 1J56A 2R4QA 3CX6A 1J00A 3NX4A 5DP2A 3CYFA 4B3JA 2ZJ4A 2YUTA 4GUDA 2H06A 3ESCA 4XWTA 2A0WA 3WYGA 4BO6A 2II6A 3ZDCA 5JDCC 1KZ7B 1U0JA 3DQPA 4OOEA 2P4SA 3QU4A 3WWOA 2A9KA 1D1SA 1JR2A 3K1TA 1HZJA 3NM6B 2GLTA 4EGSA 1L4UA 2ZT8A 1V8BA 1EMDA 5JJCA 1NOIA 4YJ2B 2Q1YA 5LDGA 3WGNA 4PU0A 4O1HA 1TDJA 2OXCA 5EMKA 3SHWA 3ZWDA 4DS3A 2PYZA 1L5QA 2WUFA 5B3KA 1QH8A 1XCMA 1W52X 5FQNA 4Z6KA 1JHMA 4DQUA 3FBTA 2G28A 4O2BB 2O3RA 2GBIA 3U6KA 4TYPA 2E85A 1QG2A 1YFKA 3MSXA 1EX7A 2JFPA 3LH5A 3RROA 5LA6A 1OHHA 4WFIA 1GNPA 1D2EA 5K3SA 1DIHA 2OQIA 4OJMX 4ZAFA 4X7RA 4Q9LA 2M6SA 1GCIA 2JGDB 2W8BB 2WF7A 2OEPA 1B6SA 2YBDA 2OO3A 2JF0A 5AT1A 1BDMA 1E3WA 4BBAA 3C8MA 3WLOA 3K6SA 3GCWA 3KLMX 3ZTWA 4PTYA 5LL6P 1G38A 5T8KA 2YW2A 4WKNA 4EEKA 1VYUA 4FINA 4MW1A 1EFCA 2P90A 4MA4A 1L4BA 1D1QA 2YMQA 4G5QA 5DXJA 4A0SA 2I76A 2JBAA 1KNXA 1XFAA 1ZK0A 5F2EA 5GZ6A 3W4KA 2C4TA 1E61A 2GYVA 1TUGA 4O8CA 3UJPA 3KETA 5HFNA 2Q50A 2YWHA 3EIUA 1RVDA 3CZ4A 3ETLA 4HZUB 4OEHA 3COPA 5H0IA 4F4IA 5AKKA 5JXHA 1Q91A 2QTWB 1PFQA 1XA0A 3GYGA 3QVSA 2TSYB 2ZJYA 5TMEA 2H9YA 1Q0HA 3E1GA 3NBAA 3TX2A 3VOTA 2OCYC 3AERA 2H2DA 2INGX 2VXCA 3C85A 3Q15C 4R3NA 4BYGA 2PBLA 2ZBRA 2Y1FA 4YJHB 1P2TA 3I8SA 3O2QB 1QANA 3K2BA 3VNBA 4LHZA 1J8DA 3OECA 3RK1A 2I62A 3HBJA 3JVVA 4J6EA 5LZ5A 5AVKA 3T5DA 4K9KA 2IX9A 4GX0A 2FF5A 3LM8A 4Q3KA 3V1LA 4BO2A 1IVSA 4JNCA 1XZMA 3SQMA 1UZUA 4KWEA 5JD4A 2Y6UA 3MUFA 4P4SB 5J40A 4QIHA 1OKKA 3O8CA 1H9AA 4M6WA 3PVCA 5FWYB 3EF3A 1HKHA 5FFMA 1EVEA 1C81A 3DGEC 1EQUA 1Z18A 4J1TC 5AKHA 2F59A 3SIPA 4TTIA 1EFPB 2AVNA 2GR9A 5ILOA 4KSCA 3A9VA 1KH1A 4PW0A 1RACA 3VVLA 2GPTA 2H2GA 1MIOB 2RAVA 5TJ9A 3KIPA 3MTGA 2Y68A 4BVBA 4ZT2A 5J2TB 3RW9A 3RYTC 4NWIA 1DZIA 2NZVG 1ULBA 4XZ3A 3UKOA 3AFOA 1U3FA 3BULA 3C1AA 1OTXA 1T0BA 1DAOA 4OTZA 3UWOA 4I1RA 4X44A 1GR0A 3W5JA 3K70B 4EKIA 1VE6A 1J0AA 3C70A 5KYXA 4M1KA 5IW8A 4TVSA 4FSXA 3GZTB 3RVLA 5JZMA 5B4UA 2DKOA 1SGWA 5C7OO 4DAOA 4R2JA 1BVRA 4UCWA 5BSUA 3NC4A 1NSYA 3FUWA 5BORA 5HYVA 5FTWA 3KEMA 2NU9B 1E9SA 3MF4A 1E92A 4RW0A 1C1DA 3SYLA 1H9CA 2UU9B 1B00A 1NLUA 2QA5A 1F2TA 3AUKA 4DJDC 2NZXA 1Q0ZA 4HPXB 1MQ8B 2JGIA 3A10A 3CZCA 3E9YA 1R4NA 3EVAA 4WFKA 5KOJA 1G0OA 1LPMA 2QX6A 4L75A 4GZ5A 1Q20A 3KPYA 2H65A 3W6PA 5I5EA 2ZZNA 2JHCA 4K88A 5LBIA 4E6EA 4EA6A 1Q22A 1YBMA 3H2BA 3ZHOA 2D0IA 4BECA 2EC5A 3MJTA 3N3BC 3RANA 3TG2A 1ZAYA 2B9VA 4KE6A 5KEIA 1GGVA 3GQVA 3PUJA 3VTFA 4IIEA 1LFDB 4HHEA 4KVAA 1N6IA 3PHHA 1DX9A 4MYCA 4U9HS 3SC4A 2ETXA 1P45A 3VYSB 4RTLA 1OTYA 2X0IA 1KHHA 5EZQA 4R5MA 1FP4B 1XG5A 2NZ2A 1QO0A 4U7GA 3NIBA 4DV1B 3EX7C 1NFRA 1QLWA 2NN3C 2QBYB 1JZTA 3W0LB 3GUHA 1UZAA 1J25A 2C94A 2SCUA 2A33A 1VJ1A 2UZ0A 2YHIB 1UC8A 3NBQA 4WESA 3AT1A 3SK0A 3VR5D 3A9SA 1PT7A 2JFNA 1K66A 1QH8B 2I2CA 1ST3A 3DBRB 3HCRA 4NBRA 2WK1A 1QSGA 1VRWA 3FFAA 4LZLA 3QF7A 4JLNA 2GK4A 1M33A 4O29A 4PSVA 1GCGA 3DE7X 3NR2A 3BKXA 4PHGA 4UBOA 5CDHA 4C7OA 3IMEA 1UP7A 4G0XA 4DKXA 3ECAA 4Z2YA 2QZ9A 5IC5A 5BSHA 1X7ZB 4DM7A 5J4LA 1QUFA 1WDWB 5DBOA 2HV9A 2A1IA 1FZTA 1V1MA 4KJZA 2XX3A 3ILXA 2AMFA 2XNSA 1USVA 1ENPA 1L7BA 2PXHA 3QMMA 2JLAA 5EMLA 1E0AA 3UXEA 1VI5A 2WAXA 5LN1A 1LI5A 1XRLA 2F8MA 4OUKX 2Z2IA 1T8TA 3JZFA 4N54A 1JIXA 3DB2A 4YMTA 3H9JA 4Q7KA 5EKTA 5REQB 3ROEA 1M74A 3TRJA 3UJ7A 2G36A 3C14C 3A1FA 4IXNA 4YALA 4FFWA 1E6MA 3OF2A 4P4TA 4BCBA 1MTZA 2C42A 4ZZ3A 1JZSA 5HWSA 1E6KA 1B8OA 1WW3A 3BSWA 5KKAA 2WC1A 1V3QE 1SVNA 3OF5A 4M1TA 4Z8XA 3GEMA 3HS3A 4DMCA 1TW2A 2IGBA 2B69A 2FWJA 2RARA 1W88A 3P2EA 1VL6A 2PIDA 4I4TA 4UD2A 4QDTA 5GWXA 1BDHA 2JGLA 3WK5A 2ZE6A 3CGWA 3DQZA 3IIIA 4DQLA 3R7WA 2E49A 1QGUB 2O0MA 1UFOA 3OZSA 1P2DA 4M89A 2AF4C 4GI7A 5LOVF 1Z7YA 2IHKA 5DF1A 1WXFA 3C87A 3ER6A 5IK2D 5KOJB 3KRTA 3I1IA 1PX0A 3NIFB 1BN7A 1YR1A 5JH7A 4FB4A 3AF0A 2O59A 1JALA 1UAYA 4HD8A 3U1TA 1G16A 1VXOA 4OIFA 1RJEA 1GRRA 1SIBE 3ND6A 4G3XA 2GM3A 3WJ1A 4ADSG 2FN4A 3U44B 3UV3A 2RE8A 3BMOB 1PDVA 2PJUA 2GA8A 4NE2A 4F8EA 3LYLA 1LLCA 1CUSA 1HK7A 4G25A 1YRWA 3I1JA 4I8DA 1JLMA 2SICE 3HCNA 4OI1A 3IFSA 1RZVA 5IJ9A 5KNBH 3QX7A 2B20A 4EDHA 1ECBA 2EF0A 4QOJA 3HJTA 3CNEA 5CW2A 1TAQA 2Z1DA 3EGIA 4TL6A 1W4BA 2IP1A 3NBXX 3PD7A 4FOTA 4LHXA 4XCVA 5FUYA 4UXHA 4AF6A 3F8WA 4BX8A 3H2GA 5A7FA 3AVVA 1NR5A 1V71A 2CB0A 2NSLA 3LO8A 4RD2A 2HA7A 1NYQA 4IOMA 4REOA 5B58C 4ER0A 1YBHA 3BRQA 4UNQA 3KYIB 2QENA 3G79A 3PT9A 5DBFA 4ZTUB 4O2RA 4KUHA 4YRMA 3G8BA 5FOTA 3QXSA 5AUNB 1YJ8A 4DYHA 3OKAA 2DFKB 4J7AA 2QT1A 5JI2E 1WP4A 4OOFA 2KM1A 4ME6A 4D9BA 4GOND 4N5LA 3X0DA 1NN1A 3HDQA 5EJGA 3N0RA 4RVFA 3UJ9A 4H6PA 4IH1A 4DEYA 1O4WA 3Q9NA 4R69A 3WK9A 1UXKA 1SA0B 1D2AA 1UT8A 4AKGA 1OWNA 4GM0A 2P65A 1E6CA 5KWEA 4PR0A 2W6IA 4CCYA 5LPNA 1ABBA 2JAHA 3PFCA 2VDWA 4DEXA 1A8QA 3DXZA 4XPIA 3RR2A 4BMPB 1AT1A 3HKCA 1ONNA 1OLXB 4DR2B 1JXOA 2GN2A 4P3KA 3E22A 1HMYA 3EFOA 4MXDA 3GOHA 4EQZA 4IRXA 4QHSA 1JTFA 3L8MA 5IXJA 2H4JA 1TUEA 3WNCA 3DAFA 3L01A 3QJ5A 5L3SB 2FSPA 3R7LA 3GDGA 3TMKA 1QP4A 3SBOA 3RG2A 2YYSA 3MWFA 1DAGA 2AC7A 3IULA 1SUSA 4C0AC 2FPIA 4KQJA 4B6JA 1JDNA 3QXGA 4MQBA 4EF6A 3GGPA 5A3QA 3GGJA 4XH9B 4YUAA 1CR4A 4IJWA 1Y98A 3SMVA 4S1PA 3D2AA 2O8CB 1JYFA 1FS6A 1SG6A 4L8YA 1QVVA 1T1EA 1JDTA 4CMHA 4OHYA 1UXJA 1NNSA 3KKMA 3G5LA 3V4ZA 3OE7A 1T0HB 2AR0A 4XD2A 3HE3A 4XGRA 1F60A 1XQWA 2C2BA 2DPMA 2HREA 2AF3C 4GYKA 4JOSA 3FSJX 2A0FA 2QN1A 3F6BX 2FSFA 4R4JA 2COEA 3IMFA 1H2XA 1DO0A 1MU0A 1JW9B 1USWA 2JD2A 2JIPA 5FO0A 4JJEA 5AVXA 4W5OA 2IS6A 1RYYA 3O73A 1NJFA 4LVUA 4MUYA 4OKIA 3IAHA 5BSWA 3AG6A 4WY8A 2ATCA 3K2EA 2EX0A 3IJ5A 4YTEA 3RI3A 3TXAA 1V3UA 1NT2A 3IOCA 2BKEA 4X1KA 3AOGA 3U31A 4EKYA 2E55A 2ZTUA 3DFFA 2Z8YA 3H8WA 4N39A 2BEJA 1C9YA 3TTVA 1GZHB 2FR1A 2WT9A 4PPQA 5GJVC 1Q16A 3C6MA 1V5FA 1APBA 2OE2A 2ZBDA 4NFHA 4QJ5A 1ZBDA 3ZU3A 2X1HA 5LXTF 4WNAA 4AT1A 1Y81A 3PT5A 1MX9A 4NYMR 1ODIA 5GV8A 4GM1A 1GDTA 1EBBA 4AULA 1KJWA 1S2OA 3M3HA 1QCZA 4HATA 4D6PA 5I01A 1HDRA 4MRNA 2D5BA 3WQQA 3MJEA 3AXSA 4U2KA 3WGIA 4LF9B 2XQVA 2O8CA 3ADDA 3PC6A 4BVAA 2D1TA 2ONCA 3L6CA 2P6OA 3LHDA 4CF3A 2E6UX 5LWQA 5LQSA 5CITA 4CLOA 4ZT7A 3E7PA 1S3IA 2QX7A 2XRYA 3DEZA 1K5GA 4I66A 1JKFA 4POOA 1GSOA 2J4DA 2GPWA 3V1MA 1UMBA 1KI1A 1T9HA 1K9VF 4E1VA 3O3OB 1D2MA 2E82A 3VH4A 1PZHA 3ZIAA 3RTBA 5I4IA 3VSEA 3WIVA 3OT1B 1QGUA 1Y7TA 2W6ID 1BEUB 3GN1A 3KFVA 1A5ZA 3OU2A 1DXHA 5T5QA 3DJYA 2Y77A 3EFOB 4BLOA 1ZIOA 4IRUB 2ZVJA 1E1CA 4B6PA 4RZIA 5E6RB 3FNHA 5DW3A 1M75A 3GWGA 3PIIA 2ZRHA 3P26A 3Q0IA 5D1HA 3S2SA 1H66A 1AHIA 4DR3B 4R8KA 3O92A 1C0LA 5JY6A 2J9YB 2WHXA 2JD1A 1W19A 4KKVA 3KDPA 2JKYA 1Z7BA 3AHEA 2J1LA 3OCJA 3O1IC 2W4IA 3IP6A 3WYCA 1E4YA 1L0BA 2CXPA 3PJGA 2CLDX 5DTIA 1IBCA 2ZSFA 4OB8A 1P6UA 4MHSA 2IBSA 2VDUE 1R6BX 3NQ41 2QVZX 2JH3A 3VC3A 4RLQA 3OD1A 2OLJA 4Q7MB 1UQRA 2DHQA 4PQGA 1RIFA 1U3TA 4IJKA 2PS1A 4DIOA 4RVGA 4MJXA 1FQKA 1ZJ4A 5FJJA 2VXBA 2XKAA 1XMOB 3GL9A 1NLMA 2JFWA 4QUDA 4R05A 2HF8A 3GVXA 2BTQB 2CLMB 3B38A 3DZFA 4X94A 4BE4A 1VKRA 2FW0A 1GN8A 3MMZA 2VQ6A 4G0UA 3HKDA 2GZAA 2R11A 5EIHA 5CYPA 3LY7A 4AP5A 2F1OA 2TS1A 3CNOA 4LDPA 4XLZA 4B79A 4ZDJA 4HNUA 3RYCB 1L5LA 1BSVA 2YIVX 3GNSA 3MJRA 1QMGA 3COJA 3A6JA 1T36A 2VVTA 3U3ZA 5KNLA 2ODBA 4JU9A 4WASA 1WP9A 4L76A 4F5YA 4GE3A 2QR5A 1YZNA 4Y7DA 5THQA 1GSIA 2DUUA 5C8YB 3ICEA 4EMUA 3O1JC 4NBVA 3C3DA 3OFJA 4JGIA 1BCRB 2FKAA 4KTTE 3QQ5A 3CR8A 2W83A 1M2JA 2RGWA 3HB7A 2R4UA 5K7SA 1L4MA 3AGQA 3O3MB 2A30A 3AH8A 1HT1E 4AN1A 2IH4A 3QOYA 3U2QA 2Q2VA 3A3OA 1YUBA 3GUZA 2QZZA 3BM5A 2GI4A 4W6ZA 4BB9A 4JGGA 1QHSA 2O8DA 1DBVO 1SKUA 4DQXA 1B8PA 2AD5A 2VAXA 4J0FA 5ANRB 1FYWA 3ZHXA 4C6TB 3Q41A 4AZTA 1BJKA 1M6EX 3GFSA 3S3TA 5KTRA 4B3MB 3PJRA 2J9FA 4Z4CA 3RS3A 5LYJB 5INTA 1O54A 1U3DA 5FFNA 3OU6A 2D2XA 1E3DA 4FFBA 1FSFA 1K92A 3MUNA 4CTJA 4C4SA 1RWMA 1B15A 4K9MA 1LY1A 3GUYA 5K1ZA 5JAPA 3O8OB 5AXBA 1JHAA 1V1JA 5KSYA 1LDYA 4NNJA 2M1XA 4S1VA 1I01A 4Y67A 3PPVA 1K6MA 1BXGA 1MV5A 3EVBA 3LG2A 4IIDA 3I2HA 4RA6A 3HLYA 4XQCA 5T4EA 4EW2A 1T36B 3BH6A 4ZVRA 3T7TA 1TQ2A 2XD9A 3QTLA 1YZTA 4WBXC 4AJ2A 4AO6A 4D9EA 4C0SA 5PNTA 4UTPA 4ZAWA 1XPUA 3BDVA 1QFJA 4OQFA 6REQA 1P39A 3BSFA 4GR9A 4K86A 5FPHA 2YWFA 4A9AA 2ID4A 5K0LA 3IDOA 4TXHA 2ECOA 4EFDA 3ZDYB 2GB4A 2Q0XA 4OXKA 4ZICA 3HR4A 5DM70 4U9IS 3PDHA 1T3ZA 3LKBA 2D1RA 4MGYR 4A8PA 3G8CA 4IEEA 4A8JB 4AS2A 1IRIA 4BBZA 5SZKB 4CHTA 4B83A 4I9UA 1Y5NA 4RGBA 4FJ1A 4G84A 4MV7A 4PPFA 5TT1A 1ZONA 4E4RA 3PG5A 3V48A 1J7KA 1UKBA 3DAPA 1QHFA 4HGNA 1EGMB 2AHRA 4Y18A 3QEOA 1G4UR 2FLVA 1GFIA 4KI7A 1ES9A 4CR7A 2WHEA 2EG5A 4MV6A 1QF9A 1Y3BE 4MCJA 4NYJR 3A25A 1LK0A 4OAOA 4OL9A 4B1FA 4XR9A 2OO5A 3UOWA 4OB6A 4D3ZA 2BYTA 4PCLA 5F35A 4EYGA 4G67A 4YMIA 1ODFA 3Q3EA 5TJHA 4ZO4A 2XH8A 1TYDE 4QEDA 3KJXA 5DYIA 4MP3A 4CMIA 4CKWA 3ACDA 1FNDA 3MYRA 4HAVA 2O2YA 3EQZA 4OAQA 3BZWA 3WI7A 5B7GA 2FN8A 1EWYA 2NV6A 2BSXA 2XHEA 5I9MA 1ODKA 2ORED 3D8BA 5E6RA 2ZT5A 1RU3A 3ZU6A 1M2EA 4DTIA 4C87A 3VAZA 2XAAA 5DIFA 4PR3A 4G5HA 4M9XA 1E4EB 1TVEA 6REQB 4B4VA 1H93A 4DCMA 1O03A 1SG9A 3Q85A 2OBLA 3G9TA 4TL8A 4YV7A 3A6LA 4UUOA 3GLIE 3USES 2RHHA 2Y0CA 2A58A 2H18A 5BQ3A 5KX5A 3IUSA 4N8DA 3LKVA 4U7JA 5JQGA 4F11A 3CVWA 4OFWA 1NSFA 2WV9A 5AVYA 3DONA 4K40A 2Q29A 3EXG1 5HSGA 1OX4B 4ENVA 3DZJA 1CTQA 3QZUA 2JDIA 2I6QA 4LJ5A 1X1SA 4DIBA 2CFRA 5FEUA 4R8VA 3ETGA 4KRFA 3FMVA 1SOWA 3L18A 1WF3A 1G17A 1H4TA 3NGXA 3OUUA 1US8B 4FMBB 5DVZA 3ROZA 4YR7A 1QWSA 2ID7A 4R41A 1EX6A 4EYOA 4ZTBA 3CRMA 4R2LA 2PUVA 1IAQA 2RI1A 1ZOIA 3RVKA 4Q4AA 3O8OA 4Z9FA 3F1LA 4RSHA 2C7OA 1U9IC 3L40A 3O03A 2NO0A 3VRHA 2O8NA 3D6FA 4NP6A 1WZCA 3U4HA 2FI1A 1P5JA 2E87A 3DA8A 3E18A 3WYBA 4A5SA 3OT5A 2DPHA 3CX7A 2Q4OA 3O4GA 3P5BA 4JUDX 4P4LA 2GTPA 3DYVA 5JBQA 3JATA 1W85B 1UXGA 2PLAA 3B6JA 4KI0A 4MINA 4RHYA 3S1AA 2VUHB 1D1PA 2QN2A 2YIJA 3HY3A 2HSJA 2WVAA 3DBIA 1ENOA 4P5PA 2R6R1 1Z3IX 5D85A 3QLJA 3FF1A 3UBTA 5LCXA 4OXQA 3FI0A 5BV8A 4WQMA 1CJVC 4JLPA 2QM8A 3NDJA 3UMCA 2W7TA 3KT6A 4JENA 3MTBA 3AUTA 2IZ5A 1HTTA 1AZSC 1J2JA 1N2HA 1PR4A 1ZZGA 1ZMBA 2MT9A 2EZ8A 3DE1X 3G5MA 3Q6MA 2MOKA 5EWMA 2JZNA 5F9MA 2I7CA 2QJFA 4Z0HO 2A86A 2EP5A 3M4JA 4BZXA 2ZJ6A 4Y1RA 4W82A 4FHEA 1GLVA 3RSHA 1N2IA 2QS9A 3GOQA 2IODA 2YZ2A 5CCEA 3AI2A 3WIUA 3EY4A 1Y9EA 1X1EA 5ALFA 4C22A 1G5IA 2QL9A 4WVFA 1NFFA 3LBHA 2B0JA 3I0NA 3CA8A 1EFRD 3R74A 4C2AA 2G70A 3L0PA 4OJTA 2PLRA 1PV1A 4E15A 4Q1VA 1H0RA 1P7ZA 1Q7BA 4TWRA 3A6GA 1JWLA 1D03A 3SC2A 1P73A 1LBIA 2H2IA 1MF7A 4M9SA 1A77A 1YS4A 5LVAA 5I4CA 5JUWA 2VF7A 4LY6A 4G8BA 4BVHA 4YT8A 4ECEA 1XZPA 3L7YA 2FETA 1T1GA 1GPYA 3IKVA 2BFAA 3HJAA 4L27A 4ZGWA 4H60A 3O6VA 5CGQB 5F5LA 3PYXA 1WXQA 4Y7CA 1XZLA 1HKUA 1X38A 2F00A 3DFKA 3OEWA 5DGDA 3S2YA 4DLXA 4OHXA 3HJHA 5FBWB 3EWNA 2HD4A 1ICEA 2XJ9A 1O97D 4NULA 3BJMA 4IJQA 1U3CA 2YWRA 3IAUA 4FFRA 4BAZA 1KY2A 1Z2PX 2C2HA 1QHGA 4C3VA 1ECGA 1O96B 1SUFA 1ULSA 4I4CA 1V9SA 4QULA 4MUBA 5JMTA 5KHOC 3WGQA 1UJ2A 2Z3WA 4CT0A 1S89A 7ADHA 1A71A 4TGLA 1A9XA 3ZX5A 3A3NA 4E5PA 1PJQA 2WQZA 3HYCA 3KT0A 4AJHA 2P1RA 3V4OA 1L5WA 1K86A 4N40A 3RYHB 4H1TA 2ZJ2A 4QO8A 5EP3A 2R97A 1KS2A 4HDNA 5F2KA 1IXSB 1P0IA 2V65A 1YMVA 4E5UA 5LQMA 4JHLA 5JCPA 5IT5A 1HE3A 1GKKA 2AJCA 3RNOA 5FB3A 4B9AA 1U2SA 2C4NA 1QQBA 1SOVA 2DAPA 3GJ6A 2ZUSA 4DDUA 2PMWB 2V5UA 1YZYA 1ZIYA 4M88A 3EBLA 1N0VC 3D6HA 4EQ6A 5KDOA 2YWJA 4HJRA 4WLEA 5J5VA 1AD2A 1UDAA 1YZVA 4R2XA 3HA2A 5AVZA 2HTFA 5JH7B 1LA2A 3H13A 3OJWA 4TSKA 4EGAA 2ZOSA 1Z4KA 2BFNA 5LLDA 4E32A 4PONA 1TF2A 5B7PA 5IUNC 3GGGA 3JRNA 1EGVB 1EXWA 2ZW9A 1AG9A 1F0NA 4OQEA 2HLNA 2MR6A 4DUPA 1SUWA 3ONFA 1CS0A 4JWTA 1P1JA 4GKBA 1SCIA 1CX9B 1S3GA 3L0YA 3A37A 4P4GA 5C8XA 4KFTA 2OMEA 2W8ZA 4Q1AA 3SGLA 1CVLA 2HA3A 5TB5A 3VR4D 1Y82A 3GFOA 3RVOA 1X7XB 4X97A 5M5BA 3SWWA 1T6BY 2HBQA 3T3GA 1M1UA 3IP5A 2ZSKA 3E6AA 3PHBE 3MFQA 3BAFA 1NPYA 1NZFA 2XXJA 1UBHS 4FMCF 1ZI9A 1E9VA 2D3WA 3A6DA 5CLHA 3M6VA 4CUKA 4B7CA 3FVVA 5I3CA 3JAWB 4MPDA 3QHQA 3C3XA 2ZJ5A 4TMYA 5I7VA 5E4JA 1B73A 4CCWA 1PSDA 3OQ6A 1NXQA 1PL6A 5CA0F 3OPYA 4IOJA 3OP1A 4D8TA 1MT0A 5IDYA 4MQ5A 4HTFB 1M34A 2OCKA 4MP8A 4NOJA 4W5QA 1Z63A 4LF4B 3L6RA 1HDXA 3FTNA 4ONEA 4BNDB 1WETA 2HHLA 1I6KA 3O8DA 2WHPA 3V8PA 3DEHA 1UZLA 1UBKS 1N8TA 2QMYA 3FVRA 5AJHA 1VPDA 1VG8A 1H2WA 1FMLA 1MUUA 1NJ1A 1O95D 3JR7A 4JA0A 5J1TB 3AIOA 3T1NA 4MQEB 1CF4A 1PR1A 1XDSA 2ZKLA 2QVYX 3H1AA 3MGCA 5AI5A 5HG0A 5CA0A 4RTPA 3SS7X 2TMYA 2UVPB 7GPBA 1NF8A 2ZSBA 4MUGA 4E08A 2OG2A 4IDQA 2XJ4A 4MUAA 2R9VA 2V98A 1TMYA 2WU1A 4GE0A 3BTSA 1A27A 2VPTA 5IYZB 5M04A 3N05A 1N7JA 3ND9A 2Z43A 1WU7A 3O8BA 4MHTA 3AQIA 5THXA 3ZZTA 1B1AA 4XJSA 2OCDA 3IUPA 3TOXA 2J3IA 5KIAA 2FSGA 3QU7A 2KW5A 1FX1A 3NAGA 4FZVA 1DV1A 2RAFA 2YFYA 3VDQA 2CXTA 4ZT5A 3G2JA 1WKVA 2AS0A 3HSSA 4IEFB 4O4IF 3TD2A 5IAAA 3TMYA 1QX4A 4W5RA 3DMRA 1EWTA 1HMPA 2IPMA 1S2LA 4KE8A 3ZBQA 4MS1A 1HL7A 4W9RA 2ROQA 4GYYA 1G3RA 1LPSA 1ONOA 1SY7A 1JIQA 1YDWA 2Z98A 4Q5IA 2GHTA 3VX3A 3ZE7A 3QM1A 1KTVA 1MJGM 3FPSA 5KO2A 1N2CB 4Z9YA 5CG1A 1IWBB 1GL7A 3VKUA 5L9AA 4WDQA 3UTDA 3EPJA 4ZTZB 3ZWMA 2BDUA 3STXA 3GLGA 4D3YA 5J4VA 1Q0RA 1NXPA 2JGFA 2XUHA 3FNIA 2PFGA 5AK5A 2EWWA 3AJEA 3JQQA 1ABFA 1PV2A 3LUHA 3SIXA 3AJRA 3AVPA 4P0QB 3C8UA 3CH4B 4Y2RA 3I52A 3GZ4A 3VZBA 1F3OA 4AZSA 2OO5C 1TU4A 2JI7A 5D2CA 3NYWA 4ITVA 3QPDA 3KD3A 4IDBA 1GQYA 3AEUA 3PEFA 3QHPA 4U7PB 4ZOEA 1C1XA 4D82A 2L2QA 4PAGA 3LYUA 1S3FA 4WHMA 2CVPA 4ZREA 5JCJA 1HSZA 3R1IA 5JWHA 3D81A 2QXUA 3EPHA 3U17A 3RSGA 4TMXA 5CH8A 1CJKC 3MLAA 2GXSA 5DX8A 4KSYA 2H48A 2FN7A 1OAOC 2HF2A 3A9WA 4TXMA 1M6YA 4UMFA 2P3QA 4XIFA 5C3UA 1OC2A 1XQXA 1BMFD 4O8ZA 3VBCA 1NQVA 1ZH4A 1E2FA 2GO1A 4BO0A 3W5IA 4S1NA 1JB9A 4NHOA 2G40A 3SYMA 2Q5OA 4V38A 2JGEA 2ZYIA 2QAGA 1UWLA 5FNVF 5CIYA 1EUCA 3GG9A 3LZ6A 4XB2A 2VKQA 2CFCA 5EJ5A 1Z88A 2BFCB 4WNYA 4ZO9A 1V0JA 3WFZA 1VPVA 2I71A 3FHOA 1RHRA 4TVKA 2MYPA 2W2KB 3KAJA 3AIIA 2FH5B 3MOIA 4MW2A 4QFBA 3ELWA 4KQ9A 4RFVA 5AVRA 5JADA 2NAPA 3MCAA 1K75A 2ZRNA 1LDGA 5CUQA 2OYCA 1SBZA 3F6SA 4QODA 5LZ7A 3WJAA 4JV5B 2EP8A 1X94A 2YY7A 1E5DA 1YRAA 2PBFA 5DHAA 1RI4A 3LECA 3FOCA 5IAJA 3UPDA 4H3SA 4OQQA 4DLAA 2VPZA 3BMXA 4G9GA 4EELA 2I2AA 1LSOA 4J07A 2A4MA 3S68A 4JKYA 1WEKA 6AT1A 2IZZA 2AYXA 1K4YA 3F2IA 2GBLC 2IRWA 2Q28A 2QW0X 3HBAA 3ICOA 3KEFA 2WJWA 4BNYA 2EYUA 4URFA 3RSLA 1FFAA 4K1XA 1NM5C 5AHOA 4ARIA 4N48A 3FPJA 2VP2A 3W05A 1M2FA 2YQZA 4QYTA 4Y6SA 4WACA 2SCUB 3QFSA 4PSUA 1AMNA 2RHTA 5BOVA 2VQEB 1YDGA 3KCQA 1SCNE 1NKVA 3ZUPA 1UM9A 1WABA 4AJOA 1CPYA 3LHKA 2X2EA 3B9RA 3E35A 2X5OA 3K9WA 4EYSA 4QXPA 1C50A 5AHWA 3V4PB 4ZV9A 3GLGE 4MI3A 3VNSA 4EG7A 3WHIA 3ZDZB 2WDPA 5IAOA 1XTPA 4CZ2A 3VPBA 1BOOA 1WDKA 2NNWB 3OJXA 1DX6A 3FR8A 1KFJB 3EARA 4PC1A 1A50B 2FZLA 2VNHA 5IXSA 2R86A 4EFMA 4FNGA 4UE3S 1M2GA 1T9GS 4C9BA 3QXCA 1OASA 1XJQA 3NUZA 4CLDA 5CCXA 1KETA 3OFSA 1YONA 2IKQA 2G72A 4UAJA 3SXJA 2XLBA 5E9AA 3KVNA 4BMNA 1U4NA 5G41A 2E1PA 3P0EA 4CF7A 1J33A 1JR3A 2GF0A 1OFUX 2FWIA 3IEIA 3BIOA 3VVCA 4DXDA 2NU6A 4F5EA 3U5ZB 1MRZA 3OCZA 2BZ0A 3Q9LA 3K4QA 4NMMA 5K0SA 2X7JA 4U6NA 3AESA 1G20A 3GDWA 2QZSA 4HLNA 2I66A 1U0GA 2X77A 4JLWA 4P0PB 5KYUA 3CWZA 5IP5A 3K5WA 4DV7B 2RH5A 4N6NA 3AVXA 4L22A 4NYIQ 3QITA 4B3DA 3T3OA 1E60A 1A9PA 4PG5A 5JFGA 1GG8A 4KIGA 4NCJA 3DZGA 2QP9X 2PU7A 4KBFA 4P36A 3DEKA 2D0PB 2EDAA 2AC2A 1MIHA 3OZCA 1WSBA 2JEZA 3AUYA 1I6WA 3ST7A 4FYXA 1NVGA 1H6DA 4LOHA 1IVYA 5C81A 2ZM5A 1N6RA 2PX3A 1XKQA 2W6OA 3C3JA 4MUKA 4BWVA 1OZFA 3KUDA 4TV9A 4UTXA 1NE2A 4P08A 2GFHA 3EVDA 2J6BA 3RUFA 2Y71A 1VIMA 3KEQA 3G0HA 2WNHA 2XWPA 3KQQA 3SHFA 3TS1A 3KQMA 2C9CA 3UOGA 3NORA 1CK4A 2ZITA 4ZHQB 1JU9A 3IQXA 3ZV3A 3F3MA 4M9UA 2IYAA 3BH7A 4IG9A 4V0OA 4F91B 5CU7A 3CPJB 5CG2A 2MSLA 1CBUA 1OWOA 1ESEA 3HRIA 3TI7A 4B5KA 5L3SA 5C34B 1KE1A 2PQ6A 4QPZA 3WV4A 3KOXA 3LW7A 1JFSA 1AMOA 3SFZA 5JR3A 2WJYA 1OBOA 2FRDA 4OQPA 5JSYA 4BKQA 4N7JA 1G20B 1TL7C 2YFQA 4B2YA 1H3NA 3IQGX 2O2EA 3LCRA 2ZREA 5CH5A 3KPWA 3VISA 3KZKA 4IQFA 3FE2A 4BO4A 4PLPA 1W0JA 2DY1A 3IQFA 1ISMA 4I5GA 2V6FA 4C30A 4ALLA 1Q7GA 3CUSA 1AN0A 5K3BA 4MWDA 1C7RA 4YCAA 3BIWA 2OOKA 4KX3A 4NV3A 1ZA1A 4OXNA 4U00A 2WTMA 1RWBA 4LFBB 3OLVA 4X91A 1WX1A 4Q3CA 1Z5WA 2R8YA 4PCUA 3CKLA 2VATA 4AIRA 1OLXA 4GSLA 4CIDA 3NHRA 3JR3A 3GH3A 1XMPA 1LNSA 1BE6A 2Q9UA 3EISA 5I8PA 1YU9A 2IH2A 4INOA 5LIRA 2IXEA 2YBEA 3CQ9A 3MCZA 3NYQA 4IJ5A 1NF2A 2K4MA 4Z7NB 3ZHUA 5JS7A 3DE3X 4OLAA 1PGNA 2V97A 1B2LA 3AWIA 2BMFA 3JX9A 1LQUA 3IR5A 2IC5A 4JXKA 1Q7TA 1P7YA 5F64A 2EP7A 4RK7A 1F0PA 3ICWA 1N92A 1N2SA 2QN9A 2ZXEA 3E9DA 5AW8A 1JLKA 2VPIA 4WKPA 1R5NA 1KH2A 1L5RA 3Q3GE 1M7GA 2XXBA 3O4IA 2VDVE 3TPFA 4ETMA 2LCFA 2VTDA 5KOIA 3EQ9A 4HR7A 1YIOA 3NIWA 4ILEA 3C3WA 3VPSA 4CR8A 1F12A 2HB6A 3EEBA 4MIKA 4CG0A 5KBYA 1IATA 1P33A 4JJ8A 3P20A 3DCNA 4DEVA 3MG9A 4AJIA 3ET5A 4I55F 1NU8A 1BGXT 2FNAA 2WU4A 1KI6A 2VTEA 3AHDA 4HH1A 2XYVA 2ZZMA 3X43A 4BNJA 3EVZA 2D2EA 1WA5A 4UFOA 2WJJA 3PTZA 3UHPA 3IRUA 2WKQA 2ZRFA 3VOBA 3R5JA 2HQ1A 1R37A 3FTDA 4WADA 2BMDA 2P11A 1NGSA 1IC6A 2ZSAA 3PA8A 2R4TA 2N47A 3B2EA 3H7IA 4R2IA 4BAGA 1IIRA 2NM0A 5JAMA 3E3LA 3UAYA 3OETA 4HJXA 4MUEA 1M8JA 3DLPX 1ZKMA 3CRVA 2RC6A 2C7VA 2DPXA 2B92A 3CF4G 3OA0A 4KAFA 4P2BA 4YRNA 3V8QA 3D0KA 1E3IA 4JB8A 3GT3A 2YJGA 5F52A 3J81k 1U7ZA 1QB7A 4BE7B 4ITUA 1X7WA 1G7CA 2WKRA 3BJZA 4HRVA 2UZ4A 3D4NA 1K5HA 5FP0A 2J0EA 3WMGA 1QJ4A 3FH0A 4RTSA 3DXXA 3P9YA 4F38A 1P17A 2ZQZA 1U28C 1U31A 1MJHA 1KAGA 1TQ6A 2QWXA 4RJKA 2X58A 5KAPA 1JR6A 2Q6OA 4E14A 2FHSA 5DGTA 3EZ2A 3TLYA 4R16A 1KRWA 4G2NA 3KUKA 2L82A 2QUJA 3AX6A 1FQJA 3LVBA 4TRNA 3TBFA 2GJSA 1JKMA 4CF4A 4MGZR 2FUG6 5GV7A 2H08A 4CGYA 5ADHA 3QVLA 1GDDA 5ALMA 4C4PA 5FLYA 1VLMA 2LV8A 3R40A 4MRVA 5GM2A 3VNAA 5FOXA 3CZPA 2A1TS 5AJXA 3THRA 2OGSA 3CE9A 1WG8A 4BB5A 5CLJA 2BSAA 3DMGA 5IM4F 4TT3D 2DH5A 1RYNA 4FEEA 2IPLA 4N7RA 4NATA 3SZ3A 1SUEA 3VGJA 1MG5A 1X1RA 3P45A 4C6HA 3V1YA 1VHTA 1JMKC 1KERA 3T61A 2ADMA 2FQ1A 4XVUA 1ZRMA 2H4HA 3T3MB 1Z0DA 5DLDA 1YUMA 5C8YA 3CO0S 1R8XA 2ODQA 1A1VA 1ML3A 3MB5A 1U2EA 4NE7A 1EP9A 3Q2KA 4LFAB 13PKA 3ILYA 2K87A 1MC5A 3R23A 1QF6A 2GPSA 3UB3A 1UFKA 2HWYA 5HUQA 3ZLJA 4S2UA 5KQSA 5U9CA 4N5DA 4YRJA 1I13A 5K8LA 3QVJA 4MVYA 1JA9A 1E5QA 1MJFA 4TUYA 2GZRA 3GLFA 4TLEA 4AY5A 3QU5A 5H3HA 2GRUA 3ASUA 5CM2Z 2IYRA 3GBSA 4EUHA 1P9WA 4RELA 1H0SA 4OGFA 1W5TA 4HX5A 3JQFA 4LECA 3VYTB 1TZBA 1WQ4A 3EGXB 2Y1EA 3FWYA 1HWYA 4LY9A 5FLXA 3UYKA 1Y3AA 1BO6A 2RGUA 2JPDA 2P7HA 5DYNA 4UEJA 5EKUA 4C5CA 2RIPA 4DLUA 4J75A 4OG2A 5ERYA 3WYEA 4D9KA 4C2UA 3PQ4A 1P4GA 1ZUIA 4AZ0A 5ILGA 2OP1A 2VH2A 1Z68A 2DWUA 5AESA 2MINA 1VE5A 5KYWB 2R1UA 1IBSA 3WIOA 1KRHA 1B3BA 4V03A 3QY0A 2QR3A 5ICCA 3ZKAA 3HPQA 1X1BA 5KTSA 2G6BA 4MKZA 1QCDA 4J1TA 3T9FA 2Q1UA 1OHHD 1YB1A 4F4DA 3RC3A 5ALXA 4YAKA 1KK0A 1T4CB 2VP6A 2ECQA 2OBMA 2G63A 2XTJA 3IUMA 4QEKA 3ZGVA 5LNK1 1T43A 3ZJYA 4GWKA 1P4HA 4KIJA 4XXHA 4KLNA 1CF2O 1FVHA 1A2QA 1LJUA 5CM9C 3UK1A 4XM0A 4JI4B 1J70A 2IEYA 1T26A 2NZ8A 2JS7A 3UQZA 2JAWA 4D96A 3MIIA 1TF7A 3N5KA 5FPSA 4A0QA 4OUDA 3O26A 3HR7A 1DO8A 2O8FA 3AUSA 3I8OA 1O6BA 1Y1QA 4LZOA 1ZM3A 4GPAA 1NXVA 3LT1A 3VTKA 2IZOA 2UZ1A 4CYMA 1J97A 1U3VA 2AFIB 2RBKA 2O8VA 4LRXA 5HQ3A 4CEHB 1Z2NX 4ZU6X 3DAGA 3TN7A 3KJGA 4WIAA 2FTKE 1NUUA 3JVDA 5AVTA 3N0TA 5JNUA 2VNSA 4AX4A 3D6TB 1FU8A 3ZJ4A 4B4UA 3ML1A 4PLFA 2BE7A 4AK9A 3NEJA 5KYWA 1ML4A 4ZVUA 1X6VA 1SC4A 1LLUA 1L5HB 3Q6IA 3OTWA 3R3SA 3DZDA 5KYYA 2J6HA 1QFSA 1QR6A 2QP4A 3G02A 4QRHA 5B4VA 3BCHA 3COVA 3OCUA 3RFFA 3WLLA 1Z8NA 1HNWB 2I78A 3OZUA 5K6AC 2F62A 4ZVMA 3BXHA 3JQ8A 3LHIA 3KU1A 4RCYA 3N8NA 4R7ZA 4EATA 1D8TA 1M6HA 3D31A 5FIUA 1EH5A 3QYJA 2FZCA 1FNNA 2OLKA 4XSGA 1V6SA 1VGQA 4HDAA 1YR9A 2CD7A 3F6PA 1CCWA 3K0KA 4YCDA 1KDPA 1QFMA 4EJ6A 3PWZA 5CDGA 1QKKA 2L42A 4LF7B 1TKAA 2IYSA 4R71A 4DQ0A 4BKMA 1CY4A 1EP1B 1JSLA 3I28A 1ENZA 3K1AB 3KSDO 2NIPA 1TGYA 3BIXA 3LT4A 3PC4A 3CVOA 3QI7A 3QK7A 4RL4A 5CK4A 3WTBA 2PFSA 1PWYE 4GX1A 3COWA 4ZI7B 2XMPA 4FYMA 2D7JA 1DHTA 1A3CA 2QAGC 3ABRB 1JAHA 5JFTA 2PMEA 1GZ5A 3GFQA 1MFZA 3HEAA 2AUTA 3LRPA 1XX6A 3M0EA 3U62A 2YJTD 5JO9A 4DQKA 2Z2KA 4O02B 2ASVA 4C0JA 1M2OA 1UF9A 1JPJA 1MVNA 1L1FA 1QRUA 2GFQA 2WD7A 1J1UA 2ECKA 3GLGB 1HXHA 2PGAA 5T41A 4QTZA 1SRQA 2WFAA 3S81A 3PRYA 5IT9A 1UC9A 3WGTA 1FXWF 4TV9F 1AKVA 1DMSA 3EQ2A 1UJNA 5JSHA 3CG0A 5EXXA 2Z6AA 3PWKA 1IQPA 1NTRA 3ER8A 4V0QA 4DV3B 1HE4A 3CKKA 2V03A 1D8AA 2Q6IA 1G3MA 5H1YA 3RM3A 4BNGA 1U2GA 4DCNA 5K0CA 5K2OA 4KRGA 2CLFB 2HPVA 2ORYA 3ANYB 1U0NA 3LUCA 2VFAA 2W6JA 3U80A 4X1OA 2ZUWA 2IT1A 4QNMA 2NU8A 1IMOA 2XWQA 3VQTA 2GN4A 2Q5LA 4PRLA 1BQ4A 4Y1RB 3ZWCA 1KKUA 1T8YA 1N9GB 1UK6A 5FPQA 3ZLBA 5T8KC 3PVSA 4G5FA 4EM6A 1YOBA 4Q66C 4KMSA 3C3CA 3HB9A 1NQAO 4QGGA 221PA 3D6UA 3VR4A 1HFWA 4I1YA 1XXLA 2FSVA 3GJ7A 4Z49A 5ECYA 3C5HA 5JW6A 5JWRA 3EOBI 4EGQA 4P83A 1REQA 4XVCA 4G0QA 2YZGA 1TK9A 2QTZA 2M6RA 3DMYA 3DT8A 1L5HA 2W70A 1LGYA 3ZU5A 3S1AB 1R0XA 3DDUA 4ZYTA 1QP0A 2QRGA 4LX0A 2RB4A 1E9AA 2GRAA 1GV0A 3KJEA 1ZM9A 3QUAA 3IP7A 1G8JA 2PWZA 2PG3A 1F8YA 4MVJI 5DEIA 3TZKA 1O5IA 1PJ3A 4G81A 4F2HA 1JJAA 1U5CA 1XCBA 3F74A 2WVJA 3TTTA 1BXKA 1G4HA 2YYZA 1D0SA 2WF9A 3TRIA 3QBEA 2OCGA 1DC5A 5C31A 1L8OA 3CH5A 1EUDB 4RFSA 4NMLA 5CJJA 1GSHA 3IQIX 5EIAA 4OQNA 3IERA 2XT6A 4LK3A 5CFQA 3UJBA 1BIFA 1Y3DE 3Q72A 3G0IA 2D6FA 1V6AA 1H3FA 3QXXA 3R7DA 4QUGA 1VDZA 2F3TA 3PPXA 4MX8A 2QV7A 4JOQA 2CXHA 1CEXA 1L1QA 2ON6A 2WM9B 3D7KA 3M83A 1OZ0A 1KO8A 1T4GA 4FTWA 4M1SA 1RWQA 1NR7A 3ILSA 1UXIA 4IQGA 1ZQ1A 3FPFA 4G1CA 2ADOA 4D2IA 4HDNB 5L95A 2ZBVA 2VT6A 3I6YA 3DR5A 1BKDR 1W2GA 3OFVA 1C4XA 5DFAA 4BP1A 4C0QC 3LP5A 3CS3A 2AR9A 1BU5A 4DSZA 1DBQA