2QD3A

Wild type human ferrochelatase crystallized with ammonium sulfate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 143
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A01
3LYHA 2H1VA 2QD5A 3W1WA 3GOQA 2HREA 2Q3JA 3HCRA 4KLAA 3AQIA 2QD2A 2XWQA 2QD4A 4KLRA 2DJ5A 2Q2NA 1HRKA 2XVXA 1AK1A 4KMMA 2AC2A 2Q2OA 2XWSA 1LD3A 2C8JA 1TJNA 1LBQA 2AC4A 2H1WA 1N0IA 4MK4A 1DOZA 2HK6A 3HCOA 3HCPA 3M4ZA 2XWPA 2HRCA 1C9EA 1QGOA 2XVYA 4CCSA 2QD3A 2PNJA 4KLCA 2QD1A 2PO7A 3HCNA 2XVZA 2PO5A 2JH3A 1L8XA 4F4DA 1C1HA
chains in the Genus database with same CATH superfamily
5H68A 1IPFA 5EZYF 5HQJA 2XCQA 5J4VA 1WMBA 2FAXA 1TMYA 4ZARA 1QONA 1YS7A 2D8MA 4CXMA 4MYUA 2HU2A 2JF0A 1C7ZA 3A9UA 1OR8A 2OAP1 3CR8A 2XJ9A 2O48X 2CXNA 3ZYZA 3MK31 3LCUA 4LBWA 4EQZA 2QIPA 1JUDA 3LQYA 3NBFA 1QDLB 1KVUA 3EIQA 3G8CA 3LA8A 4BNHA 3KLNA 4IQGA 1T8UA 1G21B 4NHEA 2VHQA 3ENNA 1MB0A 1GADO 1GUFA 4KUEA 3DVRX 5D6NA 2JFWA 4JL6A 3BFKA 1HQKA 2C96A 2EQ5A 3C3AA 3E9EA 4D92A 4KITB 5IKPA 1DKUA 4HLQB 4C2UA 1TCVA 4Q7KA 3MTAA 1GEEA 3L07A 5AI5A 4GL2A 1SCAA 3NEAA 1E2DA 2G9RA 5FBQB 5FR2A 2VZ0A 5JFOA 3DLHA 4NJEA 4BUCA 4CMCA 1IK6A 4OO3A 1JTEA 2GA9A 1DTEA 3UTDA 1J8FA 1KL7A 1LW7A 2AF4C 1FP4B 3BHIA 1DQZA 1GUDA 1CU1A 4UTXA 1SGWA 4AVYA 4Z2AA 4CEHB 4BJ3A 1TQ2A 1N0IA 1YL7A 2B30A 5JNRA 5KDDA 2R87A 4PBRA 2O1XA 4CM4A 2NPFA 3VV2A 3WNZA 5JI3E 4H3KB 4HFNA 5EHQA 5HKKD 1JHRA 4HAUA 1BQEA 3SF8B 4CM8B 3EQ9A 2D2EA 2V0NA 3WLLA 2DETA 3FHCB 2WJ3A 3Q0EA 1T2FA 1JG4A 3NHKA 1QK5A 4TYMA 2A9JA 2FR8A 3U1TA 4CKXA 3O92A 1UM9A 5A4DA 1Q77A 5CT8A 1ZH6A 2EWWA 3AIKA 3JAWB 5DBOA 5SZJA 1OD6A 3UFBA 3ZLUA 3AJ9A 5A9RA 3DW1X 3MVEA 3AP1A 4D80A 2VVTA 1M3SA 1FEZA 1PR6A 5C4IA 1JQKA 5GOTA 4PFKA 4RTRA 1QP0A 1JWBB 1YWGO 3HXMA 3N2YA 3K1JA 3UUWA 4F5ZA 2Q41A 4PTLA 3WLTA 1CTQA 1SCNE 1PJQA 5T3UA 3KB6A 1GNRA 1PD1A 2A1TR 3G6WA 4J0KA 1XCOA 3QLVC 4RKYA 4P81A 3REQB 3VMFA 3ZU4A 1BH6A 2TMGA 2JGLA 3TJZA 4CN8A 1QLWA 1PNOA 2W6JA 2QUZA 3FGNA 4OQMA 4U63A 4BVHA 5EPOA 2OO3A 1KNXA 1E9EA 1SOAA 3CIOA 3KXLA 4HN9A 3M83A 3TOCA 1QZTA 3IIKA 3M0EA 1Y1LA 3CH6A 4FKMA 3ESXA 4M8IA 3A4YA 5BSGA 3KOMA 4PIMA 1GA6A 3KUKA 2RCYA 1J2EA 4WBXC 5HUJA 3RDPA 3C3YA 1O2DA 1XK7A 1B6SA 1QIIA 3FB4A 3JQFA 4H35A 4EUFA 5L6MB 4HAIA 2ZJ7A 1GFSA 4J7XA 3P9QA 5H1YA 2EFDB 3CKYA 1M2OA 2G1AA 4CCWA 2QZPA 4H08A 1T34A 2XCTB 4KGXA 2W6IA 3OO0A 2AHOA 2ZDHA 1II8B 3FYUB 5EC8A 1Z8NA 1CEYA 4BNZA 3F9IA 4PXSA 5JBIA 3UENA 3DPUA 2R6JA 3PJDA 1T2CA 3IULA 1H8EA 2X23A 4FNGA 3CRZA 1EXWA 1PV1A 4DJTA 2QUAA 1G3MA 1I0ZA 2GUWA 4AS3A 2Y67A 5LN1A 5LWHA 2A1IA 4OKNA 1G59A 1K5PA 4GKAA 4JKOA 3RBAA 1FFAA 1FUKA 1C3JA 2JL1A 3RVJA 1P4JA 2PIAA 2Q3HA 2J4CA 2Z58A 3L7IA 2CYCA 1PK8A 1OXXK 1NZJA 2Y1CA 3PHHA 4CMIB 1SVSA 1X6VA 2XUHA 3P45A 3A0UA 4OOEA 2V6IA 4EY6A 1KQGA 3HLYA 1NXXA 2C57A 3DDSA 2Q2WA 3I3OA 5BV1A 4Z4EA 4HDOB 2YNMA 3MINB 1T13A 3IB6A 3O74A 4IBOA 1NR5A 1P80A 1R3UA 4MTLA 3THSA 1GDHA 1NSYA 2KM1A 1IG3A 2ZYTX 5DGXA 5K3FB 1TTPB 1C80A 3TD9A 4ABTA 3RRYA 5DBGA 3PFGA 3KQNA 1VHLA 1P75A 2IXTA 2MR5A 2VHYA 1AKQA 3T5TA 3DOOA 4MR9A 3TS1A 4F1WA 1UK8A 3FTDA 1E5TA 1YI8A 2YYYA 3EBLA 1VLQA 4ALKA 4U8GA 4A16A 4D02A 2JANA 3H86A 3QSGA 3H5VA 4LC1A 4U7TB 5E3HA 4V0KA 5F7JA 3T7SA 4IDCA 4DXDA 5CBPB 5DLYA 4K6HA 3IB3A 2ZIAA 3CRNA 1JEJA 3WKCA 1E32A 1JLLA 1PS0A 2HDHA 4UU0A 5BN5B 3FMIA 4EHAA 3WA7A 1OREA 4FD3A 1OA0A 3P0FA 2IXGA 1CJSA 3FOAA 3JWGA 2FP3A 5KAMA 2E5WA 3E35A 4G1FA 5JD5A 2R00C 1BOFA 1P7WA 3JQFC 4LXUA 1CF4A 4N5NA 1E0KA 2HBYA 4ER3A 3E0XA 2XNJA 4L3OA 5F64A 4G5YA 3NAGA 1J39A 4CFYA 3LP5A 3BXEA 1Z35A 3T5DA 3CPEA 5HZHA 4MJXA 2CYBA 2ETVA 2E7ZA 4OJKA 3ZDCA 1JVBA 3K5PA 2IW1A 2CHGA 3GLSA 3H2BA 2C2MA 1DEKA 1GD1O 2ZYGA 3D4BA 3QA9A 4DA6A 1DIBA 1VKOA 4IDGA 3DAGA 4JA2A 2RD2A 1GEGA 4TVKA 2VQFB 4TRJA 4MLPA 2DT8A 3BJZA 1NVWQ 4RZIA 3OIGA 2O3SA 3HSKA 3W7BA 2NYUA 1EVZA 2NZVG 2P9JA 3WJ2A 3DZGA 3TAXA 4X65B 4DDKA 2HMWA 3DNPA 1A4IA 1FJHA 4IM7A 1TPZA 1MV8A 3AM1A 3DS8A 5LU9A 4LE0A 1IEWA 3ADCA 2QVXX 1BXGB 4M98A 1SHTX 3LHDA 3NIDB 2C7QA 4HDNA 1G17A 3TQRA 2H1OA 1KO7A 3KZXA 4OH1A 4TT3D 4CNQA 5LP1A 3EFOA 3G49A 5H3HA 4DMFA 2NV2B 1XZQA 2WWHA 1U65A 4H7PA 4A6XA 3HKDA 2J41A 4IDNA 1NAHA 2VYVA 1DC5A 4I6EA 1PLLA 2G0AA 1VGQA 3PUXA 1GA1A 3GI1A 1ZM7A 2EBWA 4G8BA 5TC4A 1XTRA 1KIMA 1Q3HA 4NP6A 3BIXA 4RJKA 4D0LB 3GDHA 2VF4X 2ADOA 1E1QA 3FZQA 4TT3A 2QKYA 4YFYA 2WWWA 4XOIA 2JI7A 5IEJA 5ALWA 3TLZA 1QANA 1P3Y1 1M1YE 2VQSA 4GZMA 4AMUA 4PV7A 1D8AA 4H4EA 5JMTA 3BRQA 3OZXA 4LJ7A 3BMNB 3PHJA 2XRZA 1EM8B 5FUXA 2JGEA 1GTG1 1MO2A 3C8DA 5M7EA 1C8LA 2IYNA 3WLEA 2OC9A 2IEAA 4CM6A 5LL6P 4MA4A 3OKCA 2CJWA 1I7PA 3H4IA 4M1KA 4TLEA 5TGZA 1XQWA 4PSCA 2DTXA 5ALKA 2CXPA 2OD7A 1C1HA 4RLSA 2FSVC 4GEKA 2V55B 3DZDA 5BWCA 5KIAA 3ICEA 2PHZA 3NTQA 2NT3A 2CK3D 5CFOA 1N2IA 3H18A 2YS7A 3ILHA 1IVSA 4DQVA 3UJNA 4IMJB 2G25A 2ODPA 4HLUC 3Q88A 3WZLA 4PPFA 2JI4A 2WKQA 2H85A 4WESA 1X1TA 1G8SA 4WY5A 2BMFA 3E15A 1YV9A 1PYOA 2CE7A 3I92A 5K6TA 1K75A 4MUXA 1OSNA 1W0JA 3BF8A 3BWXA 4CR6A 1VG1A 5B4VA 4RVNA 1AXGA 2P3QA 5F7OA 5KHLB 2ZS7A 4BWVA 3CTPA 1ADCA 1A27A 1U6JA 5JJIA 1ZN9A 2FDRA 4GL4A 1E1DA 4JI4B 5HGJA 4D9GA 3WTCA 2B5OA 3E3LA 3OU7A 3AERB 2A5YB 5CB4B 3VR1A 4ISCA 2AFIB 2QX4A 3U80A 3GCDA 5KHOC 1JQLB 3CUSA 2P4QA 4II3A 4E2WA 1J5PA 2ZRKA 2G4LA 1SXJC 2V58A 2FJPA 2R65A 4TLBA 2ES4A 4EGJA 4J4HA 4DMRA 3VR4H 2DECA 3O1JC 1SKMA 2QN1A 4R3WA 2B78A 2WT8A 3KJXA 3URKA 1G41A 1ZI8A 3UHPA 1D2NA 3D43A 4LE2A 4LK3A 1NX9A 1ECJA 3X2EA 4G3XA 4JJEA 5JXGA 4EVIA 5DLEA 4PCUA 2N3ZA 4BZQA 3T4XA 2VK2A 4D26A 1PJ2A 3BCRA 4I3FA 3NTOA 1AXEA 5H80A 4PLWA 2RGYA 2ZSJA 2J48A 1RR6A 2CL5A 2ZG6A 3A32A 3LPCA 2CVPA 2O5VA 4XYBA 3VHXB 4JYAB 4ZDIA 3IJ5A 4QWMA 4YEDA 2WD9A 1GNQA 3NBAA 1NONA 3IYLW 4YAEA 4ZV7A 2BJVA 2ZREA 3JQCA 1U9IA 4DB4A 1G5FA 5P21A 1ES9A 3R3UA 4DLNA 3R6DA 4IJ6A 2IP2A 4MMXB 4NZOA 9LDTA 1YC2A 5AW8A 5JEEA 4LCJA 1SPXA 2XWSA 4L78A 4MGKR 2IU0A 3WG9A 4EJFA 4BP8A 1Y8CA 3G7SA 1QXSA 4X94A 4GX2A 1WKCA 3L7NA 3ROZA 4Q21A 4FP9A 4BJHB 4LPKA 4IGFA 2H17A 4II2A 4WI1A 2EG5A 2NYRA 3WRXA 1SY7A 2HJVA 1RPTA 3DWFA 3MTGA 1SD1A 1HE1C 4H0FA 3UGQA 4KKXB 1R18A 4O63O 1PFUA 4DV1B 2WMNB 3PQFA 1KZ4A 2F64A 5EXPA 3RWOA 2IXDA 3ND8A 4BFCA 5MF6A 1DUIA 2WD8A 4U2BA 1YVEI 1E79A 2PR7A 5CLJA 1K7XB 3BT7A 3WGTA 1QYWA 3GUZA 1S96A 1NYQA 2HDOA 2RI1A 2WTXA 4C2TA 3HXKA 2EFGA 1ZIPA 2XDWA 4QFMA 4PZZA 4EVQA 2B35A 1EFAA 4UUOA 2OQRA 8ATCA 2PX0A 1JHUA 1XDGA 2FPIB 1NW3A 1VB5A 2P9EA 2QPOA 2FLVA 4QREA 4EO9A 1MV5A 4R7TA 2WIAA 3W6OA 7MDHA 3JQBA 4TSKA 4YMSA 4C7BA 3AB8A 2GCOB 4G8DA 4FJ2A 4LDQA 4S0XA 5HA5A 4QVGA 3HSYA 3OIUA 4R2JA 2BF7A 1EXMA 5DOZA 3RVKA 3TF5A 2IX9A 2ZDGA 1D09A 3A9TA 1MQ8B 3BEOA 5GM2A 4P4SB 3A6HA 2ZIVB 3LQRA 4YRNA 4P92A 1MUUA 2PZKA 2DQZA 1XCGB 2Z83A 1U8EA 3ELDA 3IAUA 3T5BA 2JG3A 5CR9A 3V7FA 3F6RA 5ISMA 4KPFC 3Q9SA 3SF8A 3QH4A 4GI1A 3QMVA 2YY6A 1GTVA 2IYLD 2W2LA 3LZ6A 4OHPA 1QHSA 3AOGA 1PHRA 2JFYA 3F78A 1HDYA 1OPXA 2XUPA 2FMIA 3Q1KA 3N28A 3ZZ0A 4I4NA 5C5DA 1NRJB 2RAPA 3LAWA 4YS6A 2B21A 4FX2A 4MV3A 4C30A 3ROEA 3HRHA 3GRYA 3QU4A 2Q9AA 3DO6A 4AJNA 1QMPA 4CCAA 1MW8X 4JUBA 3UFXA 3Q2IA 3ZXIA 1DJLA 4OB8A 1K8XB 2C03A 2GPNA 3T4UA 2PKQP 4A8PA 2WZQA 6Q21A 2WFMA 1E2QA 3STXA 1OBCA 4CF6A 1KIAA 1SCDA 4P93A 1MXHA 4QXPA 5ALXA 4LZJA 4Y2YA 5DISB 3P20A 3LWNA 4Z9XA 3V8RA 4C07A 4W82A 3PV0A 3IR6A 4KIUA 3A10A 3MRVA 5KNDD 1ZJ4A 1RC1A 2BR4A 4BP3A 2HTEA 2GF2A 3SGLA 2BD0A 3ZGYA 4QLBA 4JSYA 5BYJA 3ILSA 3R9IA 1I01A 2G9UA 4FOSA 4EP1A 3RVSA 4ENTA 2R0QC 1CJUC 2V6FA 1NPDA 3UWDA 3TB4A 1P4RA 3WL5A 3EBPA 2MTBA 2OV1A 1M2EA 3NWBA 1DO8A 4PZCA 4R1LA 3WJAA 3GRAA 5AVQA 5CDYA 2I29A 4ASUD 1W5BA 3HM2A 1XVTA 4EHHA 3DZJA 1FUEA 1SNYA 1ZSYA 1RP7A 4GECA 4IIVA 2NSHA 4B6EA 3KALA 4L8LA 4MSUA 2BFBA 2XEXA 2AKAB 3C7TA 1QOPB 4PNHA 3VYSB 1TJYA 2O9JA 4HAYA 2R7LA 4HRXA 5DOVA 5THKA 3ZCRA 5EVJA 2QB5A 4ZAXA 5EJIA 2IHNA 4EELA 4QGGA 3AVWA 2BGMA 3FWNA 4IDDA 5EWLA 2VN8A 5IZCC 3K70B 3F3YA 2NP6A 3VZBA 1MC8A 3MUOA 1CQZA 4FMDF 1LB1B 1UMDB 2DR3A 2XZOA 4DPKA 1QS0B 2D6FA 4J07A 4DT1A 4ZVTA 1L4GA 1XRRA 4RDXA 1QTIA 1WHSB 1PKEA 3LNCA 1OH8A 2E4UA 4ZAWA 2GRJA 4GZ6A 2OENG 2BMJA 3K8ZA 5B2FA 1YR9A 4I1UA 4C1BA 3AHGA 1G6OA 1RXUA 1U0NA 3E82A 3PC2A 3ZLBA 1PNQA 1WSDA 2O0KA 4MH0R 1UOEA 4CGZA 2MMCA 5CG1A 1E61A 4NQZA 3PIIA 1A9QA 3K1AA 4GX1A 4MQBA 1LPBB 1ZH0A 2Z09A 1MIOB 1AZSC 3P2EA 4CLRA 3SJZA 3L3BA 3AU9A 2WC1A 4HXEB 2FNAA 4LOIA 2OZEA 4JZYA 5EIAA 2HRRA 5JMOA 2QTBA 4K5QA 2A9RA 1J22A 4OJMX 1ZL0A 1UAGA 4PFSA 2X5XA 1TVKB 5CDHA 2YWGA 2BFAA 2QUBA 3VAAA 4IHAA 5DNCA 2ZDQA 1UIRA 3EEOA 4U39A 2VP6A 3BQNB 3O4HA 2C4WA 3HYLA 3N58A 1I94B 1J06A 1A2BA 1JDTA 1SIWA 1YRAA 2JFNA 2XNDD 1DAIA 4L4ZA 4PGFA 5B3JC 1PLKA 4Y9TA 3PCRB 1TVKA 4IAOA 1LW6E 1D04A 4CV3A 1F7VA 3A4NA 3MBKA 4MR8B 5ES3A 3G2HA 1RPZA 1IB6A 1TO6A 4MS4B 3HUEA 3GLQA 4J0QA 4MUBA 3DHEA 1H6AA 1PZMA 1ZUNB 3GGDA 4YECA 1N34B 3D0RA 3CN9A 4IGEA 4UE6A 4FCWA 5BWBA 4QRIA 3AHFA 1NXPA 1VM6A 3T7CA 2ZJ6A 1GZUA 1YB7A 4UPDA 2IS4A 3MW8A 1HFKA 2XUAA 4WXPA 3W06A 1VCIA 4W6QA 5H4HA 1PS9A 1G8AA 4FCTA 3DE1X 2UXCB 3AKZA 2IYRA 1UXJA 2QG6A 4QUEA 2B34A 1VA5A 2VXYA 3I0ZA 4DBLC 3HBNA 3WA6A 2W98A 3LV8A 4WL0A 1IDOA 1U9YA 4LRSB 1CUDA 1T5DX 1V71A 5IH3A 4CTOA 4QZVA 1KKUA 3DDOA 4RHUA 5KX5A 5LIPA 2A6PA 1WBDA 5GONA 4G5HA 3U3JA 1KS9A 5DSXA 2QGFA 3AETB 1W4BA 5K3EA 1SKBA 3W2IA 2IHTA 1E98A 2ID9A 2WKWA 2E4ZA 4Q4JB 2EXXA 4O4LF 3BMQB 1PJAA 1WD5A 1OROA 3TPCA 4DCUA 4X62B 4HL6A 2DERA 2GYWA 4UHKA 4DR7B 4KR2A 4ILEA 2OHGA 1FQJA 4IIJF 3UKOA 2P11A 1CF2O 4WLOA 5J1TB 4WERA 4I1OA 5LZ4A 4WK6A 2GBLC 3TM5A 2X1MA 3VOBA 3RYHB 1HT1E 1R0WA 2LWIA 5BSTA 1YJXA 2C2KA 4HPWA 4MI1A 1ZI9A 5AW9A 2RJNA 4RV5A 4MRVA 2ILVA 5KVVA 3C5EA 1KBOA 3CONA 4MULA 2YQ5A 5F23A 3GY0A 1AN0A 3PEFA 4QVIA 4MPRA 3RF7A 2R8RA 1N5JA 3ZY2A 2P2CA 4UHEA 5JATA 3KM0A 4OQYA 5JC1A 4ZYUA 1ZGCA 3ZWMA 5A0FA 3EAQA 1K88A 2CLKB 4OJNA 4U9HS 4RWZA 5EUMA 3WSVA 2A0WA 5GZ3A 4OFWA 1CY8A 1WB9A 1AJEA 2DYKA 1Z83A 2A58A 2PM8A 2XYGA 4S2EA 5BUQA 5I8ZA 1DE0A 3WB0A 1U1FA 3SR4A 4ZGBA 1CETA 3QEMA 1M73E 5DNEA 1RRVA 2EV9A 2QXYA 1XNQB 4K81B 3RC2A 2OYRA 5TDHA 2YWCA 1GCUA 2GSWA 3NOOA 2YY5A 3VR6D 4TTPA 3QFRA 5ITVA 4QD3A 4JMLA 3RWBA 3HB7A 3WQRA 4ZHQB 3L0IB 3EYAA 4RADA 1XZIA 3BBPA 1XQVA 2HPAA 1RJEA 1HT2E 2ZE5A 2HCRA 1HA3A 3H0CA 1AXRA 3TJRA 4CM8A 5HFJA 1W87A 4XRGA 4QOSA 3ZH9B 4MWTA 4CU2A 3HGMA 4RHTA 4D57A 1KZ1A 2RDMA 3OD5A 1YBAA 2X8AA 1WXWA 1TJ4A 5ADUS 1VXOA 2MINA 1MFZA 2BI4A 1OFTA 4NR0A 4TMFA 1DKRA 2V4ZA 3KPVA 5FJIA 3IEIA 3VGPA 5B3KA 4Q4JA 1K4KA 4E7PA 1U0SY 1L9KA 3AUKA 4Z4GA 2J5QA 3NM5A 1TM5E 2H5IA 4PLHA 3PJEA 3CEHA 1KO1A 5LXTF 3EPRA 5E95A 3SQMA 4GAEA 4AZVA 4EPVA 5IASA 3ZV4A 1Q1BA 2Z04A 3KP1A 3V2GA 1GZ4A 1JHOA 2XDQA 3PFCA 2OV4A 1N4DA 3CO0S 1D3AA 1B8NA 2QP9X 2Z5LA 4UJ3A 1EZ1A 3RREA 1EWKA 1IXYA 3GJQA 3DAYA 1S9DA 1W2GA 3MRTA 2Z0MA 4C43A 4JXJA 3L4BA 1NSFA 4UPEA 5ALDA 4K2AA 5FBLB 4DNFA 3UPTA 3R6TA 4HK4A 2AA3A 5BRNA 2M2IA 1QHFA 5CITA 1E5VA 1UEIA 2YX1A 1NM5C 3H0EA 2O7SA 2Y1WA 5ERXA 1K7SN 1R4MA 2DSTA 3LVFO 1TU4A 4D8UA 1E9DA 3TTTA 4MWDA 1WDTA 5TQ0A 5I7AA 4JXZA 1V8FA 3W3ZB 3ZD9A 1NYRA 5J40A 2A3NA 4AP5A 4P53A 1QU2A 3AKEA 1X1RA 3PNPA 4N40A 2PX2A 4R4JA 2IYZA 2AJDA 4JWTA 4MS3B 4Q1EA 3CRRA 3S99A 2H6EA 1AX9A 1Z38A 3L77A 2A0UA 1T1EA 1AHIA 3CLUC 2BHRA 4X1IB 2IWHA 1I5EA 5M04A 1OB5A 1CSEE 2WZBA 5IVDA 3GPBA 3SIRA 2FMKA 2P65A 1HKUA 3KFXA 5EIBC 4HRYA 1Q17A 2OGSA 4CKZA 4NJMA 4E1VA 2PUFA 5CXXA 3T12A 2FDCA 2AG1A 4XJVA 4D9KA 2RHCA 2QMHA 4M1MA 4J0CA 4XDZA 4YRQA 4M60A 4JUFA 2DUNA 4WXHA 4B6SA 3HVRA 2F48A 2QY9A 1C9YA 3PSHA 4BQQA 4ZYTA 1BXZA 2ZBRA 3TCNA 1ZJ6A 3SDZA 5KYVA 4YYZA 2GO7A 2FPSA 1FUIA 5BQOA 3VVBA 4YMHA 1RLMA 1HMPA 2GN2A 1NUHA 4N65A 4R2HA 4CMHA 4BTLA 1KI7A 2F00A 2FEXA 5EGSA 4EZEA 3KO8A 1FFDA 3FMVA 2ZSFA 3IUSA 1ZOSA 1GYRA 2YNMC 1FX0B 3FSJX 1ONOA 2C4UA 1M8PA 5U4QA 3WQBA 3WLMA 4AIIA 1D9XA 3P0EA 3SSMA 4WA7A 3W8EA 4PCVA 1GCOA 3FFXA 4PGHA 2ORIA 1TCAA 4GR5A 1DV2A 1KJNA 1U80A 1VLLA 3H2YA 5IWCA 1Q74A 3QV2A 5T4BA 4RPCA 4KQXA 1I0LA 3G8DA 3RTDA 3ZI7A 5I7OA 3L1IA 3ZN2A 1VG9B 3HBLA 4YY3B 3FCXA 2WVJA 4XLLA 1N6RA 4FDTA 5JAUA 4YCNA 3UGJA 1FFYA 4RK5A 4TV8B 3WI7A 5AM5A 2OPHA 1Q5PA 2HREA 3RYFA 4LK2A 4MYHA 1ZEJA 2H11A 4N7MA 3SJBA 4KI7A 5CVDA 1NFRA 4H0NA 2IP4A 5DZSA 5JS8A 3NBXX 5JY1A 1M0EA 2GVNA 3I9OA 1PJRA 3QMWA 2GARA 1J6UA 1JQEA 1RJWA 3GLHE 4RLQA 4XYLA 2C99A 4URVR 1FU8A 4BO2A 1GDDA 3IRUA 4WJKB 4TUYB 5BN3A 1ZH8A 5I51A 2ODBA 4DUPA 2VBFA 4QFDA 1JDNA 4IICA 3LIIA 1G7TA 4ZRNA 2Q4EA 4K8RB 1NFFA 1C9NA 2VK4A 4JI5B 5J4HA 1GGKA 1YR2A 1VOTA 4I9HA 4KDCA 4QGFA 5JFGA 3MLEA 3Q4GA 4LHWA 2NNWB 1RSZA 3FGZA 4O2RA 1VG8A 1XKLA 1K98A 5GJBA 4QBIA 1M2WA 4N5HX 2XSZA 1HE8B 3VO2A 1NVTA 1UFKA 2PJRA 2ZUVA 3IQXA 2A88A 2HBZA 2NT4A 5EJFA 3ZGVA 2NXEA 4MI3A 1BD3A 4FR2A 5PNTA 4UU1A 4AZ0A 3I62A 4HDRA 3HYCA 4KOAA 4X45A 4K9SA 3ZE8A 2R6AA 4XFDA 3IJPA 2A67A 3NS7A 1NBME 3NJ8A 4AYTA 3VJMA 4MYCA 3WJ7A 5DCWA 3JWPA 2Y6VA 3L6BA 3QVGA 4ONEA 5KKAA 4A0RA 2WB2A 4RANA 1FSGA 3EWSA 1K5HA 3EXIB 1MN6A 4Y1GA 3FMOB 4W6ZA 2BGNA 3EVZA 3GWGA 2I3AA 2WA1A 4EYEA 4FBMA 2B1JA 1TYBE 1Z6PA 3MILA 1ECBA 1BW9A 3DUFB 2E87A 2H3EA 3I9NA 4AXXA 1K6EA 4U8HA 3BHMA 3IO5A 1P73A 4DV7B 1SOUA 4MVJD 1N8NA 3WNBA 1D0VA 3AESB 4Y8VA 2ZWPA 3RTBA 1VSVA 1JG1A 1QR2A 4V24A 3M3DA 1BDMA 1S2LA 3OETA 1X42A 3BUSA 1D1SA 2KQUA 3R20A 3UJHA 1H8HD 5IABA 3PZBA 5IT4A 3HS3A 5IKEA 3LTNC 1VMKA 2EX4A 1JFRA 3V1TC 1Q0LA 2AKYA 2FWAA 2HN9A 4MQFB 4YJHB 4LTNA 4ENUA 2IJGX 5FUYA 4MRAA 4DBZA 4DRXA 2Z2XA 5JO0A 3TTVA 5JD3A 2Y77A 3H1PA 3EOZA 2UZ4A 2J3MA 4M55A 5ICSA 3G23A 4AKTA 2V6BA 3P52A 4HZUB 2DHRA 2XBUA 4PBTA 4KSYA 3SBOA 2YRWA 5FPYA 4BFUA 4C21A 1RU3A 2VWPA 5EJ4A 4DDVA 1UDWA 3OX4A 1G5PA 1Z45A 5BYAA 3ACDA 3TZLA 3RQIA 4H7JA 1Z5GA 3MAJA 3NNSA 4C4ZA 4DADA 2W8BA 2VSYA 1PJ8A 1O4WA 2P4HX 4G5GA 5FUVA 4NG5A 4JL5A 5TS3A 1YS2X 2JVKA 2VK1A 2OECA 1GZ5A 1PZHA 1E4OA 2O8VA 2WA2A 2ZWVA 3PXXA 2VAWA 2ZQ5A 3B2EA 4ZPJA 2Q5CA 4D79A 3F67A 4GPEA 1DT5A 4EJSB 1P2GA 2MOKA 2H7YA 3H1BA 5T3YA 3CNQS 5FDFA 3KETA 4G9GA 1QNLA 1HLDA 2WD7A 4ILKA 2Y1EA 2O59A 5CA1B 3DVLA 1VKRA 4G8CA 1A5TA 1QIHA 1KI2A 4FFRA 4ZOBA 1FFSA 4RCVA 1NJGA 4CFSA 3T3HA 1JG2A 1QGUB 4YRLA 2JJYA 2XNDA 3SHVA 1TB4A 3TIGA 3FPCA 4EBBA 3GLKA 2MSKA 2AD5A 3QYAA 3TR6A 3H4TA 4IKPA 4OHFA 2UAGA 1YBVA 5HTKA 4C5BA 4R83A 1P9LA 4BX2A 1EA5A 1FSFA 4C1NA 2NU7A 5JJLA 1GAEO 3T5CA 3FHLA 1ZN7A 2IYSA 1RP1A 4TMTA 2QTAA 3P9XA 4ZCSA 2FOLA 1HNXB 1XTZA 4L9SA 5CLIA 2WY2D 4BLRA 3WMGA 4K1XA 5DM0A 1QPBA 4WTOA 1EJBA 3OZVA 3PUZA 4L3WA 5D6OA 4GP6A 1UT6A 2CV1A 3JQ8A 3LQ4A 3IDOA 3RC7A 5EJ9A 4ND6A 2F8MA 2GAIA 3FM9A 4MQEB 2FPMA 2RONA 1L1EA 1XRNA 3B7WA 3O3NB 4UCFA 4LFCB 1JAZA 1ADYA 3HXPA 5KVQA 3WC4A 2A57A 3CWQA 1ZVJA 3NEJA 3LUGA 1GCIA 4KN6A 3KXKA 5ICCA 2Y68A 1KFEB 5E0KB 4KTTE 1W7AA 1ORRA 2ZEJA 3INGA 1UJ2A 4CUJA 2C5GA 2H54A 3KYBA 3ASVA 3LH5A 4KFUA 2Q7DA 3UJDA 2JLAA 1EFCA 5DU2A 5ADHA 3IUPA 4IIJB 4GUAA 1PL6A 1VHTA 2GVZC 4Q9HA 3TQCA 3UHFA 2I7XA 4NCIA 3BWEA 4AJIA 4G0QA 1ORDA 3PRKE 1YF3A 3HCPA 4WRRA 2H5EA 3NBZC 4B3SB 4MB2A 3RC1A 1ICIA 3HRKA 4KXUA 4KREA 1NVEA 3KEFA 2I76A 1DEAA 2HWXA 2JH3A 2R4QA 2HLDA 3QPWA 4HBGA 2MMGA 2GVDC 4KQ9A 4AROA 1FOEB 1NUQA 3E61A 4E09A 3U40A 5GGYA 2OT3B 5KYGA 2F4NA 1I1NA 1KZ7B 3MMPA 4MYDA 3RO7A 3WWPA 5I7UA 3T5AA 4RACA 2AS0A 5CDSA 1FTGA 4H18A 4BNFA 2VL7A 1WKBA 4BO1A 1RVDA 2CK3A 3PWSA 5EAIA 2Z5GA 2AI3A 3WYDA 4L6AA 4GRIA 2YC4C 4EA9A 4A3SA 3QVOA 3QX8A 4EY7A 5J4YA 1YI0A 3QUSA 3TLBA 4MNTA 1PGQA 2YW2A 1W36C 1SUAA 3G0DA 4LJ5A 3PU6A 1E0JA 2AOUA 1VPVA 2HPVA 5TX7A 4XM2A 2CL7X 4JLJA 1U8XX 2O4CA 3L8YA 3TZBA 1C4WA 4Q4LA 1XF1A 4A26A 4F06A 2JJQA 2QD1A 3W9UA 4BQNA 4KSBA 4O2BB 4EL0A 2XRFA 2WWVD 1P0CA 1T1JA 4FFOA 4UTVA 1QYXA 1L5KA 1QKKA 5IS2A 4MIEA 4DV0B 1Z36A 2EFJA 2PK3A 3G85A 5AW4A 3V48A 3D59A 5JPDA 2XE4A 2HSZA 1X1AA 4FC7A 3VPXA 1CYEA 1DQPA 2O07A 2RSLA 3FIJA 1QCDA 1R00A 1THTA 2OV6A 1NMQA 1ZRHA 3IV6A 1BJKA 3N2GB 2H1IA 2BM0A 4FDMA 4LCBA 1VE6A 5DYYA 1O6BA 2O4UX 1CY1A 5IW8A 5L6LB 3WK8A 3BDAA 4F9FA 3ADKA 1HEYA 1FP6A 5IM4F 2RCNA 5E6SB 3IP5A 3C74A 3H11A 3ISJA 3OG9A 3RBXA 3TGLA 1Q3TA 1W47A 2CUKA 1MXFA 2RHWA 4O4LB 5TMDA 1NP6A 3A06A 2AZTA 4UM9D 5BN5A 4EENA 2Q4TA 4WPGA 2X4IA 2GZDA 1L5QA 2VYVD 1Q91A 4WBSA 2G40A 1T2AA 2CJXA 1H9BA 3R74A 3E4CA 5FL3A 3ZVKA 2ZI6A 1E59A 3I39X 3I1IA 3MJFA 3RS8A 1W35A 1OZHA 3VX3A 4I3GA 3Q5GA 3VC3A 5A0TA 3R6GA 2I7TA 3V3TA 3GRKA 4JQSA 5KHAA 3V8EA 4EH1A 2OZKA 2D1YA 4BFSA 2GWRA 3X1WA 1CQJA 3T3IA 3VNQA 1LBHA 1JQJC 3QXCA 3BERA 4P3NA 3CJQA 4JXXA 5AVJA 3VU8A 4KO3S 4G0UA 1AKYA 4KXQA 4IDPA 3ZHZA 4J94A 2GA8A 1JFFA 1U2RA 2ZJ1A 4WN3A 3E9MA 2ZRLA 2W71A 3G79A 3Q8LA 1G5QA 1DNPA 2QG4A 5TQ2B 2QD3A 3J81k 3HO6A 1SCBA 3LT5A 2QRNA 3ZDYB 3AVVA 2OUKA 1ZAKA 5JWHA 2WJZB 1H9AA 2BCEA 1NNI1 2XB4A 3MT8A 2FF7A 1YIAA 2AX3A 2VLBA 1ABFA 4TT8A 1IXKA 4DM3A 2GAJA 1CNMA 3T7DA 2QBYB 4FFPA 4X8LA 4XA8A 5G0WA 3NMUF 3FMFA 4RIHA 1ARZA 1YRHA 2C2WA 2J3DA 3GT4A 2QP3A 4BB9A 1ZNXA 2HM7A 2DKFA 2Y4NA 3NCHA 1MJHA 2G28A 3MTQA 3MJ4A 3NOQA 1MO5A 1Z47A 2P30A 4GDMA 2F8LA 4V03A 3G2KA 3ZWBA 4B75A 2FVYA 1KYTA 2I67A 4BUZA 3HWSA 1XC7A 3HJUA 1P74A 1QZUA 1W46A 4HRAA 4D82A 5ABPA 2G08A 3ETNA 4TMWA 4FSHA 2UDPA 3FLMA 3ESAA 1C3VA 5DVZA 3OCZA 3RYFB 3MCAA 3VBEA 2NV6A 2I8AA 1ZOOA 1CPYA 2B5WA 2Y2UA 3RSFA 3D4LA 4B74A 2PUBA 4RVDA 4AG5A 3R7WA 3LC2O 1WLSA 3FPFA 1E9CA 2R79A 4OSOA 4PYOA 2HF7A 3U3RA 3FNQA 2V7XA 5D00A 1ZCFA 3WGJA 9LDBA 1UH5A 1FDWA 2DQ4A 2JGAA 1G7SA 2B4YA 1XL0A 4R8LA 2P78A 4ETNA 1W75A 3FYHA 2VDMB 2XHEA 1K1EA 1N6NA 3C6YA 4LFBB 3RK1A 3HJHA 4D9CA 3KDSE 5JNLA 1B6RA 3NRJA 5JSUA 2H31A 3UK2A 4HP8A 2K5UA 1KQOA 4RH1A 4RWEA 4BKQA 2QN9A 1WQ3A 4MKRA 2UUBB 3NXSA 1JPUA 4I55B 3GVPA 4MAMA 4B9EA 3HNRA 4EPXA 4ZD6A 1Y1RA 2GD1O 2QS9A 3ER6A 5SY4A 2W58A 1N2CB 2UYOA 3V9AA 3CLTC 1RRMA 3S40A 1I6WA 1FP4A 5TB5A 1GPLA 2IQIA 5AUQA 3TEFA 4RH3A 1KPGA 1P4AA 1SKUA 2QT0A 4PZAA 5A05A 1JLRA 1LI5A 3TLEA 2YQZA 4Y6GB 3CNOA 3UF0A 1YB6A 4XWTA 1SUSA 5DWDA 3HEAA 2J4DA 1GT6A 4J3NA 3K9QO 1GO2A 1OXTA 3EA5A 4NAVA 3TAHA 1S2GA 4BNDA 5H8WA 1KXZA 1S7CA 1Q14A 4A73A 1QUFA 3TEMA 3KU1A 1RWMA 3A1FA 4B3IA 2FPUA 5GWXA 3QVSA 3SZ3A 1Q2XA 1TF5A 1Z22A 2WWIA 1E8MA 3VZQA 1Y4DE 1CUZA 1QIEA 1S8NA 2E48A 3AW9A 3OEEA 5AM1A 4C01A 5K3FA 1K7FB 1IAQA 2ZB7A 1ENOA 2X4DA 2O52A 1GGNA 2FUCA 1J0DA 1LNSA 2WIDA 2ZS8A 2CKMA 4H17A 1NVDA 4BV2A 4D4MA 3O8RA 4XE5A 3SYKA 1H42A 3U37A 2G4CA 3ONDA 4OB7A 1Z6TA 4UQLA 3MELA 4ABYA 4GSYA 5IJAA 4EGAA 2J0QA 1DGQA 1UQUA 3U3XA 4MRMA 1TA9A 3G9XA 3ZWKA 1FS6A 3Q3CA 1BDHA 1IY9A 1JEAA 3MYYA 5I9BA 3RI3A 1PJSA 2R8OA 1P9RA 3E4DA 1MZVA 1A82A 4YV1A 3HVUA 1B8VA 3DZHA 1Y7TA 1F51E 3K73O 4MIOA 4K05A 1WBBA 3CF2A 3ANXA 1RQ2A 4GE0A 4NOJA 4LECA 3OJWA 1LF0A 2R5WA 4WXRA 1DKOA 1VP9A 3DZCA 4JX8A 1AQJA 1F0NA 3H65A 4Q82A 1SZCA 4OK6A 4Z7QB 4LHSA 1U2DC 2KI5A 1VMEA 4M0LA 4HJXA 3JYHA 5AD1A 3D81A 2DHQA 3ZNOA 3L0OA 1B74A 3ZWAA 1KEVA 1DWPA 3LHIA 4PVDA 1GPBA 4IJ5A 3VSDA 2HHAA 1G8MA 3DMRA 3GAAA 3JVVA 4IQ8A 1MU0A 2PRSA 2W00A 3FIUA 2OCDA 1IL0A 2R5FA 3NOXA 1ZGGA 5T4FA 2VJMB 3DVSX 4KJXA 4S1NA 1N3LA 4Q9AA 1CUIA 3MRSA 4JBYA 4NSNA 1NMYA 1R4MB 2XGJA 1EBUA 1JJBA 2H16A 1KMHB 1F2TB 4LJ6A 3V4SA 1POWA 1X94A 2EBUA 3NC4A 2UUAB 3PGA1 3IXLA 4DCCA 3Q11A 4DWOA 1E6LA 3B3QA 1IQUA 1YJQA 4XOUA 1FXWA 4LXTA 5FOUA 1MJFA 4N6GA 1BXRA 1HDOA 2VBGA 3BRCA 2XWBF 3FHJA 1BU8A 1J7KA 5LPNA 5FOSA 1N4AA 1WVGA 1VKNA 2Y0PA 3B60A 3MYRA 5A5GA 5JDCA 3L7KA 1BYIA 3FSEA 4CKEA 1SOMA 5ENVA 1XFDA 4C7VA 1KXJA 1A1VA 2X4LA 2BMEA 1X7YA 1C41A 3K1AB 5B6IA 2DWOA 1M0TA 3KQWA 2OV2A 1YL5A 3G1WA 4ZO6A 3EPHA 1SQFA 3PXCX 3Q8KA 3EFEA 4EI9A 4DKXA 3S55A 4URYR 4UTNA 4FX5A 1MRZA 4AUNA 3C70A 5A7FA 4M8NE 3VC1A 1QE0A 3CISA 2OXIA 2QHXA 4JNKA 3N74A 2D1FA 2HDNB 4J16A 2NP7A 2XD4A 5BORA 1E3SA 1IY2A 1DAMA 4RE6A 5EGNA 5A5DA 5JI2E 3M7IA 3PQ4A 2Q1UA 3IOYA 3OESA 3TCKA 2QVCA 3AVYA 1X3SA 2OG1A 1XRLA 2BRUA 2WJAA 2ZPUA 4BVLA 2FSUA 3O94A 1UCFA 1PV2A 3K9HA 3GZJA 2ZAMA 4MKZA 1PEKE 5AVOA 4HGYA 4HN2A 4DA8A 4AJPA 2E82A 4FFSA 2GASA 1MOSA 3DKPA 4NV0A 2XXJA 4BVEA 2BFEA 1LTHR 2DBVO 5BVGB 2J30A 1Z2CA 5KVSA 3AR7A 2I8CA 3O4IA 1Z0DA 5I9TA 5HZMA 1Y5LA 3QPAA 2QOEA 4NXNB 1JHAA 3A1EA 1SQSA 5EE3A 2P0YA 4EYKA 1QR6A 1NBOA 3JR3A 5T5QA 4X64B 2AFHE 1XDZA 1LWNA 4XJTA 4YASA 2V45A 3OOHA 5EJMA 3FOFC 1QZXA 2QQFA 1I0IA 5JS1A 1YB1A 3G89A 3MOGA 4FGJA 2YFYA 3H2JA 4IG4A 4LJAA 3CR3C 5I7WA 2Q7XA 1NF2A 5KWIA 3N2LA 1S2DA 1Z74A 3DBRA 4BN5A 4R81A 1U8UA 1JU4A 3MA0A 1ZM2A 4X95A 3KPJA 3A8TA 1NUUA 3ONWA 1PJLA 1H1LA 1RFGE 1YRBA 4OA5A 1IBSA 4TYQA 5C1IA 1UEXC 3L8DA 1P0IA 2NUAA 3TSOA 1PJTA 2IYWA 3F71A 3B3AA 3FCUB 3IEKA 3AC0A 4REMA 4N49A 3FTEA 2CVQA 2EBHX 1MOPA 1ORWA 8LDHA 5H83A 1FB5A 2HK7A 4I3HA 3W7AA 5JH7A 2PT5A 3ZI4A 1UM8A 4JEUA 1PFQA 2I78A 4ZEOA 3A2MA 4URXR 2ZU6A 1WA5A 4FBLA 4G1VA 5JAZA 3T3PB 2QV0A 4MCAA 1ZM3A 1TJ3A 1O96A 2HC9A 2XLCA 4L50A 4M0UA 4TMZA 5EP2A 4D3ZA 5AW7A 2SKDA 3VHLB 1H2XA 5I5GA 4ZC1A 2M32A 4D8YA 1WDLA 2XMCA 2CNLA 1Y9ZA 1QFSA 2W6JD 4X6UA 1TQ4A 1I2AA 3K8OE 5FCDA 4M6WB 3RTGA 2JD1A 1U4NA 4NNJA 3HJNA 1UP6A 2PH7A 4HEA6 4IMIB 5EKTA 1J97A 1Y42X 1OH5A 4BDTA 1Q20A 4QYIB 3FCAA 5CBKA 1Y4UA 2HRZA 3CLSC 1KNQA 1XCLA 3RB8A 3SHOA 5IJ9B 4ZVLA 3WR5A 2HKIA 4DF3A 2HQOA 2WG0A 2AD1A 1Z13A 3L2OB 4U7GA 3V1LA 4BFWA 1TYCA 2PBZA 1D6NA 3EJWA 1FNMA 4RENA 4I1PA 4Y2TA 3HFRA 5JMPA 4KXFB 1KSHA 4DGSA 3VVLA 1F2TA 1DIGA 1FU4A 4GXRA 2PL1A 1GLNA 4YRKA 1VE3A 2HEGA 2XQKA 3ZKWA 2LKDA 1YZUA 3SXUA 1UC8A 4HNSA 3H1TA 4ZT5A 2V96A 1WLYA 1ZD1A 1ECCA 1LS1A 4M9SA 4NS1A 4BKOA 1PT7A 5DHUA 1U1CA 2VHUA 4WV3A 3W7VA 1I1HA 3TW8A 1WPQA 2BW0A 2QRPA 4UCQA 2ETXA 3DPIA 4JC5A 3SZGA 1GKIA 1P45A 3TIVA 3WB1A 1ODKA 3FPLA 2ZIZA 1SCKA 4B80A 3Q6NA 1HZZA 2A30A 2PGNA 2GTPA 2Q3JA 4RMJA 1C7EA 4K9NA 4MLZA 5FBWB 1EZZA 3WGOA 2RJ3A 2Z1NA 3G68A 3IMCA 3BKWA 4RU1A 4HNRA 4PGMA 5LYJA 3VPCA 3T1NA 1EXDA 1AOXA 4G89A 3F5DA 4L6CA 4ND5A 3STTA 3WL6A 1ZCBA 3OMWA 3CKMA 5I01A 1M8GA 2EIHA 3QENA 4FGUA 1OYYA 3U3MA 2OC4A 1RJGA 4MVJM 3EPLA 3T94A 1XEWX 2EP5A 2OHFA 3PIRA 4Q1AA 3WK5A 2FN7A 1J49A 2GZ3A 5EOVA 3TZQA 3RFVA 3Q15C 3IOMA 4QBFA 4N7BA 1B43A 1FA9A 2HRDA 3I64A 4ZO4A 3M81A 5TPZA 3FF1A 4LXHA 2M6LA 1JHDA 1Z12A 3MJHA 1U8YA 1O0BA 2BM1A 3EWAA 4V3BA 3M1IA 3IODA 4U2EA 1ULHA 5IARA 2JIZA 3QPUA 3TZKA 3MQFA 1U28A 1SCIA 1T0JB 2BE9A 4WAUA 3ERCA 3JZMA 4GMDA 1ULUA 3P0HA 2PUVA 1ISGA 4TMXA 4I50F 3E9YA 3NUGA 3NANA 4ZVNA 2XXAA 3WISA 3FUXA 1UJMA 2RC5A 3PUIA 3IDFA 3D6HA 4HSGA 3DCYA 3RAPR 1NOKA 1PG5A 3TOXA 3DM5A 3U4DA 4DPMA 1TGYA 5I8PA 5K4GA 1XEAA 2WM2A 2PGJA 1G20B 1FC0A 2C2HA 1P61B 3BB4A 3NFRA 4OF4A 3T3DA 4YRZA 1MA3A 3PPYA 2WUFA 2WIBA 5AK5A 5IYZA 2PO5A 1P62B 1SWWA 3RK0A 1CUSA 1S3GA 2HEIA 3N2KA 4X41A 4XD7A 4F5WA 2BSAA 1BC5A 2VSXA 3NAQA 5E2BA 1Z2DA 2CXTA 1GQYA 2G06A 2IBMA 2H2WA 3KUCA 3L4SO 3U3OA 3NTXA 2X76A 1KYZA 4WSOA 4D74A 2R7MA 1K9VF 1XL1A 3AY6A 3DD5A 2G67A 4DQLA 3B78A 2GX6A 3GP3A 4PSVA 5AVXA 1GPKA 1PDWA 4ERXA 3AEUA 4OQNA 2F6RA 4JJ7A 4I55F 1MT0A 1ZQ9A 3LUAA 2C3UA 1I7SB 3QX7A 5IJZA 3V1UA 3N8IA 5LM3A 2DEUA 4NI5A 1U2QA 1KY5A 2HA5A 4EPYA 3TFQA 1K6XA 2JRCA 3D7NA 3UC5A 3GJ5A 3PA6A 4EAQA 4INJA 5LDDC 3FTCA 2HU8A 3AQ4A 3BFXA 3QU9A 2H1VA 4H27A 3TMAA 3GJZA 2C83A 2DR0A 1GRRA 1XU9A 2J59A 3AESA 4L07A 1L5FA 4F2DA 1NLFA 4DUGD 3H9QA 1ZZEA 5CD9A 5CYGA 3GPLA 3L79A 4WXEA 3RTAA 4MZDA 2OXRA 2PMFA 5GJVC 2IDZA 4HQRA 2CZGA 3JAKB 4ZWNA 1SHUX 3BMNA 4FI3C 4QDJA 4W9MC 2BLNA 2UVDA 3OLQA 4LHXA 1DO2A 3EXIA 2AC4A 2WU3A 3VSBA 1XDDA 2FEOA 1JSLA 2QF7A 3LPMA 4RESA 3W8FA 4QJ3A 3DDWA 3W2TA 4F3YA 2ZM5A 2RGBA 4LF8B 5E3IA 4K2HA 4LWZA 2VA8A 1XVAA 2NO5A 4ZI7A 1Z6ZA 4AN0A 4PWZA 1FMFA 4RE5A 1H2HA 2HNAA 3P19A 5LMNB 2QMOA 4I81A 5KBYA 1P6UA 1IBRA 1NQOA 3Q0TA 2R5NA 4OYRA 4R7ZA 5DW3A 1DAKA 1E63A 3TG2A 3BMCA 1XD8A 2A0XA 4NK4A 3PL5A 3W3AA 3X2FA 4OY3A 3PJGA 3FSGD 4LSMA 4AY2A 2BDTA 3L4BC 2AUNA 4MUIA 5LZ5A 3VH3A 5FT9A 3GDOA 3GRFA 4UE2A 4M9RA 3CUWA 5EESA 4AUMA 5B7GA 1Z37A 2HR1A 1AG9A 3NVDA 1U4OA 2XTAA 4PZLA 1KY3A 3R3HA 2HK6A 5CCDA 1LQTA 2VI5A 1N2HA 1E66A 2X2EA 1E96A 3ANLA 3LBYA 2PXCA 4FMCF 4LVOA 1QHHB 2B7CA 1EZ4A 3I04M 4M9UA 2WYVA 3L06A 2Y6UA 5GMOA 3S70A 1YZKA 2XLBA 1D1QA 1XHLA 1H0HA 2QI9F 4LZWA 4Q4AB 5B58T 3NIWA 3COJA 4CF3A 3F5FA 1CP2A 2RHTA 4S0ZA 4YIKA 5T8KC 4GH5A 3GC6A 4QM6A 2DUUA 2EG9A 1YT5A 3HL4A 5CT4A 3P5BA 4MCJA 3ABQB 2VAMA 1JL3A 4DLBA 1TO1E 2XW6A 2YJTD 4JP3A 3LUCA 1BKDR 5EPUA 1X1DA 4BBAA 1O8CA 3ZC3A 3GFQA 1D2GA 1Q2UA 4R2WA 3RS3A 2XPCA 5EJGA 3VUEA 4ANFA 3GLFB 1AZWA 5C4MA 3OQ6A 2R11A 3IIMA 4R9SA 3CE9A 1WM1A 3IKMB 4DCPA 1J2JA 3KPUA 3PDHA 2PO7A 2P2YA 2HU5A 2V3WA 3D8BA 5A2QA 1XEXB 1FJGB 2ZBGA 1GPDG 1W1WA 5DBEX 2XB2A 2PLRA 3K72B 1HQCA 4UC0A 1J8VA 3D4IA 3E9DA 1ZJ5A 1ZLXA 4LG1A 3L93A 1IEXA 3KV1A 2P5YA 3EXFB 3CM0A 3GJ6A 4JVLA 2IEZA 3KQMA 4JJKA 3U7RA 4DM4A 1HG1A 4BEWA 3F8TA 3RS7A 3EDMA 3UK6A 1U0GA 5FV4A 1FTNA 2QENA 2OHXA 4R3UC 5H5JA 1YTUA 2O2YA 4JYPA 1YZFA 2GS9A 2XBLA 3GEIA 4M86A 4AY4A 2OAQ1 4B7XA 4LWOA 5K05A 2ATIA 2WRZA 3OP4A 3H7IA 1MOQA 3I34X 4G4IA 4ZJPA 4QTXA 1UL1X 3OWOA 1HNZB 1NY6A 2VDQB 3AUSA 3V8VA 4KCGA 1TKCA 2ZYVX 3DCJA 4ZCIA 3W5VA 1TF7A 3BFVA 1X74A 4XD2A 4X1IA 5BO5A 5K8CA 3ZDDA 3SM9A 5DTMA 5CA0B 3SHWA 1YC5A 3C39A 3K09C 5EQJB 2EIXA 1KFKB 1PE0A 3K0EA 4ND3A 5CVCA 2QSJA 4C29A 2JLWA 2OD9A 1NTRA 4WGGA 2BP7A 3WB9A 5CM9C 1CRPA 3HKCB 3H2GA 3BIJA 2X6TA 1AB6A 1BA3A 2L17A 4L2IA 4YLGA 1T8YA 3GGOA 4YJ2B 3VZCA 4UREA 4C0HA 1ZNWA 2Q6LA 1QGDA 4FYXA 5IN4A 1P2UA 2PQMA 2VR1A 4GZ5A 3E22A 3ESCA 4X93A 5LWQA 3Q8WA 3E1SA 3NRCA 3X1XA 1U5BA 1B00A 1L3IA 1RW4A 2VXOA 3I9V6 1QC5A 1R0CA 3FUUA 3UMSA 3CCFA 4B6RA 5KWSA 4EJMA 1TEVA 4ZA2A 3ER8A 1D07A 2WJPA 4G6ZA 2COUA 3SC2A 3D6MA 3TLGA 2COKA 2NVOA 4MGZR 4F56A 1CZUA 1OC4A 1L0BA 5B37A 5G4KA 4Q3DA 1JLSA 1TXGA 2H4HA 1ECLA 4LGYA 4WKGA 1WB5A 1YCDA 2N47A 4NFYA 1M10A 1ETHA 1DPFA 2ILTA 3EULA 3NG1A 3E7PA 3IE2A 4BNWA 5ALZA 1G38A 2JLRA 1VPEA 2G70A 4RY2A 4QATA 1AQUA 1WNFA 2WAXA 5B57C 3WQSB 4HY3A 1JQDA 2K7FA 2DXIA 1RRPA 2GPSA 2AOTA 2RC6A 3EJ6A 3FKSA 5ALVA 5CDGA 1N7HA 3ZG6A 2OKGA 3EVNA 1UDCA 2FX5A 1Z28A 2W6CX 2ZBUA 4OG2A 5ERGB 3DUFA 3JVIA 2ZT5A 5JXIA 1FMJA 2QDXA 2HD4A 4OHZA 3HI6A 1DWUA 4DCSA 1VBFA 1HK7A 1QAOA 3R75A 1Z26A 4E6PA 1F1JA 1GGEA 1L7BA 5THXA 3L4KA 4S12A 1IUKA 4KU4A 1J1UA 2WK1A 4EZBA 2FW1A 1BSVA 4ZEMA 3T3EA 1IZ0A 5BV7A 1P2TA 1R0BA 1SU7A 1NW6A 4HI0E 1HNNA 3ESQA 2AOUB 4AO8A 5FUWA 3GP8A 1D03A 4ERNA 5CT9A 2JA1A 5JCJA 3DVQX 2FPRA 2ZXFA 4I4TB 2NVWA 4V0LA 4UJ5A 4GRDA 1JNYA 4GKJB 5LYJB 1FS4A 1JMYA 2FMTA 2XZPA 4GO1A 2NO0A 4U0KA 1XQ1A 4H4CA 2RJOA 3EF1A 3MLBA 3PXBA 3Q5DA 2HMTA 3MM4A 4KGDA 4N3AA 1P2FA 4R41A 3NJ4A 3WLAA 4CG1A 1Y6QA 3FN4A 5HDQA 3IUNA 4CQMB 1M2VB 2Q62A 2Z9CA 4DSUA 5LD2C 5AOVA 5E6RA 1C50A 4X6YA 4IJVA 1QO9A 2J5BA 3QKWA 4TYPA 2QTVA 1M74A 1R37A 3GQBA 2B8TA 5EXTA 3PNBA 4RO0A 1I1OA 1MRSA 2NOAA 4P3PA 3SXUB 3O4JA 3OZSA 1CZRA 1U1IA 3JQQA 1KKMA 3JWHA 4MJ7A 4NPAA 2VJQA 2H1SA 2WE7A 1LNQA 3KLPX 3RPEA 3WYFA 1XLWA 1UM9B 2Q46A 3H9JA 1SA0B 3OTQA 2OQVA 2ZJ2A 1UK9A 4DLKA 3AXSA 5JBQA 5F21A 1RWQA 1L7OA 1DQYA 2GZAA 3M9LA 3I76A 1E6MA 4QHSA 1ISFA 3AXTA 4EFMA 3UIEA 2DC1A 4XTCS 3AJ8A 1L4BA 3H83A 4IJWA 5HF9A 3GMIA 5AI0A 3JXEA 5I47A 3DZFA 2IVFA 1IN7A 3U5TA 2ZP1A 6CHYA 1JF8A 3RRNA 3HV2A 1RC0A 1C9JA 2Q6IA 4U3JA 1H2AS 4FWBA 1JIQA 4YR9A 4O2BF 5IJ0B 4EW2A 3AP3A 1EVYA 4LRTB 1L5SA 2YOFA 3UANA 1KKLA 2LR0A 4FDAA 3IPXA 4TMKA 5FAKA 1OIXA 2RBEA 4NZ9A 5EL0A 1B6GA 3RVOA 1ZITA 4F4DA 5B7PA 3KB2A 3C6QA 4KB5A 2VQDA 3CUKA 2FUKA 2ZK7A 2GH1A 4JJ4A 2DBZA 4FHCA 1UK6A 2QNIA 1T35A 3GLGA 4ENRA 4FD2A 1SUBA 2FEWB 4S1WA 3LS2A 2MR6A 3M1LA 3JD1A 3P9NA 1FMLA 2KE5A 4V0MA 4CQNA 4HX9A 3ZY5A 2HT6A 1REQB 3TSCA 1DQNA 1LKZA 1RWOA 2CNBA 1SIBE 3OX3A 4TUYA 3C16C 4X54A 3GEPA 1CDOA 4MAFA 4RK6A 4C6HA 4EDFA 2I5PO 4Y6RA 3W5SA 2DBRA 3CLVA 1WABA 2FF5A 3TSZA 3U9SA 2WMDA 3HUTA 5KQMA 3V4ZA 1GTJ1 3RYIA 2V4UA 4KXWA 4ZQBA 5KTTA 1IUOA 1L3BA 2VPQA 3HXLA 5C37A 1W8DA 2R6ZA 2QD5A 3IIJA 3L92A 3GNLA 5D86A 2JAOA 3AI3A 4ND8A 1WCXA 4FSXA 4R16A 4RD1A 4DZZA 1FLAA 1CYDA 3A4IA 4X7RA 5HKKA 4DLXA 5EP3A 1M33A 3A1VA 1DX9A 1GP2A 4PRZA 3QW2A 5J5VA 5LQUA 4S35A 1DC7A 2RAFA 2VHJA 4HDKA 4ZANA 1KC1A 1U3FA 1T36A 4B4VA 4DMCA 2QRJA 3U31A 4Y18A 1U0TA 2QU8A 5FWXA 2PYDA 5ELXA 2Z6AA 1LTQA 1V1MA 1ZUD1 3PCXA 2WJGA 5JDCC 4KDEA 2AN4A 1T9ZA 4HADA 1VJRA 1U4SA 1IY1A 1SC4A 3JVUA 2FRDA 4RC9A 2HJ9A 3W6UA 1Y8ZA 1E2EA 5AJUA 5LB2A 4EKYA 3N9IA 1UT8A 4Z1OA 3BH7A 1FTQA 3A26A 3O2NA 4IVQA 4L4XA 3KHTA 4BNXA 5HFAA 3OZEA 2NW6A 5JZMA 2RGRA 2QUIA 3FETA 3JARB 1MPTA 2CD7A 1J9EA 3D8HA 3GPIA 3KJQA 1P0FA 4FC6A 4K46A 4Q7JB 4D43A 2NV0A 3ABZA 3X2SA 4IGIA 3V2IA 1JE0A 4D4GA 1Z6YA 1CDZA 3DGEC 2PAAA 3SE7A 4YAKA 1QGOA 3K9FC 4YPOA 1XCMA 2FA9A 4MGIR 1V3QE 2J87A 3QV1A 4KYUA 4Q4HB 1TJ5A 3QBJA 5C9ZA 1E2BA 4FEEA 4H1VA 1XZGA 5CX1B 5U9CA 1G64A 2VJAA 3ZCXA 3LQ1A 2Y76A 3B70A 3PS9A 5DHTA 3WWCA 4EHJA 1XIVA 5H70A 4TXHA 1RM3A 1FFBA 2ZIXA 4A8TA 3K0AA 4NKRA 5DNWA 1EJ2A 4GS5A 1EDDA 1XGKA 2JDIA 1GLGA 1CQJB 2I3BA 1G6HA 3RARA 4BV8A 3JASB 4JT4A 4F0JA 3X1ZA 4AN1A 2HXSA 3OAAD 4IGKA 1QCYA 1L8AA 2BZGA 4C6TB 1GKKA 2AC7A 4GPIB 2WUEA 5IDXA 1O1YA 1YE8A 2NXNA 2O3JA 1BKSB 2YHUA 1QPGA 2I0FA 5DI3A 5BWMA 3UB3A 3EC7A 4HUJA 3E7XA 2SCUB 3TW8B 2XI4A 1VYTA 4D6YA 2Z95A 1MEEA 3U4GA 5A5VA 2WJ4A 2WZCA 3OPNA 1VIDA 1KE1A 1TMOA 3W34A 4AZWA 4WKNA 2M6KA 3FSRA 3I8OA 5CX1A 2XTJA 3L8MA 4G1UC 4W4TA 3T4EA 3DMGA 2X8BA 3WGHA 4DSTA 1NUTA 4JSTA 3S1AA 3I12A 4RDIA 1L5MA 2NVBA 1M6VA 1QTNA 3KX2A 2VAPA 4MLCA 1IN1A 1UWVA 2R1VB 3NORA 3OCCA 3TL2A 2Z5FA 1IIRA 2W83A 3NTLA 1D6MA 4ZZIA 4IFTA 3F4LA 4QXRA 4X20B 5JSFA 4NPHA 5MGNA 1IBCA 5JCOC 2FPIA 4IFEA 2Q3BA 3V2HA 3BHNA 3MJEA 4KE9A 2MCFA 1PLJA 2YDYA 4NFLA 4EG0A 2Z3VA 5D2CA 4HNTA 4TLMB 2W42A 1X7XB 1EP2B 4KYTA 4XWGA 1W49A 2I2FA 2FSGA 3FWHA 3MWYW 1O8BA 4IEIA 3NHRA 2GNPA 5IVIA 2KWIA 3M9XA 4MVCA 4OLBA 5DX0A 1E2PA 1PK9A 1QX4A 3RS2A 1WCV1 3FXAA 1G1MA 3TD2A 3OUZA 4ARVA 3CBGA 1J20A 2VHTA 3G0IA 2QL7A 1DL5A 5CHYA 3EQ7A 1TF2A 1LJLA 2JPDA 3BB1A 1GZ7A 2VWGA 2XNHA 3UOGA 3F98A 1LSUA 2ZYSA 1D1TA 5KNLA 1YBFA 1Q7GA 1AUOA 1D4ZA 5H0IA 1ZUHA 1RYEA 2YVQA 2WSIA 3BGDA 5KOJA 1AU9A 2O3RA 3F2IA 1MJGA 4J3JA 5EERA 1Q95A 3V3KA 1ZMTA 3JD4A 5KCZA 4BE7B 4E88A 3L40A 4FBGA 1RKUA 2J9ZB 3AF4A 4C7XA 1NPTO 7MHTA 2PZGA 3LBFA 3LYHA 1XQ9A 4ZK6A 1U2ZA 5B3JA 3VKUA 5JNSA 3KSZO 5AVYA 1LI7A 3ZLTA 3KKOA 4H16A 4GLJA 5KWVA 2G77B 4PC2A 1AKWA 1JFSA 1IJEA 3DFUA 2CFSA 4ZXPA 1RPJA 2ASVA 3PNVA 4UTZA 2XX3A 2AQ8A 1J2RA 3VNVA 1WU8A 4RIEA 1NXQA 3IEPA 2IZ6A 3QWIA 4OQQA 1C0PA 4EUSA 3B9PA 3VH1A 1T10A 3IALA 3B85A 3V8QA 3T34A 4G65A 2JZCA 4I9NA 2Q5EA 1KEKA 4MAAA 4LHYA 4GMFA 4D5GA 2Q1TA 4JDUA 2VJOA 5D5HA 1FYDA 1WUHS 1QRTA 5HYVA 1CC1S 5DBIA 4W7HA 4NV3A 1HEUA 1NXOA 2PU5A 1C3XA 3GA7A 3M4JA 1FPMA 4MV9A 4AZ3B 4TYYA 1KEPA 3Q3EA 2F3UA 1YOVA 5FTWA 1W59A 3N53A 2WHXA 4Y2QA 1K8RA 1JA9A 2QZSA 4CF5A 3C0KA 3AF6A 1F6DA 1WF3A 3GA5A 4EYQA 4IX9A 4WINA 2M6RA 1X7HA 2PPLA 1YJAA 2ZTUA 4KX3A 4UUQA 4IIXA 1KDVA 3WLIA 4KPEC 1AQYA 3HG7A 2BL4A 2IW3A 3NHAA 4GWKA 3DE0X 4MKHA 1ZU5A 1S2OA 4ZI2A 2WHPA 4LN1A 1QDUA 4CFZA 1ULZA 4GYKA 1V11A 4I2VA 4PHTA 3ND7A 4JROA 1PFVA 1S01A 2F3QA 4R5HA 4TOIA 5FPSA 4KPYA 1SC9A 2WWYA 3Q7IA 4O4JB 5ALEA 5LLTA 2NAPA 1DHTA 4D8TA 4JT9A 1FFCA 2Q5JA 2A59A 2DUWA 1KDPA 2ZOSA 2X7XA 4Q7MB 3N76A 4R98A 3FG9A 4MMYB 3THYB 4RQAA 2PA3A 4R2XA 1X9IA 3G0BA 1KJ9A 3T7EA 1L5YA 1UJ6A 3GJTA 1CLEA 1LF5A 3MWGA 5EP1A 4C7KA 4DQKA 4L74A 4LVUA 5ANRB 3QVXA 3SVTA 1P4SA 3HU5A 2OP0A 3TZ6A 4M54A 1UAYA 2XKKA 1H93A 4MDEA 2OCLA 2GERA 2CEAA 4AT1A 3LLCA 4F92B 1GCAA 2ZUUA 5KPDA 4LFAB 4BU0A 2HFKA 2F59A 1Q57A 1BVHA 5K03A 3LUFA 2ZSBA 3H6KA 4TKZA 2WNIA 5WRFA 1T0BA 3EOBI 2VDRB 3WIBA 2HA4A 3JY6A 2XUFA 3FA2A 1US8A 4CQLA 1UMKA 1UKAA 4JJGA 2G5GX 2ANCA 3QBVA 1JU3A 2WIJA 3MB8A 3R3XA 4L0MA 1YK0A 3EY9A 4WN9B 4GOXA 5EKUA 2Z1DA 4M1QA 4OLFA 3ZX5A 2W2NA 3M49A 4DMGA 1YRWA 5A3QA 2UKDA 2ZPAA 5LB4A 2A0YA 2GZRA 4BMOB 4H59A 1P2DA 3CA8A 3OCWA 3QVJA 1VYUA 3LC1O 1MC1A 4HQFA 4NATA 1OXVA 1T3LA 4IDAA 4POAA 4ZU6X 1AZTA 3E9CA 1C5KA 3D3NA 4HPJB 1FTYA 3U39A 2CLOB 4QXQA 4HWGA 5LZ7A 5IUNC 1D0IA 1NU6A 1G4AE 5MFZA 3ILVA 4M0DA 4IDQA 1WUTA 2XJ4A 4HFJA 4Q1BA 3WIVA 2IBTA 2JLVA 3VNUA 1T6XA 3UJ3X 2AOVA 1JXMA 4FFWA 2PSHA 4FIZA 2B8EA 3EXHA 2AXPA 3FDJA 3L0SA 4CIYA 4I1SA 4NEQA 2WILA 3TXXA 1H94A 3FYSA 4L0DA 4OGFA 4CTJA 4A27A 5BQFA 3GUVA 4DIFA 2VPZA 3WWYA 3PQ7A 1XLUA 5KZMB 3ZE9A 3BZUA 1X8JA 2IYQA 1CEQA 4ALNA 4WZAB 2CBZA 3GRVA 3TIFA 1D2EA 2R7KA 5TXGA 4MDFA 1B16A 4HJRA 1PR0A 4KMOA 3X0DA 4UAVA 1EP9A 3UT6A 3SMVA 1RJ9B 3OLYA 4R1TA 3RSHA 2A5DA 4E3ZA 4OMDA 5K3BA 1P3DA 3EGXB 2G7MC 4REQA 1UXOA 3NHJA 1J2YA 1VDZA 4NWIA 5DWQA 3WB2A 1O5IA 1MAVA 1NE2A 2W4QA 5J2TF 2HMAA 3CZRA 1QRAA 1ESZA 1M6YA 2VATA 1KOJA 4OHRA 1EM6A 4QL3A 1YA4A 2PQ0A 1ECFA 2HHLA 1Z5NA 1IWOA 2CDBA 4DLAA 3LC7O 4X5OA 5AXAA 1H3EA 2X22A 1PT9A 2Z9DA 2VNSA 4XD7D 1G4HA 5DX1A 1P5HA 5KDLA 1NR7A 3R23A 3TDNA 2CY0A 4KX5A 2ZCJA 1YMVA 4LC9A 2C7OA 1QC5B 3FUTA 4OGLA 2ZTSA 4ZAGA 1EK0A 4PIPA 1AMUA 4BPRA 1YZHA 1NVAA 3THWA 2BMAA 4ZT4A 1M7BA 5EIBD 3MWDA 3QUTA 5CH5A 9GPBA 3I0MA 4KSCA 4P82A 1CUAA 2WG2A 1UWLA 2PZEA 1MVLA 2H9YA 3DMFA 3M89A 4M22A 1SVLA 1QH1B 4O02B 4OHYA 4RMHA 2OB2A 2RHHA 2GYYA 4GWLA 1J1ZA 2UUOA 3AEZA 4P86A 5K0CA 3WAJA 1VA4A 3OIWA 3W90A 3IP7A 4RORA 3AEQA 1M7GA 3QE2A 4Z0PA 1Y6FA 1T2VA 3D3JA 4P22A 3WK9A 2AX4A 2C1EA 3CVJA 3WRYC 3FAKA 3SQNA 1NL3A 1NZDA 2ENUA 5CB8A 5A3JA 1N32B 4REQB 3ZVLA 4R8MA 2WTAA 1MC4A 5A9SB 1ZNZA 5J3JA 4OXIA 4DJJA 2Q1YA 1AHNA 4JU8A 2GWHA 1KO4A 1Z16A 4OHBA 1OILA 2Z8YM 3K30A 5AYVA 5J2UF 1XEWY 1ULTA 2H5JA 1E9BA 3DFIA 3FYTA 2Q29A 4B8ZA 2TMDA 4K7JA 5AXDA 2FY8A 2LVBA 2PFKA 3VU9A 4EKNB 1V16B 3AVUA 4BQRA 3NPAA 3FFAA 3BSWA 5IZ4A 3DOCA 1YDHA 3KD2A 1GFIA 4NBVA 4N4AA 3TNYA 4W63A 4QHTA 1C1DB 3RJZA 4Z53A 2DFKB 2OBFA 1NQWA 2X6QA 3C3BA 4JP8A 1P31A 2WTMA 2F3SA 3BGIA 4X3PA 2FSHA 4NJMB 1T9CA 5HWSA 2JFZA 121PA 3QLEA 4YXFA 1LDBA 1Q83A 4YT4A 2AHRA 5I9SA 5DGIA 3S7TA 1O54A 3HYNA 4AMGA 3QI7A 2B0JA 2CHFA 1QNFA 1X2BA 2HGSA 2IPAB 4UUNA 3BFJA 8ADHA 3V46A 3SJ7A 3TLMA 1BOOA 1WWKA 4EQ6A 3A9RA 3GT0A 1SXGA 1Y7PA 4P58A 1T4MA 3R9XA 1YKFA 2I34A 3LHSA 2ZXEA 3E8SA 1SA0A 2IPMA 1QPZA 2PLAA 4F91B 5LKAA 2VF7A 4ZCPA 3EZNA 3L6RA 4RPKA 3VDMA 4IQ0A 2EP7A 4OM8A 2KYRA 3L1HA 2RG7A 4IUDS 2IODA 3F6EX 4TVSA 3ZCUA 1E60A 1SQ0A 5FHQA 1GAJA 4INZA 5IVKA 3HVKA 1YNSA 3K0CC 5GJCA 2Q5HA 3RUDA 3X1KA 5IXJA 3R09A 3BWMA 4NZYA 5G1PA 5FNVA 3L6OO 3IDZA 1U90A 3OA2A 4CMBA 4YRJA 4DLUA 1S7GA 4DCOA 3EZ2A 1KK3A 4B6QA 3L5KA 3LM8A 1EFLA 1RQGA 3QOXA 2OSVA 2IOFK 3CRVA 3GVCA 2WPDD 4S3MA 4UQPA 1KOLA 3VNSA 4LOJA 4Z3KA 4KXMA 2YUTA 3WMXA 3X1JA 1EINA 2IXFA 2OEPA 2FHSA 5K0NA 2ODAA 3G9UA 1DRKA 1AD2A 4UD6A 1V9LA 4PR3A 5CLLA 3V4LA 1JBEA 5FOVA 4D4LA 3JAWA 1YCHA 1MO6A 4KQJA 5LMUB 4MUJA 4XIYA 2C61A 5DX8A 2PBFA 2AEEA 4ARIA 4FT2A 2BR3A 1WZCA 1E3JA 1KK0A 3EYWA 3ZLJA 3BJMA 5COQA 1YZGA 1SVNA 1S3IA 1LVGA 2B99A 2G6BA 4WT7A 1C9DB 1N8KA 3LRXA 3ZQUA 4ER6A 4ZI7B 3DC2A 2AMVA 1JDBC 2B4QA 2OCXA 2GEJA 1Z39A 4M0FA 4LNAA 3P2YA 4BY9E 2ZB4A 2K6GA 3FHOA 2BEJA 2GK3A 4HDAA 1KVQA 4FZ5A 3RWMB 3SDSA 2IU6A 1TZBA 4QKQA 2LDBA 2BKUA 1MRNA 1T1RA 5A3SA 3UQYS 4ZVOA 5DF1A 1BX0A 1VHJA 2A94A 3ETGA 1G98A 1ORTA 3QHQA 3HB1A 5KTMA 1PGOA 3NTRA 2XCLA 4GR9A 4ENSA 2G88A 3C97A 3G7NA 4XX0B 1DC3A 2FEAA 4LDJA 2IGBA 5ALIA 3RHTA 1T4BA 3GB9A 1CY0A 2UXBB 1JB9A 2F9MA 1PFGA 3IP1A 1BCRB 2IZOA 2WAYA 3CU5A 2FGKA 4J7UA 2Q8QA 2P75A 1L5RA 2OMEA 3DBOB 4FZRA 4P0PB 3J81A 4H15A 2IPOA 4GXQA 1ZXBA 2DJIA 2YH2A 3IPLA 1J0BA 4ID9A 3KQQA 4JFAA 4YRSA 3JQDA 4KODA 5H82A 1PUJA 1NVFA 4JSRA 4WOCA 4WBNF 3H9GA 1R12A 4I9FA 1J1IA 1DG3A 3U49A 2OOKA 4XDYA 1R7RA 3ORYA 1WKVA 3ZV6A 5M29A 4Q3OA 4B46A 4JQCA 4EX7A 4DJFC 1D4OA 2PKXA 3CR7A 3RFXA 2JHFA 4XUGB 4Y7DA 1ZX1A 1PJCA 5D1HA 3GOQA 2C78A 2VYQA 2X9VA 2ZYUX 1GPNA 1M6HA 3B9QA 1P9OA 3BWCA 3CINA 1M1NA 3K16A 3KWJA 4IXDA 2Q9CA 4RGQA 4C0WA 4DNOA 4F6CA 3K70C 5CW1A 5JU6A 1E1RA 4L2IB 1U1GA 1NT2A 1KFJB 1RYBA 5AM4A 1E8DA 1GSHA 3MAAC 1NULA 5F7ZA 2FMHA 5JASA 5HCUA 4A7PA 4F93B 1U7DA 4AW9A 3UMMA 2HK9A 2V9ZA 2X7HA 4YXWA 3U3KA 5J2TA 5LQCA 1U3CA 2HWUA 2Q3MA 2A78A 2ZYIA 5HM8A 5JARA 1QQAA 4P08A 5DULA 2OM6A 3D1VA 3BKXA 4DWVA 3PTLA 3VVCA 5ARDA 1TT7A 3DLBA 3B9BA 1WCYA 1RI3A 1TKRA 1BGWA 1OASA 1TD9A 1L8XA 2VTVA 3TKLA 4B33A 4L85A 1JDZA 1N5IA 3L0ZA 1A9TA 1TQ6A 3C7KA 4KUHA 2FW0A 3SU8A 5JXWA 1JEYB 4GR4A 1TYEB 3C7AA 5TPWA 1XZBA 1OYVA 4RKFA 1O4VA 2P67A 4WY8A 4YRPA 1TEZA 3A2KA 3FZYA 2IE0A 3E18A 4GXTA 3Q3HA 4CHGA 5FPKA 4YV0A 4RHEA 4CMEA 4ZVVA 2UYQA 2WU0A 1RM0A 3FVWA 3HU3A 3M3HA 1DBIA 4Y9UA 1XCPA 3I2HA 3JU3A 1G2OA 1YQQA 2IUYA 4EWLA 2JVJA 1ZGJA 3H42B 2EU8A 2D06A 3P9CA 4J4BA 2Y1LA 4Y1EA 4RZ2A 3EUEA 4OXYA 1JQAA 4QQRA 5F12A 2HNBA 2LCIA 3H1AA 3I05A 2IXAA 4W5HA 5T4EA 5DNVA 2DUJA 1G8FA 3A7EA 5ILGA 1SXJE 3AKYA 2CLHB 3HI4A 4MRNA 4Z3OA 1UMBB 3HCWA 1DC8A 2R7NA 4UNIA 1XWWA 3ZD6A 3A6PC 1U0JA 2NYVA 3GRZA 4R31A 5AKZA 1QF6A 1A0OA 1W73A 1F8YA 2Q3DA 5M5BA 1YE3A 2VT3A 1F38A 3KVOA 3VV3A 3O91A 3KTAA 5BSVA 5FPPA 1QQTA 1NY5A 3QBDA 2ZJBA 4ZGGA 2WKPA 2L82A 4US1R 5T4HA 1YQDA 2XUGA 3ZWNA 2BBWA 2HI0A 3N7AA 3G2MA 2ZQZA 3AUTA 4M36A 3HBAA 3BXXA 1MLDA 3IHTA 1W29A 2ORVA 4PICA 2C84A 5AUPB 4AJ4A 5B4UA 1AUVA 1ITZA 2BELA 2EWVA 5KSPA 3D8RA 3RU7A 4BAZA 4EITA 2QTWB 4QG7A 5H4GA 1KAQA 4D9HA 1XRJA 4KR7A 4BAUA 3SICE 4BQPA 4PNEA 4TZ6A 2JGFA 3B5JA 4YO7A 4OLAA 3T0IA 1L4FA 4U2DA 1O94A 2UUCB 4C0JA 3KT0A 1YJCA 5LYYA 4I4CA 1QP8A 4HZUA 5DBHX 1A9XB 4C0SA 2XYVA 3R7AA 1BQ3A 4BCCA 3DL7A 4EY5A 1JJAA 5A5EA 5F5XA 1FU7A 2IY7A 3QITA 3PICA 3QELB 4WA8A 3IEMA 4B3JA 2BMVA 5DYTA 4EZIA 3OWXA 3GJ7A 1MJ5A 4B7UA 4MJLA 1Z4IA 4PFJA 5JD6A 3SMQA 5K6AC 4DBLE 3FTPA 2XUJA 5FTKA 4F72A 1A2QA 5AVVA 2W4IA 3K6RA 2CL6X 2PVPA 4DLWA 4AECA 3AF3A 4D0RA 1PNTA 2PRKA 3H6HA 4MVJF 2R8YA 1M34B 1CXZA 1LQ2A 2V7TA 3DNMA 3GEGA 3K9GA 3D31A 4P38A 3SBEA 1EXVA 5EUBA 4DR6B 2ZRHA 2AW3A 13PKA 2AW5A 1QWSA 3A6FA 3RU3A 3VKHA 2VJBA 3PZRA 1V4NA 2DBYA 2CVZA 1OMOA 3OLCX 4M8LA 4B31A 2PX8A 4FUQA 3U2QA 4DQXA 4EYOA 4CKEB 2VOJA 1XA0A 4A2WA 3DEZA 3PNYA 4IFBA 3QEAZ 5E4FA 5E7JA 4FMDB 3W1VA 3MUNA 4F2HA 1DC4A 2I33A 2EW8A 2P9GA 1ID1A 4JR2A 1E4EA 1HE5A 4MICA 4UATA 4KQ6A 2BKEA 3CCCA 1XCBA 5EJ5A 5LYJF 3E3NA 5JJKA 1ESCA 1NQAO 1FUYB 4I55A 2QJTA 3DOHA 3VQTA 4U7FA 1WDWB 3BRSA 5JISA 3RVDA 2WIGA 4OV6B 5HIJA 2J3EA 2R97A 1JTFA 3QNMA 5HZGA 1YRLA 1NJ1A 2VRNA 1CS4C 2IF2A 4L15A 4FHDA 1KMHA 4K9QA 2O8BA 2FP4A 2DGDA 3R7DA 2RHOA 4YJFA 1CY2A 1DQRA 4ZI5A 4BO6A 1H2BA 3BF7A 2E18A 4LOLA 5K8TA 1MC5A 3S3TA 5ALTA 2ZSIA 4ZOCA 5GV8A 3TEJA 2HV9A 2HIGA 1USKA 5EE1A 1AHHA 3F6BX 2YVKA 2RB5A 3AX6A 2WMYA 1RXYA 3T6KA 2WP0A 1QQBA 2DPLA 4G5FA 3UMRA 2X0EA 4DCVA 4WGFA 4OHXA 2TMYA 2XV1A 3CKLA 1Q0UA 1Z5ZA 2WOOA 2VDNB 4XYMA 4R2KA 4BP1A 4XTRA 4G0ZA 4YUVA 1KR2A 5F9MA 1KMCA 1ACJA 4KBGA 3B6ZA 3F3MA 3SF0A 3JQEA 1HDZA 2YW9A 4DCMA 4DNQA 1CJCA 1U1EA 3TINA 1YHYA 4PZPA 4L7QA 5KNCD 4QTTB 4WKPA 4HB3A 2A14A 2VYFA 4OJTA 2B2NA 4S2UA 3F5QA 4YJFB 1QHEA 3SHTA 4WZ6A 1HI9A 1WEHA 2V8BA 3LKZA 3V6MA 3IX7A 5MN4A 2J6BA 1XLVA 1NBAA 1ST3A 1QIDA 4V1CB 1ZK2A 4Q39A 3JQ7A 4BLVA 3LX6A 3DC7A 3ELUA 4WBNA 4FM9A 1J8MF 4WOKA 5IAEA 3WOVA 3N0XA 1G6Q1 3NYIA 1DX6A 1NKVA 5HMMA 1KZHA 4EHBA 1M83A 1KI3A 1UFVA 2IHJA 3DF9A 1VBMA 4HYEA 3ROQA 3FSGA 2B7BA 2DH6A 1L7EA 3ETEA 2VKQA 1K27A 2VNJA 3CLTD 5JUWA 5KU1A 2IDJA 4DAOA 3AVQA 4L5CA 1QBKC 1WCIB 4FT4A 3E2PA 4TL6A 3WKAA 2Q4DA 5G1OA 5K0GA 3DXFA 3V4FA 2LP4Y 3O3MB 1VKHA 5CXSA 3ROXA 2D1SA 4NONA 2GYUA 3LECA 2JKVA 4C4YA 4JT8A 2X4GA 5A62A 1IULA 1EH5A 1YKSA 3FTFA 3Q7RA 1DZ3A 1M34A 4JMPA 3C8MA 4PAQA 4CU5A 4Q4CA 5HUQA 4ZO8A 1TA0A 3D2LA 4UXHA 3TNJA 3COVA 2IGTA 1GAQA 2OWDA 5D3KA 3U13A 1AB5A 4RM3A 5KUTA 4OI4A 2IHYA 4HZIA 5F7XA 5DYNA 1T1GA 3V32A 1K4MA 3IQWA 2IELA 3OQNA 2W0MA 1KZ9A 1XRQA 4TLCA 2OBYA 2POQX 2FWIA 2NVUA 1B93A 2W2OA 3LPDA 2AE1A 3FLBA 4J2HA 2J3JA 3T7AA 5G0VA 3FWPA 1AKVA 4L8YA 1PFYA 4WZZA 1PG2A 2YIJA 3AFHA 3PE3A 1R74A 4K6CA 2YN4A 3RIHA 3H04A 1SVWA 3HZOA 3UAYA 2HIMA 1Y34E 2ZBQA 5CX4A 5B7QA 2O57A 3DMNA 3N6VA 2FR1A 2HHCA 4RD2A 1JIVA 4FE4A 3SPXA 4B3CA 2QE7A 2XMSA 3LU1A 4GW3A 2XZDA 1O89A 1MQAA 1O7JA 1TO2E 2HCTA 3MGAA 4XX0A 2R84A 2WM3A 4P3KA 1L7DA 2AYXA 2I22A 2PYIA 3IAAA 2YZMA 4FDLA 4Q5IA 4YI5A 3ZCQA 1NOJA 5ENZA 3RR2A 3FWZA 2UXDB 3IAHA 1W6RA 3PUWA 1HYGA 2D2IA 4PBSA 4TXNA 1JKJA 1NXSA 2MHCA 2HGZA 3PUHA 4P84A 2WAMA 4C04A 5K20A 4KPUA 4AJOA 5LMZA 3B20A 4ZYWA 3PGKA 4I36A 1X9HA 1SD5A 1TNDA 4JI6B 2W2LD 3PL1A 5E7QA 1I32A 1TCUA 3MJCA 3ON5A 4IDEA 1L4YA 4C7JA 1TAQA 2I6UA 1QIJA 3V7YA 3DAOA 4KR0A 3W9SA 4DQUA 4WECA 3O73A 1APBA 5AVWA 1GUBA 1S0UA 4BQEA 4UU8A 2EATA 1TZMA 2RHJA 2VEOA 2GBLA 3OY7A 4K9OA 4IEFB 3ZHXA 4ARBA 5ITZA 4LJYA 2AIRA 2C5HA 4LYYA 3RAJA 1PFKA 2VKTA 1BGXT 3WBFA 4D45A 1NF3A 2GDZA 4KGVA 1Z7EA 1ZMBA 1M67A 4B3TB 3ANTA 2GPWA 5DP2A 1JHQA 1EHIA 1FMTA 2G09A 2JGMA 4B6FA 2CMKA 3IOBA 3ADDA 2OOSA 4J90A 4BNTA 2CWDA 5ED0A 5EJ7A 1GRCA 1JA0A 3ADPA 3GNTA 3VNRA 3BM5A 2O2ZA 4PY2A 1Y4ZA 4DJ5X 2XBMA 4E30A 4BKMA 1S2MA 4MW1A 1XKQA 2RHBA 3HSSA 1R5OA 4EHNA 3H87A 5C7YA 3JQAD 1XRSB 1UR5A 3REGA 3RUCA 3U44A 3GUCA 2X0KA 3T9CA 4BWFB 1QRUA 5BN4B 3HCBA 4NBRA 4ZOLB 3ZZNA 2PG3A 5I48A 1ZJYA