2QD3A

Wild type human ferrochelatase crystallized with ammonium sulfate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 143
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A01
2QD4A 2HREA 2DJ5A 3HCRA 2AC4A 1LD3A 2XVXA 2QD1A 2XWSA 2Q2OA 2PO5A 2QD5A 2PNJA 2AC2A 1C9EA 1L8XA 1LBQA 3HCOA 1QGOA 3LYHA 4CCSA 2H1VA 2JH3A 3GOQA 4MK4A 3HCPA 2QD2A 1DOZA 1C1HA 2HK6A 2XWQA 2XWPA 1N0IA 2XVYA 3W1WA 3AQIA 3M4ZA 2C8JA 2HRCA 2QD3A 2Q3JA 2H1WA 4KLAA 1HRKA 2XVZA 3HCNA 1AK1A 4KMMA 1TJNA 4KLRA 2PO7A 4F4DA 2Q2NA 4KLCA
chains in the Genus database with same CATH superfamily
5HDQA 3ZW7A 3ZQKA 4YNBA 5FLYA 1QGED 5C31A 5HW0A 4QDTA 3ZIAA 1BIFA 3SSNA 4KMOA 5FRDA 3OZBA 4ZJYA 3DJFA 3RRYA 2ZJ3A 1K63A 1ZD8A 1J2TA 1MJNA 5E6UB 1ONSA 1L5QA 4URZR 3LNTA 3U44B 3ADDA 2IPOA 4GMFA 1CD5A 3DTVA 4YQEA 2ZJBA 3DF9A 1RM3A 1YBVA 3KVNA 3S40A 4C7JA 2FOLA 4CM6A 4NYJR 4GOND 3JRWA 5KUTA 4KUEA 2G63A 1Z0DA 1HURA 3PR2B 1EJBA 1H0SA 1R74A 4N3CA 4FKZA 4KIGA 4PO9A 1CZNA 1O9BA 1VLVA 3A7DA 3D8BA 3IR5A 3QFSA 4HGYA 5GWXA 2R6FA 2WLSA 2G77B 1MB4A 1DAPA 4QTZA 4UBMA 4P7GA 5F12A 5L8VA 1ISHA 1PZMA 1NLYA 1RWBA 3DNPA 4ABTA 5ELLA 2PYDA 2IVFA 5FBQB 3CVYA 5L6MB 4EY3A 4IRUB 3RB8A 2CHQA 2IL1A 3BIJA 5EJ4A 3CH5A 1G8HA 3DLPX 1OWLA 4B4KA 4DIKA 4RGQA 2ZATA 1GNQA 4B40A 4E3WA 2VQDA 1D0VA 2WD9A 2BEVB 1F38A 1JHRA 2JAWA 2Y1WA 5LDGA 1WTAA 3T3OA 1WZCA 4KLRA 4U0KA 3DP9A 1RHQA 2MINB 5AJHA 4N0EA 4E2FA 2P3SA 2IOYA 4UAVA 5FI3A 1VDMA 1VZ3A 1II8B 1YE8A 2I6TA 2J9GA 3E8SA 3IAFA 4DDVA 1BEUB 3RK1A 2G5TA 1Z37A 2RBGA 2XXBA 3L7BA 3DDCA 4BNDB 4HEHA 5K9ZA 1W48A 5B58C 1NVVR 4B6JA 4DBLE 3FOZA 3QX3A 2CLDX 2BRUC 3A32A 1I2CA 2J48A 3OPYI 1KHHA 4GM4A 2GXSA 3QYJA 1PWEA 4I2VA 4UEJA 1BTOA 2GHIA 1PUXA 1EX9A 2HRQA 1XZIA 3BRCA 4MVJG 1J39A 3QK7A 1CZOA 2CVHA 3PQ8A 3UHAA 1PVOA 3TOZA 3MMXA 4HGRA 3RKUA 4DSZA 2BMFA 1WCWA 1TKBA 3TFQA 3W90A 1UWLA 2GPBA 4Q3CA 2YYSA 1A9XA 1J0CA 5DT9A 2IVZA 8ADHA 1E3LA 3X1JA 1K27A 3SVZA 1D4OA 1XWWA 5J47A 2ZRMA 1Y0BA 2AXEA 1MVOA 1YQWA 3OSZA 4O2AA 1ND6A 4JN6B 2Z30A 3QLEA 3F0TA 3IAAA 3IAXA 3KK0A 2OQIA 3MCWA 5EJEA 2Z5FA 3HR8A 3ZHXA 1RRMA 2BFCB 4WK6A 5TX7A 4BO9A 4WBNF 4I4TB 5FLEX 2QE7A 4HUQB 4R2MA 1YRYE 4N8EA 4OXYA 3VC2A 6CHYA 3VOAA 2F00A 5B3LA 4WX2B 1S3FA 4S2EA 3ELBA 2H1FA 2B20A 2AEFA 5T5QA 1HXHA 1OHHD 1Z08A 2LCFA 4TTRA 2N46A 4D4GA 4ADSG 3T3GA 4KR6A 2X9GA 2GJ8A 4BO7A 2W6IA 2J4FA 2UYQA 2VJBA 4IILA 2HA6A 1GARA 2VDMB 4ZHQB 1NUTA 2B5OA 2XDQB 3RSGA 1NATA 2QXYA 4HWGA 3ONFA 3PA6A 4JWKA 8ABPA 5ALJA 1RJEA 1I6KA 2V7BA 3A14A 1AF7A 3NB0A 3QHQA 4Q47A 4ZQCB 3U1TA 2QD5A 2W2TA 3OC6A 2PNJA 4A2WA 3BL8A 3UUEA 3ICQB 2DGDA 3GJ3A 3K72B 1S7CA 5HZMA 4KGXA 3OURA 2C42A 2WNHA 3IUYA 1O77A 4GDMA 5B12A 3MWEA 1H4TA 5K3CA 1EWVA 2QD2A 4B83A 3QKSA 4D2IA 4UNRA 1ARZA 2QX7A 1JAIA 3SZMA 4YCSA 2P8JA 1PR3A 4HDSA 4WK2B 4OATA 3RK0A 5IT9A 1JN0A 4PCAA 4RY9A 1M0SA 3F6SA 3VAYA 2GN2A 4EPRA 1CXZA 4YXWD 2FPIA 4G01B 3VKVA 4COKA 1W36D 1LFDB 2APJA 4H60A 4L78A 3TWOA 3WYFA 2D3TA 2ZREA 1YDEA 2WTXA 3F3YA 1Z15A 4DIEA 1JQEA 4B8ZA 1MRZA 1SZCA 3JQ7A 1Q83A 2I22A 1VFNA 4PQFA 1WHSB 3CZMA 3Q98A 4GRDA 5IP5A 4QXRA 2QPLA 4FJ0A 4RQTA 2Q1WA 4GGMX 4A8JB 2C1XA 4OJQA 3DH0A 4JLAA 4XQEA 4GD3Q 1QRTA 1NW8A 4KKVA 3GYGA 2H8KA 2WINI 1IB6A 3H87A 5CX1A 3A28A 1CY4A 4BFVA 2ODWA 3W6ZA 1P1KA 2Q5HA 3TB4A 1SUAA 3B1JA 4RXUA 5J43A 2UZ1B 5JH7A 2P11A 5G2OA 5F5LA 4YRZA 1VGVA 1EGMB 2VYNA 3OM9A 1XLUA 1DIOB 1PQPA 2I34A 1T8UA 1BXGA 1WJGA 3LAWA 1SUFA 4GGOA 2OGWA 2ZSKA 3BX1A 2ZFUA 5CDSA 3AF4A 1SOMA 1GKLA 2YWBA 3IQHX 4ENQA 1M0TA 1N2JA 4EJSB 3R7WB 3BXXA 2OECA 1AQIA 2YQ5A 3OUZA 2JI6A 2BMJA 4D8UA 2OHVA 4P3KA 3LGAA 3EPRA 1QGOA 3KZXA 1U6IA 4UXIA 2BR3A 1O57A 4Z6KA 3OCZA 4KJXA 2L2QA 1UFVA 2WJAA 3FYUB 4ZVNA 2LDXA 1SXQA 5IWCA 2P9GA 1G20B 3INGA 3G59A 3LQFA 4OX9B 1BC5A 4Y2QA 5KKNB 3LDFA 3TINA 3U81A 3M81A 1NW6A 2AFIB 3RRZA 3HC7A 3KQKA 3GJ7A 4NULA 1COWA 2BPOA 1TZBA 5BSWA 3KYCB 3JYPA 3RQIA 1PRYA 3L8EA 4NQZA 4JASB 3VDNB 2WTNA 1QBGA 1UUFA 2L18A 1QUEA 3DZIA 3QHAA 4KLCA 3E7FA 3NW9A 5KBYA 2GJ9A 5TE9A 3QVTA 3QEBZ 3T5DA 2KPOA 3SE0A 1K6IA 1PJRA 2V0NA 2WUFA 4RW0A 4ZQGA 4WOBA 1B1CA 4LJKA 4JQYA 5CMLA 5I7OA 4QOHA 2M2IA 3S7TA 2R8PA 5K99A 3VNBA 1L1EA 1IOZA 3LDUA 1V5FA 1IUNA 3LQ2A 3V4FA 4KX5A 4TMYA 3ZNOA 2PBZA 2HQOA 4AS2A 1JEYA 3V46A 1SD5A 2H59A 3CZCA 3LBHA 1O95A 4WBSA 4CG0A 2ZM5A 1JHYA 2B7BA 2MU1A 1BH2A 1M2FA 1LU9A 1MF7A 1N5OX 3DMFA 3RWBA 3MINA 1Z8FA 5HEKA 3RODA 4BUCA 5MDHA 3T1YB 4N40A 1Z74A 1X92A 5DRTA 3RYHA 2RGGA 1OWOA 4PXSA 2HYIC 1HDYA 5FOTA 3W2GA 1R0KA 4I36A 4LBZA 5ALYA 1Z75A 1YNOA 2GH1A 2GTIA 1SCDA 4BJ6A 4E2ZA 4LEIA 3RYFB 3PQ7A 3STVA 3AVUA 2PX6A 2CMKA 2FLWA 3LT4A 2OD7A 1WKVA 3K94A 3NVDA 4K86A 2GTHA 3BRWD 5HJEA 1U5BA 4JLKA 3KP1A 1FQJA 1YIAA 1P7VA 3OCUA 2ANCA 5AVKA 4C0QC 1B8OA 1XXHE 3E22A 3DUFB 4EPXA 2FUG6 1OOEA 2WWIA 2PQ0A 4MRNA 2CYCA 4RFVA 3ZKAA 5HWSA 1L7AA 2XGMA 1TEXA 1WOYA 2B2NA 3AJ9A 5F9MA 4NU8X 3I72A 3R7FA 4D42A 5B3KA 3NEJA 2BMEA 3LXUX 3PEVA 1HDZA 1T9GR 3EQ7A 4PZPA 3PPIA 4F97A 1VHDA 5JADA 1U4NA 3AEUB 3F4LA 4LMAA 2QI9F 3WSWA 4DQKA 2YIJA 4EYKA 4RFSA 3AESB 3KJEA 4LC0A 1HE1C 3LPNA 5SYAA 1B6GA 1IQ0A 3WG9A 1GQRA 3L4EA 1N2GA 4HRVA 3K9WA 3G0HA 2OO5A 4XUCA 4W63A 3CLVA 3W2HA 2C7OA 2YCBA 4H4DA 1YWGO 5JS2A 1D2RA 1SBIA 4ENUA 4K40A 4IJWA 4JODA 4RENA 2GA9A 1EINA 1EAYA 2J5QA 2WYHA 1ZNXA 3AUUA 3AR9A 3SXPA 1FQWA 1KP9A 4DMKA 4MR8B 1FUIA 2DFDA 4FHCA 3SVTA 1F0KA 3ABZA 3ZXYA 1K3FA 2IHTA 5BVHB 1N2BA 2AJTA 2BDUA 4TVSA 3CEPB 2FDCA 2G7ZA 5K3SA 3PRHA 1T2EA 2VJPA 4HB3A 4FWBA 1U2EA 3ELUA 3TVTA 1MPXA 1Z18A 1OLUB 4FD2A 4HJRA 4JBLA 4X90A 1YS1X 2ZUUA 4BUZA 4CT4B 3RVKA 3TQFA 3HEBA 5CR9A 1SXPA 3OQNA 3NKLA 1A8SA 1RXWA 2GF2A 2RI6A 2CNKA 4BIIA 3E5MA 4FD3A 4BDSA 2WWYA 1DUSA 4OBEA 3WLQA 3A2NA 4I99A 3STUA 4D3YA 2XOEA 3KSRA 1E6EA 3A0UA 5HR5A 1JDPA 3RBAA 3KYIB 2UUCB 2X1MA 1JDNA 4JYMA 5LP1A 1USUA 3AYXB 4LTDA 5EIBC 3A26A 4L7QA 3ROKA 2Q3JA 1HC7A 4Q12A 4YP5A 1CFJA 2QJOA 2NZYA 4B4DA 2PYIA 4G2TA 4LF8B 1A04A 4IIXA 4MYTA 3ESYA 2WZCA 4CQMD 2Y0DA 3HBMA 1P2UA 2NVBA 5CITA 1U0BB 2BYTA 1NMEA 3U13A 1FS4A 1UWKA 4ZEXA 5AK6A 3FYSA 2EQ5A 4TTVA 3COYA 2OO3A 4CLDA 3EXEA 4P4TA 5F78A 2NVWA 2RAUA 3UYLA 3BQMB 2OBLA 1K68A 3OZEA 4EYOA 1OWNA 2Q21A 1PJBA 2AI3A 2ZAGA 1Z07A 3NTLA 3O0DA 3JAWB 1YA4A 4MQ4A 4WZBA 5DYNA 1XMSA 5ECWA 1M7HA 1N8NA 1UIRA 1YZKA 5EMMA 3L7DA 2HK6A 3VNSA 3K0EA 5HF9A 3KQOA 1LWOA 4ILEA 1ADBA 3R9XA 3H11B 4RJKA 4R0MA 2X5XA 3IBYA 1KYZA 3QI7A 4DLBA 4GPBA 2AVNA 1W0KA 2AOWA 1UIMA 2Y68A 2ZB3A 4MO9A 2GAIA 4O8ZA 4W1SA 4X6UA 5KTRA 4TV8F 4UATA 1P0PA 1GL6A 5H8WA 5B7PA 1DCKA 3L46A 4MGHA 2XUDA 2X22A 1UFOA 2QMHA 4PX2A 3ESRA 4ND1A 5KSOA 4EI7A 1ULTA 2YX1A 1SHKA 1K8ZB 2ZBRA 3JZDA 3FY4A 3N87A 4BKUA 2R2GA 2BH2A 1SBCA 3SEQA 2DLDA 3OJFA 5B6JA 4X65B 4IV8A 4L8GA 5KNBH 1AO0A 5BORA 1WDLA 3JVEA 3QF7A 4M98A 3VSAA 4UXHA 4BAUA 5C8YB 4YCCA 4N1AA 2HZBA 3WK4A 2RCNA 3NO4A 2BFAA 3G0DA 2FSHA 1SKMA 1CUZA 4U02A 2EOAA 3Q6MA 4EUSA 3I5XA 1LI5A 3WL7A 1CULC 1M2KA 1GZVA 5K3FB 4Z1OA 5LUAA 4MAFA 1ADCA 2IBTA 3A0RB 4ZMSA 1H9CA 7ADHA 1C1DA 2ECFA 4GXQA 4CKBB 2YVLA 1KJWA 1BMQA 4O4IB 3WC4A 1IZ8A 5M2QA 1EEHA 4NCIA 2IXGA 2IV3A 1UOOA 1X77A 2W2OA 1JG4A 4N6NA 2FF5A 1VBNA 3HPRA 1S6YA 1I30A 4RHUA 3CNNA 5LOVA 1E9CA 1KQGA 4UUAA 4UUPA 3LCVB 3DOEA 1EK5A 4R41A 4QTYA 1W88A 1GFZA 1HBJA 2DFPA 4H59A 4NBLA 4YDRA 3SC2A 4B3TB 2WIBA 1XCMA 3DXXA 3G2IA 1TQ4A 5IASA 2I6QA 4L0MA 5KTNA 5PGMA 2PT5A 5T7BA 3WWOA 1UWVA 2DYKA 5E0OA 1JJBA 2GLUA 2J3EA 2ZBDA 3FSGA 4OAQA 1HG1A 4X62B 3GLQA 1KAQA 3JSAA 2CMGA 3Q7PA 3QUSA 3WSVA 3DAPA 5FOSA 2LP4Y 4URHA 3KYDB 4HNHA 4IEFB 5FV4A 1L1FA 1L5RA 2F2TA 1OI7A 2RKOA 3Q40A 2JL1A 1QZTA 3DCJA 1XE3A 1ULHA 2RG1A 4IJUA 5DX1A 5LZ8A 1WXGA 4HYEA 3NHRA 3V8MA 5BVGB 2ARKA 1A9QA 1PDWA 4PS0A 2B9EA 2WIDA 1RI3A 4OSEA 5KNDD 3I9FA 3I12A 2GEBA 2IHJA 2ZPTX 1JSLA 1J21A 3LCCA 4C0BA 1R5JA 3DEYX 4AMZA 3MK31 1HWYA 4UDOA 2BZ1A 3DE3X 5TY0A 3LQQA 1EFPA 2FY8A 4G0NA 1C7JA 1SFRA 2OP0A 4HGQA 1NR5A 3CH7A 4TLLB 4AU1A 1WBJB 4DC0A 3O03A 4J07A 4NHOA 1XA3A 4Q39A 4BATA 3GRYA 3HB0A 2ON6A 4JMLA 1E7RA 1QHEA 5D7NA 3TI9A 4E14A 5AVWA 3LO8A 5DRYA 3FWKA 5HRUA 4FILA 4JFRA 5FNVA 2NMVA 4B3RB 1YXMA 3WJAA 5TJ9A 4HFMA 1DCFA 1X9HA 2PGOA 2D2EA 3BHJA 2WHXA 4RF5A 1FFYA 3O91A 1CKEA 1R12A 4XXHA 4M88A 5JR3A 2OZEA 1VA4A 2CLHB 3AT1A 3GJ8A 1RAGA 2Z4RA 4E21A 5CRIA 5HOQA 1EX7A 3T7IA 2P78A 5EP1A 2BEJA 1T8RA 1DJMA 3FAZA 3T1HB 5EXPA 3KQPA 3QBVA 3TGLA 2JEYA 2R4UA 3HGQA 4O2AF 2VQEB 4FGLA 1WR8A 1X87A 2FSUA 1H5UA 1IY0A 3UAXA 4X9XA 2V7XA 1FE8A 3KKNA 3MMZA 5CH8A 2Q7OE 3HN7A 1L7RA 2EFCB 1ACJA 2XBLA 4TM7A 2JGLA 4M0LA 1R88A 1U6KA 4NMHA 1JU9A 5DM1A 1GCGA 1XR3A 4WLUA 3RC3A 7REQA 5EHXA 3HV0A 3SS9X 2JAPA 1B8UA 2W8BB 1LRKA 3UCEA 3UT6A 2BI8A 3IEMA 3W5AA 2F8SA 2XMCA 4MCHA 2Q3FA 4WJZA 3FPCA 2XWPA 4MB6A 2NYUA 3EULA 2PIAA 3G17A 4HB0A 2R44A 4U9HS 4S04A 3O3OB 3FVRA 1WCV1 4MIKA 2W2LD 1DKQA 3ICVA 3C6XA 4Q7JB 1XQ1A 5DEIA 1X1SA 2QVXX 1WCXA 4HDMB 4KO1S 1TPZA 1PWZA 4FZJA 1KDTA 4JUIA 1XEFA 1YC5A 4ZI7B 4M0DA 2V3VA 2JJQA 3PQ5A 2OSVA 1QZ3A 2J7PD 5GINE 3C97A 3LW7A 4JB8A 5AK4A 1F51E 3I4FA 4TTQA 3SJAA 3R5JA 2W70A 2PZ8A 4EKGA 1BROA 1Q0LA 3C5VA 4D8WA 4MUKA 1XLTA 4TQAA 3W1VA 1IXRC 5H0IA 2VWPA 4O02B 5AM4A 2FUNB 4UTOA 5FPTA 4DLZA 3O4IA 1U9YA 1UCFA 5IK2A 1AS0A 3CZQA 4KYIB 4Z9XA 3RAGA 4AIIA 4KQGA 5AHXA 3QU2A 5AM5A 2GX6A 2Q5JA 4LNAA 3OTOB 1KI9A 4JNCA 4B87A 3PFHA 1JBEA 1N6LA 1SHTX 4BQOA 4H1WA 5HF6A 5ULLA 1GHTA 4DRXB 1XCLA 5DLQC 2FHPA 3R3XA 4D9FA 4KAXA 1XFDA 5COBA 5HFNA 3CTPA 2UVDA 1X7ZB 4QLBA 4HEJA 1HQYE 2WMDA 4R0NA 2ERYA 3G8AA 3AKDA 2OHFA 4MI9A 3TW0A 2B9VA 3KKEA 1VG9B 2Q6VA 2VDJA 1XIVA 3PJDA 4MW4A 1TVCA 1A4IA 4NLLA 2G5CA 3OF2A 1ZRSA 4HI0E 1C1HA 3NWOA 5JQGB 3TQOA 2V3CC 1UDBA 5TPWA 1P80A 4HQLA 4KFSA 4PYKA 3CF0A 5AM2A 1WKBA 2G25A 4M55A 4BN0A 2FUCA 3H3XA 1KJIA 3BPSA 4DV6B 4J7UA 2RG7A 3DHVA 3QKRA 2O0KA 2XNKA 1EXDA 1LVUA 4CUKA 2PUGA 1BE0A 1U0RA 1UZUA 4ZOLA 2HV9A 1CUIA 1N6RA 4PZYA 3IBGA 5CVUA 3E7DA 3P9YA 4FBMA 4MGKR 4KCGA 2OXFA 2PJUA 4L5JA 4X7RA 2XZOA 3E1KA 4HB2A 4G1EB 2IZ1A 4KW7A 1DI0A 4DQLA 5FWXB 3U6KA 1Y6FA 4RTNA 5K8JB 2GCOB 1MR3F 1P2SA 3U16A 2J45A 1CY2A 5A0TA 3A4NA 1TM7E 3ICWA 4HH4A 4NS1A 1IWPB 1D9ZA 2VWHA 2WJPA 2ZBPA 3GXBA 1E3WB 4TS1A 4G1VA 2Z4SA 3N6VA 1UBFA 1NU8A 4LQ4A 1Z5WA 1V3VA 3PPYA 1YB2A 2VDLB 4WNIA 3FUXA 4IGEA 4RIFA 3ZK7A 4KQWA 4AD8A 3EBOA 2QUKA 1Q1ZA 1Y4ZA 5ARDA 5G4KA 1NDQA 1IQUA 3TDKA 5LP6C 2F43B 1EFHA 5BR4A 4DB2A 2ENUA 5FV7A 1WUTA 4Y6OA 1ZN9A 3IAM6 4WY5A 3MJCA 2BF4A 1Z39A 1KJ9A 2WE8A 2IEBA 4OLFA 3GA7A 2VF5X 4ARCA 2VUTA 5GZ1A 3R09A 3HO6A 2Q2VA 2MJLA 2CVPA 2DTDA 2QJTA 4L6CA 2XCRB 3ZZ1A 3MPOA 4YDSA 5LWHA 1GYPA 3UXEA 4U2FA 3HBNA 4NZMA 1KZHA 1ZIYA 4DG5A 4L2IB 4U3JA 5DLPA 4YRMA 4JJFA 4LMPA 4TROA 4GW3A 4MROA 1CQJA 4PNEA 5C7OO 2VR1A 1V48A 1REQB 2GA8A 4OQQA 3ASZA 4CM4B 3DE1X 1XD2B 4GWGA 1H2HA 4NYMQ 1U1IA 1N6PA 1QHNA 1VCMA 4W7IA 2GAOA 4ETWA 4GKBA 3ESZA 3DB2A 1AV7A 2F8MA 2QS9A 1DT3A 1JP7A 5CP8A 3PGMA 4KL8S 1X94A 1XXHA 2QT1A 3L4SO 2VAWA 1Y8RB 4R8KA 1M7GA 4JJ6A 2CL0X 5JPIA 1EHCA 2VTKA 5L4NA 1A8UA 3WK7A 3ZV4A 3VDRA 1UANA 2Y05A 1WXQA 1M67A 4J76A 3AFNA 3TX6A 2IZ6A 5SZJA 4Q7LA 2DZDA 1HLDA 2IHYA 5JZMA 5HCNA 3KLPX 3KEFA 4R7ZA 4YAWA 3I6BA 4RM2A 4P0TA 4MUNA 3GBPA 3ZX5A 4NCBA 1QAMA 3IV9A 1OI3A 3KAKA 4JBWA 2YJNA 3P2JA 4TMFA 1XGKA 2JLWA 3ZY3A 1G7RA 4P53A 1HX7A 1OC4A 4YAIA 2EDCA 1WVGA 1XAGA 2ZQYA 3P71T 5HM8A 3E1SA 2B36A 5I48A 2AN1A 1TUBA 2OV2A 5JAOA 1YQQA 2H4YA 2HJHA 1NULA 1JKJA 3FNIA 4MPJA 1LX6A 2P9YA 2ZE5A 2H48A 3DD1A 2E3JA 4XIIA 5HRCA 1LK5A 3AI3A 2CNBA 4PZUA 1TM2A 3T7AA 3GHYA 1XVVA 4L5BA 1ADFA 1SUBA 2QYOA 3VR2A 3D8UA 1DWUA 3HP1A 4AFNA 1NQWA 4BLQA 3KTFA 1T9ZA 2JGFA 3CVUA 2CT8A 2IF0A 4G0VA 1T4CA 1JXQA 5C1DA 1FRQA 3PL1A 3TW8A 2FP3A 4E22A 5E2BA 2V6IA 4MR7B 2E48A 3IUJA 2GT1A 4DXDA 9ATCA 1VE9A 1DTWB 2OBXA 5JE8A 2HTEA 5K3DA 1KOLA 1JAHA 3RFTA 2OXTA 4C7VA 5DHQA 1TM1E 4JA2A 3RS2A 2FWRA 4PHTA 5B1IA 4DMRA 1O58A 2BN4A 2G6TA 3GPDG 5FTNA 4KP7A 1UC9A 3QX8A 2HMAA 3V2GA 1Z8HA 2BSXA 2VHYA 1TJ5A 3FZGA 2XEXA 5K09A 3I61A 1LDBA 3N8HA 2PPVA 3OJ0A 3QVXA 1XBTA 3ZJUA 4KBGA 3DF7A 4F56A 4CWAA 3DAHA 5IZCC 1Y8CA 2RH4A 3KVVA 3B8EA 3VH2A 4HGPA 2DHCA 4AUMA 4P33A 2VF4X 2YFHA 4Q16A 4F2GA 1PQ4A 3BKWA 3FI9A 3KR0A 4IFEA 2NPFA 4UAGA 4C08A 5IANA 5MFZA 2JFXA 1QGYA 2IW3A 4J7XA 2I8AA 1JJVA 4P32A 5BWNA 1FFEA 3OIYA 1ULBA 4TGLA 2XVXA 3R0QA 4GYWA 4PAOA 5E4TA 2I55A 1L9KA 3VAZA 5T3YA 1MJHA 3ILSA 3NTOA 5HZGA 1L7VC 5IUKC 1KPIA 3AIMA 4QREA 3KSDO 5F2KA 4Z9AA 4ZVUA 3SNHA 1LLQA 4PYMA 1V2GA 3FCCA 4ND8B 5LMCA 4UAUA 4YUVA 3GH1A 5BQPA 3B3JA 3X44A 2NAPA 5I45A 3SQWA 3ZIDA 4TX1A 2QG6A 1M8PA 3N1UA 4UOQA 1Z0FA 2W0MA 1U0FA 1TGVA 4R68A 4YMIA 1TJNA 3QH4A 1YE5A 3U7EB 4HDNB 1E2MA 1NM5C 2O0HA 1J7JA 4IJ5A 4M0UA 5H16A 5C4MA 5CB4B 1KPGA 2FQ1A 4N9WA 4Y2TA 1PYDA 1XT6A 5EEHA 4DLNA 4Z4QA 3CWZA 3TE7A 2Q1UA 3CUEF 3WBJA 2JZNA 1G5IA 3V42A 2GZHA 3ZH9B 4AY5A 1KEVA 4X8MA 1Y34E 2BGNA 2WZBA 1XDZA 1VBKA 2HIMA 4POOA 4EKNB 4TV9A 2DOKA 1RRPA 4Q9DA 1JB1A 5BWMA 3GK3A 3H1BA 2RAFA 1IPHA 3RWMB 3E4DA 4Q82A 5K0GA 1RM5A 1ZM9A 2FWBA 3A6GA 2W98A 2C77A 3DBVO 1B8PA 3PD7A 1RPAA 4O8CA 1TCVA 2R8BA 3FYCA 3ENKA 4RPIA 1YI1A 4HFNA 4U7TB 3SDSA 1ZM3A 4BGIA 4F3RA 3F7OA 2Z1MA 5DH9A 2AQHA 1YS4A 2FZKA 2HCTA 2JA2A 2OOKA 2P9ZA 4TKLA 4A0SA 4GMHA 4RPKA 3I04M 4HLUC 4Z99A 2CLSA 2QMYA 2P2GA 2YRFA 1G8SA 2WU0A 3N8GA 4M0MA 3UF0A 1ISRA 4NAHA 5B37A 1RWVA 2FTKE 4INJA 1IM5A 4KSCA 4IV5A 2VAXA 4EEXA 4LK3A 1JDVA 1VA5A 3UNXA 4RHFA 5IKPA 2V98A 3M1IA 4A15A 1R6BX 5ENDA 4HQKA 4E88A 3PNYA 4IEEA 2F3UA 3I34X 3D2AA 2DLNA 2K7ZA 2ZJ8A 4KIWA 5HE9A 4YQFA 2FDRA 2E7ZA 5LOVF 1R0YA 1J24A 1P6XA 5AI5A 3L0YA 1JPUA 1KOJA 4Z9YA 3UAVA 3B6JA 4V1CI 5K0FA 5AOAA 5D6NA 1HTWA 2JF0A 2H7XA 3TIXB 1TT5A 1YZYA 2AN3A 2FZ5A 3H2SA 1W7AA 1V1RA 1E5QA 4ZAVA 5K6TA 4FI3C 4F6LA 1JECA 4E32A 1CTQA 1AO3A 4JEUA 3ICOA 4MIEA 4EJ6A 3G2OA 5B2EA 3GFTA 1C30A 1XZPA 4PTZA 4L08A 1X15A 3CPSA 4KPYA 1G98A 2VHVA 1RZUA 1C3OB 3UWOA 1VP9A 2ZG6A 4AMVA 1WU8A 4D9KA 3QKTA 2EW8A 3IEUA 3PC4A 2WSLA 1RHRA 4L5YA 2RGRA 3B7PA 2OWDA 2JA1A 1CVIA 3TI7A 4RSRA 3O4FA 4NU6A 1Z28A 1E9RA 2YXEA 1JYSA 1PSZA 3FFXA 3EC7A 2WOJA 1K5GA 3ZWVA 1VYVA 3U4QB 1ID1A 1AQYA 2PGXA 2ZWVA 4XGQA 1JQLB 2VNJA 3UIEA 5BSGA 4M0PA 1AH2A 2VPYA 3UMGA 1KR5A 4JHXA 1ZI9A 2M6RA 3I9KA 4A8TA 3TNFA 3KDPA 4EG3A 1W49A 5MGNA 3WWZA 2BGTA 2W83A 3G02A 2BUAA 3QWFA 1E9EA 5FAXA 4E08A 4ZALA 4S1NA 4NF2A 2JFZA 4NH0A 4CUJA 1ZN7A 2AL7A 2G8NA 3DXYA 4NJEA 4PPFA 4CMEC 2ZUBA 5JDIC 5KNCA 3NKFA 4IWYA 4YJ2A 4BO2A 2XRZA 2SECE 2C4TA 5FWDA 3G8BA 4A3SA 3N58A 1N2SA 4DCTA 1Z4LA 3EZFA 1U7WA 3ZDBA 2EJTA 2REQA 4M9QA 1H6CA 3NBFA 5F21A 4PLTA 5FNVF 1M66A 4L07A 4MI6A 4R2JA 2CNNA 2OFFA 3KZVA 4N5IX 4CM1A 4KTTE 1MC4A 4MDFA 2AN4A 1K0UA 2X2FA 1FRZA 3ZHSA 3UUWA 4LDQA 3S81A 3I9V1 1UFRA 4DREA 3A9RA 2UVQA 5CXQA 2CBZA 2HYDA 3F5DA 4CDNA 4RPHA 1L5FA 4AROA 1KIMA 1U7PA 4IRMA 3H2ZA 4I8DA 3SZUA 2PT6A 2RJ3A 5DMHA 1HMYA 1WMEA 1AKNA 2KBFA 3HUTA 2CJWB 3IIJA 3ABQB 4XH9B 1P9OA 5HCUA 3W5VA 5LNK1 1UJMA 3EGDB 3JWPA 4IO0A 1HZZA 5H83A 4B74A 5DNAA 3FPBA 1VG8A 1XZGA 4PCLA 1T5SA 2CCKA 3UT5B 4OBXA 5JI3E 1HNXB 1SKYE 4M1MA 2AKEA 4NTZA 2FK8A 4JYBA 1AMOA 4V39A 3UXHA 3FROA 1CETA 4OPMA 3RJ5A 4AO8A 1P0FA 4R8LA 2OK7A 1QH9A 1OXXK 5EUBA 3L06A 5C5EA 3VNRA 1W44A 2QN7A 3LX6A 4M9CA 4LGYA 2OESA 2QIOA 3D2BA 3W9UA 3WLSA 4J0CA 2PSDA 2MSEB 1Z2CA 3QTLA 2JAQA 3NBKA 4DSAA 2QZZA 5P21A 3PCRB 4OJTA 1IFXA 1NXTA 5DM2A 1O94D 3S2ZA 3D4IA 5COQA 3V5NA 3C3WA 3CQ9A 3OOHA 3NFRA 4GM1A 5TS3A 1S9DA 2GYUA 2VYVA 2A0FA 1W25A 3Q7EA 1XELA 1Y9EA 1I3KA 4IX9A 2JGJA 3RSSA 3A6HA 4BV2A 2C5HA 5CD1A 2BGIA 3LP6A 1M5UA 3ZHQA 1M2VA 1Z4IA 3QMVA 5JFTA 4FGJA 4WT7A 2XQIA 3QU5A 4QQFA 5FPQA 3H6KA 2IEDA 1OC2A 3MF4A 1WXIA 3IDOA 2OA0A 3L82B 4QLOA 5A4KA 3H18A 2Y1LA 3MT8A 4N7JA 4NFLA 2WSSD 3X1ZA 1NNEA 4L16A 2C78A 5GIOE 4DA9A 4ZARA 3U4HA 3ZHBA 5GGXA 2ODAA 4AX8A 2D5CA 2ZYVX 4XYGA 3FWPA 1M8GA 1EPUA 3ETJA 1G63A 3V1MA 4GVLA 2CKMA 1RHKA 2MR6A 4BVAA 4UEQA 5AIAA 1IHXA 2FN7A 3OP4A 3WWYA 3SQDA 1Y5IA 4EIWA 3AI7A 3H5VA 1SD1A 3ZKWB 3BSSA 4INOA 2OYRA 1KMCA 3CLSC 1QZXA 2ONJA 5MHTA 4FYMA 2E4AA 4UPEA 4ETIA 1NG9A 3ENQA 4FLFA 4OJNA 4PSAA 5KKAA 1TMGE 3CVOA 4MOWA 1A4UA 1KFCB 1VIMA 4KAFA 4FN5A 4KRGA 1GA1A 5TPZD 5B5SA 7GPBA 2XNCA 2CW5A 3EASA 3UXMA 3CFYA 2R1UA 1B7GO 4XIFA 1I32A 3R75A 1DU4A 1WOMA 2J30A 4RVNA 4WFQA 2EKZA 2EQBA 2Q2QA 2Z5LA 1KZ6A 3IV6A 3O92A 4ZOLF 3N5KA 4J3JA 4YRRA 1E1MA 3BQ9A 3B7GA 1QP8A 2Q50A 3EGXB 1CZLA 2VRCA 3D8SA 3OLXA 1O4VA 3MQ2A 2J0UA 4MP3A 3V7WA 4AO7A 4FFRA 3LLUA 2RI1A 3OQBA 1LDGA 2GN1A 2PKRA 4YWJA 3ZU5A 2EBWA 4BX2A 4JL5A 3G1WA 3NHYA 2FEMA 3ID6C 4KXWA 1T4GA 2NO7A 2XB6A 1T8WA 5FO0A 1S8AA 1BDMA 3KEOA 3C4VA 3GFPA 3VU3A 4TWIA 3OLZA 4GI5A 5TGZA 2ALJA 1NY6A 2R2AA 1WCYA 2AXNA 3L0OA 4PVDA 4FFLA 3PG5A 2O2HA 1C9DB 1N6OA 3LX5A 3RYIA 4ZYZA 4J0JA 5JATA 3PTLA 5M3BA 4H3KB 1QP4A 1LBSA 5KCZA 3JR7A 4IF4A 2JIZA 4DCPA 4DHWA 2OPHA 3T6KA 5DSTA 4KO4S 3ISJA 4Q1DA 1RM4A 4I9FA 4KWCA 4JMPA 5YASA 4YT8A 1X42A 3GJQA 4JI4B 2WKPA 3KB2A 2G70A 1MORA 3VJLA 1OWMA 4WGFA 4DQ0A 2XIQA 3WK8A 1F6BA 2VJLA 4UZSA 4V1CA 4PPYA 3E9NA 1U94A 1XTZA 3HZOA 1NJFA 3JQFA 5EZYA 3EGVA 2OGSA 2H11A 4RIEA 1LBIA 3HP7A 4FK8A 2V97A 4ZWNA 5LCXA 4W5RA 2VAMA 3O84A 1ZH4A 1QGUA 3DFKA 4DS3A 4EFLA 4F84A 1IYZA 5AVJA 3CF4A 3OP1A 4OMCA 2HY7A 3SFVA 1FNDA 1ULSA 3EY4A 4X5OA 3E5NA 1E66A 4HBGA 1SELA 3W2IA 1H0HA 5LU9A 5KQRA 3R74A 3LCMA 4KB5A 3EZ9A 1ZFNA 2QL7A 4IFIA 2E4UA 1XTRA 2A92A 2XUKA 3ON5A 3BHIA 4LZZA 4WH0A 1HQCA 3FCYA 4I55A 2HDHA 2XNDA 4HAVA 1KRXA 2AN5A 1PG2A 1KMMA 2CDRA 3TJMA 3VHQA 4BP8A 1PX0A 3OLWA 3P8ZA 4R1UA 4RWZA 2NO9A 3G2KA 2ODEA 4H6WA 4Q4AB 4YGYA 1QDUA 3MJSA 3FR8A 4RZ3A 5EVJA 4DY6A 4KPEC 1PR4A 1NC3A 3C3KA 1QU3A 1VM6A 2FV8A 4RGVA 1ZK0A 3JATB 3OHSX 1Q3KA 1AT1A 3P2YA 4LK2A 4HUTA 5AOVA 2J6CA 4YR9A 3DM5A 5HBRA 4DFDA 2V6FA 4LDPA 1J5EB 2GI4A 2BP7B 1JMYA 2R7NA 2O8VA 1QO0A 4BMDA 4DZZA 1NIJA 1QQAA 1Y1QA 1IK6A 1LPOA 1NSYA 1VZ2A 2IE0A 1BXKA 4IYJA 4Q3DA 4RMJA 3ZBPA 2XE4A 3LC0A 1KZ7B 3O4HA 2K7FA 4M21A 4N03A 1RFGE 4M36A 4BTLA 4JVLA 2V0GA 2FUEA 3CUVA 4MLCA 3Q6NA 5HUHA 1QH8B 1UBHS 3BOSA 4I7EA 4JR1A 3USES 3ESXA 3HXKA 5C52B 4U7HA 1NF8A 3PTZA 1ZHFA 3PHCA 2GK3A 2EEPA 2GAJA 3C3DA 4D4LA 1U0EA 4YPFA 1JH9A 3H4IA 1B8VA 1E61A 2IYUA 3IUQA 2UUAB 4PN7A 4FDMA 3CEAA 3SGLA 4OXXA 1ZGBA 3Q9SA 2P5SA 2HBRA 1XPOA 2QLJA 4G4IA 2H52A 1H2AS 3STYA 4WUTA 1FW6A 1SH7A 1KJQA 1LPSA 2PS9A 4KDCA 4X6LA 1ZCAA 2NW6A 3C3XA 1SXJC 5REQB 3WNVA 1JDUA 1EEXB 4JB3A 2CXPA 1Z2AA 2AOTA 2QRPA 3GOQA 4AN1A 2NO6A 4A6PA 1NGSA 3FTDA 3IQXA 3M0EA 4G5OA 1Y1LA 4LYDA 1K7YA 3S0JA 4BB5A 1IZYA 2IITA 3MBIA 2YWDA 3O7WA 2VDNB 3JALA 1ITZA 1ANKA 1W93A 2HZ7A 1FRVA 4B45A 4BFUA 4QVKA 3FZYA 4PAMA 4QHTA 2R5FA 2ZTVA 5I9SA 4FS8A 1LI7A 4PO1A 3TSYA 5AVTA 4ZAGA 5FPHA 3R7AA 1P74A 3BGVA 3G2PA 3OEYA 3TQSA 1R8YA 4KN6A 5CK5A 2IX3A 2P35A 1P39A 4L4XA 4Q4HB 2G4LA 1DFIA 4OJYA 3JD2A 4B3JA 1IATA 4LA4A 1OXBB 4L3WA 1HLPA 3SOZA 4BVEA 1ESEA 3C6MA 1E3TA 4TZ6A 5FD8A 2BKVA 2IJGX 3M6WA 1RWMA 1USVA 2GJ4A 5KNLA 4AKHA 2VYQA 1KKUA 4FR5A 1IEQA 1UODA 5EP4A 3I76A 5BSRA 2PJRA 4Q24A 5CYGA 1OT3A 4G8DA 4N8DA 1ILWA 3EC2A 1M1ZA 1Z6QA 3PB3A 3R1IA 3H8SA 1YS2X 3HCBA 5K6RA 3U62A 1R18A 3D81A 1PQWA 1A69A 5EAIA 3WYCA 2OV3A 3TLAA 1JSXA 3QFCA 4RF3A 4ZODA 4PZEA 4EFKA 4F6CA 6LDHA 4OHXA 4UCFA 1ZD2P 1ILEA 1T15A 1YO6A 2GNAA 4LN1A 1NF2A 3REOA 5B4VA 3HZZA 4ZYTA 1S8OA 3CWQA 4P58A 4R51A 4R7GA 4BAGA 3HL0A 1LY1A 4Y6LA 4PG8A 4CKWA 3FOFC 4ML3A 5A05A 2GZSA 4TV9F 2J41A 4L0CA 4CTMA 3B3GA 4X6YA 3SE7A 3VBEA 2GF9A 2EERA 3PFIA 4J9UE 5CYPA 4IDDA 2BJWA 5A2GA 5EJ9A 1GR1A 1EM8A 4IS2A 4XFKA 3AI1A 4DAEA 1FDWA 1NN5A 1K97A 2HJSA 2NGRA 2XHEA 2WAMA 3JQ8B 4FZRA 4PV7A 3CVXA 3UGKA 1CQWA 1DC7A 3NDIA 2LR0A 3NUZA 4RS4A 4ZREA 2HBYA 2QLMA 2WV9A 4RHEA 3ADOA 2JAXA 4NDNE 4C30A 1BU8A 2QA5A 4QUEA 5L3QA 3JQ6A 2O4CA 4FQ8A 4NDZA 2P9CA 2NU6A 1ZONA 1G9TA 2KW5A 2RB4A 3JY6A 1ZR4A 1NT4A 3V00A 1XNGA 3W5CA 3THWA 2C7GA 3VR3D 1KDOA 3GWGA 4E6EA 2FFRA 1CJUC 1A7KA 1Q7TA 3JYLA 2XMQA 3GLTA 5HA5A 2PWZA 2YICA 3OE1A 4WW0A 2CXNA 4OL9A 2IP2A 3TGWA 2DJIA 2OXIA 4DUYB 1PN3A 1U8CB 2NSYA 4FOTA 2DTXA 4FS3A 3OZAA 4H2DA 4O1MA 1IOVA 2ZBQA 2VK1A 1O87A 1PS0A 2A3NA 3ETEA 1RKXA 1SA0B 1DO8A 4OQLA 4R9RA 1JWLA 2Z2XA 4YCNA 3RUHA 4HS9A 2XBUA 4QO7A 2X15A 3OMWA 2NVUB 2EP8A 2QY9A 3ZHTA 2NG1A 5JRJA 2Q3MA 3ETDA 3N2ZB 3ZXXA 3R2JA 4KTVE 3GNQA 4FT2A 4IHAA 1H65A 1CP3A 2JZOA 1JKMA 4RESA 5CA0F 5D3MA 2O6LA 4JD5A 4XVHA 3SJ7A 1ZN2A 4RZIA 2QY6A 3FG9A 1U9JA 3JQQA 3KV1A 1TQHA 3DD5A 1TAHA 4V02A 3D59A 2WICA 6PFKA 4V0SA 5BUZA 1GYRA 1ZU5A 4BIMA 2YV4A 1FBNA 1ORDA 4K3VA 3AXSA 4ATNA 1Y6ZA 2IY9A 4RIIA 2EWVA 1JFFA 1WMBA 3V4PB 4CMKA 3GGDA 1G8YA 3H9EO 3P5SA 2GPJA 3QNUA 4YJ2F 3O2QB 1L8LA 2EXXA 3BBPA 2AEJA 4MVJM 3T4UA 4ZJPA 5FAKA 1R0LA 3BMCA 2AG6A 3G5AA 3PHJA 4NL4H 3TLJA 3DOOA 3VR4D 3UB4A 4CFZA 2X19A 1SVUA 4KHPB 5AKGA 2CK3D 3CRW1 2PGLA 2HA2A 2ZKLA 3RT1A 5J2TB 1Y4DE 1NZFA 2XB2A 4NZ9A 4ID9A 4YXFA 4QG3A 4ZU6X 2E5LB 4CKEA 1HLGA 4ECEA 4B6FA 1VMEA 4CF4A 3DGFC 5KC9A 1V5GA 2JRCA 3EMKA 3IP7A 3LUCA 3NDJA 3QVGB 5D5QA 3ROGA 3TDMA 4CFSA 3AILA 3F5MA 2EX1A 5LQDA 1QR2A 5DSZA 1YBMA 3L0PA 5AI8A 4F92B 1SUPA 3U7HB 1N0HA 1P8AA 2FN4A 2IIQA 5F2NA 3RBVA 1D1PA 3JQGB 1YBAA 3EGCA 4OP3A 4C0JA 1FX0A 1YI8A 2C5EA 2RC5A 4Q7MB 1H1LB 3IS3A 3WP1B 2BBTA 5FOQA 1HDCA 1W6UA 5AHKA 4B47A 2QTCA 2XWBF 1ODIA 1CRQA 5A9SA 1K9SA 4N0DA 1E4YA 2QVZX 4KRYA 1ZWKA 2XNHA 4TLBA 2H57A 5AJWA 2FW1A 4BUJA 2OSBA 2XOKA 1PFUA 5H82A 1U8XX 3VO8A 2VZ9A 2QP9X 1SXJB 5IUJC 1GPDG 4PZCA 1OKKD 3CINA 5ALGA 1JHZA 2O7QA 3ELWA 4HCJA 4YRJA 2PUCA 1R0WA 1YRBA 1JSZA 4N18A 1QO7A 4OQMA 1CDZA 1XROA 4O0LA 4OQXA 2R87A 1BQ4A 3KZ1E 4Q48A 3FPAA 3INYA 4DPLA 2XKBA 2BFWA 3K9HA 1XAIA 4Q4LA 1TUGA 2VNAA 3MHPA 3ANNA 2V8BA 4BKRA 4AKIA 1P61B 1GO2A 2O0LA 3IESA 4TS9A 2HFKA 1CPYA 4MQFA 2PZBA 4BMCA 3EXG1 4CMHA 2HJRA 5EP2A 2J3IA 2POQX 4QYWA 4F2PA 1AQ6A 4EZBA 1JEDA 1XOIA 1W87A 1Q91A 4UHBA 2NAFA 3AUYA 5BN5B 2VNHA 4L8YA 1W2WB 4G1FA 3IUSA 3EQ2A 3IRVA 4KVGA 1XPJA 1T6XA 3UFXB 1VLJA 4MDYA 3Q8WA 4JDPA 3WK9A 2JLUA 1VKJA 5ALTA 1F0NA 4NIMA 3STHA 1TADA 2Q4BA 1UAGA 4H1VA 5DGTA 4JKOA 2WSYB 2XUPA 2I7CA 4P4SB 3O8RA 2D7JA 4R6XA 4AZVA 4WNCA 5K6AC 2IGTA 2HWWA 4TYQA 1R7RA 3LT1A 4WDRA 4HWOA 1WABA 4MUFA 4U2CA 1NBOA 4WLFA 1T5IA 4EGSA 4ZEVA 2WP8J 3HB7A 1F2VA 1LBEA 4LJLA 3HR7A 2FX3A 1MT3A 2GZRA 1CUXA 2ISSD 3A6ZA 3UAYA 2FPGB 2LV8A 4M9UA 3ZGYA 4MKHA 5JECA 2BW0A 3F5FA 1EUYA 4Q18A 3QY0A 5DGCA 5HIMA 1HE3A 1S2OA 3GUVA 3S70A 2J3QA 5JMPA 4R40A 4QVIA 1VRCA 1DAHA 3H2JA 3RVOA 3U4DA 5DBGA 4HAUA 4GPD1 4D0SA 2ZAMA 4Y67A 3KHTA 1GCIA 1G7SA 2AWOA 4KSYA 3B1FA 3EIWA 5G41A 3IVXA 2LRHA 1E2DA 4J7CA 3NTXA 2W2VA 4IQ8A 2H54A 3GX1A 1XLVA 4PANA 1R0ZA 1AE1A 1RQRA 2HIGA 2NT3A 2O3TA 1CCWA 2VDOB 4G5QA 4PRLA 1YL5A 2GLXA 2WU8A 3JYOA 3X1DA 4PBRA 1OUMA 5A5EA 3WO0A 2R3SA 5JNVA 3OICA 1KDZA 3TLBA 3U49A 5K5EA 1VL5A 4GT1A 3V1NA 1LPMA 2EKQA 2BE9A 2G1JA 4JJAA 4HVLA 1M6NA 4M0EA 3Q8KA 1M2OB 4PAQA 4B81A 3T5BA 4MKGA 1ZCFA 3WRYC 4QGSA 4ZZ0A 1F9AA 3ME5A 1O9HA 3A9TA 3TIVA 5GVSA 4BXOB 5MN6A 5I4IA 4NJOA 3BICA 3AHGA 5BQFA 3MWDA 2W6CX 2HA7A 2HHLA 2RHJA 3NTRA 4LRTB 4R16A 4PR0A 3UHJA 4EVIA 5KYYB 3GLGB 2OHIA 1GY8A 3RSFA 1W5TA 2C57A 1PFWA 4IOMA 1P2GA 4WN9B 5DM60 3WKDA 3RI3A 3WGGA 1GT91 4O08A 2PUFA 1EDDA 1ZK2A 3WIDA 1WUYA 3D0QA 2G9NA 4JVSB 5DE3A 3VR5A 1CEXA 3GG2A 3T3IA 4BCCA 5KOHB 2FOXA 2ZAOA 1Y9AA 3NWBA 3HKBA 1RI1A 3KHKA 1EWKA 3G13A 4DTIA 1QHHA 1AZSC 3T94A 3H5AA 1L7NA 4EHLA 4FNGA 2WUDA 3BRSA 4XUDA 4TMTA 2I87A 5IBPA 5IKOA 5KI6A 5DTIA 1IJFA 3ASVA 3FRHA 4S1VA 4XVCA 1FLNA 3U09A 3CMCO 2BFDB 2Y1EA 1MAUA 1Y7HA 4WJKB 4CGZA 1DV2A 3FTQA 3HI4A 3LY7A 1DX4A 3B89A 2QW8A 3WQBA 4MWZA 2QRVB 3EXAA 3OLVA 1EIWA 3E9YA 4F91B 2WE7A 4YUAA 3AETA 4X97A 4YCDA 2V74B 2IV7A 1N36B 4XQ0A 3T3MB 3LUKA 2YW9A 3IB3A 4TT3D 4IBOA 1QYCA 1C1XA 1DB3A 2PM8A 3LH5A 5D51S 5HP4A 1ZIOA 1MX1A 2LXNA 3OT4A 4K8RB 1X1TA 1M6VB 2ODTX 3AKCA 1A5SB 4P82A 5CK4A 5EWLA 5BO5A 3ROFA 3GCWA 3BB1A 3II6X 2IDJA 2WVJA 3OPMA 2O23A 4G0QA 5FL3A 1CEEA 4NJMB 1T9KA 5J23A 2X3YA 4U2KA 4W7HA 4XRGA 5DYIA 2O5EA 1VG1A 2VL7A 4J4TA 3LBFA 1CE8B 1O3YA 3BVPA 1QNLA 2IUFA 3HKDA 1U3CA 3HWX1 3JQAD 1TZ2A 3TM4A 4PLFA 1HSZA 3PPVA 3N7TA 5CB0A 1XYGA 2ECPA 2O2GA 1EP2B 2H1SA 1BYUA 4AF7A 3R77A 1E2HA 1FDOA 3DGEC 2D1FA 3HJHA 5BWOA 1IN7A 2ZROA 3MPUA 3V9AA 5J5CA 4ESHA 2C2KA 2C8LA 5G40A 2AJ8A 5LMUB 4CQMB 3ZNPA 3JPYA 2JARA 3OTHA 2G7MC 5AVVA 4O2LA 3RUIA 1PJCA 1GQOA 2I4RA 4JOQA 3JARB 1ORHA 1HO3A 1SIUA 1KSJA 2O3SA 3K0FB 3NIWA 2P5YA 4JJ8A 4UMVA 4BFZA 3MERA 4A5SA 4PNZA 4NBRA 1AKQA 2HREA 1ATZA 2Y2UA 3QKIA 4GGPA 1LPAB 2QUHA 4ZO6A 3TOCA 3WLRA 4MCJA 4JT4A 1E92A 1JLKA 1KEWA 2Z2JA 1KK2A 4CR6A 5KYNA 5CUQA 3V32A 3DG9A 4JXKA 4JH0A 3NGXA 1U2TA 2QRKA 3OPNA 4R0VA 1ZICA 5DISB 1O9GA 1VCOA 1Z5OA 2P1DA 2SCUA 2XB4A 3M83A 4ZN6A 1DIAA 1XQXA 4PEVA 2HHCA 2N47A 5AW6A 2BJHA 1FU7A 2C7VA 2JDIA 4G0YA 4HGZA 1GTJ1 3FTPA 2NU9B 1WKCA 2VHQA 1P1FA 3IKVA 3L1KA 3U0BA 4X64B 1LV8A 4Q9LA 3D3NA 3RC1A 1YFZA 3SI7A 5IZCA 2YFQA 4DCCA 3W77A 5L4LA 1P1CA 2K4MA 4K9NA 5JNRA 3KOZA 4I4CA 1EBFA 2J9RA 2YN0A 3DTVD 4K28A 4J3NA 1M75A 1WS6A 3Q6IA 1BCSB 5CDHA 1BW9A 4NABA 4IDOA 3OZWA 3R6WA 4WMLA 2P4SA 3DDZX 1T25A 3COVA 1U4OA 2YJ5A 2IEGA 1Q16A 2WUVA 3TXAA 1XRMA 3N74A 4HYTA 4IIFA 4RMIA 5CCBA 3AY0A 4ZC8A 1IHOA 3TLZA 2COEA 2IXEA 4MLDA 4H08A 5FUVA 2BKLA 2H51A 3W34A 4D4IA 4GXNA 1N5JA 3IVGA 3L8HA 2CSXA 3IAEA 4JHLA 4AYTA 4TXHA 2PUEA 4QECA 3WL3A 4CTOA 2CE2X 1JUDA 4B3FX 1F7UA 3FNRA 4UFPA 2H07A 4YJGB 1FUEA 2GO7A 2FMKA 4EHKA 3ORQA 3LPLA 3VO1A 1VKHA 5AFSA 1OH5A 2YJ3A 2QTHA 5CNKA 2LIVA 3WYAA 5EEGA 5LZ7A 1EWRA 2NZXA 4PM4A 1FTSA 4AWBA 3TUIC 1SHZA 4GBJA 3VAAA 1Q7EA 2IZ0A 4IDHA 1IN4A 1TO6A 4LZJA 5EZ5A 4HV4A 1BO6A 5FP0A 1YL7A 1TIBA 1AGNA 1IZ9A 5LA6A 5AYVA 3UJDA 1XNJA 3D0RA 1GKUB 1ZMRA 3A31A 3VOSA 3QG5A 3IDZA 3M8KA 4EZIA 3P4XA 3ZCVA 3KJFA 4H7EA 5AESA 5KTMA 1XEWX 1KO4A 4TSFA 5ALLA 1QG6A 2FEWB 2OFPA 3GGGA 4R9SA 4UNPA 1YVDA 3GWZA 3RTAA 3JAKB 3VH3A 2ZTHA 4CTKA 5CA1F 4EECA 5KWVA 4QJIA 2ZJYA 2EYQA 3R0XA 3I92A 3W7BA 4RA6A 4XVQA 121PA 1I94B 5TNXA 1CUAA 1U0GA 4BX9A 2J9FA 4CQJA 4E7OA 4RSHA 1I3LA 1K0FA 1ISFA 2H1OA 1U04A 2R8ZA 3GCGA 3OOYA 2I2XB 1U0LA 5LXTA 2Q9BA 3NHPA 3DZ8A 2P30A 3IR6A 2XDYA 1M34E 1Z6ZA 1NUUA 2NUPA 1P5RA 1I4DD 3BZBA 3R3SA 5GJCA 3WXBA 3W06A 2WU3A 1J22A 2R9VA 4QJ3A 4NU5A 5AKHA 3BWVA 4HH0A 1MQSA 1N57A 5FR1A 3AL3A 4QGAA 1XU4A 3JWHA 2QE7D 3KVYA 5B1EA 4OOEA 4GAEA 3RYCB 5ER9A 2B98A 2VSNA 1JXMA 2YW2A 5FPPA 3BE6A 4H35A 1AKEA 3H2KA 2I5PO 4PLHA 4ON9A 3D6TB 1Z0AA 5H3LA 1F06A 1K4MA 5K8CA 1U2QA 2YV5A 4GOJA 4P7FA 3HCOA 3L04A 1E94E 1XC7A 3HBAA 3KYJB 1H8EA 1AA9A 1D09A 2W6OA 4TTPA 4B2IA 5L51A 3RS8A 4RTPA 1YHYA 1BYIA 2NQTA 1KP2A 1PWHA 1KI6B 3RTBA 3LUFA 1EUCB 3TQIA 1CR4A 4DDKA 3VMFA 4F1JA 3QBDA 2YJGA 4GLOA 1PSWA 3GRCA 5D01A 4DIBA 1N8SA 1X8JA 2BKUA 4OX9Y 4IWXA 2DBVO 4XPZA 4ND4A 2B82A 1BEEA 1NHGA 3NH9A 1B3BA 3K9LA 1ECGA 1LC0A 4N82A 5GONA 4U9UA 3B13B 1ISPA 3KD3A 1E1QA 1DNPA 1HE2A 2IA5A 2O57A 4GQAA 4LXTA 1TC1A 5JDIA 4HZIA 4Q00A 3UTCA 1JQAA 1Q1EA 5KYKA 3UJ7A 1ND5A 2WZQA 2PKXA 5F51A 5KX5A 2O2CA 3H9BA 4KH1A 1GPKA 2MSWA 3N86A 4GBED 3KZKA 3ZGLA 4A16A 3AEQA 4FX2A 2R47A 3I83A 1A3CA 4MW0A 2C29D 2PR2A 4IQ4A 1GITA 4UHFA 5JCOC 4L28A 3LMKA 4L50A 4Q3KA 5KVVA 3W1WA 3ET5A 3ZHUA 4BU1A 1A8IA 2DUJA 1VKRA 5U4QA 2X3FA 1NASA 2F1JA 1UDWA 4AZ0A 3K09C 3BH7A 3NPMA 3WNQA 4YRCA 4DEXA 3G3EA 3VTKA 1GTRA 5U1PA 2I99A 2X0JA 2XV1A 1JT9A 4CU5A 1GNRA 4I2NA 2QRQA 3FR7A 1ADGA 4XSHA 3X1WA 2ZYUX 5THKA 3H6HA 3LUGA 1QCDA 1YTLA 2DT5A 1CB7A 4NYJQ 2VYND 5H59A 4EKIA 4JBNA 4H3VA 4YX9A 3R3VA 2F55A 1KAOA 3UATA 4G9EA 1RYDA 1PR6A 3HG7A 2PWBA 1N8KA 3ZUPA 4MHSA 1D9XA 4Y1EA 3OQIB 1RAAA 3IQDB 1D3AA 3EF3A 5H9VA 4A5OA 3WKEA 4OHUA 2E6UX 2PV7A 3AM1A 3GFGA 4GUAA 2QF7A 5FWYA 4MW5A 3A8TA 3GMIA 3BE4A 1O6BA 4PWYA 5EJIA 2YZMA 2HHHB 2PLNA 3DZJA 1YR6A 4FMDF 4L4YA 4F21A 2VJMB 3BEOA 3OI7A 2O7RA 4MUAA 4RY2A 1FP4B 3E4CA 4X24A 4HR7A 4BNTA 2B1JA 3L41A 4P31A 2YZKA 1CUEA 5AW4A 3QTBA 1G59A 6ADHA 1CEYA 1W2HA 3MM4A 3VZQA 2RHCA 1OH7A 1FJGB 4C4YA 2GQ0A 1F2UB 4G26A 3H99A 2F8LA 4FFWA 4RIHA 2YXBA 5DASA 5AUNB 3K20A 3DEKA 3KXLA 1DHRA 1BE1A 1OV4A 1H2WA 1Q15A 1E8DA 1V9SA 1Z6GA 3C1OA 1FTGA 3K9QO 1T4MA 4LCJA 1RZVA 1W9HA 5DWVA 3WAKA 3ZN2A 2WJGA 3I01M 3GLFB 4MUJA 1EE2A 1NVVQ 3B6KA 4GOOD 2NTEA 1O95D 1K92A 2Q0SA 4RD0A 5G3ZA 3PFCA 4DUPA 4R4JA 1IVYA 4I6JA 2CHFA 1H2FA 2JFBA 2IT1A 3BGIA 4LE1A 4P2BA 4JYAB 4OEHA 1P9RA 2V7UA 2J7KA 3ZDYB 3VUFA 1IQPA 3ESBA 1C3EA 4M9SA 3CN7A 3HXTA 2V4UA 2OM6A 4IKEA 4JLMA 5ICFA 1FA9A 1B4DA 4OXNA 1THTA 3GUCA 4RVUA 4W9RA 4IIJB 5AVYA 5J4VA 1H9BA 1XYVA 5EE5B 2WYVA 4TKZA 5DW3A 2XTZA 1JIUA 1X1BA 2RHGB 1SD2A 4F3KA 4CMIA 5BN3B 1UDCA 1H8HA 5KU1A 3PA8A 2PUDA 1GOTA 3HA3A 2BFNA 4EG5A 3DHYA 3K0SA 4OCZA 1GGVA 3ZZUA 4U39A 3ET4A 1SOUA 3DEAA 3O4GA 3DS8A 1U7OA 3LRPA 4US0R 2G08A 3DLIA 4GNKA 3L0SA 5LDDC 2CDAA 4HWPA 2ATIA 2REOA 4BNLA 1NVEA 3JVVA 3R44A 4ZZIA 4BNVA 3O8OA 2GXAA 3HDHA 1T2AA 3K2IA 4FT4A 4JELA 4HZUB 3IQFA 1UBJS 4UC0A 4EYQA 1IL0A 2NO0A 2ZYGA 4RH1A 1CR6A 1K8XB 3VPGA 2HV8A 1KEPA 1GVHA 2J0VA 3LL7A 2AA3A 1NF9A 4HAZA 2FMUA 4UE6A 3G89A 3LSYA 2UYGA 3OF5A 4I46A 5HKKA 1BVYF 1CRZA 3BREA 3PNPA 3NX4A 3QW4B 4YTEA 4OI2A 3ZTWA 1Y4SA 4GEGA 5HILA 4AC9A 2G0AA 1JWBB 1SXGA 4FC7A 1LA2A 3I0ZA 4K2AA 4QYMA 3UW3A 1HE5A 5A06A 2JI8A 1M0EA 2ZR9A 3K15A 1WHTB 3EVNA 3FHLA 4YMUA 3LK6A 1Q22A 3OIFA 4O2RA 3TRKA 3DKKA 4QYIA 1A8HA 2NUTB 1KO8A 3MLAA 4JVOA 1LXCA 1LLFA 4HEQA 1SPXA 2CN1A 3G23A 4GNRA 3EMDA 4MB2A 1G19A 5UKDA 3WMGA 4AK9A 1E6MA 2C7PA 1QHIA 5DK6A 3ZE7A 3UMCA 3MSCA 1N33B 4JLWA 2X7HA 5DGDA 4MS4A 4PSCA 1MENA 6NULA 1BX3A 1MO6A 4OV6B 3C87A 2VPPA 2RHTA 4D41A 1XKXA 1UT8A 3CH6A 4J94A 4ZYUA 3OT5A 1T6BY 4AZ3A 3QJYA 4G6ZA 1OYYA 2BFFA 2H7CA 1XTJA 2FZEA 3CR7A 1EA7A 1VMDA 4JJEA 3FDZA 1TGYA 2XRFA 2EFEB 3BMQB 4N6GA 1DC4A 3L1JA 4MRPA 1JG7A 5IJZA 1HDXA 1NBIA 2QD3A 2EFDB 1SC1A 2Q6KA 3HBFA 2VDWA 1JZTA 4U4AA 4J0DA 4RGYA 1XL0A 2Q0XA 4LYYA 2VH5R 2FWJA 1KRHA 2MMCA 1WV1A 4QQNA 4B3MB 3D8NA 2QDXA 2PKCA 1RTTA 1SG0A 3DTNA 3RADC 4R2LA 1F2TB 2FPKA 5CT6A 1KYVA 5BSFA 3B1ZA 4NMWA 1SM4A 4B80A 4F5YA 4RKEA 1W0KD 3I2FA 4IAOA 4EW2A 2BZSA 5HHTA 3GFSA 1CQXA 1O94C 3WNDA 1CJKC 2V96A 1I4OA 3RUAA 4C5AA 4KQFA 2GBGA 4EB8A 5B1SA 1LLCA 3EXIA 4BFLA 4JI1B 4BP9A 1XDGA 4B35A 4IUCS 3PJEA 4V2UA 2YFYA 1XZFA 1K6JA 1NU6A 3FLAA 3OIDA 4ED9A 2G5PA 1X9GA 3GIWA 2IBMA 1QO9A 3BN3A 5FI1B 3VHXB 4F85A 1C8KA 1PU2A 2FW8A 2RCYA 1USIA 1IBSA 3IHKA 2FSFA 1PZXA 1SNYA 2I65A 1DO2A 1EFKA 2NV0A 1GAEO 3BFPA 3CURA 3DCYA 4K9PA 1KOGA 5EPOA 3L7YA 5EJFA 4B09A 2Q45A 1Q5PA 3LD9A 3RFCA 2VP0A 3PQDA 3S2GA 4C0AC 1L4FA 2ZR8A 3GJSA 4J29A 4YXWA 1DTEA 5E6UA 1ZY2A 4MWBA 2D1YA 4W7SA 5EY5B 2W6ZA 2E4YA 3P2OA 2WDZA 2HRRA 3QU4A 1MV5A 2P62A 1Q7BA 1LRLA 3SC4A 5D3QA 3Q12A 1PYOA 3WL8A 4U7WA 2GVDC 3BGSA 1HEUA 4GI1A 3ODGA 4BL5A 4MO2A 1QOPB 2HN9A 4TLEA 1LKZA 1V71A 2ZDGA 3D6NB 1MJFA 3IYLW 4TTIA 1HOXA 2PVCA 5FA8A 3UOWA 4WINA 4EHFA 5CBPB 4LMBA 4HQ6A 1OYOA 3BIWA 1FMTA 3FOCA 2JW5A 4O2BB 2WJHA 4X45A 1SULA 2B69A 2R60A 3EG9A 2JASA 4K6HA 5K4AA 3K53A 3EFOB 4R54A 2KYRA 5ECDA 3OCXA 4GOKA 4Y6PA 3ELDA 2V7GA 1SK8A 3GD5A 4AP6A 2KMLA 1JYEA 3B9QA 4GLLA 4OI0A 4HAIA 2AD1A 1NUQA 1M8FA 1JDBC 1CNFA 1Z4OA 4PTLA 3GZNB 5AHOA 5BN1A 4UD2A 4UDXX 4KXNA 1T9BA 1J9ZA 4QOSA 5ALOA 3QUTA 3BIXA 4KGVA 3KU4A 4CV0A 2Q7XA 3R24A 1SUCA 5DV9A 4IDAA 4Q0MA 1M6WA 3HMKA 2B8JA 4DT1B 4O33A 5LDHA 2CV1A 1TK9A 2C4MA 1XDSA 4FDLA 1TC2A 4WZAE 5EJ7A 4TMWA 1O96A 3C3MA 4Q4JA 4M8SA 1G5HA 1RQ7A 4FFBA 1RQLA 4GWKA 5EWJB 1X14A 4XOIA 4ZK6A 4UQPA 4Q02A 4BKOA 1LZLA 2H06A 4EFNA 3CGGA 3VKHA 4Y9DA 3WQQA 1U2SA 2Z9BA 5LA6F 4J6FA 4FHGA 1CQPA 3MEQA 2HQ1A 2KHZA 1E4EB 5KQPA 5I8WA 2B2CA 4JJKA 3L6EA 1RKUA 4P54A 3D3WA 1G55A 1F3LA 4MGZR 5EIFA 3SN6A 5EIEA 2W4MA 421PA 1PL0A 4DVJA 3CUUA 1P8JA 1G3UA 4LZLA 5DGXA 4PZZA 2G8LA 1V8DA 3IVMA 4Q5IA 4D4MA 1OIVA 4W1PA 2ZU6A 4FW9A 1FFXB 2GM4A 3SU8A 4ZK2A 3BFXA 1EDOA 1EFVB 2RAPA 1J2RA 3NRJA 4QICA 2EZTA 4OFXA 1G5PA 3A1VA 4N5HX 4QBHA 5ALSA 2YHIA 4YUYA 5C4IA 1KSFX 4ZT4A 4FIZA 3UJ9A 1L4EA 1RMTA 2BFCA 5DN6D 1XVUA 2UUPA 1P1IA 4QDXA 1B73A 2CVOA 4I4TA 3T7CA 4Z7NB 4KR3A 4XWKA 5EQJB 1JB9A 4IFTA 4BP1A 4PLGA 1XXLA 1N7GA 1T13A 1Y9ZA 1M34A 3TLGB 3V1TC 3GT0A 1KAMA 5F3RA 4GSLA 5TLSA 3BRWA 1Q7CA 3HN2A 2OC9A 3OC0A 1VHQA 3KJZA 4RAQA 1RTKA 2EBFX 5TQ0B 4XWGA 1RHMA 4FIDA 4HDRA 4ZYWA 4LJRA 3LBAA 4WKCA 2XDWA 1Z82A 2XDQA 3E0QA 3G5UA 3B48A 2VWGA 1LDEA 1GTVA 3EXFA 3T7KA 3CCFA 1H3FA 1Q11A 3G7NA 5B3JC 2N1MA 3RT9A 4XJXA 5COAA 3M2PA 3HMQA 4Y8VA 1LTHR 1X7WA 3N2YA 1MB3A 3GLUA 3MRXA 2C7BA 4JLDA 3NOQA 2WKRA 1FC0A 1KVRA 3OD5A 1M3SA 4MEJA 1OFHA 1JTFA 221PA 2JBAB 2P6PA 4MKRA 3LVBA 1HL3A 2KSQA 2NZWA 3V4SA 2Y4OA 3FM9A 1DV1A 2XCQA 4JQOA 3GLIE 4MA4A 1S3IA 2FSVC 1XHEA 3QNWA 3OECA 4L0DA 2FK7A 4RYLA 5ALUA 3U3ZA 4BNYA 1STOA 2A5YB 1ZITA 1Y7LA 1RPNA 2RGBA 5C46F 4M7PA 3CMMA 1SU6A 4J91A 5IK2D 1JJ7A 3F7TA 3QA3E 4PPQA 4LTNA 5EJGA 5BNTA 3INNA 4PHGA 1UMCA 1BOFA 1ZRNA 3W7AA 3CS3A 5CIQA 4A8JA 3A2KA 1IBCA 4DA4A 3F97A 2EKLA 2H2FA 4OP1A 5FCDA 2L0XA 3SYRA 3H9QA 4FXOA 3PWSA 2J5RA 5JD4A 3X0DA 3QUCA 4F12A 4NV0A 5JCPA 2J6HA 4G8CA 1OU4A 1BCRB 2F3SA 2QBYB 3SP1A 4D0GA 4B3SB 3UXYA 2GSWA 1L4YA 1NUHA 4JKIA 1J8DA 4JROA 2A78A 1N5MA 3IAS6 2J8ZA 2HU2A 1QLWA 3D9QX 1E58A 1MVNA 3LLMA 3OKPA 4IJVA 1TZCA 2A0UA 2PZFA 1PG5A 4QOGA 2P5TB 3U19A 3MAAC 3COPA 4P83A 1NC1A 4L9WA 1T1IA 5FPSA 3FB1A 2EYUA 4B3CA 3T06B 2IIVA 3R7WA 3R3ZA 4NARA 3OH8A 4BVKA 3LRTA 5JAZA 1KHTA 3L0CA 2QTWB 4PBTA 3T4XA 3RWOA 4ZTUB 1PW5A 1MB2A 4W1RA 4XZ3A 1KK3A 5KO2A 1EVZA 1JEOA 2OZLB 1I3CA 1NMQA 4D5EA 2Q99A 5CT5A 5KQMA 2CXSA 4U7FA 2QJFA 1PT5A 3DWEX 1SKUA 1MW9X 4OLBA 3AX6A 4KV7A 1YFLA 1VIYA 2FRDA 3LOQA 3QLVA 2EIXA 3K1YA 3OQ6A 1N5LA 2F3TA 1X13A 2GPTA 2WWFA 2QAJA 4RJLA 2F9LA 3RFFA 4IIUA 2D1RA 3E2MA 3LFUA 4UQLA 1VSUA 2I76A 2QTFA 4P7JA 2BEWA 3DE0X 3H13A 5EMKA 5EWMA 3IUMA 1QB8A 2JBHA 2QP3A 4BLWA 2XUHA 1HUQA 2YJZA 2H9AA 4O1IA 4QAQA 2AOVA 3ZDXB 2QGNA 3JWGA 4N01A 1KMHB 2NTYC 5AVRA 4B84A 4KR2A 5GM1A 2GN9A 1YVUA 2EVWX 1CUBA 1NTRA 3JTEA 1P9WA 1RXIA 5EPUA 4W99A 1PD1A 1CJVC 3ZCXA 5JZVA 3NCHA 4JJ4A 1U02A 2ASVA 1HDIA 1K2WA 3NETA 4ZYYA 4F4JA 1HT3A 4LY3A 4YYEA 1FS6A 2LUOA 3C7KA 5EKDA 5CB6A 4QFMA 1N9GB 1PV1A 1VPEA 2B4YA 2HTFA 3DO6A 3SR4A 1XEXB 3I8SA 1ENOA 2VSOA 2WHPA 3HYTA 3O3MB 4W4TA 2NADA 2BFEB 1NSFA 3NT5A 1XRRA 4ZMBA 1DP4A 2A6PA 2BT4A 2C98A 2IYOA 3GVPA 3QM1A 3OZFA 5EIOA 2D2IA 4C6TB 1ZISA 3QE2A 1QWSA 2EJVA 3HB1A 4EW3A 4NPCA 4INZA 4B17A 2Z4TA 1ESNA 4U00A 5HDBB 2ORWA 2VLIA 1UC4B 2R8OA 3PX2A 3B70A 3QSGA 2ZRGA 4L8VA 4BLOA 4EUKA 1NW3A 2DR2A 3HYCA 3WYBA 1W5SA 1P9LA 2WIAA 2WG0A 2YN2A 3DUFA 3EGIA 3KKQA 3O74A 2I80A 2VQ6A 3PNOA 4OU4A 2V7QA 2R1VB 3CB4A 5EESA 2FW7A 2N75A 1E4VA 3GW8A 1YGPA 1HLFA 2VPQA 4FMPA 5JCXA 1SC4A 2JKYA 4NYIR 4ZVVA 5IAJA 3RIGA 3ZGZA 2SHKA 3M3PA 3ABRB 3PHHA 4ZEMA 2YV3A 4XDYA 1JEQA 2GD1O 1UL1X 3PC2A 2O8FA 1K6XA 1Y89A 4NNPA 2NTVA 3TD9A 1DE0A 2Q2WA 4EF5A 1WG8A 4FEYA 1P6UA 2NSHA 5FBRB 1KTIA 1PZGA 1XA0A 1LVGA 2JGEA 3A3PA 2P2YA 2PZAA 3F6EX 3RU3A 4ZDWA 3QXCA 1X1RA 1G8AA 2YH2A 1JG3A 3C8HA 3KQHA 5LMZA 1DT5A 4NK4A 3FUCA 2WWGA 4R9VA 1FMLA 4GR4A 5G53C 5HVNA 1T1RA 5IM4A 3NBZC 2M32A 3FHJA 4E03A 3TLEA 2JATA 2E4VA 2E9SA 3O90A 2Y2VA 5JO9A 2FPPA 5HZKA 3AKZA 8MHTA 5JFGA 1XZQA 3O1JC 3UYKA 2H2IA 4GXTA 4RL6A 4AZTA 1XDWA 4R1QA 1HR0B 2PTGA 1D8AA 1B6RA 4Q3BA 1PHRA 4KUGA 3KJGA 3L5OA 1RYHA 5BV0A 3EGWA 3LUJA 2O48X 3TR5A 2YOFA 3WMEA 1AKMA 1XZMA 2XB9A 3O1LA 1C9KA 4Q66C 5CTJA 5TR9A 1XALA 5I4KA 2R86A 5H3CA 2OXRA 1E7QA 1KEUA 1N2CB 4BVFA 3IP3A 2UUBB 4AXBA 2HPHA 1J56A 3B3QA 1ZLXA 3ZWYA 1C41A 4B6RA 4FKMA 4JL8A 4Y2HA 4BVGA 1B0PA 4ZU1X 1P4JA 3DFUA 4POAA 1A4XA 1LUAA 4FFOA 4KGDA 3KR1A 1FYEA 1POXA 2PZJA 2HK8A 4YCJA 4EWLA 4C20A 1VE7A 3VV3A 1PW7A 3OVMA 5C9ZA 4LQDA 1SVWA 1UC8A 4K2HA 1JLSA 1P91A 2NTNA 2D4AA 1ZVJA 3QX9A 4TXNA 1ESDA 2HSWA 3JQRA 4YA6A 3DV0A 4F4IA 2I6XA 3FPFA 1HEYA 1IJEA 4MP6A 5FF9A 4TYYA 2CC2A 2NXEA 1T36A 4R3UC 3V4ZA 4YECA 5JQWA 5A0VA 3W8NA 4PF1A 3SVLA 3KXPA 1XPRA 4TSRA 3VPDA 2GCEA 3PJGA 3WGKA 5ITSA 3JAWA 2XQFA 1P7ZA 3PF8A 3A1UA 4RPLA 3SBDA 5CPBA 2DBYA 3CY6A 4B6EA 1R37A 3NP7A 4B71A 4C6SA 2UYCA 1BEZA 3B53X 1PVVA 2O8DA 3HH8A 1UEIA 2O2YA 5H5JA 5K3BA 2Z95A 3KTOA 2A14A 2AZDA 1V8PA 5AVQA 5A3QA 3K0KA 1QE0A 1JR6A 4UREA 5BR1A 1EDEA 3GJZA 1T0PA 2EWMA 3TRFA 1ZGHA 4OH1A 3CKKA 1RPTA 1LBHA 4KR9A 3HSSA 2I67A 4LXUA 2ZYSA 3SLKA 621PA 1EWQA 3TYXA 5JD3A 3ROXA 4DMMA 4LXIA 1I0LA 3ZWWA 4YRKA 4BKQA 1HYHA 1Z6TA 3L1VA 1A0OA 2W2LA 4OL0A 4WZ6A 1E7MA 2C61A 4J0IA 4OFWA 4JLJA 1C4KA 1JHAA 4CYMA 1W5EA 3AWIA 3C85A 3D64A 3RF6A 3UJCA 2ZANA 1DTSA 3ZDFA 3S44A 3S28A 3UGJA 2J7PA 2Z83A 3FAKA 3ESAA 1QYRA 5A03A 1D6NA 1DJOA 5I4BA 3KFXA 1ML4A 1VXRA 2IUUA 3ZW8A 1E3IA 4DCOA 3FWNA 3A1NA 1Y5LA 5CFQA 2Y0CA 2ZUTA 4DV7B 1E7YA 2R97A 2PBFA 2XQKA 3AGQA 4IW3B 2RE8A 5GVRA 1D4ZA 3RROA 1OPRA 3KKKA 3PDIB 1GG8A 4DCJA 5ENVA 4HN9A 1CR2A 1V8FA 5TMBA 3GPBA 4D9CA 3NS7A 3DBRA 1DKRA 1RWWA 1U3UA 1W73A 2ZRNA 4HXGA 3UB3A 1XMIA 4NCAA 1DLJA 4B76A 2C4HA 2JD2A 4C4AA 4CCSA 2X5KO 2QTTA 2FXIA 4HBZA 3NG1A 5AM0A 4D96A 2EIHA 3I62A 2DWQA 3I6MA 3K1JA 4HNRA 4R31A 3IAM1 4OQ4A 3HGMA 4MV5A 4M22A 5AUQA 2CUZA 2I2WA 4MX8A 3VOTA 3N3BC 2P2CA 4K0RA 2CVQA 5BSTA 2PZMA 4IDQA 3LIPA 4X1OA 2Q8PA 1ZCZA 2J09A 4LVCA 2J07A 2D0OB 2WKQA 1YZ3A 3I0NA 4R8RA 5K8VA 2P4UA 1L1RA 4QDUA 1P31A 2IU6A 2WAYA 3K32A 4CODB 4BE7B 4XYLA 1ZSYA 5JXIA 4DLTA 1GTZA 1VLLA 2DPYA 4N8SA 2ZIXA 3ORRA 4CLRB 4F8YA 4G24A 2WJ4A 1FCJA 4GI3A 5JALA 1RPZA 2IUYA 5KREA 1X70A 1RJFA 2PUAA 1WZEA 3QFHA 2G1PA 1SURA 1Z4PX 5IJ9B 2ECQA 2C95A 1AXGA 2WJVA 2QQGA 3E7PA 1TMOA 5BR8B 4G0OA 5ENZA 2A5DA 1XD9A 1WV0A 1I51A 3BJEA 3T3DA 1QH0A 4A0RA 3SLRA 4C3UA 2X0IA 3ZD6A 4QUJA 4QSMA 2R5WA 3BMNB 4F3CA 1E6WA 1RACA 2ZRHA 2PMEA 1N5DA 2QI9C 1G4AE 1RD4A 3MCVA 5K8LA 2PYZA 4FGWA 4G37A 3GGJA 1DQZA 4KQ2A 4Y1GA 4F5DA 2FPWA 3LDGA 5I51A 3FXAA 2Q62A 2ZTSA 1V11B 3GLHB 3ZLTA 3L1IA 4REQB 5FFNA 5B6IA 4NKRA 5KNBA 4U2DA 4OGWA 1T0UA 1QVZA 4M86A 1MNQA 2Q41A 1CS0B 2IDZA 5KNCD 3HDJA 2QYTA 4BWVA 3BA6A 3L43A 2CE7A 3T9DA 3IURA 1KERA 2VZEA 4D0RA 2J32A 2OHJA 1FF9A 1P81A 2PL9A 1EGVB 1G18A 3DQZA 1X0VA 4N0QA 1TTPB 1JH8A 3W8DA 5EE0A 3DOCA 2Z08A 3E2PA 3RSHA 1RFLA 1TF7A 4MV0A 1GSHA 3M6XA 3AF2A 3AP2A 1FTYA 5D8DA 5BOVA 5IBCA 1CY1A 4UCXA 3FBWA 4XQ9A 1SAYA 5KTYA 3CT6A 3EDOA 4BAZA 4AT1A 3G2HA 3K70C 2QUBA 1LX7A 2P9EA 2GN6A 3CEHA 3WGMA 4I4TF 1HE4A 1LJUA 1G5FA 4XQCA 2WQ7A 1K6MA 2H4FA 2XCOA 1NNUA 1HYGA 2BE7A 4QPCA 4ZMRA 3RV3A 2PH3A 2W8BA 4URVR 5KVAA 2X1LA 3EVEA 2BSAA 3QVMA 3A6DA 5IU6A 4EITA 2IHKA 1QMGA 2ERXA 2V6MA 3ACCA 4E46A 3FLBA 3NORA 4XB1A 2I66A 1K7CA 4KO3S 3I6QA 4FN4A 4DKXA 2RHBA 4LJ7A 4ZHQF 1K86A 1ABBA 3MS2A 4K9MA 2O7NA 1OB5A 3TECE 1RI4A 2JGRA 4GFDA 4ZI7A 5CAEB 4YUWA 3MWGA 5LQMA 1MC5A 1GAWA 1MRSA 5DF1A 1QS0B 1VIDA 4HT3B 2FPRA 4K0KB 5CCEA 1KKMA 2D00A 2BTQB 4B2LA 4B3GA 4F1WA 1U11A 1AJEA 1IAVA 2HLPA 4BB0A 4QBKA 1RBZA 3AEYA 5EXXA 1AS3A 2WFZA 4N5MA 4NECA 1UOQA 2A5LA 2VYVD 4FHZA 3LG2A 4TMXA 5ISMA 3DVLA 1PR0A 3KLBA 2VJCA 3Q3JB 2XGGA 3NHLA 4KXLA 2P27A 1XRNA 2P6OA 1B23P 5DT2A 3TOVA 2FZWA 2VHEA 2XQJA 4UM7A 2EL7A 1QIFA 1GNSA 3BULA 4IUDS 3LYLA 4LYJA 2JZCA 5D3KA 5CCDA 2F4VB 5EE1A 4X1IB 1P4AA 3BEDA 1I2MA 1N1DA 4DR1B 4X7MA 3F8WA 3HVJA 1E98A 2PSSA 1Z5VA 3MXOA 4BZXA 1OROA 3CZ4A 4QXMA 4CHGA 4ZIRB 1GWNA 3FCSB 2LPMA 3S2UA 1C7ZA 4LSGA 1D2CA 2W2XA 1P4SA 4EA8A 4UOEA 2QGFA 4HRYA 5FEMA 3HB4X 4MW2A 1YJQA 4UU8A 3T7DA 5JQGA 4WERA 1DEXA 2YRWA 4L51A 2PE5A 3OWOA 3TOSA 1P1JA 1KIAA 1WBDA 3CVJA 4ER6A 3RIMA 3CW9A 3UK2A 2A94A 1G21E 1XMJA 1AZWA 3WE7A 1NRWA 4BVJA 2P9JA 5SZHB 1D6SA 4EHDA 1RAEA 3PUKA 3R3WA 3H3FA 3UMMA 3B9RA 3JXEA 3BGWA 4DQDA 1BFUA 2F1HA 3H19A 2AOUB 4TT8A 2IQIA 2AJBA 3IQWA 4MJLA 2H4WA 2QK4A 5TQ2B 3SNKA 3GEPA 5KU7A 3C4JA 4C29A 2IH2A 1U99A 5FPYA 4RH3A 3Q5DA 2GSDA 2B94A 2GWRA 3WAGA 2O0MA 1YZUA 2IP1A 4FEGA 1MQAA 3WGIA 4RS3A 2KBEA 3DE2X 1SIBE 1O8BA 1WXHA 4DLLA 4ZYVA 1E3WA 5KDOA 2A59A 4OYLA 3FTEA 1FK8A 4O29A 2HF9A 4WEQA 2PS0A 4KXYA 5IFKA 1QU2A 3WA7A 4XM1A 4AW9A 1XMXA 1QK3A 1GAXA 2IY8A 2IYAA 4BECA 3ICCA 3L4KA 3IB6A 3P0EA 4YJHB 3B2EA 3M1AA 2FWIA 3QPBA 4LOHA 1C4XA 2RHRA 3P94A 4PO8A 4MAMA 1T5TA 2ZYAA 4JBYA 1BFDA 2VJQA 1MU0A 1RC0A 1I13A 4UNQA 4YJ3A 2OZVA 3D4BA 2QM8A 5EVCA 3PX7A 1AQJA 4RGBA 1NYRA 5J2UA 3O4JA 4PQYA 5KJFA 4QRDA 4GZ6A 4WNAB 2ILVA 1GPWB 1YIOA 1QFJA 4UXJA 3MWLA 4ZP1A 8AT1A 4RV9A 5HXAA 2IU0A 1HORA 2XCIA 2H1HA 4EDHA 3KR2A 2ID4A 4FGUA 4BNGA 2ZQZA 5FDFA 1TXGA 1MG5A 1JQ3A 3MJDA 1W76A 1A9PA 2G5GX 2H1CA 4RORA 2FG6C 1QF7A 2F67A 4FP9A 2E4WA 4OK5A 4BC0A 1YBFA 4S1WA 2G07A 3N7AA 3BM5A 1U2PA 4BMNA 5F1PA 1ZA2A 1T3LA 2QAGC 2ZS8A 1CZHA 2I1VB 4TS3A 3RBZA 1QV7A 1JIXA 3MBOA 2YMQA 3DTYA 3ICPA 1M6HA 3GB9A 1XD2A 1R6AA 3OQMA 4M2LA 4E3ZA 2AB0A 1KKLA 1MLDA 2WJJA 3LLVA 2BEUB 4L7VA 2E4ZA 1PGOA 3OFND 4S3MA 3M5WA 3WDSA 4JP3A 1OX4B 2BM8A 2B1QA 1GM5A 3ONVA 3F78A 4QFDA 4RVCA 4L22A 1T5OA 3GVHA 5K2MA 4UASA 1Z88A 3PVZA 4AJEA 4CKYA 2W43A 2XNDD 3COSA 2GVZC 4TXJA 2B35A 3GEEA <