2QD3A

Wild type human ferrochelatase crystallized with ammonium sulfate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 143
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd3A01
1LD3A 1C1HA 2QD1A 2QD5A 1LBQA 2QD2A 2XVZA 4KLAA 2XWPA 4MK4A 2H1WA 2Q2OA 2XVXA 3W1WA 2PO5A 2AC2A 3HCPA 1QGOA 1N0IA 2PO7A 3AQIA 4KMMA 2AC4A 1HRKA 1C9EA 2Q3JA 4KLCA 3HCNA 2XWQA 3LYHA 4F4DA 2QD4A 2HREA 2QD3A 2XVYA 3GOQA 4KLRA 1AK1A 2Q2NA 1DOZA 2C8JA 2H1VA 2HRCA 1L8XA 2JH3A 2DJ5A 2PNJA 2HK6A 3HCRA 2XWSA 4CCSA 3HCOA 1TJNA 3M4ZA
chains in the Genus database with same CATH superfamily
3PQ4A 1EM8B 1AN0A 1H6BA 1LPNA 4LYEA 4O33A 4KU4A 2O07A 3A3PA 4HZIA 2A0FA 1T15A 1FFWA 2BGJA 2C04A 4P3YA 2F4NA 2GJKA 1JKFA 4GOMD 1VMAA 4HMPA 4ITRC 4DG9A 1GYRA 4QJ3A 3M6UA 2FDRA 1JQDA 4ITUA 3SIWA 2X5JO 1Z0UA 1UXIA 3GJXC 4E70A 3K32A 5B57C 3ZVNA 2OZKA 3BRWD 4P34A 4ZVUA 1Z28A 4H6XA 4Y9RA 3KQHA 1Y6GA 1R27A 2HDHA 3KKLA 1GN8A 2PX0A 4DB4A 1VFPA 3EXHA 4XDGA 4QG3A 5AKIA 1RLIA 1VL6A 5FBKA 3PD1A 2ZPUA 5A3SA 1USUA 1VA4A 4PO8A 4UHKA 4C2AA 1ECCA 2HWKA 2EG5A 5ALQA 4RD1A 4RX1A 2IYQA 1FFCA 5A4JA 4A15A 2OORC 2HPHA 2IEBA 4Z4CA 2PUCA 2Y1DA 2OCXA 6AT1A 5B37A 1U2QA 4PX9A 4YDSA 4IF4A 2PKYX 4YBRA 4NE2A 2IV2X 1ST2A 4RHFA 2RG1A 2I3GA 4G0UA 3CKMA 5T4EA 1YA4A 5ILGA 5WRFA 4OLJA 5TR9A 1C30A 1IG0A 1ZAKA 1E92A 1W47A 2ZS8A 5FOQA 6REQB 2HSJA 4NNJA 3DKIA 5KTOA 2PLFA 1VHQA 3JWIA 2QORA 2PQ6A 3MG9A 1WKCA 1XVUA 2JLAA 2NU9A 2WIGA 3RVBA 3VNSA 3RTBA 5KI6A 1AIPA 1WCYA 2YZNA 1J09A 4CUJA 1ZP6A 3FJOA 3L7CA 1F0NA 4HNRA 5BSMA 3D5QA 1Q6ZA 4QE3A 5CK4A 1KFBB 1T36B 3O0DA 1R6TA 2QROA 4RE6A 3OPYB 3WHKA 2B8TA 3O5AA 3EDYA 5TF4A 3DBRA 1O1YA 2WY2D 4A3SA 1T6XA 4AZ0A 1QCDA 3GFRA 3LA6A 3NBAA 4LA4A 1IXYA 4OU5A 4CWAA 5JRDS 3MJSA 1SOAA 3IOCA 4F96A 2HMWA 3E84A 4DCPA 4HDOB 4FWTA 5HUQA 2BMVA 2Q4RA 2PNFA 3N6VA 4MRAA 1JIIA 1APBA 4JLJA 1A7JA 3VR5D 5LYJA 3GDGA 3V32A 4TRNA 3MSXA 4P36A 5ABPA 3C3MA 3MSCA 2YQ5A 3QFCA 4GYWA 3KOWA 4DMGA 1J39A 3LDAA 3K0CC 4JL6A 3BE5A 1V1RB 5BSTA 5C31A 3R6WA 3RRJA 4ZYLA 4PZAA 4DIUA 1OAOC 4RK6A 4W1PA 5AI5A 2WJIA 4ZOBA 5G4KA 6Q21A 4Q3CA 3UATA 5BNIA 3WBJA 1BSVA 5E7MA 2ZCUA 3HPRA 4CMAA 2HHHB 1PFVA 4JH0A 3JVEA 1OV6A 1H2EA 1G1AA 1ZVKA 3QJ5A 5EE5B 1Z15A 2AC7A 2PZAA 4CQMD 2CHVA 1NNLA 2ZKLA 3ET4A 2X4IA 2QYTA 3UK0A 3FYSA 4IGEA 1Z38A 4C0SA 4EL5A 1WF6A 5I5EA 4CCYA 2WYHA 3TCKA 4IIFA 1MB0A 2ECPA 4YJGA 2O0HA 2Z4SA 3LCRA 4XEUA 3ZV5A 1NUSA 1SHTX 4QHTA 2W2KB 5UKDA 2WB2A 4IFBA 2HMUA 2FP4A 5H7XA 1LY1A 1AKEA 4NCXA 2HX1A 2V1UA 3QFHA 4XA8A 3V4RA 2A1TR 4ILEA 2O50A 1C7EA 4Q21A 4ALIA 3FWHA 3X3HA 1AUPA 1ZM3A 2J59A 2WU0A 5FUWA 4PONA 4KPEC 1JMYA 1IY0A 2FX5A 1E60A 3P9CA 1LGYA 4MMZB 2G82A 5FI0B 1XLTC 5C4MA 1FP4A 2D8AA 2HCFA 3BGDA 1WEHA 3AC0A 2NU6B 1QAQA 2WPDA 2YWGA 4G5SA 4DYDA 1KZ9A 4ZO9A 1LSUA 3AWIA 1PX0A 3NHSA 5DDIP 5ITSA 1RLUA 1WD5A 3HL0A 5JD4A 5KNBA 4C01A 2AT1A 4RY0A 2R62A 1V2GA 1YR2A 2B6NA 1ZGZA 2R6DA 3B9BA 3TTVA 3OTGA 3WLPA 1Y81A 1U28C 3LUCA 7MDHA 1H23A 1ABFA 1ODLA 3IKJA 1IN6A 2WUVA 3JYNA 3MFYA 2XF8A 3GGJA 4LVCA 5LDGA 3U81A 3HCAA 4BGEA 3ZWMA 1AZLA 1LXCA 3L6UA 4L5JA 4CIAA 2A88A 3A6PC 4IUDS 4X65B 1W5AA 1XLUA 2YV5A 1JG1A 5A1JA 1P74A 3S2ZA 2DG2A 2OVFA 3DR3A 2WJ3A 4BEWA 1GITA 4MV5A 2Z6AA 2A35A 4TWAA 3RVPA 2FPGB 1C3JA 5MF6A 3UB3A 2RH5A 4JB3A 1BDIA 4OJQA 3RF6A 4Q4HA 4YJ3B 2HLHA 4G0QA 2ZT7A 4JQOA 4C87A 2K7FA 3RUIA 1CETA 2MOKA 3ASUA 2HBZA 3NT5A 4R9RA 3IBCA 1O94C 1N5JA 1F1JA 1ZY2A 1F2DA 5IM5A 2HR1A 1PK9A 2FZVA 2JFPA 1NU8A 1DFHA 1OTYA 2C4HA 3CB2A 4BX9A 3SR0A 1KR2A 4P6VF 1G6OA 5CDFA 1KTIA 3SX0A 1II8B 4RH1A 1Y63A 4JUFA 3KSZO 4QUDA 3ZNNA 4KCGA 3ANMA 4XW2A 1RYZA 2OBFA 4DBVO 5EI5A 1UJMA 1KEEA 2VSQA 1W30A 1AGPA 3S29A 1F20A 2YZ2A 1LI4A 3GWZA 3GLRA 3BDAA 4WECA 1S3SA 4RACA 1U2ZA 1WS6A 1ACMA 4I99A 1E61A 3DVAA 4UNQA 3PHBE 2H59A 4EKIA 4M9XA 3LWZA 3AV3A 3O83A 3MLBA 4QJIA 3EBLA 4KO2S 3WWDA 2LTAA 3W5HA 4R83A 1Y1RA 1NBME 5H5JA 2GPYA 2B7LA 2HRCA 2VRCD 3LYLA 5DULA 4HDNB 1KWKA 1K92A 4J0IA 1NULA 1D0SA 4L4YA 4KREA 2FP4B 4PU0A 4KITB 4FX5A 2FMXA 4ZFNA 5C5EA 3SEZA 2FFJA 4EJSC 5LCXA 2ZRIA 5CA1F 2BEWA 3G8YA 1MFZA 3SZ3A 1NXSA 3MJVA 4U7GA 3KE8A 2Z5FA 3ZGXA 1X7WB 3N2IA 3ZS8A 2VEDA 3K1TA 5DXFA 4CLRB 2O7QA 1GDHA 5J4HA 3WRYA 3ADKA 2VA9A 1OT3A 2YFYA 3VGPA 1ESMA 5G2OA 4B8YA 4RJIA 3DAPA 3GJ3A 2R5FA 1XVAA 3P9QA 3TL6A 2P91A 1K7FB 2PFSA 5ELMA 2R66A 3H8WA 1DQYA 1YDHA 3HM2A 3OHMA 2WSYB 4WKPA 2PZ8A 5EXSA 4BN4A 2AZDA 1SCDA 3N0WA 3JQFA 1XCPA 4IEEA 1XMOB 4PYOA 3K1ZA 3F73A 1JU9A 4KNVA 1CD5A 1E7SA 2VWQA 1J9GA 4MW5A 3VDNB 1CQXA 1D7AA 1PEYA 3N7TA 3D7KA 4HPXB 3WNVA 3TLJA 4BXOB 2OVBA 3EPPA 2FFRA 1NQWA 3OEHD 3DVSX 1SUWA 2NOAA 3OHPA 3SYLA 3GROA 1IPEA 4NJEB 3T9BA 5ULLA 4B76A 4LOAA 1GVNB 1KRHA 3ZBQA 2DBYA 4N3GA 1FBTA 1K3UB 2MMGA 4JELA 5CLFA 6LDHA 1QK4A 4H1HA 4JR1A 2EGGA 4W5HA 2M32A 3TTTA 5JAIA 3V4OA 1KQFA 4HRXA 1PSZA 1GKUB 2B21A 4Q19A 4AZWA 2OLEA 3RVRA 4A26A 4DMCA 1LVGA 2QUKA 2ODPA 2IYSA 4OA5A 4R0NA 1G7TA 4Q4AA 2JFXA 4KDCA 2SKEA 2WP0A 2X23A 1SUBA 1L6RA 2L17A 3MCAA 1ORRA 5AKHA 3MERA 3EJWA 1LPAB 1I33A 1PF7E 3D7MA 2ORWA 2I1QA 1NU6A 3UH0A 1QNFA 4QT0A 3R9XA 4ZEVA 1B3RA 1LLDA 4D8XA 3DVAB 2OXTA 2ZIXA 2YJTD 1S01A 3D02A 4IHJA 1SU8A 3ZDEA 1HDZA 1C3EA 1KA9H 4B85A 5JC8A 1JP7A 2CJXA 1Y5LA 3RTAA 2GM4A 1NDQA 3L4BC 1Y9DA 4ALMA 5HGJA 1F8XA 1VB5A 3EXFB 4P86A 2KE5A 2GCIA 1C7FA 4UUMA 1LX7A 1Q3TA 4CV1A 1G19A 2O6LA 3ZY5A 2H8GA 4P1ZA 2ZU0C 4CF3A 5JNSA 1KYYA 1PZXA 3GEPA 3IHTA 3JARA 3R5XA 2IRWA 5IXSA 1CP3A 2HK6A 4CTJA 4DRYA 1Q91A 1FUEA 2NGRA 4X7RA 1HBJA 2AG0A 5K8JB 2VNHA 3DTNA 3BE6A 3RGWS 4JZKA 1W5TA 2UVPA 2REXB 1GU7A 1VC2A 4W1SA 2CF5A 1QZXA 2ANCA 4REOA 5AESA 1CJMA 4FCWA 1W2GA 3GQVA 1WPXA 4F5WA 1VHLA 3X1KA 4IKPA 5C1IA 1J1ZA 1KTVA 4NL4H 1MUUA 2LE0A 5FI5A 3BXZA 1AK9A 2C1EA 2FYTA 4N65A 4N5IX 3MFQA 4FKMA 4RVOA 4FYIA 4QSMA 1DZ3A 4ZPJA 5IAKA 4XUDA 2ORED 2E49A 2PXHA 5LM3A 1OH5A 2VUTA 1W59A 1W34A 1MO3A 4MYUA 2NUAB 2FRDC 3IAM6 4FBMA 3W3ZB 3MHTA 1IEWA 3E23A 3K1JA 1DJPA 3D54D 1IZ8A 1H6AA 2DFNA 3MGBA 2IYWA 3PIDA 3J81k 1K3TA 4WV3A 5CT4A 5EA2A 1CS4C 3GLIE 1W5BA 2PWZA 1G7SA 4N6GA 3KX2A 3V8PA 4CMGA 5E7QA 2GAIA 2ZR0A 1W9MA 4ZZ1A 1YK0A 1SCUB 4PLHA 3RU7A 2JK1A 4CQLA 4MVJE 4RA6A 4B6PA 2AE1A 3AHCA 3VVMA 3PZRA 3ROZA 4CGZA 2DU8A 5LD2C 3BWEA 1L4EA 4AN1A 1H65A 4GX1A 2PD6A 1OLUA 4I1IA 2H1VA 4DR1B 4CTKA 3OZVA 4Y1RB 1BJTA 4TQAA 6NULA 4QBIA 1NN3A 1F0PA 1KP2A 5AKJA 1PZNA 1TVKB 3RBAA 4MQEB 2ZIXB 1JEJA 1THZA 1QP4A 4C03A 4EO9A 4ZDIA 2GYWA 2RGXA 1JGTA 3UKDA 1E3TA 1QRRA 5EJ9A 1CYDA 3FR7A 3H8VA 2HIGA 5CFOA 2YHIB 3ZJ4A 2ARKA 2PA3A 3WIVA 4KMMA 4ZAZA 4E5PA 1JQJC 3DOUA 4DABA 2HHCA 3PJEA 5CA1B 4QQRA 4RETA 4YQFA 5KQRA 5GIPE 3K0SA 4YJDA 4R6XA 4D0RA 5AVSA 5F1KA 1GUAA 1UBJS 1WXXA 7REQA 5JAHA 2P9EA 3PQFA 3UANA 1F6WA 3BRQA 3B3GA 2Z5VA 1T2DA 3HZZA 4MQFA 3UV3A 4JY7A 5EIFA 4M1SA 3P2OA 3FOAA 3GVXA 4Y9TA 4AXXA 4ETIA 2QUIA 3MWGA 4RW0A 3L8HA 3N7UA 2JJMA 3A1NA 3BCHA 4MHSA 4R1SA 4RADA 1DJMA 2IV3A 1P6QA 2ZULA 3K73O 1B6GA 3FA2A 3P2YA 4E09A 4P9NA 3QVOA 4NICA 3HVRA 1QHSA 2A9FA 2ZIAA 4TZ6A 1CUIA 4KV7A 4CIDA 4UXHA 4CM9A 2Q7DA 3RRYA 4AJ9A 2ZT6A 3F3MA 2IXGA 4IDGA 1FRNA 2H4ZA 2IDMA 3A0RB 4HH0A 4WN9A 4XSGA 1S3GA 3H2SA 3AEUB 8ABPA 1XIVA 2ZUWA 3OUTA 1Z8FA 3L92A 3RSGA 1X7XA 5TJ9A 1PBTA 2P5TB 2QN6A 4YXWA 1Y98A 1O7JA 2XQKA 3WGTA 1A9XA 3LPDA 1JR3D 1SC1A 4L8YA 1BGWA 1LVHA 3DQZA 4QHSA 1IIBA 1TF7A 3E9CA 4FKBA 4UAVA 4AT1A 1W6UA 4AIRA 5JZSA 5EHGA 1YRHA 4YCLA 1I2CA 4A0RA 5FWYB 1QGUB 3DLBA 1HT0A 1JJIA 1T8TA 2G70A 3PKZA 4JDUA 3WHLA 1ESZA 1JIKA 2HFKA 2JAWA 1QFJA 3OIDA 2G1UA 3O8NA 2XVXA 3IQIX 1T9ZA 1Z0IA 3NXSA 3SJZA 2C78A 3T1VA 1WRBA 4YMHA 5CGQB 3RAEC 3E7XA 3ZWNA 4CMEA 4KQXA 1X14A 1F48A 1WETA 2PJRA 4DW8A 1VLVA 3CIOA 4YHBA 1VKRA 5IN5A 2C88A 1FJXA 5IWAB 2EARA 3JAKB 1GPNA 3JZMA 3LT4A 1GG2A 3HSYA 1D5CA 4JIGA 2NTYC 2O1SA 3LOUA 4GMHA 2JVJA 3T1OA 4M9UA 3PCXA 3REGA 5DMXA 4BLOA 1Q0RA 1Z74A 2QM8A 4MEJA 1K2WA 4FSHA 3WK9A 5BRJA 3OMWA 5JNVA 1R50A 4V3CA 5K6TA 3DHEA 2FPPA 2VYQA 3GJ4A 2X0EA 1W36D 1GCUA 2X8AA 4ETMA 4FJ2A 3QUSA 5KYWB 1E8MA 3R75A 3BULA 3BILA 2IYRA 1U9IA 1XPUA 1MEJA 5IPFA 2A6PA 4P5DA 4U7TB 4XYEA 4LAFA 3ZC3A 3ZX4A 3EIEA 1XFDA 4B45A 1K0UA 4CLOA 2XMBA 1TQ6A 3QPCA 4IDEA 4EVSA 2BSQA 1QJCA 1QAOA 3UV6A 4IW3B 1WX1A 1IWOA 2BH9A 1Y5NA 2I4IA 5FL7D 4H27A 4X97A 3VR4H 3UMCA 5TARA 1L7VC 3T3DA 2WNHA 5BW5A 1I5EA 2GTPA 4YJKA 2BWJA 1U2GA 4BZXA 2CDNA 1EAMA 3CO5A 3UT6A 3UMMA 3NTVA 2A86A 3ZU5A 2ZRQA 5EIHA 2Q5OA 5IM4F 3KSDO 1CIVA 2PBLA 2ZBFA 1EE2A 4RD3A 4FGZA 1J25A 2M9MA 4DTIA 1PLLA 4ZARA 2C0PA 4XX0B 2GZ1A 2H1WA 3V2IA 4B17A 4CETA 3ACBA 1Z08A 3RF7A 4RH3A 1AG9A 4JBYA 5TGTA 4AZVA 4Z7NB 3DAYA 3MB8A 4HYYA 3SC6A 3ZTYA 4MIKA 1WXFA 3AKCA 1VMIA 3JR3A 4FLEA 4M0LA 4KQGA 1E99A 1OZGA 3NIDB 4NCNA 4NEHB 5AQEA 4MLCA 4PAOA 3URMA 2Z5LA 2QPAA 2DM6A 3COVA 1IZ0A 3DH0A 4IVNA 4CIVA 5KTMA 2SECE 2W00A 4Q1AA 4F4IA 4RIGA 3BHJA 1C4KA 5LOVF 3LHIA 2BRUA 1N0WA 2XWSA 1EM6A 3WJ2A 5KYVA 4G4SP 3C24A 3L7DA 2ZFUA 2UUAB 4OKNA 1DDGA 3IS3A 4IR7A 5DM1A 4WX2B 3CLRD 1O6ZA 2WJJA 4QXPA 1B7GO 2FX2A 3VSEA 4ENVA 2AFHA 4TS4A 1M2FA 3IXLA 2QLNA 5L3QA 1EUYA 2PE5A 1UQUA 2P9YA 1TTQB 1EU1A 1RQLA 1F17A 4UBJA 4I1YA 4KQMA 3WZ2A 2GD6A 4DQXA 5F4ZA 3REQA 3MGKA 4JKYA 4X8LA 5KTNA 4AJJA 1DADA 2QD4A 4EEZA 5GQSA 7MHTA 3FNIA 2AN3A 2ODTX 4HEHA 1GR1A 4P7BA 1EI9A 3QJYA 2Y1OA 1UC5B 4JLOA 4L4ZA 3CM0A 3A6KA 1I4EB 1YR8A 3AYZB 5EN4A 2XRYA 1KOJA 2FKAA 1J56A 3E1SA 3UUWA 1LTKA 4V0QA 5AI0A 2AOXA 5DTQA 3UJCA 4PFJA 5K3DA 2EWVA 2GZRA 2XXJA 3NUGA 2L42A 3W5BA 1MTOA 4CVNA 1VI6A 1AUVA 2D0OB 2OBMA 4ABTA 1M2KA 4GE0A 1KC1A 2H2DA 1S8OA 2V6JA 5E9QA 3ROEA 4Z9BA 2FF7A 4DA9A 3AT1A 2FR8A 3B1WA 2XZTA 1RFGE 3ENKA 5DGIA 3LXMA 1WPGA 5EJIA 3SMQA 4DCMA 4DQ0A 3VPFA 3NCTA 1AZTA 2Q21A 4YRAA 4W7HA 4B4WA 2P1DA 2VJMA 2YIDA 4GSKA 1R6AA 1SBIA 2VCHA 2W2MA 1K88A 2IKSA 3O3OB 4ND4A 5CNMA 4MVJH 3BIOA 5GV7A 2QY9A 3PEUA 5J63A 3S5UA 3QW4B 2W9XA 4C3ZA 3LHKA 4XEHA 1DTWB 2GBIA 1YZNA 3K9CA 3MTGA 4YFVA 3PT9A 3GFGA 5CFZA 3AESA 5IT4A 4CEJB 2R47A 2FN9A 4YI3A 1KWGA 4YMLA 4FR5A 2G7ZA 3WQQA 3DPIA 5LIRA 1OV4A 2A9KA 4LCEA 4DHEA 2AVNA 1CUJA 2X2PA 2XNCA 3K2BA 3WNZA 3KJFA 1J2EA 1DBVO 2V3VA 5AJTA 4JI8B 4MIEA 1KC3A 1H8HA 1G64A 1UQRA 4GT1A 3VAAA 1HDOA 4B32A 4MZDA 2CXNA 1OGIA 1VLZA 3SMVA 4B6EA 3Q6IA 3KB8A 1QGED 1YQDA 4INZA 4LWZA 1MT0A 3PPIA 1QOPB 2AFHB 2ZXEA 3KVRA 4FYKA 5D3MA 5KTKA 3FWNA 5JD5A 1FFBA 3HV2A 4NARA 4RESA 2KLHA 3FBWA 2OFWA 2HCBA 3HUUA 2AZXA 1GG5A 1FZQA 3ZNPA 3JQEA 2CXOA 5KVVA 2CXPA 3OWHA 2GH1A 1GU1A 4RF3A 4NLLA 5HYVA 3KL2A 1Y4UA 2IX3A 1F8UA 2AZMA 3PEYA 3DBLB 2Z4RA 1CW2B 3TOXA 4O5AA 1R7RA 3KAPA 3IOEA 1NVBA 1IXSB 4JR2A 3EQ8A 2HZ7A 2CXHA 3K09A 3CRRA 4FZVA 2C29D 2HKIA 3V2UA 3QFTA 4HNTA 3HRHA 3FYHA 4AQDA 5JZOA 3KOMA 5KX5A 3FTQA 1ZNWA 4IXMA 4MWZA 4UE2A 5EPEA 4FX2A 2IZ6A 4WJLA 2XYPA 5HK9A 1P61B 2XGSA 2VDMB 4JCCA 4IJ6A 4JNKA 3RYFA 2VTEA 4OJYA 4BUCA 3HA3A 4ZRDA 4ZN6A 3TLEA 2HV9A 821PA 3K9GA 4WNAA 3TVDA 2EW2A 2N47A 4UBNA 1YR9A 3ONVA 4QU0A 4GAEA 3ZK7A 3TOCA 5T7BA 4WXHA 3IPLA 3PGVA 5EUQB 4FDTA 1A9TA 4OOEA 1RI5A 2XIJA 4M55A 1SQFA 4YK7A 1B8OA 3GL9A 5F4BA 2B78A 2PPVA 4M1KA 3QEMB 5YASA 3WP1B 3LO8A 1SIBE 1Z6TA 4YT2A 5LOVB 3QUQA 5D6NA 4V0KA 1XZGA 3WIEA 1Z6YA 3O2NA 1TA9A 2XXAB 5CURA 1N75A 1SD2A 1SRQA 2FZLA 1DUIA 3DJFA 4FW9A 4R8RA 1V43A 3KWFA 3V42A 3WISA 1QF9A 2QPTA 1SXJA 4GW3A 2FXIA 1QH1B 3HDTA 4D44A 4B3RB 4R7GA 3IVAA 2YASA 4H4DA 4UU8A 1UXOA 3QEJA 4TLCA 3W5SA 3FHCB 3BF8A 4RL6A 1CTQA 5C52B 1DBWA 3PTAA 2DPGA 3ZIDA 4ZVNA 4X1OA 1Y8QB 4Y2QA 3BXGA 721PA 1LK0A 3RJZA 5JTTA 5DKFA 1XCJA 1NVTA 1RKVA 5BWLA 4ARBA 4BMPB 4WESA 3QXHA 1WLSA 2XKBA 3TOZA 3DONA 4XIGS 1N0HA 1GL3A 7GPBA 1C0PA 3W2HA 3I9FA 1JHZA 5A7HA 1RZUA 1ETHA 1HRKA 4H2DA 2IYUA 1DKMA 4Y2XA 2NSDA 5AK3A 3LPAA 3ZCQA 4U7PB 1W94A 2Z04A 1PG0A 1C9YA 3IJ5A 2BP7A 3PDIB 4GDMA 4KLRA 4J29A 4M37A 2GJ8A 4MUKA 5G0UA 2P2CA 2J5QA 5FCDA 3VNBA 1E9DA 2PBFA 2WD7A 2WWRA 3HJUA 3MM4A 3F8TA 4US0R 1IN1A 1CUSA 2PSDA 3C3JA 4X6LA 4BQNA 4P4LA 2PTHA 1YTLA 3NKLA 4CDNA 4TGLA 1BHSA 3UIEA 2FPKA 4XE5A 1SBYA 1OBHA 3HCWA 4QNRA 5GONF 3VX4A 3FTCA 1QO0D 4EUEA 1CEEA 1PJAA 1E2LA 4E3WA 2WYVA 2H85A 1K7YA 3U1VA 3FSEA 2LWIA 3DZIA 1YOVB 4HFRA 4UPDA 3EZGA 3ZOKA 4HNHA 1UOOA 1P75A 1ZQ9A 4WNAB 1V47A 4LEIA 4MTLA 5KAMA 3QZUA 4OOFA 4J0DA 1SEPA 3ZVKA 2WU4A 4Y8VA 1C8KA 1BXRA 1GPKA 5GJBA 1EWRA 1XDUA 3CZAA 2XA2A 4I5GA 2P11A 2QTWB 1GA4A 3V5NA 4NZNA 1UJCA 1GRVA 1XF1A 2GHRA 2YJZA 1ZHHA 1WD7A 3MXTA 1WZEA 5ETJA 4KB5A 1T1EA 3VPHA 1Y1QA 1LUAA 3DMTC 3WYEA 2PWAA 2ZZKA 3RFFA 2NO5A 2PAFA 3HNOA 4KN5A 2OLKA 1ZUNA 1NW8A 1U3WA 2L82A 2EDCA 4GZ3A 1VYTA 2J09A 2VBFA 4UPVA 5T64A 4JI1B 2GM9A 1T4CB 4IM7A 1NI4A 1U81A 5KAPA 3OIFA 1R16A 2REOA 1YBHA 1N9GB 5AIAA 5ALIA 3U19A 3ND5A 2WTNA 2PUEA 4QWMA 3PC7A 4DQDA 3RT9A 3S1SA 2NTJA 4OYYA 1ORVA 4RPGA 3T7KA 2OHVA 1F4LA 1U63A 1GPUA 4CMIA 1V8OA 1M2HA 4IOKA 1YBFA 3BRCA 1OMOA 1ODIA 3HEBA 4OMUA 3V1UA 1NUTA 1C0EA 1DQNA 2Y2VA 3MOSA 1M83A 4KBFA 4JLVA 3PXAA 4UTPA 5K3FA 2XDQB 3U80A 2IEZA 1U7PA 2BKVA 3CISA 3ENNA 4ESOA 4JXKA 4INOA 4AJPA 5BXQC 1COWD 1OWOA 5A02A 3R3HA 4JEUA 4MPPA 5THXA 5JAPA 2TRSB 1VKNA 4IX1A 4U0JA 4X9XA 4QUJA 1E1RD 1CZNA 1WB6A 2FZWA 1B8VA 1Q7CA 4QUHA 4ZMBA 2CEKA 3FUCA 2P3OA 1OLOA 3IV6A 4HVLA 3THWA 3NBKA 4X63A 5DGDA 1M7GA 2BP7B 3Q7QA 3OZEA 4W5WA 1ULUA 4PQRA 5TQVA 4EA6A 3W5VA 3OQPA 4BB5A 1IY8A 4OD0A 2NT3A 4L15A 2H00A 4NEGA 4H7JA 5ICGA 1HC7A 1W0KD 1OH7A 1GPH1 1GYQA 5K2MA 3AUJB 4RBNA 3EUEA 5A5EA 3GDWA 4FVTA 4RLHA 4Z7OB 1LDGA 3DOIA 3PQ7A 2J0UB 1JDVA 1GPLA 1YUBA 3E0XA 5I5GA 5JXHA 1L5MA 3INTA 3HK2A 1RU3A 4EB3A 4ZO7A 3W77A 3S2SA 5DM4A 1QIJA 4C1NA 2NNLD 3BD6A 3T9DA 3KO8A 3R09A 4YRLA 2ZWPA 1IG3A 3R8FA 1BXRB 2X0RA 2FY8A 1KY4A 3K6JA 4O1HA 4UM8B 4DFDA 2Q0HA 3NJ4A 2B6HA 1WDWB 3GLVA 5GGXA 2XSZD 4FOOA 2M6KA 4W6QA 3FHTA 3THOA 1DCTA 3D0RA 2BEKA 1UZLA 1WU7A 3S1AA 1ZS9A 4DLNA 3W6ZA 3CBGA 2BFPA 4AW9A 3RGGA 2HBYA 2W2PA 4X24A 1QRAA 3L77A 2WR8A 3RIEA 1G3MA 3E3MA 3LIIA 3DSRA 2J67A 3NEPX 4PAQA 1ZM2A 4UCWA 2PRKA 1TUEA 2P2YA 2EJUA 1MQ9A 1NXQA 1D4OA 3TLCA 2C5HA 2V4ZA 4XD7A 4OQEA 4ZAGA 1I2ZA 4A03A 1OPRA 2F7SA 3NU1A 2MYUA 4D74A 4DNFA 1LX6A 2O5RA 1DWOA 3FIJA 4PR3A 3RM3A 2J0SA 4WJKB 1K8RA 1DXHA 4POOA 4RD0A 4CMIB 1VMKA 4AZ3A 1XQ1A 3FFTA 3CZMA 4G1VA 3KSBC 4Z4EA 4GZLA 5G40A 1TK3A 3T52A 4IPTA 5BWOA 5EWLA 5TF0A 1PJRA 1MLDA 3E2PA 5K0ZA 1XZBA 3ADDA 1XD2A 2BCEA 2D2IA 2I2FA 2O4CA 3N2YA 4HH1A 3R7DA 3U0BA 1RJ9A 1ZNZA 1XVTA 1IY9A 3DBHA 1Y5RA 4Z49A 1VI2A 5COQA 4NIMA 4L2IA 1ZMBA 2NM0A 2Z3ZA 3B6ZA 3PGMA 3WK4A 3DEAA 1JEOA 5FI1B 2XEDA 2CN1A 4O5OA 3GP8A 2AR7A 2JBAA 1JIUA 2JF0A 3OQ1A 1IONA 1IXRC 1NYRA 2CUZA 3DO6A 4R2HA 4RH0A 2BI4A 2R4TA 1VGQA 1G9TA 5D5HA 3MB5A 3ZU2A 4S0ZA 3TSZA 5A03A 1L3BA 4BJ6A 1BDHA 5GY7A 2FKNA 1VRCA 3GGSA 1ZL2A 1S4QA 2JRCA 3G5TA 4UAUA 1NE7A 4WL0A 5LA6F 1QFMA 2I2DA 2F62A 2HY7A 2O0KA 3K4PA 3AUXA 3R23A 4M0UA 3NHLA 2VQEB 3PEEA 4DC1A 1F8GA 4JDPA 2BEVB 3GJ7A 4D4LA 1X1EA 4UM5A 4G5FA 4DDHA 1E89A 1ADJA 2J6CA 4NENB 1VTKA 2QN1A 1G2QA 1KPIA 5BSVA 3JWHA 4R1MA 4ROSA 4LJ4A 5C35A 5I51A 4J1TC 4UEKA 5DYGA 5CTAA 3UAVA 1F2VA 1GO2A 5E1MA 4FSDA 2NZVG 1GT91 3K9FC 4S05A 1UBRS 2EW1A 3E9NA 4DUYB 2A1TS 3SJAA 4G1MB 3DW3X 4Z0HO 5SZIA 4MW7A 4BFSA 1ZN8A 2C3UA 3DLIA 3IIMA 4P0QB 3VBEA 4G81A 3ECCA 2YW9A 1FUKA 1WV1A 3PVCA 5H70A 4RJJA 1MH1A 5JCJA 2V7VA 5HS6A 3S40A 1OZFA 1U0RA 4PHGA 4PYIA 4XOUA 3TGPA 4QQKA 3OM8A 3GLHA 5TMPA 1X92A 3HB1A 3TKAA 3RNLA 2HB6A 3ZVLA 3U49A 3FKQA 8GPBA 1MAWA 2UYGA 1MOZA 1WU8A 4AG6A 1V1MA 3P9IA 4KE8A 1NLUA 4MKZA 1UAYA 4S35A 5DNEA 4LDRA 3IE2A 2QVYX 1GTJ1 3B1YA 1USGA 3ZQKA 2R7AA 3B2EA 3HO6A 2QT0A 3L4JA 4NFYA 4JL5A 2PSEA 3DDNA 5K3AA 4LRTB 2IIQA 1YCHA 3IQZA 1X7ZA 3PCRB 1JBEA 4EG1A 1AHPA 1N2HA 2C8VA 1PBNA 2DUUA 4XUCA 3OAAD 4OQLA 4LY6A 2XGGA 2GO7A 3O3NB 1SVMA 5JJ5A 2YIMA 4Q1FA 5FQNA 1AQ6A 2WHEA 3LUHA 2MIIA 2GEJA 3D6VA 3MCWA 4DBLE 1SZCA 2EQAA 1EIZA 4L2IB 4EHLA 3QE2A 3JVDA 4XB6B 3DOEA 3ZW9A 5K4HA 3AKYA 4C20A 3QVUA 3RW9A 2JNWA 2NT4A 3IQDB 2O3TA 2Q4OA 3QG1A 2KJQA 5AJXA 1PWEA 1P4JA 4J16A 5F2NA 4TYNA 4MIYA 2G7MC 2QQGA 3K4QA 3RNOA 1L4UA 1BXKA 2JIDA 3I2IA 5HPYB 2E0IA 3T0IA 1T10A 2IEAA 3U37A 4AURA 1KIFA 2BGIA 2Z8ZA 3AIMA 3C5EA 1SKQA 3M1YA 1KFKB 1UEIA 2GD1O 2F59A 1TCVA 3C48A 3RWBA 2AR0A 2XAUA 3IV9A 3LWBA 3C1AA 1BTOA 1PGNA 3P27A 1HQCA 4CLEA 1VSUA 4MAMA 4UE6A 3FUTA 4R54A 1UC8A 4L95C 3K35A 3UMBA 2IS4A 3ZGVA 5K05A 4U6QA 1KEVA 2AOVA 1RACA 4IDOA 1Z39A 4MUFA 2WVAA 5ECYA 3QOFA 3TSYA 4AN0A 1EXVA 3TRIA 3HFJA 3EJ6A 4I50A 4K81B 4YPOA 1UBKS 1X7YA 3M8KA 1U7ZA 1QQ6A 1R4NA 4DWVA 2VPXA 3MBKA 2Z2YA 3ENVA 3U40A 3X43A 3I53A 4CPDA 3IBGA 2D1TA 2O3RA 3GLQA 3BCSA 2Z2JA 5CGZA 3ZH9B 4YAUA 4CFYA 3AM1A 1LW6E 1ZKMA 1L1RA 4IINA 1Z25A 2CLDX 3MOIA 3SS8A 1U2DA 1H6DA 1CYEA 3MF4A 1L9XA 1NW3A 4MUMA 3HKBA 4XJSA 1ONPA 4EVRA 5FWNA 2GPBA 3LUFA 1V1MB 5AHOA 1XWWA 3VMMA 2W11A 3LK7A 5CFPA 1IK6A 3U5ZB 1ISGA 3I72A 4Z6KA 1Z35A 2AXPA 3HFSA 5HKKD 5LSAA 4ZI7F 1PP4A 5HZHA 2EBUA 3O84A 5GIOE 1LDMA 1ZESA 3MGGA 2BR4A 3RDPA 3LUPA 5K01A 1QG6A 3OD1A 1UMDA 3DUFA 4GSLA 1WY5A 3LO5A 3V33A 3TW8A 4ND5A 1KDYA 5DM2A 4K9KA 1GUZA 1XCLA 1QF6A 4IUCS 2QG6A 3DDOA 4EYOA 1G9XA 1ONSA 2VNIA 3L6DA 3PFFA 2W2XA 3NONA 4ZCPA 3VKWA 3IQEA 1N2GA 1DC3A 1P8JA 1NPYA 1R3UA 3P9ZA 3NWOA 2YJ6A 3GZJA 1RE1A 3M0EA 3IXMA 4WH0A 2JJ1D 2PT6A 3SIXA 1E32A 5IG2A 1TNDA 2AFHE 2SKCA 1KJNA 1UM9A 1V3VA 1MORA 3G8BA 4E2FA 4NXNB 1Q83A 1LNZA 2YX1A 2HJVA 3H4TA 2LVBA 1RXSA 2WHPA 2P41A 5AW4A 5EJ5A 2D06A 1LV7A 2ZJ3A 1DIOB 3OLVA 2PWBA 1KSHA 3CRQA 4DWOA 3A26A 4TPKA 4MROA 4D8UA 5L51A 3AEXA 1JXQA 2GEUA 5I7OA 5JZMA 4AG3A 3JD0A 4D02A 1QAMA 4QYTA 1OWLA 2QRHA 1JLLA 4ZVLA 3FZYA 3R24A 3RYHB 4KH0A 1NVFA 1K1EA 1FUUA 1OXSC 1PEKE 1WPQA 2OE2A 3FDZB 3OE7A 4JBXA 5A0FA 2PKXA 4CKXA 1X7YB 2BMWA 3DCNA 4LZWA 1R4NB 4G9EA 4YXFA 1RM3A 4PPFA 1W5SA 2J48A 5TB5A 3L6EA 1Z6QA 5AP9A 1I4DD 2XMPA 5E4TA 4YCJA 4TT3D 1FQWA 5BR4A 2C99A 2FHPA 4B3MB 2EBWA 1GL6A 1Z7GA 1UBMS 3LMKA 3WIUA 4F0JA 2Q41A 2QJRA 3K6SB 1ADGA 2CZGA 3HKBB 4F7WA 3K31A 2G0TA 4I4NA 2DBZA 4RLQA 3ZBTA 4U3JB 2UYOA 4N7RA 5HUHA 2HWWA 3DEIA 2R1TB 4FDMA 4B7UA 1K75A 1TZBA 4HGPA 3H97A 4K86A 4JJ8A 2H29A 1NVDA 3LF1A 4O2AA 4M1YA 3HHPA 1RC8A 3FVRA 1ZIXA 5K0CA 5KDOA 2F4VB 3UJPA 1IUPA 2GASA 1UMDB 3DUFB 2I67A 1AKMA 1NMQA 1XYGA 4NATA 1SMKA 4CR7A 1JA0A 1C1DA 1TUGA 3VJRA 1JA1A 1ELOA 4O2BF 3PKIA 1JLHA 3UBMA 4F3NA 3B2NA 4ZOLF 3DO5A 2HDOA 2W6JD 3JTMA 4RKYA 4AJOA 3JD3A 4B46A 2VJQA 4RVSA 2P90A 1TMKA 2IU6A 4V2IA 1XKQA 2OENG 1KDPA 3FVWA 3BCUA 3JVVA 2AJDA 3DL7A 3A2KA 2LDXA 4QQFA 5G1NA 1UPFA 3SBEA 3CNLA 5IXYA 4DBLC 1V6AA 1EWKA 1O97D 1K5HA 4P4UA 3UKOA 1C1XA 2XECA 4FDAA 5DCLA 3CLSC 3FROA 1CUDA 4KMRA 5C1BA 3OFSA 1SQ6A 3PNKA 4LRQA 1DO0A 2PVPA 2ZUVA 3OLZA 4BE4A 1OX5A 2QL9A 5FBQB 3RK4A 4U8HA 2O0LA 2EHDA 4FZ3A 2LIVA 3AMVA 2R8OA 3QVWA 2JDID 3N74A 5DCUA 5HF5A 5GVRA 3H05A 1MX1A 2JIOA 3WSWA 2V1XA 2DTDA 4GPAA 1VKZA 4AP6A 1TGYA 2A30A 1WZIA 1ZL0A 3OJXA 4BFXA 2JGDA 1W88B 3ISJA 3EZ2A 1DEXA 1REQA 3NLLA 1U0FA 3G2KA 4JBWA 4LC0A 2FWIA 2V7EA 1VGRA 4UBKA 4GRIA 2VJOA 2FWMX 2IITA 1A5BB 5AXBA 4AP5A 2X6QA 6ADHA 1WSAA 2IOQA 3SYNA 1EFDN 2R6FA 4EI2A 3C8UA 5IVHA 3TBFA 1U4OA 4HQRA 1EHIA 3JQAB 3NOOA 1KVQA 4KW7A 3TS1A 3S81A 1E3WB 4UPEA 2JVKA 2YVUA 2ZI3A 4M46A 1PX2A 2OOSA 3LE8A 5BSFA 1KKMA 3BJZA 5EJEA 5CMLA 4HJRA 5LDHA 2XVYA 3ZGZA 4GZMA 4O2LA 4QVGA 3IKTA 4CL0A 3LQRA 4HB3A 1I4LD 4UNSA 3C5HA 2XRZA 1YBAA 3WGIA 5H80A 2RI0A 4RM2A 3MT0A 4LPSA 4EYSA 2VQFB 1TD1A 2P9ZA 2C97A 2XNDA 3BVPA 4O25A 1YQEA 4YRCA 3ESBA 3B1FA 5ARDA 3IT0A 3JX9A 1R64A 3H5LA 3DTVA 4DDTA 1ZD4A 2Q5IA 2V3CC 3EXIB 2RDMA 4PF1A 5DGTA 3IPCA 5CEFA 2ZCJA 2QRMA 3ED1A 3PUVA 3TEMA 1V35A 1QDLB 1A50B 2P9HA 4LXTA 1MPXA 1EBFA 1RADA 1TEXA 3RQSA 3RSOA 3V3KA 3RK1A 4FDLA 5HTKA 5A5FA 2XZDA 3AFOA 3N2NA 3WGJA 4YCBA 1DJQA 1F38A 5KYKA 1QONA 1PR5A 4FPXA 1MO4A 3LRPA 2X19A 3FVQA 1L8LA 3KYCB 2H1OA 3T7IA 1N7HA 3LZDA 1AKVA 5G1OA 3LYAA 3GDFA 2MSNA 3K20A 1Z5PA 1BX3A 3A0UA 4DA0A 2ZI7A 1ONNA 1R0ZA 5IASA 3VBCA 2V8BA 1C29B 3GW8A 3P45A 5CT6A 5E4FA 3ZJYA 3HZRA 1U5AA 3O82A 1E5QA 4QDXA 1N2CB 3WP0A 4R2KA 1NJ2A 4JUAA 1YHNA 1WHTA 1E62A 1PQYA 1RE0A 3EGVA 4LYAA 1LB1B 4HEQA 4QZVA 3V7NA 3IHWA 2IHKA 2I6SA 2Y4OA 4KKXB 1L0BA 4GICA 4D82A 2ZVQX 1FMTA 2OYRA 3PQEA 3SDBA 1KI9A 1T3TA 2UUOA 4G0XA 2F8SA 1OBCA 3VR5A 3O8RA 1CR2A 3I5AA 4KTVE 2VQSA 2NG1A 3WGOA 5I8PA 1JS1X 3DEJA 3UWKA 2ZI6A 1SPXA 2A8YA 2PQ2A 3ACCA 2I7VA 1BVRA 1R8JA 3K5IA 3CX6A 4MP3A 3WLSA 4ERXA 3TQCA 1DDOA 2ZS7A 2R8RA 1PNRA 2CLSA 3PXEA 3T1TA 1Z0SA 1GTZA 2Q9UA 5DHUA 4IJ5A 4BO6A 1FVXA 1L7OA 2QGNA 2WF6A 3L9XA 5AI8A 5JCOC 4YT5A 4V1CA 4IYJA 1AHHA 1KVTA 3RAFC 5J5CA 5A9TA 5DI3B 2AQ8A 4ER0A 4L78A 2HDNB 3OMLA 4H9GA 4PZLA 1U7WA 3GFVA 4WDQA 4I9UA 3WX0A 2CFIA 2WD8A 2CCKA 3NT2A 3HVIA 3PFKA 4GXTA 1YF3A 1F3OA 5JUWA 4HBGA 5CLGA 4DILA 1VG1A 1WR8A 4XJVA 1FTYA 4OHWA 5D3QA 1VCMA 2QRGA 3WB9A 4D0GA 3B1XA 3ZDZB 3L1VA 1C8LA 1E2IA 1MF7A 3OZ7A 4Y9DA 5AJWA 3HYCA 3U6BA 3DHWC 4LXXA 4LFAB 2O2IA 2R6CA 4YECA 3HZHA 4F3RA 3DTVB 3MWKA 4Z7JA 4P80A 5B6IA 1RXWA 4REQA 1QWOA 2C2KA 3NRJA 3ADPA 4EG0A 4U5XA 5IBPA 4B4KA 4YRFA 1ETUA 3A36A 3AB7A 2OAEA 3CU5A 4XWYA 2IS2A 4FKZA 1H0KA 5HJ2A 4B84A 4O2BB 3AP1A 1QR2A 4NJOA 3ZHBA 4Y9SA 5BSWA 3PGKA 4PC6A 1UPUA 4A5SA 2I9PA 4C08A 5AIBA 1U2TA 5E3HA 4PLGA 3IUPA 4FN5A 4RZSA 3QVJA 4XM2A 2DUJA 2X1LA 1G9SA 1XZ8A 3PYXA 1NQVA 4TUYF 5T4HA 1FTNA 1P3JA 2MYPA 3NS7A 1SCNE 1NDHA 2XT6A 4P3PA 1TOAA 1L5HB 5B2EA 3CLHA 1PR4A 1NNEA 4MPRA 2FZCA 2RB4A 3TZKA 4I8IA 4N48A 1FMCA 1XWFA 4G07A 2XDAA 3QNWA 2EX1A 2EP7A 3C74A 3O03A 4IRUB 3LUKA 4KO8A 4LTNA 4X20A 5CM2Z 5E2IA 1DIRA 2BGTA 2P4QA 3STVA 4HNUA 4BX0A 2B4QA 3JD4A 3EF3A 1J4AA 3SZOA 4A0FA 4F85A 2HV8A 3OKAA 3WB1A 4UFPA 3CGWA 3H9UA 2CJYA 1IHXA 1N7JA 5AVVA 1U65A 3DFZA 2FMHA 1LWOA 2AJCA 5JH7A 3RS4A 2QPLA 1C41A 4KWEA 4P7JA 5FORA 3OX3A 4MUBA 4E08A 3JQ7B 3DE2X 4JSTA 3JQGA 1SVNA 3JATB 3RASA 2ADOA 4PHTA 3ZQ4A 3IYLW 3H17A 4UHDA 2CCGA 1G4AE 4FS8A 2FWBA 2O2HA 3IP6A 2FUKA 3QLVA 1GQ2A 5I6DA 2Z83A 1UBNA 1PVOA 3TDKA 4D6XA 3ZEIA 4CR6A 4NSNA 2O3QA 2FCRA 1MB3A 1QGDA 4UHEA 2OV4A 1LWNA 1F7VA 4MKRA 3O4GA 4GSYA 3BK1A 2VDUE 2QZPA 4WJZA 4IILA 3IRVA 3O94A 1JPJA 4UOQA 3DNMA 2PG3A 2VRCA 2Q6VA 3L8EA 1FP2A 1KY3A 5AJUA 3V9PA 3JQCA 5SZKB 5CCDA 8ADHA 3QUTA 5ER9A 1WL8A 1CB7A 3VI4B 4RY8A 4QBGB 2F43B 1SVSA 2C82A 1B76A 3L7YA 1MJHA 1R0YA 4REQB 3VU9A 5DIFA 1UJ5A 2WAYA 3UCEA 4EVIA 4I4IA 1OLXB 2KMLA 2WSLA 3F1KA 2IPLA 1TAUA 1Y1SA 1Z6PA 2CL5A 3HKCA 4Y7DA 3UT5A 2GJSA 1W4CA 2ZRPA 3F6BX 5D1NA 3TGLA 3E53A 1Q7GA 1D5WA 3HADA 1Y6JA 1TQ8A 4K9RA 1IM8A 1O6CA 4MA4A 4PZ0A 2HJWA 5HOQA 3WV4A 4JXJA 1HSZA 5EZYF 4RTSA 3D2LA 1U9ZA 1GKIA 5KMGA 2COUA 4N18A 2VJPA 1MOQA 4K6FA 4EG6A 2CDBA 1AMUA 4CODB 4ARIA 4NXMB 5KNDH 2IY8A 2C9DA 3IX7A 3OETA 3NP7A 5CHEA 4RK7A 3OC6A 3MTAA 2QRQA 4X8MA 4Z1MD 2EWMA 1DAHA 2QN7A 4GZ6A 4S1VA 1R4AA 4X20B 3KKNA 4TMVA 4XTCS 5CB0A 3AM3A 3IE1A 3EY9A 3M3PA 3WYBA 5FF9A 1KNQA 2WWIA 2YN0A 2MJLA 1EHYA 2AQIA 3OJ0A 4AY3A 1L4HA 1D6NA 1S2DA 1F5SA 1M2WA 3ZW8A 2E87A 2J6IA 2QSJA 2XVZA 2ZUUA 3KT8A 3LGAA 4LBYA 5GJCA 5JH7B 2GLUA 3Q87B 4LTMA 1OB5A 4P54A 2Q6OA 4IMIB 3TECE 1O95C 1GAEO 5GZ6A 5K6AC 1TA4A 1UBGA 2FSIA 2OWDA 4KXUA 1Z16A 3PNSA 1BXZA 2OILA 3DA8A 3H1AA 4MRPA 3CUKA 2BI8A 2GEKA 1YULA 3PJFA 3KKZA 2XOKA 1HNXB 5EZ6B 3WL8A 4TXNA 1BCSB 4JQZA 5C1PA 1R66A 3ESYA 4IFTA 2D2XA 4B7ZA 1QIEA 2QIPA 5AKZA 4KPFC 1LZLA 1YQ9A 3NTOA 2VRNA 5AKKA 2AN1A 3TK1A 4FMBB 2Z3VA 3RC9A 4WZBB 1E2MA 3BHNA 3F4BA 4XFJA 4CIYA 3WZLA 4RTLA 2RAUA 5BW6B 2RCNA 4EB6A 3R8XA 2OCDA 1YACA 2C3MA 2N0SA 3OZIA 4U9HS 5E8RA 3U4GA 3NPMA 1TC2A 3EY4A 4AS2A 1FYVA 4IIBA 2SCUB 5KHOC 2CKMA 1Z68A 2X8JA 3QHAA 4JOCA 5I9IA 3U7HB 4WA7A 5KSOA 4YFYA 1PYOA 3CGGA 5AHRA 1CQWA 4NR0A 1KMMA 2ZBRA 3NBMA 3N39C 3NM5A 4ZQCB 3VO1A 2E7ZA 4E2XA 1P4SA 4UMEA 5BNFA 3SX4A 3AUFA 4EYGA 4ZMSA 3U60B 1O4WA 4OHPA 2IXBA 4R3NA 2BM0A 2CDRA 2J9ZB 1NYLA 3B89A 1A9SA 2OV3A 3KTDA 3P8ZA 4RQUA 4A91A 3CVXA 1YQUA 4JK3A 3H13A 3ZHTA 3DFKA 4YAIA 1N3IA 5C46F 4D0SA 5ITVA 3M6VA 3U44B 1XVIA 1RQRA 4TTTS 3N5KA 1T5DX 1VLJA 1YAHA 3OU6A 1XEAA 1VJ1A 4GVLA 1GNVA 2HA4A 1JIXA 3GIWA 1BZYA 3I01M 4U8GA 2G4CA 1CY0A 2YBEA 3NIBA 1SUCA 5HMLA 5T8KC 1M75A 4C7MA 1ZJZA 4MI9A 4FFDA 1VE7A 4JYZA 2VJLA 3W7VA 2ZW9A 1RM4A 3UWSA 2G06A 1YHYA 1ORHA 2VDWB 4YAGA 4DMRA 3R1IA 1V96A 1B14A 1L7RA 4YH1A 3N0XA 5DJ5A 4FJ1A 2JIPA 3H75A 4MRMB 4M0PA 2J33A 3KL4A 4LBVA 5H4GA 4HWKA 4DUPA 2WTUA 4KKVA 1YO6A 2PRYA 4MYDA 2WF9A 2QSUA 3SS7X 1CY7A 4LOKA 1J8FA 1S5PA 3U1TA 1DPFA 4XIIA 3GFPA 3SGLA 3I8SA 1CZOA 1D4FA 1OYWA 2Q29A 3OSZA 5B58C 2XAAA 3R2JA 1ZRHA 4TKMA 5D84A 1GV0A 1YZFA 2ZR9A 2ZCVA 4NH0A 3VR2A 5ITWA 3PWZA 2EKQA 3WYFA 2UYHA 1PLJA 2GNAA 1IK4A 4YDQA 1Y9EA 1S3IA 2XWPA 4Q9DA 2RH9B 5LXTF 4F8EA 3AOEC 2HSDA 3LLCA 4IXDA 3VOBA 3VUFA 1XNGA 3DCJA 3FNFA 1YZYA 1O96B 3IUYA 4IIDA 3EIUA 3JTEA 4LYGA 2H7CA 1Z4LA 1KJWA 1Q3HA 3TE7A 3N2GA 1LFDB 1TX4B 2NP6A 4HO1X 1HKHA 4L75A 3VC1A 1P5HA 3PC6A 3T12A 3OX2A 3A4MA 5D3KA 2D0DA 1R8XA 2KSQA 3GPCA 1NM5A 3HS3A 2EKPA 4B3FX 1EA5A 1Q1NA 2W6MA 5I45A 5BMOA 3K9BA 1NBIA 4EB6B 1Z2EA 1YU9A 3PIRA 3RVLA 3A7DA 4A0GA 3SM9A 1J70A 2ICAA 5JAMA 1XZLA 1W1UA 4KIGA 1FNCA 3DAGA 1C50A 1TM7E 2IOFK 3H5AA 2V5VA 2JGRA 4V3BA 2ZRKA 4HLDA 3ZG6A 1BS9A 3UUFA 1EQ2A 1NQAO 4AMUA 4B6FA 1ZOOA 2PZEA 1ULSA 3NHBA 2WKSA 4GLJA 3T35A 1XT6A 1QF7A 2G4LA 2NZJA 5HCNA 5EZYB 1KDZA 3IT1A 4HBZA 3SC4A 5JNRA 1DKQA 3G9QA 3PUXA 4GVPA 1N6LA 3A4NA 5HZMA 5EE9A 3IQXA 3WJ1A 1KEKA 3OP4A 1VYHA 2VK8A 2HBQA 4I66A 1H94A 1HKUA 1L8XA 2B83A 1NY5A 2Z09A 2X5OA 3H83A 2A1UB 4BRUA 5FNVF 3VU3A 2J3KA 4K9MA 3QBVA 3W7BA 1JNYA 4DJAA 2F1IA 1EE1A 2QRZA 3MUEA 4H4EA 3V1TC 3WKEA 1PN3A 1VSBA 2F8MA 4QQNA 4F12A 4KXLA 2ACWA 4HAIA 1QG0A 4YUZA 3STUA 2WSIA 5EIBD 1ECPA 3ESAA 2VTBA 1XMJA 1JR3A 2OV2A 1NLYA 2VWHA 3R3XA 3TI9A 4YRMA 5JWRA 4A8JA 121PA 2CVQA 1F5NA 3M7IA 2BFBB 3PVZA 3E5MA 1N8TA 5CM8B 2ID9A 4JUBA 2VJAA 1JYSA 4M88A 4PAGA 4BO7A 4MYCA 3GN2A 3K16A 3NJRA 5L8VA 3HJFA 2O8EB 2I1VB 1YNSA 4D57A 4IXTA 1GTG1 2HSWA 5IJ0A 3FYDA 1MH9A 2GCPA 3GT4A 4KX5A 5ICCA 2K2WA 1PFYA 4GPTA 1U02A 1Y4SA 3O6VA 4W1RA 5BWNA 3MVEA 3SI7A 1ZICA 2FWPA 4HY3A 3IVXA 3N2GB 3OA0A 2HQ1A 4RIEA 4YRSA 3T7SA 1U1DA 3PL5A 4A92A 4OHOA 2JI6A 2D7DA 4JD5A 2PUAA 2X7XA 3KYJB 3SE0A 1JLSA 2NSJA 2PSHA 3HBNA 4JU8A 1T2FA 2QU7A 4BVEA 1W6RA 5ICFA 3OFVA 2NQ2C 1Z83A 3DT8A 2WUEA 3NEYA 2IXTA 1C0LA 1EJBA 3ROPA 5LQMA 3ZXUB 3CW2A 1Q1AA 3AHGA 5J2TA 3DQPA 3GEBA 4HN4B 3NBXX 4UEQA 3LX5A 3GVCA 4Y1FA 2I3DA 1LC0A 3AR2A 3G7UA 4UD6A 2B35A 4LK3A 3VV2A 4B5KA 4CFZA 3AJDA 3H11B 1JLKA 2Z2KA 3LL7A 3RKRA 1NQXA 2IYVA 2FEKA 1G42A 2UVDA 5K8CA 1BWPA 1BKSB 2AQHA 1YB1A 2AUNA 2CNKA 2JEOA 3PIIA 5FL7A 3QYJA 4Q82A 2I99A 1LVUA 2PMFA 1VRVA 1HNZB 4OAQA 4WCFB 2CLFB 4MINA 4R69A 4AMBA 1CQZA 2OUKA 5HUJA 3QOXA 2OXEA 4H6VA 1ZJJA 3RREA 4EG7A 3ZGNA 4BO3A 4TLDA 4RAOA 1QVWA 3T9CA 2G6TA 3MUOA 1EFVA 1M76A 1TIKA 3HCDA 4R1OA 4C4TA 4AECA 4LCJA 2Y3IA 4M21A 2G9RA 4TVOA 4G0MA 4ZXPA 3GO4A 3N8HA 4TQGA 3O73A 4QVKA 4O6VA 5ALUA 2WWWA 1Z6GA 4JVMA 3FCXA 3MT7A 5B53A 4KI7A 1YL5A 4ILKA 2VTBB 2JFOA 3EWAA 2ASEA 3G0CA 4W7SA 4XVCA 3Q5GA 2ZUSA 2IVFA 4H3KB 5HA5A 3ROTA 5KQLA 2WIBA 1V9LA 5FIUA 1QHHA 1XTZA 2GN4A 1CZRA 1Z13A 1ZM7A 3OEEA 4US2R 5KYXB 4AQ7A 1QYRA 2I0FA 5BNWA 3K15A 2KWIA 5LXTB 2QP3A 5HFJA 3ZZ1A 3DP7A 5FOSA 2VF7A 2GHQA 3AIOA 4L4UA 4CKZA 1E69A 2CLCX 1E63A 3UJ8A 2V9ZA 5CLJA 1Y3HA 1DS6A 1N2CE 2VWPA 2ZKIA 4D4HA 5JS6A 5B3JC 1DTSA 3ZI4A 4RY9A 4WK0B 1G59A 1U0BB 1TUIA 5JEDA 3FPKA 1BQEA 1V7QA 2AZTA 2F1OA 1OKKD 3O8QA 3UUGA 3K71B 4NWIA 4ARUA 4NMHA 1M34B 1Y9AA 1WSBA 1J90A 1I3KA 1HO3A 2D5CA 3HXTA 4C4SA 2DWCA 3PXGA 5TGZA 5BUQA 1XD9A 1Y34E 2ODAA 1PGQA 3BWXA 4JJ7A 4P35A 4B48A 2V7QD 3GAAA 4B9EA 1KKLA 1CUHA 1CV2A 1T0HB 4WMLA 5JSZB 2OC4A 5J2TB 2R60A 3EIXA 3L02A 3LS2A 4KNWA 1H2ZA 4F5ZA 4XCXA 2NU7A 2JCVA 1T8UA 2VXYA 3I73A 2P67A 4IIJB 1P7YA 4KDEA 2C2XA 5CBKA 1YSCA 3UGKA 4BV8A 2JHFA 4P84A 4GE3A 1WMBA 1DXYA 4YIHA 1L5ZA 4MLDA 1IZ9A 4KYTA 3U3ZA 4L8FA 3ZVRA 2AMFA 3DZDA 1GAQA 3E1KA 3N0VA 3FHLA 1KS9A 4PR0A 1M54A 1M10A 4ZZ0A 1ODFA 1UCFA 4EARA 3ZHQA 4ZT4A 1QGAA 1M2VA 3DQQA 4M99A 3CQ9A 4ZU6X 3GRCA 1POWA 2AK2A 3T7AA 1D6SA 3MBIA 1EFVB 1V9SA 3PGXA 4NBRA 4RPIA 4I19A 5T41A 3TMAA 1GKYA 1DBQA 1XFAA 2VZLA 2WK1A 3D4LA 1KI6A 1PVDA 3FPFA 3NBUA 3PNOA 3TNJA 4Q7LA 1M1UA 4ZOEA 5DWVA 1I24A 2IHZA 4BWGA 4JI0B 1BE6A 1X80B 2XNKA 2V7TA 1VPVA 4W5RA 3C1UA 1U8FO 2Q3HA 3ML1A 1RJDA 2WABA 4CEIA 1FOEB 3B7WA 5ES3A 2WF8A 2WG0A 3PUHA 1ZK3A 1PD0A 3MBOA 2Q2OA 1FU7A 2UZAA 4N8EA 4TXHA 3F6YA 4ZXFA 4PZCA 1PV2A 2GHIA 3K7EA 1TLLA 2GR9A 2JHCA 4G5YA 4UU7A 1RMYA 5K1ZA 3WOHA 4CHTA 1LTQA 4OHUA 1M7HA 3UFXA 4HQ6A 2P2DA 4MDHA 3G2PA 3QF4A 1AUXA 1M1NB 5E4YA 3G88A 1INLA 2E4UA 1PJTA 4KRFA 1IBCA 4WHMA 4V0LA 1YDWA 4A8TA 1F2TA 2JHAA 3VVBA 4PG5A 3CT4A 1OT5A 2I71A 3DG9A 2QZSA 5DISB 4A5OA 4AUKA 1JVBA 4BU1A 1YAJA 4LC1A 2E9SA 4HLQB 3TLKA 4PS1A 3FR8A 1E8DA 1TYAE 1MGPA 2J85A 2P7IA 2VYND 2YXDA 3DGFC 3GRKA 4LXQA 1ISPA 1GUYA 4NP6A 4YO7A 2CHQA 5CFMA 3LX8A 2WC1A 2C8LA 4M9RA 3WC4A 3GU3A 5EEGA 2GESA 3R7LA 4NOJA 3TPFA 4V0OA 1Z7EA 4LPKA 3EB9A 4P3KA 1AF4A 4HXGA 1KEZA 4ENQA 4LE1A 1FRFS 3OM0A 4AO8A 4RF5A 2G71A 4X8OA 1R6BX 1CZLA 2IEGA 2ZB2A 4LHWA 4WY8A 4XYMA 2PX5A 4X92A 4U2FA 2QLBA 3GLFB 4YMWA 4BNWA 3P97A 3IVRA 4CNQA 1L5LA 2OHGA 2Q2WA 3QK7A 3K4HA 2O7RA 1E1QD 3KUCA 3EAGA 1HZZC 3HUTA 1M2VB 3RKUA 1I3OA 4LZJA 2R0QC 1FS5A 2ERCA 2FVYA 5ALDA 3F5MA 2GWRA 4FYYA 4M3NA 1V11A 4G67A 1F3LA 3EOZA 4HVAA 3S2EA 2M1ZA 3CINA 3L7JA 5LBIA 1JKJB 1RHUA 4GLOA 1DC7A 2XHEA 4WNCA 1D04A 2YKGA 2TYSB 4J0FA 2NZ8A 1U2SA 3TZEA 2QV0A 4UARA 3BORA 3HY6A 1GQRA 3PA8A 1NVGA 4XPIB 1TIBA 2I2AA 1U98A 3AXTA 4GKVA 4INPA 4JENA 1SOWA 4LS3A 3VNRA 4B80A 5LQAA 3SQWA 1XZKA 3DXXA 4QULA 3VR4D 3OE4A 2X4LA 1RYBA 2EXXA 2JZCA 4ZU3A 5K99A 2ZBQA 1Y7HA 1K9SA 2EJVA 1FP1D 4A73A 3VO2A 5B1SA 4DDWA 1DC5A 2VF8A 3UFXB 2OCLA 2E1PA 4J4HA 5A2GA 1K8ZB 2Y05A 3KUUA 1E4OA 3MELA 1N0VC 1WUKS 3T38A 4XUGB 3R20A 3S4YA 1MB4A 3HDVA 4K5QA 5JSHA 3LV8A 1DWQA 1RS0A 3IAHA 3BSWA 1KSGA 1O57A 5JYBA 4XRRA 2X42A 3OPQA 3UWDA 2WU3A 1YQTA 5EXXA 1CDEA 3X0DA 3GGPA 1I6LA 4KQ2A 2HWYA 1K7XB 5BN5B 3VSAA 5C53B 3L0SA 4H7IA 1M2OA 3QE0A 2GKOA 4ZJYA 2D8MA 2QVXX 2PX2A 2JASA 5KC9A 3RJ5A 3TIFA 1FU8A 1EG2A 4EW6A 1TEVA 1NYQA 4MCIA 1AQYA 1HV8A 3CT6A 3N53A 5E8JA 4PEVA 5HEKA 2AZ4A 1RKBA 2HQBA 4RVUA 5CX4A 3USCS 1JFSA 3QVTA 4Z51A 2D0IA 3OOEA 5KWIA 1EP9A 4BBZA 4RWEA 1Q92A 4WCVA 3QF7A 1EZ4A 3OZFA 1T8WA 2DFPA 2F3QA 1BRMA 3NATA 5J4LA 1GPAA 1X74A 3HJRA 4M9CA 5M29A 1B6TA 2WZDA 2IY9A 3I52A 2QRVA 4WINA 4WZBE 2GJ4A 5DI9A 4EMUA 2JLXA 4HDCA 5CT8A 2HIHA 3EG9A 1E0DA 3F5SA 5FWAA 3R7BA 3T7RA 2I4NA 3JYHA 4NZ9A 3L93A 3VPGA 3W0LB 4P4SA 3WDMA 4WKNA 3A4IA 1WTCA 4YRIA 3K0AB 1MRNA 3CRNA 4HLNA 2JARA 4MAFA 1T8RA 1XQVA 3CJTA 4BRWA 1TJPB 1V11B 3NWEA 2BGLA 3Q9NA 3CRW1 1BAPA 1HYHA 3H5VA 4TMYA 1K06A 5CFQA 2AW3A 2XHZA 5B64A 2R68A 4Y3UA 5E0KB 3OTHA 2QU8A 1T0IA 1G21B 2E6UX 4IHQA 3OQIA 4AXBA 3H5WA 2X76A 2BFFB 3Q2IA 3G6KA 2QTGA 4CT4B 3GQBB 4EG5A 1TRHA 4K9QA 2WSMA 4X61A 4YROA 3N8KA 3F4LA 3K9HA 3MAGA 3TEFA 5JMPA 2R1UA 3C39A 2G36A 3VR0A 5A9SA 3N70A 3OM9A 5BYBA 5G0TA 3A7EA 4JBGA 5A4AA 1H4SA 5C81A 3NEAA 4ALNA 1QRDA 2OFPA 4NDZA 1CUBA 5T3UA 2A67A 3KVYA 5J23A 2ZUDA 3QX8A 1NMSA 2QBYB 3IDAA 5HVNA 1XI2A 4NZPA 3WL5A 3DZHA 1BC5A 2CXRA 1EUDA 1D2HA 2OP1A 3LDGA 3WNCA 3NRCA 2QTFA 4CU5A 3EDRA 3PG5A 2AMLA 1ECFA 1FFDA 3K5HA 2V4MA 3PFIA 4HQ0A 4HTFA 4MVJD 4OUKX 2DECA 4UUAA 2C5FA 2E1RA 3FFXA 5AR1A 3RQIA 1PSWA 3OJLA 3NAMA 3CLUC 3IEMA 2NUPA 1WO8A 2YHAA 1COWA 1YS1X 2CFOA 4J1QA 3SHOA 3HO1A 1WNFA 3FG9A 1M2OB 5DN9A 3E22A 1C7QA 1YJ8A 1QZUA 4S1WA 5MHTA 3I6BA 4OHZA 4DLWA 1FTQA 1MZPA 4AKGA 2X0FA 2DY0A 3HN2A 1HOXA 1E2QA 4WKBA 1J33A 3IEXA 4F5EA 2ZWAA 4JBLA 4WBNA 2VJYA 1P81A 1UM8A 3G59A 1EUCB 4LNUB 4D9CA 1LJ8A 1WDLA 3GK3A 4QGHA 2BGUA 4QC2A 5MGNA 3GVIA 4EPXA 1G6HA 5BV0A 4ZV9A 4Q7QA 3VZCA 3K9QO 4KVGA 5EUCA 3H9EO 5J58A 4MQBA 2ZIFA 4BN5A 1C9EA 2VAVA 4LJ9A 5T5QA 2PM8A 1HL7A 2YWFA 2CHUA 1VSQA 2OZLA 2NU8A 3EIFA 4MGHA 4DARA 3UVEA 4Q9AA 5IYZB 4I3GA 3GYGA 4KV9A 2FPIB 1QBGA 1CY4A 3DV9A 4CKBA 3W8NA 3Q72A 3H4VA 4TV8A 3DPUA 3Q9SA 4RIIA 1IFXA 2XSZA 2YHBA 2Y6UA 3OT1A 4HF7A 4MR8B 4ZICA 4LDQA 5JE8A 4RPJA 3VTFA 3W90A 3KC2A 4KR2A 1I2DA 2UZ1B 1XJWA 4J0EA 3E9EA 2A5GA 3JWGA 4RSHA 3BYZA 4Z3DA 5BSHA 5ES4B 3RIXA 3M1IA 2YZKA 2WWTA 5KC8A 5A9SB 4XQ0A 3I9OA 4WWHA 2XYQA 4NS4A 1TF5A 3H2IA 1Z4JA 1DB3A 4S12A 5HCIA 3UXHA 5EHQA 4H6WA 4LNAA 3EGDB 4QDUA 1TMOA 3TD2A 1SHLA 4FILA 4PNHA 3QRWA 2NXNA 3UFBA 2CL0X 2XIQA 1UBOS 4E6EA 5E6UA 3P20A 2WJVA 4IDNA 4BEVA 5CEEA 4EKYA 4BKMA 4FE7A 1KYXA 2X0DA 4JT4A 3E3AA 3BFVA 5L7TA 5MN5A 2NXJA 3WK7A 1FYDA 3SFVA 3EPLA 5ECWA 4N54A 3PPYA 4FI3F 3W2IA 4BO5A 2OO5C 4B83A 2Y4NA 4J0HA 3CTMA 2PRSA 3EEIA 3RHTA 1L8OA 1MAVA 4K0RA 4OFBA 5KQPA 4LHXA 1SM4A 2EFHB 2PSFA 3KYIB 4R2LA 1JHRA 5JHGB 1PUXA 2B34A 1JXMA 3AH8A 1CLEA 1NRJB 2DTEA 4L7QA 1CRQA 3BHMA 4GOXA 1DX6A 2PLWA 1G20A 1DARA 3QVGA 3A14A 3NHMA 1R9MA 1LC3A 3RUPA 3T5MA 2JRLA 3AIIA 1MA3A 3PF8A 3PFGA 4ZEOA 1C0KA 4ZALA 4TN1A 2R6AA 4PRLA 4O3FA 3H2BA 3CUUA 2BGKA 5TRTA 3UB4A 3WG9A 2PUGA 1T4GA 3OZAA 4R2XA 1VLQA 4QO8A 5JAOA 5A6SA 5JSUA 2IS6A 1PTJA 1Y82A 3T5BA 2ZIUB 5EOVA 3CVOA 3SFZA 3RAPR 3OURA 3C3PA 4RMNA 1U3TA 2CDAA 3M6WA 3RUEA 2HQSA 1SQSA 4IZHA 5ALEA 2DJIA 1UFOA 5JQGB 4I08A 3MD9A 1XMXA 1W5FA 2ZVPX 3PXXA 2NU8B 4HR7A 4CRWB 1EGQA 3QH4A 4E7PA 5AVUA 5AK5A 4H60A 4EABA 3AVTA 2COEA 1O89A 4ZCIA 2GZAA 2YXPX 3IHKA 5BSRA 1BMFA 2QTMA 3LZCA 4G36A 4KO4S 1PKEA 1FYFA 2A4KA 3I01A 4M8NE 4H31A 1QFYA 4TV8B 4DIBA 3HBMA 5IANA 1JPUA 1Q1GA 1Q17A 3P96A 5BORA 2WJPA 3J7AC 3UV7A 4DN6A 3AB3A 2PV7A 4F72A 5DNAA 2J4CA 3WWZA 1Z7YA 5CB4B 4AZTA 3D3WA 3PZBA 3FCOA 1WMEA 3NBQA 4BNDA 5KVSA 1X87A 3N2EA 4MSUA 4D9NA 3U62A 2G1PA 3HB7A 1HF3A 4K9DA 2BEUA 5C7LO 4ZHQA 2FWRA 4DT1B 1Y7IA 5HRUA 1Z36A 3I64A 2ZZNA 2CW5A 3I4FA 2ONKA 4ZQGA 1LLQA 1L6IA 1WEKA 1H3NA 3OZUA 1YIDA 4IQGA 4KAJA 1W0JD 2AI1A 2P6MA 4MCHA 1PQPA 2F3RA 3F71A 2NO7A 4KSBA 5LMZA 3DDWA 2XE4A 4FYVA 3Q41A 4N01A 5FR1A 3FZNA 3OAAA 4C6TA 2AHOA 3QXJA 1ZDMA 4KQWA 4RZUA 1BN7A 4EHAA 4WK6A 4DAOA 5C7IO 4B8WA 3GD5A 2GAAA 4HNQA 2VHWA 4Q6BA 3WICA 1IJKA 3Q12A 3GN1A 3PD7A 4FFLA 4IOMA 4M89A 2RGAA 2GWHA 4Z2YA 3VTKA 2JIMA 2NV6A 3AETB 4U2GA 5LQSA 2W4IA 3OCVA 4YS6A 2GSWA 3E3LA 3Q6MA 3DMHA 3Q98A 4JWKA 1A98A 1TPZA 1CUXA 5FUMA 2VWGA 1ISJA 1U0HC 1XZAA 1NSTA 4OY3A 2RHWA 5LZ2A 3P94A 4PM4A 2BFEA 3E4CA 1X86B 1YV9A 4PTZA 4BECA 1QVVA 3A1UA 3PE6A 3CZ9A 3MJTA 2AOTA 1VKOA 4LWOA 4M9SA 1P2GA 4LBWA 4FHCA 5A6SB 5I4BA 4MS3B 1M34E 2W6ZA 3HSKA 3IP9A 3KJXA 5F23A 2EF1A 1JPVA 2NZ2A 2YV3A 3BXPA 3GRAA 1H4TA 3A27A 4QUAA 1GFWA 1X3SA 2XA9A 1QVZA 4U7JA 5CDHA 3HKDA 2DR0A 3UMSA 2GCNA 1FRVA 2W98A 3OPVA 4QYMA 5CFNA 2G3YA 1IB0A 1QR6A 3BGIA 3TIGA 3W4KA 2XZLA 4TZ0A 1L7XA 1PKXA 4I9NA 3OO0A 2AJTA 2FEPA 4RKEA 1J42A 4KVAA 4M54A 4RGYA 1XO1A 4BLTA 5CDYA 3DUWA 1LI5A 4MWTA 1OWPA 1S1MA 1WV0A 3L8GA 1YDGA 3T7JA 3ZZ0A 5H4HA 1KR5A 3EFOB 3RVMA 4BIIA 1EZ1A 3ETNA 1HK7A 5HNKA 1C4OA 3QW2A 4KIJA 4OFZA 4QATA 3TZBA 2J7PD 3FOEC 4BNDB 2Y0EA 3D43A 3WDSA 2B4RO 2GYUA 1RLOA 4NCHA 2BEUB 4OBWA 5ICEA 2HYDA 4ZAWA 4QUBA 1V48A 1N8SA 3VO9A 3V7WA 4UHJA 4L9SA 1E2HA 2GBFA 4R9UC 1DUVG 1Q57A 5FUVA 1G8YA 3KPJA 3L6BA 2G76A 1UAAA 1TK9A 1ZOPA 1KXZA 4GUDA 5KDDA 3PB3A 4Y0AA 4E5YA 2E5WA 2HSEA 3H2GA 1JEQA 2BFCA 2JFBA 1QG4A 5BMVF 1C9MA 3UMRA 1N5KA 3IAFA 3OKCA 4QTTB 2H48A 5KNCH 1RIIA 4DDUA 3TL3A 3MINB 2QIOA 2OBYA 4XWOA 1KI1A 2MSKA 3AQ4A 3L18A 5DBIA 1CE8B 4UQLA 3ZWAA 4JR0A 3ELYA 3G9UA 1QYCA 1X7DA 3ZXSA 4QXMA 1RC0A 5L6MB 1MDBA 2EZ8A 5AKEA 4AB1A 3B48A 3MJEA 3EXG1 3S44A 4EI8A 2BTQA 1KU6A 5IUNC 2QJFA 1Z6ZA 3E7FA 4EPVA 3HFGA 4M6WB 2BHNA 3KVVA 4I50F 1C8BA 2X1VA 4QPPA 4JI2B 4RHXA 3PL1A 2IYLD 1WZNA 2BTOA 4KYIB 5CA0B 2H18A 4II7A 1RD4A 3D6JA 4MDEA 2I29A 2ID7A 4KQ6A 4QREA 2MU1A 4KUGA 1UKZA 2PUFA 5HZKA 2I8CA 1ODTC 4A36A 1Q12A 3HPQA 3ST7A 2O2CA 4YDRA 2HJSA 2H6EA 3OSUA 3PI7A 2E5FA 2QAGA 3IP5A 3M2TA 5AOAA 3N75A 3CN9A 1H0RA 1G5FA 3UHAA 1Q50A 1T9HA 4MYTA 1N5IA 4NFHA 1OF1A 1ZN2A 4BLUA 3RWOA 2JATA 3F6RA 1M6EX 3KFVA 3RBXA 1KF0A 1U4SA 1GQFA 2IZ0A 2Y1LA 4Q37A 3GLFE 1UJNA 4I46A 3OTIA 3KKPA 3C4QA 5CH8A 4C7KA 5K51A 3MGCA 2BJHA 4X00A 5EIEA 5K4GA 2DBQA 4X62B 2V6BA 4Q66C 4HPJB 3DZCA 1QCCA 1U0EA 3T3OA 5CVCA 1VG8A 2UYCA 3D3EA 3LT0A 4EFKA 5L9AA 2DWPA 4ZCQA 5JWHA 4BNGA 1R5OA 3O4RA 2RHTA 3KHKA 5CNKA 2P4UA 5DRYA 4H1VA 1S8FA 4WCFC 1F8YA 4ZVOA 4ZVRA 3KVNA 1KQOA 5B55A 5LWQA 1MA0A 3Q88A 3UBTA 1C3LA 2AN9A 3BXHA 4Y6OA 2NUTA 4Q7EA 4RTKA 5A6VA 4MVXA 4H1WA 2GBCA 4G0OA 2CVFA 1U0TA 2BFCB 3Q3GE 1LJLA 5IJAA 1G17A 3WQRA 5KQSA 1YA6A 2O2XA 2NYVA 3WOVA 4HK4A 1JILA 3R76A 4DLUA 1B3BA 4RAQA 1AF7A 2WT4A 1E6LA 3AB8A 4FUTA 4MQ4A 2I76A 3WYCA 1VPLA 1X77A 3F9RA 3I0NA 5AI6A 4B6JA 4ZI5A 4AROA 5AFSA 2HW8A 3A04A 1JEYA 4Y9UA 1SKMA 2ZSIA 1F2UA 1JSLA 5JVDB 3TQRA 4ZHSA 2XGOA 4F6RA 5JBNA 5LMCA 3TKLA 2VATA 3K70B 5EMNA 1G66A 2CY0A 1DJOA 1HDIA 3D4PA 1D1SA 3KB2A 3P0FA 2ODBA 4FMDF 5GOTA 3I9MA 3V48A 4OHFA 5G4LA 1E6KA 3GOHA 2ZRBA 4KQEA 3B13B 1LBIA 3DXFA 3LBNA 2ESRA 1QKIA 2NTNA 2IUEA 2J6HA 3MEQA 4D92A 2GPJA 3TZHA 1XMPA 2QV7A 3CONA 3L1IA 5M2QA 2XCOA 2YUTA 2OZPA 4LG1A 5THKA 4QTYA 4EGAA 2GI4A 5M5BA 3WWCA 2FB9A 2Q9CA 1K6JA 2VDRB 3EARA 2AI3A 4IIYA 3WRXA 1E4EA 2IBMA 1H2HA 9ATCA 4JROA 1FIUA 2A0XA 2GN2A 2GZ3A 1QPBA 2WFZA 2WA1A 3W8FA 2FZ4A 2R84A 2C7RA 3PA6A 2ECFA 5DYNA 1UK7A 3DLCA 2Y1XA 4ZKEA 2HEIA 1BQ4A 4O2AF 4WLFA 1ZISA 3LXRA 4N7MA 4DA6A 4DXDA 5FHRA 3OTOB 2F00A 3Q2KA 2LDBA 3LBYA 4HB0A 2OGZA 4WUVA 1GPDG 1OQAA 1ZI8A 4OUDA 4DJFC 3F7MA 2XCSB 1I32A 2PX6A 2Z0MA 5ALOA 1VPDA 2PUWA 3TW4A 5ARBA 4J49A 4JX9A 3TINA 1EUQA 1WW3A 4HD8A 3SSAA 2C58A 2PS9A 1Y9ZA 1XKXA 2GEFA 3H1PA 4LZZA 2BKUA 2W70A 1PI3A 2G04A 1AZWA 4YJFB 4J90A 2OZVA 2Q6KA 1A0OA 1RVDA 3DE3X 3STHA 3PDCA 3U4DA 4H08A 4OTZA 2PKQO 3WGUA 4WLUA 1ZWLA 5CAEB 3E58A 1RAIA 2YJNA 4KE9A 2BW0A 4NNPA 4UAGA 5KYUA 3VJKA 4C05A 3R74A 3ZWPA 2CLOB 3Q1KA 5BMVB 1SO8A 2I3AA 1ZGHA 1NR1A 1G21E 3QU7A 4QXQA 3WB2A 2O8BA 1P5RA 3TLYA 3A6DA 2D7JA 2ZYRA 2H3EA 5LB2A 5BN3B 1PFGA 3KKKA 3RYTC 1WBBA 4ALKA 3WK5A 2WIAA 3JQ6A 1Y42X 4U39A 3UOAB 3D4NA 1UWVA 4YVFA 4FD2A 3HYLA 1A8QA 4XCQA 5FYDA 4ARAA 1NZJA 1NFQA 4PWZA 1I51A 1PEAA 3L8ZA 4TKZA 3IIEA 1YI1A 4JVSB 4F6RB 2GPNA 1E6MA 5IAOA 2MSLA 5AM5A 4WFQA 3RV4A 1V39A 5DT2A 1JJFA 4PO3X 4AKTA 5ADUS 2REQA 4RV4A 4CIXA 4V0ME 3QENA 4Y2HA 4LZLA 3URKA 2P9CA 5HKBA 3M4JA 1TAGA 2IZOA 4ZQEA 1MO5A 1ISSA 4BO2A 4JHXA 4I3FA 1LD3A 4JGGA 4B6RA 2HYIC 1H9CA 2J6BA 1C3OA 2CFCA 2Q3FA 4M1QA 3V8BA 2C7BA 3W5IA 5L4SA 2JA2A 3F98A 4G5RA 4WLOA 4G0PA 1SCJA 4D4IA 2QN2A 4Q9HA 3ZY6A 5FQOA 2PZJA 1RAAA 3OD5A 4Q4LA 4QDJA 3AY3A 5EXPA 5FEMA 4PYMA 1WUJS 3SE7A 2ZTHA 4IIGA 2IYFA 4Q3KA 3PNBA 3FBTA 5EJAA 5C2JB 1DIAA 2PMDA 3N0RA 4XYLA 3CMCO 2XADA 3CNEA 3Q9LA 2OBNA 2XX3A 3CEJA 4RM3A 3W6NA 3AUTA 1LW7A 1W73A 1VHTA 5FUBA 2ZSFA 2F2TA 1J00A 3A3KA 4FU0A 2OAQ1 4NFLA 4FZ5A 1M2NA 2G40A 4F45A 4Q3NA 4HGYA 3CNBA 1R8QA 1U2RA 1MVLA 3HTXA 4BRSA 2FPRA 2X7JA 2AG1A 1EGVB 1HLGA 1O9GA 2C2WA 2FW6A 3FNBA 4LF4B 1XCOA 3SEFA 3QHQA 1N0IA 1MC4A 1ZFNA 3INRA 4CLXA 1V5EA 4LC9A 1KYIA 3QSYA 3BEOA 3PICA 2G72A 1YMVA 4RQTA 4MX8A 2ZRNA 5B6PA 1NC3A 3VSCA 3DDZX 1YKFA 1YR3A 1NR5A 1RWOA 3LD9A 3R0JA 1FMLA 2C9YA 4I4TF 4KZKA 2ZAOA 4XGKA 1A3CA 1TYBE 3A3YA 3KQPA 3JWEA 3O31A 4JBNA 4MDFA 1X1CA 1U3UA 2OSBA 2WJHA 1ZAYA 5IH3A 2ZEJA 5IK2A 4ZVTA 5C37A 1XAJA 2GZ2A 3MUFA 1OLSA 3FPJA 1M8FA 1NVEA 3HEMA 1X13A 4PG6A 4MW9A 5TE9A 2AUTA 2FEMA 2Q50A 2X1HA 4AYXA 3B2QA 3OPXA 3QOYA 3TQFA 2QW0X 3JZIA 4I8XA 2F3TA 4YRNA 4FMDB 1I9GA 1XG5A 2PIAA 1KE2A 2ZR7A 4OH7A 1I7LA 1UPCA 2XCLA 1RRVA 1SEVA 3JASB 3LW8A 1L7AA 4FMCF 4LSGA 4PLPA 4E2ZA 2VPTA 3KT0A 4FYMA 3F97A 3AR7A 5FLYA 4BP9A 5CBPA 3AFMA 4Y1EA 2QNRA 4ZGWA 5AICA 3W5UA 3WE7A 1O0BA 3JYPA 1VBFA 2B2XA 4OP2A 5EUMA 1QG2A 4C2BA 2VP0A 2ETXA 2XBMA 2WFAA 1PYGA 4QELA 5I7HA 5FNZA 4P32A 4E03A 2AD1A 5JRZA 3T06B 1BEUB 3D8TA 2VPIA 2OY0A 1E1LA 1EWTA 2NVWA 2W8ZA 3HBFA 1X8XA 4Q3LA 1Y8CA 3OOYA 3AJEA 1RWPA 2DCUA 4HZUB 2GN9A 5TJHA 2OHOA 3BWYA 3WFZA 2FN3A 2FWJA 2HXSA 4BLVA 4YV7A 5J2UA 3VH3A 1KYWA 4MWSA 5HQTA 4IV5A 4UE3S 4BBPA 1QTRA 4UQPA 2WT9A 4NYJQ 3WLOA 4ZA2A 2D5AA 4MVJM 4YYZA 2UXBB 1Q5PA 1T26A 3P52A 3NIWA 5CJJA 1HUQA 4DM4A 5JNWA 1CFJA 2Q1WA 4LF9B 4B4UA 1UBLS 1XVVA 1U6KA 2C95A 4DCJA 1Y6ZA 1X9IA 1PSDA 1QQ7A 4FQ7A 2LIPA 4P22A 3RLIA 1LDYA 1G5RA 1O2DA 1CUWA 1S8AA 4OYHA 3PRYA 1MC8A 1VDMA 2P3SA 3P19A 4PICA 4HNAA 3LWNA 2LCQA 4FFVA 4C4ZA 4RULA 3A25A 3R5KA 1VE9A 2IBTA 3B5IA 4OQDA 5E6RA 2NPOA 1QFZA 4Z8YA 1GSIA 3ETDA 1L7EA 2VZ8A 3M4XA 1EDEA 3ER6A 2X0NA 5JCXA 2AKEA 1R6DA 1RW4A 4RIHA 3IELA 3ANXA 1DOHA 4B6GA 4JCOA 3NHWA 5JBIA 3DAFA 5D51S 1L5FA 1EFLA 3GBPA 5CJ2A 2QMQA 3SFTA 1UJ2A 2JH9A 3P0JA 4REMA 4LDNA 1Q15A 4RVCA 4BCDA 2PTGA 2BBWA 1NMEA 2W5UA 4K6GA 1FE8A 5K0EA 3R9KA 1XZJA 3K9LA 4EDHA 1HYQA 4ADSG 1XGKA 2DTXA 3R77A 1YE3A 2HI0A 4AVYA 2XTJA 3K1AB 1AXGA 1R4ZA 3CF4A 4FGUA 1FYEA 4F2PA 4BMVA 4YNBA 4CEHB 1UFRA 3WR5A 1D8TA 1W87A 5D7BA 2XUAA 1T8PA 2AG6A 3DMDA