1KZYC

Crystal structure of the 53bp1 brct region complexed to tumor suppressor p53
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
259
structure length
232
Chain Sequence
ALEEQRGPLPLNKTLFLGYAFLLTMATIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structure of the 53BP1 BRCT region bound to p53 and its comparison to the Brca1 BRCT structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein, protein binding
total genus 66
structure length 232
sequence length 259
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18428 BRCT_3 BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1kzyC01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1kzyC02
4IGKA 1N5OX 1T2UA 3SHVA 3PC7A 2K6GA 3PC6A 4BMCA 1L7BA 1T15A 3EF1A 3K16A 3L41A 4XPZA 3AL3A 3K0HA 2L42A 3PC8A 3KTFA 1T2VA 2EBUA 2E2WA 3FA2A 2COEA 3T7KA 1IMOA 2D8MA 3HUFA 3UENA 3AL2A 3SQDA 3PXCX 4U4AA 1OQAA 3I0NA 3T1NA 4Y2GA 1WF6A 2EP8A 2VXCA 4Y18A 3QVGB 3U3ZA 4OFBA 2JW5A 2HTFA 1JNXX 3PXAA 4BMDA 2K7FA 2COKA 3HUEA 4JLUA 3K05A 1KZYC 3T7IA 3PXEA 2ETXA 4BU0A 3SZMA 2LE0A 1IN1A 1CDZA 3OLCX 1T29A 3T7JA 1Y98A 2NTEA 3PXDA 2DUNA 3UEOA 3K15A 2VXBA 2ADOA 2XNHA 3PC8C 2R1ZA 2XNKA 2AZMA 3K0KA 4ID3A 3EF0A 1L0BA 2INGX 4BU1A 2COUA 3PA6A 3PD7A 1Z56C 5ECGC 1GZHB 4N40A 4XQ0A 4IFIA 3QVGA 2M2IA 3L40A 3SHTA 3II6X 3L46A 3PXBA 2EBWA 2WT8A 3I0MA 3JVEA 3COJA
chains in the Genus database with same CATH superfamily
2KS6A 1LH0A 2Q2QA 2Z2KA 3MCWA 1O0BA 3NX4A 3PC7A 1O95D 1KMHB 3DWGA 4NNOA 4R5HA 1XLUA 2A94A 1ADJA 3KT6A 2PEZA 2VSXA 5JS1A 2PZBA 3EHEA 1U31A 1RRGA 2DF8A 4QODA 3GJYA 1SBTA 1QFZA 1NXVA 3QMMA 1E96A 1SVWA 1ZOSA 4U63A 1OILA 5T3UA 3D8UA 4RH0A 2WJWA 2AMLA 1YOBA 2JJ2A 1KDOA 4W6ZA 4K5QA 4WA8A 1QZXA 1QGYA 1YS1X 2QOEA 3FZEA 1QCCA 4L9WA 1E3WB 1T2VA 1K2VN 3OSZA 2BVNA 2C5AA 4OB6A 5EHIA 1XDSA 2H52A 4L85A 3C41J 1QF6A 4CYMA 4C7OA 2MWMA 2HZ7A 3NO4A 1JAZA 2I66A 5KBYA 3RLFA 1R27A 1PZMA 4PQEA 1ZEJA 2DX7A 1LLCA 2JFFA 2FSIA 4QVKA 4UHCA 4ER6A 1B8UA 4GQAA 1DG1G 2GDZA 2X0DA 2H1RA 3RV4A 4D7AA 5IVKA 1GPUA 4Q7JB 3EISA 4HJRA 1QP4A 1E1YA 2B34A 3HG7A 5DX0A 4JNKA 1Y6FA 1X1SA 4X0EA 3VU1A 2OM6A 2AA3A 5LZ5A 1RJ9B 3DMPA 3H4IA 5CB8A 1UKEA 1T3SA 4ER7A 5A4JA 2HJVA 2CD7A 2IA5A 3LNTA 2XMCA 5D85A 1N92A 4GR4A 4HSGA 1DKUA 1CJCA 2IZ6A 4KPFC 3V4PB 2BEWB 3KKMA 1VSQA 3DE4X 2P90A 1FVHA 5D6OA 4R7TA 1VLVA 1N9ZA 2J5QA 4LGMA 2CT8A 3PEFA 3SIPA 2ODEA 3LSYA 4NZYA 4HTFA 2O8BA 1Y82A 1E2GA 2GNPA 3H5AA 4PLCA 3TNDA 5C3MA 1J7KA 1KI6B 1ZUHA 3U80A 2H2HA 1KI4A 1US8A 1FUIA 1NLZA 1QG0A 1NQXA 1VL5A 2ORVA 3GVCA 3M6IA 3AUSA 4NJEB 1DDIA 5GMOA 2IHTA 1DKLA 3BAFA 4IVNA 3N87A 3ZCVA 3IOMA 1PK8A 2C2YA 3A26A 4JIGA 2WLTA 4QQKA 5K45A 5K09A 3T5CA 4ZT6A 3ELYA 2P9HA 4ZAYA 3EXEA 2NADA 5FULA 2PSFA 3U1TA 4BTVA 5JD6A 5JSUA 5C1BA 2VTBA 2EP5A 3E18A 2BKXA 3CO5A 4LDPA 1E2FA 3GB9A 1L4BA 1EZ4A 1DRVA 4ZCQA 1KR5A 3NBFA 1B3BA 1R9JA 4EPWA 1YA4A 2VJOA 3QE4A 3DAPA 3EVZA 3GFGA 2HF2A 4IDGA 3HVRA 2HR1A 2XZLA 4KFTA 1PZFA 4X1KB 5A06A 2GN1A 1U6KA 2WA1A 3OE7D 2AN5A 4B2PA 4AZWA 5INTA 2FR8A 5EYPA 4B8WA 1JS1X 3Q3IA 2M6KA 3U7GA 2W71A 1M9NA 1YR1A 4YXWA 3P0HA 2D7CA 5F51A 3ZX5A 1JEJA 5DISB 3HV0A 1QHNA 2CLLB 1HYBA 2H16A 2N1MA 4GOOD 4LDQA 1OTYA 3KLBA 3UT5A 5BV1A 3QBVA 1QF9A 4L75A 2CXQA 5LYJF 1L3CA 4XQEA 2YFQA 3JD3A 1DJQA 2HJGA 5J2UA 1AK1A 4WX2B 4X94A 5HQ3A 3DDNA 2O5VA 4H60A 4HZUB 5F21A 2I4OA 3VXKA 4B82A 5IK2D 3DFMA 3KTDA 1EDOA 4C78A 4ASUA 3GPLA 3Q8LA 4LG1A 5CVEA 4B09A 3IAAA 5AHKA 3UTDA 1JHYA 1NXSA 2Q46A 3IP5A 5TV2A 4ECEA 5KTMA 4GM0A 5G53C 4WGFA 4I5FA 1ZPDA 4HLNA 2FU5C 1Q95A 2VYFA 3WZ2A 3KIPA 1LU9A 1H3FA 1GZ7A 1GRQA 1S2GA 4HFJA 1L5NA 2VJMA 4FSHA 1Q7RA 3WKDA 2V0CA 4B3IA 2OB2A 2QZJA 3DUFB 4R0VA 3KYJB 4DCSA 1NBOA 2XRZA 1B43A 1RQGA 5ITZB 3SZRA 4F2PA 4BMSA 3RT7A 2V0NA 4Y2SA 3FBWA 4U5QA 3KTFA 2YFKA 3EXHB 1SY7A 4ZANA 2AKEA 4HMOA 1M34E 1B6RA 1LS1A 3TBFA 2GPBA 1Y7TA 1OTHA 3GFOA 1RWXA 3ZZTA 3JVVA 2M9MA 3KSBC 2C97A 4JN6B 4F9GA 4GI5A 4I4TB 1A72A 2HMAA 4FM9A 3OEHA 2WMNB 3PFBA 1ZK2A 2F8LA 1ZK3A 5FAXA 3S55A 4WKGA 3B7GA 3DLAA 4DLXA 4YMHA 2O2EA 3CBGA 3B7WA 1YMVA 3ZGZA 2ZT5A 1LLQA 1UWCA 2WJ6A 3KSUA 4BMNA 3DAHA 2GN8A 3O8LA 4XPIB 4NCIA 1E1QA 4DV6B 3U62A 3ZWXA 3THXA 2VC2B 3D4PA 2A84A 1JFTA 3DNPA 1E0SA 2SNIE 3LDGA 3QKSA 4BMDA 1OGIA 3CVVA 1JAHA 2H5IA 3BTOA 4CI0B 1PJCA 1JIIA 4G5XA 1N9GB 1VFPA 4E11A 3GPDG 2AYZA 2XRFA 3PGMA 4H1TA 4INPA 3LY5A 3ZVRA 4OQZA 4EG8A 2RGEA 4NXNB 3GD7A 5A4AA 1WP4A 3CFYA 5J2UF 3WL6A 1IVNA 3GJ4A 3N2LA 1NDUA 4M9RA 1MNQA 5D3ZA 2HMUA 3ZGYA 3OQMA 2XADA 3CVYA 1GIAA 2OBMA 1C9JA 1N2OA 3FF1A 3KR0A 4CDRA 3BFPA 1FMFA 5EJ8A 1O5IA 1X3LA 5C3UA 5B12A 5G0TA 5LLSA 4IDOA 2PZ8A 2IOQA 2YBEA 5J1SB 5AVQA 3HCRA 3DPUA 4HL6A 1BDHA 2Y1OA 2YJ3A 3DMFA 5AM5A 2ZJ0A 1PBTA 1IXYA 2QUIA 3AG6A 2AG6A 3GP3A 1V6SA 4QFCA 3ZXSA 5IWCA 4ONEA 4FINA 3WTBA 5MN6A 1SURA 1MX5A 2Q6VA 3BIXA 5AUNB 2D0DA 1UMCA 2AC2A 3DLTA 1VG1A 1Z2OX 4D57A 5IULC 4GD3Q 4E2WA 3OT4A 4CF5A 2B9EA 3D0QA 4H2DA 4P8RA 1U4OA 1E92A 2GZMA 4UXJA 4Z86A 4FIDA 1Y63A 5FTMA 3W8RA 4RJKA 5LOVA 1NMEA 1S4MA 2ACWA 4HLUA 2PV0A 2EC5A 3AW9A 3BJRA 3C3WA 3GHHA 3W1WA 1G5IA 4ALKA 5ADVA 2UXDB 1JYEA 3QFFA 2QM7A 4OBWA 3TGWA 1CHDA 2WD8A 1DBVO 4BQIA 1B6GA 1OXTA 4NEGA 5SY9A 2A5GA 4FX2A 1IZ9A 2NYRA 1M2NA 1E8MA 3WIBA 4D5EA 2A3RA 2M6RA 2BHLA 2ZB8A 4E30A 3GAZA 1X9IA 1MOZA 1Y3IA 3GUHA 1HE4A 1OFGA 3G2IA 1ILEA 3RHSA 1XL1A 2I71A 3B6ZA 4P4NA 4QG7A 1FQWA 3MWLA 3STXA 1N33B 3LF2A 2OVBA 1NRXA 2DKOA 4OA5A 2F59A 4DCNA 1ADYA 3CCCA 1BX0A 1NOIA 2FP4B 5AJUA 2FSUA 2R96A 3INNA 3NNDA 4YQEA 2Q3LA 2FSVC 2FLWA 2WMYA 1NYQA 1SQ5A 2QPAA 2PAAA 3FTCA 3LUCA 1R6DA 3KSMA 4CL0A 2C2XA 4X65B 1OA1A 4K1XA 1CETA 1ESNA 1F06A 3GVIA 1WDWB 3UBMA 2ZIZA 3FBGA 3PDCA 4ARZB 3A6ZA 4C4OA 4CU5A 1PDWA 1ECBA 1U2PA 4JNCA 3C5WP 3TLAA 3FZNA 3OBBA 1UKBA 1WR8A 2C4HA 2X4DA 4KVAA 2F6RA 3GZNA 1RI4A 4I66A 1CR2A 2JB9A 3KALA 1LBEA 5C31A 5F23A 3WL8A 1DIHA 1NJ6A 2FDXA 4AUKA 1IY8A 3P0JA 4RKQA 4DV3B 2XBLA 2FHPA 4S1TA 5A3QA 5CLFA 1VZ3A 2BRUC 3IDAA 4FDMA 2J87A 3BQMB 3SVLA 3F74A 4ABYA 5BVGB 1XEXA 3M6UA 1QVVA 2EX0A 2HA7A 4MKIA 1F48A 1G19A 3KT3A 3QPAA 1SXPA 3IT2A 5C2JB 5FOXA 4BNMA 1DXHA 3DAYA 4OJKA 4RIGA 4TWZA 3ZH9B 1J20A 4RA9A 1XJ0A 4JI2B 1CW2B 1JKMA 2VCYA 4JX8A 5AW2A 4BP8A 5CGQB 2AHOA 3AEYA 3BPSA 4Y0AA 1S3FA 4B32A 5BSEA 4K9DA 5BYKA 3NP7A 1TJYA 1D2RA 1MJGM 1OA0A 1N6KA 3TNFA 3THYB 4BE9A 1E1RA 4HDKB 4HJXA 2FPPB 3LTEA 5BRAA 1B6TA 1MUUA 3RSLA 3HMQA 1T6XA 1KSFX 2YTZA 1YVPA 1YAJA 4YRJA 3R3JA 1X8KA 4HYEA 3ESCA 3KLMX 5EOVA 2BHTA 4D8WA 1RBQA 3FYUC 4AZVA 5HRAA 2C88A 4F6RB 2FX5A 3JAKB 5HQJA 4AQYB 4ZYWA 2OGWA 4J76A 2HEGA 4FI3C 4TQ9A 3H2BA 3F67A 1V4NA 3G13A 4GX1A 4QUIA 2HDWA 4YDRA 4DIBA 3FGOA 2V6IA 2WJ3A 4TXJA 1J2UA 3TB6A 2VHYA 1SK9A 4ZCLA 4EVQA 1N0VC 1ODJA 3BHNA 3RNLA 2WIKA 3OQIA 1MW8X 2P3OA 4KLRA 2UUBB 4OMCA 4R84A 1LRLA 3OLVA 4KAFA 3C6QA 2NLOA 1XVIA 3UK7A 3DOHA 4AJJA 4DA0A 3QFTA 2HIHA 1DO2A 3OTIA 5E6SA 5LVAA 1Q15A 4JR0A 1E3WA 5EUQB 5M2QA 3DV2A 3PFWO 3K1ZA 5G2OA 1CQJB 2ZJ2A 1CZHA 3NT5A 1S96A 1E2UA 3OBIA 4HDCA 3QHPA 4D3YA 4UBJA 5C37A 1Z82A 3IS3A 1D0IA 2O8NA 5BSUA 2OLKA 4HQ0A 4OIFA 2GCOB 1PFGA 1HL7A 3E2PA 2DTEA 4Y9RA 1L7EA 1QGUB 1Y9EA 2IT1A 2P2LA 3SYKA 1GCAA 3L77A 2HPAA 3C6XA 3COYA 4XGQA 1UM9B 4EGCB 1YK0A 2BF4A 3B6MA 2V7UA 1RJ9A 1QFYA 4UBOA 3M5CA 2JS7A 3L1IA 1ZC3A 1NAIA 1QAQA 1TM3E 1WO8A 3P4XA 2K2QB 3Q4GA 3ADCA 4B81A 1A50B 4QUAA 3AVOA 1XTBA 1YR9A 3NDRA 1ESCA 2A0XA 2CSXA 4FDUA 5L4SA 3M6VA 4FGUA 2OT3B 5FOSA 3SG0A 4UTVA 1NPYA 1DAGA 1JW9B 2LIPA 2X41A 5DHQA 2XUQA 3MBOA 1DQZA 2GCPA 2CHQA 4HAVA 4MGEA 1BCSA 1UBFA 1LW6E 1KI6A 1FS4A 1Q3TA 3ES9A 3ZXIA 3TK1A 2WUDA 4NJEA 1EDZA 4RY0A 4OREX 1U1GA 4F93B 1L5VA 1AH2A 1U7UA 2XE8A 1GQQA 1QIEA 1UP7A 2B7BA 2J3IA 3L0ZA 3V8RA 5KTRA 3WGUA 3OMLA 4CQNA 1WM1A 4D9FA 1U8AA 3CT6A 4CN9A 2CLIB 2NU8B 4LF9B 4CR8A 3FKQA 2ZT6A 4MMXB 2R7MA 5AJXA 4WOKA 4ZARA 2P9BA 2ZWVA 3BB4A 1ODCA 1NBMD 4JJ7A 3FLBA 5A3RA 2C3UA 4U0KA 1TAQA 3KQWA 3NTOA 1T9BA 2WYUA 1J7JA 3B89A 3MMXA 5K3EA 3KS9A 1FFWA 5DW0A 2GKSA 1YDWA 5COBA 5GGYA 3SWWA 3R9IA 4ARCA 3AW8A 3CRVA 2JAOA 3QJYA 4LXYA 2G72A 5JQGA 1GAXA 5DBFA 1TL7C 3W05A 6ADHA 4GYYA 2WAAA 4WVFA 2AG8A 3W3AD 3CRNA 1OBVA 1EBFA 3HU3A 2Q7OE 5CDGA 4L73A 2HYIC 3EA5A 4NCNA 3U5TA 3IO5A 4M0DA 1K8YB 4KRYA 4PZ0A 3SM9A 1ISPA 1LRKA 1DE0A 2HSZA 2RAUA 2VYVA 3FNHA 4TMFA 2HSGA 4WZ6A 4IUCS 1PTJC 3WGZA 4F12A 1O87A 1ENOA 1QHXA 5CLIA 4RJTA 3NIDB 3QELA 1EXMA 4ND7A 4RD1A 2VNSA 4QPZA 3PGJA 4A10A 3ASYA 5D3MB 2P5SA 1F12A 3UXYA 2JHFA 5K0CA 4W99A 1GVHA 2VJDA 3FHLA 1PR2A 2NO0A 3IKVA 1UWKA 5CRIA 4QUKA 2VUSA 5BSKA 3HJTA 1IJFA 3G8BA 2AB0A 4RVUA 1WABA 2PXHA 3P4YA 2DR2A 4YRIA 2H1VA 2B94A 2R86A 4OL9A 5ITZA 3IJ5A 2B8WA 3EJ6A 3M1YA 4IW3B 4JL5A 1I32A 1KVQA 3NBYC 5DLYA 4W7SA 2AI3A 1FSGA 5DXAA 1T35A 1C9MA 1YDGA 2JZCA 3PNBA 4L15A 3VYVA 4D9EA 1TJ5A 1IFXA 2YVKA 2A1IA 3ZKWB 3TG2A 1JLLB 3M34A 4OHYA 4IQFA 3CIFA 4MYHA 3KZCA 2XA9A 3F49S 3L6CA 2WU1A 3ZW7A 1IBCA 3E7XA 4KHPB 2CFRA 1U11A 1ZZEA 4ZEVA 4I4TA 2E5LB 1XJCA 3QQ5A 2VZEA 3D4NA 4YO7A 4AUNA 4HS9A 3E35A 3R09A 2WABA 4D97A 3P2OA 3WGQA 4L2IB 4RY2A 5ALHA 5I8WA 2FSPA 4YAEA 3AVYA 1ORVA 1K5GA 2ZB4A 3FNGA 5JCPA 4G1EB 4XPIA 5J59A 4G2TA 4RZHA 4KKXB 3VO1A 2X1HA 2I1QA 2HQSA 1RI2A 1TO1E 3ZDAA 1GPDG 3LKBA 4CNQA 4LWPA 5LQSA 4PXSA 3TOZA 1DKPA 2Y1WA 5K2OA 3JARA 2J0VA 1IWBB 3AVTA 4E2FA 2CHEA 521PA 5JQGF 4N4AA 4NC9A 4ND8B 2I4RA 4QFBA 4C4RA 4P5EA 5C5DA 4MCJA 2GM9A 5DWQA 3GRUA 1CYDA 5KTYA 3R74A 3GGCA 4F7DA 5I9NA 1GGKA 1CY8A 1EJ0A 1HQKA 2PH7A 3TIIA 3I5YA 1C4OA 2IU3A 4UUQA 4MHTA 1OBOA 4LN1A 4KXUA 1IRXA 2YVUA 1QHSA 3KJHA 3SHFA 2QK4A 3T7EA 4KFUA 1RQRA 1XCJA 2WQZA 1B93A 5JCXA 4NCKA 5ED0A 2CMFA 4GLFA 3JRWA 1IN6A 1Z0AA 3TW8B 3UVEA 4IP0A 2AE1A 3WKAA 3P2MA 2UYQA 2RDMA 1A5ZA 1Z6XA 3VKHA 4C7BA 5E95A 3BGIA 2MMCA 4A27A 1N0WA 4PWYA 2ORYA 3GW8A 3V34A 2YUTA 3GRKA 5JSZB 1G6OA 4XIYA 3ZVKA 1RLMA 1JU4A 4MYRA 4YECA 4BFUA 3AJDA 1IL0A 1B00A 4YUAA 1Q0PA 2DSTA 1Z75A 2O2JA 1Z7YA 1AKVA 1UP4A 2OVFA 3FWKA 1P73A 1O6ZA 2R7NA 2ZGVA 4NEQA 1Z34A 4QO7A 1MC8A 1XVTA 2AUNA 3Q87B 4LXQA 1A9RA 2F2TA 2ZIEA 1NULA 4J03A 3GRYA 3K9FC 2QD2A 3C8DA 3T3OA 1PWYE 2W2MA 1RBZA 3TVDA 4C89A 1KIFA 3D0KA 2BEUB 3AHFA 4ACAA 3DTVD 3K6KA 1SQFA 2JAHA 1U9CA 3F8TA 4YBZA 3ZDRA 3VPBA 1ZJ5A 5CVUA 4JD5A 4A8JC 3T1YB 1I4LD 1Y33E 4EO4A 2IH5A 3ZWOA 3BMQA 1PNQA 4JB3A 2XCRB 2RGNC 1G2IA 4Z0HO 4QPNA 1SCJA 3DE5X 3L4EA 3QIAA 2OQRA 3KRTA 3DC7A 4QLAA 2QTNA 4N49A 3Q9SA 3U0VA 2WD7B 4MP6A 3VHQA 4BMOB 4M2LA 2FP4A 3LFUA 5JNRA 2V54A 1T26A 2NN3C 1KI8A 2ZTSA 3VNRA 4GP7A 4K0KB 4W5NA 2I6QA 1WIWA 3BGDA 4Y30A 3RHZA 1FYVA 3LA8A 2PO5A 1VJGA 5JBQA 1XQWA 4YT2A 4MVWA 3N2GB 1Z5GA 4FN4A 4FQ5A 2Z58A 3SY8A 3O26A 2F7SA 2PFGA 1MJGA 1V39A 5CX4A 3RHTA 4ARZA 1SKMA 4LPKA 3GELA 3ZQUA 5IJ9B 3GCZA 3WB1A 1U4SA 4XRRA 1Z4NA 4EX7A 1SC1A 4IV0A 3FETA 1Q84A 1XP8A 5EZ6B 2GETA 3TMAA 2Z2IA 5DTMA 4NVRA 1KH2A 4YAOA 4E3ZA 4DAEA 3W78A 3B1KA 4PGGA 4P7JA 4PG6A 4Q9IA 3MB5A 3OZBA 3Q5EA 2NZWA 5CPBA 1VMAA 3GEGA 4PZEA 4RAQA 3D3NA 4YRZA 4EY6A 3ZDCA 5EKDA 3I2JA 5EUBA 5JXGA 2R48A 2ZB7A 4I2VA 4CZ2A 1N1GA 1TA4A 3A1NA 5BVGA 1L8QA 5JY6A 1WV0A 4Q00A 3DHEA 2EJTA 4KZKA 4Q03A 1YRHA 4RTPA 2CHGA 1PT5A 1N1DA 5E7QA 2EBUA 4CEIB 2FRVA 4YUXA 1F0YA 1P0MA 4LKRA 2WTEA 1EK5A 3OZCA 1AZTA 3CB4A 4EPYA 4MVJE 4ETWA 5HHTA 4TT3D 4JB0A 4ZOLB 1XCPA 4R9SA 1NVXQ 4RH3A 2NU7A 5FWAA 3WGHA 1YBAA 2HUNA 4CL3A 4TMWA 1XALA 2P79A 2FR8C 4HAZA 4G4GA 4NRDA 1VHLA 3VTZA 2ZJ8A 1UXKA 3TD6A 1GRNA 4PG7A 1N4AA 1KWGA 5AT1A 3UWSA 1EDDA 3EIOA 4LF8B 4I19A 3B5EA 5DTEA 5GVSA 2BI8A 2PQ2A 3OUUA 4RMJA 1EVJA 2PRZA 3QTLA 4CHTA 4B3CA 5I4KA 5F9FA 3AB8A 3QA3E 3DBLB 2DBYA 3MTGA 3CN7A 1R16A 1QE5A 2AR9A 4N5MA 1T1IA 2VNJA 1K27A 3T99A 4C03A 1E2BA 1HNXB 4UNPA 4JB2A 2CNNA 5ELMA 1LUAA 5E0OA 3OA2A 4BCBA 2YHAA 1HMPA 4OOFA 4M88A 3U44B 5LWQA 3MHTA 1VA5A 1KAHA 3K0AB 4AWXA 1R6AA 4R8LA 5K0TA 2C83A 2DPLA 5A2GA 1J25A 2ET6A 2VYCA 4HGRA 4OHXA 2GZHA 1GTL1 2BR3A 1T24A 5DOZA 4JT4A 3R76A 1M72A 4RDIA 5CD9A 1ZGJA 5L53A 2Q5OA 1TVMA 4YC7A 5B7PA 1H2ZA 2DHCA 2ZEJA 3ZQJA 3LCCA 1R0WA 4FFWA 3UWMA 2WJ4A 3TIFA 4LVUA 2ZRLA 2QXTA 5JEDA 2AUMA 1A8PA 5ER9A 4NZ9A 3OESA 1A9ZA 3R6LA 4YRBA 1QK3A 1EFAA 2A35A 3D6UA 1U3DA 5K3OA 5IT5A 2GCOA 5F3DA 5J40A 1NQTA 1YZLA 3CLUD 3OQHA 4AN0A 2W22A 1QGUA 4DARA 3EGXA 5CP8A 4W8GA 4MQ5A 3ZNPA 3HYCA 2BONA 2UKDA 2QTCA 1LV7A 3EUWA 5A4MS 4DMLA 3ND7A 4Z0PA 4UCWA 3L0BA 1PHRA 3PEYA 2OK7A 4IFEA 3GJ7A 3K4QA 5ESWA 1E69A 3SK0A 3GXOA 3WWPA 1A0OA 2FWRA 3BJMA 2X9NA 1O4VA 5DSXA 1E6KA 1MQAA 5UKDA 3ZU3A 1ICIA 2VWGA 3H8SA 3L6DA 2NTJA 4FJ0A 3M7IA 2E5WA 1FTSA 4LJLA 4PQYA 1Z7EA 3FN4A 4C1NA 1F3LA 3FJYA 1IU9A 2GF0A 5BP7A 2BDTA 2PL1A 1F4VA 4MKGA 4BLTA 2IUSA 2V5UA 3K1YA 4A6XA 4C5AA 4CIXA 4UCXA 2IDKA 1GFWA 2BFBB 3ENZA 1PQPA 4YJ2A 3IDSA 4OM7A 3FM9A 1A9XB 2C5HA 4RUKA 1ID8A 2B8NA 3EGVA 4LVNA 1UAGA 3KYIB 4RSMA 3WWEA 4P86A 4EW2A 3D8SA 4NNPA 5D01A 4G0OA 4BO4A 3G9ZA 1UPFA 4LE2A 4INZA 1MTOA 4RPCA 3EPLA 3K0HA 1R7RA 2FN4A 2GRJA 3KZXA 4LRQA 3LGXA 3BXOA 3MLEA 1R0BA 1KJZA 2SCUA 3R7AA 3GPIA 3ORYA 1CSEE 3V8BA 2QDXA 4G26A 3G5UA 2ZRAA 3PWZA 1GHTA 1MV5A 1NVKA 3GN1A 1AV7A 4U39A 3RIHA 3WICA 2H9IA 1SBNE 5B1IA 4HCJA 2JI6A 1U02A 5EWMB 1QQ5A 2Y1CA 3RYHB 3T1OA 2QUBA 1JSLA 3TVYA 2O8CA 1B8PA 1Y5LA 2RGUA 3HXKA 2IXDA 1WB4A 4QPPA 4LNHA 1DEKA 2AOWA 2BPOA 3ESBA 4NCHA 5MHTA 3GVHA 4BX3A 4HLUC 1QYDA 1UK8A 4JP2A 5D84A 4F1JA 2ZJYA 1T6NA 2XNDD 5G0SA 3H05A 4FEYA 3PK0A 1NLMA 4Y18A 3REQB 2H9YA 4RHFA 2CVOA 2R1TA 2WJYA 3D4IA 4WZBE 3FSRA 1UEXC 3AL0C 1TVCA 2ZYTX 3K32A 4TLEA 4AY4A 4KYUA 4TM8A 5CJ2A 1F5NA 4RMHA 1TPYA 4ZI5A 4B79A 1RZ3A 2FSSA 2JKZA 4Y2JA 1RC1A 3MM4A 4H0FA 1V47A 2JFQA 5AHOA 4ZA2A 5EQTA 1G5FA 3CUYA 2G1JA 5JS6A 1TF7A 3USCS 2B0JA 2P9EA 3JD2A 4JLMA 4FR5A 3VH2A 2W6PA 2FEOA 1TMKA 4CM6A 3JQ7B 4EGAA 4GZMA 4DUGA 3PB3A 4DBLC 4BRUA 2P9GA 4K03A 1JI0A 2B8JA 3I42A 2ZREA 2HUPA 4MQEA 1L5GB 1S2NA 1JLLA 1TI7A 2XTNA 2ZI9A 2ZBFA 2Q6LA 2A9OA 4KQJA 4D1YA 3TGPA 3QPBA 1JFLA 4FD3A 4BKUA 2CHFA 1H69A 1U2GA 2FUG6 3BF8A 3SKVA 1P29A 4F5DA 3HDTA 1NKSA 4RPHA 2IUYA 2FK8A 4N6OA 3IEIA 4H7FA 3TZHA 2YY5A 3DWEX 2IZOA 4L2IA 3F7OA 3JQ8B 5JLAA 1S2LA 3EC2A 5ICCA 4N8EA 4C4PA 2PUFA 3D4OA 2HJWA 2TRSB 2VUTA 3UMRA 2H4ZA 4OP3A 2R5WA 4WUVA 1R6UA 1T0PA 4ZI7A 2IU0A 2GJ8A 4RETA 4REMA 3PQEA 4YASA 1CZRA 5JV5A 1WXQA 1DEHA 3BH7A 4U3JB 2A4MA 3PRHA 1EFRD 3N5CA 4WKCA 5JI3E 3RADC 1YDMA 4TLDA 5AQEA 1JLHA 3QG1A 4QRHA 4AYTA 3IJRA 4RD6A 5B64A 3A6JA 3DP7A 4UQPA 2VWPA 1O9GA 2N3ZA 4M3NA 2J3MA 3OFJA 5HTOA 2EX4A 1U98A 3O6VA 2QV7A 2WYIA 4IKOA 4B7ZA 1SZDA 4FDTA 1VJDA 1PZNA 2PZFA 2NZVG 3VI3B 1RXVA 4OJMX 1CBUA 5EIEA 5AWFC 4DWVA 1C7IA 1T15A 5AIAA 3C24A 1P1FA 1U1DA 2FX3A 2YOGA 3JWIA 2RK6A 3QE2A 4LYHA 4EJ2A 5HUJA 4L7VA 5DM70 1YFJA 3RQSA 1K08A 3I32A 3RG8A 3H0CA 2EKZA 2W2OA 5E9QA 2JK1A 4XUDA 2B69A 1VIDA 2YXPX 3RRBA 3KQNA 5ELXA 3SIXA 4PO1A 2O3JA 4BFWA 4EEXA 5KNBD 2NP6A 4OA8A 2DYKA 4P38A 1JHXA 3IVAA 3LZ6A 5T4BA 2ZTUA 5A0VA 5T6MA 3O1JC 4MH0R 1G1AA 4HUTA 3KX2A 4XD2A 1RAHA 4F5YA 3DAOA 2BMJA 3DOFA 1U1CA 3AP2A 3CZ4A 4JLAA 2O50A 5DW3A 1S9DA 1BIFA 1F1JA 5IAGA 5BRNA 3RWOA 4B40A 2NMVA 5CFMA 1HRKA 1R00A 1Y37A 4ES6A 3FPEA 3UENA 2G36A 4Q3LA 3M82A 3G79A 1EH5A 1BEZA 1EFKA 4LZLA 3M3DA 1ZMXA 2BH2A 1UJ6A 1Y80A 2VEOA 3TR6A 4C2BA 4TV8A 5IJ0B 2XGJA 2QP3A 1YRBA 3RS8A 2PQMA 5F7XA 4A2QA 3BFXA 4KN8A 1KAGA 4QIHA 2B83A 2BAGA 1XXLA 2GXSA 2QVYX 2WWTA 1E89A 2YNMA 4R68A 2PUAA 1NUHA 1MGOA 5JBIA 4I08A 1MX1A 3SBDA 4TYNA 1FNSA 3O8QA 3IT3A 3QKIA 2EW2A 1CZNA 1RRKA 4P92A 2K7FA 3GMIA 1KA9H 2JK0A 1H1TA 3T9CA 2Q1SA 4D46A 2ZRDA 1NURA 1OH7A 1DNPA 1NUSA 2O2GA 4DCMA 4HT3B 4WNAA 3HV2A 4PYMA 4C2TA 3SZMA 3VOBA 5EHGA 1OH6A 1ULBA 1JIXA 1XN1A 2XUKA 4I1RA 4JHXA 3WOVA 2PS3A 1Q91A 3T1VA 4RCVA 1RQLA 3G2QA 2R4QA 4UU0A 1NTRA 1B23P 1CD5A 2I9PA 4YALA 5F5XA 2ZS7A 3ED1A 5KKAA 1C7QA 4XIGS 3L79A 1G3QA 5IXYA 4UOEA 3CCFA 2XEXA 1X0XA 4BLRA 1QXSA 1TUBA 1WXFA 2H54A 3BE6A 1Y42X 3L7KA 2A3NA 4K0RA 4LSGA 2W90A 3GLGB 1PZXA 2QV0A 5IJ9A 1WY7A 1P2GA 2QJOA 2XE6A 1SN7A 1X1TA 3O2NA 2DJIA 4JODA 2W4MA 3X1MA 4US0R 4DQXA 4QXMA 4U00A 2O2IA 3C97A 1CU1A 3Q3GE 4RVOA 1KK2A 4F5EA 2VHXA 3HVKA 2GF2A 2P7IA 5DULA 3JWGA 1VA4A 4DUYB 4R9RA 4G3XA 4JB8A 2LDXA 3AC0A 5HJ7A 1CB0A 2AD1A 4LY9A 3SAJA 3W6OA 2Q5HA 3P5BA 4RY9A 4O2RA 2XCOA 1L7RA 3OE1A 1XMOB 3W7BA 1OZ0A 2PJUA 3DGEC 3G5TA 3IJPA 1LFDB 5KQLA 4D79A 5A02A 5CM9C 3DKVA 1CLUA 1ID1A 3OMWA 3WZLA 4L4SA 1GYPA 1G42A 1YZUA 1Z6YA 3FB1A 4R2MA 3VUFA 4QLBA 4UTXA 3HS3A 4TZTA 4JZYA 4MVJP 5LUAA 5AVZA 1RWQA 5BORA 4MPTA 3IBGA 4MKFA 4DILA 1LTHR 1NUQA 4CEIA 3ECCA 2F1KA 2DHEA 2IRWA 1A2BA 4RA6B 1BA2A 1FLAA 2FEXA 3KELA 3BRCA 2X0RA 4UEKA 4F85A 1P2VA 2JCXA 4TV8F 5EIWA 4ZOLA 3WRYA 3FPBA 2NXJA 2JGDB 1XU9A 1CZLA 5CB0A 5DT2A 2IZ5A 4OLJA 1BXKA 5DTQA 3BG5A 3ORSA 4N7JA 1TM1E 2F00A 3B6EA 2I9KA 1NHWA 2DGDA 3CF4G 3AJRA 4UEOA 4BFLA 4CF6A 5C4IA 5AHWA 5EKSA 4AKIA 3M2TA 1AM4D 3DHNA 3OZFA 4KWIA 1HT2E 1P5FA 4RIEA 3QSYA 4CM5A 3PTAA 1F17A 2FN7A 4BATA 2JNWA 4RL6A 5EWJB 4WV3A 1XLWA 4LYEA 1L7OA 2IOYA 3IBYA 1AGYA 4WHMA 2IYLD 3IOCA 1N0UA 2E49A 5DI9A 3V9PA 3UCEA 1R5BA 3HCNA 4DCVA 3WL4A 1ZIOA 5HRUA 5THKA 4DSTA 1J8QA 4GO1A 1MABA 4GZLA 4KTVE 1DAIA 1O54A 5HP4A 1I3MA 1SVMA 1E7QA 5LZ7A 2HYDA 4Q9JA 4CKBB 4DYHA 4ZU6X 2PGNA 3FCAA 4FPXA 4YNBA 2ZE6A 2V7GA 3CW8X 3PFCA 3VTKA 4JBLA 4LS3A 2E4AA 4MEAA 5BN3B 4U2BA 4U4AA 4IUDS 1Z37A 1C0KA 2C95A 3V55A 5KWVA 1FA9A 1EM6A 4HUJA 2OD7A 3VNQA 1JA9A 4OLBA 4WOCA 1BFUA 1HXHA 1MORA 4DMHA 5JC1A 2VJKA 3M1AA 3Q11A 1LI5A 1U8ZA 1ML4A 3Q10A 4BV3A 4G1VA 2YWHA 2P9ZA 1GGEA 4ME6A 3P9ZA 2H2DA 2BTQB 5LMNB 1ZESA 4HHEA 4PCLA 5FPYA 1FTGA 1N1EA 3NKVA 1UOOA 4FZ5A 1WW8A 2MHCA 2EG5A 4ANFA 1T36B 3CC8A 3W2FA 1ZS9A 1CVRA 3CE9A 1TU4A 1WMSA 1HKUA 3P8ZA 5AW1A 4JUFA 1N3LA 2C9YA 5M29A 2HRZA 4UBIA 3WYAA 1XRSB 3G0CA 4B2LA 2HPHA 1IAQA 3BCSA 5ALFA 2E6UX 5JD3A 3SQNA 4F06A 3G6WA 5K4AA 3ZZNA 4ENUA 1KEWA 3HCBA 3C7CB 3RJ9A 1I5EA 4OD0A 3ZY5A 4AZ0A 4HADA 2IP1A 2PIDA 2WTNA 2I4MA 2B8TA 2Y99A 3BMCB 1PFWA 3I8SA 2X7XA 2XNKA 1E20A 1V3UA 1KVTA 3LCUA 4JXKA 2AZMA 3N39C 4R71A 2I7DA 4MS1B 5LKAA 3VZRA 1IBKB 3OHSX 1B16A 4OY3A 5FNVB 5LZ9A 3LX8A 2ZUWA 2PY6A 2DUWA 1E63A 1UJ5A 3FG9A 3JQAD 4FFDA 4XTCS 3JYNA 4EI8A 5DNUA 3W8EA 3P97A 2Y4NA 4J6EA 3W6ZA 2GZ2A 2VP2A 1M6NA 4FFPA 1MP0A 1IEVA 3FMFA 4QYXA 1F8UA 3H5RA 3I4CA 1SM4A 2M2IA 2V9ZA 2AJLI 1YCGA 2CUZA 5E1DA 3R75A 4V0NA 2O06A 3CEHA 3L7JA 3UC5A 1PAUA 1QPZA 1H93A 4J7AA 1VSUA 2PZLA 2IC5A 4WH0A 3TPZA 1KO5A 4ZC1A 2XD4A 3VR5D 2TSYB 3KEOA 4OTZA 4EVIA 3A3NA 4WFJA 3WK5A 4XM1A 1SR8A 4NX2A 2BTOA 3O73A 3G0DA 1KMQA 1LD3A 1H6DA 1SHLA 3AP3A 2HRRA 3N8IA 3CH6A 4J16A 2OCLA 4C9BA 3MJHA 3PRYA 1V41E 1I36A 1RS0A 2R79A 3FH0A 3I52A 2PXAA 1WHTB 1YA8A 2ZYWX 3LRTA 2VZ0A 4P54A 3D7KA 3TTYA 1WZ2A 3H4MA 3CKYA 4L5CA 4M38A 4L3OA 3G2LA 3TLBA 4AD8A 1JU3A 2PX0A 3K0BA 4N9WA 1ISRA 5EJ9A 1DLJA 4QO8A 1ZL0A 1E7MA 4JI3B 3AVWA 3IP7A 4TLAA 1IM8A 5K20A 3ON5A 1F6BA 1VJ5A 4KNWA 1YJBA 2WPNA 1DEXA 4KI7A 3MPUA 4M8NE 1JYSA 4Z8YA 4HWRA 2DCUA 4OF4A 5IAKA 3NOVA 4FYYA 4K6KA 4D4KA 3L01A 3K5PA 5KSYA 3CEJA 4HYYA 4MUIA 3R5FA 1C1YA 1YL5A 3RK1A 1PE0A 2H3HA 3CSSA 4XLZA 1GILA 3EEOA 4N41A 3AGQA 1OYWA 4C4SA 3K0CA 1EFHA 1H2RS 3BD9A 3PI6A 3INTA 3WLAA 1KZ1A 5L3QA 3FSJX 3KG2A 3ZS9A 1HPLA 4MHOA 1MZPA 2ZW9A 2HNKA 3TCNA 1TQ2A 2O3RA 1BVYF 3I4FA 5L7YA 4PHGA 5DYNA 5EP1A 5PGMA 1M33A 4B2YA 1DV1A 1QQBA 4Q12A 2I80A 3IKMB 1E8NA 3ENVA 1SWVA 1EKXA 3DEYX 3NOOA 3PVZA 1E9FA 3P9IA 3PICA 1XQVA 2RI0A 3E3NA 4K6HA 1R0ZA 4M7PA 4RF4A 3KVRA 4CQMA 1ZJZA 3LX6A 3JQPA 5BV0A 4PTYA 1UQUA 3MJTA 5AM0A 1Y9AA 5AKXA 1YMQA 4Q48A 1OB5A 2B78A 2ETXA 4HAOA 5LXTF 3IDQA 3O4FA 4R1TA 5KAMA 4D42A 1Q0QA 1C0LA 1QAMA 2HH9A 2JFOA 3LG2A 3O03A 4V38A 4ZTZB 4ZAXA 5AW5A 2G1AA 4GOKA 3TGLA 1VIVA 2FZKA 2Y77A 4U3JA 1KEZA 2DRIA 1IN8A 4QYIB 2Y05A 4X3PA 4ZZIA 1WRBA 1L5LA 4ZOEA 3QBTA 1KBOA 2QNBA 4BHTA 1X2EA 3U56A 3N8KA 1W0JA 3DFIA 3DT6A 1Y0BA 3KQPA 1E4VA 3AUYA 3ESDA 2W70A 1FZTA 3F6CA 2R1ZA 5EHXA 5FRDA 2ZI4A 4R8RA 1GQYA 1L7XA 1Y3BE 3G0OA 2HW8A 5AI9A 1LNSA 1OLSB 4KE7A 3X1JA 2WJZB 4JOSA 4P7KA 4MGHA 3K92A 3V00A 4X92A 2XKKA 4UNNA 2RHLA 1FB5A 3GEBA 3PEVA 3V7UA 4EPRA 5ENVA 3PD7A 4HFNA 5FBRB 4E12A 2JIOA 3N0XA 1LBSA 1EMDA 5EC8A 3GIDA 1Q0UA 3OJFA 4DCUA 1S8OA 3RG2A 2IUUA 2AC7A 3CJTA 4G01B 2BUCA 4R51A 4POOA 1IXRC 1QIIA 4LYFA 3SQLA 5IDXA 3SHTA 3ZDFA 3H87A 4DNXA 3QV1A 3ROFA 2QJWA 2FPSA 1WDMA 3OQJA 4HX5A 4LHSA 3WQRA 4DY4A 2YKGA 2BFEB 1QUFA 4QNMA 1C3LA 5DBEX 1M2GA 2G83A 3EARA 4WXHA 4IRXA 4FNMA 2OQVA 5J5VA 3GLUA 5CBKA 3HEAA 3RJTA 2HSWA 4WLFA 3MFYA 4QEZA 1N57A 5AKYA 5TPZA 4FHEA 2JATA 4B3FX 1MJHA 2JBHA 2DTXA 5D00A 4YUZA 4PANA 4QZVA 1CRZA 1N75A 2YW2A 3VPGA 2GBFA 2IKQA 3GR6A 4CCSA 4YY3B 4YMUA 2FFBA 3KFXA 2JJ1A 1X3SA 2V7QD 1G3RA 4OG2A 4PGHA 4KW7A 3ABSB 4ZQIA 5DLPA 2V6BA 3LW8A 3K09A 1IQRA 4RNCA 2BY4A 3B9PA 1A5SB 2YYYA 1P7YA 3DL7A 3M1IA 1DIGA 1JVBA 3JRXA 4TUYF 2GH1A 4BRSA 2ZRFA 5EIOA 4URVR 3NVKI 1U04A 1HF3A 4QUJA 1NXPA 1WOMA 2JIZA 4LCJA 4DM3A 4QYMA 4K9KA 2QHXA 5T4FA 2CNKA 4EP1A 4HZGA 2GFHA 4ZEOA 1WLYA 1USGA 2PM8A 1VE9A 3CPJB 4UFPA 2J9RA 3M89A 4M86A 3BIOA 4I6JA 1KF0A 4NAUA 5EZQA 3MUNA 3ISTA 5BR7A 1YZNA 5DNAA 2ODQA 5DSTA 4JDUA 5HPYB 4EUKA 1QIMA 3WXBA 4D9BA 4KFCA 5J23A 4HVCA 2YXDA 1R0YA 1OBHA 4P33A 4BWFB 2GZ1A 3QOYA 4HTAA 4MWSA 4RGBA 4JXXA 1CIJA 5HOEA 2QXYA 5D86A 4QSMA 3I58A 2HTFA 1HRDA 2WM9B 3PIIA 1H2EA 4NJMB 5GV7A 2G77B 2PBZA 4US1R 4B6JA 3EN0A 3PSHA 4UU7A 2YDXA 4G89A 3ITKA 4GW3A 4CW7A 2VBFA 2W6JA 2G4VA 2C98A 4Y6RA 1M76A 4KAAA 2QY9A 1G7CA 1YKSA 1QB8A 1E3JA 4YAUA 3S1SA 4B73A 1N77A 3MUOA 3JAWB 3FW1A 4C4AA 3IO3A 5B1YA 1D5WA 2Q3CA 4LIPD 3W34A 4DXDA 2IYZA 1ZXXA 1XELA 1BMFA 4C7MA 4A0GA 3AVPA 3HWRA 4CKCA 1D7OA 1PYOA 2PGIA 1LPNA 4H6VA 3SF0A 4R5MA 3PPXA 1XNGA 2P9JA 2W6ID 3KDSE 3I37X 1YSCA 2JRCA 2IS2A 5L3VA 3CE6A 2QXUA 4WFKA 5JS8A 1C7RA 4XQCA 3CH7A 5LR6A 4HQLA 1C30B 1UODA 4CUZA 4WXEA 5GM1A 1VC2A 4WBSA 1NDQA 1I3NA 3KPWA 4LCEA 3LPLA 1NR7A 4NS1A 2ZDHA 3EF0A 4P5DA 1L8LA 2CK3D 2VK2A 1U5BB 5JNVA 1RYHA 3Q0IA 3ILVA 4X24A 3BQ9A 4YRRA 5JDCA 2PGDA 5CFQA 4IIFA 3G89A 3L0SA 2P11A 1UUFA 4HSEA 3LYHA 1VHDA 3BH0A 4RIFA 1STOA 1CUFA 4YMSA 1NW4A 2IX3A 1MO4A 3H65A 4ZYZA 1K8ZB 5AH0A 1YUNA 3Q9UA 1FLNA 1VCOA 2IYUA 2ZBDA 4M55A 5EWJA 1MJFA 3W8NA 2QNRA 3TKLA 3PJEA 4X00A 3HR4A 5IAOA 3HNPA 3AKDA 3CZRA 3T5AA 1SQ6A 3T5PA 1SZCA 3D31A 3GEMA 3H16A 3LWZA 1AGRA 1NUUA 1VPTA 1NIPA 2WU4A 3G2HA 3LMKA 2GRUA 3QK7A 4DOMA 5MN4A 4PQGA 3G5LA 1R88A 2QTVA 3HUDA 4FN5A 2Q3MA 4EKGA 3BXGA 3C8UA 1HYQA 1LY1A 2IYXA 3RRMA 1WPQA 5I9LA 3HI6A 4PO9A 2AQ8A 2CFSA 2HKIA 3HFSA 4MAAA 5BN3A 3F5SA 3WGNA 4LE0A 4CIVA 3FHCB 1RWNA 3LW7A 4FOOA 4YFYA 1KYYA 4G85A 3OEED 1ZN9A 4BYMA 5BWBA 3LUDA 4IV5A 2RGWA 1BJKA 2YRWA 4CF4A 4F4UA 4KUHA 3VM6A 3JATA 4MI6A 4D25A 4OJQA 2R44A 4HQ6A 1WNTA 3EFHA 1T1GA 2BTQA 1A77A 3HYTA 3WG9A 1A2OA 3MEQA 4ZJYA 5G4LA 4ICIA 1W88B 1P4GA 2JKYA 2V7BA 1QHIA 1T36A 4IDBA 1U2GC 1DCKA 5EKUA 4QDTA 1D8AA 1TT5A 3C39A 2XD9A 4AJ4A 5SY6A 2XUDA 3CUTA 3B8EA 4YHHB 4A6PA 3WQSB 3PDIB 5BSMA 4M7OA 3AP1A 3MMPA 3ZE2B 4DTCA 1H2XA 2O7QA 3DSRA 4LZJA 5BNZA 3OPVA 3I92A 4H6XA 4WCFB 5M7EA 2D7DA 5AK4A 1E59A 3TEJA 3QP9A 5AOVA 3E9MA 4MWGA 3WYEA 2Y71A 5FDFA 4JEMA 3V4FA 3PJRA 4NCXA 3ABQB 1E6MA 3WMRA 4A15A 4BVGA 2VDWB 4JC4A 4BZXA 4KR7A 4B8ZA 5JMPA 2XQGA 3VNVA 5IBQA 2XA1A 3R4VA 1BW9A 4MJ3A 2P1RA 2P7HA 2ZBEA 4EBBA 5FNVA 1AE1A 3QLUA 3K05A 5ELLA 1KZYC 2P1DA 5FQOA 2R6DA 3WV4A 4GXQA 1A04A 1VP3A 1FNCA 5HJ2A 1DRKA 4D9IA 2OYCA 5AM2A 5AM1A 2VNKA 1Z06A 4LXTA 5F64A 3B2EA 3BEDA 4DQUA 1Z6TA 8ABPA 1IN1A 3ZY4A 4KX5A 4DQLA 1VZ2A 1LWNA 1JB9A 3FDJA 4DC0A 2O2DA 3DVAB 4UVHA 2VP0A 1XZKA 4HI0E 3AY3A 4FMBB 4HVAA 2R1VB 4XKJA 3NTQA 4QREA 4ETIA 4S0XA 2GN9A 4OXKA 5F1PA 4RZUA 5ICGA 2KI5A 1GQRA 4ATNA 4LZOA 5HR5A 2X6RA 3LVQE 1M3SA 4OGLA 421PA 6NULA 1XHFA 1KFEB 2RHOA 3OJXA 2ZJAA 3DO6A 2QVXX 1Z0KA 4NHOA 4DVJA 4HDSB 1X1CA 1T1SA 5CDHA 1JEAA 3H1FA 3R3ZA 3KLNA 3WBJA 2NU9B 4Z7OB 5E4FA 2ATCA 4UUBA 1PS9A 1WHTA 2R8OA 4JU8A 5T67A 4E94A 1RYNA 4UDOA 3WMGA 2IYVA 3LQ4A 3Q5GA 2P91A 3RBXA 4ETMA 1CJBA 1MAVA 1C4WA 2VS1A 3MVEA 2UZ1B 3N0WA 3PUVA 4IOMA 4O59O 3QU4A 3VOTA 3WIOA 4CMBA 5CCEA 3NEAA 2EJBA 4IFIA 2PLAA 3OQVA 1PLLA 4WLUA 3A1SA 2A88A 3EZ9A 4PAGA 4G0UA 3AFOA 1UK6A 1FL9A 5I9IA 1XQ1A 3ORFA 2ZS9A 5HS4A 4L5BA 3QVXA 1P18A 5FADA 2R8RA 2YNMC 2ZVPX 1QDUA 4UASA 5HBGA 3W2GA 4AUMA 1VLQA 1UINA 4HDAA 4DLNA 4DA6A 5DWDA 2CXSA 1GPH1 1L1RA 2OM2A 5BSFA 5U4QA 3T7CA 3RS2A 3WL5A 4AIRA 4NOLA 4YT8A 1H42A 1NUAA 3QTTA 4QJ3A 2DPMA 3MMSA 1T2UA 3WSWA 1KS2A 1E2NA 1CR6A 3NU1A 4YCJA 1WW3A 3GYGA 2MYNA 2NSYA 2WIBA 3TO5A 3W4KA 3MLBA 4B7UA 5IXSA 2ZRNA 3CS3A 3E8MA 3K4PA 3OT1A 5JJLA 1FXSA 1AKRA 4HF7A 4A0HA 1HC7A 3HCEA 1C1DA 3FFBA 3I5XA 1JFRA 4RXTA 1VE1A 5TT1A 1RPAA 5TARA 2QLTA 2JARA 3IPXA 1E3LA 3MINB 1C29B 3PX2A 1Y1KE 4LFAB 3CONA 4II3A 3DC2A 3VDMA 4DL9A 1DC4A 2YV3A 1EP1B 1KQPA 1RWWA 5EI5A 4FMPA 5AW7A 3ZCQA 3LXXA 1DRWA 4U9UA 2G7ZA 2XQKA 3EGDB 4ZI3A 4RFVA 1KNQA 1X92A 5E0KB 2OXFA 2NSLA 3ID6C 4LNUA 1L4GA 3F7MA 3PLNA 1B0UA 1PLKA 4JI4B 1JNYA 4G8BA 3C48A 3VQTA 2EFHB 5DNDA 1M54A 4JUIA 1E4OA 4M8KA 5TQ2B 2Y0DA 4X91A 1CUDA 1O8CA 3GZ4A 2XVZA 3RVOA 1A5AB 4QYIA 3UJHA 5F2NA 2FWNA 2VAWA 4RANA 1YA6A 1T3GA 1Y1SA 1Z22A 3FAZA 3A6PC 4H3VA 3MD0A 2QRVA 4NDZA 3COPA 5J4KA 3V9AA 5LQCA 1OYOA 3KWLA 4X63A 4P80A 3UKOA 4DJAA 1NQUA 1OLSA 4QJBA 5GZ1A 2XKBA 4QUDA 1E4EB 2EFGA 1T0BA 2XCQA 5B37A 5K8JB 2QUZA 1A9SA 2BMEA 3BTUA 3ICEA 2FP3A 2EZ9A 5LA6F 2HLNA 2Z08A 4M0CA 5EP3A 3U9LA 4AX4A 1WXXA 4MWOA 2XOKA 3F8SA 4OQEA 1DUSA 4DLWA 5JHGB 3EGEA 3BN3A 4LOKA 1M74A 5GINE 1KYIA 1JIVA 4G65A 1JYFA 1G16A 1KL7A 2NSDA 2Q29A 3O74A 1NMZA 3KNZA 2I3BA 4MIOA 4KDRA 3C70A 5FCDA 1KDTA 4R1QA 3JALA 1UC8A 4M0UA 1Q50A 1ADGA 1TPZA 1UPTA 1RACA 5EE3A 3BXZA 1TCVA 5JBNA 1F14A 1N2EA 4C07A 1IY1A 1S89A 3FYDA 5HIMA 5DNVA 1XCLA 1Q7GA 4BVFA 1UZNA 3NJ4A 2P0YA 3V42A 4YXWD 1BC5A 1XEWX 3AZPA 3KOOA 2P78A 4TGLA 2VKQA 2QUAA 2PHZA 4YJDA 3PA6A 1Y8AA 5FWNA 5EJFA 1JQLB 3GRFA 4BZWA 1YI0A 5LYYA 4C1BA 4A2WA 6CHYA 2I5PO 3RO7A 2XUAA 1YFLA 4UC0A 2ORWA 3KEQA 1TLFA 3PJDA 1XROA 4XARA 2GJKA 4AZ3B 1Z0IA 1E18A 1GTZA 4OXRA 4XX1A 4P9NA 3ADDA 2VTDA 4Q15A 4L9AA 2WM2A 5EZSA 4K3VA 3HU5A 4HD8A 1SD5A 3LUFA 3RVQA 4MW2A 1FUUA 5HA5A 3P45A 4F3CA 2I8LA 4TKUA 1J6UA 4LY0A 4V0MA 3I23A 3RD5A 3ZTWA 3FWYA 3KKEA 4C0QC 3LZDA 4L6CA 3Q85A 7REQA 3PZBA 2QY6A 3VR3A 1JL3A 4UULA 2YCBA 3AWDA 3BGOS 3GPBA 1Q2UA 3PZRA 4BFSA 4NCBA 4RENA 1H5UA 3JVUA 3OECA 4BEJA 2NM0A 1FFBA 3L5KA 2J1LA 1RMQA 3GBSA 4G5QA 1TMGE 4W1QA 4B33A 3CNHA 4DEYA 4MKHA 1OH8A 1YNSA 5D5PA 3SOPA 2YZGA 4PC3A 2GK7A 3PWKA 4NV3A 4OCZA 4KPGA 1JSXA 3FMOB 2XWJI 3ESRA 4NG4A 1JPNA 4PS1A 2J5RA 2NPIA 1Z35A 3FF4A 3WWCA 1AUQA 3H8WA 1L7DA 1CS0B 3F6SA 1LPSA 3RU9A 4B17A 3ZWDA 1IZ7A 2A2ZA 2A8YA 2R87A 3AIMA 3BJZA 1WXHA 1MMFB 1G5PA 2HV8A 2LDBA 4KXQA 5GQSA 3QIVA 3VJMA 5M34A 1JHPA 2OCYC 3N28A 4FKBA 3M6LA 4KAJA 4N6NA 3QFRA 1VTKA 4X1YB 4B3SB 3OEHD 1PFKA 1BHSA 3AOEA 2FE4A 2VH1A 4MP3A 4AAYA 5BR4A 2PX5A 4HNSA 3ZG6A 1RYDA 1ZD3A 4CMIB 1JFSA 3AKEA 2IWHA 2ZSAA 3DD1A 2QQFA 1WSDA 3KB2A 2ZIFA 1XA3A 1GZ5A 2XMGA 3CA8A 3S2GA 1DO8A 3PR2B 4ZAFA 1CCWA 5HE9A 4YQFA 3H2KA 4FGZA 1X1DA 1I51A 1UFOA 2QQ5A 2VPWA 4TYQA 4YQYA 1IOZA 2FWMX 1U1FA 5BXYA 4WLOA 2H7YA 5DMHA 4L5AA 2G06A 2WHYA 4Y2XA 2NX2A 1DADA 4MB2A 3CNQS 4JSTA 5CLGA 3SSNA 3WTCA 3L49A 1EFVB 1C30A 1ZA2A 1QSGA 1U1EA 1AQIA 3RRJA 1JZTA 2GWRA 2ENUA 2VYND 1CPYA 1V1JA 5ALQA 3AFIA 5K0JA 4YRMA 5I7EA 1SAYA 4UE6A 1H2BA 1JBEA 3GEPA 3ZY3A 5AESA 1GDDA 1FRNA 1IJKA 4J16C 1LF0A 3SVZA 5CTAA 1P44A 3PUYA 3EQ2A 4NMHA 1VPVA 3CZQA 5TIIA 3PPWA 2Q5LA 1N5DA 4J7CA 3LECA 2BGIA 4DIEA 1G5RA 1LWOA 1U7DA 3LP8A 4RVGA 3EEIA 4RF3A 5E2IA 1JR3E 4RK0A 5TT0A 1UC5B 4KWHA 4E4TA 4XWKA 4O3MA 1X1RA 1Z4PX 3ELBA 4XWYA 1EJBA 4AJNA 2QX7A 1AUVA 3BM5A 4F56A 2QT1A 1FNNA 2YHIA 3LBNA 4XJTA 3TIXB 3AHDA 3EVGA 2QVLA 2XT6A 4YUYA 1Q83A 1I1HA 3E9NA 4ZT4A 4LBZA 4LHXA 4B6OA 2O05A 1DRUA 3CF0A 4ROTA 1DOZA 2OSBA 2OZKA 5KYKA 1OIXA 3FLMA 4OMUA 2J41A 2QRLA 2COUA 1VMKA 1RXCA 2GYWA 3HNOA 3FOBA 4J49A 4PSDA 4MR9B 2PVCA 3OU7A 4UE3S 2LD4A 4F04A 4LX8A 3NTXA 2HXGA 2AR0A 2G04A 1UCFA 4RC9A 3HUUA 4JC0A 3RROA 5ICMA 1GKYA 1U0HC 3QOWA 3ONDA 4WZAA 1W5EA 1X13A 1MRNA 3P9PA 4ZO8A 5HFJA 3AUUA 5BUQA 4TYYA 3EIHA 1B76A 4FFVA 3ZE8A 1W88A 2D4AA 3K2BA 4JBNA 4NYIR 4PZLA 1PJ8A 2ZAGA 4XCXA 3EDRA 3H11B 1AO0A 4DPKA 3DYVA 3PL5A 4LF4B 2ZR0A 2ZRGA 5A6VA 3RFFA 3UJAA 5A0FA 2HBZA 3ZX4A 1KKLA 2H65A 1W4ZA 4EG7A 5SZKB 1A4IA 1YS6A 3CZPA 1FW8A 3QW2A 2RHHA 4YV0A 1GXSB 3Q5DA 2XXAA 3UMSA 1TT7A 1PT8A 2H1CA 1LCIA 1VLMA 3J7AC 4L74A 3FUUA 3GN2A 1SU6A 3FCUB 1SKQA 4X45A 5D2CA 5T3YA 1BNCA 4ENTA 1RRPA 3CHYA 5EIAA 3R6WA 4MRVA 1VPWA 5HOQA 2I1VB 3KYBA 3WAKA 2ZUEA 2GHTA 3Q7QA 4OI1A 1SC9A 4GRAA 4IJ5A 2VJPA 3NEPX 2OYRA 4BB0A 4EUSA 5KVVA 1TNDA 3T0GA 1QR2A 1XFDA 4FEGA 4EL5A 2QZZA 4WW0A 1YZTA 3T8YA 4TROA 1EXDA 1ZVVA 1YU6A 2RHWA 4G5GA 1H4VB 1SBQA 2VJBA 3HKDB 3R5SA 1O3YA 3IE2A 4V0QA 2FWBA 5BN5B 3VYUB 2Q3EA 5FXMA 4OQXA 4IPTA 4HLCA 4MV8A 2A6PA 3HBAA 3X1KA 4UUPA 1KO7A 5DNWA 4YYEA 5AK6A 2X5NA 3C87A 3KSAC 2HMSA 1FTQA 2G1KA 1WOYA 3PT5A 2WICA 1KZHA 4QTYA 4XE5A 2WNSA 4D02A 1KAEA 1XUOA 4ZVPA 5EWLB 1DCTA 3TS1A 1RWMA 1L5HB 1N1MA 1VKZA 3LC0A 4RJJA 2I91A 1G4AE 4PM4A 3UK2A 4UVGA 2DHDA 2W11A 1R5NA 3C74A 1GCUA 1E1RD 2QDKA 2RGRA 4RXUA 2G3YA 3O93A 2P0AA 5IBCA 1U6IA 3E3AA 4LGCA 5KO2A 2EZTA 2CMKA 3IQXA 5HZGA 4DCOA 2XOXA 1K0FA 1SC3A 1Y48E 3FCEA 5E6UB 3R8FA 2QX8A 5DHTA 2G0TA 4AJ9A 1I6LA 2UVDA 4NE9A 4RF5A 3A36A 2VPPA 3W5HA 1WW2A 1Q0RA 5DM1A 2ZDGA 1V1MB 2CZGA 2JHPA 3K09C 3OETA 3V4RA 1NE2A 1E2MA 2GM3A 4RM2A 1QQ7A 2FZ4A 2R00C 3PNYA 1P2FA 1JE0A 3KAKA 5K0ZA 4GZ6A 4MARA 4LRUA 2GYYA 4Y1EA 2ETVA 3Q6NA 2JLQA 2O0MA 3QVLA 2H06A 4JP3A 4HLQB 4OQMA 2YXNA 4D41A 1ELOA 3NM6B 1E9DA 5JH7A 1IOLA 1DQRA 4M83A 2DFVA 3QVJA 4UJ3A 4EM6A 1Z4QA 3IAM1 1NW8A 3TDKA 1L0BA 2ZJ7A 3D3JA 1K4MA 1R8SA 3L7CA 1SD1A 4YJFB 1WXGA 1TC1A 3SYRA 1JALA 1OPRA 3HKBB 2INGX 4NMWA 1ETHA 5KKCA 6ABPA 5FFFA 2ZPUA 3CUEF 1QVAA 2D1QA 2P3LA 4O5OA 4CFSA 3NS7A 3VPFA 1G5QA 3IERA 1R15A 4HNAB 2VLIA 4BB6A 2WZBA 2ALJA 5CX1A 2QM3A 4YRLA 4IMRA 1Y4UA 1E77A 3L40A 3LPMA 2FEPA 1NX9A 2EFYA 4B44A 1KEEB 2ZIXA 4UAGA 1ORRA 2GI4A 2PA3A 3ZDYB 2A86A 1Q1QA 1IZ0A 3TM4A 1CR4A 1OAOA 2QB5A 3KT0A 4MUKA 2Q5JA 2XVAA 2ZROA 4GBED 1ZM7A 2NW6A 3E81A 2WUEA 1VLLA 4JA2A 4BLVA 1RRCA 3CGWA 2D06A 1WG8A 2RKWA 5EXDA 1EXVA 2H4JA 4NU5A 2C29D 3GC6A 1ESEA 1QTIA 3FUTA 3I5MA 4KHZA 4CL2A 2W6NA 3JZIA 4J0KA 4L8WB 3V6LA 1OSNA 1ZY2A 1UJMA 5TQ2A 3BMNB 3M9XA 3O4RA 2I3DA 1KC1A 1PQUA 1IXZA 2CJWA 1Z2AA 4KLNA 4M36A 3NCHA 4BFXA 5BSGA 2RKOA 5LP6B 4RE5A 2C2BA 2J9XB 1LZKA 4QOFA 3ABIA 2NOAA 3ASVA 4AO6A 1QK5A 4OV6B 3UB3A 2C2OA 4RMNA 3QNMA 3DA8A 4CLRA 5CA1A 4BPBA 5ADWA 3AL3A 4P3XA 4QRDA 1GZ4A 3V7WA 1PJ2A 1G0OA 2PRIA 1JEQB 1N2XA 1WSBA 4Y9TA 3U4GA 5IAAA 4DA9A 1EBBA 2QORA 2GCEA 2J6IA 3R6DA 4YCBA 3R44A 5BWNA 3STTA 5JAIA 1EJ6A 4EUNA 1K88A 3H2JA 3VTAA 4M9UA 1NYRA 3MAJA 3NT4A 1UK7A 5JDCC 2WUGA 4R1MA 821PA 2PRYA 4BVHA 2X40A 4D99A 4WA7A 1UMBA 3IHKA 4YT5A 3NVAA 2LR0A 1W1WA 4I6GA 4YCSA 2UUPA 3IRUA 5TJHA 3A31A 2VHWA 4UZFA 4X20B 1PJQA 1I13A 1OWOA 4Y2GA 3RS7A 5FI5A 5KOHB 4RHXA 2FZLA 3ICWA 4N3NA 1TQ8A 3WLIA 4BQEA 3WLEA 4EY7A 3CMMA 4R3NA 3QX9A 4X6XA 4ZT7A 1Y6JA 3ISJA 1VL8A 3QVGB 4U9IS 3FTDA 1NVVR 1TAGA 2FGJA 3ANLA 3IAUA 1OROA 3OZTA 4WSOA 4L6IA 3ZEAA 3OCYA 4YS6A 4DLSA 5AVSA 5I4BA 3I5AA 4QL3A 1TAUA 1MA3A 5B58C 3DLCA 1E6WA 3FI0A 2GZRA 3B1YA 3NCTA 4C0WA 1PNVA 4ITRC 4LJAA 4N0QA 1PUXA 1IY0A 3G2PA 3IMKA 4QGBA 4ZYYA 2BWJA 2IWRA 1V96A 3GBVA 1C7EA 4H7JA 1KJNA 2CLSA 1J09A 1HX7A 4AN1A 1O9HA 4Q05A 3I8OA 3I6IA 1G21B 4UREA 4I36A 2WEKA 3RAEC 4ZPJA 4BVBA 2REQB 3KFVA 1PR5A 5HF6A 1QH1B 2JCGA 5JSHA 1RQPA 1KY2A 2F43A 4JYPA 5GWXA 3H9UA 1DUVG 2RE8A 1KZ6A 4MLPA 1G59A 4ESOA 4Q9KA 2F8SA 1SUBA 3Q7TA 4J29A 2HA3A 5JSKA 2QMUA 2A5LA 4BDSA 4OKIA 1Z25A 2JGKA 1E3MA 4LHZA 1KOLA 1RAFA 3TH5A 4AG3A 1GUYA 2BGUA 4QHYA 3KEMA 5BURA 3GH1A 2IQ5A 1KK1A 4KQIA 2VXOA 4FVTA 3PHJA 3ZEIA 4EHAA 1PTKA 3BK7A 4HGPA 3Q7SA 3U81A 2YZ7A 2A14A 2GBCA 4JS0A 3O31A 1PR1A 2FR0A 4CDNA 4TKZA 3HFGA 1FFEA 3VBEA 1SXJB 1CJKC 2RHDA 1DBIA 1MB4A 1N7HA 2ZYUX 3AG5A 4LJYA 2FI1A 1N5MA 2ZBRA 4WCVA 5CFZA 1JBQA 3DE0X 3M4YA 4YCNA 4X1YA 3UWOA 3OOJA 1OVGA 3ANTA 4L8YA 4ND4A 3WIDA 3ZIAA 1D2HA 1JLMA 4HNRA 5T4HA 2QVZX 2GEFA 2WMOB 3TTWA 3TECE 1KEVA 2PR7A 1XA0A 1B2LA 5A05A 1E0DA 3QLUC 4REQB 4YVFA 4E2YA 4PNEA 2DXIA 1YE3A 3NB0A 5IYZF 4NBRA 1QFMA 4ZXPA 5LQRA 3D54D 3KAQA 1EVEA 1R64A 3ED5A 3HZZA 1LQTA 4GPTA 4NBNA 1OYVA 4UUNA 1KETA 5LDHA 3QEAZ 2JJ8A 4CEJA 4KIFA 3Q3VA 1OT3A 1SOAA 2CF6A 4FNOA 3ZKAA 2QMYA 2RARA 1Z83A 3QJ5A 1ISJA 5CMLA 1I9GA 4F2GA 4EY3A 2HQOA 1H22A 3JW8A 4M99A 3D6TB 3UA4A 4P98A 3UUGA 5AI4A 1C3JA 1ZRMA 4BO5A 1DWPA 4PPFA 1Z8NA 4U7GA 3V1NA 4GKVA 5EZ5A 4Q4JA 5D1NA 2XWSA 3J7TA 3T7SA 3U6BA 3VSCA 1X7HA 1JT2A 4EA9A 2QBYB 3OIFA 4OHZA 1EE2A 4CLEA 1AS0A 4LXIA 4CIDA 3DXFA 4KIUA 3EPJA 3T95A 2IHVA 2WG2A 4KN6A 4PHHA 2OO3A 5JD5A 2IZZA 5JYCA 1FDTA 2UYYA 4XWOA 3VI4B 3QMVA 1SB9A 5GONF 4I55A 3WLQA 3Q6MA 2NXWA 3RKRA 4E7PA 4LF6B 1H85A 2XYRA 3IPRA 3IB6A 1QG2A 1QHHA 3FWNA 4N8DA 1EPUA 4Q21A 2R68A 3TTTA 4ENWA 1K5PA 1ZJ6A 1ZCJA 3CNLA 4FJ1A 4MGYR 1T3HA 2CVQA 2AMFA 3LBYA 4A26A 1SA0B 1UXIA 1VMIA 1XN4A 2KBFA 2XUGA 4LDRA 1YUBA 3EXFB 4QELA 1MIOB 3LHFA 4UM8B 3ZOKA 1KQGA 3AJEA 1JDUA 4BIMA 4RHTA 5GPBA 4N5IX 3GEDA 4MR9A 5C8YA 3JX9A 1E9BA 1TTHA 3AEQA 4P3NA 5DPMA 3IELA 3MAGA 2ZRKA 3B7PA 3DHWC 4XIFA 3IT1A 5BQXA 1G4UR 5HUQA 4Y7CA 2WAYA 2BHRA 4NPCA 3GLIA 4ESHA 2D62A 1B73A 3DEZA 3NHSA 5TRTA 2ZR8A 4B6QA 1KRXA 4Z3DA 3IL2A 4M0PA 4OLHA 5C18A 1QTNA 5GIOE 1XMPA 2BMWA 2CUNA 3REFA 3NANA 1LJ8A 1DZIA 4G0ZA 1EGHA 1SCUA 3PRJA 5TS3A 3W77A 4MINA 1XC7A 1F1BA 2PS1A 1P1BA 3REOA 4PRKA 1G5TA 4FU0A 5AM3A 2V6JA 4FONA 5AVTA 2DSNA 3DE7X 1OAAA 2QL9A 1UDRA 3PYMA 3UJPA 3KPUA 1UFVA 1Z8FA 3P9NA 4L4XA 4FBMA 5IHPA 3VU3A 3FDFA 4BWGA 3CLSC 3U7HB 3MRXA 5JECA 1WQ4A 2FG6C 3CIOA 3HSKA 1SOWA 5BMVB 3A70A 1NQ5A 1XTSA 2CHVA 2JFBA 2IY8A 3OZUA 3C5EA 4EJ6A 5TMBA 1HNZB 2ZJ4A 2HX1A 5I8ZA 3D8BA 2ZBUA 1K7EB 4B0PA 2YWRA 4Y0NA 1HDXA 4V02A 2C0PA 1ETUA 2X3YA 3OIDA 4EHDA 3N6XA 4O0LA 1L1EA 1VL6A 3MQ2A 4X8OA 3HKDA 4B80A 1VFNA 3QNUA 4I55F 1T8PA 2I3AA 4BLWA 1WKBA 4EY8A 2JD1A 4IHJA 1ZVQA 1Y4SA 4PWZA 4R3WA 1AS3A 2WE8A 2VQSA 3C15C 4R9NA 4M1EA 5EFOA 4YV1A 2W6OA 2ZBVA 3HA7A 1Z5UA 1L3IA 1BEEA 3I0ZA 2R0QC 1DFHA 1XMVA 3CM0A 3UGKA 3BFVA 3ZV5A 2ZSDA 4GMGA 3PDUA 5C8YF 4IDFA 4OQDA 1JHRA 2BCGY 2O57A 4RWEA 1L5HA 3V2HA 2PBRA 2DM6A 3EHDA 4QT0A 4BLQA 1ZITA 1G7TA 5KX5A 1V9SA 3QEOA 3U5ZB 3G23A 1PR9A 5GADl 3ZVLA 1OU0A 2H2WA 2C7OA 4ILKA 3RF7A 4B3MB 1X42A 4TKVB 2P69A 2HOQA 1WUHS 1RABA 3AB7A 2CC2A 3VHXA 3F78A 5FYDA 5E6UA 4BCCA 1GLNA 2AOUB 4KQ1A 4ZODA 3BS4A 1BKSB 2VP4A 4CQLB 4YRFA 1IWPB 4EGFA 3LV8A 2ZRIA 2ZIAA 3WLOA 2PUCA 5I9SA 2OLJA 2A9FA 4BKMA 5HG0A 4B76A 1TCBA 2RD2A 1J4AA 1QKIA 3DMDA 4LSMA 1WQ3A 4L76A 5LU9A 4WXMA 3GJXC 2RIPA 1Y9JA 3WDLA 3U3XA 4B3TB 1D0SA 4FYKA 4IWYA 4R54A 2BFFB 4DC9A 4F92B 5MN5A 3WR5A 1BMDA 5F1KA 1JGTA 3BHJA 4BGDA 2P8SA 4K7JA 2W2KB 1SOMA 4KJZA 1R6XA 3NBAA 3GLGE 4FR0A 2HK6A 1PVOA 1K8RA 1AX9A 3HKBA 3NH6A 1ILWA 3DYBA 4A0SA 2XH8A 1BOOA 3IQIX 5HGJA 2Z9CA 5JT1A 4RFSB 4LDNA 2H5EA 3BYZA 3D3WB 2C31A 4BNVA 5JANA 4HNAA 2XGSA 1E9CA 2XMBA 3BICA 3OKCA 3ZNQA 1KXJA 1QO7A 3QX3A 3W6UA 1U5CA 1PR6A 2RGCA 4MIKA 1JJ7A 3T7JA 3BWYA 3K96A 4K86A 3A0RB 2WFLB 4F4HA 1C8LA 3EODA 3AFMA 4IHJF 4TV9A 5FOVA 4Y6OA 2YVQA 2BW0A 1KQFA 4K6OA 1FP4B 1QHYA 2O52A 3NHUA 4M21A 3G02A 4K1LA 5C51B 3SKYA 1LFAA 3R7FA 1I2ZA 4YAIA 3CVWA 5K0BA 2Q4TA 4D3SA 5IAJA 3VNSA 3WSTA 1T5LA 2PXXA 3PWSA 3FZQA 2EJWA 1M7GA 1ZGBA 1BVRA 1HUQA 1MEJA 1XVLA 2FZ5A 3BMNA 4BMPB 5KX5F 3V80A 3UUFA 3E22B 1CP3A 2XMZA 1SHTX 4QDKA 1G9XA 5JOQA 5K8TA 3RSZA 1U4NA 3C4QA 2VSOA 2GK4A 4JJKA 4R2HA 5G0VA 4DYDA 1HFKA 1KIAA 4CIWA 5ECYA 1T13A 1UBLS 5JRDS 2WSBA 5KINB 3ER8A 2QTWB 3HSYA 1LNZA 4L72A 4ND3A 4QOGA 3F3SA 4FOSA 4ALLA 3D2BA 1AQ6A 3BGSA 4H7EA 3RC8A 3H0EA 4RU1A 4FOLA 4O6VA 2OUKA 4JAVC 2DUJA 4ALMA 4JZKA 3BRQA 2OGSA 1D4ZA 3HHPA 4YJHA 3CR3C 3TTSA 5A7FA 4NABA 3PQDA 5ERGB 3KQSA 1ZD2P 3GCXA 1J90A 3NGLA 1NVGA 3ET4A 2WE7A 1ISHA 1JXMA 2QP9X 3E5RA 1BCRB 1MRSA 1IULA 1YRLA 3AR2A 3LY8A 4GI7A 4OQ4A 4BJ6A 5KIAA 5DNYB 3CYFA 4YRTA 3WK7A 2C7RA 3INGA 1OB2A 4OHUA 4N7BA 1TZJA 3HR8A 3L8CA 1LJLA 2ZVDA 2PR2A 1G9TA 3C1TA 3R7DA 2ODBA 3W4IA 3P20A 4Z4FA 2IUEA 2XHEA 4KXLA 3RFTA 4B6EA 2WZQA 1Q77A 3OM9A 1NLFA 5ITSA 4YAJA 4EFLA 2R8PA 3NJ8A 1VKNA 2DECA 4LUCA 3TIVA 2YZ2A 5FTNA 1UWLA 1B41A 2FEAA 3UMYA 1GPJA 2KPOA 2WRZA 5AKLA 3PF9A 3ER9A 4WFQA 4Y67A 5KC8A 4TV9F 3QXCA 2FFQA 2ZUVA 3ZK7A 5B3AA 1B3RA 4D4GA 3ZV7A 3TUIC 1YCFA 4OIMA 1W1IA 2NXCA 4RCZA 1AN9A 4K9RA 2KX7A 1SIWA 1NBEA 2D59A 2Q9CA 3C6ZA 4GU5A 5BN1A 3PQ5A 4BFTA 1J9EA 4L0MA 1VE3A 3LZCA 4IOLA 1OLUB 4D98A 3BWBA 1PFQA 1XYGA 1U0FA 1UBUS 1C4KA 4HWTA 4TXNA 4QG3A 1M8PA 4UVEA 4YCAA 2PD4A 1Y5RA 2BIFA 4O4HA 1KJ9A 2QPLA 4WKNA 4X6UA 5ALPA 3FOAA 3ILHA 2CCGA 4Z7QB 4DUGD 3AI3A 2O5EA 4RULA 2PRKA 2PX3A 3GA7A 3OJEA 2ZI5A 1RTTA 2XDYA 2PKEA 3OLCX 1TJ4A 3CZMA 1DBSA 2O2XA 2R84A 5JS2A 1LSSA 2WYOA 3MRVA 4M53A 1ODLA 4F3YA 3K9BA 5BVHA 1S2IA 3KDPA 4OP1A 2XI4A 1L5WA 4NYMR 5HIAA 1OX4B 3GP8A 1K6MA 3W8DA 4GQIA 3UEOA 2YINC 3CG0A 4UNRA 4O4LA 3N2IA 1AMNA 1ECJA 2GX6A 5F5NA 3IQDB 5JYEA 2K5UA 2Y2VA 1KOJA 2FF5A 5KOJB 3ESAA 3TRJA 1FXWF 3RSCA 4ND5A 4NNJA 4AK9A 5JAMA 3IHTA 3W9SA 5LSAA 1UZLA 4ROSA 2ZDQA 5A9SB 4L9SA 3QQPA 5FEUA 2WPDD 3GY0A 2YHSA 4BQPA 5B3LA 3HI4A 1X7WA 4DT1B 4DLVA 3GU3A 5HMMA 1T4CB 5DM0A 1TYEB 2ZWPA 3BJEA 1F8YA 3DDUA 5AMXA 4LF5B 2DFPA 3D8TA 1XQ9A 2RCYA 2R3SA 2YV2A 5C80A 1W85A 2GESA 3A4MA 4I14A 4TLMB 1W9MA 3PPYA 1B6SA 2IEDA 2FQQA 3JD0A 3ZGXA 3TQHA 4DHEA 2ZM5A 2JH8A 3SJAA 4HMPA 1QQAA 2RH5A 4YRNA 3S6JA 4YN3A 1BFKA 3Q98A 3V8VA 2XMRA 1XPJA 1WU8A 1Y7HA 3ORRA 1LNQA 2P3QA 3TXXA 5K1ZA 5CUQA 2BGLA 1XRJA 2X6TA 5E4YA 3R9KA 2QJTA 3G2KA 3HCOA 3EPRA 4RV9A 1W8DA 5H82A 1UJ2A 4TL6A 1IOWA 1NMSA 4YB8A 2BGTA 1L7QA 4QNRA 2X4LA 1M2OA 2G63A 3IV9A 1CUVA 5EL0A 2IEZA 2AN9A 4C3ZA 5E2AA 1J70A 1Q3KA 3ITEA 2Y0CA 1USIA 3ANMA 4HNUA 2C3YA 2WJPA 1TMYA 3NONA 3RIYA 3WYFA 1HDIA 2PUJA 5I6DA 3E27A 3GWZA 3T6KA 2B92A 5KTOA 2X9GA 3HDJA 4PTZA 1ZR2A 2PTHA 2TMDA 4TTJA 3VR4A 3ZTTA 5HILA 1E94E 1NY6A 2X3UA 4QRIA 4XASA 3NOXA 4N6GA 1NVAA 1X7ZB 2QWXA 1NAHA 3AM3A 2Y6VA 3CTMA 5K3BA 1SA0A 5BSTA 3RS0A 5FLXA 3A37A 5DHSA 4O29A 2W7TA 3WA6A 5G0WA 3ZV3A 1GV0A 4MRSA 3SX4A 3DO5A 4NK4A 4N76A 1J00A 4NYJR 2P65A 4G07A 4EABA 1QU2A 4XB6B 4IYRA 4GE0A 3RC9A 3LWDA 4COKA 2JHCA 2XEDA 2BKUA 1HEYA 4DNOA 4O4LF 2D0PB 4BECA 1KIMA 3C7KA 1FNMA 3TIGA 3D8NA 1T8RA 2J4CA 4KO4S 1O0CA 3ZU4A 3CXUA 1OGJA 1PVVA 3RVDA 3U40A 3SI7A 1TGVA 1UQTA 3EBPA 1JF8A 4I9HA 4XVRA 4M8IA 4Z1MA 3E3MA 5L51A 2O8DA 2F48A 4RZQA 4Y1RB 4TMYA 3U3ZA 1PJBA 2ZYHA 5I01A 1UIMA 3TSCA 3TVTA 3A1TA 2V8BA 2PSEA 4JUAA 1OAOC 2EJVA 2R7AA 4J1TA 1TQ6A 4B3HA 4EO9A 3BCUA 4MXDA 4DDMA 3PHLA 3BTVA 3JR7A 3WQBA 5TC4A 2IPAB 2AG0A 3IIIA 3GJ3A 4W9NA 8LDHA 4N47A 5A6SB 4DSNA 4FMCF 4P7GA 3Q3EA 5TPWA 3NV7A 5GJCA 3AH8A 4QXAA 5DIZA 3FJ1A 5CHYA 5BMVA 4XGRA 2C96A 5CGZA 1Y3AA 2C61A 2WG1A 4JJEA 3I6QA 4WJKB 3KFLA 4HNQA 4L0DA 1MDBA 4L7QA 2QA5A 4H17A 3SZOA 2A78A 2X23A 4PSCA 3GA5A 2WSSD 3GDGA 2AS0A 2JFNA 3O8DA 2YWFA 1DX6A 2C59A 4CMHA 3ZJYA 1PJSA 1FFXB 1EIZA 5LA6B 3H19A 3HDHA 4IAOA 4E22A 2EBFX 2HU8A 1OI2A 2FUCA 2VP5A 4IIEA 2Y1LA 4OAQA 2ZZNA 1C9DB 1NV9A 3K8QA 5ALSA 2UU9B 1I4TD 3RAGA 1QLWA 1C50A 4TTSA 1BDMA 1NFQA 1FYDA 1Q14A 1KVUA 5IH3A 3S0JA 2BELA 4CMAA 2AL7A 3ESYA 1VLZA 1CNMA 3AT1A 5FFNA 621PA 4QU9A 3B8HA 1X2BA 4QVGA 4QQRA 2ID8A 4MYCA 5HW0A 1GNPA 3OX2A 1UT5A 3HRKA 3SC2B 2MR5A 3BWVA 3VJKA 1TCCA 1YHYA 2EHJA 3IH5A 2DH5A 2H11A 4J7XA 2NZXA 4A73A 4D82A 3JVEA 4V1CI 4E51A 5CA0F 1XJQA 2OWEA 4TKVA 1U3TA 4AKTA 3ONFA 1E7RA 1JV2B 1T8YA 1F2TA 1XSEA 5EZYB 4AI6A 3GDHA 3IUQA 1IZZA 1G64A 1OXUA 2AOUA 2G9VA 2R6ZA 2RONA 2QD1A 2VSYA 4UDXX 3V3TA 4AJKA 3PXGA 1U3WA 1N7GA 4I81A 3LL4A 1N7JA 4RJIA 4BX2A 3BT7A 2BFNA 2VQ6A 5A9TA 1II8A 3ZDXB 1JDZA 1GL7A 2YS7A 4YMVA 1SIOA 3LQKA 4EO7A 4KQ9A 4IDDA 1XB2A 5JTTA 1EP3B 2HHCA 4UARA 5JU6A 3S29A 1UBRS 5AKHA 1VKOA 1FRVA 4TS3A 4TWAA 2QMOA 1GSHA 1F51E 1H0RA 4HKTA 3WYGA 4PZZA 2ATEA 2BHNA 3KZOA 5H81A 5EQFA 1Z2DA 3L4JA 2YOFA 4O2AB 4RELA 1EEHA 1OIVA 1GA1A 3DOEA 4RQAA 2W2KA 2EBHX 1U0RA 4Q4LA 1R12A 1DARA 2QAIA 5TQ0A 2Q0XA 1CUBA 1OLXB 1XQYA 1ZH8A 3UHAA 2ZSUA 2IUFA 3OPXA 1KORA 3R7WB 3WWYA 3KQLA 3M6WA 1S1MA 4RFSA 3CPEA 3D3WA 5D3KA 3G88A 4ZEMA 1IEWA 2W42A 2MU1A 1YVRA 2IXGA 2TYSB 3UA3A 1HR0B 3GUVA 5HKKA 3G5MA 2Z43A 1U9YA 2H1FA 4YRPA 3AI7A 5KNCA 1DAOA 1QYRA 2JZNA 1CJUC 3UJBA 3CX3A 1PR3A 4IVQA 3WY9A 4C7XA 5IT0A 1QRTA 2WMDA 1WF6A 4M8LA 5FUYA 3AONB 2IF0A 4X7RA 3AY0A 3BDIA 1GT91 3C3BA 1OE0A 3TE6A 3U37A 3I53A 3W5UA 1ZAYA 2II6A 1HNWB 4Q1AA 1NMXA 3B60A 2GERA 5BW6B 2UV8A 3NBMA 4NIMA 4Y98A 3T5MA 5DHRA 1ZDMA 2XQFA 1OW3B 2X8LA 3UICA 1P5HA 1PDOA 4BNWA 3T3GA 2EZ8A 3E22A 2C5SA 3NORA 4TRMA 3V8NA 2VWQA 3I9V1 4D3DA 4N48A 1E62A 2QM0A 2ZJZA 3C3AA 3HKEB 2JGMA 5L3RA 2RKBA 4PZDA 4JMPA 1AHNA 1HQDA 4D56A 1V5WA 2GASA 2BV3A 4L5YA 3VVCA 1KZGB 4HATA 1Q44A 3UH0A 3VH4A 2ZSJA 3A4IA 3H5IA 4L51A 1QDEA 2OKGA 4CG0A 1Z6GA 2WKRA 3JQGB 5AVUA 4P34A 4TMTA 4NOKA 1OWLA 2CFIA 1E98A 4WNCA 1DAFA 3G59A 1WTAA 1RLUA 2QL7A 2PLFA 5HE8A 1XCOA 3H7IA 1HO3A 2ZSFA 4GBMA 5IJWA 5KSWB 3A1WA 1KRWA 4XM2A 1UDWA 3JQDA 1QX4A 2OPHA 4OATA 3D7MA 3E2MA 3F5MA 3BE8A 2QENA 4ZOBA 4ARUA 3ZUPA 4RVDA 1D2GA 3EG9B 3TBHA 2DLCX 3K2QA 1GZHB 1FP2A 4F9FA 1F2UA 2PH3A 3AEUB 4JHLA 4LTNA 2QLLA 2WNHA 3TZBA 1UKYA 4NMMA 4A2CA 1NVBA 5FBVB 3CH5A 1JLRA