1KZYC

Crystal structure of the 53bp1 brct region complexed to tumor suppressor p53
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
259
structure length
232
Chain Sequence
ALEEQRGPLPLNKTLFLGYAFLLTMATIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein, protein binding
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structure of the 53BP1 BRCT region bound to p53 and its comparison to the Brca1 BRCT structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 232
sequence length 259
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18428 BRCT_3 BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1kzyC01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1kzyC02
4BU1A 3SHTA 1OQAA 3PXBA 2AZMA 3SQDA 3AL3A 1WF6A 3T7JA 1L7BA 2INGX 1T15A 1Y98A 1GZHB 3PXAA 1N5OX 3JVEA 3UENA 3K0HA 3UEOA 3PC7A 1KZYC 2EBWA 2K6GA 3U3ZA 2COUA 3QVGB 3SHVA 4XPZA 3K05A 4N40A 2L42A 3HUEA 4XQ0A 2ETXA 3T1NA 2DUNA 2M2IA 2VXCA 4JLUA 3K16A 2COKA 4Y2GA 4U4AA 3HUFA 3T7KA 3EF1A 3OLCX 4IGKA 4BMCA 2K7FA 1L0BA 2JW5A 3L46A 2R1ZA 3L40A 1CDZA 2EP8A 4Y18A 3I0NA 1T2UA 2WT8A 3PC6A 2VXBA 4BU0A 1Z56C 2XNHA 3EF0A 2HTFA 1JNXX 3SZMA 3PD7A 3FA2A 3PC8A 4BMDA 2LE0A 1T2VA 1T29A 3PA6A 2NTEA 3AL2A 2EBUA 3L41A 3K15A 3K0KA 4IFIA 1IN1A 4OFBA 2D8MA 3PXEA 3T7IA 1IMOA 4ID3A 3I0MA 3COJA 2COEA 5ECGC 3PXDA 2XNKA 3KTFA 3PXCX 2ADOA 3PC8C 2E2WA 3QVGA 3II6X
chains in the Genus database with same CATH superfamily
2WWRA 5EFZA 2Q5IA 4Q16A 3W2FA 3UJ7A 5J2UF 4DC9A 2ZYIA 2Q6VA 2XGOA 2HNBA 3T52A 1U7HA 3A25A 2QE6A 5F33A 2QG4A 4N01A 4RE5A 4KQMA 1H8ED 1GADO 2GZ3A 5A1TA 3GJ0A 2FPMA 5FHQA 5G0TA 5TPWB 3PE3A 5FTLA 2Y1KA 4FX5A 3T4UA 5IM4F 1M0SA 1MJNA 2IPAB 3ZC3A 3OBBA 3V33A 2WAAA 4BASA 3ZWCA 3EZGA 1V5IA 4JMLA 1NRWA 2TECE 2AOTA 5FDFA 3RIXA 3DPIA 1S2GA 1SBYA 1M2WA 2O2DA 2OXCA 2PX2A 3BHIA 3TR6A 4XPZA 1FFHA 1CUUA 1K3FA 2JIZA 4L5AA 2GCOA 4CCSA 3PSHA 4CPDA 4PLVA 3PIDA 3U40A 4F3TA 2EXXA 1TTTA 1QIIA 1TAGA 3NEYA 2X0EA 4MA0A 2CNOA 3CEPB 4YRDA 5HZMA 3H1EA 4JGBA 4IO1A 1Y8AA 4N3NA 4QDTA 4J2OA 3TNFA 1QGDA 3W6PA 3N1UA 2JI6A 1FZTA 4EHFA 1G2QA 4MKHA 4CYMA 1ZN2A 3K70D 4FYKA 3CKYA 1QFMA 5AJWA 3L4SO 4TZTA 4GX2A 2E1PA 3ASUA 4TKZA 5DSZA 2M9MA 4XJXA 3UWMA 4D9GA 5ALYA 5F3WB 3FOFC 4N0MA 3IDFA 2WDPA 2AR7A 3CX8A 4JLDA 3REFA 3K09A 3Q7PA 3FUTA 3IUNA 4M8IA 1DSSG 4OP3A 5KYNA 3EC2A 3B3JA 3PC2A 3TW6A 5JRJA 1XJCA 1XWIA 2HXGA 1WZIA 3AY0A 1GRQA 1KI1A 2H3HA 3MFYA 4PSAA 1DEAA 1H94A 1S9HA 1J42A 3KJFA 3V1UA 1UIRA 3WGGA 4UBOA 2YFHA 2P1DA 4NZPA 5AP9A 2LNDA 2RC6A 5AWFC 1IY2A 1UT8A 5JQGF 5M5BA 4KVGA 4G4IA 5FA8A 2EYUA 3KLNA 1K8YB 1CVLA 4DW8A 3M6VA 1ODLA 2P2NA 4C22A 1ILEA 3GCGA 3D4OA 2ZJOA 3IUMA 1W0JA 1NHWA 3FWNA 1FNMA 2LGJA 2P91A 2C2KA 4P93A 2VZEA 1RQ2A 3LX8A 1TJ3A 3IXLA 1X92A 2P8JA 5K05A 1AUOA 3L8FA 4TV9A 1OAOA 4BNTA 4YP7A 4ZREA 1BE6A 5KVSA 1ORVA 2BR4A 2OHOA 3ZWXA 2G9ZA 3C6YA 2EEZA 1KK1A 3ZU2A 2PS1A 1D07A 3ZH2A 1EJ0A 1N0UA 1YFKA 4INZA 4ZKEA 3TTWA 1OKKA 2QTZA 1UWVA 1KARA 3RE1A 1CLUA 3H4TA 3HZHA 3OLVA 2CB9A 5JY1A 4N48A 3NRBA 4RBNA 4MUJA 5AT1A 2YWRA 2HDHA 1DINA 1LY1A 4UNQA 3UAWA 4G8JA 4QHSA 4WFJA 2IPNA 1TM1E 5M3BA 5LJIA 3VYSB 1HYBA 1Y9AA 2ZBRA 2WTMA 6ADHA 3MJRA 3NOQA 7AT1A 1XYYA 1LPMA 2H9YA 1QK5A 5CM8B 1PQWA 4NNOA 3MJSA 4DWVA 1OREA 5CTAA 1NOJA 4U0JA 3HCPA 1XC7A 3UT5B 2OECA 5HF8A 5EEHA 2GYYA 2QZ9A 3TDMA 3S44A 1F51E 1Z4LA 5ER6A 4DMGA 4HDKA 3IQFA 1M2OB 1DQNA 3U5ZB 4PIVA 4A92A 5I5EA 3EA0A 2X86A 1DC8A 3KEOA 4MDYA 1JQDA 2AFRA 4J16C 3IPCA 5JHGB 1TE2A 2WJ3A 2N75A 4IX9A 3JZDA 3EGOA 1W1IA 4G5OA 4DMRA 4DV5B 3OWHA 3T1QA 1JB1A 1A5BB 4OYYA 1Q0PA 2YXBA 3ZGOA 3KFVA 3LC0A 3GGPA 4JCOA 4R0MA 1BHJA 1IK6A 1EE9A 3GPDG 4LRUA 4HWTA 4P80A 4QFMA 5BN5B 4G0UA 2OZVA 4RZQA 1Y3DE 7ADHA 5K8IA 4Q82A 4A8PA 2ZDQA 1I4EB 1UPUA 4O02B 3T5MA 5AD1A 4GOND 2AUNA 3R9KA 4EI8A 3CZRA 4QFDA 2JVIA 3GJ7A 1XEWX 2HRBA 2XAUA 5CM9C 3QLVA 1OZGA 3B1FA 3ZDFA 3LRXA 3H7IA 4EG5A 4TTAA 1T1RA 3W79A 4DOMA 1YJAA 3N86A 3WS7A 3I5XA 1OYWA 1T8PA 2FCAA 3HB0A 1W4RA 1CZNA 2A3RA 4HLUC 3MJCA 3KTAA 1VPLA 4MCHA 1W7AA 3CGWA 5IX8A 5J3JA 1ZVQA 2OZPA 3HA3A 4TTRA 4O2BF 2OV6A 1TQ2A 5ALJA 2PBRA 5FEMA 5G3ZA 2YWHA 3UA4A 3A1SA 1T6ZA 2C99A 1CQWA 1RWKA 1UP7A 1EXMA 1JR3E 1Z7WA 2PMKA 2V7UA 4X7PA 5DEOA 4K9NA 4JEIA 4AICA 3ZCSA 2HMUA 1JX6A 4PPFA 3H5IA 1P4SA 5ERYA 3R9WA 3N59A 1U81A 5DNYB 3EUEA 3L9WA 4MQFB 3UGKA 4D3YA 1K4YA 4EFLA 1VM6A 1DEHA 4YP6A 2YH2A 5BSUA 2LV8A 3Q98A 3EFOB 4PSCA 2PSEA 4MRNA 5F78A 2Q3CA 3WI7A 5HM6A 3AY6A 4I1OA 3GJRA 2WZBA 4MS3A 4Y2HA 4ZALA 4EGAA 1X7WA 1FFXB 1DBQA 3CVUA 2JGAA 3IBGA 2A0XA 4L78A 1H2EA 4W5JA 5FOUA 4DA7A 1FNBA 3UC5A 4BCCA 1KI6B 3CLSD 4GMKA 3U7RA 4M1TA 1J20A 4A7PA 4JY7A 1ZM4A 4YT2A 3CZMA 4HDNA 4Z9AA 4U7WA 3R9XB 2NP6A 2VKQA 1KZ9A 1IY0A 3EGXA 1QHHB 1XGKA 2ONKA 3I2HA 4PGGA 4TV8B 1G19A 2GDZA 2PD4A 2A9FA 3K0CC 3LUPA 5ICMA 4UC0A 2F1JA 3FOZA 1IM2A 3OLWA 4ENRA 5EXDA 1XDBA 4JFAA 1Y7IA 3EEYA 3L7LA 4Q9JA 1PL7A 4CV2A 3BHMA 2UYOA 4IG9A 2HBRA 1ML4A 1PT5A 3A11A 3KSMA 3IHLA 3G1UA 4GZMA 2A33A 3L84A 1EESA 3OI7A 1C9YA 2H5JA 2Z4TA 3PGKA 2NUTA 2AVNA 1DJOA 3VO8A 3OX1A 5FB3A 1RIIA 4RKYA 5ECGC 3UOGA 4BN4A 2WWYA 2OLJA 1Y8ZA 4X97A 2VT3A 5COAA 4ZMSA 1SK8A 1QGYA 4AJOA 4HRYA 5KNCA 1EZZA 1U0EA 1XTZA 3K5IA 3VHLB 2RHLA 1WUJS 2HSGA 2X7XA 3JQCA 2O1WA 1HWYA 3A8TA 4P54A 1UF9A 4QO7A 2O2IA 1N5IA 4MLPA 4NZ9A 5SYAA 3WGUA 1LVUA 2X5XA 1R7RA 2I54A 3ZNNA 4NE7A 2JFQA 1RP7A 4MYUA 1LFDB 4HFJA 4HQKA 2VJAA 3OZXA 4IMJB 3WTBA 2JANA 2PCLA 2A7XA 4B2PA 3NBAA 4JL8A 3WLLA 1N78A 1Z26A 4D96A 1O0CA 3NDBB 1BAPA 3QE9Y 1Y6QA 3PDIA 3TH5A 1E6EA 1KYYA 3NTOA 3N58A 4UEJA 5SV2A 4ESEA 2MSWA 5CH8A 5A62A 1RM3A 4M9CA 4ESOA 4M9UA 4CXMA 4BFVA 1FTQA 4OI1A 5ED4A 3EMKA 1T3ZA 1WO8A 1NLYA 1J09A 1IAVA 3IAM6 1GHTA 3IP3A 1TDJA 3K73O 4QT4A 1V6CA 1F9EA 3JAWA 1MB0A 1WVIA 5I7EA 3FNGA 2EKDA 5TEWA 2WF7A 1LPPA 3HFSA 1GZ4A 1V2HE 5AFSA 1GUFA 1MX1A 1WUIS 4PPQA 1LW6E 1E2MA 2B21A 3BF7A 3QUAA 3PHCA 1Q0QA 2CMHA 1G55A 4G3XA 1NBAA 3QKSB 3V1NA 3X2SA 1EX1A 4BQFA 3TIFA 4J75A 1ABEA 5HE8A 3QLUA 4Z4QA 5U1PA 1JEYB 1SBCA 1R88A 2NZJA 3H4MA 1FUYB 4MYDA 1CZKA 4CMAA 3TJMA 1N3LA 2CLSA 2NVBA 1K89A 3WYEA 3R6GA 1ZIPA 1N9GB 1W0CA 1YVUA 4RTRA 4EGSA 4M49A 4G97A 3RWOA 4Z2YA 3OCZA 4JLOA 1W0KA 1T0PA 5JJLA 4KH1A 4MJ7A 3QIVA 4S1NA 4YFYA 3RSGA 1PW7A 4GAEA 2XA1A 1UWLA 1G98A 3U37A 3K9LA 4LVCA 3KSDO 3BSSA 2YHAA 4RV4A 4KQKA 2IBMA 4AX8A 3R3VA 1JKMA 2J0EA 2H00A 4JX9A 1C3OB 2Z08A 1GSOA 1E3LA 2YN0A 2DETA 3WK8A 5ESXA 2YC4C 4M9RA 4M7PA 3SP1A 4BU0A 2YXEA 1W4ZA 1WUTA 1BVYF 3OQIB 3A26A 4HEQA 3IULA 1AB5A 4UPEA 3KKLA 1T2EA 1WEKA 2PIDA 4DYDA 5JSZB 2R68A 4O6VA 3AVXA 2WHXA 2YNMA 1G8AA 1S2MA 1TK3A 3HMQA 4IJ5A 5EIEA 4ETIA 1L5ZA 2HIGA 2L82A 4HAYA 4S1WA 3OHPA 3LX4A 2ZE6A 4RD1A 5MDHA 1H23A 4R51A 1EJBA 1NJ6A 3WJ2A 5DT2A 2DR2A 3F7NA 1HL3A 3H9QA 1NN0A 5DCYA 1S8OA 1U5CA 1VLHA 2WD8A 3KPVA 1MUUA 1EGVB 4PBRA 1OFUX 2YJ6A 4KLCA 2AT1A 4RV9A 3KXPA 2X77A 4FFPA 4M1OA 1Q7GA 2IA5A 1ZM7A 2KQUA 2JH3A 3OZBA 4G0VA 4IJUA 1CY1A 4J94A 4MEJA 3GUZA 5JNLA 1QCYA 1WHTB 1XIVA 3VJLA 4CHGA 1AD2A 4WKGA 2R6AA 3P0IA 3KSBC 2WT9A 2NXWA 4UXHA 5JNWA 3H83A 5BT8A 2H7CA 3GXBA 4FGWA 4LMBA 4MUXA 4BJ3A 2GBIA 4S0ZA 1EYZA 1PV1A 3IIIA 5L53A 5CB8A 1JXAA 3BQ9A 1NVEA 3DZHA 5LYJA 2VFAA 4PCUA 3UW3A 1MPXA 3WE7A 4AKEA 4B4KA 4JT9A 4RGVA 4BB6A 3G82C 5JCZA 1AZSC 1FNNA 4G9GA 4LDZA 3DO8A 3E8MA 3QPBA 4E70A 3REGA 1UBHS 2DY1A 2H06A 2OFPA 4HPWA 3SX4A 3ZNOA 1OROA 1XN4A 3ESDA 3IBFA 2X1VA 2AG8A 4YJ3B 3SS9X 4B46A 2HLDD 3DXFA 1UBMS 3GRRA 3LT2A 1G5IA 4AUKA 3MUFA 4OQMA 2GWHA 4G41A 3MMPA 3HCBA 2IH2A 4OA8A 4PGHA 3NR2A 3WJ7A 3DVAB 1KFBB 3U3RA 1DQRA 4NFLA 4LYHA 2ZYHA 1JG6A 4Y1GA 5CFPA 2HGZA 4L8VA 4JV5B 4UREA 3EVAA 4YCJA 4DT1B 3OZDA 4CF5A 2JCYA 3DWFA 2O1EA 5JCJA 1ZM2A 2JRLA 3WWYA 2VQ6A 5LP6A 5CLQA 1Z6GA 2ZIUB 2Q29A 3JRWA 1JTEA 2PKYX 5EHXA 3OPNA 2CY0A 5GV7A 4JJ8A 4AS1A 4UXIA 2QW8A 5IBQA 4A8TA 4WY2A 1P1BA 2AOUB 1RI4A 1X42A 1GQFA 1T8SA 3C3DA 2UVPA 3ZDEA 5JXGA 4LVNA 3DONA 3K9QO 4NABA 5D84A 5LJLA 2Q3EA 3W2IA 4B3HA 2V7VA 3GPLA 1TLLA 2R66A 4FMCB 3HMKA 3FAKA 3COZA 2RFLA 3ZXSA 1N5RA 2P1RA 2IGBA 5A3RA 2QGZA 2IEDA 1Y6ZA 3WBJA 4XXHA 2DUJA 1XVVA 2WZCA 4RTMA 3EVTA 4UBKA 5AK0A 3K1AA 2BW0A 1JALA 4YMWA 5KAMA 4BTEA 3UK2A 4NIMA 3DD1A 1U2GC 2NZUG 3H16A 2O8DA 4PAOA 3A3NA 4ZICA 3M5PA 1RWNA 2D2IA 4LWZA 5KQSA 4JSRA 1T2CA 1UEJA 1FP1D 1Q6ZA 3GDFA 3JY6A 4ZQEA 4CQLA 1M6EX 3PT9A 5KJFA 3ER9A 3E9NA 3V9PA 3A1EA 3HFJA 3PPWA 1K7XB 5KTYA 3QFRA 2VDLB 1JV2B 4I4IA 4ALMA 4CEIA 2WYUA 2E4XA 1I7DA 4P3YA 1G8SA 1X3LA 4V1CA 2VAXA 1PIWA 1DWPA 3B1KA 3TQOA 4TT8A 4LFAB 3OF2A 1SUCA 2PRYA 2N47A 2OM6A 3EEIA 3RFXA 3H1GA 4RL6A 2AZTA 3GLFE 5F9HA 1DG3A 1SHJA 1ACLA 4KUHA 2HTFA 3UXHA 2JAHA 1E89A 1ZC4A 1N2CB 1TC1A 3HUDA 4FEEA 3WWEA 3DA8A 3GFQA 1AHIA 5AI8A 4RGQA 4ESHA 4TYNA 2V7WA 2WZQA 4IVRA 1YFZA 4J6EA 4QNNA 4BVLA 3PC8A 5FT9A 3IFSA 2CF6A 2HRRA 2A1UB 1J2TA 1D1TA 1OFTA 3BXEA 4V39A 4QOIA 2HUNA 3RNOA 5K4HA 2WR8A 2XZDA 2RH5A 1FSFA 3OZTA 3ED1A 5HRAA 2IHNA 3QNMA 3OETA 5FH9A 3V7YA 1UXGA 2QR3A 1IZ7A 2C03A 5IK2A 4BZXA 2WYHA 2SCUA 1FTWA 5BXYA 3GROA 6CHYA 4HMPA 4AO7A 4FXPA 4UQLA 4OD0A 3S99A 3CEAA 3KNZA 2OBBA 3K8YA 1BRTA 4RPLA 1QTQA 4YCLA 2WSYB 3NT4A 3OQ1A 1EVIA 2H5LA 2WMYA 3EAFA 4RVUA 3OHMA 1X1QA 4Z0NA 1TT5B 4Z1OA 4Y0VA 5JBNA 2Z5GA 1NOIA 1FXUA 2HADA 4YV2A 5BNTA 1G16A 4D0GA 3UB2A 4G0NA 4M76B 3HG7A 2JI4A 4IHQA 4BAGA 4MWEA 3I2JA 2WYOA 3O8OB 4H7PA 3EVEA 4CQMB 3FTDA 3HZRA 1RQLA 4DS3A 1YKGA 2FUEA 5DLDA 1EXDA 2DKFA 4XARA 1MNAA 1O5IA 1QC5B 2RGNC 3HZZA 2HQRA 4PYNA 3P8ZA 4D45A 1CQXA 1NRIA 1ZCFA 4KYVA 3T1VA 3UMFA 4IOMA 3U1BA 4V0NA 1ID8A 1VRWA 1LRLA 3ZDBA 3ZHQA 5AVSA 3RIGA 2HSZA 1YD7A 2XUKA 4FDVA 4ARCA 3HCWA 3PXXA 1J2JA 4BLSA 2EKPA 3UG7A 2VDNB 4BTLA 2EBFX 1DJMA 3KKEA 2WG2A 2BFAA 1QIMA 4L6IA 4I50B 1AE1A 1M2NA 2GBGA 4BKQA 2JIMA 5FPHA 5KX5A 4LK3A 1IOZA 4F1WA 4KZPA 1VHJA 3E3MA 2KE5A 3OO1A 1SVMA 1TUBA 2KX7A 1NY6A 3A2MA 2Y1WA 3JWJA 2WTBA 2FEKA 4KLZA 4LV5B 5CBPB 2P6RA 4HP8A 1OBCA 4LTMA 1QBKC 5AJHA 4D81A 4KR7A 4TXJA 2CHUA 2P6OA 4P82A 3GT4A 3NH9A 4ZAFA 2FWNA 3RT7A 1RQNA 4Q6WA 5D01A 1GDDA 4YP9A 3JSXA 3C6XA 5LB4A 1LDBA 1U1IA 1EP1B 1M83A 1YMUA 1JHPA 2W2TA 4FW8A 2BEWB 4KO4S 4TYMA 4UHEA 3ZIAD 4W7HA 1VPTA 4DLTA 2EIXA 5DFAA 1ZICA 1VBMA 4QUEA 1TKAA 3DS8A 1ZCJA 4PX2A 3P32A 3ZGVA 2HJRA 4J9VA 3ERCA 5IYZA 2FP3A 3FDFA 4BE7B 4O5AA 4NBLA 3QEAZ 1EJ6A 2WTEA 2XLBA 1ATZA 1KAEA 1NMSA 3MD0A 4EGJA 2IK8A 5BURA 3L4KA 4NNPA 3LRPA 5H5JA 3DLAA 1QLWA 1FDSA 4DILA 1ZGAA 4IDGA 1V9CA 3FSGA 4E7PA 3BFVA 1H2AS 2Q5OA 4M9QA 5AM0A 3W6NA 2NOAA 4HH3C 2KHZA 3FCUB 3JQFA 4MITA 3T5BA 1WAMA 4QOGA 4MMZB 4IRUB 5EIBC 5A06A 4PXAA 3NBFA 4EKEA 4LBVA 1T34A 1ISIA 3WLOA 5DX1A 5F7JA 1L6RA 1WY5A 5C9ZA 1WBJB 1ZQ9A 5EJIA 1RBZA 5T8KA 2IQIA 3ZY5A 1TL7C 1ODTC 3BTUA 1ZOPA 2DQSA 1NVAA 4YRSA 1YUNA 5IKXA 5F2NA 2I4TA 1W2HA 2QQGA 2X13A 4UM7A 1RD4A 2PV7A 3L3BA 2ACWA 2P5SA 4R2XA 4XWWA 2JARA 2YV5A 3CLRC 4EVRA 5CA1B 4GVXA 5BQFA 2BSQA 5AKZA 2N1MA 1LRKA 5J5VA 1ONPA 5IT5A 3LH5A 4JJ4A 4Q47A 1E2BA 1RWXA 1NPTO 4BE4A 5BQPA 4KR6A 2REBA 1Q11A 1OZ0A 1ZVMA 3CWCA 1MEOA 4TV9F 2CYBA 1Z8FA 4EY4A 3DEKA 3QFFA 2VG8A 5AUQA 1L5NA 2QAGA 2EFCB 1IPFA 3DXZA 3ND7A 3D1VA 4Z9BA 3JQGA 1KQNA 4MNTA 2I29A 2ECQA 1LK5A 4QDZA 1J9EA 4KOEC 2BMWA 3SZOA 1H0HA 1M34B 1JXOA 1N7JA 3K5PA 2X6TA 4FYIA 2COEA 3AI3A 4AT1A 1KY5A 3I01A 3OIVA 5CNJA 2J4DA 3AZPA 1NSTA 1QYWA 1M75A 1NN5A 3DF9A 4EYKA 2O8BB 1PUXA 1QVVA 3FUXA 3K6SA 1BSVA 2FQXA 3DMYA 4PS0A 4R0VA 2X8JB 4I5GA 1L7MA 2B94A 1XZBA 2OUKA 4TMXA 5DX0A 2L0XA 3GEEA 4LXXA 1RXIA 4MROA 4LJSA 5YASA 4BWFB 4RPJA 5LQKA 1VBFA 3WHPA 2WM2A 4KXVA 4NENB 3WMFA 1UJ6A 2ATCA 3TSZA 1CY0A 3O83A 1QAMA 2VH5R 3FVWA 2X6RA 5GM2A 1TKBA 4JI4B 1XZAA 3GPIA 4MSUA 3NAQA 2DT5A 1RZRD 3DE5X 1D0IA 1HH4A 1HSZA 2H54A 4L9AA 4G01B 4NS4A 4IH4A 3GLIA 2GN0A 1NR5A 4HH4A 1IAQA 1R6BX 4UDNA 5DNWA 2BONA 1C1DB 1TUGA 2QX4A 3N70A 1JHRA 1WNTA 2DQYA 2J30A 2XOKA 3AJRA 3CTMA 3TDNA 4HBGA 2OBNA 3ITKA 5A3VA 2JH9A 1OU0A 4J3JA 2JFFA 2F1HA 3KCQA 1PDOA 3ZUGA 4FZ3A 4C5AA 3EIHA 4DJEC 4G85A 4YAOA 4WZBE 4DM3A 3NBYC 2GN1A 1WF3A 5K3AA 3KD3A 2Q9CA 5AQ1A 1OIXA 1V43A 1LB1B 4HWOA 5C8DA 1WXXA 4B8WA 2WHEA 4PR3A 4E88A 4ZRDA 1NNLA 4BLUA 1Y33E 1OH7A 4ZEVA 1OLUB 2IYTA 2JH8A 2P79A 2PWAA 2V5UA 4YNBA 5B3JC 2WVAA 4BHTA 4GXQA 3TLZA 1KAGA 1WMDA 4PV7A 4WK6A 2ZJ3A 4FWBA 1LX7A 1LPNA 1E66A 1X9IA 4UQOA 4AQYB 4ZHSA 4BB0A 4RSGA 4HEA6 1E8NA 4X1OA 1WB9A 5DH9A 3VMFA 4BCDA 1AKVA 5A4AA 3VO9A 4F3RA 4RW0A 1SUAA 4S1VA 3NETA 3NEAA 3CUWA 4EHNA 2JKVA 3V4RA 1L3IA 1BA3A 2G1UA 3NP7A 3K30A 1A5AB 3JARB 4GSLA 4H0CA 2DCUA 3DUFA 4M1SA 5HKOA 1C30A 1OVGA 1QCZA 1FUEA 1Z8NA 3V2GA 4B6GA 5EIHA 1LGYA 4KXFB 1ZVKA 3C7AA 3KYCA 4NESA 4UBLA 1A97A 1XOIA 3PNQA 4CEJB 2AIRA 1Y8QA 4FLFA 4E5YA 5EFOA 2D1QA 2VOJA 3HYNA 4IDFA 3UAVA 3FMGA 4DWJA 5C5CA 5I7WA 1X1TA 1JFSA 2IQ5A 1H85A 2WD7B 2MWMA 5DGXA 2NTNA 3THSA 2GF2A 3TQSA 4N6OA 3TZEA 2Q3HA 3QF4A 2I8AA 4NCKA 1AO3A 3BXGA 4X6LA 1J5PA 1XN1A 3AIMA 1P7CA 1XMSA 2GR9A 1DARA 1D2RA 2PMCA 3HTXA 2PUWA 3EY9A 2W5UA 1IZ8A 2P3QA 4JHXA 1QPBA 3ANLA 3HP7A 1YIDA 3Q7RA 3KKPA 5JPIA 1H93A 4HQLA 2RGDA 2I2WA 4KWHA 3SZRA 3EVGA 3L7JA 1UM9B 3O2JA 5I8ZA 2EFDB 2FG7C 3OAAD 3NNNA 1H66A 4BNUA 2O7NA 2V6BA 3ENKA 4QGAA 5KPJA 1GLVA 2GD2A 3QQ5A 2BMVA 3IILA 4B3RB 1US8B 1RWBA 2AN3A 3E3LA 1H3EA 5JSYA 4IJVA 1C4KA 1JZQA 5AK4A 3IIJA 2HJ9A 4BIIA 2P6PA 3DKRA 2YZNA 3QPVA 3ZLTA 4ZMBA 4XCQA 1G1MA 1UBUS 3JVIA 4ZO4A 1GN9A 4EHDA 1UJCA 3QZUA 4LYAA 1P4AA 3SQNA 4M8KA 1L5VA 4NULA 3OT1B 3WXMA 4ZT7A 1QGUB 1L4GA 1LDEA 1JHQA 1QDLB 3RU2A 1CS4C 5KMGA 1JLKA 4DPKA 5KWJA 1TJ5A 2MINA 4G0ZA 4JBNA 2BFFB 4CR8A 1ISHA 1FSPA 4P6VF 2JLRA 3F7OA 1PS8A 4TWBA 3ZHTA 3GLUA 3R5XA 3KXDA 4KMRA 1VG1A 4HVCA 4IV8A 1YR3A 5AESA 2Q5HA 2R00A 1TAHA 3Q4GA 5FTNA 2ZIAA 3UHJA 2D6FA 2IW3A 4HUJA 1BDMA 5LMCA 3TRKA 1O94C 3X2EA 1GP2A 4XEUA 4G07A 1CZRA 1C9EA 1MO6A 3EBOA 1LDNA 2I3AA 3U9TA 5MGBA 4JH0A 4IVNA 1Z4OA 4RDCA 5CGZA 1LSJA 1RYYA 3ZD9A 2VUUA 5JNTA 5I4KA 3DGEC 4FE3A 1HE1C 1GAWA 4NE9A 4KXWA 5I7UA 3HUFA 2IIBA 2PSJA 4HAUA 3D6HA 3COYA 3Q0TA 4QUKA 4Y7CA 4JT8A 1PDWA 3ZV7A 3ABIA 4DMFA 4PIMA 1A7UA 1C3EA 5BSGA 2HLNA 2FFJA 1GN8A 3OJ0A 2PTGA 3AR4A 3NO4A 1NNSA 1TVEA 1X1DA 1G7TA 1PJZA 4HNVA 1ORHA 4XGNA 5ECWA 3SU8A 4GP6A 4QXRA 1GG8A 1L2TA 4HNTA 4DWOA 3DLCA 3HCEA 2NU6B 3HB4X 3DBHA 1FX0B 1T3GA 1EBBA 3NIGB 3GLKA 2IS2A 2R25B 5REQB 1NMZA 3GRFA 1ZDMA 4CIXA 2PUJA 2WIJA 4BO6A 4FVTA 3CVWA 5K0JA 1CS0B 5E38A 4DKJA 4IQFA 1TYCA 4RFSB 4XCVA 4IDCA 1R0KA 3ETEA 4KWIA 2PDAA 3PL5A 4MPPA 4MVJA 4ZXPA 5LQJA 3FNQA 3ANNA 1Z2PX 5IEBA 1VL8A 1SCQA 1UBNA 4BDSA 3O93A 1L5SA 2XDQA 3DAGA 3F8WA 4LJ6A 4U5XA 4TS9A 4BMNA 4DUGD 3VKFA 1Q0HA 1QYXA 1W75A 2R751 3ACCA 4EPRA 5E2IA 1PZMA 1E77A 1BMFD 4NL4H 4TS1A 3TZLA 1XR3A 1YS2X 3A10A 2QSUA 5HKKD 4D44A 1FTSA 2QU8A 3G0GA 3HACA 1VB5A 4I55B 3IAHA 1F2DA 4OQ4A 4Q1AA 5F51A 4MUFA 5HYVA 4KE6A 3UXEA 1P61B 3R8CA 3EDMA 1YNSA 3GLIE 5ILQA 1EFVA 3HFRA 3AYZB 1ECBA 3ONNA 3DLBA 4QQRA 2QV7A 2ZUDA 2R8XA 3D6FA 3FRJA 3JQEA 3LQYA 1ES9A 1JIXA 1SVSA 1XU7A 3PFGA 3R7DA 2D0OB 5C80A 4OVKA 2NYUA 1TMOA 2W42A 4EKNB 2QM3A 4YI3A 3SS8A 3LBNA 3ZGXA 1AURA 3DT8A 5LYJF 1SBHA 3MELA 5TARA 5EMLA 5A1JA 1ZUWA 4TM8A 3G1TA 1U0FA 621PA 4WACA 2XUOA 4MI1A 1Y9EA 5HKLA 1ST3A 1MMFB 1VFPA 1YU9A 2V7GA 2CFCA 4A6XA 1CF9A 3USCS 1ZIXA 3G8DA 1Z18A 4MA4A 3VVBA 1JF8A 4RGBA 1USKA 1NXSA 3HKBB 2JDID 3TPFA 5JATA 3JQ6A 3QOFA 3RAGA 2JLCA 5T4BA 5DN6D 3LBAA 2ZDGA 4WGGA 4A73A 2Q2WA 1HDGO 4JUDX 1PJRA 1QS0A 3EPLA 4LTDA 4FGLA 1TYZA 3JVEA 2KBEA 2Z0MA 3M3DA 3WMGA 3PCTA 3E61A 4QVGA 3RT1A 3UENA 3WIDA 3HYSA 1I1HA 5AJUA 2O1XA 3AR9A 2DPMA 5AVUA 5K4GA 5LP6F 1TTPB 3QFSA 4WDRA 1FVOA 3DMRA 5B5SA 1IB0A 1VIMA 2H4YA 4GQAA 1V8FA 2CCKA 4KFSA 5KI6A 3ZE1B 1UMBB 4XQCA 5DI3A 1UBJS 1VCNA 4CIYA 3SBOA 2V58A 3BMQA 3OIGA 3QVWA 4O4IA 3WOVA 3DTTA 3O8QB 3AHJA 2UXCB 5D6OA 3IO5A 4QC2A 2OFWA 4HQRA 2I6UA 1BQEA 2GTPA 3T1NA 5F4ZA 3S1AB 3GFTA 1RI1A 2IHYA 1W85A 4X85A 5DCLA 2VEDA 5L7WA 3UGJA 1PE0A 3G6WA 5KNBD 2A2ZA 3LKZA 2YHBA 1Z4JA 2DYKA 4W6QA 1EE1A 2R0QC 4QG7A 4EENA 4P8RA 4CCWA 5KTKA 4YCNA 5K3CA 1ZJWA 1GQSA 3KV1A 1EHCA 1U2TA 2NVWA 2AG6A 2A94A 2BBSA 3ILYA 2GKSA 1YVDA 4H7EA 3QKTA 1J1IA 3ELWA 2ZBQA 4EY7A 3GQBB 3SF8A 2QTBA 5D5HA 2C8LA 4R1TA 5BSMA 1TRKA 3KZKA 3ND8A 3ZTWA 5CB4A 1ISPA 2P3LA 4I5EA 1H1LA 2XNHA 1FPQA 1COWD 1J0DA 2BGLA 2IP4A 3PPYA 4R69A 5FV7A 4TSFD 1QHNA 1FVHA 3NRCA 2VPXA 3V97A 3D31A 3WZLA 4H7JA 3RS2A 4F8YA 3E2IA 1J2YA 4JVSB 1SEPA 3UICA 2R6JA 1NUHA 2C61A 2ODWA 2GTIA 4QXOA 2HQBA 1OXUA 4I1VA 1G8PA 1BDJA 2C2WA 2C7VA 2QXTA 1SUPA 4CMBA 3NM5A 4Y6LA 1PD0A 1GFZA 2OORA 3LO8A 3RF6A 2QVXX 1NYQA 4HGZA 3QEBZ 1PR1A 3EXEB 3WLEA 1PX0A 2O1SA 3V3TA 4M9ZA 5FLKA 2R3SA 3DDHA 4XGKA 2HBQA 4QBKA 2BDTA 1NLUA 5BW8A 1XEWY 5B57C 1TC2A 5AH0A 3BG5A 4FGZA 4ARZB 3F5MA 1Z15A 1KEZA 5EIFA 4RFVA 4B2IA 1VI5A 3NANA 3ZI7A 1ST2A 2H1FA 1T0UA 4N9WA 3T0GA 3ROGA 4UTRA 2HV9A 3RUEA 5EJ5A 1CRPA 4N0PA 4CTOA 1IMOA 3FWYA 1F3OA 4XWOA 4G5SA 5HWSA 1N8NA 1ECLA 5HFAA 5BYJA 2RG7A 3LXMA 3KCNA 4Y0NA 4Z51A 4ZT3A 3TS1A 2JJ2D 3LTEA 3JWGA 3QTTA 2PH7A 2EQBA 1XDWA 1V5WA 3AY3A 5DBOA 4D0LB 4DR4B 5J2UA 3LVRE 3DHNA 3GN2A 4XYLA 4Z6KA 2I2CA 1GIAA 3IR5A 4REQB 4EARA 3MBOA 3Q9SA 5DYIA 2GPAA 2CT8A 4GNKA 3ZD6A 3IEPA 3RODA 1PGNA 3WBBA 3ZGZA 3R2JA 1FQOA 4F3NA 1PR6A 2X8AA 3CV3A 4B6EA 1I0IA 1S02A 3E0XA 5IDQA 1II8A 2FSIA 1X8JA 4ASUA 5KSZA 2RK6A 2V7PA 5KX5F 4LMAA 3K9HA 2CK3D 3JW8A 4EWLA 2WHPA 1GV1A 3G49A 3U4HA 3FLMA 4K9RA 4H4DA 2OQRA 1P74A 3H8SA 2FXVA 4G5QA 4PRLA 4ZOLA 4B8ZA 4YJGB 4YAKA 1EXWA 3F49S 2ZRIA 4AKTA 2VDWB 2B30A 2X76A 3TD2A 3U56A 3G5AA 1FP7A 3IUSA 1XTPA 1PHPA 3MLEA 4GR9A 4INPA 1G7CA 5JXIA 1ZNYA 4W9MC 1ZOOA 2E49A 4K05A 3S28A 3JQ8B 1XAHA 3DW1X 3UOWA 2HREA 4A0QA 2PKXA 3N07A 4OMDA 4CF7A 1N2ZA 1PVDA 1EM6A 3R7WB 1IZZA 3DBRA 3WRYA 1NIJA 3NDRA 3P9SA 1G5QA 1E7MA 1B0PA 5MN6A 4IVQA 4CQNA 3HM9A 4MQUA 1OILA 3SXUA 1GZDA 4BO2A 5IYZF 4YALA 1DUVG 1WWKA 1XMQB 1ZR2A 1G66A 5BUSA 2DQ4A 2EATA 1VKHA 4N3GA 1JYFA 5FHRA 4OHYA 4JELA 1KS9A 1R5BA 1YCDA 4O4LB 2UYHA 2OXEA 1TYAE 4PC1A 4G1BA 2ZRBA 2GN4A 5CIQA 4OHXA 4Q9IA 4NF2A 5FLYA 1A9SA 2OOKA 2CEKA 1W36B 3A4TA 3HDJA 3OECA 1ORWA 4ILKA 3ITEA 3CKLA 2G5GX 1IB6A 4GX0A 3E7XA 4IJQA 5J47A 3KWLA 4OQZA 4ZVLA 2EHDA 3BMCA 2XQVA 1RAIA 4RKEA 1JEAA 3A2NA 4J3FA 2Z1DA 2ZVQX 4WKBA 1TU0A 3HVRA 1D2NA 1QZXA 4JOSA 2VT2A 4A2WA 2QDXA 3ETLA 4GI3A 5EWLA 4C05A 2CHFA 3HEAA 4PGMA 4QQ8A 2B7BA 4WK2B 2XQFA 4BVKA 2CLLB 2ZRQA 1PZFA 4RJLA 2CVHA 3EZXA 4FSHA 3HJTA 5DNUA 2ZUCA 4G1VA 4RLSA 4UEWA 3ORQA 2ASVA 2BDUA 3U3KA 1ADFA 4HDMB 4WDQA 2C4HA 3IR7A 3W05A 1BCSB 1NF9A 3ZDQA 4ZD6A 2YCBA 1PFWA 4ZJZA 2XTJA 1U0NA 3VAYA 1GUBA 1EX9A 3ESAA 3V8PA 1R6XA 5K0BA 1WQ4A 4CMIB 1WM1A 2R5NA 4YCBA 2E21A 5B7NA 3IHKA 1DV1A 3CRW1 3ZWQA 3ZWAA 5KKNB 2O0HA 2QM8A 4KQXA 7REQA 3AFNA 2PMDA 2QENA 5AHWA 4P0QB 2HK7A 1DTSA 4LJ9A 1KETA 4JT4A 3COWA 3RFUA 4C0WA 2WQ7A 3IAS6 3CHYA 1BXGA 3MB5A 3OURA 4IIGA 3IMEA 4MB0A 1U3UA 3SKXA 2IUUA 5JCXA 3AB3A 1KSJA 4B83A 2HJHA 2NZYA 2YW9A 3TNJA 4DCTA 1K8XB 2FNAA 3EC7A 3K0AB 4DXHA 2FGJA 1FDWA 1N6HA 3PUZA 3QMVA 4FWIB 4IVPA 5B6IA 1XT6A 1XFAA 1GZ7A 3EGIA 4R1NA 4NXNB 1WY7A 1KYQA 5DGHA 4ZIRA 2BF4A 3G2OA 4WZ6A 3OJFA 4AS3A 2QD4A 4WZAB 4G9EA 2UU9B 3NCHA 1TO6A 5AKGA 1GNRA 4N0DA 1HURA 1I13A 2B4KA 2K6GA 3PDCA 4MVJG 4MW5A 5F21A 4E11A 1U3TA 1WVMA 4KIUA 2F8LA 2W58A 3HO8A 4G37A 2CE2X 4GGPA 4DGQA 3T9EA 4F06A 1HE4A 4TUYA 1R10A 1YQDA 4DEYA 1L4MA 3ZH9B 5DPMA 4P92A 4JP3A 3RQSA 1VXOA 2XGSA 3IQXA 4IXDA 3UK0A 3ZG6A 2GXQA 2BTQB 2DG2A 2GSWA 5HR5A 2VTBA 1JTFA 3ZJ4A 2GRAA 1A2BA 4K6GA 3ZU4A 4DJ5X 4OFXA 3ADBA 3HGQA 3U3JA 4FFVA 2VN8A 3P20A 3NOXA 1FQWA 1DO0A 5FI0B 4OI2A 3JAKB 5C4IA 3QVSA 3DL7A 4HTAA 1CQJB 4ZWNA 1L7OA 4I81A 3KLBA 2GAAA 1Q1AA 3DPUA 3KQPA 5KEIA 4BPRA 4LRSB 3NT2A 1J5EB 3HR4A 3V8NA 3RFCA 2X5JO 2V5AA 2O8CB 1XXHB 2CZGA 1Q0UA 2E6KA 2YQ5A 1SXJA 3IS3A 3R77A 4QBTA 4M2LA 4Z8YA 3TE6A 1E7YA 2QN2A 1H2BA 2UZ3A 4B82A 3HNOA 4C08A 3IB6A 3FZQA 3RIEA 3ZHYA 3RAPR 3IEMA 1GQRA 3FDXA 3FWZA 5JLJA 2MSLA 3UFXA 5CFNA 3D7KA 4JZKA 4KQEA 3LY5A 3O4JA 4CV3A 2ZAOA 1LC0A 1SFRA 1OIWA 4FK8A 3BDIA 4PINA 4Q34A 2YUTA 3JV7A 4PG4A 3AWIA 1LLDA 4Q1DA 4L3VA 4X1IB 1KDZA 3A4VA 2DF8A 2HD4A 3PA6A 3ZW9A 1B2RA 5LXTA 2XUFA 3RYHA 1NDUA 2ZM5A 2LDXA 4IGIA 2MMGA 4IH1A 1NVVQ 1U2EA 3BFXA 3WFJA 4C9BA 4ZHQB 1ZH4A 1NR7A 1U5BA 5H8WA 5I48A 3RWBA 1THGA 2ZS7A 2D1SA 4XI9A 2FPSA 3GA7A 1G59A 2PQ2A 5HS4A 3BMNA 1C4WA 2YV1A 3OCWA 4ZQBA 2AD5A 2JNWA 3N8DA 4ND6A 3GLFA 4KGDA 3QEKA 4FDMA 2WIAA 4FN5A 3M4NA 4NU5A 3O26A 3NHRA 4LECA 4OQYA 3KWJA 5IF9A 1M10A 2ECKA 3THYB 5FRDA 4B3MB 1VBNA 2CJFA 3Q3CA 4U3JB 4BTVA 1A1SA 4WX2B 3HY6A 4KPUA 2NT3A 2QWXA 2VNJA 4KSYA 3CH4B 3W6UA 3WLFA 5C8XA 2DE0X 1CK4A 1M54A 3GUUA 5EE9A 3TIGA 2QZPA 5HEKA 3UAOA 3RVNA 3A05A 3KB8A 4EYOA 1XDZA 3TR5A 3QLTA 1TZ2A 1X77A 1KOJA 4XR4A 1NA5A 1Y3CE 1RRKA 2OT3B 5ADVA 1EZ1A 2ORWA 4Y0AA 2BFEB 3I2YX 3BGWA 1MDFA 2BR3A 2EFYA 4Q3LA 2PMEA 1AHNA 5ALFA 3UGTA 3D5QA 3UKJA 1NASA 5F1KA 3DWEX 5HGXA 3JRNA 3PJGA 4B09A 1XHLA 3R7LA 1UMCB 1P4HA 2YV4A 3PYLA 1KVRA 1Y98A 5B1SA 1NE2A 5KOJB 1M1ZA 3AR5A 2PWZA 4D8TA 1HZJA 2Q5FA 3S2YA 3Q2IA 3UV3A 3X43A 3IODA 4NJEA 5MN4A 4R6WA 2WB2A 1YBFA 5JBIA 3W04A 1PV2A 4CUZA 5JH7F 1U8AA 4O1IA 4MUBA 4DR5B 3PUIA 3M6IA 4GR5A 1DKNA 1KRWA 1CZUA 1M1YE 2FPLA 3L5OA 3PC3A 4QSMA 5JY6A 3KUDA 1HLFA 2J6HA 1T4GA 1W44A 4YR7A 2ICAA 2OD2A 1VJ0A 3N28A 5JNVA 1U2SA 2CXNA 2PH3A 3RRFA 5FYQA 2ZSEA 3MJDA 4UBJA 1W35A 1H8HD 2B1QA 2CCGA 1BO6A 1TPYA 4WUTA 2CFIA 3WLPA 2J6BA 2A1TR 3FOBA 1AY0A 3SNHA 1PUJA 4XQ0A 5HJEA 3ZU6A 5DW0A 1P2GA 2ODTX 1T43A 4FFMA 4BZQA 3PHBE 1JXMA 5KTMA 1PK8A 2CNKA 3NT5A 2H5EA 4UMVA 5A3QA 3A1FA 1HDIA 1OXXK 4XDGA 3DLPX 2HF7A 4GPBA 4BNJA 2AEJA 2ILTA 2VRNA 2QUBA 1QK3A 2IYAA 2XF8A 4MGKR 1X1EA 4N7BA 4Q4JA 3DQQA 5K2MA 1E0AA 1ORRA 5I4BA 2J33A 1O9HA 1U28C 6AT1A 5IDVA 2WIDA 1XNJA 2QVYX 4GWGA 1OTXA 1XMPA 2H11A 2J0VA 3H0CA 1RYFA 2OCBA 4HPXB 2AB0A 4EZIA 5IVPA 2JJQA 4Y8VA 2EW2A 1OJ7A 5DWQA 1D7OA 3TAHA 1DLJA 5H4GA 1H5NA 3JQDA 2EW1A 1I10A 5BNZA 2CBGA 5E9JA 2R2AA 4Q3NA 1PT9A 4RNCA 4DCGA 3E84A 3OQ6A 3NOVA 3F7TA 4MVJF 5CDFA 2W6ID 2WJZB 5KQMA 4YRRA 3RSLA 4WBXC 4RA9A 4BO1A 4MJ3A 5GMOA 1XD2B 3SC3A 2QMZA 1R4MA 2PN1A 3HDYA 1AUPA 4EJ6A 1RIFA 1UPBA 3SOPA 5BYAA 1UXKA 2QVZX 2VNKA 1JB9A 1MR3F 4K3VA 4Q3KA 1ZKMA 4JB0A 2IDMA 4DV1B 4IW3B 1XU9A 2AMJA 4XTCS 3DMDA 1X86B 2HJGA 3WNQA 4LWQA 3L0OA 3U7QB 4X24A 5EGSA 4C4SA 4ZVTA 1EZ4A 3F2VA 5TY0A 1E79A 1B8NA 1DFIA 1UC4B 2BSAA 4MGHA 5CDFE 4EY5A 3EGCA 5BRAA 5JC8A 2WAYA 3UH1A 3W1VA 3SQLA 5K0FA 1M6VA 3NALA 1QR2A 3L9XA 4ID3A 4OP1A 2KI5A 5EZ6B 2JFWA 1FJHA 4LY3A 2YKGA 1Z7YA 5DBEX 4PRYA 4GXRA 4TX1A 4PNZA 5ARCA 4ZEOA 3W8NA 4ZI7A 1ICIA 1YGYA 4Z1MA 4G0WA 1UJ5A 3DDOA 3LX5A 2BKVA 4FYHA 1CVIA 2FDRA 4BXOB 4C7OB 3HV0A 5KVAA 3QKIA 5JCOA 4OJNA 2WTXA 3JTMA 5AIAA 3Q7TA 3TZKA 1QU3A 2RSLA 4KR3A 1JU3A 3ILHA 4X64B 1V45E 3NHLA 3VNQA 2OQIA 1PJ2A 4H35A 4XIYA 4M99A 1KAQA 5AKJA 4UMFA 5T64A 1ZX1A 4WADA 3UCFA 4LRWA 3TXXA 5AVOA 5TQ2A 4FPXA 5K51A 2CMKA 4DADA 3MBKA 1FDVA 3R6DA 4OHPA 3Q7IA 2O6LA 5I9NA 5JXWA 4ND8A 2K87A 2VZ9A 5TRTA 3H84A 4DA9A 1WCV1 2B92A 3PUVA 4WXPA 3SSAA 3TF5A 1CJMA 3FDJA 4J7AA 5AVWA 1QK4A 1WPQA 3NJ8A 3LLSA 4NTZA 4MKFA 4Y9UA 2H63A 2BKUA 5L45A 5EJAA 1LF0A 2W6OA 3I9FA 4NAHA 3PFKA 4AQ7A 1O5OA 3B8HA 1L7RA 3IYLW 4DIUA 1QRTA 4YASA 2X0NA 4Q24A 3PUKA 2IRWA 2ZJZA 5F4BA 3HKCB 3OOHA 2ORVA 3V4ZA 4K7JA 1N8KA 5B4UA 4J4HA 4KLRA 1ORIA 1Y1QA 1B43A 1HDXA 2EF0A 2O20A 2RHCA 1OI3A 3GVHA 4QEDA 2IZ5A 3DUWA 3OIFA 3D3QA 4MUGA 4LRQA 4ZXFA 1RWWA 2C9MA 4BKUA 1RWMA 3AR3A 3CPSA 5CXUA 3SC2A 3VR4A 2PGDA 4JLPA 4OM7A 2RIPA 4DCUA 3RJMA 1K6IA 4OHBA 1DRJA 1EA7A 1UBLS 1J4AA 1J0AA 1YNOA 2GJ4A 3BQMB 3JSAA 3L7OA 3O47A 3P1JA 4EEKA 5JD4A 1TO1E 2GN6A 3U48A 4ENWA 1DCKA 2Y2VA 3AF1A 4TSKA 5FBQB 5K01A 3L8ZA 2OM2A 3PRHA 2E7ZA 5ALDA 2ZSDA 4L4UA 3TLKA 1YZHA 2O2GA 5FNVA 5KVQA 4NCNA 3QY9A 3GEHA 3WAJA 3D7LA 2IY7A 4KHZA 1QYRA 3MGAA 3VI3B 3WA6A 3LUJA 4KL8S 1LBIA 1OFIA 2JCVA 1UDXA 2ID8A 4GPAA 3G9XA 3ZBUA 4C7BA 1Q0RA 4CGYA 3GFRA 1MRNA 1S4QA 3DG9A 3FF1A 4BLOA 4DTCA 3V00A 4LOJA 3M1IA 4K9LA 4BV3A 1RJGA 4D9KA 4YK7A 4A4DA 1ZN8A 3L43A 1J1ZA 1OGIA 1ULZA 1YOVA 2AXNA 2OGSA 1TVMA 4RDIA 3UMMA 3HDVA 2HMYB 4RA6A 2BM1A 4Q01A 5KJEA 3FE2A 4HFNA 1SZDA 3IP1A 3G79A 5IVKA 3WV4A 2H1HA 1BWRA 2F90A 1ZGBA 4Q12A 3TDKA 1CYEA 1AQYA 4PAMA 2WJ6A 3ZW8A 2A92A 1TVCA 1ZMRA 1UQUA 2V7XA 2FXIA 3PWTA 3RNLA 4MW7A 4B0PA 2DKOA 1FP4A 3OLXA 4GIBA 2CD9A 5HNKA 5TJHA 2Q28A 4IDPA 2YMMA 1XQYA 3DJYA 2NZ8A 4UM8B 2QL5A 3EEQA 2PFSA 1JFFB 2NVUB 3T3HA 1RMTA 1VJDA 4NPCA 3A6HA 3BT7A 2HQOA 5JD3A 4FW9A 4IOLA 1GUAA 2AMLA 2IHJA 5DKFA 3QLEA 4BMVA 4O5OA 1GU1A 4W5QA 2WQZA 5KTSA 4KK3A 5EP2A 2XBMA 3BOSA 2AKYA 3DMHA 3GAAA 5I7RA 3DZ8A 3RT9A 1H2ZA 1EX6A 4U7JA 2B4YA 4UTXA 4J8PA 4LY6A 3ZE8A 1CQPA 4D46A 2IS6A 3FOCA 2QTVB 3FCEA 2WP8J 5EHIA 2H4FA 4BO7A 3DOUA 3ML1A 4BV8A 4C4ZA 1UXOA 1TK9A 3BL5A 1KF0A 1FXWA 4GRAA 2P78A 2Y9PB 2GBLA 4R68A 1XCBA 2YWJA 3B52X 4QECA 2Y6VA 5ESRA 1NW6A 5AM3A 1WW8A 1Y0BA 5LNK6 1U98A 2A4KA 2WIBA 4RESA 4ZOLF 5DLQC 2PGXA 3PR3A 5AI5A 4L50A 4G23A 4JBIA 4PYRA 4XVHA 5SZKB 3A9RA 1E1QA 5CFLA 5FWXB 1XV5A 3O9ZA 2A57A 3VPBA 6YASA 3K94A 3OKFA 5IBRA 1JIVA 4UTOA 1G2IA 4WL0A 2TSYB 4HDSA 4FE7A 5DMHA 5EP1A 4BZPA 1ISJA 5EKXA 2WSSD 4NZOA 3CZ4A 1NBHA 4GPEA 4NYMR 1AUVA 1IEXA 1WW3A 2C2OA 1TOAA 4L07A 3C7DB 4O4JB 1PK7A 3A6KA 1N5JA 2GPTA 4EQ6B 5IC4A 2JGIA 2RK3A 3OEYA 7YASA 5AOAA 1YR1A 4EYQA 2HHJA 3CVXA 4MDFA 5BV8A 5K3OA 1DP4A 2JAXA 2G04A 2V7EA 2VVTA 2GGSA 2BE9A 3QVUA 2JAPA 4ND5A 2PL1A 4XPIB 5G53C 1VLMA 2FEMA 2JGNA 1SKUA 3EIQA 3WHLA 4CKYA 3QG5A 1W88A 2GEFA 3ASZA 5K0ZA 1L4KA 2F4NA 4AJLA 3MUNA 4XX1A 3CB2A 4A23A 4YAIA 2VUIB 3CX3A 4OHZA 2IODA 1VKNA 4JD5A 4CG1A 4XEHA 4RKQA 3K9BA 1VPDA 4MULA 2PKRA 3BGOS 2B69A 1RLMA 1OFUA 2JEYA 3CW8X 3Q3EA 1WXFA 1N92A 4ICIA 5CLLA 5EP4A 3A36A 5AVRA 5AW0A 2IL1A 4E32A 2O2ZA 1KO8A 3ILSA 1E1RD 1LSSA 2VH2A 5CVCA 3B6EA 4UVEA 1QAQA 5AW2A 1PWHA 2ZJ2A 5JSQA 1WETA 1MC5A 1OD6A 5CM2Z 5TVGA 4FJ2A 4R54A 3EDRA 2WA1A 4L0QA 1MC4A 4D3ZA 1IPEA 3AMVA 1SUSA 3R0QA 1G21E 3GJTA 5NLLA 2GD0A 3QJ5A 1XYGA 2JFOA 3OKPA 4C76A 3IDSA 4PTZA 2LUOA 4WCFB 5JOQA 5I9IA 5ALTA 1UFOA 1XMVA 3Q12A 3SNKA 4YRIA 4OO3A 2HNAA 1MC8A 4FOOA 2Z95A 1A4RA 4PQEA 2GPYA 3QYFA 3STUA 3SDZA 4WBNF 1U8TA 1HZZC 2PX0A 1XK7A 2IXEA 3PFFA 4FSXA 1GEGA 1Z29A 4XLZA 4E13A 4BFYA 1Z5UA 5HSGA 4LXTA 2Q9BA 2WF8A 2FW1A 5TDHA 1EBUA 1WXIA 3VR3A 1YI8A 1JBKA 1Y6FA 3HCRA 3RYIA 1SD2A 5EC8A 1ZH0A 3RJTA 1VL2A 5KYYB 3EZ7A 4N54A 2AJDA 2C5HA 4G1UC 5JAZA 4AZSA 4YRTA 3JRXA 3PC8C 1T9KA 3ZY2A 4OATA 1RRVA 3QW4B 2AG1A 3R09A 1U9ZA 2OCGA 1T1SA 4D26A 3ABSB 3BULA 4MUNA 5CVDA 3EWNA 3WP0A 2CZQA 5CX1B 5LKAA 4WFQA 3JPWA 2R7NA 2BCEA 2BISA 4DMKA 3H9UA 3KDPA 4RVHA 1GA4A 4EGQA 5A0TA 2J67A 4NC9A 3NC4A 1XJ0A 2BJVA 1YZNA 5ECDA 4BQEA 4E5PA 4Z7QB 3UEOA 3N3BC 3ISJA 4UHBA 3OZSA 1K86A 3VISA 1GPH1 2O48X 4OLHA 5KTTA 2OUIA 5ALIA 2WPDA 2BM0A 3T1YB 1IQUA 1L7AA 2AFIE 4TUYF 1RTTA 1X0XA 1G41A 3WRWA 3RTEA 2ZRMA 5IUJC 4L5BA 3T3MB 4ZYLA 4IDBA 4IJMA 2VNIA 3B3GA 4TS3A 4AP6A 1TKRA 1F17A 3U3XA 5GOZA 4ETMA 2X9QA 1ZUIA 1JQBA 2AYXA 2H2WA 1JIJA 3I72A 4RZIA 3FLEA 4NOJA 1IXSB 1D6MA 4RCYA 5ICCA 3G3EA 2FHSA 3WHIA 1BIFA 1DC3A 4B31A 1JDSA 1EEXB 5JSHA 5DK4A 2AK3A 3D4NA 1WBBA 2FMHA 2W37A 3PP8A 3T9FA 2BT4A 5A4DA 2E82A 3DFMA 4KAAA 1LPOA 2DLNA 2FYTA 2ES4A 5LQSA 4K88A 4CKEA 3QE2A 4EI2A 1HI9A 2Y3IA 4I14A 1DXQA 3B78A 5FWDA 4XB6B 1ML3A 4NOKA 4FMDB 3X44A 1YACA 1P1KA 1RYNA 2FOIA 1JVSA 1N4DA 3CEMA 3KOZA 4WJZA 2WFZA 5DHPA 3PNSA 1BHSA 1DKLA 3LHKA 4OAPA 4QFBA 4URUR 4TKVA 3E3NA 1FRQA 4JT2A 3SJ7A 1R4NA 3AFIA 1RTKA 3KB2A 3LW8A 3ZWMA 3HSSA 1KXZA 4B3GA 4YH1A 1JL3A 4ZHQF 2D0PB 4YJ2B 3LFTA 2QNRA 3QG1A 3H99A 4XWTA 5DXFA 3FNRA 1FMJA 4CM4B 5FV4A 1T36A 4P4SB 4GM1A 3VR2D 3PGJA 3TEJA 1ZUHA 3SICE 1BKYA 4QDJA 5LXTF 4LF5B 4C0JA 4LJ7A 1G9TA 3ODGA 2Q0XA 3G59A 1R18A 3H04A 2VYQA 4LC0A 4TQ9A 4HMOA 3AQIA 4FHGA 4ZK2A 2OAQ1 3EZNA 3M1YA 2BFOA 5JIBA 4KC0A 2CL5A 2W6PA 1QF9A 3H9JA 4V0MA 1DT5A 4JQOA 1M2FA 3EXG2 1WXQA 4X44A 3NONA 1YQWA 1ZUNA 1VPEA 4YHHB 1R8JA 3HB9A 2H2HA 1E1CB 2DJIA 1GLNA 1HOTA 3P97A 3AFHA 2IV7A 3I37X 5FTMA 3JVDA 2CXXA 5JI2E 3SLGA 2H7VA 3JQFC 3Q72A 4P31A 2GXSA 4QU5A 3RVJA 3ZJUA 1EE2A 3CNEA 3I0MA 4R81A 3TD9A 3COJA 3RCBA 2DBRA 4IDEA 3PXGA 5C5EA 2IYFA 4HN2A 3CE9A 4ZCIA 2AXPA 5T8KC 1PU2A 2F9FA 1A8HA 1HLDA 1V7QA 4PWYA 5HIIA 4DHWA 4XB2A 1KYXA 1OC4A 1JG4A 1E2DA 1T5LA 2PQMA 4OH7A 3SQWA 3HCDA 1Z0DA 2CLIB 3D0OA 4JJ7A 3KELA 4XDYA 5EQTA 1B8OA 1KQPA 3AL3A 1G8MA 3ZZ1A 4B2YA 2QTWB 3HDTA 1H1TA 4JLAA 5L51A 1GFWA 3FH0A 4L4ZA 1GZHB 1I6WA 3IE2A 2GHQA 1QVWA 4JLWA 2FN4A 2GYUA 2OCLA 3EK2A 3VOSA 1VIYA 4DCOA 5AW3A 3GDGA 2AC4A 3HXKA 4P32A 3SLKA 2W6QA 4ISBA 1XRJA 1ZOSA 1EHYA 2WMDA 1R0CA 1R12A 3VPGA 3AP2A 1KBOA 3PV0A 4MI3A 1JQ3A 1HV8A 2PJZA 2HL6A 2N42A 3SIRA 1UKCA 2HCFA 1X7XA 1E6LA 2BZSA 1VA4A 4L16A 3X1JA 3WYFA 5H70A 2HHCA 3LBYA 2PFKA 3UJDA 4HZIA 3D59A 1QRRA 2XF2A 4MW1A 2HA5A 2DUWA 3AETB 5CJ2A 1XZIA 4C07A 1XQ1A 3NMUF 3MYRA 3QV1A 1CWUA 3T8YA 3EWAA 4YO8A 4ZZIA 3ZEAA 5H9WA 5T4FA 1QXSA 5EHQA 3BGVA 1JFVA 5B3KA 3BA6A 3IRVA 2AN5A 4K2AA 4ZC1A 3I6MA 4FYYA 4BQOA 2EP8A 2ZXEA 5DJ5A 3SQMA 5AJXA 4CKBA 3GFBA 1M7HA 4FFDA 2YDYA 3SK0A 3BPSA 3H7AA 2YASA 2NXNA 4J2TA 4RLHA 5DBIA 5ALNA 4CKWA 2FJUA 1QH0A 1I5EA 3CRRA 1JR3D 3Q3GE 3R1IA 4M1YA 1GLGA 4YP5A 4DXAA 5AUOB 1EUQA 1AV6A 3EB9A 1A7AA 1EVQA 1SA0B 3H6HA 3KOOA 1SCUA 3Q85A 1FOEB 1SEVA 3CINA 1DAPA 1V8ZA 4JJEA 4EO4A 4RADA 4RPGA 1DBWA 3TLAA 4W82A 3SVLA 2W8BB 3A4NA 1XVIA 3KKNA 3CZQA 2E4ZA 3QYAA 3MJVA 4H6VA 4HO1X 1IG0A 3EGDB 3OHSX 3TXAA 1FFGA 1JEQB 2C0PA 2O07A 4M46A 2CDAA 2VTDA 4LZAA 2UYCA 1IWOA 1NFFA 1Y3HA 1VSBA 2NT4A 1S2DA 4K40A 5EYPA 4RAOA 3E8XA 2FEWB 3AERA 3CZAA 3IBSA 2AG0A 4DC0A 4KI0A 1LZLA 1VQ1A 2R6FA 3LPMA 5K3FB 1KEVA 1E7WA 2VPIA 2YY7A 4B85A 4Q7LA 2A78A 3O8NA 4HAXA 4MWCA 4RD6A 4DHEA 1XPJA 5ALVA 3ZJTA 4JLSA 4EUHA 3A4IA 3CTPA 3JALA 4ZQHA 2QYTA 3TK1A 1HYQA 2JIZD 2R5FA 5AW9A 2ZYWX 3FW1A 2QOEA 4K6MA 1G4HA 1KJJA 4GX1A 4G25A 4XSGA 2PGAA 1QLJA 4HWGA 3UJ8A 5B1HA 5K8VA 1QH1B 1TJYA 1Z9BA 2OK7A 3QK7A 2P2ZA 5SZJA 3W78A 3RK1A 1XPRA 5FOTA 3Q7SA 2I33A 4F6CA 4ZI7F 4QM6A 4OOFA 2GAOA 4NBSA 5E3IA 3PFCA 2VSQA 4MS4B 4TVKA 5C34B 3VPDA 2FMUA 3MT8A 3K3PA 4KKVA 1ABBA 3I64A 1V4NA 1CJVC 4QGHA 1OFGA 1GUYA 2FFQA 2VYND 4P3XA 5FPSA 4CCAA 1J56A 3EUAA 4GZ5A 4H6WA 4N7MA 5TB5A 2D3WA 3NATA 1ZL0A 4PZEA 3GT0A 2ZITA 2H51A 2A67A 4U2GA 5J1SB 4KO1S 4IIDA 3CNHA 1I01A 1USVA 2WLTA 4OTZA 1XAGA 2L17A 5AW8A 5ALKA 4BVAA 3G2JA 2ZYTX 3V1TC 2MSDB 1WL8A 1AKTA 1I14A 2R6R1 2V59A 2WAXA 3A6EA 3B20A 3D0KA 3CMCO 3I1JA 3IJ5A 4G1FA 2BCJQ 1ISMA 4I6GA 1OUMA 4BPBA 5GVRA 1TPZA 5T6MA 3AHEA 4DMLA 2JK0A 5JEEA 2ZB4A 3CUYA 3D3WB 2R60A 2SKDA 1VMEA 4WIAA 3WIUA 1CRZA 5LN1A 1D03A 2QL7A 2E5FA 3FPAA 1MO2A 3E9CA 1CEQA 5KOYA 3CRMA 3OE1A 1ZGGA 4QXQA 4CT4B 4XSHA 3GF4A 4E6PA 1KORA 5A9SB 3RK4A 4P3NA 1NG1A 2CYCA 1VHLA 3OLYA 5JE8A 2CJWA 4EPXA 3AVUA 3MWFA 2JFVA 1W0JD 2DKNA 3FX2A 3O1HB 4M7OA 4WXHA 2WV7A 4W9RA 4LMPA 1JLLB 2V3CC 3BRSA 3FKSA 3AVOA 1E4OA 2BGUA 2XB9A 3FIJA 2HK8A 4JKOA 2CV2A 1IULA 1T13A 3EISA 4QGSA 1Q57A 4IJ6A 3FYHA 4URZR 3BTOA 1OKKD 2WSBA 3I23A 3NS7A 1ESZA 1GRCA 1GGKA 2O4UX 1PLKA 3O91A 1UANA 2R1TB 2R8RA 2VTVA 4H15A 2CV1A 4HTFB 5IJWA 3FZNA 4CEHA 4IEIA 3BE8A 4FFOA 2ZI3A 5EWMA 1N6RA 2WT8A 3CX4A 1M67A 4JJIA 3UAGA 2YWGA 3JATB 5GZ3A 2V0GA 1V8OA 3KU1A 4KG7A 2R00C 4AJPA 2ZUWA 2OCDA 3MLAA 4QYWA 5A0FA 3GP8A 2OCIA 3LZ6A 5CMLA 3EXG1 4PAQA 1XTKA 4QJIA 1V35A 4YV0A 1VJCA 1NUPA 1DKRA 2N46A 3C7TA 3N2LA 4BE9A 5AK5A 2GM5A 3VJMA 5AW7A 1VFNA 5DYGA 1AN0A 4UUQA 3L6BA 4OK6A 4WZBB 4ZV7A 5CT5A 5LZ7A 1MV5A 3ESXA 3ZK9A 1E2EA 4JXJA 3LCCA 1SR8A 1TMGE 5EJMA 2B4AA 2D1RA 2VBFA 4A16A 4RPHA 4KMSA 3S1SA 2OBXA 3MEQA 3E9DA 4U6QA 3K96A 4ZANA 5AIBA 1VSVA 2R84A 4OSOA 5A4KA 3CH6A 1UPXA 4EATA 3N6XA 3V7FA 1YWGO 4KRXA 2H2IA 2KJQA 4PQFA 2QTGA 4XLTA 3B1ZA 5KJCA 3T7IA 2ERYA 3PNVA 1P2UA 2WUFA 3EFEA 3VV2A 1DQZA 1VIVA 3CR7A 1WXHA 1YC5A 3A37A 4FINA 5DM4A 3UT5A 2XZLA 3CSUA 1U3FA 2VP9A 3L8DA 2ZWPA 3NIFB 1M2OA 2C3YA 4IQ8A 2G06A 4DNFA 2RD2A 3A3PA 3DSRA 4M7RA 2PGNA 1CUDA 3PUYA 2Q3FA 3SWWA 1QB7A 3GAMA 3DO6A 3FUUA 4IIUA 2XXAA 5FA6A 5K0TA 1JLRA 4P0PB 3U19A 3WJAA 4K0RA 1LEHA 4YT8A 1P7PA 1L8AA 1RSZA 5BN5A 1UC8A 2PWPA 3MG9A 3OX3A 4Q9AA 5JJBA 1QP7A 1BVHA 1VE9A 4LHXA 4X20A 1MZVA 3V5NA 1QFXA 3S29A 4MRMB 3LECA 2IFTA 3CCFA 4FHDA 3M6LA 2JJ8A 2ZT8A 5HK9A 4ME6A 1E32A 4XYMA 3RGGA 2NYAA 2X8LA 4KE9A 1FXWF 3A4MA 1BYIA 1Z0FA 2B9VA 1UK9A 2F3SA 3C8HA 2AI1A 3FYDA 4BNDB 1JG2A 1OC2A 3ETJA 3TKAA 3H9GA 1KJYA 4KO3S 2C9ZA 2XX3A 5LLSA 1UBOS 2GARA 2PUHA 3RBAA 5A3JA 2H1VA 4W9NC 4E4TA 1H5QA 3VQTA 2XJ9A 2C5EA 2JIBA 1ZHHA 4FOLA 4JBXA 5DV9A 2ZUTA 5ITWA 3C3CA 4OI4A 2GHRA 3EGWA 2RGYA 3SC6A 1JSZA 5JAHA 4Q4AA 1U4SA 4AJHA 3LUBA 4YUZA 4ZV4A 2Y27A 1LQ2A 4OP2A 3W90A 4DIKA 4QOFA 1OBFO 3I3OA 3IOEA 4YUYA 4XYBA 4WN3A 1VLLA 2HFKA 3KJHA 2AE1A 5L6LB 5H16A 1OCEA 4IEEA 1PZHA 4MQFA 2Z6UA 4O4HB 2UUAB 3WGMA 2C00A 3HLTA 3I9JA 1GPNA 1PNOA 1Z5VA 2HPHA 2A9KA 2PK3A 3EFOA 3L1HA 4LXIA 3B3QA 3S5JA 4DSOA 3ZVKA 4CHTA 2WHYA 1IG3A 1I4WA 3UO8B 1E5VA 3ILXA 4W5OA 3K7EA 1GPLA 2IHTA 1DU4A 1T2UA 3V34A 4Q21A 5IM5A 1D0VA 4RY2A 5LIPA 1KI6A 5ES3A 4U2CA 3QSYA 5KNCD 4M6WB 1XMOB 2X1HA 4XM2A 3NJRA 2RH8A 5IEJA 3R9XA 1NKTA 3OLZA 3FTEA 1XDGA 2QPOA 2FZLA 2IOFA 4OFWA 1QHHA 4FQ5A 4TV8A 4JIGA 1HG1A 3IB3A 3FA2A 1VCIA 3QPWA 4JOCA 2DAPA 3AX6A 2Q8PA 4EW1A 1KKMA 1A8QA 1DB3A 3IO3A 4MUKA 4W5WA 3G8BA 2P9BA 1GVHA 5FWYB 1RXVA 1XEAA 2ZTVA 1FMTA 1QQ7A 3GD7A 4O25A 2I7CA 2ZSAA 4HDOB 4L1KA 3CNQS 2NYRA 3FR8A 3KS9A 4N03A 1QMGA 2A14A 2PYIA 3I6QA 4EP1A 1GTRA 1I3OA 1NMEA 4MIKA 1D7AA 2KSQA 4R9SA 3WLQA 4CBVA 1UDCA 2QF7A 2BHRA 3HADA 4NCJA 1I32A 2X9NA 5IT4A 3T1OA 3F78A 3HJCA 3EYAA 4LE2A 4MQEA 4HV4A 3PTAA 3DLHA 1WMEA 4PG7A 4EK9A 2P9EA 2GJSA 2V7BA 4YWHA 3A6DA 4RIIA 4U7FA 1GTL1 3RFTA 4CU2A 4QM7A 3OQBA 4N9QA 4B75A 4URVR 1W59A 2D5CA 2G4LA 3L0ZA 4C06A 3WSTA 3OFNA 2JIDA 2OCXA 2ONJA 3UHAA 1BCRA 1Q20A 2C4NA 3CNNA 1BEUB 4LJLA 4OBXA 4YVFA 4IMPA 1WCIB 3OZUA 1G6OA 2HQSA 1OQAA 2FUCA 2IYNA 1I0LA 2C1ZA 3JD2A 3PGMA 1UJ4A 5K6RA 1T3HA 2EX1A 1AS0A 1CCWA 1D6JA 2OORC 3HVKA 3QELB 4ZV9A 2E9SA 1EA5A 3P4YA 1VSQA 5K3BA 1A8IA 2XV1A 2CLKB 1EB9A 5DGIA 2I6SA 3QKSA 1QYCA 1FTNA 1T5SA 4UNNA 1FP6A 2JLWA 5CDGA 1JWLA 5IANA 2Q6KA 3LIPA 2FZKA 3AR2A 4R05A 5FOXA 4K3UA 5HF9A 4M0MA 1FFDA 1L8LA 3UMJA 3LQ4A 2W2VA 1O95C 4JBHA 4DRXB 2CSXA 2RHRA 2YNMD 2XPCA 3A70A 3E7FA 5IJZA 4FT2A 2WVJA 1WKBA 2ZBEA 3BJIC 3CVJA 5B6JA 2AKEA 1N9GA 2YX1A 2H1CA 1ZWLA 4GEKA 3B12A 3LPDA 2OAP1 3AKEA 4FNGA 4UPVA 4EFNA 5JFOA 2XUAA 3FXAA 5B7PA 4DMUB 2AN4A 3QE4A 1DO2A 3T9BA 2QRNA 4ZOCA 1ULSA 4AZ0B 1P80A 2EJWA 2CKDA 3DMTA 3HA7A 1BXKA 2HMAA 2UXDB 1T35A 1MEJA 5CT8A 4PYJA 2QL9A 3RK0A 1C3OA 4HRXA 4KXQA 4TRMA 2O7RA 2RGRA 1SY7A 1NC1A 2V1UA 2GVZC 1W30A 3R3XA 3KVNA 4LUCA 3LYUA 2MIIA 3NNDA 2YJ4A 5JSZA 2FAXA 2DFDA 2RKWA 2ZSFA 4BECA 4LNAA 1VE7A 2G7ZA 1CDZA 3DCYA 2FW8A 1U8CB 4IZ6A 4IV5A 2HF9A 5AJTA 2GSDA 3GLRA 1IYZA 2CHEA 2C2HA 3A1NA 2PLAA 1QWOA 5BR4A 1GNQA 2O5VA 2Z3ZA 2EW8A 3AI7A 4E03A 4E51A 2QMOA 2Q3BA 3LI2A 4UMEA 1YOBA 4RKRA 3FMVA 3AUKA 5J5CA 1KY4A 2HDWA 2A5LA 4QPPA 5ALUA 3UUEA 2F1KA 2H31A 2FPIB 1AHPA 4LXGA 4HJRA 2JGLA 3O0DA 3QKRB 1ZK1A 5EXTA 5E3HA 4Q7KA 1SRQA 3V4VB 1BFUA 3EF3A 4XJTA 5JFGA 2OHHA 2HA2A 3G0OA 5LM3A 4XLLA 4U7DA 3NXKA 3GBVA 4CDGA 1RKBA 2GM9A 4R31A 4R1OA 3I2FA 1XCJA 2RHHA 4LZJA 5IAGA 4E5VA 4V03A 1C9KA 2HWKA 2P9QA 1JFRA 3U4GA 5JCJD 4JP5A 4QBGB 4ALLA 1KO1A 3DR3A 2PKCA 3W2TA 4KZKA 2PUGA 2XRZA 2VA8A 3U0BA 4DV2B 1HOXA 3WG9A 4JGIA 2FI1A 1FVXA 4M0EA 1KKUA 1HLPA 4YJ3A 1FYFA 3OA0A 4RENA 2GVNA 3DM5A 3I30X 4KXXA 3ZV6A 1OVMA 3KFLA 1P0IA 4Q9NA 1DJLA 4WEOA 4LRYA 1EGQA 2F48A 1WP4A 3CNBA 1G6Q1 1U7DA 1ZH8A 1E92A 3HBJA 2O0MA 3AHDA 4PYQA 4F2PA 5K2OA 3H87A 5ADWA 4HNAB 1EWTA 3N5KA 2G82A 3C3WA 4JR0A 2C4UA 5KBYA 1FVFA 4DT1A 2GLUA 3MWEB 1NKSA 2BKEA 3IMKA 4D99A 3H5OA 3WLJA 1HDZA 3DYBA 3H86A 2NXEA 3UPTA 1Z06A 3MB8A 1RM0A 4F2GA 1KFJB 1TJPB 3SJUA 4PNEA 5K6TA 5TMEA 1OT5A 2UUOA 1RLUA 3HY3A 4HLDA 3FNHA 1MAVA 1XJWA 2IKQA 4JEHA 3RIHA 4QUJA 2AOUA 1AF7A 4ZKDA 4KGXA 5EI5A 2EP5A 5KB3A 1UFRA 2REQA 2DWCA 3ELDA 3H65A 2RMKA 3L6EA 4M1KA 2W93A 4Q3EA 5F98A 2Q7OE 4FHFA 2FSPA 3CUUA 3JZIA 4HUQB 4BQPA 4F21A 4EUKA 3AEZA 2DFTA 5FCDA 2QYSA 4PLGA 3WLNA 4Z4HA 3MNFA 3CC8A 3RADC 4YO7A 2UXBB 2E5LB 2Z58A 3L8EA 5B2EA 4PRZA 4KNVA 1DXOA 5E9WA 1K9SA 3Q0IA 5K3SA 1QP0A 3LLVA 2XNDA 1E60A 2L19A 2XNJA 1GGMA 3Q2KA 1I3MA 2DFVA 3I6ZA 1GTG1 4RZXA 1WKCA 1JQKA 1HX7A 3O4RA 4WKPA 4DIFA 4P7BA 4YN3A 4NU6A 3VJKA 5IK2D 2ODPA 1FX1A 2F6RA 1W46A 4CM5A 5JZSA 2C4WA 5JZVA 2XW6A 5LU9A 2IEAA 3IQIX 4YRKA 1THMA 1KPIA 3VDMA 3EXIA 1Y9JA 4HQ6A 4BNXA 1E2FA 5C4MA 3IPXA 3WK4A 5HJ5A 2OKCA 1KE2A 1Z2CA 1ZESA 4LX8A 4S1OA 4WQMA 1DC6A 1N2CA 1MQSA 3RB8A 3KAJA 1M6WA 2QGNA 4ODIA 4S12A 5FUMA 2HU8A 4MV8A 3RTCA 3ICOA 3WK7A 2WPNA 2VJDA 4YT5A 3MYYA 5CITA 1DS6A 4O3FA 4L27A 3HP4A 3DTVB 4BIMA 1PR0A 2A1UA 1OI7A 2FPOA 1WXGA 1C3XA 2B35A 4Z3DA 3S0JA 1A9ZA 4L8FA 4GKVA 4G67A 4IIBA 2VJMB 2CFTA 1SOMA 1V3VA 4IGAA 4JDUA 4ER3A 1DAKA 4FJ1A 5A9RA 2ZK7A 1TIKA 2DECA 2EFGA 4CM9A 3VV3A 1RM5A 5HW0A 2PEZA 3RLFA 5JSFA 2LE0A 3ZHSA 4UPDA 1W5BA 4D42A 4G56A 5K8TA 5K8UA 3ZLVA 1UUFA 3HL4A 5GJCA 3LU1A 2PZEA 1YR8A 4NV3A 3U44B 1X7HA 4RJJA 1NW4A 2JD0A 3MTDA 1NBWB 1BD4A 1BE1A 1V4VA 3L0DA 3PFHA 4BS9A 3UW1A 3O8OA 5D51S 4CQMA 3HYTA 3ED5A 3KHKA 3R5TA 4HB2A 2VK8A 3MQ4A 5I45A 1EUDA 4GPIB 5FLEX 1PWZA 1GAEO 1QC5A 3THXB 3D6JA 2FWIA 2DR3A 3HBFA 4HDRB 2WTUA 2ZIXA 4ENSA 5CXXA 4C6SA 4LZPA 5JLAA 5KNLA 1LBHA 4R9UC 3RUHA 1GFSA 1SXJC 1T6BY 4P5DA 1GZ3A 4HN4B 2O2JA 2O2XA 5BVGB 4L5JA 1JAYA 2C7QA 2XKBA 5EL0A 2AX3A 4HSGA 3LCUA 3ORSA 4PZUA 1KE1A 3AWDA 4TWJA 3BYZA 1SQGA 4I50A 2G63A 3PWKA 1HDRA 3CISA 1Y1SA 4GXNA 2EBHX 1YJCA 1EGMB 2QMYA 4OGFA 2WNIA 1JJVA 5DYTA 4N3BA 2P2SA 3MGGA 1EFPB 5CBPA 2XDWA 4HX2A 3B36A 2J9XB 4F4CA 3NHYA 3FDIA 3FSGD 4K0KB 4NYIQ 1MB9A 3KOUA 2J7PA 3EUFA 1PEDA 1RMQA 3MINB 4HX9A 1GZVA 4MRRA 4OMCA 1SURA 2I78A 4OXKA 3UUFA 3L04A 1SXQA 1AZLA 1PLJA 1SXIA 4IGEA 4BMPB 1O03A 4KV7A 5KTRA 1FDIA 2J87A 9MHTA 3ZE0B 5DEIA 3C3YA 1EWVA 4LXHA 1XAIA 3HBAA 4JLJA 4F5YA 2EQ5A 4CF6A 1GGVA 4DGSA 5JZ9A 1XRNA 4IZHA 1SC4A 2D54A 3O90A 3ZR4B 3ROQA 4C89A 1C9DB 1E63A 2GJKA 2WF9A 4WESB 3RANA 1XZEA 2UAGA 2QEQA 1CR4A 4PHTA 3DFUA 5DCUA 5DYYA 3RR2A 1Y6JA 4EMSA 1Y8RB 1CB0A 1NM5A 1WMSA 3CZ9A 2ZIWB 3R74A 4C21A 3ZVNA 5AKXA 2G76A 3ESYA 3K92A 2OBMA 3L7CA 2YWXA 2YINC 5AI0A 4MR9A 3V6MA 1IBRA 2RHWA 2PUBA 4X5OA 4I5DA 1M74A 3OTIA 2BF7A 2RAPA 3QIAA 4H1TA 3SJCA 5CEJA 2OSBA 2A9JA 4V0KA 5IDWA 4N5IX 5DE3A 2FZ4A 4YTEA 1KVSA 3PB3A 3NYIA 1C7ZA 5TX7A 3NYQA 1DFHA 1G7SA 3KQVA 4YJKA 4KITB 1H65A 4DA4A 3EA5A 5MHTA 3WNDA 2X40A 1ZD4A 1H3NA 3HSYA 5COBA 1PLLA 3LDGA 1NJ5A 1CUYA 2P0YA 4BNFA 1QRUA 1OZFA 1ZGCA 3H5WA 1U1EA 3STHA 1IVYA 4HXYA 4YRGA 1CF2O 1CUVA 1XLTA 1YBVA 3KP1A 4EW3A 4P4UA 3KT3A 4YJFB 1ZD2P 2IIPA 1EQUA 2PXCA 3N39C 2YIMA 4MVJP 3AO0B 1U9IA 1NP6A 1I1NA 1FRFS 3HN2A 4WUVA 2LCQA 1H6AA 5JWRA 3UJ9A 1DC5A 3OP4A 1AKWA 4OJYA 1F1BA 3IE0A 3OIDA 2XVZA 5GZ1A 3Q40A 3IAAA 3AUSA 1CUJA 4K9SA 3KEMA 3BUSA 4YYZA 1M2JA 2VOEA 3D3JA 5DIZA 1GNTA 3EDQA 1OT3A 1RU3A 1RABA 1SBTA 1BD3A 4RF3A 4W99A 4D9MA 1CETA 1PV4A 3EFHA 4CTNA 1ZWKA 1FJGB 1M34A 3HU3A 1QYDA 1NNUA 2I5PO 1CJTC 3EXHC 2G09A 4FYPA 3UMSA 3KRTA 9LDBA 3DBVO 1FUUA 4KCGA 4U00A 3C6MA 1A5SB 4RPIA 2XCSB 3B6MA 4YCMA 3L4JA 3FRIA 4H7HA 2O8BA 4M4SA 2XOKD 1E8MA 5KNDD 2X8JA 4I9NA 3GNTA 1OH6A 2FPPB 3PQ6A 4PQYA 1ZH2A 3QOXA 3QF7A 1ZL2A 5EZYF 6PFKA 1JT2A 2GS9A 2ZSBA 3GFOA 2PMBA 4LVOA 2XVXA 4NENA 1B0UA 3Q0EA 1OU4A 4BGVA 4PZAA 2OCAA 3SOZA 1N2CE 5DOVA 2Z2JA 2ZSIA 3EVZA 3PNKA 5IVHA 4XVQA 3VUEA 4HNUA 3KQOA 4NMWA 2XCQA 2D3TA 3F5FA 1OWMA 1Q16A 2CXPA 1ITZA 2J9FA 4UJ5A 1WF6A 5GV8A 5ICGA 3SYKA 2OYSA 1C1DA 1C41A 2O52A 4QPNA 5AHOA 4MV1A 4QYXA 1IQ0A 2VHZA 1CRWG 3I6BA 3E9MA 3L7KA 5ARDA 4B3SB 2P7IA 2VEOA 4PTLA 5DSTA 1YB2A 1X7DA 2Y1FA 4GRIA 1YZUA 2CFSA 2Q0QA 1FLNA 2XBUA 2W70A 4D8UA 2F8TA 1KRHA 9LDTA 1N2GA 2GUGA 2O2YA 3N7UA 4ZO6A 1V6AA 5A4FS 2HT6A 3DEIA 2EFEB 1JJ7A 1UP6A 2A5YB 4WWHA 4LX0A 4R8LA 1YMVA 3L6CA 2QI9F 5F77A 4R9RA 4QU0A 4Z9FA 3RVKA 1G9XA 5EPUA 1QIFA 1VLQA 5HOEA 1EG2A 5EJ7A 1RKXA 4WSOA 2FETA 3ZLUA 1NT2A 3N2KB 3CU5A 4IUDS 4CG0A 2P2LA 3IVAA 2JFZA 1S8AA 4UOQA 2GNPA 3SYTA 1B7GO 2BV3A 3GLGB 1I6MA 1Z6AA 3FVQA 5HJ2A 4UOZA 2B20A 2K7FA 4YJDA 3TVYA 4KVFA 5KJ6A 4LMRA 4ZMRA 4GKJB 4MHSA 1MVOA 1R6AA 2C5SA 5LDHA 1J97A 2ZWMA 2OGTA 3JARA 1X9HA 3L6OO 2RIRA 1TVKB 3S2SA 1YFLA 1IK4A 1Q7EA 1N77A 4K5QA 1EFUA 2Z2XA 1R0LA 3SQOA 1M1YB 1X1RA 2O4CA 1FSSA 4JI2B 4M0CA 3JYNA 1OWNA 4GUAA 3N7AA 2JI8A 2NIPA 2R96A 4I3GA 4IF6A 2DTDA 2YZ2A 4AVYA 3MWDB 4A36A 4M0FA 2GRJA 1JEOA 1ZJ6A 2WD7A 3AKYA 3WB2A 4D43A 4KGVA 3SVZA 4TV8F 1JLMA 4HJXA 2VXYA 1N5DA 2Z4SA 4E4YA 3A6PC 2O54A 1C2TA 3EEFA 5D86A 4NBNA 3DMGA 4FGJA 5CLHA 5BMVB 1COZA 2O05A 4HVAA 1HTBA 3FNFA 1KP9A 1XZFA 2VBGA 3OFSA 3P0FA 2XE6A 1PJ3A 5LMUB 4GOXA 4Q18A 1U1FA 2V98A 3K2EA 4FMPA 4ZC8A 4BRWA 2V7QA 5BSWA 1FNSA 3DJFA 3VYTB 2H1OA 4HPJB 4BX2A 3RBZA 1WU8A 1US8A 5EKSA 1Z74A 3TR0A 4P86A 3EPJA 5FR1A 3QKUA 3K9GA 1Z2AA 3WADA 1HORA 5K45A 1FFEA 2C78A 2I71A 3F4KA 1DIOB 3CPEA 3KWMA 3CUVA 3O21A 2XYRA 3OCXA 4OFZA 4X92A 5TQ0B 3C5EA 1VA5A 1EWRA 1MOZA 5D1HA 5C53B 4EB6A 1BWPA 2O5EA 4XIGS 1KNQA 4F7DA 4AY6A 1L5YA 3OT1A 3UYKA 4TRNA 1QGUA 1JILA 1S3IA 1NP7A 5EGNA 1MCZA 4LHZA 4XUDA 1LF5A 2DHRA 2BFFA 2W2KB 2O7QA 4EF4A 3WIBA 2MSNA 3A2KA 1DZIA 1JWBB 3RS7A 3TINA 1IQRA 2QUJA 1UZNA 2QLNA 1DBIA 2HQ1A 3I5MA 4AZTA 2X5OA 4RY9A 1V2GA 4J0EA 3BCRA 4LCJA 3PXBA