4HX2A

Crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KerA
publication title Mechanism of action of a Janus-faced single-domain protein inhibitor simultaneously targeting two peptidase classes
doi rcsb
source organism Streptomyces caespitosus
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4hx2A00
1Y4AE 1PTKA 1NLUA 2B6NA 2DUJA 3DE6X 3DDZX 3L1KA 5CW1A 1KDYA 5B1DA 2Z2ZA 1AF4A 1GA4A 1ST3A 3WHIA 1P7VA 3VHQA 1Y33E 5JXJA 1C9MA 1SCDA 1SUBA 2PWAA 3TI9A 3BPSA 1GTL1 3SQOA 1AVTA 1BFUA 1THMA 2WUVA 1IAVA 3GCXA 3WIVA 1OT5A 3A3NA 1R0RE 1OYVA 4BWGA 1GA1A 1BE8A 3LXUX 1Y4DE 4KB5A 3GT4A 5B1EA 1SIBE 2ID8A 3DVRX 1T1GA 2W2OA 1BFKA 2ZWPA 1MEEA 3F49S 1Y3DE 2TECE 4JP8A 1R64A 1V6CA 1BJRE 3WIUA 4CFZA 3Q5GA 1SUEA 4HX2A 1SELA 3QFHA 1GT91 5ARCA 1CSEE 3DW1X 2ZRQA 2G4VA 1KE2A 4MZDA 3DVQX 3DE0X 3DYBA 1SUCA 4I0WB 1PEKE 1AU9A 5JXHA 3AJ9A 4KPGA 1HT3A 1SBTA 3DE5X 4ZOQI 3DE1X 1WVMA 4C3UA 2DQKA 3SICE 3H42B 1YJCA 3D43A 5SICE 1DBIA 2Z57A 1YJAA 1AQNA 1WSDA 2PRKA 1LW6E 3VV2A 4DZTA 3AFGA 2ZWOA 2QTWB 1P7WA 2ID4A 5JXGA 4GI3A 2Z30A 2XTJA 2SBTA 4H6XA 3DWEX 1OYOA 2PKCA 3QTLA 2PQ2A 2ST1A 3CO0S 2WV7A 4YN3A 1SCNE 3TI7A 3I37X 1Y48E 4ZARA 1Y34E 1Q5PA 2WUWE 5FFNA 4CFYA 4NMXB 3P5BA 1DUIA 3PTLA 3UNXA 2V8BA 1BH6A 3EDYA 4C3VA 1WMFA 3I34X 1SUPA 1TM4E 2SNIE 4OV6B 1WMEA 1Y9ZA 4FONA 4AKTA 1UBNA 4RYDA 1S01A 1A2QA 1SUAA 1Y3BE 1T1EA 1SCAA 4DJ5X 2Z2XA 1AK9A 5FAXA 4LVNA 1SPBS 1S02A 1EA7A 1NDUA 4WOBA 1TM3E 1WMDA 3QMPA 4OMCA 3T41A 3BX1A 2Z2YA 2XRMA 2HPZA 1SIOA 1SIUA 3GT3A 2IXTA 5JMOA 1PJ8A 1SBCA 3VTAA 2IY9A 1TECE 4H6WA 3PRKE 3VSBA 1AV7A 1V5IA 1KDVA 3A3OA 4M1ZA 2P4EA 5AMXA 2DP4E 2SICE 4NE9A 1SUDA 1JEAA 1TMGE 2X8JA 4H6VA 3DE7X 3DE2X 1SH7A 1NDQA 1KE1A 1ST2A 3EIFA 3GCWA 3HJRA 1GTJ1 5AVKA 1SBHA 1Y3CE 2W2MA 1TO1E 1BE6A 4K8RB 1Y1KE 4AKSA 4WOCA 3A3PA 1YJBA 4CG0A 4DWWA 2SECE 3ZXXA 1SCJA 3LPAA 5AVJA 5K7SA 3CNQS 1TK2A 1TM5E 1TM1E 4B5LA 3DVSX 3DE3X 2GKOA 4HVLA 3WQBA 1TO2E 1TM7E 3LPDA 1ZVKA 3I2YX 3TECE 3I30X 1GNVA 1MPTA 2W2PA 2PWBA 3LPCA 1C3LA 1CNMA 2Z56A 5JXIA 1C9NA 5ARBA 1PFGA 1XF1A 1T1IA 1SBIA 2PMWB 3EE6A 1IC6A 1R6VA 2Z58A 2PYZA 3VYVA 1SBNE 3D9QX 3VV3A 2WWTA 5FBZA 5AQEA 3AJ8A 4KG7A 1ZVJA 1GNSA 1S2NA 1SVNA 1KDZA 1C9JA 4J94A 2W2NA 1P8JA 3DE4X 1EGQA 1GCIA 1SCBA 1Y3FE 4Z2AA 4NE7A 3F7MA 1VSBA 5ARDA 4LVOA 1GA6A 3BGOS 4OMDA 2W2QA 1YU6A 3DW3X 1SN7A 2X8JB 3ZXYA 3Q40A 1GTG1 3F7OA 2HD4A 2E1PA 1AH2A 3OSZA 5I9SA
chains in the Genus database with same CATH superfamily
2Y0PA 3W2EA 1GIAA 1LPOA 2YXDA 3DAPA 2PD3A 3ERCA 2DUJA 3HKDA 1H93A 1UPBA 2QMOA 2X1HA 1N8NA 4NBUA 4WLEA 4NABA 3DLAA 4R9VA 3F6RA 5FEMA 4COKA 2QQGA 2WOJA 1A9XB 1OJ7A 2GN1A 5T3YA 1DG9A 4CM4B 2AOXA 2IIQA 5L7YA 2ZXUA 2AUMA 3AERB 3GLHA 4JOCA 1OA0A 2BBOA 1DHRA 4DCNA 3E7FA 1L8QA 1A4RA 1JG7A 4BQFA 4HAVA 1T5LA 1Q74A 5EHQA 2OZLB 1YAHA 4FU0A 3DR3A 4NBVA 1G8GA 2GZRA 3L4BC 4QARA 4EAQA 5HS4A 3HCOA 4CCWA 3HDHA 3R4VA 3IDAA 1HMYA 4IDBA 3WXBA 4EQZA 1VMDA 2V3WA 2Z6UA 1DO2A 3BGWA 5DZSA 2I3BA 1BNCA 1E9CA 1X74A 1YOVB 2MWMA 2WSSA 4EDFA 2LIPA 3U9LA 1MVNA 2VVTA 3LRTA 4PBRA 2A1IA 3ZY5A 3QXJA 2PE5A 2OUKA 4QPZA 1GTL1 2ZTSA 2RGXA 5CLIA 3GHHA 3W8RA 3MK31 4M9SA 4BB0A 1UBRS 2NVUA 1OT5A 4HPWA 4M36A 2R8EA 5TJHA 3ZJ4A 4QYSA 5GIPE 4OQNA 1CV2A 5GAJA 5GY7A 2HY7A 3AZPA 2FB9A 2X1VA 3AWDA 5BV7A 3G9QA 5JMWA 1YBHA 4K6FA 3EA4A 3I73A 3LLMA 4WVLA 1BHQ1 1C2TA 1GZ6A 2HJ9A 2XDQB 2Z09A 3HCWA 5U1PA 5IKMA 1TNDA 3D4OA 1BCSB 4DLSA 2QIOA 2X58A 3B60A 3RC7A 2IPXA 3RKUA 3O8CA 3H1EA 3A6JA 1YH3A 2EX1A 2L69A 2UUPA 1CK4A 4JI1B 5JH7F 4C3ZA 1QU2A 2V98A 4L3WA 4XVQA 3HTXA 2HHAA 3KQOA 5BSUA 5AD1A 5IMBA 3G0OA 2V45A 4P92A 2HA0A 3A2MA 5DHUA 4LN1A 2CYBA 5AW8A 5FWYB 2XWPA 3W5SA 2RJ3A 3IKJA 2YOFA 4IOLA 1PGQA 1NQAO 3JZDA 4NDZA 2C59A 3RU3A 5IJ9A 1YFKA 4K6OA 4NCHA 1OC2A 5EIBD 3ZV5A 4TZ0A 1XMXA 3CONA 3BMXA 5BSRA 1Q3TA 5DCUA 4UUAA 4BX3A 2YIJA 4G01B 5AK6A 1JIQA 2V8OA 2GBLA 5LN1A 3GU3A 2G8LA 3TDMA 1QUEA 3INGA 4QNNA 4TSRA 5B58T 3ZWPA 5KINB 4CQMD 2PBLA 4YT5A 5KOHB 1L1EA 1RQ2A 4PIVA 1EFKA 2A0FA 2J6CA 2QJFA 3PD0A 3QKRB 4LHEA 4X97A 4DLWA 5CB0A 1GTZA 1EFVA 3QFHA 4S2EA 2G3YA 3TSYA 5SZHB 4MUIA 5AI5A 1CSEE 4TV8F 3AVOA 4KIGA 5IK2A 1K89A 3C70A 1GUAA 1TEVA 1KMQA 2JCXA 3F5SA 3A70A 4GRAA 1H6CA 5CA1B 4C2UA 4K2HA 1SHUX 1NZJA 3OLYA 4GSKA 3GJ8A 2Q5LA 5IRCD 5FTJA 2JCBA 3RWMB 3S1AB 5HA5A 4BMVA 3RRNA 5COQA 2SKCA 4LK3A 3RARA 1GRVA 2H1VA 3BRQA 4YFVA 1QTNA 2WP8J 3HYNA 1ODLA 1WM1A 5K0JA 1LH0A 2BRUC 3SP1A 4TXJA 3VU1A 2VHTA 4KPGA 3K20A 3VKGA 5DTMA 1OFGA 2JIOA 4E7OA 4YUVA 4RX1A 4C6TB 4J49A 3ZU6A 1DZIA 1Y1RA 4DCTA 1XZJA 2ZS9A 4AB1A 5AIAA 2NU6A 4QTUB 2Y66A 2GEVA 3PGXA 4ZDKA 1YRHA 4JBXA 1V47A 1E1MA 1OAAA 2BH2A 1DBSA 1XCPA 1CQIA 2D54A 3L93A 2YUIA 3TZCA 2G88A 3I6IA 3KCQA 1RWKA 4I66A 4HAXA 1J8DA 5E4TA 3ZNPA 4DV7B 4ZJUA 1W5SA 3PR3A 3LUHA 3IP5A 2PL9A 4C07A 4IZHA 4RGQA 3I2KA 5CU7A 2C03A 2C5LA 2WIJA 3G5UA 2WVGA 4MTLA 1EB8A 2CJWA 2HF2A 2QQ0A 1Z6QA 3D8UA 5JJCA 3LU1A 3HL4A 5ERYA 4LXUA 2GPYA 2R7LA 1V41E 4B2PA 3RUEA 2CLIB 1QF9A 1Z5PA 4TVSA 4WOKA 1L5GB 3L8ZA 4A0GA 1DO0A 1L5OA 1ZK2A 1QOZA 3A9WA 3NDIA 4FDLA 1RAGA 2VWPA 2XA1A 4NAVA 4ARIA 3R7DA 1RYBA 4F11A 4HMQA 2IUUA 1CIVA 1V6AA 4OU5A 4AZ3B 2C2YA 3TGWA 2UYQA 1JA9A 1NOKA 2BGGA 5CTJA 4ISBA 4HZUB 5JT1A 1PHRA 2P4UA 2C3UA 2H59A 1Q84A 1NYRA 2BL4A 4OB7A 3UPUA 4UNPA 2PKCA 2GEJA 3T8YA 2VDNB 2X86A 3S7ZA 2PQ2A 1WXQA 4K26A 3FDFA 5IDXA 3G7SA 3NASA 1ABBA 3KQLA 3LKBA 5FX2A 2OG1A 3R5KA 3USES 2HQ1A 3KAPA 4RK1A 1EWYA 3JD3A 2J5QA 3G7NA 1N2ZA 4NXNB 2XMDA 3MS7A 1RHKA 3DZ8A 3R3ZA 3WYBA 5KSOA 3ODPA 3D7LA 3U31A 2HCTA 4DJEC 2GPBA 2VI5A 3GFBA 2FLWA 1Z6TA 4Q7EA 4R1OA 3K6KA 4DB4A 2ZJ4A 5JTUA 2C4VA 2HV8A 1IOLA 2II6A 2L82A 1JP7A 4R9SA 4ZANA 3ZUGA 1LDNA 1C3EA 2W2KB 1HORA 4V0QA 1Z75A 1SK8A 2QZZA 1DJLA 2R25B 5FULA 4BKUA 1VE3A 2Q1TA 4CF4A 1G5QA 2V6IA 1WMSA 2ZJ6A 3BIOA 3G8AA 4L72A 3WRVA 5HNKA 2ZM6B 1XEWY 4XQCA 1RWWA 5B57C 2IRWA 1M6VB 2FR1A 1OAKA 1E9FA 1QB7A 1F8GA 1SBQA 3EG5A 3L7JA 2V3VA 3PI7A 4JR0A 3BH0A 2IYAA 2JBAB 1QBKC 2QTFA 2NM0A 4HADA 3L4EA 2YWEA 2NTEA 1H8HA 5JY1A 1UBCA 3DWGA 1AQLA 4KIJA 4RZQA 4EGQA 4LOJA 4PXYA 2ZJZA 1IJKA 1N5KA 2OO7A 4JBNA 3U60B 1K66A 1HNNA 5FJJA 1GLVA 1T0IA 2IVZA 5KYVA 2NPOA 1ZD5A 5TT1A 2EZ8A 4P4UA 5C5CA 3CF4G 1NW3A 1LNQA 2W6JA 3K9NA 4PYJA 1XR3A 1QO0D 4F12A 2YQ5A 5DX0A 2PS9A 5I7FA 5IULC 1G2QA 2POCA 4B48A 2PUVA 1IBLB 4U7WA 4YQZA 5GZ3A 5CT8A 5LUBA 4Q24A 2XAAA 3QEMA 1E1DA 1XPUA 2ZIVB 4NJOA 3BGDA 4DJ5X 3RS2A 4UFOA 2D13A 2QTGA 3QKSB 1IU9A 4L2IB 2G5PA 3NHBA 4LXGA 5FBHA 3TCNA 1T2AA 2EF1A 3RSCA 2FR0A 1BXRB 1NDUA 3B5JA 1YT5A 2WUDA 3EUFA 4GYYA 4BX2A 3FPLA 4IZIA 4KIFA 2VXYA 1KSHA 4LFBB 2PNFA 2KI5A 3JPYA 4Q39A 1R4NB 5KDLA 3S2SA 4QUHA 3VH3A 1D6SA 1NBIA 4YP1A 1JIUA 3IMGA 2HPZA 1L8XA 2Z3ZA 4OGLA 3P2MA 4IDHA 3OUZA 3S6JA 3GAMA 3C8HA 4HMOA 5AJUA 3SZMA 3P94A 4K6KA 3HVKA 3SMQA 4KGXA 1Z5VA 4R71A 5I7RA 4N5LA 3SXUB 4IP0A 4D0NA 4KQFA 4HUTA 1GD1O 1WUJS 5E6UB 2P5YA 4Q1BA 1QORA 1V1JA 5EWMA 1RLMA 1NMSA 3OLCX 4WEQA 4RKQA 3VTZA 3ZV7A 3AHGA 1ECGA 3F1LA 5D3MA 2WD8A 1H0SA 2GPAA 1DS6A 1H2FA 2NSHA 1BIFA 3L07A 1KMIY 1POWA 1NGSA 2CWWA 3DP9A 4Z4EA 1U0BB 1QFXA 4P4SA 3K4PA 1MAAA 5FTWA 1SZJG 4BCDA 3U3JA 2HL6A 1GLNA 2XH8A 2DT8A 1LI4A 3N0WA 5EG5A 3VZRA 3PR1A 4BASA 2Q1XA 2CLMB 3OHPA 2DHEA 4EY7A 5TPZD 4KNWA 2SICE 3V8BA 4UQOA 4PHTA 3FDXA 4L9AA 4LGVA 1XALA 1L4NA 2W4IA 4H3HB 3RTBA 2L19A 2WHPA 2OCDA 3AB8A 4O2AB 2JH9A 2ZBRA 3NBZC 3CR8A 3O8OA 2H9IA 3FX2A 4FGZA 4B4WA 2J07A 3DB2A 4KZPA 5FBRB 4CTNA 3JXEA 1X80A 2PS3A 4FGLA 3OPYA 1KYWA 4HQLA 1BD3A 2XWSA 3CZQA 5LZ8A 4DM3A 2PRIA 3KKQA 4YRBA 4F3NA 1EWRA 4HRYA 2CNWD 1ZIOA 3L77A 4X1OA 3TW6A 3C3YA 3WBBA 4ETWA 2FWPA 3GARA 1QKKA 2XUZA 3C7DB 2XD4A 5DU2A 1QCCA 2N75A 2X9LA 1QFSA 3KJXA 3MWLA 1VGRA 3DEJA 4DAEA 4DT1A 1TO1E 2R96A 5LD2C 2H17A 1SR8A 4HJRA 4Y2VA 4IGKA 2AXPA 3ZNNA 4GYKA 3A3PA 3RJ9A 3G0GA 1JJFA 3IAXA 2K87A 5ETJA 2B30A 2H11A 2JH3A 2CVZA 2VJMB 4HEQA 3NGMA 4NQRA 4FB4A 2AZXA 1ZJWA 3FTFA 1T4MA 2W6ZA 3GY0A 4Y1GA 1T8PA 3JWHA 3SHWA 4MWSA 2NV6A 4EF5A 2FRVA 2FPMA 2RG7A 3UXMA 5AVUA 4XJSA 4DBLC 1WABA 3UPDA 4EJSB 1RWMA 4JWKA 4NBSA 3LP5A 3SQDA 4X8LA 3U9SA 3FDZB 2AKEA 2O8FA 3FWPA 3BE6A 2J9YB 4Q1DA 5YASA 3DV0B 1GQSA 5DI3A 3LWZA 3RYHB 3U5TA 2WJ4A 2PMFA 5HOEA 4UC0A 5KTNA 3IIIA 5LZ2A 1DJPA 1W35A 2X42A 2YCBA 4B40A 3WP1B 3AKEA 3VNQA 2O7QA 3ASZA 3GBVA 2VA8A 3NUZA 4KIWA 1Y4UA 4V0NA 5LBTA 2RAVA 4BU1A 4MV3A 4IEIA 2YZKA 1J39A 3FUTA 2QN7A 1EK0A 1QVVA 2D2XA 2HJVA 2IDJA 2QJRA 3IIKA 1J06A 4LOLA 5KNBD 1WBJB 1FP6A 2J9RA 4Y30A 4X1YA 2F3SA 4ZHSA 2VEOA 1HBJA 4Q4CA 1G8FA 2JHCA 4KDCA 1XTZA 5F9HA 3STUA 4G3XA 4MS4A 2AOUB 1MABA 2PZFA 4RVGA 1N6IA 3PUXA 3ECSA 4B7CA 1F8XA 3PD7A 4HGQA 5T57A 4GQIA 1W4RA 3LCVB 1PJSA 4DSUA 2X5OA 1A9SA 3TLZA 2I1WA 2OD2A 2VF7A 3SDBA 2W2PA 3O93A 3V8NA 4FFWA 3H2GA 1FQWA 3P0HA 2IE8A 1E5LA 1XVAA 2NACA 3MIIA 4P4GA 5CLQA 1O94D 1ABFA 1T36A 3IFSA 4RTSA 1NZDA 3BWXA 5FADA 1KVSA 3GJ0A 4JB0A 2P1ZA 4ZU3A 1IBMB 1EHIA 2V6FA 4ZAFA 1YDEA 1H05A 4XDZA 1NQOA 1XPJA 4MO2A 5CD9A 1Z6GA 4EI7A 5C7OO 4UUOA 1PNTA 4M0DA 4NYJR 2DWCA 3KUCA 3IUEA 1TUIA 4NU6A 3DF9A 4TMWA 3SC3A 3MWDA 3V8QA 3L0PA 1CS4C 3I1JA 1E5TA 3QE4A 4IDQA 5IJAA 2LR0A 4A2WA 2RSLA 3OQJA 5JADA 3FOZA 2F8MA 1GV1A 2COUA 3P9QA 5BR7A 2HLDD 3WX0A 1TAHA 5A0FA 1EUQA 1Z6AA 3FMPB 2Z8XA 4L57A 4F06A 2Y1DA 1I5OA 2QNRA 2HWWA 3A7DA 3OAAD 4GLFA 2Q3EA 4YCNA 4S05A 1JDVA 3K9FC 4WCFC 4RM3A 1Q0ZA 1E6EA 4LF4B 421PA 2MMGA 2GZ2A 4IHAA 4YAJA 1G9TA 2DLNA 2JFWA 1XYGA 2VC2B 3EGXB 1NBMA 4TN1A 4E12A 1EBFA 1N0IA 2VDWA 3JY6A 4N6NA 3KLBA 4QTTB 2RK3A 1Z0UA 3E23A 2OAQ1 3MM4A 4OGFA 5MN6A 3RFXA 3JQGA 2JJ1A 2X4IA 4JI4B 3THXB 4ARZA 3D8BA 4D9KA 5HIAA 2FXIA 3ZZNA 2ZE5A 3DT8A 4L8YA 3B89A 2A0YA 2J7PA 1TL7C 1XU7A 1NUSA 2P9CA 1SBYA 2VQ3A 3NATA 4OQPA 2NTVA 3HFGA 1HT1E 4O2LA 1Y3FE 3RE1A 3TLMA 3WL5A 4BQNA 5BWLA 3LCJA 4GGOA 4OP3A 4RD1A 5JZ9A 3U4QA 3F7MA 1U8EA 1LRKA 3D0QA 5B55A 2HSWA 3UGJA 5LQUA 3TEFA 2C9OA 4RK6A 1WLYA 2NUTA 1V48A 1DQZA 2GTHA 2R1VA 2V1XA 4OMDA 1U65A 1BE0A 1O87A 3ANXA 1RCTE 1QR2A 1E7RA 3VR2D 2P68A 4ICIA 4OH1A 2FRDA 5AXCA 3RHZA 2D7DA 1W6RA 1G19A 1T6BY 3ZCRA 2WSMA 1KOLA 2RGCA 2HWXA 1ZH6A 5CLJA 4XW2A 2JA1A 4QE3A 4RDHA 4IWXA 1SQ5A 2PKRA 1YR7A 3BWBA 4G9GA 4DBZA 1JHYA 3N2ZB 5E95A 1E3EA 2O2GA 4ENSA 1PI3A 4PZCA 4IX1A 2B1RA 4YASA 1RWBA 3UMSA 4H1HA 3VPXA 2CB9A 3NRJA 2IU0A 4BU0A 3V4ZA 3FG9A 4D0RA 1AF4A 3BMNA 5ICSA 1HG0A 1OYYA 2HXSA 2OSBA 3JALB 3LGSA 1N7GA 3O2QB 3TX2A 1E2QA 4ZTZB 1M2OA 1Z8HA 2BGJA 4KHZA 1XMVA 1LRLA 3RWBA 1UODA 1LF0A 3Q4GA 2BD0A 4CI0B 4DCSA 1LX6A 1SPXA 2GZ3A 2HSZA 5D6OA 3DAYA 1FUYB 3EW7A 1KPHA 3IUQA 1T5OA 1B1AA 3A4NA 3RS5A 4D4GA 3QGMA 3O4FA 3KB1A 4U1RA 5BUCA 2QW1A 2IEGA 5CX4A 3JVEA 5IVPA 4ZEXA 1GGHA 3L18A 2QRVA 3IEPA 5FP0A 4P0QB 1O6ZA 1LPBB 3ANTA 5A9TA 3TTTA 2YV4A 4P35A 2ZQZA 1LPSA 3JD0A 4DDKA 3HYSA 1QWSA 5LP6F 1WF3A 4US1R 3IRUA 2Z2IA 5B6JA 5BNWA 3EIUA 1NATA 5FPKA 4HH0A 3FSGA 1CUSA 4JUAA 1T6XA 4MWTA 4Q4JB 5CM2Z 2IZ1A 3V1NA 2AE2A 1NONA 4B85A 2A9PA 1U1FA 4RZXA 4W1QA 5FQNA 4YRIA 2CT8A 1DCTA 3A3NA 2I1LA 1W0CA 1DFGA 2IEYA 3EMKA 3AETB 2YQ4A 1LDGA 2KBEA 1K4KA 4C06A 4KXXA 4TTSA 3DEZA 3TQSA 3DO8A 1T1JA 4HX9A 3GJRA 1BE8A 3FNGA 2RHGB 3HN2A 3H2BA 4XASA 4K9SA 2DEUA 1TKRA 3H4VA 4H17A 5DNCA 2Y8EA 3HDJA 1PHPA 1W88B 4I55F 3Q6MA 1VE5A 3IIMA 2GCOA 1G64A 2C94A 2JCVA 5EJIA 2PX3A 1SIBE 3IPLA 1H94A 2FGJA 4P7GA 4Y6OA 1UK8A 5JCOC 4MHTA 5KJFA 4YP9A 1JJVA 3T1TA 3DVRX 4MGZR 3DONA 5JD4A 2HWYA 3G2OA 3T4EA 4I08A 4Y2PA 4M7WA 3ZW9A 1VE7A 5KSPA 4PZAA 4JJ6A 3CU5A 4PNPA 2QRZA 4POOA 3KUDA 3VM6A 4DCUA 2R8OA 5EWLA 3W9YA 2TECE 2H1IA 2YX1A 4JVMA 1A72A 2DHQA 2VA9A 4WESA 5E9WA 2BFEB 4Y2UA 5KIAA 3RHSA 3QFTA 2ZTMA 3OU7A 5DNEA 4Z3DA 1EXMA 3TPCA 3ANMA 4KTTE 1TX4B 2GO1A 4GX1A 3E7WA 2C98A 1ZRNA 3MC1A 4HYQA 1E7WA 3UAZA 4AY6A 2PGOA 2R1TB 2FK7A 2WAMA 3AUYA 3GRZA 1FSPA 4HNHA 1JAYA 5CGQB 3PI6A 3F98A 3VRHA 2PYDA 2ZS7A 4G86A 3WFJA 4YYEA 3N7AA 3LCRA 4IV8A 3NONA 5CM9C 1CIPA 3ICVA 4D02A 4X62B 2QYSA 1LK7A 2IX3A 1N6HA 5DGHA 1SWWA 1UZLA 3GCGA 3B6EA 1FQJA 1YS2X 1WZCA 2JKVA 3PFGA 1MOPA 1E9EA 3CPHA 4I55B 4QUIA 4X3CA 3LX8A 1YF3A 1EVQA 3FZGA 4TTQA 5CXXA 4PRYA 2Y9PB 1DRKA 3IKMB 4QVGA 2JVJA 2F43B 2R4TA 4HEJA 4KQMA 4ODIA 3UQZA 5SYMA 1WE2A 1PWHA 3DE0X 3K0FB 1XE3A 1O9HA 4UDOA 5K8UA 3SEAA 2EOAA 3BRSA 2Q5IA 3OCZA 5EUMA 4FYPA 1UAGA 1PEKE 2JANA 1UQUA 3KQTA 1G3MA 4IDFA 2EV9A 1DU4A 2R00C 3AR7A 3DBIA 3TRKA 1QZUA 2ASVA 5LLDA 1CCWA 3DE1X 4MYCA 1DSSG 2YMMA 3TPFA 2IH5A 1FNBA 5JQWA 2FPLA 4MVXA 4N18A 3HSYA 2DQKA 1EPUA 2BWJA 3CKLA 1PZFA 2RGBA 1NF3A 2QMEA 3HU5A 4M46A 1XMSA 4R1UA 3D31A 4ZAYA 1BW9A 3TQRA 5G0SA 5JBQA 5LQDA 4WQMA 1X8XA 3H3JA 1JQAA 1BROA 2FJPA 4QU8A 2IH4A 1ACMA 1RBZA 1SNYA 2SHKA 3PG5A 1S89A 3I0NA 3B7PA 2H5LA 4EL0A 4TZ6A 2QTMA 4XD7A 3H9BA 3AF2A 2H0RA 4Y0NA 4MGYR 4Z4HA 4ESOA 3GZJA 1JKFA 2PT6A 1OI4A 4ZQBA 2GILA 3DVAA 3LLCA 4A16A 1K5HA 1A7UA 3RC1A 2Y0BA 4DEYA 3OCVA 1F17A 1KIFA 1J21A 3AEXA 3VZSA 5K8VA 1AK2A 3KB2A 1W5TA 3O0DA 3P9IA 4URZR 4F91B 1IB6A 3B51X 1Z28A 3J81A 4EJ0A 4U7PB 1P2GA 1VJRA 1JWBB 3C8MA 3DULA 3F9RA 4ON9A 3V4OA 2BFFB 4FWTA 3D2CA 3K7EA 3GYBA 3ZHZA 2D2VA 4D42A 1UPUA 3TL6A 4ZOEA 2VSNA 4CR6A 4LISA 2ID4A 2XI4A 3JWGA 3E27A 1WDTA 3RB8A 2ZWIA 1CJCA 3U0VA 2FJUA 4RIIA 5DXFA 1OI7A 4A92A 4MYRA 5IAAA 2VSQA 5BVHA 1R7RA 4AX8A 3LF1A 3HH8A 1OFUX 3UG6A 1Q7CA 3PJGA 3X0DA 4BOYA 4WH0A 5HOQA 2Z2JA 4H7HA 2GQ0A 2WABA 3BB1A 4BNXA 4W5RA 1KQOA 1TI7A 3GLTA 1IL0A 4E51A 4BJHB 5J4LA 3LVFO 4ZVMA 1Z18A 3AG6A 3B6JA 3O4HA 2OB2A 1OBVA 3EZXA 2C2GA 4MR8B 3CO0S 1NC3A 2PLFA 1FFHA 1IXZA 1KC1A 1SIWA 4D2IA 5IZ4A 5IC5A 5EE1A 4OHBA 1NBAA 4JI0B 1CF9A 1R27A 2GM5A 4F45A 3CZCA 2BGKA 1NF2A 2Q2VA 5CUQA 3SSMA 1G3QA 1N5MA 1YUNA 1VL0A 1F1JA 3AXSA 3F6SA 3FUVA 1AGYA 3JWIA 3SLRA 3ACCA 4Q3CA 1ZAYA 4EAAA 3JAKA 3KOOA 2ZXEA 3ND7A 2PU7A 2F9LA 2XE6A 2B37A 3DJYA 1R0KA 1L9XA 1OIVA 2EIHA 3AO0B 1EYZA 3CRMA 3LQYA 1DEHA 4CFYA 3ZXSA 5F21A 4BFUA 1I3KA 4G1FA 1ENYA 3KQUA 1H4QA 1S1MA 4GT1A 4BO3A 2BGRA 5CJJA 3WAKA 2C5HA 5FBLB 2AEJA 4Z6KA 5KQGA 1ZNWA 4DCMA 1E5QA 3HYCA 2AHOA 3N28A 1JIVA 4HYEA 2GNPA 3WICA 1TZKA 2BUCA 3FMVA 3Q72A 4NFLA 4PGGA 1D2NA 2JJ2D 4WACA 4X20B 3TD6A 2PUWA 1K4MA 4E5NA 2J9FB 5IFKA 1NBEA 1TM4E 1SXGA 1Z4LA 3L7LA 4KI0A 4CEIB 2YXEA 4ZEVA 1VDMA 4ESEA 1WSWA 2I5PO 3GPCA 1QLHA 3GUHA 4TWJA 3TNDA 2W42A 1AMUA 1PG5A 1P2VA 2BPOA 1U3GA 1C7JA 4MTCA 1AKNA 4JVSB 3LE8A 3N2GB 3ETCA 1G5HA 1P2BA 5DT2A 3T06B 4IIJB 1CDZA 3I8OA 4NDNE 4QSMA 4YH1A 2OR3A 4F5WA 5KU7A 4TM8A 2AFIE 2GERA 2VZ8A 4JLKA 4NV3A 2HK7A 3UWPA 1FTWA 3KP1A 4UHEA 1E2JA 5JD5A 4NYIR 2RKOA 1JLLA 3ELDA 4QA9A 1DHTA 4WKPA 3QENA 2D7CA 4B2YA 3G49A 4MKHA 1GN8A 3TLBA 5ITZB 1Z8DA 3NH9A 2FLKA 1GQYA 1XN1A 2NZ8A 1NR5A 1DC4A 4CLRA 3ZJTA 1G2OA 2EJWA 3BK1A 1AXEA 3FRHA 2R751 1L2TA 5FWAA 2ZSKA 4OQMA 3ZLUA 4RHXA 2QRGA 2V7GA 3G23A 4QXPA 3RJMA 3UHJA 2YMLA 1MW9X 1W0JD 3HBJA 3K6RA 2ZJBA 2KX7A 3PICA 3AF4A 3LOUA 3ND5A 5EIAA 1JMVA 1SBCA 4LVCA 5AKGA 4Q48A 4WADA 5EIHA 1QH9A 3KTDA 1EX9A 1N4DA 5CH3A 5E0KB 3TDNA 3NOVA 5ALWA 4FMDF 4O2BA 4UQLA 5KOIA 1BX3A 4L8FA 4LTNA 4DR6B 3JQEA 4ZI7F 4EKEA 2Q1YA 4C0QC 3Q3JB 1O6GA 4QECA 2IWRA 2X0IA 3I52A 2PGAA 1R0ZA 4I4TB 3S2IA 3ZWYA 1H1TA 4HUQB 1IY1A 1E1YA 2P6OA 4QGSA 3CX3A 1B26A 3ORFA 3AMVA 5H5JA 1XK6A 2ZATA 3MA0A 5A6SB 5GZ1A 3L4JA 3ZE1B 3VR0A 3HBAA 1E1LA 1BS1A 2PSEA 3H9GA 4TTIA 1O96B 4X95A 3KALA 1FLNA 3GLIB 2J3QA 5HF9A 3H13A 3UWOA 1JDSA 3B48A 3KR0A 3HYRA 4L8LA 1JTVA 1D6NA 1DX9A 4M9RA 2Z3WA 1KY5A 2R3SA 3ZHXA 5KYWB 4UHJA 5IT0A 1E0SA 1OROA 5DOZA 3NP9A 2QUBA 4L4XA 3CXRA 2X8JA 2QL5A 3KHTA 4F2PA 1KYIA 4MVJM 3ITDA 5C31A 3W2TA 2DRIA 3EZ9A 1JR3E 1XZPA 1EK2A 2QRNA 2QRHA 4H35A 4OOFA 5ES4B 4OHZA 1NDQA 1ODCA 4L7VA 3AVWA 4WOPA 3TTWA 3EIFA 1WQ1R 2QPAA 1HLGA 5E4JA 4Q3NA 5ISMA 1TAUA 1GTJ1 2V65A 3FPJA 3MF4A 1AGPA 3A4LA 3CYFA 3NDPA 1Y5LA 3K53A 2FETA 4FMCB 4WY2A 2GN9A 4QG7A 4A8HA 1PG2A 3K70B 1WPRA 2O8CB 1WB5A 1CJKC 2AWOA 1VBFA 3I01A 2YIVX 4K8RB 2HDNB 4AF7A 2IQ5A 1JZSA 2XNKA 1VGQA 1XF9A 3LBAA 1L5HA 1MO4A 1PZNA 4YO8A 2O14A 4MGEA 1ZYUA 3IEKA 3OESA 2SKDA 3H2HA 2AKYA 5EIOA 3RTDA 3BXXA 4JJIA 1NVEA 4DWWA 2CWDA 1CE8A 5BWMA 3ZE2B 1FW8A 1LNSA 4DV5B 2XB2A 5CGZA 2ZYTX 3IPAA 1G8KA 1WZUA 1XRNA 1CRPA 5HEKA 1QRSA 4ASUD 5LP1A 2ISCA 4GZ6A 3B12A 4P5EA 5E2IA 1GCOA 4IAOA 4Z8YA 4HTAA 4MDFA 1ZJYA 3WGYA 1Y4SA 5HGJA 1L4GA 2PKQP 3GV0A 3O74A 4JEIA 3ISTA 3SU8A 4A6XA 2LRHA 1DMRA 3WRYA 4TX1A 3L6UA 1RQXA 3Q15C 2IOHA 2REOA 2WP0A 4LBWA 3HJBA 3FNBA 3H0EA 4JUBA 4WZBB 5DBOA 1ZITA 2NUAA 3CCBA 3HI4A 3JZFA 1Z26A 2Y92A 3L7CA 3MLEA 1CQJA 1FP4B 4RMNA 4F04A 3FZNA 1AN9A 4HPXB 2P9GA 2XPCA 1EP9A 3COJA 1P1JA 1YZGA 1N5LA 2BKUA 2HTFA 2ADOA 4RZ3A 3VU8A 3ZQKA 2NAPA 3P32A 1O9BA 1L4MA 2VHCA 5L40A 1DARA 4ZGBA 3ML1A 2I76A 5BWNA 1JXOA 4WL0A 2A78A 5F5LA 3ZE9A 1AUXA 4BV8A 5T6MA 2NO6A 1EX6A 1F2TA 1Z2OX 1SXJD 2R1UA 3T7IA 2JG3A 2GO7A 1ZIXA 1MRSA 2AG0A 4IQGA 4FN5A 3I42A 3T5GA 1L5FA 1ZZEA 1VGVA 3AY6A 4FSHA 3QFCA 3BD7A 1IULA 1O97D 4PQFA 4MW1A 4QJ4A 4ZCPA 4PNEA 2PYIA 2O2XA 3F6EX 1JEDA 5ARBA 4AZ0B 1CYEA 2JCSA 2X1MA 5CX1A 4YMSA 5C9ZA 5GINE 5KWIA 1HFEL 2I4TA 3CLSD 3O8DA 1OZHA 2O8NA 4BNGA 5GJBA 1FYEA 3AK4A 3OIYA 1YZTA 3NUQA 5AJZA 4YI3A 1AQYA 5FXMA 1G59A 1VHWA 2Z8ZA 3O82A 1MD9A 1TGYA 1UT5A 1XAGA 1IXSB 3DMRA 4WBXC 4R0VA 4B43A 1H1LB 4YPFA 3AEUB 1HZZA 4X24A 3U19A 4ZCRA 1AN0A 3U9TA 4M38A 4ENTA 4HDOB 5TARA 5J2UA 1W29A 2HNKA 1X3SA 2G7ZA 3KU4A 5AHWA 3WHPA 3LY5A 1LLFA 2IZ6A 3MRXA 2ACKA 4KVZA 1Q1EA 3TMKA 3QKTA 3ORQA 3VBCA 3N0TA 2P9ZA 3E7DA 5K3OA 4CMHA 2ZYAA 3CF0A 5AK5A 4KR0A 3RVPA 4J0EA 3TVTA 1GARA 2W2XA 3E35A 5JZSA 2VSOA 2G17A 3QELB 3LYLA 1UPAA 1CR0A 1U9CA 4RTKA 1KJNA 2OC4A 2PCJA 3ROFA 3JRXA 3JYOA 2E85A 4O4HA 4RJJA 2RGNC 3WWYA 4B71A 1P8JA 1I6MA 3MGBA 5FL7D 2WZBA 3T3MB 2VJNA 1R0XA 2WYIA 4BQRA 3WLRA 2KBFA 3D4LA 4XTRA 2MSLA 4RKRA 4XQGA 5DB4A 4AJJA 5JAPA 2ZKLA 1ZMBA 5K8CA 1TU3A 4FIDA 1FYXA 1NOJA 1WMBA 3EIWA 3V4VB 3ZI0A 1JIXA 1C4XA 3HCPA 5KS2A 2ONJA 1TEHA 2FGKA 2PTHA 3KSRA 4WN9A 5IAKA 5AKKA 1AB5A 4BB5A 4N5MA 4QUEA 4J2TA 3IVGA 4N8SA 4NZMA 2UYHA 4KXYA 3B6ZA 3RYFA 2PAFA 3MTEA 3PQEA 1USUA 2H4HA 2VDJA 2YZNA 2DLCX 4BNFA 5D01A 3SR0A 3IP3A 4O1HA 4XIJA 1UMBB 3WIUA 1HT2E 4E1BA 4JITA 2JFHA 3T9AA 2BBTA 4BMNA 3D3WA 3FYTA 3ZDQA 1T2DA 2HD4A 1Q6ZA 2DZDA 3EQ6A 3T15A 4CUJA 2R6FA 4FDTA 3W1VA 2BHLA 3UK1A 3N7TA 5ES3A 5NULA 2C7RA 1QYVA 4EG7A 1IG3A 4B75A 1EVJA 4OLBA 4GR4A 3FOEC 5FD8A 2RKWA 3WL7A 2P41A 1VLJA 2P5SA 1N3YA 4F4JA 5MN4A 3LBHA 5A3JA 3V34A 2VNKA 3RRZA 2PO5A 2HRDA 1PWZA 3NBYC 4TLBA 3WV5A 3SVZA 4JBHA 1DAMA 2DCUA 4G4JA 1KDYA 2ERXA 2VDPB 3C98A 1GKYA 1K6JA 1KRHA 2OXCA 3M4XA 2YWFA 3BMOA 4L5AA 5GVSA 5KWEA 3Q11A 1MX5A 2GFIA 1CR4A 3AVQA 4PCVA 3R75A 3RC3A 5CB4B 5JMTA 3M81A 1U8ZA 4QRHA 1LTHR 4GU5A 4LC0A 4A0QA 5MDHA 3F78A 3RVLA 2I6QA 1WEHA 1VIVA 3BWVA 1EK1A 3DBHB 3GNTA 3UIEA 4BNTA 4JI8B 1DDOA 2A59A 1WUYA 2J9GA 1QYWA 3Q2IA 3W06A 4XPIB 3UZUA 1RQ7A 3A31A 3ZUPA 1OX4A 1J24A 4G1BA 3MQFA 4Y7DA 2L18A 3PUYA 4UCQA 1O6BA 4CDGA 2NGRA 3SIPA 2B8WA 4GGPA 5SYAA 3RKRA 3G9UA 3A4TA 5FBVB 1YS9A 2DFKB 3BG5A 5K3EA 1T6NA 2NZVG 4R2MA 2H29A 2HT1A 1XRRA 3A25A 3N05A 4BXOB 1NW5A 2APJA 2OESA 3IE0A 4A2QA 1WDKA 4BAZA 1JHXA 3ZJVA 5D6NA 1OXMA 2H7YA 3NV9A 5E38A 5B4VA 1AKRA 1H0RA 1LJUA 2QAGC 3EBPA 3STTA 5K09A 3GVCA 3NTOA 1M8FA 2CFTA 1JA1A 3FNIA 2ODWA 4D4JA 5FUBA 2TMDA 4XUDA 2GD6A 3ELWA 5BXQC 2IV3A 4X1KA 1X8KA 4QUKA 4UHCA 2ZDHA 2ACVA 3I9JA 4PPFA 5EYPB 3VMFA 4DY6A 1TUEA 4PR0A 1UOEA 4BZXA 3K2EA 3ZDBA 1JFFB 4MROA 1HT0A 3I2JA 4M8KA 2EP7A 3K4HA 1PGPA 2ZI7A 4CCAA 1JV2B 4MUEA 3WO1A 3MW8A 4R6XA 3FBGA 2I9PA 2QVXX 4NWIA 3ZGNA 1K92A 2V58A 2RD2A 2YVQA 3E3MA 2AFHA 1L3BA 5HR5A 1P2SA 1U3FA 3OVMA 1TJ3A 3EWSA 2VATA 4CUKA 2O3SA 2H2AA 4YP5A 1TMOA 4XYEA 2XXAA 4ZD6A 3L7DA 4C22A 4QYIA 1R64A 5F77A 1KH1A 1DTWA 2F17A 2J33A 2FPGB 3LIIA 1K7EB 1NMZA 1NTRA 1B8OA 2G36A 3GJQA 5C81A 5D5QA 1JPVA 5JZBA 5L6LB 1BJRE 1AS0A 4QIHA 2PDAA 3PCTA 4TKZA 4IZOA 2Z8YA 1B0PA 3KSMA 1M67A 2FCAA 3M4ZA 1OV6A 3T4UA 1HDZA 1KA9H 1LPMA 2I4IA 4PFQA 4BGEA 2WUEA 2XTNA 4JASB 4M3NA 5GM1A 1EK6A 1DOZA 4IIBA 1IQ0A 2P9EA 1NOIA 3OTWA 3OJWA 1XAHA 1PUXA 3STHA 3RBXA 4IINA 1N3LA 2GXUA 1J00A 1NYTA 1U2GC 1UT6A 2IXAA 4CIVA 1FUUA 4BFTA 4URHA 4KV7A 3X1KA 3B3FA 2DY1A 4ZTBA 1NMQA 1AHIA 1NE7A 4GM1A 4S24A 1SB9A 3L4KA 3PB3A 1BYIA 4C0KA 1Z0IA 3W5UA 1BEEA 2GYYA 4ZYXA 2C2MA 4MA0A 2E89A 2CHEA 2OV4A 4I1RA 4AWXA 4QUJA 4KTVE 1OX6A 1Z62A 3T5DA 4WJLA 4QFCA 2NQTA 3ZK9A 1ABEA 4TUYA 1K08A 4ALKA 3TZ6A 4F6RB 4WCFB 4HKTA 4QM7A 4OJNA 4KZKA 5EKDA 5ED4A 5DTIA 2HC9A 3GD7A 4RY2A 1JNXX 3PUJA 7AT1A 4LCEA 1R6XA 3IAM6 1P4HA 2ZSDA 3SHTA 4OX9B 5B3JA 1E1CA 2D4AA 3LFUA 4LF8B 1JYSA 4Z0HO 4WBNF 4CMIB 4ERXA 2OCKA 4L9WA 2CSUA 4N1AA 5AW9A 1WCWA 3KVRA 3MUEA 4OQXA 5BMVF 3DEKA 4G5XA 5IVKA 2QLMA 2W2VA 4H27A 2DJ5A 4YWHA 3RBZA 1ULUA 3VVLA 1UDXA 4JLWA 4WASA 2OK8A 3KYCA 1LPPA 3E7XA 4GZLA 4TLAA 3JTEA 3BE4A 4PWYA 4UEQA 4G1CA 1TQ8A 1F7VA 4TRMA 1ADCA 4C20A 4ZAGA 2FFRA 1PEAA 2ACWA 3RO7A 4XIIA 3W0LB 3WZMA 1AA9A 3TRIA 3ZWWA 2NP7A 2ATCA 1P0PA 4M9ZA 3VR4H 1II8A 1UH5A 2AN4A 4CZ2A 5KOYA 4BZZA 4U7HA 3CW9A 4EGJA 2HIGA 3X1ZA 3IULA 1GRQA 3NHLA 2KQUA 3P97A 4XFDA 1XT6A 5ALDA 4BFWA 2OEPA 4HVTA 4MB0A 2IEIA 1IVYA 5K8IA 4INZA 2Q9UA 2W2LD 1DC7A 4J0FA 1N7HA 5LKRA 3HVUA 5JW6A 1T4CB 8MHTA 1L7OA 4G1EB 1ZCFA 4M99A 3BSYA 3GEMA 3VDNB 4EW3A 1QOPB 2FZWA 4CF6A 5J47A 3O8LA 3B2EA 3G0DA 4IGIA 4OHRA 4MGIR 5DNDA 4FNMA 1HH4A 1IY2A 3TI7A 4EVSA 4RTLA 1LDYA 3FR7A 5LPNA 1VRCA 2AJLI 3I37X 4H7JA 4WY5A 1L5KA 3UK0A 3WMRA 5FBWB 4UTZA 2I2FA 2Q49A 4D44A 2LZ0A 1M7BA 5L53A 1HQDA 3NVDA 2EXXA 3PNVA 4KR7A 3PF8A 2FMXA 4IIUA 4RZ2A 4UUPA 2GTPA 4JVLA 4JLSA 1IE3A 1R18A 3VSDA 4R8SA 1KU0A 5GONA 3WK6A 1UJNA 3GGSA 5DEOA 3K1ZA 4Q3AA 4W1RA 4BGVA 3NTRA 2HMSA 4P53A 1AKVA 1FJGB 5GP1A 1E4EA 4QU5A 3BK2A 2H7CA 1UDBA 3L79A 2A9FA 3CXUA 2Y68A 2R6JA 3F74A 3PDUA 4PAQA 1ZWLA 3UWMA 4N41A 2DWUA 2E1RA 5I45A 3N3BC 4EY3A 2JAWA 1K6MA 3V48A 1GTMA 1WMFA 3T35A 3AX6A 1KTVA 4HNAB 2ORYA 1CUHA 3EUWA 3ZD6A 2BFBB 4Q3DA 2NQ2C 2PTGA 4QWWA 4OUDA 3FFTA 1DDIA 2IS6A 2ZUCA 3WVNA 1Y8RB 2VPZA 4RY0A 3WGQA 3Q7PA 1CZKA 1AZWA 1HTWA 1QV9A 1DRJA 2B7CA 3D7NA 3B1JA 1MIOA 2IHUA 2R5FA 4AJOA 2GF0A 3MQ2A 2AX3A 3PXGA 2H1CA 2JBWA 2P8SA 5DWDA 4YRCA 4CI9A 1XWFA 2CHFA 4LYHA 2ORWA 1CRWG 3E9NA 5BSGA 3FVRA 4KUEA 5ELLA 2V97A 3RTCA 2OORA 4Q16A 1EVZA 1WZEA 4M49A 4GPZA 5FAXA 1X1DA 5HIJA 3TNYA 1YR1A 4PSDA 1FSFA 1BO6A 2IEZA 3A9TA 3JYQA 4MW7A 5P8WA 4BHTA 1GZ3A 3OPNA 3EWAA 4Z2YA 1S8FA 1ZLYA 1GILA 3K0AA 3M4NA 4QODA 3AQIA 1UPCA 3GBSA 4LBVA 3ABIA 4HWOA 4FJ0A 2O0MA 2M6RA 3IQWA 5DNWA 3EOZA 1X92A 3TB6A 2VJOA 3BYZA 4KXWA 4OMFG 4GDMA 5E6SA 2YDYA 3GT3A 2J9ZB 3HHEA 2OG2A 3ZGXA 5JATA 1PJ8A 3O4IA 1EFLA 4KAFA 3N75A 3R9XA 3VTAA 4NCJA 3QTTA 4CW7A 1KJJA 1RTTA 1H5NA 4DMLA 1JGTA 1Q22A 4UEOA 5CIYA 2H2WA 2O3TA 1P45A 3AEQA 5ITVA 1KEUA 1JLSA 2FW7A 1OTYA 2ZRKA 1Q2UA 3A3YA 2Y76A 4OYYA 1TU0A 2O7NA 3URMA 4X94A 5KREA 2VP5A 4C2BA 3QLUA 4P58A 4XOIA 3NAZA 1NVVQ 3MVEA 1KDVA 3TOSA 1A4UA 2JAPA 3THRA 4Z1MA 1SKMA 3PWKA 4BVJA 1WZNA 2G07A 4YJFA 3X1YA 2IL1A 2P4EA 4XGKA 1HKHA 2AG8A 1I0IA 4PRLA 1OHHD 4RWZA 1WR8A 4PU0A 3RH0A 3P52A 1ITZA 2YFKA 4RF3A 3I9NA 4FLMA 4QTYA 2O8DA 2B21A 4XR9A 3C7CB 2IJGX 4ZFNA 5IKXA 3L7NA 3A0UA 3QOYA 4GPTA 5JALA 2XNJA 1IN8A 3OFSA 4GZ5A 4PAWA 4ARUA 1YRBA 3E4DA 4NOLA 2XZDA 1N2IA 3BFXA 3SZRA 5H83A 1J0DA 2FMHA 3AF3A 4E07A 1YE8A 1JUDA 2XKAA 2J3MA 4D96A 4OK5A 2HBYA 1XA0A 1PNQA 3TSCA 4BFZA 3QBEA 3UYKA 3HY4A 4MR7A 4QUAA 2YIDA 3BSWA 3HYTA 2WWGA 3VU3A 5JS1A 1ISIA 1D1TA 3G9ZA 2GEDA 4FYXA 2DHRA 4MIKA 5LMCA 4H2DA 4M88A 4JENA 4EQ6B 3LM8A 1JT9A 4RIGA 3SF0A 1QIIA 4P83A 4JNKA 2PKWA 4W5NA 1PBTA 2FZCA 3IT3A 3MTIA 4FOTA 4Q6BA 3E53A 5JCXA 4CG0A 1H42A 1A9XA 4UU8A 4L8GA 1SG0A 4G5HA 2VDQB 3A1TA 3AERA 4RPGA 1S3GA 4CL0A 2XOXA 1UBEA 2Z0MA 1WX1A 4CV2A 1M66A 5A1TA 1FU7A 2SECE 2C97A 4Q9LA 5EINA 3F67A 4DLTA 2W6ID 4LJ5A 1KARA 1FMCA 2OZLA 3GQVA 4YJHB 6ADHA 1KYQA 3PUHA 2WJJA 2WG0A 1SQFA 2BMVA 2AZ4A 2J0EA 4QVKA 2H63A 3JAWA 4GM0A 5ALHA 2A3NA 2R6ZA 1R6DA 3AUJB 4K1LA 2LTAA 1IN7A 2H5EA 2I29A 2AFRA 4YRJA 2CUNA 4FKZA 4DLUA 1YOVA 4MQ6A 3VAAA 4C5BA 3E5HA 4CM5A 5IDWA 3OZCA 2VO1A 4Q1VA 2V0NA 3HLYA 5ALEA 3UFBA 2J0SA 5DN6D 2G1PA 4WZZA 1EEXB 4CM3A 1ZX1A 2PNJA 2O6LA 3IODA 2O0LA 3E2PA 3KPVA 4I1VA 5DM60 1TO2E 3GMDA 5F4BA 2AEFA 2CDRA 2ZBFA 1KZGB 1OXKB 4MWDA 4PLFA 4C87A 1TM7E 5A1JA 4BMPB 2MSEB 3VYVA 5K45A 1A8UA 4LYGA 4KLZA 4M1KA 3VMMA 4E15A 1SU4A 1VKRA 3BC1A 2XDQA 3IQIX 2JB9A 3ESRA 1P3JA 5ALNA 3IESA 1HY3A 1I1OA 4DA7A 1R8QA 1H8EA 1BCSA 1QR6A 3PDIB 4R8KA 2BE7A 2GF9A 2BHNA 4WLNA 16PKA 5J59A 2Q4DA 2ZUDA 2ID7A 1IPHA 1Z6PA 4ZI5A 3RVJA 3RSQA 4B0PA 2HCRA 3T7DA 3G1WA 2EWVA 4YAWA 1NA5A 3DL7A 2C5EA 3QI2A 3SLGA 4G2NA 2ZB2A 1W34A 1S5PA 4TXLA 1CFJA 4HB0A 3B7WA 4C6HA 2I80A 1MHTA 2I7TA 2I2AA 4NBTA 5FWYA 1KPIA 3R41A 4N7JA 4LKOA 4FBMA 1GDDA 4DRYA 2DFTA 2LWIA 4IM7A 3IMCA 4TSFD 3HZOA 4RO0A 1AUQA 2AIRA 3A6KA 4XB1A 5KI6A 5I7UA 1DEXA 3BJMA 3ZKWB 1J33A 4M0EA 5J43A 2J31A 1LS6A 1S2OA 5AVZA 2Q2OA 1C3JA 3EGOA 3NWOA 5IANA 3ETDA 5JANA 4JT8A 3GYGA 4HS4A 4P2GA 4RETA 4BVGA 2Y1WA 4EJMA 2WU0A 4I2NA 1D7OA 3H4IA 5EJ5A 5ALJA 1X1SA 3KQHA 3LT0A 4NAUA 1LLQA 4D74A 1HFJA 3QKRA 2WTEA 4UVEA 2IHNA 3ZI7A 2XYVA 4MKIA 2WTUA 4XAQA 1OH6A 1DINA 1OWMA 3ZZUA 1PL8A 1AUVA 1WXXA 4IIVA 4TMFA 3R5FA 5T7BA 3BFPA 3I9KA 1BJTA 3RD5A 3ZWDA 3D2LA 5CYFA 3H7AA 1D8TA 2EGGA 3TJMA 4H60A 1P33A 1XP8A 3QG1A 3INYA 1T1SA 1YS6A 1XKXA 2A2ZA 4J94A 3VR4A 4BMYA 2W83A 3P9RA 3S1AA 1V43A 1Z4JA 1H2WA 2D1QA 4QGFA 1GNQA 1WV1A 3ROKA 1CEEA 2MDTA 4J3JA 4B8YA 1KNQA 2EBUA 3HP4A 2BJVA 3CX6A 1QCYA 4FYIA 4LX0A 4ND3A 3WAGA 3CUYA 4LV8B 5FRDA 4CU5A 1ZNYA 5ULLA 4C6TA 5JCJD 1XRMA 4KWEA 4ALJA 3F6CA 4PFJA 5J4KA 3M6AA 4EHDA 2IFTA 2QTTA 1HFWA 4BP1A 3NHJA 1NUPA 1X1QA 2OPHA 2YYAA 3ZYZA 1JS1X 3EJ6A 1C1XB 4B34A 1DELA 3N6VA 5J5AA 5DW0A 5HQTA 3PC2A 4W5JA 4WY8A 4BLSA 4AU1A 2V74B 5AHKA 1Q92A 4Z5XA 3B5EA 3LFHA 4QM6A 4ZZIA 4Y2RA 3IO5A 1TTHA 2G9VA 3V00A 2GZMA 4BRWA 5C7LO 1XC7A 5JS2A 4CU2A 4C1BA 3TINA 2GAAA 1QWOA 5KOJA 1J20A 3OWOA 1Z2AA 4IUCS 4NECA 1HUQA 5C7YA 4I5EA 4GGMX 1Y5IA 3PHCA 1LFAA 3DDSA 1DAEA 3MB5A 1GAQA 1VL1A 4UBLA 3ENVA 5EP2A 3BFVA 5JYDA 2YY5A 1IM8A 3UJ7A 5A4IS 1DAKA 3IQEA 3B9RA 3CZAA 4B81A 4Z4CA 1DOAA 1MHPA 5SZKB 2XNHA 4AZ3A 4B9EA 2AJDA 4DR2B 3KU1A 4GPEA 3HFRA 4JH0A 2XXJA 3A04A 3JS5A 5EGSA 4DMMA 4JQZA 3MGAA 2BI7A 3WGHA 2PH5A 2OC9A 3O1IC 4HZUA 1ST3A 4B2LA 3OEED 5CBPB 2IZ7A 3KQKA 3ROZA 2AE1A 4E32A 1Z73A 2OMEA 3DNFA 4E5UA 1RWPA 3M82A 3O9VA 3JZIA 5CK5A 1CUYA 1TTTA 5A3VA 3AB7A 3D3EA 4K2AA 7ADHA 3THWB 2GLUA 2EFHB 3LZDA 1SCDA 2PCLA 4RACA 1U7XA 3D2AA 4CMJA 1ZI8A 1NUUA 4N8EA 4F97A 2PRSA 3D3KA 3O2SB 2FFHA 3JWPA 4MVJD 1SA0B 2C4KA 3AM5A 3FE2A 3T38A 3E9EA 3WLLA 1EP3B 4H1TA 2HDOA 1YRAA 4XM2A 3DMGA 3WISA 2A4MA 3G59A 3L04A 5KYNA 1QK5A 1QIMA 3G7UA 4F1JA 3V5NA 4AJLA 1CRLA 5A5VA 2QM8A 1QGUB 3G5MA 2W2KA 2ZJ5A 4URFA 3ABRB 2IW1A 2PX0A 1D07A 4IGAA 1P19A 2G1KA 2QL6A 2BSAA 2MSDB 3JU3A 3O4RA 4WKOA 1J1UA 3T7SA 3QZUA 2P6RA 3RLFA 4LNHA 4HEA6 3LXUX 3RSZA 1P5ZB 1APBA 4QWMA 1M6VA 4OHMA 1WCV1 2GUWA 2IXGA 1GG5A 3FWYA 3OEHA 4LBYA 3KUUA 2JLUA 4FT2A 2JBAA 3FZYA 4R1MA 1ZGJA 1OXTA 4DKJA 1ZR2A 2VPWA 1ZL0A 2DM6A 2E4XA 3BQNB 3EPRA 1T35A 3F4KA 5CVDA 2YYZA 5DNYB 3N1UA 1E60A 1GFWA 3IB6A 1W87A 3T5AA 3EXHC 4L4SA 4KXFB 5BQOA 4ZQFA 4DQXA 3OIUA 4FXPA 1JWAB 3HJAA 4Y2YA 1L4HA 2O52A 4A2PA 4M0CA 4MKRA 2P0EA 2ZR7A 4JP8A 1DV2A 4U2FA 2NZ2A 1FFEA 4E08A 3W9BA 4RSHA 5DWVA 2XKBA 4G9EA 4ETIA 2QRLA 4ECAA 1IQUA 3H9JA 1P2DA 2B2CA 1VYUA 2R6AA 2PPLA 2WEKA 4FILA 3KJQA 1FDTA 2VTEA 3PKJA 3R4CA 4DM7A 3QKSA 4L2IA 4OM7A 1Z83A 4GG1A 4BWVA 1X1RA 1XZ8A 1BXRA 1HLDA 2H2IA 1W73A 1XQ1A 1ZKDA 1AG9A 2QY6A 3C39A 3G0BA 3MS4A 4R84A 4WUTA 3ZTTA 2I6TA 5BWBA 3KE8A 3RIHA 1FDOA 1R4NA 2IYLD 5K3FB 2FW8A 2EZ9A 3FKJA 1DUVG 2HK6A 3KHSA 5FA5A 2XVMA 4K03A 4ZAVA 3ROPA 2RHRA 4CT4B 3SC4A 4NONA 4IW3B 4M1QA 3ONDA 3C1TA 4WFKA 3W1EA 4H18A 3VI3B 1GQFA 4BEBA 1QXSA 4ARCA 2OXIA 1R9MA 3KZNA 4LJ9A 3SXUA 5JVDF 3HJUA 4YHHB 2ODAA 2XEXA 5CEEA 2TMYA 3AJ9A 1UBMS 3IDFA 5IABA 3GQBB 1JPJA 5HQ3B 4JSRA 2HW8A 1PJLA 3AVVA 1D04A 2CFOA 2PUJA 4OHWA 5GOTA 5B2ZA 4D0GA 1KP3A 2JAQA 4C3UA 5GZ6A 5A7GA 2NNWB 4WINA 3LQKA 3RYCB 1ZIPA 3WIDA 4DN6A 1QFZA 4IKPA 1NPTO 4QOSA 3ME5A 4LDZA 1G8AA 4NULA 1Z15A 3QLEA 4WK4B 4N0DA 4FVTA 4CVNA 4YMTA 4UUBA 4KREA 3LY8A 3C2QA 5L3ZA 4OMUA 1C7RA 4YCDA 3I0ZA 4GX0A 3IA7A 1BDHA 4LRTB 3Q6IA 3Q8MA 3T3EA 5C7IO 4C08A 3WQSB 2QTZA 4O2AA 5AJVB 4FDAA 5EIEA 3NTUA 2GLXA 3G2QA 2J5BA 3U13A 3WQQA 5A2GA 3L0IB 1I80A 4PO3X 5K0NA 4D9GA 5HIKA 1KZ6A 1D9XA 1N1GA 3AFGA 4OLAA 3LUJA 1DMSA 1RYYA 2B7LA 3TCKA 1PVOA 2PVSA 5EZSA 2ESRA 5FI1B 1GWNA 4J9VA 4TYNA 3FM9A 3RFUA 1E8MA 4B3CA 5IT4A 1RZ3A 3I2FA 3H5NA 2D59A 4GXNA 5TEWA 3DWIA 1V9CA 3N8HA 3T9DA 4RD0A 2Q3LA 5J3JA 1Z3IX 5D1NA 3IVRA 4Y18A 1FFYA 4J4HA 3QMMA 2JF0A 3EG9B 4UREA 3VPHA 3RGGA 4XGIA 5TS2A 2VJMA 5KX5A 4MV9A 2XDWA 3NFYA 2A1TS 4U4AA 1QVZA 1G5PA 1RP7A 2LVBA 2EYQA 4O5AA 3HCAA 1WUHS 4TM7A 3UKJA 1WIWA 2WV7A 3OCWA 3VPGA 4CN8A 4FTWA 2FUG6 4B3RB 2ZIXB 1NJ8A 4URWR 1QDEA 4EJSA 4JLMA 3IEVA 2DTEA 2N46A 3FDZA 3LHFA 2ISQA 4KWCA 1YWGO 4X85A 3BA6A 3FYCA 2WT4A 3VR6H 3GUVA 1A9RA 1T9CA 2B1QA 3DV0A 3RYHA 3B3QA 3P2IA 3DYIA 4GNRA 1H3NA 4ZALA 5MN5A 3EFOB 4CIDA 4DLYA 4K88A 3T1OA 4DGQA 4B6JA 1YJQA 3OE4A 1AS2A 3SMVA 1A8PA 2V9ZA 2WJGA 3MB8A 3R0IA 1DT3A 1Z4PX 3C48A 2ZI4A 3GBPA 5DFAA 1TM2A 3VHRA 3CZ5A 1CUCA 5A2QA 4CTMA 1PTJC 3TO5A 4R31A 3BFJA 2BEVB 5JPIA 1I4OA 1YI0A 3E7PA 4IXMA 3WNCA 821PA 2CMGA 4Y2JA 3M4JA 3ZWXA 4DF3A 1JBEA 3BTOA 4MHSA 4PC2A 2V59A 3FGOA 1RC1A 1Z2PX 2JK0A 2OBMA 4RA9B 3B1KA 3LDFA 3HZHA 2I6UA 2VWQA 4LY0A 5IKOA 3WY9A 2OUIA 1NXSA 4XYMA 1KS9A 1IK6A 3K9WA 4I4IA 5JE8A 4EHJA 3HM9A 1A82A 1SOMA 5G1PA 1J8YF 2H18A 2RAPA 3KD2A 3MLAA 4FONA 4OB6A 2WT9A 4YRQA 2X6TA 2C3PA 3JQFA 5AK3A 3FF4A 2QB5A 4UZSA 4MARA 4M55A 4JN6B 2C58A 4MZXA 4FE4A 3VSEA 1U3VA 3O21A 3A9VA 2GSWA 2M9MA 4N3BA 2V96A 1AT1A 3I3SR 4ZAZA 5K0CA 5T5QA 2O5EA 3BJRA 2YICA 4KHPB 1EFAA 3QFSA 4BO4A 3A6ZA 2Z2XA 3OPXA 1Z08A 1ONSA 5JD6A 1E3QA 2B20A 5FT9A 4D7AA 3OZDA 1CU1A 4XIFA 3RF6A 4OIFA 4X6XA 4D1YA 4DXHA 1BA2A 4KV9A 1JE1A 3QXXA 4UTXA 4WOBA 3RFVA 2PM8A 5H59A 1UFRA 2RC6A 4RENA 4S1VA 2CL0X 3ROTA 1JH8A 4Q66C 1GUYA 3B85A 1E4YA 3PC8C 3FTQA 3S4YA 2Q4BA 4IJUA 1GVNB 4QVIA 1FFSA 2ZULA 4ES6A 1CJTC 4LF6B 2G09A 4MYDA 5K0SA 4ZV9A 2JVIA 2YWCA 4LPSA 3WDKA 5EHZA 2D8MA 4LZJA 3WLKX 4FQ5A 1TRKA 3WSWA 2A9RA 2GAOA 5EXPA 3L8GA 1CDDA 3OF3A 4JP3A 3P2KA 4WNAB 3D5QA 4G0WA 1EVKA 3EGXA 4EKDA 1PWYE 5KJCA 2XQVA 2B4YA 3V80A 3OI7A 3FWKA 2DAPA 3T61A 4I9UA 3TTSA 4RQUA 5KNLA 2P2NA 1II0A 1Z0AA 5BN5B 3K0EA 3F0TA 3DMNA 4R40A 1R9JA 3ZVKA 3VYSB 3U7RA 3THXA 1R2QA 1LC0A 2ZQ5A 5HTKA 4UPDA 1K3TA 5CIWA 4I5IA 4B7XA 1SOUA 1YHYA 4PAOA 2X5JO 3GK3A 4LYAA 3OKPA 1KO8A 5BQ3A 3LH5A 1G7SA 1Z2EA 4W9NA 3T7KA 5IYZB 1CW2B 1NPDA 2OLKA 3CR3C 2IU4A 2O4CA 4KXMA 3M5DA 3N9IA 2HIAA 2PH1A 4KL8S 4ZQGA 5LYJF 2PGJA 4V0OA 4YJKA 1G7TA 2D7JA 2VPIA 2RGDA 2GBFA 3DE7X 3CUTA 5FNVF 3E1KA 1ZO8A 4FYKA 3HWX1 4RSMA 1WWKA 4D9BA 4C43A 3BMQB 4DG5A 2QD4A 4BQQA 3PUKA 2VJYA 1MAHA 2VUIB 4U8HA 4WJKB 3LX5A 2JLSA 4QJBA 1ST2A 4ZEMA 2P3QA 2A8YA 3SZUA 1UBOS 2VYVD 4F71A 4C2TA 3EF3A 2O7RA 1I94B 1E1KA 1L7XA 4Y0AA 3W5JA 1JW9B 2DFNA 4FYVA 4J0CA 3KG2A 5KHAA 3D7RA 1EHYA 4Z7OB 1AZSC 1CUBA 5DWQA 1XP5A 1Q12A 5KBYA 3IUYA 4LOHA 4CDRA 1OU0A 1UUFA 1A04A 3JALA 1KIAA 3EEQA 4FGJA 1ZCJA 1XZLA 1N77A 4LJ4A 2XHZA 1IHXA 2JI4A 5BY2A 2GD0A 2OQIA 4IG9A 2B3DA 1NNEA 4LWPA 2IIVA 3AI2A 4GKKB 2OYSA 4MWOA 1NHWA 3KQVA 4J1SA 1EE1A 5EI5A 4ITUA 1PW7A 3AVTA 4L15A 3TLGB 4JWTA 4C14A 3OZIA 1KP9A 2HI0A 1I9CA 4UVIA 4RZHA 2GA8A 3ZIAA 3W7VA 5CVTA 1Y1QA 1MORA 2C8JA 3HJNA 3QJYA 4JP2A 3RW9A 1J2EA 1MB3A 5A06A 2VTDA 2QIPA 4Q9JA 5CNKA 3VOAA 4CFSA 4D8TA 4GXTA 1NG9A 3PEWA 4Q4JA 2QD5A 4EO9A 4XLLA 3FYHA 1KU6A 5DLPA 4B5LA 4EB6B 4IHJB 3N53A 4U7FA 1F7UA 2YJNA 2P5TB 1LLUA 4WOJA 4W8OA 1IHPA 1RRGA 4RVOA 4RY9A 5JI2E 2DMRA 3H5RA 3HDQA 4V0SA 2CFRA 3AETA 4FUTA 1X87A 2V7WA 1RLJA 1YO6A 4JAVC 5EJAA 4AM8A 1LTQA 4X3PA 1L7NA 1J2UA 2VXCA 4KNVA 5H3HA 1Y6ZA 1E98A 3TXAA 2ZYWX 4I4CA 3WYCA 4D9EA 2NYAA 3IKLA 1W88A 1T9BA 2YDXA 3I30X 1G18A 3IYLW 3J7TA 5LBIA 3UOWA 1SQGA 3BGVA 3EAFA 3H1TA 4LHXA 1DWOA 4HUJA 4ZREA 2P11A 4KRXA 4BUJA 1P7YA 2HAEA 4X7MA 3AHCA 5EJ2A 1YONA 3OBBA 4YJ3B 1QHIA 3CN9A 1JJIA 4DR4B 1Q6YA 2VLIA 3TUZC 5KKCA 4P80A 2OQVA 2DERA 1N1EA 5KQRA 3LK7A 2YV1A 1V4VA 4TT3A 1I3LA 3GNLA 4FFBA 4DWVA 1DI0A 1U94A 2LDXA 4HWKA 4MEBA 4C4TA 4UPEA 1XB2A 2DT5A 3O8QB 4JDUA 2QN2A 2ZT7A 3H9QA 1Q95A 2BFEA 5T8KC 5HX7A 2YC2C 3UQYS 1JHRA 2ZSFA 1H2HA 2NSLA 2WSBA 2WPDA 3LOPA 3N87A 4LXXA 4MVJH 4Y2QA 4ZOCA 2R1TA 4RTMA 1G4UR 3IUMA 5T41A 4XWWA 2BGMA 4DMGA 1HDIA 1H2XA 4UTOA 4ZKEA 3U26A 1UBLS 4KKXB 1VPDA 1XZGA 2C9CA 4I9GA 4ROTA 3EXIB 4TMKA 2PD6A 2YNMA 2PJZA 4YPOA 4RFVA 1RAIA 2V7QA 5E1OA 4EA9A 1B3BA 1NNSA 1PK9A 1PQ4A 3FKQA 3LUKA 2DWOA 3F3KA 4I55A 1TVKB 2B36A 3BWCA 4WKCA 1H5UA 4JQCA 4OYRA 3RNOA 1MC4A 2NU8B 1RXYA 2KW5A 4PGHA 4P5PA 2HNAA 2C4NA 2VH2A 3H8WA 2ZI6A 1YZFA 2W70A 2F43A 4C7OB 1AGRA 2RJNA 2GPTA 2HQOA 4CM1A 3K0FA 1RE0A 2ZVQX 4D92A 2BKVA 1DQSA 3HB4X 4Y2SA 8GPBA 1W76A 3RG8A 1QANA 5BMOA 3KKZA 5BPHA 1A8SA 1R3DA 4EKYA 4C1NA 2FPXA 2X0NA 4P7FA 3EPJA 1IZ7A 3UA3A 3G0IA 3U81A 2PVPA 3O38A 4FX5A 3WLEA 2GB4A 3LP6A 2ZRCA 2OHXA 2OO5A 3S1LA 3SYTA 4CODB 1EKXA 2YRWA 4QX6A 2PUEA 1PZEA 3PENA 4G8DA 3BQMB 4C29A 3VO2A 4D8YA 4DQKA 1VSBA 5FLEX 1GPYA 2F48A 3V1YA 1CY2A 1NASA 1XELA 4E13A 2NXJA 4GEGA 3VR6A 4N0EA 4CMEC 1YU6A 1OLXB 3UAGA 4KQXA 3NC0C 4YAGA 3Q40A 1SKBA 4ZA2A 1VHDA 1UC9A 1H6BA 3FPKA 2PLNA 3I9MA 3O3MB 3JASB 4HB3A 4JKOA 5JAOA 4YAUA 2QD3A 2QG4A 4GO1A 2RFLA 4LX8A 4F4CA 1DQYA 2QJTA 3LQQA 1QIFA 2Q0QA 3IAM1 3LDAA 4RADA 1FDIA 3JARB 1L7DA 3WIEA 5BV2P 4YRFA 5AW4A 1N2BA 4HQOA 2MTBA 1JQ3A 3PVCA 2V55B 1DRUA 4ML3A 1KOGA 3G5LA 4LWQA 1EGMB 1KMMA 2BFFA 4HMPA 2PA0A 3B9PA 3FVWA 1Q19A 3OMWA 4LNUB 3BTUA 2W2TA 2HIMA 1YZVA 2B6HA 1ZUNB 2QW0X 4YJ2B 3RC9A 1JSZA 1E2KA 5D84A 4Q9NA 3B1YA 5CW2A 3KEMA 2YHSA 1OH8A 2FKNA 3EY4A 2RI0A 4DREA 5K03A 3D4IA 3GRVA 1KAOA 5FIUA 2DKFA 3GJSA 5FPYA 3UA4A 2WMNB 1DCMA 1OXSC 2ZI3A 2UXCB 4EEKA 5F52A 1C9MA 5DLQC 4D8VA 1DTEA 2R2GA 1JSLA 1B2RA 1EDDA 2AFIB 4BFSA 3JVDA 3GZ4A 4JUCA 5D5HA 2E4AA 3KSAC 1MFZA 3AV0B 2AEMA 2IITA 1PBNA 1H1DA 4HDCA 1Q0QA 4II7A 1Q20A 3OQHA 3SQOA 3B1WA 2XEDA 3HR4A 3B2NA 3GW8A 3KZVA 4HXGA 4RJKA 4S1NA 3WR5A 1A97A 4BC0A 3OQNA 4DG8A 3HA7A 2XTAA 1OZ0A 1S7GA 3GB9A 3BIWA 4UE3S 2WTMA 1ETUA 5ALXA 2E4WA 1H2BA 5JPCA 1VRWA 2AR7A 1E6LA 1S9DA 3ANNA 2YVKA 3A0RB 3L6DA 3WYFA 2ILTA 2NYRA 2WU3A 3MXOA 3REOA 5JR3A 3KJHA 1GZDA 1BX0A 1AF7A 1RHUA 1QAQA 1LDMA 4QUDA 2O19A 2QZJA 1IQPA 1O0SA 1QP7A 4FC7A 5ECWA 4CQNA 4YX9A 2Z04A 4N5IX 3MFYA 1FQKA 1UMKA 3C85A 3EGCA 3IDSA 3L05A 4L3OA 4L76A 4LOAA 3PE4A 4LYFA 4Q03A 3MNFA 2FFAA 4B45A 4E4RA 4RV4A 1JG4A 2GD1O 4DG9A 5JNVA 3VC7A 1CY0A 2HF9A 2J9FA 2X5NA 4KPFC 4CEIA 3F49S 1IBRA 2ZTUA 5JO9A 1PFQA 1RZRD 1UM9B 2P6UA 2C4UA 4L95C 3ADDA 1A9YA 2FFBA 4KXNA 4MIOA 5DYIA 5I7EA 1VL6A 3CLKA 1OBCA 3ZCVA 3WGIA 4UHKA 1TCBA 2M2IA 2EF0A 2P67A 4MR9B 4Y9UA 2OHIA 2X8LA 3N2GA 5IJ9B 1KC3A 2OV1A 1U8XX 4IIJA 4GMFA 1YFLA 3VR1A 4YCLA 3FPFA 1CETA 3QK7A 1VE6A 2PL1A 1E2EA 2XYQA 1ENOA 4IR7A 3Q5GA 3AUAA 4X8MA 1ZD9A 5BSVA 3ZIDA 2PG3A 1ADYA 1RJWA 2BR3A 2J85A 3OHMA 3G2IA 5ARCA 4QNRA 4RXUA 1UWCA 2XOKA 1BA3A 1RHJA 1SULA 2JASA 3CJTA 3DW1X 1LX7A 3BJIC 4KJXA 5K3DA 5DM0A 3WRXC 4DLZA 5JQGF 3JX9A 1NBOA 4L1KA 3AFOA 3U4DA 5EQFA 4BO8A 4MZDA 1QVRA 3OUTA 1BVHA 2B61A 4DABA 1UWKA 1AY0A 2VF2A 2WZCA 4EUFA 2FMKA 3QE0A 1EGHA 2J4DA 3TZBA 3AUKA 2YC4C 1JDTA 3DE5X 2HBZA 3FXAA 2GNOA 3KEGA 3NZEA 3FBWA 1SB8A 2ZSBA 2YW2A 5HXAA 3VA7A 1SXIA 3ACDA 4EYKA 4I4TA 1A5AB 1WZ2A 3B3GA 2XMGA 4BPBA 5JSQA 2H4XA 4HUQA 1ZW6A 2HFJA 1X3LA 1V11B 3C5CA 3NT5A 4ZRMA 4MVJF 3QPWA 4O59O 5A6SA 4WKNA 1UEXC 3M2TA 5HWSA 2HMTA 4IRMA 1O96A 2BRUA 1TUBB 4A23A 1ZGGA 2QNBA 4ETMA 1M8JA 3GLIA 1PKXA 3TKYA 2QK4A 2CLCX 2CL5A 3UK7A 1GAWA 4LJ6A 3OQ1A 5AH0A 2VIIA 5KYWA 3LHKA 4S1WA 3ROGA 4DJDC 2FKAA 4X65B 4A1OA 2IDMA 1SEVA 3A1WA 3FN4A 2OBBA 9LDBA 4Y98A 4L9RA 3ROQA 2C7GA 3WDLA 4DLPA 3JQDA 4GLJA 2XUGA 4L22A 4H7IA 3ZY2A 1ISMA 2XVZA 2ZSHA 5AVXA 2ZPAA 3CRQA 3N2YA 1ZUHA 3IBCA 4NOKA 4QXOA 3I4CA 3NXKA 3PHHA 3MJCA 4JC5A 5HE9A 3VR3D 4JLNA 3K1YA 3KKNA 4ZOAA 2DR3A 3R3SA 2VK2A 3EDQA 2NSYA 4EPRA 1P7WA 1GEGA 4HK4A 3RU7A 1QP0A 1OBFO 1RAEA 4OJKA 3GRKA 2FWRA 4XSVA 4BO6A 1K7XB 2O8CA 3OZTA 1UOPA 4ZQEA 1IXRC 2FK8A 4GYWA 5B1IA 3AM4A 5AW5A 4M8IA 3VR5H 4EY4A 4C6RA 4B3DA 5KTRA 1RIFA 4N0MA 4DFDA 3H2ZA 4GWLA 4AP9A 3SY8A 3OF2A 3TZQA 3P0FA 1GPMA 3WL8A 4OQQA 4NARA 4AK9A 1OB5A 1ZUIA 2FZ4A 1UBUS 2QTAA 2ST1A 3HN6A 1Q0UA 3TD9A 2KWIA 1ESCA 2VAXA 5I4BA 5HFAA 4FFRA 3HSSA 2QL9A 4C30A 2AG1A 3FHJA 1XCMA 2CF6A 5HM6A 3TF5A 2ISSD 3O73A 4M1OA 3CUEF 4IQ0A 4Y0VA 5LMNB 2OCPA 2ODEA 4NPHA 1XZIA 4PPGA 2G71A 1E99A 4UEWA 3RK1A 3H11B 4K7JA 3RS3A 1MO2A 1L3IA 1DCFA 2HHJA 2DWPA 2IC5A 3IQDB 4MS3B 4WZBA 3RSGA 2GN2A 5D85A 1VRVA 1G1MA 1FP4A 2YZGA 5DKFA 5EZ6B 3DTTA 3U3KA 5BUZA 1UJBA 3DTVB 2WJ3A 5I9BA 4QQKA 1BX1A 4QT4A 2NNLD 3DM5A 1RFGE 2IS4A 3HR8A 3PZRA 1B7GO 4HDMB 4AS3A 1A1VA 4DLVA 1XRJA 3LPNA 3B20A 4CM9A 4CR8A 4X41A 4YMUA 4W5TA 5AHOA 2B99A 5ELXA 5BRNA 4AMBA 4CKZA 1KMCA 4KFRA 1W44A 3TYXA 2EKDA 2O2CA 1CY4A 3H3XA 2DPGA 1JR4A 3ZQ6A 1DJOA 1QC5B 4ZU6X 4BN0A 2X76A 3UWKA 2IEDA 5EMLA 2HYIC 3R0VA 1SUPA 3SYNA 3M1YA 1UXKA 3LYUA 4MYUA 1VC2A 4JGBA 4LXIA 4U6NA 2CMDA 5BQFA 3EYWA 4C4ZA 4RQAA 4IRXA 4B8ZA 4LQDA 3I2HA 1E0JA 2CXPA 4TWAA 3W5VA 4YLGA 5KTPA 5T6BA 3VFDA 4GPD1 1SUAA 3H5VA 4L02A 4YRGA 5H7XA 1FXWA 2BMWA 4QXMA 4E2WA 1ZKMA 1O95D 3L1VA 3IOEA 4BFXA 4D80A 1A3CA 2F6RA 3EXHB 3ND6A 1AS3A 3M9WA 5EHNA 5TX7A 3TAHA 1N3IA 5IG2A 1H1LA 2HRBA 3AEUA 3AY0A 1S2DA 1G6KA 2QX8A 3R3UA 5EMHA 3HPQA 2QQ5A 2Q46A 1WMDA 4XWGA 4NU5A 1XMQB 4ZRDA 3S99A 2LCQA 3ICQB 3TWOA 3IHTA 2VAVA 4M89A 2RH8A 2PZEA 5BUQA 1UZMA 4I1SA 1F3LA 4CNBA 2JGJA 5ESWA 1GU0A 2GWRA 5C53B 1K9VF 3FPBA 1LBQA 3TXXA 4AJ1A 3IR6A 2O8EB 4LY9A 5KOJB 1IMJA 1TAQA 3QELA 2EAUA 1DADA 4N5NA 5C5EA 5FAKA 3O4VA 1W36D 5D00A 1WG8A 1HXHA 3L3BA 3KOUA 4LQCA 4OM8A 5BWOA 3CUKA 3QIAA 1C8VB 2YS7A 4LRXA 3SF8B 2P0YA 4DLRA 3RVNA 4DEVA 1NSYA 2ZLBA 3MTBA 4MB6A 1FUIA 4B9AA 1U3WA 2RARA 1HG1A 1XZMA 3FFBA 1PR1A 5L95A 1QGOA 1R0BA 4FKMA 3VH4A 1G3UA 5JFTA 2RBEA 3TUJC 1XDGA 4C78A 4M60A 3VKFA 2OILA 4ER7A 3GRPA 1GY8A 2H1OA 2F3QA 3V2GA 4TVOA 4D9CA 1T9AA 1RCFA 2F1OA 1I3OA 2GEFA 3HEMA 3ABOB 2GZHA 2VP0A 4FXOA 1UBKS 4Y6GB 5REQB 5I9LA 4ITVA 4IYRA 1R4AA 2XRZA 4B6RA 3QLVC 3UJ8A 4QUBA 2AYZA 3EVNA 4KE7A 1H3EA 1UMBA 3AVUA 2GM3A 3PPXA 4QPNA 1TU4A 4L27A 4Z1OA 3DKKA 4LC9A 1PQWA 2X0KA 3DZCA 4CJXA 5LU8A 1C0IA 1WF6A 2AQ8A 3C8UA 1IZ0A 1JYFA 1T0PA 1ZL2A 1FTQA 4V03A 3S70A 3TR6A 1YRYE 3GFVA 3DPIA 1T8YA 4IQFA 4JFAA 5HRUA 4HNGA 1MJHA 5TC4A 3RS0A 4F9EA 2RHJA 4F2GA 1GL6A 3CJRA 1JZTA 3UV6A 1FVFA 5IEJA 2CLKB 4Z4FA 4AKSA 3AI7A 5DULA 1YZYA 1IH8A 3N74A 1EH5A 3SOZA 1RZUA 4LDNA 2V03A 3B53X 3M89A 5IUKC 1TK3A 4P4LA 3PNKA 4JLBA 5CB4A 2C9DA 4JS0A 4BNNA 1MO3A 3UUFA 1LQ2A 1BDMA 3VQTA 3WRWA 1ES9A 2VYFA 3DBHA 2V7XA 3C3CA 3SDZA 1FQOA 4XPIA 2MSWA 1CB7A 2JBHA 2EGUA 2XT9A 4J2OA 3T9CA 2YXLA 4RZUA 1EINA 4IILA 5L7TA 5D51S 3DP7A 2YWHA 2VZ9A 4RGVA 5JRDS 2O8FB 3BHNA 4FYWA 3FI0A 1DBQA 4AUKA 1L8OA 2RIRA 1NW7A 1QIGA 3H0KA 4BXOA 1A5BB 3DDHA 1J23A 1VP3A 1BEUB 2FNAA 2QLNA 2XKJE 3HKBB 3K4QA 5KCMA 2ENUA 1I32A 2GJ8A 3E5NA 4IFIA 1P60A 1NXOA 1TYZA 3OLXA 2OHHA 1SZPA 1L7PA 3NKFA 4QDOA 4F3YA 3JQ9C 4FNOA 4EMUA 2AC7A 2HTEA 3BE8A 3L7BA 3WWPA 5HKAA 4QG3A 1K7CA 1CKEA 5M2QA 1PK8A 2GBPA 3MBKA 2Z6QA 4X1YB 2Q6KA 1MB0A 1C5KA 2Z4SA 2QRJA 4G37A 2IXDA 5EYPA 5KAPA 1QCZA 4LRYA 3DFFA 4MQ5A 3GFSA 1CZRA 1J99A 1JFFA 1ENZA 1TUGA 1XDUA 2Q50A 2Z9BA 3TX6A 3LPCA 4EG8A 5T64A 3K8QA 3GOQA 4G6ZA 2ZI5A 2CDBA 4H1VA 4MJ3A 3TFWA 2NUBA 4OSPA 1BRMA 5JXIA 1M8GA 2R62A 3Q3IA 3NTXA 2OGWA 1EFCA 2XADA 2F90A 4EL5A 5CA0F 1JLMA 1RXUA 4QU0A 2EKZA 2XJ9A 3GEBA 1U7TA 3HDGA 1VPEA 1PJAA 1YB2A 2ABWA 1R6VA 1X42A 2YJ4A 4L07A 5BSMA 1H2EA 1OYWA 2PA3A 1X0XA 1X1TA 5IZCC 2X9QA 4QGAA 3PQ7A 4KYUA 3PU6A 4GS5A 3WGGA 1E1QD 3TW4A 1ILWA 3OAAA 3R8FA 2P4SA 3HXMA 2UZ3A 2FMTA 3JQAD 5MHTA 2M6LA 1VBNA 5HUJA 4OP2A 2BOVA 2PQ6A 2VDUE 1FRFS 1U3CA 3C15C 3OH8A 4ZVUA 1DJQA 4QJ5A 5AM5A 5FV4A 3UT5B 3A4VA 2VFAA 4F46A 2PO7A 2EFGA 2DBQA 1NI4B 2ONYA 5EQDA 4LHSA 1ILEA 3VH1A 4GZ3A 4OA5A 3OFND 4O4IF 2A4KA 4PQEA 5IBPA 2D3WA 1PFYA 3K35A 3VTKA 2JGNA 4B6PA 4EHHA 4N40A 4QQNA 3P45A 3SIRA 5EJ4A 1U2SA 1U7PA 1EZZA 1EXDA 1ZHHA 1JA0A 2CC2A 2P1RA 3I6MA 2ZOSA 3VR5A 5CITA 4WLVA 3AKDA 1P0CA 4GR5A 3GFRA 3VKUA 3W3AA 3ZH2A 1ADFA 2VP6A 3NHAA 3VOSA 5KMGB 1I2MA 2BVNA 4F6RA 4WCFA 4P82A 4EUNA 1CQWA 1M1YE 3CS3A 2F3TA 1PT8A 4ME6A 3COYA 3NBUA 3ZH9B 5JPDA 3C6QA 2GBIA 4QLAA 1UKBA 5ALUA 2P2YA 4QBFA 3RI3A 4X7BA 2HHCA 2WYUA 4GOXA 3SS7X 3V6MA 1W5FA 1G42A 2C31A 3R1IA 4RHTA 1XA4A 4CMIA 1LEHA 2ROQA 3UOGA 4GUAA 4KP7A 4IFBA 3X2EA 2OD9A 5I8ZA 2GZDA 1RM0A 1GLGA 2C99A 1BTOA 2D2IA 2DE0X 1MZVA 2AMFA 1E92A 4M83A 5L51A 1WVGA 4TSKA 5E1BA 3X1WA 3VZBA 2CV0A 1PV4A 1LK5A 2MSCB 1YA8A 3DKIA 5EZYF 2I34A 1RE1A 4ZYTA 2EBFX 4PZ0A 4AY5A 2AX4A