4HX2A

Crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KerA
publication title Mechanism of action of a Janus-faced single-domain protein inhibitor simultaneously targeting two peptidase classes
doi rcsb
source organism Streptomyces caespitosus
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4hx2A00
2W2NA 2W2QA 1ST2A 2PRKA 1YJBA 1A2QA 3DE0X 3DE2X 4OMDA 1ZVJA 5SICE 1SPBS 1AH2A 1GTL1 3BPSA 3GT4A 3UNXA 1T1EA 2PMWB 4K8RB 3A3PA 4FONA 3DE3X 1SN7A 3CO0S 1MEEA 1Y3DE 3DVRX 1C9JA 3DVQX 3D9QX 2Z58A 3DVSX 3I2YX 1KDZA 1TMGE 3A3OA 3DW3X 4C3UA 1AV7A 1C9NA 1MPTA 1SUDA 3DE5X 3ZXYA 3LXUX 3BX1A 2HPZA 1Y34E 3DDZX 1BE8A 2ZWOA 2ZRQA 1Y4AE 1TECE 2QTWB 3T41A 1DUIA 5I9SA 5AMXA 1PEKE 3Q5GA 4H6VA 3TI9A 4DWWA 3DW1X 5ARDA 1BJRE 3EIFA 3I37X 1SBIA 2PQ2A 4B5LA 5JMOA 1YU6A 4LVNA 3Q40A 2WWTA 3WQBA 1SUPA 1WMEA 4ZOQI 1SUCA 1SIOA 1NLUA 2DP4E 5B1EA 3I34X 1ST3A 3GCXA 5ARBA 2Z2YA 1BFUA 1SUBA 1P7VA 1R64A 2P4EA 3VTAA 1AU9A 2W2PA 1AQNA 2X8JB 1LW6E 4RYDA 1PTKA 4H6XA 2W2OA 5FFNA 2WUVA 4CFZA 3AJ8A 3TECE 2PKCA 3SQOA 1ZVKA 4NE9A 4DJ5X 5JXGA 3QFHA 1GTJ1 3DE7X 2PWBA 1TO2E 4NE7A 3TI7A 2XTJA 1OYOA 2PWAA 2WV7A 4NMXB 3VV2A 2G4VA 2XRMA 4YN3A 2SBTA 4J94A 4CG0A 4AKSA 5B1DA 1WMDA 1TM1E 2DQKA 4I0WB 3LPDA 3DE4X 1Q5PA 1PFGA 2ST1A 1AK9A 3VV3A 1THMA 2E1PA 3CNQS 1Y48E 1SVNA 1OYVA 3WIVA 4CFYA 1GA6A 2Z56A 3BGOS 1P8JA 2IY9A 4OMCA 4HVLA 5FAXA 3DYBA 3F7MA 2Z2ZA 5K7SA 1GT91 1IAVA 1AVTA 1WMFA 3DE1X 4M1ZA 3F49S 1OT5A 1SCBA 2PYZA 3PRKE 1AF4A 2ZWPA 1Y3CE 2GKOA 3F7OA 3PTLA 1Y3BE 1VSBA 2WUWE 2IXTA 1Y3FE 3QTLA 1TK2A 1PJ8A 2SECE 1R6VA 1GNVA 1V5IA 2Z57A 1S01A 3EDYA 1C3LA 2SICE 1EA7A 1GTG1 2TECE 1WSDA 3H42B 4ZARA 3AFGA 1WVMA 3WIUA 5FBZA 2X8JA 5AVJA 3A3NA 2W2MA 4AKTA 1S2NA 1C9MA 1NDUA 1NDQA 1KDVA 4JP8A 1YJAA 1SUEA 4KB5A 2B6NA 5AQEA 5JXJA 3WHIA 1TO1E 3GCWA 5CW1A 1SCDA 1SBCA 1HT3A 1SUAA 1SELA 1TM4E 1S02A 1TM3E 3OSZA 4GI3A 4KPGA 1XF1A 2Z30A 5AVKA 1SBNE 1TM7E 1P7WA 3SICE 1GA4A 4WOCA 2ID8A 4BWGA 4DZTA 1V6CA 1GNSA 1KE1A 3L1KA 1T1IA 2DUJA 4MZDA 3EE6A 1GCIA 3I30X 5JXIA 2Z2XA 1JEAA 1SCJA 3GT3A 3VHQA 1SBHA 4H6WA 1CNMA 1BFKA 1KE2A 1Y4DE 3VSBA 3AJ9A 1T1GA 3QMPA 3ZXXA 1CSEE 2HD4A 5JXHA 4C3VA 4KG7A 4WOBA 1IC6A 1KDYA 4OV6B 4Z2AA 5ARCA 3LPCA 3P5BA 1YJCA 2ID4A 1TM5E 1SH7A 1UBNA 1SCNE 3DWEX 1SBTA 1Y9ZA 1Y1KE 3DE6X 1EGQA 1SIUA 1BE6A 1DBIA 1Y33E 4HX2A 1SIBE 3D43A 4LVOA 1BH6A 3LPAA 1SCAA 3HJRA 3VYVA 1R0RE 1GA1A 2V8BA 2SNIE
chains in the Genus database with same CATH superfamily
3IP7A 2ZUBA 5E95A 1PP4A 3HA2A 2A84A 2ZB2A 4YB8A 4JGIA 4JKIA 4S1PA 5CYPA 1FNCA 1QCZA 2C5BA 2PT9A 4GX2A 4KRGA 3NANA 5BV7A 3VA7A 4R1PA 1HR0B 2QI9C 3ZW9A 2VSFA 2XR1A 2QSJA 4GUAA 1D2NA 1UPTA 4KXNA 3IC5A 5EIBC 1EWQA 3AO0B 1A2KC 1O89A 2HXGA 1OH6A 3QPBA 2PT6A 3H2JA 4OGFA 3HYRA 4UHCA 4WZAE 2OKCA 4YWJA 2GLXA 3CY6A 3NJRA 4L76A 3OA0A 4Q9LA 2I91A 1FP4A 3LX5A 3FZNA 2B83A 3LG2A 2JH8A 2VHWA 1QHFA 1FQJA 3QVGB 4FGUA 2CY0A 3C15C 4BJHB 3LKDA 1HTTA 3KDPA 1KMHA 3KUXA 1CUCA 2FDRA 2EKBA 3CBQA 4XCXA 4CKYA 5LPNA 1EM8A 2ZXFA 2H3EA 4M7RA 2VDVE 4BNMA 4JUFA 1C0EA 5A6SA 1UBTS 4PLHA 5AK0A 3AM5A 3GVPA 3OZWA 3ANTA 1UDBA 4YMGA 3DMYA 3OE7D 2FMUA 3FDIA 5LQMA 3DHNA 3UC5A 3EQ9A 2WJ3A 2G5CA 4R1NA 1DBRA 1U7WA 4LYAA 5ITWA 3U80A 4YT8A 2J4CA 2B1JA 5FI0B 4NYIR 5E0OA 3PEUA 1XU4A 2YZMA 1JYSA 4YJ2A 3F74A 4XWAA 4F2GA 4FFVA 1E63A 1R0ZA 1VE7A 4TSFA 5I8WA 2C9OA 3N0WA 3U6BA 1U0RA 3AUXA 1VYHA 2EOAA 2Y8EA 3IMGA 1T4GA 4AIIA 1ADJA 4DQVA 5IXJA 5B3LA 1OI4A 1R0WA 2AE2A 4MH0R 3EWAA 1W2GA 1RKVA 3CR8A 3QBDA 4AO7A 1VHJA 1HLDA 4XRGA 4XQ0A 1KEWA 3OPVA 4DCPA 3NCTA 1IN6A 4FWBA 2PVSA 4B34A 2F8LA 3L79A 4R9SA 2YN0A 3Q85A 3A9WA 3HR4A 2HRRA 3UWSA 1AQJA 2I62A 1EFHA 4NFSA 3FNQA 1OZGA 1J8FA 4E51A 1BE8A 4DN6A 4EHBA 2OECA 2UZ3A 5JNLA 1DPGA 3WRYA 3KVRA 3HO6A 1QAMA 2CDBA 1E2GA 3HHPA 1K8YB 1WEKA 2IQIA 2PR2A 2Y0CA 3G5AA 4M8IA 5ALTA 1Y4AE 3P0RA 2ZATA 4RA6B 4M21A 1JEYA 2JC3A 4IDOA 1LJ8A 2NIPA 2VUIB 1HSZA 2LBPA 1QZ3A 3JYOA 3LLVA 2YJZA 1KFKB 2H1SA 2JGMA 2WTNA 3FUWA 1KFEB 3JQGA 1ZJZA 1PNVA 3PWTA 4IFBA 4RPLA 5G3ZA 3QV2A 2H7CA 3SWWA 3Q7SA 4UD6A 4ER6A 2AB0A 2IA5A 1M8KA 5DOZA 2HJSA 3ZDZB 2WQZA 5KB3A 3GX1A 4IDQA 4R1UA 3Q6NA 1SBIA 1JECA 1GKLA 4KIJA 4A6PA 3DEIA 2VJCA 2A67A 3EXEB 1DOHA 3IA7A 5CBKA 1VOTA 4CHGA 1KAOA 4OB6A 1D9ZA 3AFHA 2PSHA 5GADl 3D54D 4RGYA 1Y9JA 5I4CA 3FNBA 2PJDA 1PTJA 1OXKB 1RWWA 1SAYA 3SF8A 5KVAA 1PR1A 2DH6A 4DCJA 4DMCA 1G4HA 1F2VA 4XIIA 1L4GA 4RXUA 2PZAA 4FEYA 4JEMA 3WS7A 4RWZA 1JVNA 3JRWA 4BN5A 3OJWA 1LDMA 1L5HB 3NHWA 4O2BA 5DBIA 3RB8A 4PZCA 1WBJB 3PQ3A 2OO5C 1KY2A 4OMUA 5DM70 1U2DC 3ADBA 2J3QA 2BHNA 5LWQA 3UK1A 4ZQFA 3E5RA 5B1HA 2HFKA 1Z12A 1WXIA 2NU7B 3OCUA 3MK31 1JP7A 2LV8A 3FYUA 3R8XA 1XE3A 3FOZA 4RPHA 2GX6A 1L4BA 1ZK1A 1IHPA 1FSGA 3H05A 2CHEA 1CS0B 2Q2QA 2TMKA 4Z2YA 4XX0A 3GJYA 4OA5A 2WNHA 3K0CA 2Z04A 2HJVA 2O2JA 5CA0A 2PUCA 1DX9A 2GT1A 4BZXA 3T5CA 3RFUA 5DCUA 2FN8A 4YP0A 3R3YA 5DV9A 1DZIA 1IEQA 3FVRA 3AVQA 3K7EA 3PHCA 1EPUA 1TVKB 1QYXA 2Q49A 3L7DA 3QXXA 1H5UA 4K9RA 3X1KA 4HADA 4P2BA 5KVCA 2ZRLA 3SHOA 4DV3B 4LN1A 1SOUA 3AEXA 1CY6A 2FRXA 3TVYA 2BKAA 1BYUA 2CKDA 3KQLA 2H1HA 1W59A 3WXMA 2O6HA 4C7XA 2EJUA 2FLWA 2QTLA 4DDVA 2C5EA 3BJZA 1Z47A 5LP6B 2BM9A 4IXDA 1D2GA 5GJWC 5IPFA 2HNAA 2ZSUA 3TECE 2H2HA 1Y8QA 2RIPA 3P32A 3ZCQA 2JBWA 3TDMA 2GK3A 4YUXA 3THWB 4XH9B 2UZIR 4LXGA 4B17A 4IHKA 3Q3VA 2XJ4A 2XYGA 5EEHA 4N3AA 4PO9A 2V59A 2YCBA 4PCAA 5F64A 3K2EA 4S1OA 1G21E 2EEPA 3DAPA 4D3XA 2BGGA 2IYNA 3UJAA 4RHEA 3ET5A 2PXAA 3FNHA 2PGNA 3PL1A 5JROA 3GDFA 2WOOA 1JHPA 1G9XA 1E79A 3B1JA 4UTXA 2WV7A 3L04A 1CR4A 1J06A 2PUBA 1IE3A 4JVSB 2XUFA 5GONB 5EE9A 2B9EA 1ZH0A 3JQ7B 1LPPA 5UKDA 3ZZ1A 4IKPA 1HMYA 2XPCA 1RC8A 1GKKA 4MEJA 1VLZA 4O4IB 5ILOA 1TU0A 2AHOA 2NQTA 3HCOA 3IPAA 3WGMA 4C4XA 3SQDA 1NZJA 5I7RA 1EGVB 2IKSA 4A6DA 1H23A 4YRZA 3VNRA 2C5FA 4XIJA 2NVUB 4D3DA 5LSAA 2VAPA 3AWDA 4D9NA 2Z98A 1A5SB 3WK6A 3GL9A 3LPDA 1N8KA 2FKAA 4NIMA 1VG1A 3DLAA 2GF2A 3ZNPA 3UUEA 4X0EA 2DQ4A 2B8JA 1SCUA 1SWWA 1YJXA 1Z5OA 3HS3A 2BUAA 2E5WA 2J9GA 2X1LA 3ASVA 2JI6A 1T29A 2X9QA 1OBFO 1J9ZA 1POXA 1WV0A 1XL1A 3HU1A 3JV7A 2BMDA 3BORA 4KE8A 4XDHA 1ZHHA 1VLMA 3QYFA 3DQZA 4JBYA 5DNWA 4B0OA 2AZXA 1RZRD 4Q00A 1S4MA 2BFEB 5A9SA 4B84A 1JDTA 2AOXA 4O2RA 1HYEA 4R8LA 5HF5A 3HUEA 4IX9A 1UK9A 4X41A 1KTIA 1NG1A 2A78A 1V2HE 4JSTA 1O8BA 1RYHA 2C4KA 2FZCA 3CRZA 3K5WA 1CP2A 1PJRA 3E1SA 3RRJA 4DIOA 4NQZA 1ZD1A 1XAJA 3A9TA 4EHHA 4C01A 4I1PA 3IP9A 4XJXA 3NASA 6GPBA 2H00A 3BWYA 5KTRA 4JYAB 1S2DA 3LJKA 1QVZA 1UJ5A 2FSSA 1NNI1 5MN4A 2BISA 2QDXA 3KBBA 4Z9YA 4YRCA 4D96A 2B78A 2W93A 1WMFA 2JJQA 5HFAA 2ZJ4A 3LCCA 2VS1A 3ZW7A 3P2MA 2FP3A 4C2UA 5HK9A 5JQWA 3QIVA 1KI6B 3HP7A 5D86A 2XQJA 1XTKA 3THXB 1T2UA 1ZGBA 2YDYA 3NYWA 4QUJA 5DRTA 1EFPB 1KXZA 1UBLS 4I7EA 1G5PA 4URWR 4C4ZA 4F45A 4WBNB 1ECBA 1IPHA 3QWBA 4RTJA 1EUCB 5JWHA 5K0CA 4IDHA 4DRXA 1FSFA 1JLMA 2MHCA 4Q3EA 1L7VC 1V9LA 2PUFA 1K88A 3W5AA 3F7OA 2DB3A 3BBLA 3R3SA 4N4AA 5G41A 3RUPA 4BCBA 1GN9A 2JK1A 3S5JA 4P1ZA 1NA5A 1V7CA 5IJWA 4I66A 4WKGA 4RF3A 2O7QA 2L82A 1VKRA 4AY5A 4EY3A 5IAGA 1E8NA 1L6RA 3PHGA 3QTLA 5AOBA 3WK7A 3LKVA 2EKQA 4HAVA 2HT6A 2ZS9A 3PC2A 3HJAA 1YACA 5BOVA 4JGBA 2OXEA 3ZGZA 4ILEA 4J6FA 1S9DA 4ZO9A 1KO7A 1DX6A 1GPWB 5FPTA 4X1YA 5BP7A 2W2VA 4CMIA 3EPRA 2P9HA 3F2IA 1OBVA 4K6MA 5TQ0B 1V4NA 1C9YA 2C9BA 1A77A 1WHTA 1WSDA 3MHTA 4D9EA 5JJCA 3PA8A 2ZUCA 1KAMA 1A96A 2CYCA 4G25A 4GZMA 3LF1A 3W5CA 5FNVA 2I4LA 1DKMA 2OZLB 2ZCJA 5C7LO 1PT5A 3NEJA 1XQXA 2Y4NA 3OJFA 1UWCA 2X8JA 1NT2A 2C2OA 2Z43A 3QPUA 2NU8A 2AQIA 3RS0A 2A6PA 1T1SA 4DCOA 1WABA 1YONA 2W2MA 1OWMA 4ZGWA 4X61A 2FU5C 1F3LA 2Q2OA 5I7HA 4LV6A 2XSZA 5DYWA 3V1KA 1KDVA 4GOOD 1VE3A 1UXJA 3VDXA 3TFWA 5AXBA 5LVAA 1SUEA 2JGEA 2ZUVA 3KFXA 4X7PA 3DMRA 4A6EA 1T9BA 4G4SP 1ZMXA 5BQOA 2X15A 2I6TA 4O4HF 2O3RA 2QZZA 1M10A 3CURA 1V45E 4QVIA 4YFYA 3JQEA 5LMUB 1E3MA 1TT5A 3IMFA 1Q7CA 4XDGA 1LV7A 4ZIRB 4MDFA 3P19A 2J7PD 1OXUA 2RHBA 3R0JA 3DB1A 2BE9A 4N3BA 4G24A 1SELA 3H16A 1S1MA 2QN9A 5LDDC 1LVUA 2FW1A 3NPAA 4NG5A 4XIYA 1GXSA 1KYWA 1LNSA 3ZWBA 2AS0A 3FVVA 1NUAA 3L7CA 1VBMA 2VPZA 1E3IA 4HWRA 1IXKA 2ZWVA 2QS9A 4FFMA 5C5DA 1CQZA 4MV8A 5C8VA 2A7XA 5F3DA 4B7XA 2OCKA 4O4LA 1A8IA 2YNMA 1HA3A 2X8WA 4WESA 3RRBA 4L72A 1QOPB 3ICEA 4FNAA 1UDXA 1MV8A 4J2TA 4AJHA 4QNMA 4XLLA 2WT4A 2RK4A 4ESVA 4TMWA 2YHSA 1AQYA 1C3OA 2PT7A 2GCGA 4IEIA 1L5NA 1ACJA 4DMGA 3HO1A 1U7PA 2JFZA 3TQOA 1WXDA 2VQFB 2PXXA 3TNJA 4OAQA 1NSTA 4ACBA 1CUUA 4DKJA 1XEAA 4X6YA 5LUBA 2X4IA 1D2CA 4KH0A 3FPSA 1ZONA 1ITZA 3AHCA 5DB4A 3ZKWB 4ZCIA 4O0LA 4R2KA 4R81A 3SZUA 1OAKA 1P7WA 4MCIA 4UU1A 2VJDA 3ABQB 2Q2VA 1WDMA 3CHYA 5BN1A 2DE0X 4B2YA 3HSSA 1GQQA 3QUTA 3WRWA 4E08A 3LO8A 4MQ6A 2BJVA 2WE7A 1V6CA 5BSMA 4CBVA 2H5JA 4BO2A 3N70A 2WD7B 2Q5LA 3W5HA 4UFNA 4HUJA 2COUA 5HZHA 1M2KA 1FYXA 3QEMB 5FLYA 2AI1A 3MJ4A 3U4MA 4ADSG 1K4KA 2O20A 3H8WA 5LDGA 3O75A 3W2GA 3MCAA 3WNVA 1OB2A 1VGQA 2WJJA 4PPQA 1VLHA 2Z2XA 3CT6A 4OGKA 2ZM5A 2VBCA 1SCJA 4J7AA 2Q6LA 3JWEA 1S5PA 1A76A 3FLBA 3IE0A 1Y9DA 1EVJA 2DZDA 2CFSA 3QXGA 5DBEX 2J46A 3EVTA 1D1PA 3AJ9A 4WY2A 1I7DA 2GXAA 4IDEA 4UXIA 2PZMA 3EMVA 4DDKA 4GOND 2EWWA 1DDIA 3D0RA 3JQ8A 3OCWA 4MMXB 3ROEA 3W6OA 4D26A 1IXSB 2IOQA 1L3CA 2JVKA 2NUTB 4H7JA 4QYXA 2VF8A 4GMHA 3G5MA 3ZI4A 1VFPA 4MSUA 1WLYA 4UEKA 2VTKA 3ZDYB 1MN6A 1EI9A 1U8TA 2WHQA 2XYRA 2TRSB 3PDUA 4TRRA 1T35A 1PQYA 2FSFA 4OSPA 5LQSA 4LZLA 3D6TB 4D43A 4WOBA 3MD9A 3DBVO 3AI1A 2V7EA 1DAPA 1PVVA 4MWBA 1FNNA 3DL4A 2XUOA 3DONA 2PU5A 3H5RA 1K89A 4DCUA 2GO7A 1R5NA 2X9NA 4ZOAA 4BYMA 3F46A 3OZUA 3QNUA 2PAAA 1K6IA 1U3GA 1Z2AA 1X13A 1WY7A 5JIBA 1SB9A 4OYRA 1NP3A 1J24A 1OLUA 4RQTA 4PLVA 1T9DA 4XIFA 3PYMA 5AH0A 3AJAA 2A1UA 2R4UA 2Q7DA 3VU9A 2K6GA 3PRYA 4L9RA 1PJ3A 1BMQA 1V5FA 1K92A 2XITA 1AKEA 3SZGA 1PD1A 2QUIA 3T1NA 1NLFA 1AGXA 1IWBB 3LC7O 4P81A 1NATA 2XE8A 3T9EA 1HDCA 3VPXA 2B0CA 3BD7A 3OJ0A 4J49A 4II7A 4OJNA 4DLTA 4GSLA 1E6KA 2GN2A 1W7AA 3G5UA 3R3WA 5L51A 1AOXA 3MFQA 1XX6A 2GNPA 2JL1A 3EPJA 1U9CA 2FE4A 4LMPA 4AQDA 3I8XA 2A94A 2FF5A 3LK6A 3HA5A 1I14A 1E9AA 3KG2A 4HY3A 4G86A 1ZK4A 3W7BA 4U6SA 3NUZA 2VDOB 4IIGA 2VYNA 4HNTA 4FOLA 1G59A 2JIOA 5JC1A 5C52B 1I6LA 1NQVA 3T1OA 3GUYA 2OQVA 4FK8A 5FR1A 5DYYA 3CTPA 3ICPA 5TJ9A 2FWNA 2JJ1A 1II9A 1Z6AA 2H4XA 5ECWA 1ETUA 3VKWA 4GO1A 1IQUA 4WCFB 4EDHA 4C2TA 5CT9A 1RXIA 2OBXA 2NQ8A 4IZIA 1HV8A 2X13A 3A1TA 3BBPA 4EKNB 5C51B 3WISA 2RBGA 3IDQA 3V4OA 1R0BA 1EVIA 1KH1A 2CD9A 3H18A 2EL7A 2UUPA 4JEUA 5IRCD 3B7PA 4B3XA 2P8SA 3I53A 3KLMX 3K92A 3C0KA 2JEOA 3KTAB 3M5PA 4CQLB 2G9RA 5FO0A 4LOHA 3RS9A 1E69A 2D2XA 1PUXA 2UVPB 4GF5A 4IGFA 2RGXA 2VXCA 5JMTA 3BFKA 3M5CA 2C3PA 2I2WA 3WVNA 3EY9A 3L93A 4FDTA 3T06B 3WLQA 3M4YA 4QGSA 2FDCA 3BPSA 3GT4A 4FYKA 3L0YA 2XUJA 5J2UB 4BWFB 1WUYA 2BZSA 1HOXA 3W5DA 4Q66C 5AI6A 4ZT2A 2D5CA 2ETVA 4FONA 3Q0TA 3QVKA 4MW9A 3A31A 1DB3A 1NONA 5EC8A 5FOUA 3WL5A 3K94A 4E3WA 2AG8A 3KFLA 1JPJA 3MRTA 3HDTA 3KS9A 5HFJA 4MVJE 2V7QA 1ZU5A 1ILWA 1T8UA 3RARA 2HMTA 4NBUA 3QHQA 1WHSB 1JUDA 3IESA 3DVQX 2EJVA 1GGVA 1CY1A 3K1JA 4D1YA 1P5FA 1ZKMA 4YCAA 1IPEA 1M2OB 1RWOA 1SBZA 1K8ZB 1PEDA 4HUQA 2ZYGA 4BQSA 5AVVA 4NV1A 3IOCA 1HXHA 2WSMA 3NXSA 5C46F 2WHPA 2QRZA 2QR3A 3A3OA 3PUVA 1A8PA 1ORVA 3UKDA 1GO2A 3W79A 3SFVA 1Z0DA 3CZ5A 3AU9A 3UEOA 1T4DA 5D2CA 1I1QB 1RZ3A 1CWUA 2POCA 3DBRA 2PSEA 3JTEA 4LNUA 3W06A 1KAQA 3T1HB 1ZI6A 4EB8A 2JGJA 1GFSA 2R62A 2ZB8A 4IG4A 4W5OA 1QE3A 1LJLA 1I94B 2A0UA 1N6KA 2FW6A 3BXHA 3ZTWA 2NSYA 2LNDA 3A26A 1MG0A 3CH4B 3DAYA 3DQPA 3I4LA 1Y34E 3R6GA 4NZZA 4OVKA 4PO3X 4R54A 1N7JA 3NDBB 1GPJA 1WD7A 4Q15A 4ZEWA 4Z9AA 3JYPA 5HK8A 4KLCA 1EGMB 1ODLA 1J2RA 5E6SB 3TLEA 3Q11A 1LNZA 5KTOA 2Q3DA 3R9WA 2O59A 3LK7A 2JGIA 3EOBI 3PDWA 3KEGA 1E61A 3ETCA 1Q7RA 4IQ0A 4MHOA 4B8YA 2I2AA 3RGGA 3GQBA 5GM2A 4M46A 3NCHA 4YO8A 5EMNA 2B92A 2DVMA 2WPDA 1SJ9A 3D8RA 1RM0A 4JQYA 2M2IA 4JP1A 2H4FA 4MQEA 3CGGA 4PVCA 1XCLA 1C41A 4URYR 3SLRA 4ZKDA 5HKKA 1CJBA 2Q29A 3T7AA 3T1TA 4H6VA 1RE1A 2H4HA 1P9RA 5E3JA 5CB0A 4D4JA 4OI0A 1WPXA 3CLSD 1V8FA 4EJSA 3L4SO 3AVXA 2XAAA 1Q0TA 1NAIA 5JMOA 3K6SA 3MTIA 1VJ5A 1Y3IA 2JHAA 4R8RA 2IT1A 2GPBA 3TL2A 3B1VA 5TT1A 5A4AA 3R41A 1DSSG 1XWWA 4LVNA 4TV9A 3SMVA 1U1CA 3RTEA 3GLGA 3GELA 1M34A 4HG2A 2XWJI 1SB8A 1VBFA 1V25A 2GQ0A 2MR6A 2PKQP 3EJ6A 3QUBA 4WK6A 1L7QA 1P9WA 2GPJA 2I8LA 3ZQ4A 4G0VA 3ZWDA 4MS4A 3KOZA 1NYTA 4AKEA 3S5UA 4O8ZA 2JCXA 4AJ2A 2BWJA 3U7QA 3UHOA 2PS9A 5G0UA 3CPHA 2H1IA 5CVJA 1NN1A 4YJGA 3E48A 3K0BA 3I34X 3I1FA 1HLFA 2ZVDA 3KWFA 4HX9A 4MIKA 5EXPA 3OWXA 3WC4A 4JVMA 1JJ7A 1U02A 2F43B 3NGLA 3VU3A 4B3IA 5TF4A 3FA2A 4D8WA 4ZHQB 3RHZA 3PUZA 4HDSA 4HR7A 2FMFA 2EIXA 2IHBA 2M9MA 1L5KA 2B21A 4KHPB 2TYSB 1JFFA 3FN4A 4G1MB 1VQ1A 1Z15A 3BTOA 5JCJA 2DUNA 4GR4A 4JLVA 2A9JA 4NDNE 3UWDA 1ZX1A 2JIDA 3ELYA 1EFLA 4Y2UA 4QUGA 3SDZA 3WGZA 4D74A 5SZJA 4EBBA 2NVWA 3DTNA 2O2CA 4D9HA 4M1OA 3N8GA 1W1IA 1J8DA 1QV6A 1UMCA 2OQRA 4D3SA 1GP2A 2Q3BA 1GDHA 3SIXA 4U9UA 2V74B 2YYAA 5A5VA 1LW6E 2JD0A 2HA6A 3K72B 4MS3B 5HQTA 5B12A 1EXVA 1U0SY 1VBNA 2CXPA 4BTLA 3ZE6A 1I3OA 3SBDA 4ICIA 3SBOA 1L3BA 3IDAA 4CFSA 4ED9A 2FEOA 2Z83A 4QPPA 4JHLA 2EJTA 2FPIB 5AW5A 3WLAA 1XMIA 1UDWA 1B1CA 1P2TA 2J5XA 1J33A 4ZOLF 2C97A 3BQ9A 1K7XB 1HDZA 4YUZA 4QDXA 4JB0A 1IG3A 2PBRA 1FDUA 4RF5A 5ENZA 3DSRA 1D4ZA 1SXIA 1ZCJA 2MIIA 3TLYA 1TAUA 4QELA 5BYBA 1U1IA 1RYZA 5LOVA 3F78A 3ZLVA 4DHEA 1UT6A 2PZKA 1QYVA 3TQIA 2BM8A 4RS4A 3WGHA 5F2NA 1UPBA 2X4DA 5HS6A 3EXIA 1PFKA 4WHMA 3NWOA 1TAHA 2NAFA 5IXSA 2D00A 2I6XA 1OYOA 4ALLA 2Q0HA 2XCLA 2IELA 1E96A 3K5IA 3W2TA 4FMBB 3EFOB 3ENWA 4QYIA 2OM6A 3WYGA 2N0SA 3FPJA 3ZU2A 3RAFC 5CT4A 2ZG6A 1Z8HA 3QE9Y 5K0JA 4CG0A 4L3VA 1PEAA 5EHZA 1IBKB 2G72A 2IZ1A 3N74A 2GCPA 4GC9A 4X1IB 3OJCA 3VZDA 4DLYA 1JFLA 2JFFA 4B83A 1VCMA 4E5VA 1FSPA 3AF6A 1OH7A 1Y6RA 1RQ2A 3AIIA 5EIWA 4BO3A 1EFUA 1MZVA 2AZDA 2EKLA 3A6DA 3C48A 3CGWA 1T0JB 3ZV3A 5K3FB 5BWMA 1Q5PA 1ZOIA 2FOXA 4RESA 4JFRA 2BH2A 1KS9A 2R8PA 4KCGA 5J9FA 1XRQA 3D3WB 3U9LA 3OCYA 2PEYA 3H1GA 3S6JA 4IIUA 5DPMA 3BGSA 4S35A 1MX1A 3Q2KA 5J4YA 5DNCA 1BS2A 1WMSA 1J8YF 1OYVA 2QNIA 3WTCA 3D3JA 4A82A 1NVAA 2QVGA 2O2ZA 2FRVA 4DR7B 3TIIA 5GJBA 5AVOA 1A7JA 2FN4A 3PQ7A 4PC1A 1IUNA 1HEYA 2PJZA 1T4CB 3PYLA 2HHJA 2BSAA 2C5HA 2ZYIA 3QE2A 1EIZA 3ESBA 4BQFA 4R0MA 3FNIA 4KR7A 2WQ6A 2OSBA 4GLJA 10MHA 2YXLA 5LZ7A 2XUQA 1EP1B 3CM0A 1HDOA 3JAMA 4X7RA 3VAZA 2WU3A 2IOYA 2WFZA 5HDQA 3JYQA 4RDIA 4DRYA 1YRAA 5HILA 1QZZA 2PIDA 4LS3A 1RE0A 3PR1A 5G1NA 4GUDA 5HYVA 1PG2A 1POWA 4KR3A 4DLPA 3PRKE 4QXRA 4XPIB 2DUUA 2YUIA 3WSTA 5LMCA 4ZQIA 2ZAIA 4J76A 3FI9A 4J6EA 3T7EA 5JDIA 3RSHA 2Y2VA 4K6FA 4A0HA 5FEMA 2DSNA 3ZCUA 5JD5A 3RUAA 2FPOA 3D6VA 4CDRA 1COWA 4WV3A 5B55A 2NUBA 2AI2A 1FUKA 2P41A 4A9AA 4FSXA 4L7QA 5E4JA 3K35A 1C7IA 2ZJ6A 1QE0A 4MJXA 3ZQJA 4DGSA 3OTIA 3ESQA 4MDYA 4JJ4A 3TR6A 2E7ZA 3ONDA 3CLTD 3QYAA 1SVSA 4KFTA 1H22A 1I4EB 5ICCA 4ACAA 2CWWA 2LGJA 4ZVNA 1R0XA 3BHIA 1XN4A 1T9GS 1OAOA 1UP4A 1K5HA 3WLOA 4BZZA 3R77A 2P9JA 4P31A 5FD8A 5E0KB 3GGGA 2A1TR 1QYDA 4KN6A 3RF7A 1I1OA 5BYJA 2CE2X 3N8NA 1IMOA 2C8LA 1X6VA 4I36A 2Z57A 4HVTA 1S01A 2KB0A 3M49A 2E21A 1SQSA 4YHBA 1QIEA 1C3LA 1JHDA 1U4OA 2VP6A 2NYUA 4LYHA 1WDTA 1KXJA 1GL9B 4ISBA 5IJ0B 4L3OA 4N76A 3EG5A 3EBOA 2OKGA 1K7YA 3OO1A 4OP3A 4DSZA 1UINA 2HKIA 5BXQC 1GNRA 3S8EA 3E9CA 1U2EA 1ZK0A 3IAAA 4JVLA 5I3ZA 3L6UA 5K01A 2DLDA 4HJRA 4N5IX 4N9WA 2B4YA 2DHRA 5EIXA 1F14A 4FZ5A 4US0R 3ZHRA 1I51A 1S2NA 4FLFA 2GN8A 3DMFA 1E1DA 1HT2E 4RM2A 3RAJA 4NESA 1U0HC 4ZT6A 2Q6OA 2R6JA 3TM5A 1P5RA 3T1QA 2GF0A 1ULAA 3QE3A 4JIMA 3AF2A 3WGTA 3W1WA 4JITA 4EI7A 3WAKA 4ZEOA 1GTMA 1S2GA 1RZUA 3IX7A 3FCYA 3P9QA 5F33A 1ISRA 4L08A 2O2HA 3T7SA 2GNAA 3NNNA 1DKRA 4X20B 4DGQA 1H66A 1U3TA 2R5NA 1Q0UA 3BQNB 2WK1A 1BMFA 1I5RA 2BV3A 3D6AA 1Z9BA 4X94A 4YRDA 1YO6A 4LXHA 5AO9A 4P5DA 1CRLA 1FK8A 4YRFA 4X5OA 1JG1A 3TLKA 4MK4A 3PFWO 5A3SA 2ZUFA 1CUBA 1GUYA 1AMUA 1TM3E 5L7YA 3EVFA 4AJNA 4ZVPA 1DRJA 3QRWA 1T5OA 4IVNA 4LRTB 4PO1A 1LC0A 3K5HA 3U4HA 1C3JA 4HZIA 3N8KA 2JJYA 3QITA 5I8ZA 5F1PA 4DC1A 2XMPA 4OBXA 4C7VA 1I4LD 1NVKA 3KWMA 1OGIA 4FJ1A 5ALFA 4DCGA 4DNPA 4M37A 1GZ6A 4J16A 3PGKA 2YCLA 4LOIA 3CONA 4ALJA 1M1XB 3SHWA 2JCVA 2AN1A 4KWEA 3HB9A 2IYFA 2GVDC 2INGX 2MYPA 2PL5A 4M86A 4X54A 3OIDA 3NH9A 5G1OA 4PGMA 3RVQA 4XOIA 3ORFA 3RFXA 3ZVKA 5AR1A 1CUYA 1I4TD 2QQFA 4IGAA 1PDWA 4LJ7A 4FC7A 4DZTA 2JLUA 2OLKA 5K6TA 1XZFA 5J4HA 5AK5A 4X85A 3ORQA 5GY7A 3QUSA 1X2BA 1T1IA 2CUZA 2BFNA 2CJYA 3P9YA 3OA2A 1SK8A 1Q1ZA 4YAFA 1CEEA 3EE6A 1NY5A 2P6UA 1YDGA 4HXYA 2X1HA 1LPMA 4RS3A 3N6RA 1EK1A 3UIEA 1SXJD 2F3UA 5F52A 2C57A 1WBDA 2EW8A 1JSXA 4OH7A 5I9LA 1NW7A 2EKPA 1KO5A 2PX6A 3FPHA 3GFRA 2HLHA 2H07A 3GFSA 4ISCA 3PXGA 3F5DA 1FDSA 2I71A 3K8ZA 3EG9A 5I9MA 1YAHA 4IFIA 1V3VA 2XODA 3HACA 4EQ6A 1WUTA 2CEAA 3BMQB 1KAGA 1Z62A 2ZRPA 4FZJA 5GV8A 5JVDF 2WTBA 4Z0HO 2BBSA 2GZHA 5JXHA 2OFOA 4EOGA 4IJMA 2R751 3OAAD 1I7QB 3BRSA 4G1UC 1FFWA 2D5AA 4CIAA 5IBPA 1R0SA 5DHFA 3ZY4A 4RFLA 3GF4A 3OFJA 1XVTA 2QVXX 4Q1VA 3TFQA 3BH6A 1KAHA 5FV4A 5CIYA 2WJVA 2QW1A 1RXEA 1R37A 3MOIA 4PLCA 2VRBA 1A04A 2NT4A 3BDVA 1BVYF 2BHRA 4FTWA 3CC8A 1GDDA 4FX5A 4I55F 3AERB 3Q8MA 3O8QB 2VYQA 2ZIUB 4TWAA 4D0NA 1A4XA 1HL3A 2BZ0A 3IHKA 1SIUA 2CLCX 3B6KA 3VYTB 4H4CA 3ZNQA 4XB6B 1WZ2A 4YCCA 1EBBA 1NI3A 2O3UA 1DI0A 3A6JA 1UOQA 4FN5A 4IVRA 4XEHA 1K7SN 1UJNA 1V95A 2CF5A 3CX3A 4CCSA 2E82A 2I67A 4YCDA 4IJVA 3AH8A 2ZE6A 4OAOA 5FYQA 3U09A 3SSMA 4KZKA 4YRLA 2HW8A 5T4HA 2Q99A 1UBEA 4R98A 4RJKA 5JCPA 1JHQA 4QOJA 1U2ZA 5ES4B 3JWIA 4UU0A 2A9RA 3DLCA 3PC8C 1ZVQA 3IKJA 1RAFA 1JYEA 4PAMA 2B35A 1E2DA 1N0VC 1ZJ4A 3DT6A 1P1FA 3TAHA 2AFIB 5CURA 5J2TF 3LUHA 4ENQA 5K4GA 3FF4A 4UFPA 3HPQA 4PFQA 2XECA 4TN5A 4L5JA 4A8TA 4LJAA 4MB2A 4MI3A 1W5FA 2YFYA 5JFGA 1LKZA 4Q0MA 4ZOBA 5LB4A 3BT7A 4KVZA 2NZ8A 3ZLTA 1UFRA 2UAGA 3WZLA 2FG5A 3DO8A 3TZLA 1L5QA 3OF3A 5IEBA 4BYGA 1DC6A 2G09A 1TT7A 4RL6A 4KPFC 4AW9A 5HIAA 4KK4A 3NR2A 1CK4A 1A97A 1JBQA 1NV8A 1ODCA 3I05A 3P71T 4J8PA 4Q7LA 4YROA 4Z4CA 5AQ1A 2ZI6A 3JYNA 2BD0A 4DMKA 1XPOA 1G5TA 3H3FA 3R6LA 5FOXA 2ACKA 1J1UA 3D7SA 3KXDA 2XVZA 4RVSA 3K5PA 4M7OA 1DTWA 1UM9B 4HDMB 1VG9B 1NLZA 3GY0A 1AKMA 3MOSA 1B3BA 1JHVA 3LMKA 4M76B 1I6KA 4QU8A 2XJ9A 4P53A 3UH1A 3FMIA 3L8DA 1CDZA 1FS4A 3DB2A 1LX7A 4CT5A 5BR1A 5JMWA 3H5AA 4LRWA 1ZVMA 3ASYA 4OJMX 1H94A 4CGZA 4LJLA 2FUNB 2DM6A 4MUAA 1J21A 4BRSA 4YJ3F 1H2YA 2GM9A 4TLEA 3IE1A 2QX4A 3LBIA 1RYYA 4G4IA 4HHEA 2IHVA 2J9FB 4MVJG 5MDHA 1A1VA 3K20A 2Q6KA 4ZXPA 2WU0A 3NNSA 1Q57A 1SN7A 1YVEI 3FDZA 2HSEA 1V16A 1YOVB 3HI4A 3HJGA 3M3PA 3OEED 4ZAWA 1FDVA 3DEYX 3VHXA 2HF2A 2O54A 2JS7A 1N9ZA 3A10A 1GZ4A 1MB4A 2DWPA 3GB9A 3EIXA 5CNIA 2WFAA 1PWEA 4B3GA 3DZDA 3LS2A 3UJ3X 1N4DA 3LGXA 1D5CA 1I32A 4GPD1 3I2YX 3NXKA 2ZSFA 2I3ZA 1N7GA 3KSMA 3T3PB 4Q4AB 4NMLA 4X60A 4D46A 4LIPD 3HKDB 1YQGA 2J08A 3ZS8A 3KQPA 1ZQ1A 4MRPA 3DW3X 3PVCA 3GRCA 5M04A 4UCWA 5KQRA 1X7YB 2YIDA 4RK7A 2JJ8A 3FMFA 2B25A 1CEXA 2WSYB 1G5IA 2FQWA 3L8MA 3UFXA 4MWOA 3WTBA 1A7UA 1M6NA 1E2JA 1U3VA 1KWKA 2P1DA 3KVVA 2YRFA 4EJSC 4QLBA 4QECA 5EJEA 2R1ZA 5EQTA 5B6PA 5MN6A 2LRHA 5FPHA 1QFXA 2UZAA 4FI3C 4Q9DA 3E2MA 2KBEA 1LVGA 3UUGA 1CFZA 1EE9A 2WILA 3D3EA 3EVAA 1PDOA 1QGDA 1WXXA 2DFLA 4G5YA 4MP6A 4TKUB 1XRJA 2PUAA 2QTWB 3R9IA 3V2IA 1CS4C 3E53A 3DXFA 4ER3A 2WHEA 2EBHX 1HMPA 3HVJA 4OH1A 3DLIA 4CU2A 3QF7A 1HRKA 1PEKE 3I2FA 3P9XA 2ZKIA 1WUJS 5IN4A 1X1BA 1P81A 1Z36A 2OZPA 2R87A 4BNWA 1C2YA 5B57C 1SKBA 1DRVA 3KYDA 4NFHA 1RC0A 2QTBA 2NUAA 3L02A 2HQRA 3ZIAA 1BU8A 4I6JA 5C8YF 5T41A 1ONNA 3PFKA 1L8QA 2VP3A 5BV2P 4D9KA 4P6VF 3TZBA 2AH5A 2D4AA 2VT7A 3Q40A 2X23A 4PX9A 4F93B 1GJRA 5AI5A 1C5KA 1Z45A 1J8VA 3TVTA 3FKSD 5IT4A 5A71A 5J1TB 2I4TA 3TRHA 5JYBA 2X5OA 1NTRA 4Q01A 5DX0A 3D7NA 4QKQA 1E2EA 3CWCA 2QIPA 2NSLA 4OFWA 4KXQA 4R2LA 3IIEA 1NNUA 1LY1A 1EUDB 3EK2A 4R2HA 3AKZA 3CYFA 2XTMA 1KBZA 3EDCA 3ONVA 4G9EA 2YFQA 2R6ZA 1MEOA 3OESA 5DP2A 3V00A 5KJFA 4AKIA 3N2GB 5HZMA 1L5RA 3DXXA 4QLAA 3IIMA 5IYZA 4JLKA 2OUKA 1WVGA 3MTGA 4XVUA 4MTCA 1YWGO 2ZTSA 3DKKA 2NU7A 5KO2A 3IIJA 2UZ0A 5EMMA 3JAKA 1CY8A 4JBNA 3U0BA 1FMFA 5ESRA 3EFEA 4AMBA 4GQIA 2YC4C 2F9FA 2ZBPA 3H5TA 3PFBA 4TS9A 1UPFA 3DLPX 3FMVA 4L73A 3O4GA 3BWVA 5J5VA 4AWAA 1AU9A 2W2PA 3UV7A 3DMPA 2WLSA 5HS4A 5JFTA 3PHIA 4YJDA 1D0IA 1GPYA 1EWRA 1QXSA 4KBYA 5FULA 1LVHA 1JMKC 4P2GA 1Z0UA 1EFKA 3OHPA 2NO0A 4S04A 3BILA 3R6TA 4KO4S 1YOBA 4G1EB 3HLTA 3ELWA 4GZ3A 1I3LA 3UUFA 1LCIA 2BBOA 1E2KA 4PIPA 4F86A 1J5XA 2XE7A 3MWEA 4X3OA 4TWZA 5KNDH 1OBCA 1N0WA 2CZQA 3KQQA 1J6UA 1KNXA 1RRVA 3V4ZA 2CNDA 4FVTA 3C74A 2Q9AA 4PHFA 4W6QA 4EFKA 4Z7JA 5LLTA 2CJFA 2VPPA 4ZQCB 1XPRA 1N32B 2CXTA 1PU2A 3FHCB 4ZODA 1LQ2A 1C3XA 2WKSA 1XF9A 1DL5A 3VPHA 1OFVA 1ZC3A 3HYCA 4AP5A 4X97A 2E18A 5A3RA 3JRXA 1CJVC 2AF4C 3AEKA 3N75A 3TI7A 1RAGA 2V9PA 4PSAA 1LSUA 2OCGA 5AM4A 4EEXA 1XMXA 2YWRA 5KYXA 4DUZB 3K0FA 4PC6A 1TZJA 4KRFA 3DTVB 4DTIA 2ZYWX 4NFLA 1MORA 2IP2A 3GLVA 4DLBA 4EY7A 3P9KA 2C7QA 2ZYAA 1LRLA 4N40A 3BUSA 3GPBA 1PLJA 3R4CA 1XN1A 2WM9B 2ZK7A 1SWVA 3IILA 1KK3A 4GZ5A 1BXKA 4AKSA 4YYZA 1PJ4A 2P78A 4OUDB 1W581 4OKSA 2OPHA 3ESDA 3G02A 2YZKA 1KEKA 1UK6A 2VXYA 2QQ0A 2D7DA 2H5LA 2Y1FA 1BS1A 4M87A 4ON9A 4RC9A 4KXYA 2C2BA 1UPUA 2H57A 2ZSDA 3MWDB 1TTHA 4RPIA 1OF1A 2BGTA 4LCEA 2PLNA 5EWLB 2FRDA 4XWKA 1E3JA 5L3QB 3K1AB 2HWUA 5TPWB 1RJFA 2VCYA 3EUWA 2ZJAA 2I6UA 3OX4A 4G8DA 1Q0SA 3OKPA 4X44A 4IDPA 3J7TA 3GFPA 2C07A 2GHTA 2WJPA 3QE4A 1OPRA 3T5MA 3RHFA 4GKAA 1OJ7A 4JXJA 2AIRA 4QJ3A 1I1HA 1QZTA 3I2JA 4CKZA 5EJ6A 4KGVA 1K7FB 3LY5A 1O0SA 1IUOA 2Z56A 1G8FA 2Z4TA 4QAJA 2HSDA 1G64A 4Z9BA 1M2FA 5CJ2A 4K2HA 4GYWA 3VTFA 1LI4A 5JDIC 4RZSA 4HVLA 3JARB 3B8EA 1E32A 2WAXA 3F4BA 4D42A 4YCNA 2QLMA 3N6VA 1XQWA 1TE2A 4IINA 3ZX5A 5I7UA 1SHZA 2FJ0A 3GLHA 4TVOA 3M89A 3PNKA 3F3KA 4NENB 5CFRA 3GLSA 2QN7A 4Z0NA 2FSPA 1I33A 1SURA 4HV4A 4IX1A 1FNMA 1C1XA 1PR0A 3FOBA 2HBYA 5JCXA 4U39A 1RYBA 1TTQB 2J85A 4TTVA 3ZY3A 2X86A 4X7MA 2Y0EA 1O03A 5IAEA 1Z7GA 1F0YA 2C2HA 3H3JA 4KXMA 4B4UA 5FI3A 4AUMA 4ZDWA 3F1KA 4BMVA 2BM0A 4CL8A 1VIMA 1T5TA 3KHUA 1ID8A 5EIFA 4X1OA 4LC0A 4ZJPA 8OHMA 5CT5A 2J3HA 3H1PA 2CHUA 5TB5A 2FK8A 5LYJA 2GKOA 1CZLA 4YCBA 1JQDA 3WV4A 5FT9A 5L4SA 1GILA 5TVGA 3QXHA 1QZXA 4WGGA 4EJFA 2BGLA 5DYGA 4PXSA 4NJEB 4WBNA 1PSZA 5ITZB 4MRRA 3NH6A 3ZE8A 3THYA 1CLEA 4IV0A 1URPA 2WB2A 4CLHA 1E5QA 4IILA 1X38A 1EP3B 4XWTA 1JKXA 2DY0A 4WK0B 4QSHA 1C80A 2OVBA 3E84A 1W36B 2FMKA 3K31A 3EXG1 3BA6A 3KYCB 3HCEA 3WP0A 1JG3A 1TOAA 3H9GA 4MV6A 5GV7A 2HR1A 3IAM1 3W5JA 1FBTA 4IIYA 5CXUA 1AK2A 1SD5A 2G17A 4FP9A 5T6MA 2Z6UA 3KQYA 4DMHA 4NCAA 1ZA2A 5ICFA 3TZHA 2HGZA 3Q10A 2XGMA 4G1FA 3WX0A 2QVCA 3GBSA 4EG1A 1OZHA 4MJ7A 1EA7A 3GJ7A 4UULA 4NJMA 2TECE 4X6XA 5BSEA 2W90A 2DOKA 2A5GA 4N7BA 3ST7A 2IHYA 1TCCA 2QP4A 2P6MA 3NTQA 4NCNA 4C4OA 5JAIA 3KUCA 1BGWA 3E58A 1U9YA 4CL0A 1V7QA 4CCYB 4E1BA 3ADDA 3UJHA 4YP9A 2ZS7A 3FVQA 4XAQA 4BGDA 3I61A 3MJDA 4CMEA 5ALLA 1X86B 1JKIA 1SXHA 2G1PA 1CUVA 3UHFA 1Q44A 4RK0A 5SZIA 2NXNA 1NDUA 5DKFA 5JYDA 4TLCA 3B6EA 4L27A 1YB2A 3GMDA 4FQ5A 4G65A 4EQZA 2BFDB 5CJJA 2BF7A 4FOSA 4YV0A 3GFFA 4L6AA 5FA6A 5AESA 1FVXA 3FHLA 5FQNA 5L3SB 1ZR2A 1SCDA 1PJBA 2X8AA 5CB8A 1WKBA 1DDGA 2BMEA 3FWYA 4KBGA 4CLDA 3E1KA 1T3SA 1DAEA 3VR1A 5JWRA 4IG9A 3FB4A 3PC4A 1T0PA 3E3AA 2ZOSA 1QZUA 4JC8A 2GZDA 2XVXA 4QXAA 3MTAA 1IJBA 2AQKA 2X58A 2AW3A 3MFYA 4PAQA 1SRRA 1HKHA 4GOXA 2HYDA 2AUMA 2VZ9A 1S02A 3TBFA 3L6EA 2WZBA 3A6FA 3DAOA 1KOLA 2W2TA 1NFQA 1R6UA 3IRUA 5H80A 3AVWA 1A72A 1PR6A 3KNZA 4CR8A 5LXTF 1W52X 1Z0AA 3KZMA 4JLBA 1KIMA 3ZC3A 1RWMA 1N2IA 3B1YA 3E0QA 3MLEA 3MJEA 3ZD7A 1OGJA 3M6VA 2Y1KA 1ZIXA 3VR3A 1E2PA 4E2XA 2BOVA 2BGWA 5EMKA 1Q74A 3NBQA 2GCOB 1UZUA 3D3KA 4HKTA 4LJ4A 2WVJA 3U1BA 2BI4A 2Z3WA 4EVRA 3I64A 4MV9A 3EBLA 3JASA 3OQVA 2EFJA 2O2IA 3FBGA 4G9GA 2HCTA 3R3ZA 5KBYA 1UOEA 4GI5A 4K1LA 1HQYE 1SNYA 3SICE 1V37A 3TXAA 4S2EA 3L4KA 2XUDA 3TZEA 4HB4A 4F12A 5CHYA 4EENA 3ZKWA 1E3WA 1G8GA 1W0KD 2H4ZA 1J5EB 2CNOA 4V0NA 5REQA 4P3YA 4DEVA 3EULA 3BEOA 3OPYA 1GNSA 3KKLA 3LOQA 3ZWAA 2VH2A 3GNLA 1PV1A 2V4UA 2XWBF 4TKVB 4JBLA 2VYCA 3PE4A 4C08A 1FJGB 4K6HA 1V4BA 1FRNA 5EE0A 3G49A 1XTPA 2J6HA 3OSUA 1GQRA 3CE9A 2I4IA 1KOFA 3LUGA 3O47A 1AB5A 2FWRA 4PANA 4TMXA 4TWBA 4UBIA 5IK2D 4FHCA 5AJVB 2EWVA 1SXQA 1TUBB 1XMPA 4MHSA 5K03A 1Y4DE 3T0IA 4Z0TA 1KVSA 1CY2A 2V96A 1N36B 3SCZA 4KIFA 4N47A 4B45A 4AAYA 2ORYA 1ZNXA 4LW8A 4N39A 4L15A 5JATA 4TLMB 5F3WB 5CDFA 2CVHA 3MIZA 5JQGB 4NNJA 3MEQA 4BVFA 1TVMA 4CQJA 2BRUC 3HBAA 1DLIA 3A32A 1H85A 3P96A 1QK5A 3TGPA 1KU0A 4UDXX 5BSRA 5WRFA 3VNVA 3FR8A 1WDKA 3BKWA 3G9XA 5EJGA 3N2KA 2WKQA 1WBBA 3KQSA 1QFZA 1YHNA 4YREA 3TEFA 1KDYA 3QVSA 5KI6A 2WF8A 2SHKA 5KX5F 3COWA 4Z2AA 4CM1A 2C5AA 4A0QA 3P5BA 4JLWA 2XAUA 5F1KA 3GLHE 3DWEX 2BFCA 4F96A 3H5NA 4IM7A 2OGUA 3ZGNA 2GZ1A 4J0JA 1U99A 2FWAA 1Q1AA 1DFGA 3GUZA 4XX1A 4LDNA 3FDXA 1RU3A 2H7VA 1YIAA 2DMRA 1E20A 4P58A 1MAAA 4JYBA 1Y6GA 4M22A 5F21A 1EXDA 3W9SA 5A7FA 3BE5A 4DA4A 4PG4A 4C21A 2XMQA 1YFJA 2DJIA 2GHQA 4AZ3A 2WM2A 3IE2A 1TZ2A 1J2UA 6REQB 3PUYA 4A5OA 4EYKA 3A4MA 5TQJA 1RT9A 1XMSA 1MT3A 2PWYA 2E5FA 1SZJG 2JJ2A 2PBFA 4RJ2A 1QB7A 1EWTA 2L17A 2QAGA 3WWOA 4E5YA 4PZEA 4M98A 3JALA 4I6EA 4P4UA 1J7KA 5IDXA 1ENYA 1I13A 3B6MA 1EHIA 3T7TA 4BNFA 5JASA 1IBMB 3AK4A 3MWLA 4II3A 5L6LB 2HJGA 1O9BA 4KQMA 4YALA 1KC1A 2BEWA 2MSWA 4R1SA 1R0RE 2A4KA 2BR3A 5F9FA 5JE8A 4BFLA 2R1UA 2DKNA 5LC1A 3UT6A 5AUQA 1IBRA 3BRWD 4Q9NA 3HDGA 3RG2A 1E0DA 2ZRFA 5FJIA 3FHOA 3RABA 1JIQA 2ZBVA 3VKFA 3Q9NA 1J0CA 1ECJA 3PUHA 4WTOA 3R7BA 2P68A 1QBGA 2QK4A 3B8HA 5CNKA 2P2NA 2YN2A 3IQXA 5ABPA 1XTBA 5FNZA 4J75A 2W2QA 1LBHA 1XD2B 1N34B 2FCRA 1FUEA 1YR3A 2BELA 3WZMA 1E77A 5TGZA 4DLVA 2PRKA 5E4YA 4FR5A 2YMQA 2FW8A 3CZ4A 4L4RA 3WQSB 1S1CA 2OC4A 4H7IA 2Y1XA 1X7WA 4JLSA 5DXJA 1L4MA 2FEKA 4B3JA 4YMUA 1GT6A 4RH0A 2WSSA 3F7NA 3AEUA 4L1KA 5CB4F 1P2DA 3D8TA 1MJGA 3NVMB 3RU7A 2Q62A 2AJTA 3E9EA 2QV0A 2AX4A 3NIGB 2Q5OA 2P3OA 3LC0A 2X5JO 4HRXA 1I10A 2PMWB 3I6ZA 3P9SA 4NSNA 5A03A 3RFVA 1Z4QA 2GXUA 1PBTA 1V41E 3FHJA 1U9IA 4KR0A 1BN7A 4LYEA 3MXOA 3C45A 5CXSA 3SBXA 1YGPA 3AOEA 3DL2A 3QKSB 1E1MA 1WZIA 4QBFA 4R6XA 1FTWA 4ZPXA 1V26A 1MEEA 4D9MA 1U1GA 4P4SA 4MYCA 5IVDA 2WVAA 4KDCA 3D7LA 3AM3A 3QXJA 3X1MA 1IDN1 3CIOA 1WXGA 3ZS9A 2VC2B 4KFSA 3T3HA 2WJ6A 2P75A 4YRBA 4PLTA 2ZAGA 1AQIA 1YNSA 1YL7A 3IVXA 1MAVA 3K9QO 2B20A 2O4UX 4K5QA 1KDZA 4A3SA 4CL3A 3W6PA 3LZ6A 4FUQA 4ZU3A 3D7RA 3LZDA 4GC5A 2C96A 2P2CA 5CVVA 2P77A 2PZFA 4F5ZA 3PFHA 1JKMA 1JH9A 4D3FA 2TMGA 5F98A 2JLXA 1ORWA 1V6SA 3DEAA 1JIKA 4HEJA 4KQHA 4TUYF 5TX7A 3WMRA 1SUDA 3GEGA 3TLGB 2EARA 1DE0A 2IJGX 2JFYA 4OTZA 3V8MA 3RYFA 4Q6BA 1M75A 3I9KA 4LZOA 2Z2IA 1T8YA 2IS4A 2ZJZA 2W6JA 3RG8A 3PDHA 2EX0A 2I1QA 2P6NA 3LA8A 3OZSA 4DLUA 3TINA 1XKTA 3OTQA 4CT0A 4GX1A 4YRNA 4Q24A 3NQ41 4EG8A 3GOQA 1NG9A 3G9UA 4F2PA 3GR6A 1DIGA 3O6VA 5JH7B 2O0MA 5IKPA 1F2DA 1FJ2A 1TZBA 2UYQA 1ZEJA 4O6VA 4QQKA 3SKYA 3JZIA 1GTVA 1YSCA 3S2FA 1Y5MA 2EERA 2BKUA 5EZ5A 3CXRA 4FGSA 1PFWA 2Y6UA 4RAOA 5ECDA 2XUGA 2FPWA 3VR4A 4PNPA 3K8YA 1N6HA 5JR3A 1MGPA 1UH5A 2R84A 2VH5R 4PGFA 3T4UA 4C89A 3TWOA 1UZMA 4CKEB 5IXYA 3LUJA 3IQEA 1Z4IA 4HQFA 4U4AA 3RKUA 5GPBA 2V5AA 4XWWA 3C7AA 4K6GA 1PL8A 1XQYA 4M88A 4LE2A 3HV2A 1D0SA 1EUYA 1H8ED 3N2EA 4ZMSA 1GSHA 1TCUA 2IPOA 2EATA 1ZWKA 4HYYA 4B5LA 1FJHA 4KPEC 4L95C 2BEJA 4UASA 5BMVB 2CV2A 4ETWA 2X19A 4JLJA 2P2SA 4JBXA 4DBVO 1ARZA 1L1RA 3CZMA 3KV3O 5DNEA 4RJLA 5GOZA 2GBFA 4A26A 1QRRA 2FN3A 3SJ7A 2NZVG 1GPAA 4MINA 3CPSA 1RC1A 1RNLA 3F98A 4BQRA 2A9FA 4PINA 3Q15C 5AHKA 5IKMA 3Q2OA 2Z1NA 1ZD5A 2BHLA 2QQEA 2AFHB 2C00A 2GWHA 3LKZA 3MWGA 1R0LA 3NFRA 3FCSB 4NK4A 4ZI7A 4Q4JA 4WDQA 5BY2A 2HEIA 1Z2EA 1OX4A 2PE5A 1GN8A 2OZEA 1JW9B 3OTGA 2TMDA 4CE6A 2FEXA 1Z35A 4YRJA 1RWXA 1QCDA 1I2DA 3R0XA 1U5AA 4PZDA 4QAQA 4S3MA 2Q3JA 2BHTA 2ZDHA 3JSXA 3QGMA 2P90A 4MUIA 4PHTA 3ZGXA 4DCVA 5KYUB 3PNSA 1S3IA 4ZEMA 2WP0A 5THXA 3AVUA 4CIBA 1CRPA 2HA2A 3TZKA 3MB8A 1XEFA 4KO2S 2HC9A 5DO9A 1FFAA 1E4EA 1GLGA 2IYAA 4JQCA 2VF4X 4QRHA 3AW8A 1B7GO 2H1WA 3E15A 4MYUA 4S2UA 3INNA 3ZX4A 4PX2A 3CNEA 4N6OA 3ETEA 3GDHA 4DCMA 1N3BA 4I19A 4W5QA 3EMKA 4XD7A 4V38A 2AWOA 1TJPB 4Q7EA 4RYDA 1PTKA 2FCAA 5EUMA 1GPUA 3EZXA 1O94D 3KZOA 4ZK6A 2WF9A 4X90A 2VDLB 2RGRA 3AESA 1QVRA 1NWHA 5F35A 2TSYB 1RR6A 4HGPA 3DBLA 1GR1A 2WYHA 1BEUB 2EJBA 3WXBA 1ZPDA 2PQ6A 3H4TA 3B48A 1D6SA 4DBLE 4DV5B 4PZPA 3GRAA 4DEYA 1NKVA 2B8NA 2YV4A 3LZCA 2G04A 4B46A 4M9CA 2GBCA 1JH8A 2ZROA 4JBHA 5J23A 4M89A 4Q3KA 2WMOB 3AUJB 1YBFA 5TLSA 4GHWA 1BIFA 2YV3A 1X3LA 2W70A 1U94A 3B1ZA 3RC3A 3ZLJA 2E9SA 4WE3A 3VKGA 2W83A 3RCBA 4IJWA 4I46A 4X84A 3RS7A 2C7OA 1B8PA 4LHWA 3T9DA 3HHEA 4LXIA 5EKTA 5CGZA 1DO8A 5CR9A 1ZMTA 2FRDC 3VSAA 1BKYA 4K3UA 2XD4A 4EAQA 4UATA 3THRA 2GZ2A 5GAJA 2PWAA 1N8NA 3C41J 5LQCA 2NQ2C 1DEOA 3SN6A 3W3AD 1DBSA 1GPBA 1Q83A 3M83A 3BIJA 4Q18A 2X4GA 4WECA 3C87A 1NVTA 1KSJA 5BNZA 4YR7A 4GRDA 2CFTA 3W3AH 5ANRB 2XQGA 4U6QA 4B85A 1XKXA 1E4VA 5FTMA 4W99A 5KYGA 5I7FA 4IHJB 4LNAA 3V8PA 1N2BA 2J9YB 4KI0A 4EY5A 2FWMX 1ZD4A 4UXJA 4CM9A 3CWQA 4HPXB 4EDFA 1F2TA 1N92A 2VJAA 3VC1A 1USGA 3T4PA 3WQHA 3ZN2A 2P9EA 4BN0A 3HM9A 4UQLA 4AZTA 4JUBA 5CFQA 3RYHB 1QRDA 3X43A 4MI1A 2TS1A 4ZVVA 1Y5LA 2FQXA 1IJEA 2J5RA 5BUZA 4G5GA 3SDBA 4DA0A 2VTBB 2HNBA 3IFSA 3OLCX 4HL6A 1WO8A 3E3OA 4QGBA 3VV3A 2CHQA 1O08A 7REQA 3K6KA 4BFZA 4C0KA 1G66A 1T5SA 3G2HA 3N7TA 1XXLA 3BZUA 5FOSA 4DLRA 2FZKA 2ON6A 4RADA 4YRQA 1QP0A 1EFTA 2X3YA 4ZPJA 4LDQA 1FZQA 4LHXA 1T2NA 3OEHD 4OMCA 3JZMA 1ZSVA 1B1AA 5FNVF 1KI7A 2FXVA 4FGKA 4R5HA 3PX2A 3CLRD 1RQ7A 3NC1C 1XRRA 4EEKA 4F9TA 2GD2A 1H5NA 2Q8PA 2V6BA 1G2QA 1YC2A 1Z39A 3TCXB 1VL5A 4ENSA 4LF6B 5D85A 2NP7A 3MJRA 5E9WA 1WDWB 5MGBA 2QYTA 4KQFA 1JIXA 1XD9A 4IUBS 2HRDA 3WL4A 2BHSA 2PNFA 4M8SA 4EI2A 4W5RA 4IDGA 3AHIA 4OBEA 4F60A 2HMUA 4HLUC 2W2KA 2A5DA 1JJIA 1MDBA 2GFHA 4W9NC 4ASUA 1P31A 2BONA 3Q3CA 1E7SA 2G6TA 4Q1AA 3PHJA 3DV0A 4JC5A 3UICA 5BO5A 4RVOA 4C1BA 1SUWA 1PJCA 2QTRA 4FYJA 3ZWOA 4ARSA 2HDNB 3EEIA 4ZYZA 1KOJA 3GFQA 3L7YA 2A14A 4UBKA 2PLWA 4WEQA 2SCUA 2ZBEA 4MR7B 4YAKA 3LXMA 5EL0A 2ZJ5A 3S2UA 5AW7A 4F46A 3D4PA 3E7DA 5KOIA 4KV9A 2P0AA 3GZNA 4G0UA 2I2XB 2EP8A 3U4IA 4DDTA 5TPZA 4Q34A 2Q27A 2HWKA 3RANA 2YKGA 1P1CA 1VE9A 1GNVA 3C7DB 3WB0A 4P0QB 5TS2A 3H13A 2EQ5A 5DHSA 2W22A 2OGWA 1NOKA 2DWOA 4Y9TA 5DNVA 1EFDN 3HM2A 4K87A 5CBPB 3AP2A 3PWKA 4JLOA 5AVXA 4NS1A 2O2EA 3EVZA 3CH7A 2B5OA 1LDGA 2WWRA 2K87A 1FL9A 5FPQA 2SICE 3HP4A 4JI0B 1T5HX 3ZZMA 2ZITA 2FX3A 4K9QA 2HIHA 2ZJ1A 1BRMA 1WOMA 4RF4A 5IT9A 1SD1A 3CSDA 4L2IA 2PGXA 2QD2A 4TM8A 1OVMA 3O38A 5KVQA 2DWCA 2QUHA 3ESYA 3TF5A 1QGUB 2F3TA 1QFMA 1TIBA 4AYWA 3WLLA 3GLQA 4O1IA 3UJNA 2GPNA 1OIXA 3C7TA 1KETA 2WJGA 5EFZA 2HOQA 1AC5A 1D7OA 4X91A 2ZR7A 2ODWA 1MAHA 2H1VA 3F97A 1TGVA 1FSZA 4FFBA 2DAPA 2E49A 5AQEA 4IRXA 2H4WA 3ZI0A 1DMRA 5CFOA 2DFVA 5EJ7A 5ILQA 3U3OA 3HKEB 2A2ZA 2EJWA 1JLLA 2VHXA 3PQEA 4GMDA 2P9YA 4DPMA 4AS2A 5LQAA 2VK1A 1UFQA 2QIOA 3PVZA 1E6EA 1T9ZA 3V4PB 3EIOA 5DWQA 1Q15A 3G8CA 4Y2QA 3JU3A 2J0UB 3O8OA 1M7HA 3NTOA 1N2XA 4MQFB 3T7IA 5KYNA 5BR8B 2I6GA 1PNQA 2C0QA 2YJ4A 2BGUA 1O6GA 4E32A 4V1CB 5J58A 1W36D 2WMYA 3VGPA 3P2OA 4U3JA 4DDUA 3KEOA 3SEAA 3PXBA 3UANA 2R1VB 4ZC1A 2FB9A 3G5LA 4WK2B 3FLEA 4QQFA 3EISA 2GHRA 3R0QA 4PCLA 2W2LA 3ZK7A 2XF2A 1QO0A 4F4IA 1IBLB 1VLJA 4MUGA 1U4NA 3HBMA 2REQA 2AZ4A 2ILVA 1ZICA 1OC4A 2R1TA 1M2NA 3CRRA 4H31A 1CIVA 2YW9A 5FF9A 5H5JA 3A70A 3EXFB 3EXAA 4FLMA 3I0MA 1TFUA 4UNNA 3D1VA 3LL4A 5I9NA 3HYNA 1FZTA 1BG6A 3BGWA 1C8BA 3GEHA 1JR3E 4L28A 3VSDA 3KSBC 3PX7A 3ABZA 4RZQA 4E12A 3H2IA 2Y93A 2NV6A 4BTVA 1CT9A 1TEHA 1RTTA 2ID8A 2V03A 1LH0A 4ZDJA 3DEJA 3PIRA 1MJGM 1QKJA 5BSVA 1CR2A 4ATNA 3C7KA 4YRKA 4IIVA 1UKVY 1W0CA 4CXMA 2P9FA 4WBXC 3VZQA 1GQFA 2Q3FA 1ISJA 3G1TA 4V02A 2BBWA 3B70A 4PQRA 4RQAA 5EHGA 2EC5A 1RXVA 4LF4B 1CVLA 2ZAMA 2Z5LA 3IOEA 1MW8X 1ML3A 1TQ2A 4RD1A 3MBOA 4H6WA 4HXGA 4KE7A 3RUCA 5H68A 1V1MA 2EW2A 2ZJOA 4MWEA 1KE2A 5FWAA 1FNSA 4TQUS 1HE8B 4MCAA 1XR3A 1YR6A 2HSZA 2QNRA 4LTDA 4I9UA 3ZH9B 5JCZA 1JT2A 2YY7A 4UQOA 1XO1A 2Z1DA 3QVUA 1Z17A 1K8RA 1G4UR 1XNJA 4HATA 4FKZA 3NHKA 4YAEA 3ZXXA 5F7XA 4ZEVA 5BXYA 3AETA 3JXEA 4H3HB 4LE0A 4YRRA 4EG3A 1Q11A 3C1AA 2XKKA 1DG9A 1X77A 5K9ZA 1OZ0A 3K0SA 4ZCSA 1U5BB 1A50B 2RB4A 1W8DA 3AR2A 4BFWA 1KKUA 3GJ3A 3PR2B 1F48A 1A4RA 3JVUA 2P11A 4HGQA 4DBLC 4W5HA 1N2CE 4DG5A 1E1YA 1SH7A 5BRAA 1JEDA 2IY7A 1YASA 2QBYB 3QNMA 3IXLA 3SAJA 3G7SA 1B8VA 5A9RA 1E6CA 1N0IA 4HMQA 5CT6A 3QVVA 1DCFA 2X77A 3C24A 1QANA 2J3DA 2X3UA 4C0HA 4DG9A 3KLBA 2ZYVX 1FS6A 3TD6A 3ZJ5A 4YAWA 4CG3A 2GH1A 1YE3A 3DT9A 4BMSA 4WUTA 1QBKC 1LK5A 4CEJB 4YRMA 4QU0A 2X8BA 3RVBA 5DISB 4CCAA 2Y27A 4NBNA 4EW6A 4EY8A 5IASA 1M2HA 1X15A 2CHGA 4OHRA 4A15A 1EHCA 4FFLA 2J5BA 3OFSA 3ORSA 2P35A 5GZ3A 4N48A 3C8DA 4EY6A 5HQ3B 2X4LA 1JEJA 3VR5A 2J41A 1HTBA 4AUEA 4K7JA 5LNK6 4BNDB 5JAUA 3H1EA 4P4NA 2NSHA 5BVGA 2E0IA 3L49A 4FD3A 4MI6A 3NZEA 1P4AA 1XA4A 4DQUA 3I42A 5A04A 2VXBA 1X9GA 1KRXA 2JFPA 1KEEA 4FFWA 3GYBA 4JU8A 4OHVA 3O2QB 4QTXA 3F2VA 1XZPA 2X2EA 3BHJA 2XT6A 2ZQYA 2HMYB 1F8FA 5FAKA 1TAGA 4ZVTA 5TEWA 3VDMA 4Z51A 3Q98A 4B4OA 4K03A 4EGFA 4GGOA 2P2ZA 1YB7A 3Q9SA 4XD2A 5J4KA 1SOAA 3DO6A 1O97C 3BAZA 5FFFA 3PHBE 2EDCA 1U9IC 3A1DA 1O96B 3IALA 1J2YA 1ZDMA 1X7XB 1RYEA 3ZXSA 4DL9A 4F6CA 4QDUA 1QIGA 2C2GA 3WLEA 1ZN8A 4XVRA 1J42A 1UIMA 5K8IA 4NF2A 1BQEA 5JAMA 5E3IA 1HNXB 1JU9A 1Y1PA 5ALDA 1XCPA 2XADA 2XOKD 1SQ0A 3EVNA 5KSWB 1BDBA 1Q77A 4RYLA 3VDQA 3CEPB 1I4OA 4MS1B 1TZMA 5EMLA 3WGJA 1HO3A 1MRNA 1SMKA 2ORED 1MUUA 2P62A 3DXYA 3ME5A 1PGOA 4JI1B 3TZ6A 3E7XA 4EG4A 2FSVA 5BURA 2QTVB 1S2MA 4LBZA 2O2YA 3WIDA 1Q7GA 2QX9A 5DBGA 2G0NA 1TLLA 3E5HA 1BH2A 1H05A 4BJ6A 1Z4KA 2QY9A 1U28C 4WZZA 1L5VA 2HM7A 1NM5A 1T8RA 2W6QA 3DZ8A 2PRJA 1KJZA 4L02A 4JUAA 4NZMA 3O8CA 2EGGA 2PSFA 1JSLA 3LVRE 2IFTA 1FVFA 2HIMA 3MSCA 4A16A 2G36A 5HSGA 4REQB 1S7CA 3CJRA 4RZ3A 4EO4A 2QN3A 5IM4A 4ARZA 2CSXA 3KP1A 5EHQA 2BEKA 3EGIA 1F5SA 2YVLA 1PWZA 3KHTA 4JR0A 3CZPA 4MUKA 5JSYA 3EPHA 5EYPA 1BSVA 4JP3A 5E1BA 3VYRB 2ZUEA 3LBYA 1DO2A 4RTRA 1EK5A 2XB6A 4RSGA 3CB4A 1PIWA 2RK3A 1FQWA 2VYVD 1EA5A 5K45A 3A9CA 2HWWA 4D4HA 2CFCA 1O2DA 2YXEA 3GJQA 2A58A 2WMDA 4AMUA 2X5NA 6PFKA 2F3PA 4P7KA 2GTHA 2L2QA 3OJEA 1BWPA 3MGKA 3AR5A 1PCXA 5F7JA 2EU8A 5BN5B 3TVDA 2HHAA 1ZG3A 5EUBA 4EKYA 3LIIA 3W6NA 4KSCA 1JDBC 4GKKB 3GK3A 2KI5A 4YECA 5GINE 4P7JA 3OZFA 1YZVA 1QONA 4B4WA 1ND5A 2IODA 1ZLXA 1UWVA 4M8KA 1XXHA 4R8KA 4YAOA 1ISIA 3SZMA 3P2IA 4JL5A 4J0DA 4RF2A 3UWMA 3ZVLA 5LP6F 1U0BB 2EL9A 3SLGA 1N1GA 4UE3S 1YMQA 5T6BA 3ZKAA 4BB5A 1KDRA 4FMPA 5IZ4A 1ABBA 2JGAA 3KOYA 4EYQA 1RYDA 3FJOA 1QVWA 4H1TA 5CXXA 3UWPA 3WL7A 1JHOA 1FTQA 1R66A 1QGZA 3KAQA 3RRMA 3VDNB 1XAGA 2GAJA 3JATB 4OI2A 5H9VA 3TIFA 4EP1A 3O91A 1T0BA 2OXCA 4XASA 1GRQA 3RTAA 1WMBA 3I37X 2RHHA 1GUAA 1YGYA 2XCOA 3ZDRA 3U39A 4MUFA 3FCOA 2OMEA 3BSFA 4YV7A 4G0QA 5LFAA 1YU6A 2AL7A 1DPFA 1Y1TA 3DS8A 1V1RA 5E6RB 1OTYA 2VTEA 3FZYA 5GONF 1HZJA 2X41A 1RZVA 1CG6A 2BI8A 2LE0A 4Z5XA 2VPXA 1H1LB 3GLKA 1PLLA 1P2VA 1XDSA 4YLEA 3K73O 3SKVA 4Q4CA 4FEAA 4O4IF 3N0RA 3WLHA 1TEZA 4KPYA 1M1YA 4JHXA 4B2LA 3BKXA 3H1AA 1SUCA 3P97A 4C22A 3FRHA 4CKWB 3PXUA 4Z3KA 4NYIQ 3IKTA 4J43A 1XROA 1CDOA 3A1UA 1Y82A 3BEDA 4LK2A 4XQGA 2H8KA 3D7MA 1CF9A 4MVWA 2H51A 1QF7A 4G4JA 3RYCB 1SUSA 4URVR 1EGHA 2XUAA 2JH9A 3L1UA 4H6PA 4UM8B 5IJAA 3ZD6A 4HAIA 1MX3A 2JBAA 1OA1A 3I5MA 3V9PA 3ZBPA 1YA8A 3STUA 5KYYB 5HOQA 3D5TA 4L4XA 4IGIA 1EVLA 3QEAZ 4L4YA 3N3AC 3BZBA 2E4UA 1PVDA 3TW0A 1M6YA 4MPDA 2IS1A 4PS1A 3LCUA 4TZTA 3OCXA 1RIIA 2YWBA 2R7AA 3VTAA 5T3YA 4PYNA 3SEFA 4WZAB 2IU4A 1P61B 5EWJA 4ZALA 3A2NA 1TA4A 5HP4A 3DKIA 2QL7A 1UOOA 2A9PA 2JLRA 4LRSB 4LOLA 1EEHA 3ZDAA 4N0EA 1U8YA 4XVQA 3F67A 3GUCA 4OHBA 3RTCA 4RHCA 4CUJA 3QW2A 4BQPA 2IDJA 1P0IA 1Q95A 2FPSA 4GYKA 3VI4B 4DCNA 1FDRA 4AJIA 4ZMBA 1OUMA 1X1EA 1WZUA 5JSZA 3KZXA 3TCKA 1NF9A 1RP7A 2IOHA 3ACBA 3QKUA 4QDOA 4DUGD 2RGNA 3Q41A 5BT9A 4ND8A 1SBYA 2NSJA 3QHPA 4G63A 3WB9A 3J7AC 2IYPA 1X9HA 2OAGA 5EFOA 4B7ZA 4TMFA 4TV8A 2OYRA 2H7YA 4UEWA 3KQNA 1QIFA 2CL0X 4HGNA 4YMVA 1JQ3A 4U7JA 3R7WA 4RM3A 3QI7A 4IIXA 4Q9KA 4WBNF 3T5DA 1UKYA 4NE7A 4Q4DA 3LWZA 2Y68A 3JVIA 4U63A 1R3DA 3WNQA 3P9RA 3PLAE 3BJRA 1YRYE 3HJHA 4DOMA 4QOSA 3P2JA 2A5YB 1N6NA 3CSUA 3LY9A 2O4CA 1CLUA 4WASA 5AICA 5ER6A 1SHKA 3I72A 5ELLA 3I3OA 5CM9C 3UMRA 3EMDA 2PX3A 4G0YA 2DPXA 4MQUA 3L4EA 2JEYA 3OT5A 2D2EA 4OXRA 3TUZC 4DSUA 1UJ4A 3HDYA 5JZVA 3P9IA 1DIHA 4TLLB 1F0KA 1G7RA 1K66A 1LTQA 1RMQA 4HNGA 3KBOA 4V0ME 1ZUD1 1AKYA 3GRFA 2HT1A 3ILXA 4RLSA 2F48A 5DW3A 2G7MC 3F1LA 2ZVPX 1TGYA 2ZWIA 1XHEA 2OCPA 2XMCA 3DE4X 4ODIA 4TVKA 5JNSA 5K3EA 2ZEJA 1HH4A 4QJIA 3UAYA 1MCZA 4OATA 1HYGA 4MDHA 5I5EA 1BROA 2GM4A 4UTNA 3KJGA 3LYAA 4IMRA 1IQ0A 1X7ZB 1NRIA 1KJQA 2CDCA 1HLGA 2F3SA 2BY4A 3GUVA 2YR0A 2DPMA 1DG3A 3IPLA 4DAEA 5FWXB 5IULC 3HVRA 2C8KA 2CLEB 3ZWXA 4CG1A 1C7QA 3IHLA 1CJCA 1ZNQO 2BEVA 3REGA 4C0SA 4OBBA 4D9IA 3TK1A 5KJ1A 2GFIA 4TPKA 3M3DA 4PZLA 3RD5A 3RHTA 5MF6A 3MJVA 3V1UA 3W5IA 2NLOA 1DKUA 1TRKA 2AXPA 1N2JA 3MD0A 5C5CA 1QE5A 5D5QA 4QUKA 5FAXA 2IEBA 4BNUA 2XMSA 4PFSA 5JDCA 5K2OA 1YS2X 3LVBA 4PNZA 4DILA 2NYVA 3KKPA 2XNDD 1Z06A 3AC0A 2XTZA 3B89A 3IAM6 2FX5A 5K7SA 1LPNA 2YXPX 1NKSA 1T6ZA 3A6GA 1XTZA 3HYTA 2PY6A 3EWSA 4ZVUA 5CXQA 4FFOA 4YCLA 1AVTA 3N8IA 3ZUPA 2REXB 1CY7A 1DRKA 3OLYA 5B3JC 3UMMA 5THKA 3A0UA 1JU3A 1WU7A 3EF0A 2L18A 1ODTC 4QX6A 4EB6B 3THOA 3ER8A 4YEDA 2QMEA 4WNAA 2PSDA 3SS9X 3T95A 1WW2A 4UBOA 1GZVA 1VCNA 1M0WA 2WNIA 1QX3A 4LFCB 4MUMA 3IKLA 1XXHE 1V7PC 3EODA 3R5TA 1LX6A 4JR1A 4JYPA 4G0MA 3JQBA 2JDID 2NTYC 1XKLA 5E4TA 2X0EA 4U2FA 4OO3A 4KUGA 4TYNA 1JJBA 1VSBA 4QOGA 3C4QA 1R5BA 2NXWA 1IHUA 3STWA 1GAXA 2WIKA 2R7MA 2VBFA 4R0VA 4LXXA 2X6TA 4AN1A 3U4QB 1JF8A 2PO5A 3E9NA 4JQZA 1P62B 3JQRA 4IRMA 4X8LA 3HGMA 1G5FA 3KQOA 4FCCA 2HJ9A 2H4YA 4UC0A 3U7JA 5H83A 3KYBA 2DFPA 3L8FA 4LSMA 5JYCA 1NPTO 5KDLA 3HNPA 2QX8A 3PP8A 1N9GA 4FGWA 4AWXA 5DYNA 2WKPA 1UXHA 3KKKA 4MRMB 1V5IA 1P19A 3GJ6A 2A33A 4RCYA 3NS7A 4EHIA 1GV0A 1O0BA 4H7DA 2R6CA 4R8VA 4KIUA 1W46A 3PB3A 5ILGA 3JWJA 2XEDA 1LS1A 1YQUA 5CX4A 4KN9S 3OD1A 3C4VA 4TLBA 2EQAA 1GTG1 2UUOA 4JUCA 1XAIA 4FOTA 5EJMA 4DRZA 3Q7IA 3GAAA 5ERXA 1UEJA 4I1VA 3EVGA 1A7KA 3AL0C 1ONBA 1RI1A 3F96A 1YZUA 4CIVA 2R68A 4R01A 1ZITA 3M7IA 4KRXA 2I4OA 3EARA 4AZSA 1DELA 1FFXB 1G21B 1BEEA 3M4XA 2PNJA 2O8EB 1X8KA 2B6HA 4MA0A 1DJMA 3P4XA 3AI3A 2JAUA 1K6EA 4P7BA 3SZLA 3FOWA 4A2WA 2IHZA 1NXWA 2NU6A 1W4CA 4CEHA 1FW8A 4J4HA 1J23A 5CK5A 2R6R1 5K99A 5IAAA 3AM1A 3SSNA 3MJHA 3H7IA 4MW1A 3WHIA 4AL4A 1BXRA 1P33A 4IYRA 4R68A 1JMYA 4R9VA 3X2FA 4YXFA 4TYWA 3OCVA 2WM3A 3AXSA 1V4VA 5EZSA 1NYRA 1L8AA 1NBOA 2R4TA 4Z7NB 3OM8A 4UAUA 4YPFA 4YR9A 1YQ9A 1FP4B 1LF0A 1T2CA 1W75A 3EYAA 1ZBDA 3FSJX 1BCRA 4J90A 1QUEA 2J9RA 2QRPA 1LTHR 1X70A 1KMHB 3CUEF 4UHJA 2VATA 2OFWA 1C3VA 4E46A 1PJLA 2WLTA 1BXZA 2MYUA 4YA6A 4EIWA 4Z4EA 1LWOA 1YZ3A 2P65A 4MW2A 4JZYA 4UVGA 2OA0A 3WJ1A 5KYKA 5KTSA 3BFJA 1UR5A 3AY3A 4GFDA 3M1IA 5A6SB 3V55A 1Z74A 1ZZGA 1B42A 1B3RA 5CFPA 5B58C 4Y0NA 3DTYA 1XALA 2BMAA 3R3VA 2AG5A 5AM1A 1WTAA 3EEQA 4E1AA 1DQYA 1NJ8A 5D5HA 1B0AA 3OQOA 4LFAB 1Y0BA 2OVFA 3MT7A 1FFDA 1BA3A 3SXUA 1ZWLA 1DU4A 1H4TA 1I3CA 1EFRD 1QHEA 4MGIR 4EL5A 5IVIA 1WXHA 4GU5A 3IUSA 4QO7A 4YJ2B 4Z3DA 2GCOA 1NW5A 2C4WA 4G3XA 3L7KA 3S40A 2O0HA 4B3BA 3ISVA 3W5SA 2IPNA 1BMDA 3X1WA 3NTRA 5AUNB 1AUQA 3ZHVA 3P9CA 3EFHA 1RKUA 2Q0QA 3RDPA 3B5JA 3RO7A 2IV7A 3FSGA 2XUKA 4IZHA 3HZRA 1SVWA 5DXFA 2XNSA 5T8KA 3PNOA 1W6UA 1AURA 3IBFA 3HBLA 1B00A 1IUKA 8ADHA 4RIHA 1XK7A 3IBYA 2XA9A 4FKMA 4KQXA 3BGVA 1Z6QA 4U7WA 3I30X 3WWEA 4JASB 1YB6A 3LYHA 4HCJA 4WKBA 5EJIA 1CQPA 2FWBA 3FYCA 2ATVA 4JSYA 4TKVA 3R3XA 1LFDB 3HFJA 2Y2UA 4IF4A 1WB5A 5CP8A 1P5HA 2VZ0A 5L4NA 3ITEA 1QGYA 1UXOA 3BSSA 1QK4A 3NRCA 1JEYB 2PH3A 5IHPA 2YVAA 3Q7RA 2V8OA 4FUTA 4JJ8A 1EFAA 5TXGA 5E4FA 1PV4A 3KQVA 4P82A 5CM2Z 3F6YA 3JQGB 3HXQA 2CT8A 4D3YA 4YMHA 5EUCA 3UJ9A 2QYSA 4OSOA 5I3CA 2PQMA 2RGAA 4Q7KA 4CRWB 4UEJA 3GUHA 4QXQA 3HUTA 4TM7A 5FO1A 1PUJA 1U98A 2FEAA 2XD9A 1FFBA 1TC1A 4LQ4A 1NULA 5DU2A 3CINA 5EIBD 5J2UF 1GZ5A 3R7NA 4OV6B 3P4UA 4U9IS 4BB6A 4L0DA 1ZIPA 1C7FA 1S9HA 1TM5E 4MV1A 3MTJA 4MRSA 5E9QA 5EIHA 4TXHA 4B40A 1CQWA 1SBTA 1RCFA 3E7PA 3GJ5A 4MMYB 4NATA 2PKWA 2I6FA 3T9CA 1NN5A 1Q3HA 1RLTA 4NMWA 2AMYA 3AZQA 1XMOB 4O2BB 2OOSA 3BMXA 3ZHXA 9ATCA 2AEEA 1YF3A 4GLFA 3BXFA 2FNAA 2IC5A 3ZU3A 1YI1A 2PCJA 4BP9A 1JE1A 5KWEA 1XZGA 2XVYA 5ICMA 4CHTA 3FYUB 1VE1A 2GN9A 4EGJA 2XUHA 2JI7A 2P5TB 2XGOA 4LVOA 5EZYA 4OYLA 1SZCA 3D59A 1H2FA 2V7TA 4XX0B 5CA0B 3QI2A 4K9PA 1BH6A 1DQRA 3URMA 3O4RA 5BOSB 1Y6JA 2Q0SA 3GN1A 3KYJB 1E3DA 4DLKA 5AM2A 2PLAA 1U7XA 3ILHA 2QJFA 3L46A 3LDFA 1M8JA 3G2PA 4HNHA 3P9PA 3P9ZA 1YRWA 1AUOA 2BCGY 2FHPA 1XJ5A 4QBHA 3QBTA 3TLJA 2ARKA 4ME6A 1FTYA 1EFCA 1DAGA 1UJBA 3G89A 4RGVA 3P0HA 4I5DA 1HFKA 1U1FA 4L3WA 3IB3A 5FWDA 3NHMA 1YE5A 2HBRA 3RNLA 1RHUA 2X0DA 1NIPA 1G6OA 3ESZA 4ZQGA 4Y1FA 3OE5A 2QORA 2FSVC 1LLCA 2V0CA 3O0TA 2G1KA 4L5CA 1JLHA 4GPIB 1CQIA 1NKTA 1YMVA 3IJRA 3UFBA 3Q87B 4Y2VA 5ISMA 3HEBA 1QTRA 1G8PA