4HX2A

Crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of action of a Janus-faced single-domain protein inhibitor simultaneously targeting two peptidase classes
doi rcsb
source organism Streptomyces caespitosus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords KerA
total genus 93
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4hx2A00
3DE4X 4OMDA 3WQBA 4I0WB 1YJAA 2Z2ZA 3VYVA 1GTJ1 4OV6B 2W2OA 3DE3X 1NDUA 3DE7X 3DE5X 4K8RB 4AKSA 2G4VA 1BE6A 3F7MA 2PYZA 1R6VA 2E1PA 1NDQA 3ZXYA 1ZVKA 1DBIA 1C3LA 1Y48E 1GNSA 1TO1E 2PKCA 2ZRQA 2Z58A 3EE6A 3I2YX 1T1GA 4H6WA 5ARDA 1GTG1 1SBCA 1KDVA 1C9NA 1LW6E 1TM1E 1SBIA 2Z2XA 4RYDA 4ZARA 1KDZA 3LPDA 3DE0X 1TM4E 1OYOA 3OSZA 1KDYA 1PFGA 2W2PA 3CO0S 1SCBA 2IY9A 1P7VA 3DE1X 4GI3A 4WOBA 1PEKE 1YU6A 4B5LA 1Y34E 5AVJA 5AVKA 1WMFA 1T1EA 3D43A 3DE2X 1SCJA 4OMCA 5ARBA 4HX2A 1SVNA 1PTKA 1YJCA 4DWWA 3DDZX 3DW1X 4NE9A 2WV7A 1TO2E 1V5IA 1Y3FE 3SICE 4CG0A 3A3NA 3TI7A 3TI9A 1IAVA 2ZWPA 2DP4E 3BX1A 3I34X 2ID4A 5FBZA 1WMEA 2WUVA 4ZOQI 1TK2A 1Y3BE 1EGQA 2WWTA 2Z56A 3Q40A 3VV2A 3WHIA 4HVLA 1NLUA 4YN3A 1GNVA 2ST1A 3GT3A 2SNIE 3VSBA 2PQ2A 1THMA 1Y1KE 1Y4AE 1Y9ZA 1SUBA 2GKOA 2PWAA 3I37X 1BFKA 4H6XA 5FFNA 2ID8A 1SUCA 1S2NA 3SQOA 1DUIA 1BFUA 2SECE 2W2MA 2ZWOA 2P4EA 1WMDA 3P5BA 1SCDA 3PTLA 5I9SA 1AU9A 5JXIA 5JXJA 3DVQX 3DW3X 1GA4A 5JMOA 3F7OA 1CSEE 1S02A 4KB5A 1SUEA 2X8JA 3UNXA 1Y33E 4C3VA 1C9JA 3D9QX 2Z2YA 3EDYA 1ST2A 1SBTA 1BJRE 1SIOA 1R0RE 4LVOA 4NMXB 5CW1A 5B1DA 3VTAA 3CNQS 3QMPA 1P8JA 5FAXA 4JP8A 3A3OA 1SUDA 1AF4A 2DQKA 3Q5GA 2PMWB 3EIFA 3BPSA 2TECE 3LPCA 3DWEX 1Y4DE 3WIUA 3GCWA 1XF1A 2HD4A 2XRMA 1SBHA 3LXUX 3PRKE 1P7WA 1AVTA 1EA7A 1MEEA 4KPGA 1MPTA 3F49S 1R64A 2PWBA 4H6VA 4J94A 5B1EA 2Z30A 3DE6X 1SN7A 1KE2A 1GA6A 3QTLA 5ARCA 1GA1A 1SUAA 1TM7E 2HPZA 2PRKA 2W2QA 1IC6A 3AFGA 1SELA 1SH7A 3LPAA 4KG7A 4NE7A 1SCAA 1C9MA 5JXHA 1HT3A 1OYVA 1AH2A 1WVMA 3VHQA 1JEAA 1A2QA 1OT5A 1SUPA 3H42B 1UBNA 3TECE 4WOCA 5AQEA 1Y3DE 5SICE 2IXTA 2SICE 3I30X 3AJ9A 4MZDA 2X8JB 4DJ5X 3ZXXA 5K7SA 3QFHA 2SBTA 1T1IA 2V8BA 5AMXA 1GCIA 1TM3E 1YJBA 4FONA 1KE1A 4M1ZA 1SIUA 3A3PA 3HJRA 3WIVA 1AQNA 4C3UA 4Z2AA 3VV3A 3BGOS 1Y3CE 1GTL1 3GT4A 1WSDA 3DVSX 1SBNE 4DZTA 3L1KA 1AK9A 2B6NA 2XTJA 1Q5PA 1V6CA 3DVRX 4AKTA 4BWGA 2Z57A 1CNMA 2WUWE 1BH6A 1SIBE 1BE8A 1TMGE 2DUJA 3T41A 1ST3A 2QTWB 4CFYA 3DYBA 1TM5E 4CFZA 4LVNA 1ZVJA 3AJ8A 1SCNE 3GCXA 1TECE 1VSBA 2W2NA 5JXGA 1GT91 1AV7A 1SPBS 1PJ8A 1S01A
chains in the Genus database with same CATH superfamily
5LQSA 1H93A 1Q0UA 1VKHA 2I8AA 1Z3CA 3GRRA 3PD1A 3Q8WA 4MRVA 4K3VA 5CNIA 3V1UA 1FFDA 2AB0A 2GHRA 3ASUA 3HABA 5A4JA 4M55A 2BEWA 2QYSA 4ZJPA 2BFBA 2HZ7A 2XGSA 2Y6VA 3A0RB 2BOVA 4H7HA 4ZXPA 1IHXA 5BWBA 3AL0C 1RAHA 5EJ2A 1KZ7B 2ZJ3A 2X6RA 4D9HA 3TLYA 4D8VA 4DBLC 4ZV4A 1XXHB 2APJA 2JHAA 1ZWKA 3FOWA 1EVJA 1GT6A 1H66A 1P3DA 4EB0A 1UBSB 2VH5R 4YK7A 3H16A 4JZYA 5ALLA 3TNLA 4HADA 4DQXA 4UJ5A 3RSSA 3KWLA 1OREA 2H7VA 4G09A 4B5LA 3K6SA 1PK8A 1L1RA 4KQFA 3M34A 1F0PA 3NORA 1Q7GA 5GV7A 1T9GR 2ZBFA 5JSQA 5KKNB 1PTKA 2G5PA 1Z2DA 3RPEA 2FFJA 3ZDFA 5DPMA 1Z63A 4DLNA 4ER5A 5BW5A 5CEJA 5CFMA 2O3SA 3RBAA 1ECLA 3WWPA 4IIVA 3ZE7A 3N76A 3OIYA 2C2KA 1I1OA 1PK9A 2AJTA 4W1RA 3LW7A 3ZJ5A 3EIXA 1RHKA 2XQJA 5AUQA 3ZQKA 3I1YA 1AQ6A 4TXJA 5A3RA 1YS4A 3SXUB 2JLWA 1MDBA 1N5LA 4J16C 3C1TA 2A5GA 4R83A 2OBYA 1C8VB 3A6JA 4WESA 3ZEIA 3I2HA 5BQFA 4O1IA 2MWMA 3BYZA 4D0GA 1P9OA 4I5FA 4ND8A 3DD1A 3ZHXA 1QZXA 2IHBA 1T3SA 3MZ0A 2OENG 1JECA 4MGIR 4Y2RA 3AXTA 2VF8A 3WO0A 4ER3A 1A97A 2WD7B 5B2EA 3V8QA 3G88A 2VRWA 3B12A 1IHUA 1XTUA 5AKHA 2WKPA 1S1MA 2QSZA 5K0JA 2M6SA 4Y0NA 1H1LB 1OXUA 1UPXA 2PWBA 1L7BA 1XZ8A 4HPWA 3O8RA 4LF6B 4LF7B 1UJ4A 4FLEA 4MAMA 1QVRA 4AKHA 3KXKA 2DPGA 4PAQA 3ONEA 2IHVA 3B9BA 3CLHA 1P80A 3MTAA 1M1XB 2QENA 3BA6A 3BJRA 1AXEA 2A5LA 2C8JA 2D0DA 1C9DB 1KC1A 3OKFA 3RROA 2I2FA 2FPRA 4PLPA 1UBEA 1JIIA 2ORYA 4KBGA 5ER9A 2XDQB 2SICE 4BVKA 4Z4IA 3BOSA 4DS3A 2PPVA 3G0CA 1FRFS 4IS2A 4KR0A 1QQBA 1D9ZA 4DR7B 1XZLA 1PX2A 5J59A 2RBGA 4FKZA 5GONB 1GQSA 1KY4A 2ZGVA 4HXEB 1AURA 7REQA 2ZIXA 3H9GA 3ZD9A 1RAIA 3COWA 1E4EB 3KO8A 4XQCA 1S7CA 1PIWA 4O63O 2COUA 4KX5A 1KSGA 3LA6A 5U9CA 4CEJB 4QU0A 1WPRA 5JWOA 2VXBA 2HF2A 1QO9A 5JMPA 4G8DA 4F6RA 4RZUA 2IY7A 3SZUA 6GPBA 4C4YA 2H4WA 4MIEA 1QF6A 4NHEA 1EGAA 3P2EA 1S01A 4Z9XA 5G02A 4PS1A 3EOBI 1QU3A 1CDDA 2WHPA 3EEIA 3KXIA 5H9VA 1ZM3A 4B5KA 4FFWA 1VMIA 1Z0AA 2EJUA 4FJ0A 4HLDA 4Q9KA 4F71A 3H2KA 3KT3A 1RXSA 5D51S 4ARUA 3LSTA 1GQOA 4FOOA 1F2DA 4RPIA 4H7PA 4DN6A 1KJYA 3CSDA 5H7XA 2DQ4A 3PLRA 2OLJA 3JPYA 5KNBA 3HB7A 1CBUA 4BE9A 2I6XA 3BSSA 1YL6A 4ZAYA 2Y3IA 4LX8A 2EX1A 2O06A 2H5EA 3NFYA 4ALMA 3OJWA 1LK7A 4QOEA 3K35A 4LNUA 3SKVA 2JLYA 3HGTA 2VZ9A 3HN7A 4W63A 4ADSG 1E6KA 1J0CA 1SCIA 2DFPA 2GBLC 3TSOA 1CZLA 1LPOA 1S8OA 5CHYA 2W11A 1R7RA 2Z2KA 3D6NB 4CF6A 1QORA 4HX2A 4CF3A 1PQYA 4GMFA 3KKEA 1AGYA 2OSBA 4AJEA 1OJ7A 1W73A 1MB2A 3SS7X 5BORA 3K71B 3HO1A 5T64A 3RK0A 4GBED 1TNDA 4AI6A 2XD9A 2EIXA 2IHUA 3E05A 5FUVA 3NBAA 2F9FA 4A16A 1RWOA 4RDHA 2ZU0C 1VRVA 3S2UA 4BX8A 3AO0B 4JJFA 1KIMA 3FNRA 2IXFA 3CX7A 1YTLA 2A1UB 1G8YA 4QT0A 4WEOA 3HVJA 3RCBA 3X44A 2ZM6B 1QCCA 2QPLA 1C9JA 4FPXA 4LVCA 2NUAB 3RABA 3GUYA 3T12A 4ZK2A 1HYEA 4GZMA 3F2IA 3NIBA 4FLFA 2X2PA 1EWQA 3ND5A 4YP7A 2Y6UA 4WK6A 3GCWA 4DKJA 1F17A 4E4RA 2W2LD 2RAUA 1NJGA 2JCXA 2PGLA 1N7HA 5JWRA 3KAJA 1PZFA 1GGVA 1Z13A 4G65A 2XUIA 4L8YA 3JX9A 4PWZA 4TKLA 3SC3A 1C1DB 2OYSA 1X7YA 4PXSA 1ZK1A 1R4NB 2AR7A 2V5AA 1IDOA 1O94A 2Q6KA 3W0LB 4YAUA 1Z4IA 4R01A 2HA4A 1D2NA 2FJUA 4XD7D 4F2PA 3O7MA 4OX9Y 5JEDA 5HQTA 4XUCA 1NJFA 2H1RA 1RIFA 2R79A 3QW2A 4LCEA 4F4CA 5F9HA 4LK2A 3DKVA 2CLFB 2DUUA 3F46A 1IBRA 2JJYA 3ETCA 4K9NA 5DCYA 4DDMA 1E7WA 2QYTA 1KJIA 2VJOA 4L1KA 2H48A 5JXGA 3F5QA 4X3OA 2NP6A 4JVSB 4TLDA 3RC7A 3S2GA 3V48A 3K9QO 4WBSA 1UP4A 1SEVA 1WZIA 1RKQA 1ESCA 2A33A 4TUYF 4Q4CA 3I9FA 4AKGA 4BWVA 3QU7A 2ZPTX 1ZOPA 4R3UC 4GPEA 2WTNA 1Q5PA 3JQAB 4R0VA 2CV0A 3F5MA 2M98A 3DLIA 2K4MA 2VCHA 4A8JC 3R6DA 5KTSA 4K3UA 4Z5XA 1CP3A 2QHXA 4MIYA 1JDBC 4B87A 3I0NA 4OP1A 2J7KA 3W6NA 5HCIA 1V0JA 3S7TA 3JD4A 3C5HA 4BC0A 5ALNA 2CL0X 3PFIA 3FROA 3OAAA 5HEKA 3COJA 2XYPA 4U0JA 1U8CB 2GNAA 2PSEA 3GJSA 5E6SB 3U26A 4DXAA 2P3OA 1LSOA 4CMEA 1Z4QA 1YQUA 5EWMA 2AOTB 1QRAA 3E9MA 3D4PA 1XROA 5H16A 2IITA 2G1UA 3FNHA 1AKEA 1MT3A 1UP7A 3FRIA 1WWKA 3RQIA 3U9TA 1EFKA 4PGGA 2ODNA 1E0KA 4IQFA 1TTHA 2WQ7A 3ZJUA 1J2YA 4G1BA 3SLKA 1NA5A 3KM0A 4I55A 4OXYA 1PQWA 3C7DB 4PZPA 4C76A 2YV2A 4OI2A 2GUGA 3MXTA 4JUFA 5KSYA 5IDXA 2IUTA 3U7JA 1P7YA 3WMGA 1J09A 1X1AA 2BJVA 4EM6A 1YOVA 3EC7A 1P7PA 5C0OE 4Q4AB 3VR3D 4WQMA 5J63A 4HQ0A 1EG2A 3NIDB 2JATA 6YASA 4C0SA 4OP3A 4E6PA 2G09A 4R1MA 5BV2P 4OHMA 4D4IA 4LRYA 4TN5A 2QN3A 1X0VA 3PUVA 1GFZA 1Y4AE 4FMBB 4Q39A 3K9GA 3EPHA 4XTCS 1S2NA 1KVSA 4G5RA 4L0DA 4UU8A 3U09A 5IVHA 2QLBA 4H4EA 4J0FA 1G2QA 1E2EA 4U7WA 1JT9A 4IP0A 4X91A 3ZDQA 3N0XA 3B20A 3G59A 5L7TA 3UNXA 3ZCTA 3N2EA 5J5CA 3GU3A 4J3FA 1NQOA 4F4JA 1HV8A 2ANCA 4YX9A 3IPYA 4POOA 2SKDA 4NX2A 3KR9A 1NT4A 4Z7JA 3CVYA 3DLAA 3VR3A 4QOHA 2DPYA 3A3OA 4WFKA 4E5KA 1Z6AA 3IIMA 4OK5A 3FBWA 2BKLA 3Q6IA 1RM3A 4EI2A 1EP3B 1RYBA 2Y2UA 5ERYA 1QGYA 1RLTA 1XJCA 4Z54A 2YXEA 3HKDA 2BCGY 2YRFA 2Z8YM 1WB6A 3A1VA 3MB8A 4R1TA 4XQ9A 4P4SB 2F67A 4LQCA 2B4KA 2RHOA 4MYTA 2ZB8A 4LXXA 3R3ZA 1VYHA 2QRZA 4NIMA 5B36A 1OV4A 4CEHA 1BXKA 3H42B 5T57A 4UASA 4WKGA 4F92B 3SVTA 1VLJA 4L57A 5AHXA 2O8CB 1DRWA 1MA3A 3CY6A 3DO5A 3IPAA 3FZEA 3ITNA 2PCJA 4I4IA 4XXHA 4J76A 4QOGA 3V42A 2DT5A 3I04A 1W4BA 3MPOA 1CWUA 2PIAA 1QTQA 3WGTA 4G9GA 2XIJA 3SZLA 2VPZA 3OOHA 4JA2A 2QTZA 2ORWA 1KYZA 3C39A 3DL4A 4MR8A 4QJIA 2Y67A 2CDBA 4G01B 2WHXA 4FNOA 1BD4A 4XQ0A 4LJAA 2FWRA 3G13A 3TL3A 1N3LA 1N5DA 5DE3A 2BEWB 3DHNA 4XLZA 3S68A 3OLZA 1VPWA 5CDSA 4MI3A 2PLRA 5EQTA 1YAJA 4YMWA 4N1AA 1V6CA 1WB4A 1Q1EA 3PEUA 5BR1A 1JMYA 5ILGA 3WWZA 2ONYA 3RANA 2NUBA 5KS2A 1QP8A 3DKRA 4MHTA 5JRJA 4NECA 3EVCA 1DKOA 4GF5A 3FFBA 4FK8A 2W2NA 4MLZA 4MUIA 4XOIA 8OHMA 2J09A 3BXOA 2BZSA 1CR1A 3JQAA 4MB6A 4OCZA 3S1AA 4Z53A 2XUGA 4B6FA 1JDJA 3D4NA 1EX9A 4FC7A 3LUGA 1ISRA 1QYCA 1H2XA 2WUFA 2HHHB 3ADCA 3THWB 3NEYA 2B25A 3FPFA 1P6XA 3OURA 3GA7A 4Z9FA 3UB3A 5HZHA 3EEOA 3J80A 2CJFA 1FFAA 2Y68A 1OA1A 2WWVD 1QX3A 3MLAA 2NYUA 1YHZA 3CUSA 3QLVC 4AKIA 1ENYA 1SXIA 3IA7A 3X1XA 4IIJF 3D4LA 4W9RA 1DCMA 1E0SA 1TKRA 3B9PA 2VTBB 3OQBA 2WAYA 4B7ZA 3CISA 1KAHA 2W2LA 2XUPA 1KJQA 2FA9A 2Z1NA 2ZRJA 3O3CA 3R7DA 4B9EA 4CR6A 5MN6A 3CVUA 4GICA 4H6PA 2JVJA 1TMOA 2HY7A 2ZTSA 3QBVA 2Q4OA 4I50F 5EIAA 1TT7A 4PSKA 3PT9A 4IG9A 3JQCA 2F43A 2WZDA 4M0FA 1QPBA 2HBYA 3QI7A 5EP2A 4OM7A 3T0FA 3HDHA 4TTVA 1X3LA 3C5VA 4CBVA 5PGMA 3ZDZB 1UXGA 4ND2A 2GEFA 4QYIB 3FPCA 4QIHA 1I3OA 1DIHA 2GKOA 3FXAA 2ZWVA 2AOVA 2Y0CA 5FRDA 7GPBA 4ZRNA 3OKPA 4UXJA 1FPQA 1D2GA 4ZVQA 2XKBA 4QEKA 5C8YF 2XUAA 3ET4A 5D8DA 3OWOA 5CGQB 1QUEA 3QX8A 3TLAA 2FW6A 3VAYA 1HI9A 1S02A 2B3TA 2O07A 1K63A 3ACCA 1FQJA 3IS3A 4UHDA 4V24A 1UBKS 3EDYA 3KKZA 3OM1A 4NK4A 4F04A 1R6TA 3QYJA 5KDDA 1O89A 4PO1A 5CDHA 2HLPA 1SVLA 2FSFA 4JUBA 4ZWNA 1ZJJA 5A0VA 1MN6A 3C6KA 4KQ1A 2NO7A 1PT7A 3DZBA 1HE4A 1LSSA 1X0XA 3LPCA 4U0KA 4UUNA 1TZCA 3SR4A 1O03A 5A02A 2D54A 1KEWA 1GL9B 2G5GX 2WY2D 4F2WA 5KPDA 1F0YA 2GA9A 2I6GA 3BWVA 4YMIA 4AC9A 3OQVA 1ABFA 2GYUA 4YDSA 4PG7A 5EJFA 3VQTA 4TMFA 4KDFA 1N6PA 3V8EA 4L78A 1VKRA 2KLBA 1U7UA 1OBOA 1GRCA 4M1WA 1KEVA 3TJZA 1FCJA 4F5EA 3B6JA 1J21A 4M46A 2EXXA 3PWTA 4HQNA 4J9VA 1MAWA 4JYAB 2FP3A 3E3LA 1P2UA 4Q6BA 3KEQA 4QTTB 5JPIA 5CB4B 5IASA 4EKGA 3S29A 4DEVA 2JFXA 2I62A 4A73A 4FR5A 1ZEJA 3U44A 1GCIA 1KO1A 2DCUA 3D2AA 5HM8A 4FXPA 1MJGA 3B9RA 3H11A 5HQ3A 4HP8A 4PYIA 1R18A 1DTSA 1SCUB 1NUHA 1V43A 2BSAA 3G6WA 3MUEA 3OEWA 4UNIA 5IK2A 4NZYA 4AZ3B 5K45A 4OI4A 1IONA 4EA7A 4LGMA 3DUFB 3UANA 1HG0A 5FBRB 2QTFA 3BL5A 2G1PA 4C6HA 5B7NA 3O2QB 1U8EA 2JLZA 2IPOA 2TMYA 1KVUA 4GU5A 4JNCA 4BBZA 4D8YA 1LSUA 5KNBH 2Z98A 4LY0A 4Q1VA 1RU3A 2HXYA 4RCVA 1D6NA 3WKEA 5ED0A 1MIHA 1MV8A 1TKAA 1L3IA 1WXIA 3GXBA 3KL4A 4ZI7F 3ROMA 4DGQA 4PLWA 5JVDF 4DCCA 4EHKA 1K66A 1OI3A 2FI1A 2JAWA 3O4VA 2V59A 2YZ7A 4IZOA 4QD3A 3GIWA 4U6QA 3P8ZA 3VU3A 1KK2A 5LQJA 2FUNB 1S2LA 5FUWA 4YYZA 1NVXQ 1WQ1R 1VRWA 4OBWA 1G1AA 1NZFA 3P27A 2W6JA 1U2TA 2O3UA 2Q9BA 1Y48E 4FCCA 3KQKA 5AK6A 5ALJA 4N5HX 5B55A 1CQWA 3A1SA 1MVOA 1TUBA 2PXXA 3FMGA 3ONNA 3SX4A 4C5AA 4OQXA 2UVQA 4DJJA 3QKUA 2O48X 1IUOA 1WUTA 4E7OA 1A8IA 4CTKA 5G4KA 5JJLA 2WKRA 1WXQA 4CUZA 4F5DA 2VQDA 4NZZA 3ZE6A 1B0ZA 1WMFA 2CVHA 2E0IA 2Q3CA 2W90A 4IBOA 4ZT5A 2XGJA 1WHSA 3K1TA 3JWGA 4G1EB 4X5OA 4XVRA 5AH0A 3FYHA 4NE9A 1KPGA 3TIXB 3PFHA 1II0A 4IX1A 5JZ9A 4DB2A 3HNRA 1Q17A 3N2NA 2FHPA 2N1BA 3T7TA 1XVAA 3LF2A 2QY6A 4NYIR 3ZJVA 1A69A 2PH7A 4FYPA 3WJ7A 3ADDA 5J2UB 4NS1A 1WA5A 2J9FB 3ET5A 3RFTA 2RG7A 2A78A 1A2OA 2QQGA 3VR5H 5K0EA 3VKUA 2P69A 4ZYWA 1BFUA 1PDVA 2O2HA 3SEQA 1YR1A 2Q99A 4YUXA 3LY9A 1G60A 4DDWA 1JLSA 5IKXA 4ZC8A 5IP5A 1A7KA 2P8JA 2XAAA 3PHGA 4B2IA 1A7AA 3ML1A 2J41A 2MMCA 3EQ8A 3H8WA 4DOMA 4D26A 3FTFA 1GV0A 1E8DA 1R0RE 1W75A 3GDGA 4Q21A 2GHQA 4I66A 5LZ5A 4L3WA 1AN9A 2VJYA 3CKMA 1LLCA 1I6MA 3MYYA 3QELA 4TROA 5AO9A 3LUDA 4BKUA 1Z17A 1QTNA 1YI0A 4LFBB 4OSEA 5AW6A 3WIDA 4CI9A 3CB4A 3FPJA 2V65A 3N28A 1XD2A 3SHVA 3T7KA 1KYQA 5ALDA 2CHVA 2G25A 4OBEA 3W5JA 2VPXA 4IR7A 3DG9A 1KK0A 1B8NA 2CJWB 2Z8ZA 4U3JA 4Y1GA 3LZDA 1FSPA 2ZR0A 3P20A 3K73O 4CM8A 2C2MA 3UC5A 2J0UB 2WQ6A 4X41A 3BS4A 4UMFA 4IH9A 3TQFA 1X13A 2I2DA 2QTMA 3AF0A 1DPFA 4J0CA 4MAFA 4DIOA 5FI0B 1NW3A 2G71A 1B1CA 1T91A 4IJUA 4IIDA 4GWLA 2FN7A 3MG9A 4XCXA 4EG3A 2G04A 3SPXA 5B12A 1BEEA 3C6ZA 1W5FA 5JANA 3ETGA 2VA9A 3TFWA 1KEEA 2CD9A 2Q2QA 4TTSA 1X8LA 2WAAA 4GSYA 4J91A 5BO5A 2VAWA 2X14A 2Q49A 1K8YB 2AFHB 5FJIA 2PZBA 1ARZA 3E9NA 4OI1A 2Z4TA 5LLSA 1PBTA 2X7JA 2VYND 3VFDA 1GXSB 4MRPA 2VNSA 4OLHA 3VXKA 4RW0A 4N3BA 4UULA 4I9UA 1ADJA 1RAAA 4A2CA 2A5DA 2B82A 4K9QA 3Q5DA 4B76A 3RYHA 3UMBA 1PQ4A 5EMHA 5A9RA 5I4KA 1YNSA 1NE2A 4Q3CA 2AG5A 4H3KB 3GB9A 4NU8X 5LOVB 1FBTA 3F4BA 3LVFO 3X2FA 4RLQA 3DTNA 3LKVA 4F0JA 2EFEB 2Z8YA 3LOPA 4FEGA 3ZI0A 2I6FA 3RVNA 4I5IA 4BBPA 5T5QA 1TCAA 1QDLB 3KSUA 3F71A 1PR2A 1OC2A 3NWJA 3QLUC 4FFLA 4YUWA 5CA0B 4WBNB 1Z4LA 2CC2A 2N47A 3NO4A 3SOZA 3W6ZA 1PZNA 1RWPA 3VJMA 2FG5A 1IY1A 1QOQB 1JQBA 2NU8B 3B60A 3IPLA 4P86A 3UWSA 1CY4A 2BKAA 3R0VA 3A3KA 3DOJA 4HZIA 3W5IA 1ITZA 1QLWA 2JF0A 1DJPA 2BH9A 3RS0A 3PHHA 4TSKA 4Z1OA 3B53X 4H1HA 4RMIA 5C4MA 3TGWA 1ZYUA 3WYEA 2JJ1A 1CUGA 4QQKA 3IDAA 1GADO 1QPGA 1UJMA 4DA9A 4FWBA 5EJ8A 5JS2A 3ETJA 1UBUS 4AJLA 2FRXA 1IXRC 1QIJA 2O7SA 3HYLA 1T0UA 3K4QA 1J2RA 5JNLA 1W52X 1G4HA 1WCYA 1ZSVA 4JCOA 2C96A 4IVRA 1EU1A 2COEA 3R3WA 4NV1A 5BSTA 1C4KA 3OX4A 1FU8A 2GN2A 2P7HA 2QXTA 3IH5A 4A6PA 1Q1NA 2MSKA 4MGZR 4YT2A 4I1RA 4NEGA 4CM4A 2D0PB 4G23A 5EKUA 4YCCA 2WPDA 1EWVA 1YQTA 1MU0A 1WW2A 3DZ8A 3CSSA 4H6XA 1HE8B 4DUPA 5E7QA 4B3XA 1JEYB 1DUIA 1ODKA 1P33A 2AMLA 2X22A 5F9FA 3MEQA 3H11B 3PPYA 2PR7A 3GMDA 3RYCB 1P0PA 4ZQGA 2YFYA 3DL2A 3SI7A 4BRSA 1OXMA 2HQOA 3CX3A 4GX5A 3GPIA 1D8AA 1F1JA 3N2GA 1DX4A 4CEIA 1SBTA 4NPAA 2R11A 4E2YA 1KTIA 2DBVO 1P4SA 1UFKA 1HF3A 1OAAA 2BVNA 2IE0A 3C87A 4Z8YA 3T5PA 5A1TA 3H0KA 4WLNA 3BFXA 4YAJA 2YWRA 4GS5A 1FFXA 4HYYA 4OQPA 4X3PA 3HYCA 2XDWA 1FEZA 1OLXB 2P4SA 4RHUA 1X19A 1M1UA 1KERA 3I8SA 2HWWA 4WK0B 1TC2A 4RPCA 3RK4A 4QM6A 2O3JA 2VEOA 1ZXXA 5AHRA 3CS3A 4Q03A 1ACMA 1CUSA 1JXAA 3ZKAA 2JRCA 5KWEA 2IZZA 2NZUG 5MFPA 1NU6A 3I01A 3K4PA 1D03A 3D8UA 2D2FA 3A10A 4IV8A 2W6MA 4A15A 4TLBA 1M0EA 1YZHA 1RAFA 1UT8A 2ZRMA 3ZXXA 1Y8RB 2I76A 5BURA 4OHUA 4V0RA 2QX8A 3A6ZA 3GBSA 2VN8A 3B3AA 3S55A 5ELXA 1FMFA 1OH8A 1WUKS 3OZXA 3T7JA 1U9CA 2WKQA 3MJ4A 4DWJA 5LZ2A 3BGVA 3H75A 4F60A 5FTLA 1LXCA 2ZT7A 2AMFA 2C1EA 1M2VA 1T4GA 4JJGA 5JC1A 2FZKA 1P6UA 3GGDA 1AK9A 2AVNA 2H07A 3MC1A 4ISBA 2PWPA 3UXYA 3ZQ6A 1KYTA 4CNBA 1R74A 1MFZA 5GZ6A 2MOKA 2PZLA 2BCJQ 4QWWA 3T3HA 1WY7A 2G88A 4KSBA 4DT1B 2P4HX 2GXSA 3E3OA 2JIMA 3H5OA 4EHIA 3UIEA 1SULA 4HDCA 3ROGA 5JD6A 2BDEA 4WA8A 1Z5ZA 4PPNA 2V55B 2Q3HA 1KDOA 2JI8A 3NHZA 4KN5A 1ZI9A 3TUJC 3TCKA 5IRCD 1XLVA 2BDTA 4PG8A 4MULA 3UJ3X 4GOMD 3DTVB 4B6RA 3UPDA 2IVFA 4QDZA 4U2GA 1QS0A 4JA0A 4IIXA 4LC1A 2BFNA 3W8EA 4RM2A 1IN4A 1AUQA 2QVGA 3OCZA 2QV0A 5HM6A 1NMZA 1N5KA 4QNMA 4RIFA 2YICA 3KT8A 4QLBA 4L3OA 1NBWB 1OAKA 4ES6A 3FHTA 4NJOA 2LPMA 4BVHA 3VYSB 1ANKA 2H0AA 2VSXA 4Q82A 1EQAA 4EBFA 2CFOA 3BHMA 1T1EA 2CXPA 1N33B 1K2WA 1PR3A 3OCWA 1ZZEA 4F12A 3A6PC 1A98A 5IT5A 2C57A 5JAIA 2VH1A 4Q19A 4GGMX 2AOXA 3C4QA 5IDQA 3FTCA 2GF0A 1Q21A 1OB2A 1CNFA 1IN5A 4W99A 2XB2A 1M2VB 5JBQA 3KVVA 1BQ3A 5HGXA 5A1JA 1NVVR 5KCMA 2PV0A 1PR0A 2WUVA 1HNZB 5A4MS 4JK3A 3G7NA 1Z8NA 2R8RA 4YAIA 4MOWA 1ZAYA 2DECA 3MWJA 1H0SA 5EN4A 1SUBA 4EUEA 4FDMA 3L7NA 4WLOA 2F90A 3GEBA 3SF0A 4CTNA 1EYZA 1L8AA 2TRSB 1T6XA 1UZUA 2B0CA 1QYXA 4U5QA 5FWAA 3WLOA 5JMOA 1U2PA 3E2PA 1H1TA 4W9NC 1GRQA 1Y33E 4B1FA 5I51A 2DFTA 3LDGA 2W48A 3DZFA 5GAJA 1FU4A 1MHTA 4J1QA 1WKBA 2XV1A 1X86B 3QPAA 2HV8A 2IP2A 4IRXA 2Y2VA 3R3SA 4EMSA 2XGGA 3DZKA 4LOKA 1ZVVA 1XQ6A 1PGJA 1UWLA 2R4QA 4KQJA 3GLVA 4L4XA 2AOUB 4DW8A 4GGOA 2ACVA 5D84A 2C61A 3IXMA 3NQ41 4KO3S 1A8PA 3QEMA 1JW9B 2K5UA 2P3QA 1KETA 1SUAA 3GVXA 3O38A 2ZUVA 1H3FA 2R66A 1TK3A 1JU3A 1J0AA 1ZNYA 5C5DA 2XVXA 1MRSA 4U2FA 4GXRA 2DHRA 4I8IA 4KFRA 5AM2A 4MH0R 1P1FA 1E61A 3GYBA 4QYTA 5FTKA 5KX5B 4YLEA 1TM3E 1VZ2A 2OT3B 5DTQA 2HRRA 5DBFA 4C3UA 1GARA 4RH3A 3VKWA 1R0LA 1PNQA 2XY4A 4HEA1 1KZ4A 5IEJA 3H3JA 3G1WA 3NTLA 5D3QA 3N39C 3O84A 2IYEA 4P0TA 4RD2A 1P2SA 1WNFA 2AD5A 4ER6A 1CR6A 4YT4A 4GOJA 4E33A 4JI8B 2OC4A 2OHXA 2YQ4A 1CFZA 4Q93A 5FADA 1BE8A 1EDDA 3T1VA 3URMA 3T7IA 3BGWA 3DOEA 3HADA 3KWFA 2ZYGA 3I6QA 4HX5A 4JJIA 1X3SA 4UE3S 3U9LA 4ZI2A 2JW5A 1RHUA 3QX3A 1KDTA 2VDVE 5E2BA 2QYOA 3C3WA 4IQ4A 1COWD 1WPQA 3DE1X 2VQFB 1R0WA 4RM3A 2PL1A 2OGSA 3HWWA 4RGQA 5K9ZA 2O5RA 3TLKA 4BV2A 1Q0LA 2B5WA 4CDMA 1U28A 1NDUA 3ABOB 3QXSA 1GRRA 1H1DA 3OM0A 1ZD9A 2E1PA 4PO8A 821PA 2R3SA 3ILXA 3GZJA 1ES9A 4JUCA 5EA2A 5CA0A 2ZYIA 1C0PA 5K3OA 1CRWG 1LBSA 3FTDA 4KOAA 4QUEA 1SC1A 2P9CA 3VTZA 1ZGJA 4HTAA 1XLTA 1BA3A 1NQUA 1OXBB 3BRWD 4PEVA 4RK0A 1MV5A 1RMQA 1Q50A 2WFAA 2TS1A 1CQJA 2XB6A 3HKBB 4QQFA 4AYXA 5KSWB 2O2SA 2XD4A 2QF7A 3HR7A 1ISFA 4GMKA 1PLLA 2PR2A 4IHQA 1PT8A 3EVBA 4FDLA 4EHFA 5ILQA 2Q21A 3DBRB 4J0QA 1GXSA 2VF5X 3OLYA 4O4HF 5HCNA 5IJ9B 1EGQA 1L4GA 3MYRA 1N5JA 2G9VA 2C07A 4YR7A 3OA0A 3PJEA 3VDRA 3DXZA 3WGUA 2X2EA 4YRZA 3UXEA 2AKYA 3EZYA 2ORIA 2J5KA 2ZBVA 4GI2A 1S8NA 5LP6A 4LXYA 2PWYA 3P4UA 4EUKA 1KDPA 3P71T 4NZNA 3I5UA 4OFWA 1FVXA 1GA4A 2FN4A 3AG6A 4DV0B 4UATA 1JFRA 2Q3EA 2YC2C 1GKUB 3CWCA 4FFVA 4DEXA 1KZ1A 3DBIA 3SJCA 3PC7A 3L93A 3NRBA 4C4TA 2X1HA 3IHLA 1E3LA 3L2OB 3OEED 4JFAA 4B31A 4OAOA 3TXAA 3T5CA 5BUSA 3VUFA 2RGYA 1KTVA 1TDJA 1B6RA 4V0LA 2NU9B 3O3NB 3DHEA 4D9EA 5LD2B 1NPTO 3DS8A 4ZCIA 2ACKA 2JASA 1M34A 2Q5CA 5LIPA 1RI3A 4QHTA 3OQPA 3EA5A 4X63A 4LECA 3UK1A 4NONA 2XMBA 4MV3A 2XUJA 1D5CA 2W8BB 5F2NA 1HL7A 2WSLA 3ZHQA 4JSRA 1U0HC 4Z9AA 3DTVD 1IXSB 3H2GA 2NUAA 5EE5B 5SICE 5M2QA 1SHUX 2QGZA 4RHCA 3RAGA 4EX6A 2V8BA 3K8QA 2E5WA 2PKWA 1T9AA 3EBPA 3HCWA 5TY0A 4CKEB 4DQKA 5AW0A 3S2ZA 1W6UA 4GRDA 1USKA 2VSFA 1C4XA 1QIHA 2AJCA 3L7KA 4FJ2A 2QRLA 4KTVE 4PXAA 4V3CA 3UAZA 3VSDA 1HTTA 1EJ6A 3RDPA 3E35A 1W9HA 4MYSA 1FC0A 4NF2A 3DCYA 3KQSA 4AUMA 5FPTA 1GQYA 1B4DA 1NN3A 1ZA1A 2I7TA 3EUEA 3WQBA 4DIDA 4RTMA 2AKEA 3VO9A 1CKEA 5DHAA 2XEDA 4XWAA 3OE5A 3QUBA 4I14A 1I3LA 1TM5E 1QAQA 2DBZA 3AM4A 3L6CA 4BMSA 2IV7A 1FSZA 5G4KB 1KH1A 3NHBA 3A26A 4UHCA 3TW4A 3O74A 3CH7A 4GZ3A 4Q4JB 1XCMA 3ZQJA 1AKQA 5T3YA 1PX0A 4ABTA 1KSJA 4G81A 3RS2A 3GUCA 4DM4A 2Q2OA 2EZ4A 5TJ9A 4MXDA 1BROA 3IC5A 3IAEA 3IMFA 1QP0A 5ICMA 1Y6ZA 5LXTB 3KSZO 4NXMB 4PLFA 3V4ZA 4J3JA 1JIQA 2NACA 2HJ9A 3A4LA 3AUJB 3G2LA 5JHGB 4GPTA 4MV7A 3UGJA 3FOFC 2TMKA 4M86A 3EF0A 1G5TA 1VMDA 1DARA 1GSAA 2QAGB 3BZUA 5EXXA 4ZEVA 5LQCA 1IHOA 1LBQA 2LWIA 3R1IA 3NJRA 3Q98A 1S4MA 1TF5A 4Y2YA 5HDQA 3N6RA 4KREA 3AP3A 3MJEA 2JA1A 2I2AA 3LUKA 4EPRA 1FSFA 2I3GA 3QVSA 1JL3A 1WQ4A 4D3DA 3Q0EA 3T1HB 1ORHA 2QZJA 3TTWA 2JPDA 3GEGA 3TJMA 3W8RA 1Y3BE 2VUTA 5K8CA 1CVLA 1RACA 2Y1EA 4DLRA 2VOJA 4N48A 3IBCA 1QQ5A 4FHGA 1N2GA 4NH4A 1Y9ZA 3MWYW 1U7HA 1Q0TA 1W85A 2BM8A 2MCFA 4DY6A 2QRKA 2PXAA 4NCJA 1YOBA 4MRNA 4MYUA 3TOVA 3W4JA 1NNUA 3F90A 2OBFA 3KEOA 4KPFC 4GR5A 1F7UA 3CRNA 1W581 3JD1A 4PGFA 1TW2A 4P3OA 1CDOA 3D3JA 3K6KA 1KGDA 5KDOA 4JI5B 2RKBA 4KFUA 2FW8A 2W0SA 3IYLW 4MB0A 1L7MA 2LXNA 3GEEA 4FYKA 3TQHA 4E2XA 5I7OA 1R4AA 3W9BA 4P93A 4X6UA 1DLJA 1JHAA 3MMNA 5C53B 1ZR2A 4L07A 4ZK6A 2H2FA 2OFPA 3EA0A 4G07A 2GM3A 5LP6C 1EA7A 4DR3B 2XWQA 4PFSA 5B1EA 1JQDA 3EGXB 5GJCA 2Q46A 3IL2A 4F5ZA 1KE2A 4UPEA 2DBQA 2C5LA 5CDYA 1OWOA 3GGGA 3QENA 4MITA 3WV5A 4C5CA 3BUSA 3JQAD 3WZMA 3P9ZA 1PJZA 3CXUA 4B45A 2A59A 2JK0A 4AT1A 2BISA 3B6KA 4CCSA 1N2EA 4HO1X 3CUWA 3N70A 4U8GA 2VHJA 2O8DA 3DMHA 4MWEA 3RVJA 1JEDA 1W1WA 2DR0A 1LF0A 2DULA 1NW9B 1U90A 2QN1A 2HO5A 1DAFA 1U3FA 2BJWA 3GAMA 1I7PA 3LHSA 4HDSB 2BI8A 5CPFA 1SQFA 3G9UA 3QVMA 3JZIA 4IY1A 3WNVA 1G3MA 1FRQA 4N12A 4B71A 1V4VA 3T5TA 1L4YA 1D07A 1Z5VA 5IXSA 5ALVA 5KWIA 3U3ZA 2YH2A 4LSZA 3ZNPA 3ZOKA 2OZKA 2BFPA 4IXDA 4ZTBA 5AVXA 4WZZA 2VZ8A 3MT9A 1RQPA 4O4IF 1YVUA 3H2BA 2DVMA 3VOAA 2G0AA 4QUAA 1GRVA 1KXJA 4FX2A 1B6SA 1SMKA 3ANMA 4EB6A 1QBGA 1XZHA 3I45A 1PV4A 5CJPA 3E9EA 1EQ2A 4FB4A 3H5VA 2XEXA 2XUKA 3WK7A 2WP8J 4A0SA 2JB9A 5EE1A 4J16A 3RVMA 3AMVA 3U2QA 4B3FX 1ENPA 1H4SA 1HFWA 4BVEA 3EISA 4YFYA 5DO9A 2CNBA 4HZUA 4NHOA 1CDEA 621PA 3WLNA 1LZKA 1CUUA 1UMCB 2O14A 1E3WA 2RG1A 1IZZA 2A7XA 3KPWA 2E37A 4UREA 5K0TA 4G5OA 4TVSA 3PUJA 4YJGA 3QITA 4HNVA 4ZOLF 4HUJA 1ORVA 3PC8C 4BGVA 4ZEMA 3CNNA 3LBYA 3MCVA 4UVIA 1QR2A 1DC4A 3ZZNA 3TG2A 3THWA 5CYOA 1IM5A 1T9KA 3EPPA 3HH8A 3R5KA 5GM2A 1ZJYA 2XRZA 4EI8A 1F4PA 1C0KA 4XJSA 2GNPA 1FUIA 4NAUA 1FDRA 2F8MA 1D0IA 1NF8A 1JVBA 1ZJZA 5HUHA 1O0CA 1OY1A 4LEIA 1H9AA 2EV9A 2PUHA 4IDHA 2N75A 1ZKDA 2ZQZA 4WN9B 5E6RB 3AP2A 4DSAA 2BMVA 5HF9A 1DSSG 1YDMA 4QBTA 3I12A 2FHSA 2ZDHA 3GN1A 3QPBA 4E0BA 3HVRA 5ALWA 1KMHB 1VFNA 3CU5A 4IIHA 5WRFA 1GPUA 2VP9A 3GG9A 5GJWC 2IYOA 3WGVA 5IVKA 2FPGA 2GF2A 4BTVA 3KAPA 1VC2A 5EE3A 2Z9BA 1FDTA 2XXJA 3DNPA 3LYAA 4LTMA 3U4AA 3EXG2 1O9BA 4XASA 3N7TA 4R84A 2FLWA 3KKKA 3PBKA 3QFFA 4LBZA 5EMLA 4P54A 4POAA 1G55A 2Q7XA 3Q88A 2JC3A 3MUOA 3UT6A 3B1YA 2IQ5A 3EAGA 3GD5A 4XGRA 3OICA 6Q21A 1ZH2A 2IXDA 5ELMA 3QTTA 3TLCA 5KOIA 3HB5X 2NUTB 4MJ3A 3W2FA 2XQFA 4R2IA 1EK5A 3AV0B 1T3HA 5K4GA 3BKWA 3SYRA 2C5BA 3BZBA 4BO0A 2P5UA 2Q3JA 3W05A 3O4GA 4D8UA 2GWHA 3A27A 2RHMA 3BCUA 1GA6A 1AK1A 3BTSA 5CU7A 1JEJA 4B3TB 1PR1A 4R8RA 4IQGA 4PX5A 1DC6A 3GEDA 4R1LA 3NBYC 4M7OA 2QMOA 1AZLA 4LF8B 3Q3IA 4B75A 1DKUA 5BQXA 4C0XA 2Q0SA 1E2DA 2VP4A 4EG7A 3BM5A 1CUFA 4FR0A 1I2ZA 1ZUWA 4JITA 1OAOA 1Z6TA 3ZWNA 3ZWAA 2WBLC 4BNYA 1U8UA 2CMDA 2NNWB 2OYRA 4EW6A 2CWWA 3EXAA 1ZNQO 2A0YA 3H4TA 4K6GA 4MQ5A 4BQIA 3H1BA 4YUZA 3B7GA 1U5CA 3OESA 2WWRA 2O0LA 2WT8A 2EGGA 4FNGA 4X1OA 2ZRCA 1N0HA 2G1AA 4WOPA 4CKWB 4RKRA 3GRYA 2FF5A 3WS7A 4AF6A 2XSZA 2AXQA 1VXRA 4WZ6A 4UQLA 4YWHA 2LRHA 1PL7A 3GH3A 1LUAA 1DOZA 4MV0A 4AUKA 2KS6A 4GPAA 2OHJA 1EBFA 2C2GA 1KZ6A 3WFJA 5CLJA 4ZYXA 4XVQA 1E6EA 1E5VA 5CDFA 2ZOSA 5A5EA 3KYIB 3T5GA 1RXVA 3MRTA 1ZEMA 4IJVA 1GL3A 1Z6ZA 5AWFC 5I6DA 5LYJF 1NTRA 2VC2B 1N9GA 2HQ1A 1ICIA 1LD3A 3JU3A 4ROSA 2VHVA 5EWMB 5CDFE 1G2IA 5KTYA 1CRZA 3NGXA 2GMWA 1U81A 1ZI8A 3T3IA 3CX6A 4GL4A 2FVYA 1HQYE 1YULA 2C88A 3GC6A 4MUMA 5TB5A 2A1IA 2VLBA 4RAOA 3TG8A 2PBFA 3O8LA 5C4IA 2OXEA 1R00A 2ILVA 1DJQA 1DKMA 2HEIA 1Y5NA 1NQVA 5CD9A 3QOFA 2P6NA 5ESDA 1PJQA 3D31A 4UEKA 2DSTA 4X20A 4ZMRA 1PZEA 4MUHA 4DCTA 3AUUA 4JV5B 1AUPA 5JALA 4ID3A 1TLLA 1IFXA 1ZNWA 4MQMA 2GXAA 2I91A 2VR1A 3SZRA 3UMRA 1B1AA 1H2EA 2QE7D 3B36A 3KFLA 4NU0A 3TXYA 3QX9A 3R3YA 4BTEA 1DBQA 5EKTA 1IZ7A 1SURA 1QIIA 4H7JA 2HT1A 1DFHA 3EG9B 3KYBA 1BHO1 4M9UA 3IUYA 3ZUPA 3L4BA 4TL7A 1MH1A 1E8MA 3B5JA 3L1IA 1JG4A 1GQ2A 5K0NA 1AUXA 1Y3IA 2R8OA 4DCOA 2ZAYA 4GLFA 1R4NA 1MZVA 3R44A 5ABPA 2E89A 1MXFA 2EYUA 2FWIA 5KKAA 3ZE2B 2FSGA 8AT1A 3AUKA 2PS1A 3MJFA 3CPJB 3A6FA 3NIFB 1RYEA 4C06A 4ZQIA 3BQMB 2HEGA 2HPHA 3B3FA 2GTPA 1T5IA 4Y6SA 1M83A 4IIUA 1WMAA 1NVEA 4S1PA 1PSZA 3IE0A 5LJIA 1OXVA 3GGPA 4FLMA 1FP1D 3GOHA 3T99A 3AU8A 3NAMA 4XEHA 1GYPA 3TVYA 3WB1A 3KALA 2PX5A 3UEOA 4BASA 5KNCD 3PZBA 2Q1TA 5B6IA 1FLAA 4EJMA 1X7WB 1XKXA 2VQ3A 1FSSA 2WYOA 3I9KA 3L7DA 2F64A 4KG7A 4UD6A 1G0NA 2A1UA 4XDYA 5CCXA 4XRGA 4RZSA 2IC5A 3T4UA 4HTFA 5AD1A 1Z6YA 4PXYA 1NF3A 5JSYA 4N8DA 1GEEA 4A5SA 4ZYTA 1ONBA 1SKAA 2R48A 1JBQA 2AA3A 3EXIB 1E7MA 3DUWA 3I4CA 3PQFA 3ILVA 4Q0MA 4ZFNA 1HT1E 4DV7B 1U3UA 4KITB 5AK5A 2RK3A 4GFDA 1RKBA 2XUZA 3HBLA 4MGKR 1EBBA 1EDBA 2I65A 2R5FA 2WG0A 3EULA 4IWYA 4CCAA 1SD5A 2YNMD 2CYCA 1CRLA 1JR3A 1SBNE 3RJZA 2XCSB 3V2IA 1Z47A 3DF7A 5LZ7A 4OSPA 1IB6A 1FP2A 3G49A 3HFGA 3L0CA 2Q3MA 4PZZA 1W25A 5F64A 2O0MA 4BO5A 2PJDA 2QUIA 1KOLA 3GJ8A 1E2NA 3K0AA 1U3VA 3E03A 1FL9A 4EATA 1WKVA 4CEIB 2AFHE 1P39A 5CUQA 4C1NA 4J75A 2WYVA 2ZBQA 3PD0A 4RA9B 3RYCA 1EESA 3HRHA 2V3WA 1X42A 2C95A 4NMHA 3PHCA 4RBNA 3BZWA 4L6CA 3UAXA 4IGEA 4QDTA 2BEKA 1QE0A 3FVVA 1M2HA 4DQDA 1FDWA 3SOPA 4FD3A 4OGWA 3H2YA 1N8NA 3FM9A 3IILA 2PFGA 3NVKI 4N47A 3IDQA 1KQPA 1WR8A 2WHPB 1I80A 2Q5EA 2OHIA 3SE7A 2ZR9A 1RRFA 3EHEA 4IPTA 4ZI5A 4PRKA 3WYCA 5L3SB 1Q0SA 3IHTA 2EZUA 1SHJA 2E4VA 1Q7TA 2GO1A 2IQIA 3L7LA 4RMJA 4AIIA 1MZPA 4JBLA 4C14A 4S05A 3HJBA 5H9WA 3GVCA 4JI1B 1AQJA 5K8VA 2XMQA 2EL9A 3BE6A 3TM5A 5LQRA 3NMUF 2O0KA 3FA2A 3LDHA 3BXGA 5AIBA 1YZLA 1RRVA 4LJKA 4OYRA 5K3BA 1ORWA 4CEJA 3A2KA 2CT8A 1EB8A 4NE2A 3IUMA 2VBFA 1U0JA 2FUEA 3NRCA 1A5SB 1SZCA 3PHIA 4G86A 1OB5A 4EWLA 1JZTA 1RTKA 4YAEA 4AG6A 2AG8A 4PRYA 1JT2A 1YK0A 4P5DA 1D4ZA 5EXEA 2IWRA 4AJ2A 4UTVA 1WMSA 2Z6AA 2Y1WA 3QUCA 2BE7A 2OYCA 3L6UA 2EWMA 4ITUA 4BNWA 1T3TA 2VJMA 1LX6A 1NONA 4L0CA 4I1UA 1Z0FA 1HETA 3UK7A 5JXJA 1CZKA 1E98A 1C0EA 5DTJA 2A6PA 2FMFA 3FTNA 3PNQA 2WU3A 1OFUA 3DDUA 4RF4A 3SC2B 1YL5A 5BMOA 3OOYA 2QD2A 2ZSFA 1SK8A 3KRTA 3ZY5A 1P8JA 2D5LA 3ZTYA 4AICA 1H1LA 2CMHA 2QW8A 4AQ7A 5SV2A 5I9TA 1P3JA 1RYZA 2WF7A 1IK6A 4HNUA 3DWEX 3JTMA 3WA7A 4CQLA 2IH4A 2NX2A 3O8BA 5THQA 1GPDG 5YASA 4U8HA 2IDKA 2J7PD 2IUFA 3W2HA 5BP7A 4W5QA 2AFIE 4IZ6A 2JFZA 3SIRA 3VPCA 1MJFA 4AJHA 3F47A 3I2KA 3ZGOA 3ZW7A 4BNLA 2ZUFA 2JIRA 4K0KB 4UVHA 2CLSA 2R2GA 3BDIA 2R6HA 3FZYA 4FBGA 5EJMA 5SYNA 1DCFA 2JFUA 2W2QA 1DWQA 3FCUB 4RFSB 3MJDA 3TBFA 1W36B 2FMXA 2OZLB 4P7BA 1S7GA 4RTOA 4ROTA 4LYHA 5D5PA 4RJ2A 5B7GA 3GJRA 3TECE 3EXFA 3G0OA 1PG0A 1FLVA 4KC0A 4DCMA 2C5GA 1L8XA 3PITA 5ALFA 2YZMA 1IJBA 2BW0A 5GVRA 2PAFA 1XMOB 3BMNA 3CF2A 1QG6A 1RD4A 3O7WA 4FFBB 1TCBA 1AZTA 4N9QA 1QHFA 1OVGA 3QKWA 4YIHA 4EL0A 1G59A 2WIAA 3MT7A 3ND6A 5DMXA 2GN0A 1XTQA 2O8BB 3S44A 3O4IA 1ZIYA 4LW8A 1KMQA 3TR5A 1D5WA 5E0KB 1QHSA 1PNTA 1C80A 2ISQA 4G8BA 4AK9A 3JVEA 3KUXA 2RKOA 1MGOA 1J56A 2Q41A 1YBAA 1E79D 5BY2A 5GMOA 1TGYA 4KXXA 3DCNA 4TLAA 4XLLA 4QECA 4ZTUB 1TJNA 1RIIA 3TH5A 1ESDA 3K09C 3E23A 1NKSA 4DEYA 4TPKA 3HWRA 3K6SB 1W1UA 2G82A 1ECCA 1TECE 3BL6A 3J7AC 2HXSA 4O4JF 5F51A 8ADHA 2QZ9A 5ER6A 3PA6A 5JS8A 2XCRB 1BCSA 3C7CB 3WZ2A 3BN3A 4D6PA 3WL7A 3HN6A 3V1YA 2JJ8A 4GUAA 4EF5A 3BJEA 5KVSA 4CIWA 2BMEA 3GF4A 4PSAA 4C04A 2B4RO 2V7QA 1RKUA 3GAZA 2O6HA 1JGTA 2PRIA 1MC1A 4RHXA 1SKYE 4G0YA 1AG9A 2IYAA 5BT9A 4ZOEA 1E1YA 4R8KA 2CLKB 1K7CA 2OAQ1 3DFZA 4URZR 5KYWA 1ZMRA 4HB4A 1A95A 1DNPA 4UQOA 3ST7A 1U1GA 2C4WA 1ZPDA 1PR5A 1G6Q1 5ALYA 3SYLA 5GINE 4J4HA 1SCBA 1VJTA 4DA8A 1AT1A 2EG9A 4N4AA 4HEHA 1IY8A 1Y34E 2J48A 5AVKA 4EYOA 3ICEA 1D1SA 2QG6A 4X66B 2AL7A 2CYBA 3PXBA 2OWDA 3EZ9A 2HGSA 3M1LA 4GP9A 2O9JA 1K88A 2ZUUA 4W9MC 1QF7A 2FW1A 3FVTA 2QTBA 2V0NA 2EJVA 1NMXA 3DDNA 3E0XA 2A3RA 1QBKC 4LSWA 2IP4A 2V5UA 3G0IA 4YACA 2GAIA 5LC1A 3W78A 5B3LA 1CRPA 4YN3A 3TQCA 5ISMA 4LOJA 3CPHA 5KQRA 3IAXA 1OKKD 2MMGA 3NKFA 4QVKA 4RHFA 4YQZA 1NVUQ 3B51X 4BNDA 3VSBA 1VJGA 1A9SA 3JVVA 4KQKA 2HHAA 1LBEA 4RE6A 3AUTA 1UQTA 2GPYA 2P9GA 4S1TA 3H9QA 3U31A 3N8DA 3PNKA 2CXUA 2PX0A 1JHPA 1TPYA 3EQ6A 1KI6B 1MGPA 2WOJA 3DM9B 3VJLA 4HRAA 5LM3A 3L5KA 3O75A 4H1VA 1DU4A 3DV0A 1P5FA 4Q18A 5A4KA 1EP2B 1DBVO 1H2YA 1W5AA 2A35A 2D1SA 2LVBA 3KDPA 3UATA 1L6IA 4AMYA 1Y6FA 1Y6GA 4ENWA 2AN5A 2XHZA 3EZ7A 4JELA 4M3NA 4MWOA 5HVNA 4UEJA 3R7FA 4L8FA 3IKJA 3TIIA 4INOA 4XPIB 4BVGA 3AY3A 3EZXA 4V38A 4BQSA 1VLZA 4PYMA 1TD9A 1JXMA 3RASA 1MX3A 1DPGA 4CCYA 5EHQA 1U4NA 1V9CA 4PX3A 5EIXA 2CEAA 4JT9A 5A4AA 4I19A 4ZCRA 3C74A 3Q7EA 4PYNA 3AETB 1DINA 5K6AA 1GA1A 4I50B 1F20A 3RT9A 4DGSA 4CG3A 2C92A 1UBOS 3EVEA 4KQ9A 5EESA 3U7RA 2ON6A 1M5RA 4IVPA 4TMZA 2VHUA 5AQEA 1TUGA 1EBUA 3HLKA 4FGZA 2D5IA 1WXHA 3QFHA 3VC1A 4MLPA 4PSCA 2ZZKA 3Q9NA 4JLUA 1NY5A 2WDPA 5IYZF 1UK7A 4AJ4A 3A3PA 4YEDA 1XUOA 3GK3A 3GL9A 3RRMA 2EZ9A 1XQXA 2C97A 3O8QB 1DT3A 3OZGA 3Q9LA 4DV3B 2F4NA 4REMA 4ENRA 1M0WA 2GAJA 4RMGA 4DG5A 3B5IA 3AR4A 3LYUA 4RSGA 2ZVDA 2RHWA 3MELA 4HPJB 2HN9A 3V8RA 1TW3A 1U2SA 1CT9A 3I8XA 5KOHB 2CJXA 3C3JA 3OPXA 3M7IA 3MJHA 1P62B 4BB5A 2JL1A 4WGGA 5EFZA 1UODA 4EK9A 2HB6A 2YOGA 5DK6A 5K8TA 4GX0A 4FQ5A 3IMEA 1GG9A 1AZSC 1KP3A 4DVJA 2QM0A 2FXIA 4YJ2F 1YC5A 4F93B 4G0XA 5AVOA 4UTXA 4K0RA 2PYIA 1UANA 1U2ZA 3BSFA 3DFMA 4I36A 4PC3A 4OHZA 3SS8A 2WI8A 5KWJA 2I4LA 5LQAA 3UTDA 2WWYA 1OC4A 3L79A 3EUWA 1ISIA 4HD8A 3WQQA 1IH8A 1FPMA 1Y37A 1MNAA 4Z9BA 4RLFA 5FYDA 2XNCA 3TZCA 3AH8A 3K0BA 4ZO8A 2B7CA 3VNBA 3KB6A 2L0XA 4Y2TA 1NRWA 2BI4A 3D43A 2VP5A 1J5EB 3CEJA 3KJQA 3H13A 4YJFB 1EWTA 3P9NA 2NZJA 4HB2A 2PUTA 2QM3A 2EIHA 3RRXA 2FJPA 1FS4A 1XRSB 4BWYA 3HUDA 4EHJA 4N0PA 3LYLA 4CIYA 3AF5A 2C1ZA 1UBFA 2Y66A 5KCZA 5JR3A 4YC7A 2XW6A 2VSNA 3U4DA 4B7XA 4IVNA 4UM5A 2SCUB 5EWJA 4AB1A 2RHLA 4UZFA 1HEIA 2UZ0A 1VE5A 3DPSA 4HAVA 1W46A 1WSAA 3DEZA 2IYLD 1HOXA 4MQ6A 5TQ0B 5G0UA 3J81A 3UPUA 4F46A 3ZHUA 2QD1A 2QPAA 2X9VA 2X1LA 4DCJA 4Q00A 2RCYA 2ZJ7A 1RPZA 2OL4A 1N0IA 4HAUA 4IWNA 3FGZA 5ANRB 3VO1A 5JS1A 4DLUA 1GZHB 1MH9A 3D2LA 1I33A 1ND6A 3MERA 3K0FB 4FR2A 3IVGA 4PZCA 4NCNA 1WUJS 3UENA 4A8PA 4NU6A 1FFCA 1N3BA 4MYCA 1YR3A 4KIUA 4CLEA 4FHEA 3MS2A 4I55F 3E7FA 2WWFA 1WHTB 4Y0AA 2A5YB 3C8UA 1BMDA 5KVVA 2IS6A 3TEMA 3JAWA 3AR9A 4DLKA 2AN1A 2IHYA 4KHPB 4AL4A 2GK6A 4YXWD 3R09A 4PYOA 1J25A 4BOYA 1RBYA 2WJGA 1XZCA 3CYFA 2VAPA 3IAUA 2Y4NA 4KEAA 4ZU3A 3FFWA 4MUAA 4JJZA 5TJHA 3E5HA 1V7QA 3BSWA 4MI9A 4O8CA 3HFJA 1XRNA 3GQVA 4RKQA 5F3DA 3QLUA 1GZSA 4HNTA 5TARA 3MTQA 1X94A 1LLQA 3QGMA 1PGPA 4G4JA 1KPIA 3OJCA 4J7AA 3MS4A 2ZRGA 4GKVA 1BWRA 1S89A 2DF8A 1L5HA 3I9MA 5SZJA 5DTRA 4E94A 2ZXEA 1PTJC 2H59A 1R8QA 2OBMA 3A4NA 2FCRA 3MAGA 4N49A 1X92A 2GCGA 2HPAA 3KVRA 4KLCA 2CF6A 5CRIA 1H6AA 3G85A 3JASA 5KNDD 3CONA 1E5XA 1EFTA 3VV3A 1A96A 1X87A 3AYZB 4KU4A 1TA4A 2XOKA 3AIIA 4BZXA 1Q95A 1S5PA 3LHKA 2H4XA 3KLNA 2ZSUA 3JAKA 1JKMA 2Q5LA 3ZE8A 4AMVA 1G41A 2W6PA 1CP2A 1FA9A 3LP5A 3G2MA 1DRJA 1L5HB 5ADWA 2FQWA 2O19A 1W1IA 4OB7A 3VPXA 3KLOA 5LMNB 4NS4A 3WWCA 6NULA 2XR1A 1J8YF 1VPTA 4RPJA 2HMTA 1IATA 5HE8A 4QPNA 3QF7A 5DSZA 3RS5A 4RZIA 3BA1A 2B30A 2YVQA 3D8SA 1FJHA 2XRYA 4J0DA 1UADA 4Y8VA 3S2IA 4BZPA 3OFND 2GTIA 4D56A 2CXRA 3THYB 4JLMA 5LPNA 1C3OB 2E4UA 1YB6A 2IYWA 1L4FA 4B4KA 3NB0A 5BRJA 2JJ1D 1II9A 4YO8A 4LZOA 1LW6E 4NULA 5FIUA 1W4LA 3TE7A 2VJDA 4BV9A 2JFWA 3C3XA 3OZCA 3HV2A 4LVUA 2QA5A 2BHNA 3U1VA 3I0MA 5A5GA 1EWYA 4XQGA 2Q4TA 1ZD1A 1PN3A 2V4UA 1NN0A 2YXPX 1VQ1A 1JS1X 4LOIA 4EA8A 2QL6A 3FFXA 4JIGA 3ZWKA 3ZCSA 4TTAA 1E94E 1QG2A 3DEIA 4F5YA 1YC2A 3FNGA 4K9KA 3GLGE 1PFYA 2CNNA 4XGKA 3CH4B 3H1TA 4RS3A 3T4PA 3G3EA 1KGSA 1TUBB 1Y98A 2QU7A 4H7KA 3OLCX 4MROA 3T6KA 4D74A 1RDFA 5LA6A 5CDUA 3BL8A 1I30A 1X77A 1B93A 3GT3A 3HU3A 2I3DA 2P62A 3PHJA 1SU4A 1YR9A 4JYBA 1E1QD 1Z0DA 3SXPA 1AQUA 3Q3GE 2R8XA 1E9AA 3ICOA 4RGVA 3RRYA 1B41A 1I9GA 1SVOA 1YZVA 1U7ZA 3ASVA 2PUFA 3FIUA 2WNSA 1SG6A 1N1DA 1ZICA 4R6XA 3NI2A 4ESHA 1V11B 4ZCQA 2QRJA 4XM1A 1DDIA 3JR7A 3RSCA 5BUCA 1NTOA 2QUZA 3M4JA 4DYDA 1NJSA 3RHFA 3V3TA 3VPHA 2QD5A 4EHLA 1V45E 4EUHA 1E0DA 2TECE 3NHLA 1J2UA 1RPTA 5ALOA 3AJEA 3BFVA 2PEZA 5DLQC 2J3DA 3CCFA 1SBHA 3H17A 4JLAA 1OLUA 2IEGA 3V7YA 2IXEA 3VJKA 5KOYA 4JL8A 2WIDA 3AVQA 1A7JA 2AW5A 3QFRA 4RGBA 4C05A 5AJHA 3TDMA 2VS1A 4IDNA 1O6BA 3TLEA 3B3QA 2J67A 5BNFA 2G0TA 5H82A 1XK6A 5T4HA 3U44B 2MSCB 5FOUA 1FX0A 2HSZA 2XCIA 1N7GA 4Z2YA 1F14A 1OYVA 2YWGA 2FUG1 5C7OO 3H6HA 5NULA 1L1QA 1QF9A 1TVCA 1WL8A 2VF7A 3OPYB 2OFWA 3TKAA 1EVYA 3HUFA 4KPYA 2A0XA 1SIUA 3MMZA 3VR1A 1PYGA 2C78A 4G5HA 1DAHA 4MR9A 3HL0A 4RVUA 5HZMA 1YDEA 3DD5A 1QGUB 3KBBA 1M5TA 1OBCA 4KKXB 1SZPA 2RIRA 5KTMA 1W4RA 2R1UA 3N9IA 2ZE7A 4Z8XA 4DQUA 3ETEA 3CR7A 3KKPA 3USCS 1LV8A 1SIBE 2J3MA 4FSDA 1ONPA 4RTPA 1KAEA 1MW9X 3GBVA 2A94A 2H0QA 2OA0A 1L4UA 3EGCA 3N75A 4QRIA 4N0DA 1JQ3A 4FDAA 5JATA 1BCRA 1WDKA 2J5RA 2V54A 4A1FA 3VPDA 4BKRA 2ZK7A 4F06A 3BWBA 2IJGX 5K3CA 5F2EA 1II8B 1RT9A 2GJAA 1G6OA 4F3TA 2OMEA 1DHRA 3B5EA 4CM1A 1JN0A 5CURA 3JYQA 1UDBA 4R9NA 3HK2A 5EUBA 4WOJA 3N7UA 4MKRA 1UAAA 1JHQA 3BB3A 3I72A 4INPA 5FUXA 1L4HA 1YBVA 4W9NA 7ADHA 1XTBA 3UK0A 2E4ZA 4KUEA 5M04A 1EB9A 4FCWA 3ZW8A 2YIJA 1QMPA 3TL2A 4H17A 4A0RA 4JYMA 5LQKA 1UEXC 3LCRA 2P7IA 2Y9MB 4YR9A 1IUPA 5B1YA 5I7UA 1QXSA 1P7VA 3EIHA 3Q8MA 2MYNA 1PD1A 1TUIA 3UG7A 2WINI 2XMRA 3SKXA 3DH0A 3A31A 4PV7A 5DB4A 1S3SA 1SVNA 2X8AA 4ZAWA 3G7UA 1O95A 3CF6R 4KKVA 1P7ZA 4G5QA 1SC6A 5FF9A 3ETDA 4R8MA 1NBOA 3VPGA 4L51A 4BNZA 1T8RA 4COOA 4CT0A 3JYHA 2LR0A 3IAAA 3O8OA 4QU5A 5AOBA 1YB4A 3UMCA 1B74A 1H8EA 3ZWDA 2XGOA 2X2OA 4BN4A 5HRUA 1HEYA 2R1VB 4MDYA 1OLOA 3JWHA 1P5HA 4IILA 3UBMA 5JCJD 4NV3A 4AZSA 4NABA 2Q1UA 1G6HA 2EC5A 4JJAA 4LV5B 3IT0A 3PE6A 4TWIA 4ARBA 1NI5A 3ACDA 3W06A 3ANYB 2WMYA 3PUYA 3TOCA 2C29D 2HRDA 2NO6A 4RZQA 5IJ0A 3IVAA 3N8HA 4BCDA 4FU0A 3ZS8A 1BS9A 4Q3DA 5DULA 3G5UA 3UAYA 1AUVA 4M8IA 3GRZA 1MABA 2HHLA 4RIHA 5JY6A 2DPLA 4CXMA 4P7FA 5BNZA 1AF4A 4HDOB 2J9RA 2GVDC 2PX3A 5CAEB 5GTDA 3PL5A 2Y92A 1L3CA 3PQEA 4RQTA 2CVFA 1QGOA 2I4RA 3RC3A 4BX9A 1XDDA 4P4GA 3SYTA 2R00C 3VM6A 4ZOCA 2FV8A 1IMJA 2HSJA 3B3GA 4MR8B 3QVLA 1RLIA 1UKAA 3AGQA 3DONA 1HKUA 4ENPA 2VAXA 3HP4A 3WMXA 2QN7A 4L27A 2YBDA 4OEHA 5A0FA 3AY7A 2QL9A 5FR1A 1ZVMA 1P2BA 4G5GA 5B3JC 1EHIA 2ERCA 3QEAZ 3WDLA 1W49A 1Z2PX 2P6UA 1KJNA 1UM8A 4TV8F 3RIXA 5HF6A 4DTIA 3IEVA 2VRCD 4LGVA 2SBTA 2JI7A 3BH0A 3RTBA 3MCWA 2LIPA 2QQFA 3DT8A 1AMNA 3R3HA 1T36A 3G7SA 4LC9A 5KMGB 3JAMA 4C7OB 2LBPA 1IZ8A 4JU8A 2OO7A 2PAAA 4PPGA 4MSUA 3T7DA 5JCPA 3EYWA 4BE4A 1CUWA 2R1TB 2NXNA 5C34B 3OFJA 2HMUA 4Q3LA 2FFHA 1HFKA 3D6HA 4TSFD 3A6GA 1MHPA 2BJHA 5E38A 2V7VA 1CE8A 3BHIA 3TWOA 3ZWMA 3GLGB 1HE2A 2GCEA 2WUWE 4E30A 4PONA 2WAOA 2PKQO 4OQLA 1QQ6A 4WN3A 5AOAA 1ZX1A 2B69A 2WVJA 5LNK1 2EX4A 1Q15A 4LG1A 1FIUA 1OSNA 2OZLA 4ZAFA 3ZZ0A 2IEAA 1NV8A 5BQOA 3DOUA 3ZV7A 4ABYA 3D6TB 4L28A 1RHMA 4IDAA 4E03A 3ILSA 4AS2A 5ADUS 3VI3B 1HQCA 1VPVA 2HI0A 2QL5A 3HG7A 4X6LA 3DT9A 3JQBC 2OHHA 3ECAA 1GQRA 2G4VA 2HCBA 3A1EA 5JDCC 3R74A 1ZXBA 3DHWC 3FOZA 5SYMA 4AO8A 5EMNA 3Q3HA 1YKSA 1FUKA 1X74A 4XH9B 2JGRA 3D3WA 2QVYX 3IOCA 2RJ3A 4FMPA 4BVFA 1VG1A 1VLMA 2QKYA 3IBYA 2Z2XA 1E96A 2Q3FA 3E7PA 1FFSA 3F3SA 1DWUA 2B1GA 2FMHA 2NUTA 1GYRA 4UHHA 2A3NA 2XCOA 3ZPXA 2FSUA 3F0TA 5JFOA 3NX4A 3WFIA 5BN3B 1N3YA 4NENB 1TYAE 2GHIA 4IEIA 5F7ZA 4CF4A 2H2AA 1XNRB 3KELA 5IFLA 5H5JA 5EERA 4RLSA 5GZ3A 4TM8A 1NE7A 1WO8A 4WNAA 4D46A 4B7CA 4DDTA 3AZQA 3KU4A 4I9FA 4TTRA 1KKMA 3WR5A 5KJCA 5C52B 4EARA 2A1TR 1Z5OA 2P1DA 1T8UA 4D96A 3H87A 3CMMA 2F55A 4P3YA 3T1OA 3QBJA 2O8NA 4LJ6A 4NATA 4RELA 1WCIB 4ZYUA 5BRAA 1N75A 1QOZA 4YB8A 1VMEA 1ZK0A 1ZN2A 4KZPA 4LGYA 4C6SA 1WPXA 5KU7A 3O9MA 5L4SA 2UYCA 4LF5B 5JLAA 4B46A 2ASEA 1LK0A 3LQ1A 1TZKA 1CG6A 2GBCA 1GZVA 4ZQFA 3AUSA 3QWBA 4CIXA 5INTA 1DFIA 3M2PA 1Z39A 4BYMA 4QNNA 1JB9A 1O77A 1I01A 3HB0A 3KOOA 4Y6RA 3I2JA 3TW6A 4HDKA 4N03A 4QTYA 5IJXA 2F1KA 2XBUA 2NO5A 2OD7A 1Y7PA 2C9CA 2G6TA 4S35A 3FGOA 4F1KA 4DLZA 3QEJA 5LBIA 1PZHA 1YFKA 3KZKA 2AK3A 1DELA 3AHFA 2YJZA 4M1MA 3TD6A 4F56A 1W88A 3DE6X 5KTKA 4RFVA 2GZ2A 4QHSA 1DZIA 1I51A 1T6NA 3ACBA 3VOBA 2EQBA 4ESOA 3DBHA 1NOKA 1T29A 3PI7A 3DDCA 4J90A 1H2BA 1IIBA 1XAHA 2LZ0A 3L8GA 2ZSBA 2ADFA 3PC6A 2GYVA 1AKUA 1FYEA 3KD2A 2H0RA 2Q3DA 3F1LA 1ORDA 3FUUA 4F2HA 2YZ2A 2Q5HA 3OBBA 1ISJA 1V47A 5EL0A 3RLIA 3VR6D 4B4WA 2AI2A 2E5LB 3L8HA 2PNJA 2QD4A 3H2ZA 3WMWA 3FCYA 2DLNA 3QE3A 2CNOA 2H06A 1OROA 4UDYX 2UXBB 2BGTA 2YS6A 5HP4A 3P0HA 3PVCA 4LCBA 3S8MA 1KP2A 4WD3A 1Z5WA 1KU0A 2FETA 2XECA 4U6SA 4BN5A 4EHHA 3O6VA 4F7WA 5J4HA 5LZ9A 2EKPA 2P9BA 3FAKA 3UT0A 3V8VA 4EYSA 4IQ8A 5J2TA 2PUDA 3BJMA 3G2PA 4Q3OA 4F21A 3REFA 2BKEA 4S1NA 1W2HA 1UBHS 2YC4C 4ZJUA 3DYBA 2VXCA 4NFLA 2R96A 1X1CA 4LDJA 3ZNNA 3DAOA 4KI0A 13PKA 2B78A 5K3DA 4CFSA 4LGCA 3U5ZB 1SPBS 1COZA 4LZAA 5TV2A 3FDZA 2ZKLA 2CXQA 4OXIA 1GPAA 1XVLA 2JIZA 1JLRA 2FSSA 2VLIA 3MWFA 4AUEA 5CT8A 4QUDA 4QUHA 2UYOA 3M81A 4TS9A 4EHBA 1OLSB 1U2EA 2XCQA 4OQNA 4UCXA 5AKKA 3G5TA 4KFTA 1M5UA 2QY9A 2YXNA 2OC9A 3G2JA 3C4VA 5DT2A 1GG5A 3RIHA 3GD7A 4WOKA 5BSMA 2OFFA 3OO1A 3R0JA 1T6BY 1VE6A 4I6JA 4L4RA 4GMGA 5LSAA 2P2LA 3IP8A 4Y2UA 4DC1A 4DABA 1U0SY 1MRNA 2QTVA 4YV7A 1QC5B 1FNCA 1TVEA 1V7PC 2FE1A 3JQBA 1ISHA 1U98A 1UEIA 4B0OA 4OQEA 3PFCA 2HBZA 2O52A 2WU4A 4JT2A 3H86A 4QGBA 1QNFA 4WTOA 5DNVA 3U39A 4MPPA 1YRWA 2RHDA 5JFTA 3VNVA 5G4LA 1O57A 3O91A 4XM2A 2V7WA 1GCUA 1O4WA 4RK6A 1QV6A 1IYZA 2OQIA 1PFQA 4PR3A 3CWZA 4YJ3B 4KVGA 4OQZA 4M60A 1KH2A 1P74A 4FX5A 4WMLA 4ZVOA 5KSOA 4RVFA 5C1BA 4JEHA 4OVKA 4B6GA 2QROA 2IZ6A 2VWPA 4X20B 3AHCA 4X90A 1UBTS 4J3NA 1B43A 3WGHA 3OTGA 3RBZA 4KK3A 2YZKA 4BNGA 3DO8A 2OEPA 4B33A 3EGVA 3DEYX 1SUEA 3HZHA 4G41A 4AS1A 2FEPA 4FEEA 1ST2A 3RFVA 3OU2A 2IEDA 5AM0A 4M8LA 3PNSA 4F91B 3CNQS 5LQUA 1VMAA 1PGOA 3OX2A 3IJ5A 4PBSA 1SUDA 4S3MA 1UOPA 2X6QA 2W6NA 1Q1AA 4OXNA 4DYVA 4E5VA 1LY1A 2PZEA 1O4VA 1QRUA 5ECWA 3RI3A 1I4EB 4NICA 4FWTA 3U61B 4J9UE 1M0TA 3KOYA 5CP8A 1ACLA 1K2VN 4M8SA 1JVSA 1QFJA 4RF2A 3LY8A 4DC9A 1TT5B 2HOQA 2REQB 3DR3A 1TMYA 3O4RA 3OSUA 2ZANA 3TRFA 1T2DA 1TU4A 2H85A 3ZD6A 3TNDA 3ZX4A 2QX9A 5DTMA 1I4LD 3RRFA 1G20A 1I9CA 4OATA 6LDHA 4BUZA 3FZNA 1QQTA 1VDZA 1XXLA 3QNMA 1KO5A 4ZJZA 3P9PA 3TLMA 1XJ0A 3SE0A 1L7AA 2DFDA 3FRJA 3W7BA 3BMQA 2A4KA 2DPHA 1TZMA 4GM4A 3J7TA 1DG1G 3HJRA 4GWGA 4C1BA 3STYA 4Q9NA 1QHNA 4LRTB 3O8DA 2NG1A 1NRIA 3D64A 2ODWA 2RGXA 3P9YA 4BFWA 2OCLA 3UJAA 1GVHA 2GASA 2REXB 3RODA 3RRJA 1B7GO 2B6NA 3ZHTA 3A28A 1XRMA 3HO8A 2WD7A 3D0OA 1NJ6A 4FS3A 4EY6A 4YCSA 1JALA 1F7VA 4RD3A 4R2XA 3WLQA 3OOJA 5DVZA 4U7GA 4DLBA 2R6FA 3FYSA 3HMKA 4RA6B 4MR7A 1YFJA 1SB9A 1WRBA 3LQ4A 2W6JD 3LQRA 3KZNA 4BNTA 3AF6A 3TDKA 1QTRA 4FMCF 3OMLA 4KQHA 3CLUC 1E2IA 3M1AA 5LB2A 4C08A 1ETUA 1NXWA 2BTEA 5DSTA 4QOIA 2ZAGA 1X8JA 1XSEA 4ID9A 3R6LA 4JENA 5KEIA 1UFRA 4OYHA 3SZ3A 3AFIA 1ZFNA 2PZGA 4KLRA 5D87A 3G1TA 3GW8A 4DCVA 3O4HA 1BMFD 3INGA 3GBPA 2ZJBA 4LJRA 2J4DA 5CLFA 4UVEA 1EVKA 3JQ8B 3V4SA 2INGX 4LN1A 1XD8A 4AZ0A 1PWEA 2Z4SA 5CFLA 1N34B 4Q1DA 1GCAA 3N5KA 3B3JA 4X71A 5BOVA 1R3DA 2WJIA 3WJ1A 4RV4A 2QGNA 4OMCA 4KGVA 3GRUA 3UCXA 1CVRA 1BXZA 1PSWA 3L7AA 4G0ZA 2QP9X 4R9UC 3MSXA 3K2IA 1Y3FE 2FPGB 3A8TA 1BU5A 3TTVA 3EC2A 2QJTA 4PANA 1E9RA 4R7GA 4ZJYA 1T2NA 2AFIA 5KVCA 1WCV1 2AXNA 2VDWA 4LA4A 4QXOA 2ZPAA 3L4SO 5FPKA 1Y42X 3F9CA 5CBPB 2A58A 3QFCA 5CIQA 1E2MA 4NLLA 3P4XA 3QIVA 4OHVA 4TZKA 4BVLA 5AVRA 1MB4A 2H2HA 1DC8A 2DYKA 2R25B 2GD2A 4PGHA 4TTJA 4XYBA 4V0KA 1LNQA 1KJ9A 2X58A 4MTCA 2ZRPA 5BSEA 3W5AA 1XCLA 2BTQB 2IKSA 4HDRB 5EPEA 1WJGA 4O4LF 1M2OA 1E1NA 2WVGA 3K5PA 4K81B 3TSCA 1N36B 4KNYA 3GP8A 4NAHA 1AMOA 2AN4A 5LQMA 4MGYR 5KINB 4IDPA 1JH9A 3PF9A 4FYXA 4YMUA 3QF4A 4R2MA 1FUEA 1K0UA 3WC4A 2XCTB 2PDAA 1OZ0A 1O6GA 1W0JD 2R5WA 1C1YA 2QW1A 2VDWB 2ZIWB 3HCNA 4JGIA 4L5JA 4WKBA 4ZQCB 4G1VA 4AMGA 4KQWA 2DERA 4IXMA 3CLRD 4PLHA 3NNDA 2JD0A 5DV9A 1ONNA 2AFIB 2CXNA 3L8MA 3CNOA 1M9NA 1ZA2A 3HCRA 1JPUA 3NHJA 4II3A 2OUKA 1N2OA 2Q28A 4Z99A 2ZJZA 2P9JA 2BONA 1EFHA 3CCBA 4I2NA 2CZQA 1QYDA 2XE4A 1ZUNA 1T9BA 3WOVA 2B7BA 3KR2A 4EB6B 1TJ3A 1FFEA 2GLTA 2E9SA 3JD3A 2HDNB 5L7WA 2F7SA 5IVDA 1VL8A 3UMMA 4DLAA 1Y1TA 3SF8B 3DFFA 2QTHA 3OZDA 1R3UA 1E9DA 2QZZA 3IGFA 2Q5QA 4PO3X 5FH9A 2A5JA 5AW7A 5L3VA 1E5LA 2W71A 1IOZA 2PKEA 2D06A 3D3WB 1ZCFA 1O95D 2O05A 4CQMA 1L4BA 3SVLA 2GUWA 4WADA 1NM5C 4Q9IA 1WAMA 4O33A 1G7CA 3L1KA 1ZH6A 3ESQA 5IUKC 3S27A 1SK9A 5HF5A 4Y7DA 3DVRX 1EE2A 1EK2A 1VGQA 2E2WA 4OGLA 5CNKA 2JJ2D 3UHOA 3WGNA 3CVWA 1E77A 1UZMA 4INZA 4Q4DA 4WY2A 2ZIVB 4X54A 3GROA 5ITSA 3V1MA 4JX9A 4TM7A 3H1AA 3I9OA 1SOWA 3FI0A 1J33A 1XDZA 4JI3B 3SYKA 2D7CA 2XYRA 3NDPA 5LVAA 1U8TA 3GLGA 1M2JA 1C29B 4OIMA 2CXHA 1DQRA 1JKFA 1EFDN 4UAUA 7MDHA 1JTFA 1JDTA 4N7RA 3W5DA 3IEPA 4L9AA 4BB6A 5FTNA 1ZUIA 2A9QA 3OOSA 4UHFA 5REQA 4PTYA 3ZHRA 4Z0NA 3F7MA 2D1RA 3L4BC 2JGKA 4PGAA 2PMKA 2BZGA 2GCPA 3PNBA 4I6EA 4IWXA 2AOUA 1RRCA 1XI2A 1OMOA 5G1NA 1KYVA 3KHKA 2M1ZA 3ZBTA 3NR2A 4OMUA 3L05A 5AT1A 2ZUTA 4RD1A 1ZISA 3N07A 3IP6A 1QU2A 2JIBA 1PNVA 3RHSA 2HBQA 4C88A 1Z45A 1Z4OA 3L0PA 5BMVA 1TEZA 3T4XA 3PRYA 4QSMA 1BHQ1 1NP6A 1A82A 1D2HA 2D13A 3O47A 2GD1O 2X3UA 4M7WA 2YMPA 3TNJA 4EHDA 3COYA 2JNWA 3VSEA 3COVA 3LOQA 5ITWA 5L51A 3NHPA 4R1SA 1W85B 4Y2XA 1L7EA 4YONB 2ZB7A 4OB6A 4B35A 3KC2A 4KPUB 3MPUA 4YVFA 1NDHA 5T7BA 1WMEA 4URXR 1I7NA 2JCVA 1T5OA 2XE7A 3CLTD 2EGUA 8ABPA 1A4RA 1PQUA 4I4TB 4GKBA 5GVSA 1GTRA 3D2CA 3AUXA 1K5PA 1N7JA 4N5MA 3TRJA 3LE8A 4WKNA 1GR1A 3MWEB 2WM8A 3GMSA 1LFAA 3IURA 3OUZA 2OCIA 2XJ9A 4D6XA 4RETA 4U9IS 2VWQA 3E15A 1RI2A 3TZQA 2YHSA 4H1TA 1T5HX 1TL7C 5ESXA 2BN4A 2GAOA 4RQBA 1N2SA 1V8BA 1YSCA 1HURA 3NBZC 3OU6A 2HA2A 1T9HA 4PHFA 1KFJB 5AKGA 1GPYA 3MWLA 3S8YA 2FZEA 5EXTA 1T2FA 4TV9F 2PK3A 4BNKA 2IH2A 3LK6A 4LJ7A 1AJEA 4ARZA 1XALA 3R0ZA 3N0WA 2FPMA 3PWSA 2R1VA 5D1HA 5C18A 3JWJA 4DLVA 4RXTA 1QGAA 3LX6A 5LXTA 1WKCA 1XQ9A 3CZPA 1KR2A 3O8OB 2ABWA 3VGPA 3UJ9A 1OH6A 3IIJA 3PV0A 2FEOA 4R7TA 2PZ8A 4RTRA 2VT7A 3OE4A 4WZAB 1E2PA 1QIMA 2GRAA 1A5ZA 1GL6A 2BKXA 2GBLA 3QJYA 4A9AA 1GGHA 2GB4A 5JCOC 4KGXA 1FJXA 4W1QA 3FDIA 2G5TA 4MI1A 2FPKA 2J7PA 4KJXA 2I2BA 2P78A 2QRGA 4P2BA 4DT1A 2JFNA 2QTLA 4J8PA 3UXMA 2QAIA 1VG8A 2GN6A 1HSOA 3NUQA 4CM6A 1KY2A 3O0TA 1Z73A 2AF4C 2GX6A 1KE1A 1W93A 4WA7A 3CZQA 3STVA 3T3EA 4G89A 5DM2A 2HU8A 3PS9A 3UCEA 1Q74A 1P29A 3GHYA 3LAWA 3WIVA 5AVVA 3U5TA 1JWLA 2I8LA 2XQKA 1YCFA 3GVHA 3QTBA 3LC2O 4WY8A 3ZV3A 1J1IA 1KS9A 1E9BA 4UHEA 1KI4A 1TA0A 3E3NA 1N5IA 2FP4A 3HB1A 2ZT6A 2WJWA 1QDEA 1T1RA 4GVPA 1UPCA 2PSJA 3I73A 4P35A 1J07A 3KZXA 1HDEA 3VHRA 1KBQA 1OFGA 4A0FA 3TR0A 3SG0A 3A9RA 2UZ3A 3CCCA 2WF8A 5T67A 1QK3A 5B58C 1UEJA 3MFQA 4B4OA 2RH5A 5K6AC 1GEGA 3AONB 4WXPA 1LQ2A 4EIWA 2CW5A 1BXGA 2MSWA 2VF2A 2NXCA 3NBKA 2JGMA 4OMDA 5J2TB 2NZVG 2ECQA 1FTYA 3TIGA 3BIFA 1M34B 3LG2A 5BN4A 5JH7B 3MJVA 1SXJC 3SJUA 2XT9A 1KO4A 1KIAA 2H92A 3ILYA 3NKLA 5EYPB 2Z58A 3QWFA 1F6WA 4QNRA 5CLQA 2DWOA 5H3CA 5IH7A 1UPFA 4FW9A 5DISB 3B6ZA 3WOHA 1Q0PA 5FBLB 2ZI3A 3VJRA 2XE8A 3OSZA 4C7VA 5IN4A 3DTTA 1IXZA 3A2NA 1NWHA 4NWIA 4K03A 4NY1A 4RK7A 1UQRA 5H02A 3LMKA 3N2GB 4KW7A 3ZCXA