1C81A

Michaelis complex of fructose-2,6-bisphosphatase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
191
structure length
191
Chain Sequence
MRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction Mechanism of Fructose-2,6-bisphosphatase Suggested by the Crystal Structures of a pseudo-Michaelis complex and Metabolite Complexes
rcsb
molecule keywords FRUCTOSE-2,6-BISPHOSPHATASE
molecule tags Hydrolase
source organism Rattus norvegicus
total genus 60
structure length 191
sequence length 191
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1c81A00
1DKNA 3DB1A 3F3KA 2GFIA 4FDTA 3HJGA 4JOBA 2HIAA 2H4XA 4TSRA 3PGMA 1UJCA 2OWDA 4D4MA 3MXOA 3D6AA 2I1VB 1DKQA 2A6PA 1V7QA 2BIFA 2ENWA 1V37A 2P77A 3NTLA 2OWEA 4GPIB 4D4LA 3GP3A 1RPAA 3E9EA 1EBBA 3QPVA 1RPTA 2WU0A 3GW8A 1DKOA 4ARVA 2AXNA 1QHFA 2QNIA 5AK0A 1FBTA 3O0TA 3OI7A 4ODIA 2H0QA 4ARSA 5CDHA 1T8PA 1QWOA 2IKQA 2P2YA 1SK9A 3FDZA 1XQ9A 2YN2A 2YN0A 4IJ5A 4JOCA 1E58A 1DKPA 4PZ9A 3FJYA 3QPWA 4QIHA 1YFKA 1YJXA 5CU7A 5PGMA 3IT2A 4AROA 1H2FA 4PGMA 1BIFA 2F90A 2A9JA 1TIPA 3QPUA 3LG2A 3F2IA 3MBKA 1E59A 2RFLA 2P75A 1FZTA 1SK8A 2P6OA 3K4PA 4D4KA 1QFXA 1IHPA 1ND5A 2P9YA 2WNHA 3IT1A 1UJBA 1DKMA 2H52A 1DKLA 3LL4A 2EOAA 4FDUA 4D4JA 4MA4A 4ARUA 1H2EA 3E9CA 5CX4A 4IJ6A 3IT3A 1BQ3A 3R7AA 3ZHCA 2HHJA 5AJZA 3DCYA 3D8HA 2HPAA 3E9DA 3FDZB 1BQ4A 1K6MA 2P6MA 2P9ZA 3NFYA 3EZNA 1NT4A 3BIFA 2DWOA 1ND6A 3EOZA 5AJWA 4EMBA 1SKBA 4HBZA 2WNIA 2P79A 2EKBA 2P9FA 1C7ZA 4GPZA 4EO9A 1C80A 2P78A 2EKZA 4JODA 1SKAA 5AJYA 2PA0A 3KKKA 2P2ZA 1C81A 3GP5A 5AJVB 5HR5A 2ENUA 5HTKA 1RIIA 4E3WA 4PZAA 3C7TA 1CVIA 2H4ZA 3K4QA 3IT0A 2DWPA 5AJXA 2P30A 3LNTA 3D4IA
chains in the Genus database with same CATH superfamily
1ZLXA 2R48A 1CF2O 3CR8A 4LK3A 2AN3A 3OLCX 2NADA 2QJTA 4Z8XA 3WLJA 4X45A 1EDEA 2ZAGA 2P9HA 4F7WA 1YOVA 1V45E 3DZFA 3KVNA 4DV7B 2R8RA 1BMFD 1CJVC 1ID1A 4PYLA 4LBZA 3H4IA 3TLGA 3OICA 1FYEA 1SVUA 2VJNA 1YA8A 1QHHB 2WNSA 3C74A 3IV6A 4KYIB 3R7FA 1TNDA 3L0DA 3C3KA 3R3XA 1PI3A 2QQ5A 3A1DA 4WWHA 1ZR2A 4DM4A 2GVZC 2HM7A 2OLEA 1N5LA 1OAOA 3T9CA 3VPBA 1Z17A 2JI6A 2XOKA 2FKNA 2NWQA 1ZVVA 3LUDA 1D03A 3LX4A 4AWAA 4HX5A 1X2EA 1DIOB 3REOA 5KVAA 2DUNA 4WX2B 5EJ2A 3HPQA 2YJGA 4Q5IA 2RGWA 3H9CA 4Q12A 2DG2A 1ZOPA 4KVZA 2NZXA 4RACA 3UFBA 5I7VA 2RGBA 4O4LA 2UV8A 1KDPA 3OLWA 3M6AA 3ZH9B 4B09A 2CJFA 3D64A 3HKCB 3IESA 4Z4CA 2AFHA 5DHQA 4F04A 4PPYA 3HSYA 4PRLA 1V3QE 2BHNA 3GFBA 1I51A 1VA4A 3O83A 4PTLA 4MK4A 5EAIA 3T3EA 1EUCB 2ZTMA 4CM7A 2J48A 4K6GA 4QUEA 3ZQUA 5J2TB 2EEPA 2CLIB 3EGXA 4RIIA 4NNJA 2BZ1A 2HMAA 4XTRA 5H5JA 3MTJA 2WIAA 1G1AA 2Z2KA 3ABSB 3EE6A 2ID8A 4MVXA 4V3BA 4ZYXA 1SNYA 4MYSA 3PC8C 4Y2YA 1L7MA 5DSXA 3OTOB 1YA6A 5CTAA 4CIDA 3Q7PA 4NZ9A 3OA2A 4DYHA 2XZDA 1JA9A 1D4AA 2FHSA 1BU8A 4QKQA 1EFPA 1LLDA 4IWXA 1H5QA 3AX6A 2RBKA 1U3CA 4Z9BA 3U4IA 5YASA 2RE8A 3DKPA 3OCYA 1M1NB 1BE0A 4MP3A 1WPRA 4QOGA 4ARBA 1Z4KA 2CXPA 2ES4A 3MXTA 3N6XA 2UYHA 3DBHB 1Z4JA 1EP3B 1YRAA 5GY7A 3ZLJA 4YEDA 2OC9A 3FWNA 1ZVQA 4MGIR 1DTWA 1G7SA 3JYQA 4OHWA 1GGKA 3MC1A 5EMNA 3T0GA 2W43A 1Y6JA 3T4PA 2D4HA 4IKOA 1BEEA 1DINA 3LCUA 3N2GA 3HA7A 4ZWNA 2OBMA 4R2KA 1PT6A 5IM4F 5BSMA 1HZZA 2I6GA 1ZSNA 2I7VA 3ZX5A 3GLFE 1A9OA 3UO8B 1ND6A 3AK4A 3GP8A 5JALA 4BO9A 4Z3DA 4IMJB 1W85A 5K0BA 3QEAZ 3NHFA 5DB4A 5FUXA 2WTUA 2QD1A 4C88A 1N9GA 2EJUA 3CO0S 4NEQA 1BHO1 1XTQA 4AJ1A 4H4EA 1SHJA 3B51X 4FOOA 5EYPB 3WRYC 2B4AA 4B3SB 1RC0A 1YZVA 4R9VA 4NULA 2OVBA 2DKNA 3OLXA 5KYXA 4B71A 1U2TA 3PENA 4MS3B 1BCRB 1DRWA 1OYOA 4IXTA 4FYVA 4QOFA 3OJLA 4OQYA 4PZ0A 4JJIA 5K3DA 2EJWA 2QQ0A 4HJRA 3W3AH 4PN3A 4D9EA 4PAQA 1O2DA 5EMJA 2PEYA 2RHRA 1WSWA 3B1XA 1ABFA 2Y0DA 1I7PA 4RM3A 3ZBPA 1NBEA 2DR0A 1KMMA 2GEVA 2RJ3A 4NFYA 4PZUA 4QULA 4UUMA 4JI5B 3V8EA 3WMFA 2FPMA 4FYJA 4GG1A 4JBXA 1KAOA 4P5PA 3ROKA 3DNMA 3WYGA 4D4MA 2I4IA 1NX6A 1P2UA 5BV7A 2C82A 1DMRA 1Z8NA 2BCGY 4YRAA 3QHPA 2Z57A 1U7DA 3HWSA 1DUSA 4KYTA 3PT5A 3UJPA 5IH7A 2FUG1 1GQSA 2ZU0C 4MQLA 1LU9A 3I37X 2VK8A 2OCXA 4MVJF 5H3HA 3WIUA 3F4KA 4BFTA 4TZ6A 1JMKC 2Z2YA 1W96A 4LF4B 5EXTA 2EL9A 2YVLA 1RLUA 1LPSA 1HLGA 5BP7A 3X1XA 1ZIDA 4ITRC 1FBTA 4DV6B 3TOZA 3UAYA 2IP1A 4G5QA 1V96A 4PN7A 2OV3A 4MGEA 1YR7A 1QGZA 5UKDA 2X9LA 5JIBA 1W88B 2IHYA 4AZTA 5FOQA 1T9BA 1EQ2A 3GGSA 2WKRA 2N1MA 3FCAA 1SBZA 5K20A 2VT6A 3PT9A 4RHCA 5CFMA 4AX4A 3S81A 4MR7A 4Z0HO 5JO9A 5CEFA 3KDAA 3NJ4A 4EEXA 4I5DA 1JDBB 2HSWA 1SBCA 3KJEA 1SUIA 4G2TA 5K6TA 1GAXA 1F2VA 1JVSA 3RJTA 2C84A 3GLHA 4M87A 2JGJA 2W2LD 3LG2A 3B82A 4YFVA 5IJ9B 4G4SP 3VVLA 5KNCD 2D2XA 3QOYA 3N2KB 1FIUA 5KKCA 1T3ZA 3G2NA 3L9WA 4L16A 4LGMA 2H2AA 4BJHB 2IHNA 3E3OA 1GKYA 4H7PA 3WA6A 2VHQA 3ZCVA 1XAHA 2IPNA 4BVGA 4LHEA 4PLYA 4QT4A 3ZVNA 1V48A 3K9QO 2Z6AA 2XNDA 1IUNA 2F8TA 5T64A 3U7IA 5EQDA 2RAVA 1NMSA 3VNBA 1EHIA 4ZT7A 4BFSA 1KJ8A 4JK3A 5K3FA 3TD6A 3OEHD 3FOZA 2B4TO 4EHDA 2EDAA 1GR0A 3I2JA 121PA 1BX1A 2C99A 3QLVA 1J6UA 2PKEA 2R00C 5FLEX 3WKCA 3SSAA 4E33A 4UUOA 3U4DA 1W36C 5ABPA 1U2DC 2IXDA 5CVCA 3IQIX 1C0EA 1R9JA 4EGAA 3BJZA 5JDCA 5DTEA 4M36A 1MJGM 2FDRA 3BJMA 4UFOA 3RSZA 1NP3A 2O07A 4RNCA 2Q4TA 4F9TA 2Q5EA 3PXCX 1LPAB 3GJTA 3MJ4A 3KKNA 3AESA 3WL4A 1AA6A 2C7PA 2AC2A 3A3OA 4FFRA 4LGCA 2XCSB 4Q18A 1PZXA 1VB3A 1YGPA 2CEKA 2VHYA 1TUGA 5DWDA 3SHQA 3O8CA 4AS1A 3D3WB 4HK4A 3CUTA 1OLOA 1LDEA 2EJCA 2O2DA 2ZQ5A 3D8NA 3EQ7A 1L3BA 3FH0A 4RK7A 1IBSA 4HADA 2QG6A 2FZGA 3CNBA 2B98A 4U9UA 10MHA 3ABRB 1U3FA 4KQFA 4UM9B 1K3FA 2BGLA 3WBFA 4G4GA 2ZJFA 1PL6A 3DKIA 2C98A 4QM7A 2Q9BA 3WNQA 1C2TA 1RJEA 4IIFA 3M5DA 4XYGA 1VCMA 4HH4A 1MB9A 4TXHA 4K9LA 1Y6ZA 1PZHA 4N5LA 4R3UC 5KWVA 3RIEA 4X90A 2JATA 1JKMA 3IPRA 1IN1A 2IY8A 1B1AA 1I7DA 2WAMA 4C6TB 3DL4A 2PZ8A 4XGNA 2V96A 5CNIA 4FGUA 4G97A 5EMKA 3U7GA 2O9JA 3QK7A 1N36B 4KFUA 1Z25A 1ZJYA 2A6PA 3AFGA 4Y0NA 1D09A 3P9PA 1GGEA 4QXPA 1W48A 4GW3A 2CLKB 2JLCA 3VPAA 4DPKA 5B7QA 3TGLA 1JFSA 1E5LA 3OX1A 2YH2A 1JXOA 1MC4A 3TDNA 1UODA 2WDZA 1MG5A 4YROA 2YRFA 1XU7A 2ERYA 4WZAE 1TQ2A 1TM3E 2DH6A 1SPXA 3T3PB 3CVYA 3P19A 1RD4A 1A2OA 4LPKA 5ETJA 1U2RA 3K2IA 1VBKA 1XSEA 3M6MD 4OQLA 4RTQA 1YAJA 2A4KA 1AZTA 3GNLA 4J7AA 4KDCA 4AJKA 2A1UA 4JELA 4DLPA 4CBVA 1DAPA 5T5QA 2BYTA 1BS2A 1C1DA 1S3FA 3I76A 1WOYA 3GQBA 1GNPA 5GINE 1I7LA 3SHOA 4G26A 1FSFA 1P9LA 3PGXA 4W5JA 4Y6GB 3C5EA 3L1UA 4HDSB 2ATXA 4L0DA 4AKIA 2FEOA 4KAJA 4HN2A 4L2IB 4E22A 3GHYA 3UOAB 3WL6A 3QBVA 1DV2A 3AHEA 1VI5A 2FJUA 3WMEA 3C14C 5H9VA 4EAAA 3HVIA 1JXAA 2ADMA 4BZZA 5K2OA 2VIIA 1L1RA 2XUIA 4WK6A 1OREA 5ESDA 4LOHA 5KAMA 3NR2A 4ZVPA 1YZFA 2TRSB 3QWHA 3WB0A 5KYYB 2QLNA 1I7SB 4C5CA 4MVJP 3LECA 1WV0A 3ML1A 1VRVA 1EINA 5B7PA 1JT9A 1S0UA 3IE1A 2WD9A 1QRTA 3PEWA 1K5GA 3CU5A 1AU9A 2FRXA 3AGQA 3ER6A 5FFMA 3ZHSA 1R6DA 1DWQA 2JAHA 2NU9A 3BFJA 2HJ9A 4CM4A 3QE4A 1XYGA 2FSVC 1O95A 1IN8A 3O3MB 3RSHA 4PSVA 3RVQA 3T6KA 1C7RA 3ONEA 4DADA 5EKSA 1U2SA 4DILA 1SVMA 5AQ1A 2E89A 4OFZA 2JASA 4PONA 4JROA 1MRNA 3G5TA 4BNIA 1TM7E 2XLCA 4NQZA 1AGNA 4TMZA 2NG1A 4DLZA 3P26A 1STOA 1F51E 3F6RA 4KFSA 3W05A 5IT4A 3B9PA 2A30A 1I36A 1A2BA 2ZJOA 3SYTA 3GU3A 1NI5A 4QWWA 4PZLA 5LQDA 1CQJB 5DWQA 4ETWA 1N2BA 3A6ZA 3DE6X 1LH0A 1Q1BA 3EJ6A 2Z2ZA 2Z8XA 3DMHA 2HN9A 1EZZA 3ZWCA 2O5CA 1C8LA 1OROA 4I1IA 3LLVA 1VECA 4B34A 4DEXA 2V0GA 4AZVA 1BJRE 4EB3A 3BFVA 2CL7X 1Q0PA 2WHEA 3PV0A 1PL8A 4OBBA 1ZH0A 1NV9A 2PUGA 5GONA 4QC2A 1SVLA 1E4YA 2NZUG 2O3JA 2OSVA 3SQDA 1CETA 1YSCA 3GYGA 2O2YA 3RKSA 1W4CA 4IVRA 4JYZA 3R9WA 2DULA 3PK0A 2J4CA 4DV4B 1ZD3A 2O23A 1C3OB 3LKVA 1CJUC 2HHCA 2VNHA 3HJTA 2WWGA 4KRYA 5FPHA 5LBUA 5SZJA 4O2AF 3TGWA 1QQBA 4GLLA 221PA 3IBYA 2C8JA 3GUYA 4LXUA 3WGNA 5BT8A 4W5QA 3Q3GE 4QRHA 2CMKA 4IIDA 4YRZA 4PX9A 3R5XA 1RQ2A 1S8FA 4XWYA 1HT3A 2I1VB 4JSYA 3RARA 1NF2A 3JWHA 4YRSA 2EW2A 2J3EA 2O0JA 3C2QA 1U98A 4L6CA 4Z9XA 2G72A 1FTWA 1IHYA 4D43A 5ADUS 5JCOC 4QVKA 1TO2E 2A7XA 5CURA 5L4SA 2QS9A 1T9DA 5DM2A 1Q91A 2AKYA 3NHAA 1J0XO 3BRSA 5TS3A 4ZEXA 2QSYA 3RCBA 5BSTA 2IZ0A 1LGYA 2X5KO 3IP6A 5FUVA 5IDXA 4ZYVA 1QXSA 1TA4A 4MP6A 3ANXA 1SM4A 3RIGA 3RIMA 1ORHA 2DSTA 4ZO4A 5IT5A 4TVSA 1UUFA 4YUWA 4LJRA 2YHBA 4AO6A 3E27A 2YMLA 1KRXA 1W87A 2RI6A 1YZKA 3IQZA 2ZSKA 4YYEA 1P5RA 3TE6A 5BV0A 1G21E 4O08A 4RYDA 1EX7A 5L8VA 4D9MA 2QAGA 1ZH8A 2AQHA 4I9NA 3PI6A 4I8DA 5CDYA 2IZ1A 2PUBA 5AW2A 4ZIRB 5LIPA 5EHGA 4CLRB 1A76A 4UHHA 1V16B 3GH1A 3M4YA 4HQFA 2I4TA 2X0NA 1X7XB 3HDGA 4QT0A 3TLKA 1N2SA 3LUHA 4MJ7A 3H1AA 4EHIA 2PX4A 5TY0A 2WMDA 3DXZA 4GI2A 2II6A 3PCXA 4BCCA 2YHUA 1I4LD 4ZYLA 5AUPB 3VKGA 2YNMD 3MOIA 1HRKA 4FDMA 4UARA 4LFCB 4HTFA 3I6ZA 2YUTA 2R1TB 3ZV6A 2IBTA 5EMLA 2FW9A 3MG9A 5IYZA 3EPKA 1AQNA 3L6DA 4AJNA 3VJLA 3A6JA 4OXXA 1QO0D 1YGYA 4M89A 5TT1A 2PWAA 1N6RA 3GRRA 1OX6A 1CNMA 2SCUB 4AF7A 3VI3B 1XZCA 3R9IA 2EFCB 3IP1A 3SQWA 2YWEA 1KYZA 3QIVA 1SXJA 2HCBA 2QD4A 1TQ4A 2JHFA 3NUQA 3OFJA 4LDZA 2PZKA 4R2MA 5TVKA 4IJ6A 3V6MA 3V3TA 4YBZA 3M1YA 5B58C 1E4EB 5C8DA 5HGXA 2P1RA 2HRDA 3PNSA 4BCBA 4TYNA 3UPUA 1A88A 3E9ZA 1KEWA 3CPJB 5AJZA 1P0MA 2GN9A 2NU6B 2YWRA 2OCGA 3MS2A 4IO1A 4CQMB 3HP1A 3U4AA 1Z9BA 3ABIA 5K3AA 4ITUA 4E2FA 4NYJQ 2X5OA 1ZWKA 2QY9A 4FEEA 1UDRA 5TMBA 3QBJA 2V1XA 1CDOA 2A58A 2LBPA 4ZJPA 4NI5A 1EIZA 3SXPA 5LQMA 1Y3CE 4NZOA 1RXYA 4EYSA 3DMYA 3KWMA 4MWSA 4CETA 2E4AA 4B45A 3GVCA 4LDQA 4PHTA 4XVHA 5K8CA 3AF0A 2EKPA 5CDTA 1PT8A 1V41E 3LOUA 2C9OA 4M0DA 2YV4A 5AM3A 3L8FA 4AKGA 1ZMXA 3DEAA 4LRSB 3W2IA 1RHQA 5ALFA 1A96A 3EGDA 4E09A 2A4MA 3R3WA 1CRPA 2QTNA 3VR2A 1E1RD 1P2VA 3OQMA 1Z88A 4HNRA 5JTUA 1BEZA 1CJKC 2R8EA 3OAAD 3QPAA 5AI0A 3HNRA 3TB4A 3L1KA 4WBNF 2J67A 3HB9A 4ECEA 1GTVA 1SQSA 2DPMA 3MMXA 2WAYA 4UJ3A 4EPVA 3RUCA 3TZBA 4A0QA 4NOLA 3H2YA 2JG3A 3SM9A 2B94A 3BCHA 1MO6A 5I7OA 3H2SA 2YVKA 3W2HA 3IAHA 4AJEA 3C8HA 4YCBA 3FGOA 4J43A 1CY4A 1W4LA 1KP3A 3D7SA 4MB0A 1MZVA 1CZOA 5JYBA 3NHSA 1KFCB 2Q3LA 1C3VA 4PIMA 2VP5A 4KLAA 4MGKR 3RBAA 1RHMA 2CF5A 3FVQA 3WL5A 1C1YA 5DTQA 2CT8A 3PWKA 1XCLA 3WGHA 2H3HA 1VSBA 3HU5A 1MUUA 4W8HA 4TKVA 1KKLA 1UINA 5DGIA 5LZ7A 1E1NA 5HWSA 1FU4A 1RQNA 1VP9A 4FWTA 3ELYA 1NQTA 1W76A 3S1LA 2HRCA 3R3UA 1GZDA 1KY3A 2ZZKA 4IHJF 3OU7A 4URYR 4N12A 3SS9X 4BQRA 4YCSA 2VR1A 1NM5A 1D04A 4LJSA 3JY6A 5CDHA 5FPKA 2VHUA 2CUKA 3DYVA 2C3PA 3MGGA 4P1ZA 4A8JA 2QRZA 1W46A 4C78A 2YXPX 1HQYE 1B2RA 1QSGA 2AMVA 4V03A 2QR2A 2I2BA 3U3RA 1PJCA 1OXKB 2I80A 4G1BA 2IYVA 3DQPA 2Y0PA 1PR2A 4KP7A 2FMUA 3BDAA 4M1TA 2D62A 3U5ZB 2IH2A 1D0VA 1UM9A 2QR5A 3VSBA 1PD0A 3GDGA 5EIWA 3C16C 4GI5A 4ZHQB 2NNLD 1M0SA 1FNMA 4G63A 2D13A 2IHZA 2QX9A 4RADA 2RCYA 5F2NA 1VM6A 1QGAA 2GXUA 3BTOA 2OYRA 1FFXA 3DKRA 3C3XA 4PF1A 3HJBA 5CMLA 3TFOA 3VU3A 4BJ1A 1PJAA 4D4KA 2WNHA 1XNGA 2H65A 2NTJA 2ATCA 3H5RA 3ND5A 4TUYA 1BFDA 1U90A 1DKLA 3FUCA 3OZAA 4HH0A 1E20A 3VC3A 3ZDQA 3OQNA 1E1QD 3PVCA 3LHDA 1F06A 4MKHA 1XQXA 3H42B 2R87A 1ZICA 1LF5A 2QT0A 3IIKA 4I3FA 4CG3A 5LM3A 4WCFA 4ARCA 2VF8A 3BX1A 2BL4A 4LXYA 2YCLA 2IHBA 5FOTA 3KKLA 2IU0A 1NLFA 3GPIA 4TVOA 4W7SA 3W5BA 4C7OA 1J7JA 4KDRA 2DYKA 1AUOA 2H2HA 2H8GA 1XEAA 4RF4A 2PU5A 4YMHA 2HYIC 3OBIA 2HNAA 4BASA 5E9QA 3VC2A 3UANA 1Z36A 1ATZA 1PW7A 3L1VA 4NATA 3SYRA 4DJTA 3MFQA 2OO7A 4L4RA 5TMPA 4ZREA 3C3WA 3TXYA 4OUDB 1VMDA 4CMJA 3VJKA 4ZKDA 1P2SA 2O3QA 3IILA 1CZUA 4TKLA 2W58A 3C5HA 5CR9A 4LOIA 4PU0A 1HYEA 2F9FA 3SE0A 4ZQIA 3RGWS 5MFZA 3VU8A 5AVVA 2DR3A 2A0YA 4R69A 5DVZA 2LCIA 4WIAA 2WD8A 3WGOA 5BSVA 3BMOB 5IAAA 3AY6A 5LYJA 3WLKX 5LQAA 4N01A 4L9AA 1H8ED 1VKJA 2CZCA 3CO5A 3PICA 4G24A 2V7UA 2HU2A 4E5VA 1SCKA 2OVFA 4O5AA 4RGYA 5A6SA 1FLAA 4JU9A 5JQGB 5C5CA 5K3EA 5IC5A 3TQQA 4LBVA 3EVBA 2PMEA 1KNQA 2H1LA 4MR8A 3ZE1B 2WG1A 5BNZA 1O0SA 4YASA 4C43A 1LDMA 1U1DA 2HA0A 4UDXX 3TIVA 3UUGA 1DBVO 1Y4DE 3MS4A 4DMHA 2I76A 3HEBA 1IUOA 2QZPA 5G0UA 1X19A 3KFLA 4AZ0B 3PSAA 3CN9A 5DYNA 2GN0A 1GRVA 1Y4UA 3LP8A 4S24A 2JAUA 1B43A 1SCQA 1SCIA 2AFIE 4FILA 5DRYA 5DGCA 1A5BB 3NBUA 1VE6A 2WUGA 2XVMA 1O08A 1C7QA 1NT2A 3C3MA 3B9BA 3FSJX 4L72A 2JKVA 5IVDA 1LUAA 3L8MA 4FLFA 3R8XA 3UHPA 5H70A 1JNYA 4QDKA 7GPBA 3PTAA 4DKJA 2YIVX 3KAPA 4UTPA 1II9A 2DJIA 5AK0A 2PKQO 1G59A 5HVNA 1E69A 3K5IA 2C8LA 2PS1A 3JQBC 2I0FA 3E4DA 3VRHA 5JAZA 3SD7A 3W9YA 3BMXA 4DUGD 1I3LA 2YWDA 4AKHA 5BVGB 1J9EA 5DYTA 2DPYA 2RG7A 3EPPA 2PZLA 2QT9A 3OZWA 1KVRA 4LNUB 1QUFA 3ED1A 4BNUA 4LGVA 3LO8A 4MW0A 3MB8A 2AC4A 1S1CA 1S8AA 3A26A 4KJZA 1J8MF 3JQ9A 3CJRA 1AX9A 2HUPA 1A8SA 2VUSA 4IJMA 2J07A 5HK9A 3QKTA 3GNTA 4GYYA 1P9OA 3KKQA 1FDSA 1SBHA 5JSFA 3EN0A 1Z8FA 2AE1A 4NBVA 3RFFA 1QOPB 3E5NA 5D6NA 3GJQA 3O26A 3SHVA 1TM2A 2GEUA 3H86A 4XEUA 1N6LA 4MQFA 4XRRA 4YJ3F 5JROA 1KRWA 3KL2A 3I32A 1VHJA 3GVXA 4ZALA 3TUJC 1HDXA 5IUKC 3DWIA 4D6XA 1FBNA 1HT2E 2X1LA 5DF1A 5KNDH 3O3OB 1W44A 5DLEA 1NDUA 2EXXA 4ZGGA 1F5SA 5CYFA 5K0GA 2AX4A 1K8QA 4LKRA 1W29A 3CLUD 3P8ZA 4HXGA 2QZSA 1VSVA 3HDVA 4KHPB 2AG8A 4X93A 3LBHA 1V1MB 3TM4A 4TTTS 1ML3A 1T3SA 1H2RS 5HIKA 4FUTA 5JE8A 5C7LO 1EM8B 1QNFA 4MCIA 1YBAA 3EYAA 2J5RA 2J0UA 3LM8A 4JEUA 2WB4A 1QDUA 1FP6A 1ZRNA 1GGHA 1K5DA 4Q9KA 2HJRA 3TBHA 2OY0A 1EZ1A 3NRBA 1MMFB 1XTPA 2J9ZB 3MWGA 2JHGA 4G09A 5I4IA 1QBGA 3A05A 4QGAA 1RI1A 2FZVA 4XASA 2NT3A 2JH3A 4V39A 4DGSA 3ILHA 3CVUA 1WNFA 1T15A 2XOXA 4JOQA 4Q1AA 1EFVA 4I9UA 4WJZA 3K4QA 1IC6A 1L5QA 2BFPA 3OP4A 5D01A 3WAKA 5GMOA 4K81B 1BD4A 4UPVA 1AMNA 3GLIA 1SHLA 4BO0A 5LNK1 1R4AA 1UJ2A 4DCPA 4RJKA 3I1YA 1OH6A 2OYSA 1U65A 1G7CA 1YR1A 2RH8A 4INPA 3A37A 4B6PA 3U1VA 2IEZA 4IEIA 5BW5A 1PUJA 1QOZA 1YB1A 2WQZA 1J90A 1N2GA 2XUZA 3M34A 4NZYA 1O4WA 1YZQA 2IYTA 2QV0A 3IOEA 4RGBA 3BSFA 4NH4A 1PR6A 3HUDA 2H5IA 4NWIA 3DTVB 2CV2A 2J3QA 4AYTA 3VU9B 2WJWA 1H85A 1GZVA 4H27A 2R62A 3V1TC 3KYDB 4B33A 4KAFA 1FVFA 2NO4A 3HABA 1T0JB 2WWHA 5EKXA 3MK31 1AKTA 4BDSA 2XB8A 3N07A 4KVFA 1USKA 4GC5A 3OQ1A 1G20A 3UAZA 2G7ZA 3SFVA 3UMRA 2IVFA 1F0YA 2AQKA 1FJXA 2VYND 2BV3A 4DLVA 1KK0A 1PWZA 1A5AB 1ONBA 4DA0A 4IGFA 4QLAA 3MCAA 4LMBA 2HWWA 1L9XA 4F1JA 2CVZA 3D6VA 4KHZA 3QKSB 2FDCA 3JD4A 4AMUA 3NBZC 5JXWA 4ARIA 1S3SA 1TJ3A 1SK9A 1Z13A 3H65A 2ODWA 3C3JA 4R3NA 4AZ3B 1YCDA 1SRQA 2Y8EA 3AU8A 4RHFA 2Q07A 1BO6A 4R7GA 5EN4A 3ZWXA 5CDSA 3P0HA 3OE5A 1YFKA 5B6IA 2VAMA 5D3MA 2ZE8A 3A70A 3BGSA 3OZVA 4QEKA 1RRKA 1ADYA 1H23A 2Z0MA 4C4ZA 2C4NA 1YBHA 2I8AA 5BR7A 1NVEA 2O7RA 2IEGA 1NW6A 2ISCA 2NU8B 1N0IA 4FD2A 3OZTA 1G98A 4H7FA 4POAA 3TWOA 1T2AA 4A27A 2ZIVB 3NHUA 3C3PA 4KE7A 4QAJA 1E6UA 3ZGXA 1AHHA 4PANA 2PRJA 3MMSA 3HVUA 1CY2A 1NPTO 1WBBA 2XT9A 1R8SA 1U2PA 2PUHA 4G37A 4FE4A 4O8ZA 4XD2A 4NS1A 3SVLA 4YQEA 1U9IA 1TOAA 3BMQB 4W9RA 1XL1A 1H6CA 1KK2A 2NUBA 5BNFA 3N8IA 1U80A 2QI9C 3ONFA 4V0MA 3WV4A 4CIVA 4F2DA 5CA0B 1FVXA 3HSKA 6ADHA 2C88A 4OTZA 4QFBA 4WOCA 4EITA 2Z3WA 4HB3A 3AEQA 3UMBA 5HUHA 4BRSA 3ULKA 1T2UA 2HHJA 2IYUA 4B3BA 4Q3DA 4O25A 4LDPA 2VJMB 2YFYA 3KO8A 4MA5A 4YRBA 3UOGA 1T3LA 1QX3A 2P5SA 3ASVA 1AN9A 1SIWA 5A05A 3RVLA 3VHQA 3ABQB 3V1KA 5AVWA 2OR3A 8ADHA 3NGLA 1KY4A 4G23A 3PXGA 4DBZA 3RVBA 4G84A 1I13A 4MAFA 1XMXA 3K4HA 1GGJA 2P6PA 3AUUA 1ZIOA 3PQ7A 1JR3D 2H31A 4CMIA 3P1JA 4O1IA 1JBKA 3G2QA 8OHMA 1G5HA 3LKDA 5JRJA 3GJ4A 3IPLA 2X19A 3RBVA 2BMWA 4RV9A 1QTNA 3H04A 5AVZA 2AEMA 2H1SA 3HCBA 3KLNA 1UH5A 4LDAA 4BMXA 5B3JC 4YV2A 4Y1EA 4LHZA 1T5LA 3HNPA 3M3PA 4J6EA 4ZMSA 1EM6A 3CUYA 6AT1A 1G17A 2OFFA 2I9KA 2ZKLA 3O31A 3KE9A 4NF2A 1GA6A 3ISTA 2GT1A 3D54D 1USVA 3OPXA 5JY1A 1W94A 1OKKA 4C14A 2BKLA 1NLZA 1DXQA 1XEWX 2VNSA 2XMGA 1NMQA 3LX5A 4L3WA 2XDWA 4LOLA 1A9SA 4WEQA 4Y2SA 4C7JA 2QYTA 2X5JO 4FONA 1ZD1A 4OGKA 1VIYA 3QFFA 4JBGA 4MJ3A 3TIFA 4DIDA 5K4HA 3CUVA 1WW3A 2Z9CA 3E18A 4KQ1A 1WQ1R 2BIFA 1SZCA 5K0FA 5JYDA 1ZIYA 1X7ZB 5CB4F 4W5NA 3ZHBA 3KTAB 3SZMA 2A88A 4K6CA 4N0DA 4US2R 4Q3LA 3ZE2B 1GVHA 2O3UA 4TWAA 5FXMA 1KP2A 4K9RA 5HCNA 2FN4A 1Q50A 1VLZA 1ECPA 2R5FA 1ZM3A 1VJDA 2NTVA 4RMHA 4DRXB 4WCVA 4JC8A 3P2KA 3PGJA 2H4YA 5KYUA 1E2JA 3ACDA 3M3HA 2ODAA 4N41A 1E60A 4LSGA 3ZV4A 2YDYA 3QU2A 2F3RA 3OF3A 1N92A 4CF4A 4JY7A 4OYYA 1PQPA 4ZO9A 2FMHA 4TQAA 5IJWA 1TK3A 4K6KA 1OLUB 4ZCQA 2HQRA 3B13B 2R7NA 3JVUA 1FP4A 4RHUA 1L0BA 2QM7A 3ORFA 1UMCB 3TD2A 2NU7B 4ZC8A 1HA3A 2Q6VA 3EGEA 1T2DA 3PDIB 3UC5A 3X1JA 3DW3X 1YCGA 1MGPA 3BTVA 1G64A 5HKKD 3OCCA 4G25A 4NOKA 1R0BA 4P54A 3DQZA 3DXXA 4QE3A 1EFTA 4Q3NA 1XWWA 1QB7A 2VWPA 2HF8A 1DBWA 2XYRA 5HYVA 3LPNA 1SOWA 1XZFA 2EX0A 4GQAA 5ALIA 4QM6A 5CW2A 1I4OA 1Y9ZA 2OKGA 1OWMA 4M9UA 3WJ2A 1J8QA 3WSVA 4D7AA 4D82A 4NBRA 2IPAB 2FPIB 3D4BA 2HJSA 1YZ3A 2OPBA 2IODA 1CUXA 3OCZA 1HKHA 4UM9D 2YS6A 1X39A 3Q7QA 3QG1A 1C9NA 4W7HA 5U4XA 3TVTA 5KCZA 3CCCA 4UU7A 5LMCA 3QE9Y 4IIHA 1JJIA 2W2KA 3KELA 4HLUA 1W5BA 4RSMA 1ML4A 1MB0A 5JBQA 4U9HS 2ODEA 4G0MA 5J5AA 1MX9A 1KHHA 5FNZA 3O6VA 3QKIA 4Z49A 1MPXA 4OQDA 1K2VN 4EB0A 2W2PA 1UM8A 1AIPA 3HB5X 1R10A 1UBGA 4L9RA 3T7EA 1CVLA 2XV1A 3QELA 3ZHCA 1A82A 3GARA 4G5HA 3MMNA 3PA8A 4CLXA 4PSUA 3LO5A 4XE5A 1FF9A 4WT7A 4ZVKA 3HBNA 5G3YA 1TCBA 3KU1A 2CE2X 4UHBA 5H4HA 1JW9B 2XE6A 3PDUA 1ABEA 4KQMA 5A5EA 3HSSA 3FPLA 4H3SA 1P1JA 1R0ZA 3O9VA 4UHDA 1TU3A 5AO9A 3T41A 3HP7A 1T6ZA 4GI3A 4N48A 4Z3KA 3SIPA 3UUFA 5ALUA 3CBQA 3G85A 3OFND 2PZJA 3KUDA 3OPYI 1MRZA 3LC0A 3U09A 1FS5A 2M2IA 3QKRA 3DTYA 4I5EA 4MUFA 2HX1A 1J00A 1Z7EA 2NO5A 4CIYA 3LHFA 5E8JA 3QLJA 1A5SB 3NCHA 5ALJA 4DLTA 3BRWD 1M6HA 4C7MA 3KKEA 4RPHA 3SXUA 4UTNA 2XMSA 2I8CA 2RBGA 1R9NA 5FNVB 3VPFA 3JD1A 1WV1A 1XD2A 2UUBB 4EI8A 2Q41A 2ZR8A 9LDTA 2YIDA 3D7RA 1DAIA 1X3SA 4QODA 1O9HA 4I19A 3T4UA 3GJYA 1JS1X 4WJLA 4KN8A 1FU7A 2A5DA 1QK3A 3MHPA 4H7JA 1QV6A 2Q3FA 3W8FA 4P0QB 4BKUA 1HNWB 4ZQBA 2PZBA 4M38A 2JLVA 3TG2A 4Q02A 1Y5IA 4MNTA 5HFNA 1UXJA 3T9BA 2P6RA 4NNPA 4LVOA 4MULA 4AN4A 1VKNA 3ES9A 2DGDA 1VPVA 4B5KA 3ZE9A 4CT4B 4HVCA 3IEXA 4R8LA 1WWKA 4RX1A 2XWPA 4A23A 2BSQA 5KDLA 2O8BA 1RZ3A 4F4JA 4L8YA 5E6SB 3KC2A 3EASA 2VEOA 2CLOB 4PXSA 3PUZA 4NCNA 2C2YA 5GM2A 3I12A 1KGSA 4JS0A 1H6AA 5LQCA 3ESYA 5ELMA 1BX0A 1GRNA 3JZIA 3KSBC 1ZL0A 2FK8A 2YWHA 4O0LA 2C7GA 4KR7A 2V6GA 4Z7NB 1SEPA 5EIOA 3EIQA 5HBRA 5A71A 4CR6A 2DBZA 5AK5A 3MWJA 1H66A 2BKAA 4WZBE 5EA2A 1D6NA 3ROXA 3AR6A 2FSSA 2HQOA 2NSJA 3KB6A 4RK1A 1A97A 5AXBA 4DIFA 2X5XA 5JMOA 1SBNE 2WWFA 4GZMA 4GECA 1PS9A 4DMKA 3GOQA 5JZSA 1EK5A 3QPUA 3EXEA 5ICMA 5F73A 3R23A 4LY3A 1E89A 2ODBA 3RS0A 3BIJA 4F5WA 1X14A 4DPMA 3FLBA 1PV1A 3O03A 1P3JA 1KSFX 3LBIA 2W6ZA 2F8MA 4KNWA 5AVXA 1DJOA 1PGJA 2FP4B 3U7QA 1CQIA 4IDHA 5LP6C 4OGFA 3PGKA 3LPDA 3TEMA 3WKBA 2GZSA 3NOOA 4NENA 4UNNA 3RAGA 3FYUA 1X9HA 3CBGA 4PGAA 3EIEA 1EXVA 1JEQB 1G5PA 1GY8A 2RJOA 1SN7A 1U0GA 3IIMA 5DTMA 2BFDA 4NABA 4FBGA 2NIPA 3STYA 5CYGA 4NCBA 5IMBA 3TQFA 1SQGA 3Q8WA 2Y71A 4NBWA 1U04A 2HL6A 1L4HA 1CERA 2HPAA 3O8OB 3U44A 1FUUA 3FHOA 1ZUNB 3K53A 4OJMX 1UKAA 3HY4A 2UAGA 5DYWA 2HGZA 3LC1O 5L9AA 4K88A 2D0IA 3AF3A 1APBA 3DTTA 3L7OA 4BAZA 1CT9A 1M7BA 1U0SY 3ZD7A 1GPJA 4MP8A 4JH0A 1GA4A 2AN9A 3LBYA 4KEAA 2HNBA 3TZEA 4Z54A 2IY9A 5F98A 3ZXUB 5IN4A 4X71A 5F2KA 4F85A 3IB6A 4MB6A 3JQAA 4FKMA 4WXPA 1R8YA 2F8LA 4CKWB 2PCLA 3G2OA 3C7CB 2PX5A 1KR2A 1J8DA 2IDJA 1FRVA 2IYQA 4JLMA 2HYDA 3T3OA 2Q3MA 2AJTA 3WLSA 2L2QA 1Q0HA 2GPSA 2ZWVA 4MW7A 1ENYA 4G89A 3DLHA 2DE0X 1N5JA 2FPSA 2B8JA 3VPCA 2Z8YM 1KFBB 1TQ8A 4R0VA 2O8DA 3FNIA 2UZ4A 2W90A 5HIJA 1ZESA 3TINA 4FWBA 3ZVRA 3WTBA 4DNPA 4YBRA 1EMDA 3LU1A 1RZRA 1QYIA 1WUIS 1Z7WA 2JGKA 2VPYA 2O3SA 1XVLA 3G17A 1FFGA 1K8RA 3LPMA 3PRHA 4ON9A 3THYA 1KTVA 2J0QA 4MGHA 1A7KA 2Q9CA 1Q0QA 4TTRA 3SCZA 1BRMA 3HU3A 2YINC 421PA 4ZT3A 5A9TA 3WZ2A 4ALLA 1DPGA 4UVGA 3IEMA 3M5WA 2EQ5A 2NQ8A 4EJMA 1TYDE 2GYYA 3IEVA 4UHFA 1OTXA 2HY7A 1FQJA 3O8NA 5D87A 5DCYA 2N3ZA 1VL6A 3I62A 1ZD5A 4PSCA 1NSFA 1KO4A 2HK9A 3FZNA 4KPFC 2OO5A 1K4MA 1A4UA 3HV0A 1OFUA 1SA0A 1K1EA 4G85A 4B1FA 4DABA 4E7PA 1IK4A 1LK0A 4XIIA 3RVSA 3LUKA 3A6KA 4QLOA 3TRKA 1OLSA 2Q3CA 4N54A 3RTCA 3HG7A 3T5AA 5AVOA 2KW5A 4CKCB 1P4JA 5EFZA 5EZSA 4RE5A 1AMUA 1XZHA 3HEMA 1KI3A 3NYQA 3PFNA 4JX8A 4BMZA 4DCMA 3W1VA 1TUBB 5A5VA 2YDXA 2Z2IA 5AMXA 1TZMA 1GJRA 5CT6A 2ZJ2A 5TF4A 3TFWA 4BFWA 1WRBA 4UNIA 3RTDA 2R7LA 4KL8S 2V6FA 1QLJA 2D3TA 1WXGA 2VT7A 2W2QA 3NOQA 2W6ID 3KOUA 3TIGA 3JX9A 3QVJA 4JQZA 3GCZA 4DG8A 4ZYYA 5K6AC 1GQOA 1P2FA 4H7KA 1M75A 5HZKA 2GAAA 4L57A 4KCGA 3R5JA 1G4UR 2E6UX 1P4SA 1E6CA 4MR9A 1VSQA 4HQ0A 2C94A 2QMZA 3OZGA 2ECKA 1GP2A 2RH4A 1G0OA 1F0KA 3PCRB 3PQCA 3ENVA 3ZZMA 1L5WA 5DW3A 3ZCXA 1P1CA 1SHTX 2XQVA 4CL2A 5M29A 1QCYA 2F43B 2HCJB 3CCBA 4MJXA 5ALZA 3RKUA 4PRKA 3AFNA 1EQAA 4NPHA 3KS9A 4E2WA 1N57A 3MLBA 5JI3E 1PJ3A 1NL3A 2JIPA 2P40A 3EISA 1JQEA 4PLPA 1NW7A 2OHHA 3AUYA 1JU4A 4K46A 2C7BA 3CR7A 5LMNB 1QIHA 2LGJA 4RPCA 1PAUA 1PV2A 4RZXA 2RIRA 1UP6A 2VYQA 3C0KA 5LDGA 1IATA 1OZ0A 1WB4A 1IMJA 1HFWA 3DR3A 3O95A 3DNFA 4NOJA 2PNFA 4ZMRA 1VJ1A 2O2IA 4DR7B 1X6VA 7REQB 4DG5A 1JHUA 3J81k 2V45A 1U3GA 1E7WA 4E6PA 4C4XA 2OFWA 1HR0B 1T0HB 1XQ1A 2D1YA 2QX4A 3E8MA 4WVFA 1XYVA 4D9NA 3SOZA 1JQLB 1Q2UA 4IH1A 1KC3A 2Z2XA 3VH2A 4CM3A 4O5OA 2G5CA 4ZAVA 2E4ZA 4IG9A 4AXXA 1HBJA 3EULA 3SJZA 2C4MA 2DWPA 4QDZA 1D07A 3AILA 2QVLA 4GPAA 3LIIA 3OKPA 5D3ZA 2GBLA 1BXGA 3PQ2A 1TA9A 4CKZA 4ZVSA 3WNZA 1MABA 3B5IA 4OSEA 5HBGA 2R0QC 3ZX4A 3RUDA 3TLMA 1RC8A 1X7WB 1RPJA 3AQIA 3K2EA 4G0VA 1OYVA 4LYFA 1S8OA 2FWPA 4B43A 5EE5B 1U5BB 4HMPA 4KV7A 2GJ4A 5U4QA 3TMYA 3MXOA 1U0NA 4KB5A 3ZOKA 3EZXA 1CZLA 5EE3A 4CTNA 4DG9A 4IR7A 3BDVA 1AGXA 4FJ1A 1WB9A 3UTDA 1D2MA 2W2XA 4DCVA 1QIIA 2GVDC 3NRJA 1IIRA 4QXAA 3PE4A 2CBZA 2HA5A 4XLZA 4B2YA 2OV1A 4YLGA 4JP3A 1MO4A 1KJ9A 1YRHA 3V1UA 3QLUA 5JNTA 1OXTA 4OAOA 1DO8A 1Q22A 5EWJB 3V7YA 3GN1A 2FPPB 3VZCA 5CDUA 4B7AA 5L40A 4ND3A 1FFBA 1JQJC 1K4KA 1VBMA 4JHXA 4V2UA 4JI1B 2E0IA 3QEBZ 4HGNA 1UJ5A 2QP9X 3NHYA 1JEYB 4NCXA 4CM6A 3OU6A 3EXFB 5EHXA 3OJOA 4OHYA 2FR8C 1T1RA 1VJCA 1U8AA 4HJXA 1C9DB 3OWOA 2HZ7A 5FBHA 3TAUA 3AIMA 2ONKA 2AUMA 1M1YB 3IEUA 1WCV1 1ZOSA 1ZU4A 4HRXA 4UQOA 4ESHA 5JZMA 2W6NA 3EWAA 1X80B 3OEEA 5B3AA 4W9NA 3GLVA 4JR0A 3U4MA 2FXVA 2X4LA 4I55B 3BMCA 4DF3A 3M2PA 5HP4A 1TKRA 2AN1A 4FHGA 4WXYB 3RIYA 3KPJA 3A7DA 3UBMA 2ZLBA 1EDZA 3IDAA 1N2XA 1ODSA 1EX1A 1PFGA 2XWJI 4JB2A 4GX1A 2WBLC 1QKIA 3A6EA 2EP5A 4MMYB 3F1LA 2BE7A 5FKJA 3ZR4B 2IA5A 4TMTA 4XUCA 1WXHA 4H08A 5SY6A 1P9NA 3CLVA 2ZWPA 4NL4H 3NJRA 1WDMA 2NLOA 3MJCA 4TL6A 4YONB 5K4AA 4ARUA 4E51A 4CGZA 1RJGA 4DA7A 2WSIA 1NUPA 3HACA 4N1AA 5BVHB 4KPEC 4O4JF 3WYEA 2A78A 5TGDA 3QEMB 1FX0B 2C83A 4TM7A 2YR0A 4DDHA 2Q1TA 3D3NA 3IKLA 4X8OA 1FX1A 3I2IA 1RHJA 3GYBA 3HWWA 4B46A 2X77A 5FB3A 4ACAA 3DVQX 1HTWA 4MYUA 4P0PB 1K3TA 3DUWA 3O4JA 2HT6A 4HZIA 5CBPB 1HTBA 2DSNA 4ND7A 3H1FA 3I9LA 2DWOA 2X7JA 4XI9A 3SY8A 3VISA 1DG9A 3STWA 1W8DA 3F97A 2QG9A 1B73A 2Z30A 1YQEA 3KAJA 1LLUA 3BGDA 3L8HA 4KITB 2O2JA 1RYBA 3HB7A 4JWKA 3ROQA 4YUYA 1BMQA 4KFRA 2D74A 2EIXA 2NVUA 1VYTA 3I01M 5KOHB 4N5MA 4JBHA 4AKSA 2PXHA 1NI4A 1D5CA 3VYWA 3K70D 3RREA 1WULS 2QI9F 1YS6A 3IX7A 4R2HA 2XE7A 1EDOA 2PY6A 2B3TA 2JCYA 1PJRA 3L1JA 1QLHA 3FNBA 4B0OA 3ZPXA 2B1JA 2C2ZA 3C6YA 1K8ZB 4BE4A 3FLEA 4RHTA 4HSEA 3R7WB 1M2OB 4RQAA 2X6TA 1K6JA 3PGMA 3ZK8A 4DIKA 3UW3A 3GCXA 3PC4A 4L15A 4UNSA 3CMMA 4IP0A 3IAM6 2YQ4A 3ANTA 1IEXA 1W59A 4N5IX 3W79A 3HJCA 1RLTA 2IEDA 2YZNA 3S8MA 1G6HA 1V37A 4PLVA 4IFEA 4LRWA 1PYOA 2Z4SA 3H9EO 4I14A 4M8LA 1TAGA 5FP0A 1VIDA 1KERA 3VSDA 5ALGA 4DIUA 3SYNA 1RBYA 1H2WA 1QK5A 5JAOA 3COSA 3O5AA 4BO6A 1LZLA 4C2TA 3EB9A 5IT0A 4JEHA 4DSAA 4ZOLA 3GFGA 4TUYF 5I7FA 1J70A 1LLFA 4ZAWA 1LDGA 1GCAA 4DNOA 2KE5A 1LBHA 2XSZA 3BFKA 3UAXA 5DNCA 2JVJA 2E4UA 1WXQA 3VOBA 3HTXA 3KKMA 5T7BA 3VYUB 3I64A 5M34A 1JMVA 4JLAA 3M6WA 4X8MA 5FWYB 5CITA 2I1QA 4NK5A 4M8NE 3VSCA 5BN3A 2G04A 2Q3EA 4AIIA 1E3WA 2R66A 4UJ5A 1NJFA 1KZ4A 2CKMA 4E2YA 1EFAA 3MWKA 2CMFA 3PNMA 3KVYA 3DMDA 2XDQB 2ZP1A 1ECBA 4Q4DA 4TLAA 2VSNA 2W6PA 5JD3A 4DR3B 1DE0A 4MQ5A 1Y1PA 2VHWA 2Q1XA 1QH8B 4QO7A 5DI3A 4RVNA 4D2IA 3V80A 1N32B 2I87A 1GQRA 3B5EA 1G8GA 2KSQA 2CXRA 3FB4A 3JWEA 3L0YA 5BQOA 1YL5A 5EXPA 1S96A 4IUYA 3T12A 1IHPA 2BGGA 1ZU5A 5KYWB 2GHTA 4LZPA 2ZXUA 1EGHA 3L7NA 5EE0A 3DTNA 4D96A 3BEOA 1SUDA 2NYUA 4NYIR 4A8PA 4XIYA 2XRFA 1DHRA 2HFJA 3D0OA 3ZQKA 2YZMA 2W6JD 2XODA 5HS4A 2CWWA 2QZZA 2VPPA 5HQTA 3DDZX 1RXEA 1QHIA 1PQWA 3JTEA 3T34A 4I1RA 5JSUA 1WTAA 2PV7A 3DTVD 2B78A 1XA0A 3EVTA 2BFAA 1PRYA 2VPTA 3MNFA 2ZJAA 2GF2A 2J3LA 3GJSA 1WAMA 3IERA 1E66A 2YCBA 3G88A 4B4DA 5DOVA 1H0SA 1U7XA 2QE7A 2W2VA 3WDMA 2PR7A 1IRIA 3G8CA 2ZJ4A 1Z68A 1W9HA 3B3JA 4FGWA 2IYAA 3MQ2A 2FJ0A 2GTHA 3HRKA 4G1FA 3TF5A 4ALMA 1R6BX 1T9ZA 1T5TA 2VTVA 1U8FO 3P20A 2EKQA 3ISVA 4NYMR 2Q5OA 4PCLA 4TYQA 4RELA 2O0HA 1PT7A 2I2CA 3CLUC 4Q4AB 5BV8A 4DYVA 3B9RA 2OMKA 4BNFA 4XQGA 2P2ZA 3DO8A 3IP5A 4BOYA 3BT7A 1EEXB 4G0YA 5AHRA 3FJOA 1D6JA 1TTHA 4RLFA 3AOEA 3OJXA 2B25A 4YN3A 3THWA 1F4VA 3DMFA 1C1XA 4MKZA 3P2YA 1BKYA 3IUSA 3BUSA 2XCLA 2EC5A 2H57A 4N3BA 5AI4A 3VDRA 1XRQA 3I2KA 4NMLA 1MV5A 5EJ7A 4OFBA 4Y9DA 3P94A 3OY2A 1TB4A 2ZUUA 1J7KA 2BI7A 4J0DA 3Q5GA 3W7VA 1CSEE 4QL3A 4BTLA 1F8XA 1OH5A 4N7MA 3N5KA 4WESB 1P7YA 4CVNA 1MF7A 2EHDA 4HX2A 4KN9S 5HMLA 3NHBA 4E1VA 4P58A 3EZ7A 2C78A 2MYNA 4P7FA 2IYNA 3G8DA 4TKMA 1E79A 1JJVA 3A6LA 2B8EA 2HI0A 5EZ5A 1W0KA 2ZZMA 1AXGA 1J42A 1YR6A 4GQBA 4IBOA 2QORA 2QWXA 3CX3A 2CL5A 1Q6ZA 2H16A 4XCXA 4XR9A 1LJUA 4M1YA 1TW2A 1C29B 1O3YA 1WHTA 1UADA 2QSJA 3D3QA 2ZUSA 3TTUA 3UK6A 1CDDA 4I50B 4UUBA 2LE0A 1PCXA 1U2GC 4L5IA 4AN0A 1KOGA 1VG8A 3Q9NA 1G5QA 1RWMA 1MAVA 3RAPR 3W6NA 5L51A 4WKGA 1HOXA 3RT7A 1NRXA 4TKZA 2D7DA 4YRCA 4GEKA 3ENWA 1XMPA 1VCNA 1XK7A 2BVNA 2FLVA 2BBOA 2BFMA 2ZJ0A 4CEIA 3P2EA 5JLAA 2IPLA 2MTBA 1N2OA 5DBIA 1IDN1 1YIDA 3ENQA 4LF8B 3T1HB 3DL0A 1U3UA 2JHPA 1TLTA 4S2UA 2XTMA 4RM2A 5GV7A 4OGLA 4EHAA 3N6RA 1R50A 1ZNYA 2JBAB 2VG8A 1OB2A 2VKQA 2Z04A 2L19A 4EX7A 3H8SA 1HE8B 1ZNZA 1T0PA 1L4YA 5AW5A 2EW8A 3K0EA 4TRJA 3ZLTA 1JYEA 1P1HA 3FFWA 1RWQA 1SVIA 2P9YA 4LDJA 1Z6TA 4NU6A 5CNMA 2NACA 4G4IA 2DUJA 1Y6GA 2V6MA 3IELA 2NZ8A 1CX9B 1U11A 3COWA 3EQZA 4HGRA 3WSTA 4ZEVA 5DM70 3A4TA 2IW3A 3TUZC 3HU2A 2ZAIA 2AFHE 3L4EA 1PVVA 2P3SA 2ZB7A 5E7IA 4YRIA 5HJEA 3I30X 5H8WA 3TQRA 3BICA 1TRHA 1LPMA 1UR5A 2GGSA 3KR1A 3D8BA 5I8ZA 3X2SA 3WRXA 4KPGA 4EHKA 3K6SA 3MTDA 1CPYA 4Z0TA 1AQIA 4BVAA 3CZ5A 4O6VA 4LJ4A 1I6KA 1OSNA 3OWHA 3ELDA 3N75A 4HNGA 4TKUB 2PANA 1XMSA 5EP1A 1YA4A 4A2CA 3BIFA 5FV4A 5ITWA 1P0QA 1Q3KA 2QX6A 1GVNB 4FI3F 5DM60 4Z53A 4ROSA 2FWJA 1CFJA 4QASA 4RK5A 3EBLA 4RD1A 3QSGA 4R5HA 2ZUFA 3MJDA 5EXXA 2AOUB 5DNDA 5IZCC 1PQYA 3KQUA 3CLRD 1A9TA 1NRWA 2SKEA 3O4FA 4JLJA 4L85A 4LTMA 3G8YA 2VOJA 5EXEA 3AUTA 1LF0A 1Y7LA 2ZYVX 1LSOA 1BXRB 2HMYB 5FWAA 1ZD9A 2I2AA 3DBLA 1D8TA 4RK0A 1NC3A 4I36A 4TL8A 2P5YA 3A9UA 1EFDN 4ZARA 3AONB 4IOJA 2OA0A 4V1CB 4POOA 3OZDA 3BWEA 2DUMA 3LT5A 1T8TA 5LXTA 4L3VA 2P4UA 4RQBA 4AS3A 2XIQA 2V7BA 4U2DA 4G4SO 2XUPA 2QVCA 4WK4B 3TDKA 2C3OA 4ZYUA 2ID9A 3THSA 5MDHA 2I1LA 4JKOA 3GJ7A 4RVOA 1J0CA 3OP1A 2CNDA 2C4WA 1JYSA 1LDNA 2A1IA 1XKTA 1JDBC 3D7LA 1RWXA 3IVAA 4OJTA 5AVRA 4XQ9A 3ACCA 3NM6B 1AHNA 1MFPA 5D86A 2DBRA 1NQOA 3GBPA 4FVTA 2Z1NA 5HA5A 3WGJA 1W8IA 1VE1A 1W52X 1M5UA 3NALA 1XHLA 5REQA 3EFHA 1A9XB 3PJGA 3WGIA 3PL5A 1T0BA 1Y8QB 2WJZB 5HK8A 5TC4A 1EXDA 4KIFA 3OEYA 5JISA 2P2CA 2VP0A 1U6IA 3EJWA 3IKTA 2I6XA 2JIQA 4ARVA 1IPHA 2C92A 2ZYUX 2CNWD 4RMJA 2UYCA 3FG9A 3RHTA 1LJ8A 2WZCA 4P84A 3RVDA 1XYYA 4Q4HB 3USCS 2H0QA 4EMTA 2BMAA 4ARZB 5KOIA 1N2CB 3GEBA 2IKQA 1P6UA 1QR2A 3MRXA 4HNTA 1FYFA 3NP9A 3L7KA 2UKDA 1NNLA 5F2EA 5CH8A 3O8QB 4KQXA 4B3TB 3ASYA 2ZS8A 3IP7A 5C5IA 4ZT2A 1ONSA 16PKA 4TTQA 3IQHX 3NIFB 1HDCA 3FDIA 2MCFA 3WYCA 3TW8A 5IRCD 3IMGA 2XT0A 1AKEA 3QYJA 1TIPA 1REQB 4KYVA 3ET4A 1M8KA 3LQQA 4HWGA 2LPMA 1G5FA 2OP0A 1G2QA 1XB2A 1Z0KA 1EXNA 2ERCA 3BGOS 3KQPA 3LP5A 4J49A 3DOUA 2X0EA 3K9BA 3ANSA 4X8LA 5B4TA 5BQPA 3VVBA 3OE7D 1XRRA 1V4NA 2PS0A 3NBKA 1F60A 4RTLA 2H1OA 5FAKA 3LT2A 3OURA 4JLSA 4TWJA 4WQMA 5IHPA 1LS6A 2XGGA 3GLKA 3SC3A 3W5DA 4O2LA 2Q6TA 4NSNA 4XIFA 1M6EX 1ZSYA 1V6SA 4JASB 3U3ZA 2GQ0A 4QUJA 1RAEA 1TMKA 4R8MA 5JLJA 5LR6A 1ACLA 2WFZA 2AMLA 4FQ7A 5G02A 1FFEA 2Q1SA 1Y8ZA 5L3ZA 5JS6A 1T5OA 2IHKA 4O2AB 1G55A 1U3TA 1RLJA 1Z33A 3GLHE 1GXSB 2AOVA 2H11A 3JARA 1KVTA 4QJBA 2O19A 1G3RA 1DLJA 3O7WA 3U3JA 3BMNA 4YCJA 1GYRA 4EVSA 1WHSB 1YK1A 4JGGA 3TRFA 3ZDAA 3QUSA 3FNQA 4V0KA 5CB6A 4LZAA 1ZGCA 3PPIA 4LQDA 4LGYA 5AUQA 5K8JB 1F8FA 1R18A 1UK9A 2G0TA 2RK4A 5KHOC 1CXZA 1QYWA 1RDFA 4U2FA 4LCBA 4YJHA 5DCWA 3HA2A 1MX3A 1IWPB 2OZPA 3FYTA 4IUDS 3SQMA 1HQDA 1N3IA 4EJSB 2Q2WA 2OUKA 1PUIA 2VA9A 3K2QA 3DWEX 2OZKA 1YDEA 3ZIAA 3TLEA 2BSAA 4HGZA 3N2LA 4BXOA 4CMCA 1RWNA 4DWJA 4F06A 5CVTA 2EKLA 5DNUA 2NV2B 2MDTA 4LUCA 4YMGA 2AC7A 3K1AA 5A2GA 1NE2A 3MTEA 3G59A 1NMXA 1EEHA 4PX5A 4RKQA 2H2GA 1Z7BA 5DZSA 3MLAA 1MN6A 2GWRA 1LVUA 2HK8A 1H1DA 4L74A 4Y2RA 1IXKA 1DDOA 1V7QA 3NM5A 5KWSA 1FDTA 4C0KA 2BGWA 1AKNA 2Q3DA 1MIHA 3CNLA 4K9DA 4LC9A 1XK6A 1ZNQO 4B74A 5EZYF 1DCFA 3CW8X 3IVCA 4CKEB 4KR9A 5K2MA 1RPAA 2QAJA 4MI3A 5B6JA 2GPNA 3RAEC 2HU8A 2YWXA 3NWOA 4XWKA 3X1DA 2ACKA 4YR9A 5SZKB 1OWLA 1E1LA 1JFRA 5TMEA 1BGXT 4RWZA 1R6VA 2QNIA 4Z4HA 1BDHA 1EGVB 3ZXYA 3VOTA 5JS8A 2NP7A 2ZROA 4JDUA 2WPDD 3H3JA 1D0IA 3DLAA 2Q5JA 2F1KA 4QDUA 4AULA 3BSWA 2ZJ7A 4DQ0A 4MRVA 3UMSA 1BMFA 5AICA 2X76A 2ZSIA 4QBKA 5TLSA 2RH9B 2LP4Y 2ZVJA 5JI2E 2WKSA 1ZA1A 3T0FA 4HSGA 3G23A 1MORA 4FSHA 4IOKA 4Q3OA 3FPCA 1QIDA 3NDBB 4MQEB 1DMSA 1KQ3A 3Q6NA 4MUNA 2VHVA 1I1HA 3ZV3A 1RRPA 3ZZ0A 1H4TA 4X1KA 4DPLA 5KREA 2VQ3A 1XVIA 3F2IA 1K6IA 3EK2A 4AF8A 1R8QA 1K9SA 2J9RA 2O7SA 1U8UA 4R8VA 3TPFA 2O8CB 5CFZA 1W2HA 4QOSA 1KI6A 4B6OA 1P80A 1JIXA 1MENA 3K1JA 4MZXA 5P8WA 4CKXA 4C7VA 5IC4A 1P1RA 4K6HA 4DMMA 4EF5A 1YOBA 1RABA 1Y7PA 3R0IA 5FTMA 4PE5B 1Q5PA 4K3UA 5DHFA 4CL3A 2Q4EA 2X4IA 2FR1A 1RFGE 3W6ZA 4ND2A 3RC1A 4ER5A 3WDLA 4XLLA 4CIWA 4DIEA 4YRMA 1VPEA 1O8CA 2IWHA 3R9XB 4B3DA 4KOAA 3A8TA 3M3DA 1CZRA 1R0KA 3AOGA 3WI7A 3ETNA 4GUDA 1NN1A 3LUGA 5KJFA 1VJTA 1M7HA 2ZJ1A 5FD8A 1HMPA 2XZPA 3DM5A 1ILWA 4WY5A 5HM8A 1DELA 2UVDA 5D5QA 2FWMX 3FTFA 2DY1A 3KPWA 1I33A 3CIOA 4Q93A 3DVAA 4KVAA 5FRDA 1GTL1 1X1SA 3WO1A 1NBMD 4DT1B 4FP9A 4W6ZA 1ODKA 2JA1A 2NUTB 3D4LA 3R5TA 3DAYA 3PQDA 2COUA 5TJHA 3Q40A 3RO7A 3OUUA 2LKDA 3GFRA 3AR4A 2H5EA 1US8A 1BWRA 4MYRA 1Y48E 5KX5F 1Z7GA 1MR3F 2ZVQX 2JAQA 4JLKA 5J2UA 4R1NA 5F77A 5GJWC 3ZWOA 3RYHA 1WBJB 3OF2A 4CL0A 2JH9A 3ZNQA 1AK1A 2X23A 1FLVA 3QVKA 3EEBA 4FIDA 4TMKA 1NPDA 3PX2A 4RF2A 3V6LA 3WMWA 4EB6A 1YQXA 3KCNA 3KJZA 2CCGA 3EXHC 5C8YA 4LXHA 4R1OA 4EO7A 4GKKB 4IRMA 1MA3A 4JL8A 5JJKA 1U8EA 1WO8A 3CONA 3O47A 3R74A 2QVGA 1JILA 1G9TA 1X0VA 2CVPA 2FUNB 3QITA 2OENG 2FPGB 3ZY3A 3HZRA 5EI5A 2E85A 3LSTA 4QRIA 4DANA 5HKOA 2A5JA 4C0SA 2HEGA 1QRAA 2KLHA 4RHXA 2AG0A 4N76A 2G40A 2N1BA 2B6NA 3S2FA 3NTLA 3AFIA 3C6XA 1CUIA 4W1QA 2GD1O 1BX3A 4IS2A 4FHDA 4FS3A 2NV0A 4UEQA 3M0EA 4YAFA 3RRXA 5EEHA 2FX5A 3EG9B 2YWJA 3RYIA 1GPKA 2XCOA 1IE3A 2LRHA 4HNUA 4WH0A 1KDOA 3MWFA 5JD4A 4D5GA 1U7OA 1VRCA 3GLFA 5B37A 5IH3A 3ND7A 2PSDA 1NU6A 1ZQ1A 3FVRA 4GBMA 3FNGA 4ZI2A 4Z5XA 3ZZ1A 2FPUA 3ZN2A 4LZOA 2VI5A 3PHGA 3T3GA 1PWYE 5FYQA 1E1MA 4H1VA 3OM0A 1Y8RA 4ONEA 5ALWA 4M0FA 1ZRSA 2V9CA 5E7JA 1O8BA 1E58A 3HCPA 4RULA 5EINA 4QVGA 2VTDA 4DDTA 1RYYA 2GILA 1YASA 3E7XA 2ONJA 2O7QA 3A4MA 4PYIA 3I8XA 2QL5A 1X1CA 3K96A 3UWKA 1YFZA 3FZQA 4KQJA 2C4UA 4MEAA 5I6DA 4U2EA 1OGIA 4IXDA 1Z7YA 2EARA 1O03A 1QB8A 4TN1A 2ORYA 5GJVC 2B37A 5B3KA 5IK2D 1TFRA 5HXAA 2NQ2C 2YY5A 1XAIA 4HLNA 5DEOA 1SELA 4GRIA 1QFZA 2PL1A 2GI4A 2GK7A 1QFXA 2XA1A 2ZI3A 3FRHA 5F76A 3FVWA 3ZYZA 2QUKA 1QHNA 4GGMX 1B93A 2RGNC 1CF4A 4HFJA 3MELA 5F1OA 4E07A 5IUNC 5KOJA 3RRJA 2BGTA 1VCIA 3MWYW 5U1PA 3I45A 1K63A 2OGSA 3JTMA 4BRZA 1VBNA 1LKZA 4RPIA 2EX1A 4F5EA 3OOWA 4B6QA 3P4XA 4DB2A 1MW9X 3C3BA 1EESA 4WOPA 3PU6A 1FMCA 2WSLA 4S1VA 2LVBA 3A1VA 4CW7A 1IH8A 5FL3A 5EQFA 2NPOA 2ZYWX 5DRTA 1E2DA 5HEKA 3BWVA 4DWVA 3I5XA 4OXKA 2BM1A 2VK1A 1CUZA 4PYRA 3UBTA 3QWBA 4GZ6A 1NXXA 3K5WA 1S01A 3FBGA 1QP8A 3VR5A 2AMJA 3WP1B 3MERA 3IQFA 5KNCA 1ZL2A 2W5UA 3AWDA 5KKNB 1UFQA 4PFKA 3L0IB 5BN4A 1PJSA 4R1QA 3W5IA 1PS0A 1ZISA 3PNVA 3UB4A 5A9RA 2C59A 2XGSA 2ACWA 3X1ZA 3LYUA 3ZHVA 4FIZA 1I7QB 4RKRA 1U9YA 1SXJE 3QKUA 3ZOZA 4WDQA 1HI9A 4E2ZA 1C4OA 3CUEF 2I3DA 1CEXA 2V9ZA 5ENDA 3M9XA 2W8BB 3OEHA 4X1YA 5JTTA 1F8UA 4KO1S 1MAWA 1YDHA 1N0UA 4PRYA 3VR6H 1XD9A 3A4LA 3GI1A 1UAYA 2BP7B 3WDKA 4YHHB 1QK4A 4MVYA 5H02A 4TT3D 3FR8A 2PRIA 2GETA 3UAOA 4QTTB 2JHCA 4C4TA 1I6WA 2O8FA 4FDVA 1YQQA 2H2IA 4J2OA 3Q2OA 1GAWA 1NUHA 4HAUA 4IO0A 5BSWA 2DR2A 2PKXA 4FEYA 3WLNA 3CT6A 1SC3A 3SJUA 1OLXA 1F4PA 5THXA 4X65B 1UZLA 2D0PB 2HDHA 2HBZA 3K6RA 4GZ3A 3S1AB 1SO8A 1YAHA 3GA5A 3N59A 4ESOA 1DP4A 4JKYA 5CJJA 2FPLA 1EP1B 4J2HA 5B2FA 1I4EB 3BL6A 1IM2A 3H5IA 3E5RA 3KTDA 2ZT5A 3OQBA 4HDMA 3W8DA 2O48X 4YJ3B 2XUFA 3M1AA 3OPQA 3FIJA 2OHOA 2OXRA 3JWJA 2B8TA 2PFGA 3IHWA 4CEHA 4HR7A 4Z0PA 3NC0C 4KDFA 2EX4A 3PCTA 5K0JA 2NO1A 3DBRB 1OBHA 1JXMA 1RKQA 4J0CA 1KJWA 2IDKA 4ZAYA 3RBXA 1B16A 4TOIA 1M2EA 2JGLA 5FHRA 3WIBA 3A9TA 3E9YA 3KM0A 3RGGA 3Q8MA 3QVLA 4NNOA 4PGMA 1E1KA 4K7JA 3KJQA 2BF4A 1BN6A 3F4BA 3JQ7A 1F3LA 1KI9A 3NKLA 1WEHA 3HBFA 3TO5A 2B1QA 1PEYA 4KZPA 3ORYA 4JLBA 3F7NA 4PM4A 2EJTA 3N7UA 2JIOA 4D46A 1SK8A 2B0CA 2GAIA 1AK2A 4CIAA 2XBLA 3AHHA 4BNJA 4B4OA 4CDRA 4DZRA 1GU0A 4PRZA 4C04A 2H08A 3ZW9A 4DSTA 2EG5A 1YMQA 3E4CA 1K7EB 1DCMA 1IQPA 1L7NA 3F2VA 3RF6A 2ZYDA 4MDEA 3EUEA 5FA5A 2D5LA 2HWYA 4A6DA 2ODTX 1XZQA 4XM1A 4Q9IA 1CULC 2PH7A 4QBTA 2NX2A 1G41A 4WZAA 2GARA 1M9NA 4CMEA 2QMHA 4K2AA 3TZHA 1P61B 1JDSA 5LQSA 3P2IA 4OXIA 1GDTA 2WHYA 3UV7A 4YCLA 3G2LA 3NVDA 1CNEA 4QDTA 1PP4A 5AKEA 5HE9A 2QZJA 3Q9UA 2GD6A 3HJRA 1GGNA 4RXMA 1BHQ1 5ESXA 2NTNA 1N78A 4FB4A 2F9LA 2FQWA 1OH7A 4IGKA 2AI3A 2GTIA 4EMBA 1W9MA 4WY8A 5F21A 5F33A 1DZ3A 2MT9A 3S8EA 3HE3A 1RWKA 3D8RA 4HQ6A 4TMVA 5AHKA 2G0NA 3PLNA 2X9QA 1TVKA 2XYHA 1VLQA 4ADSG 4X41A 5BYKA 1NATA 2FUKA 5COBA 1T1GA 1GZUA 3GT0A 1NQWA 2BJWA 3RTEA 2MR5A 2JGDB 3Q15C 3AHFA 1NW5A 3AVWA 1D5WA 1MIOA 4MEJA 5AVYA 1NFFA 2BFFB 4OQMA 1CS0B 1R66A 4CCYB 1DLIA 1OIVA 4EVQA 4F8EA 1Q7EA 3SX0A 1DKNA 1XAGA 1SD2A 4TV8A 1DIBA 4YRRA 3UGJA 4O8CA 3H11B 3QYAA 5LBTA 2CZGA 4QPCA 2MYUA 4AL4A 5BR4A 1U2ZA 1FRZA 1XTUA 4PQEA 4PNZA 2AH5A 2J6HA 2ZW9A 4DJEC 2NYVA 4IJKA 4OY3A 2QUJA 2VZ9A 2OBLA 5AT1A 4B4VA 4YXWD 3RR2A 1PE0A 2OZEA 1Q77A 3HYLA 1MAUA 2OK8A 1I24A 1PO7A 1OV6A 2NPFA 2P77A 2QRKA 5JJIA 3PR3A 3X43A 1WD5A 4F1WA 3AHIA 4HEJA 3K5HA 4QQFA 2CMHA 3E1KA 3HN7A 1G8SA 3V8VA 4R2XA 2GAOA 1BD3A 1GN9A 2E55A 5L3QB 1W0JD 3LMKA 3B7GA 3ZDBA 3W4KA 2PLFA 3SS7X 4X1IB 5ALNA 1GYQA 1NNSA 2YHSA 4MV5A 1SCBA 1XF9A 3FMVA 1PQ4A 2PYZA 4TZKA 3TJMA 4J1TA 3EUWA 3I4LA 3VBEA 2R84A 5IVIA 3BZBA 1J1IA 1R16A 2HQ1A 2PV0A 2QRQA 3F47A 4E21A 3NONA 5AK4A 3VXKA 1EE9A 4ESEA 5LWQA 4UOZA 4JIMA 1GU7A 1L5LA 2P65A 1J5EB 4QEZA 3LV8A 3KT3A 3A1SA 3O75A 4QPDA 3UG7A 4C0WA 1KPIA 2HV9A 2UUPA 2UZ1A 1YOVB 4WFKA 4E11A 2B83A 4BYGA 1TT7A 4P2GA 1JPNA 2UZ3A 3LTEA 4MVJD 4WEOA 3EOBI 3IULA 4KQCA 2A9FA 3NDJA 2PBZA 3NV9A 5CK5A 3RVPA 3DXYA 1NJSA 2GNAA 3S27A 5CGZA 1N6IA 3RS2A 2Q6IA 1YJ5A 3MLEA 3C70A 4MPJA 2MINA 1GKLA 1V8ZA 4GI1A 2FTKE 1X7DA 2BFNA 3L46A 3RDPA 1SH7A 2CXSA 3GMTA 1E6KA 1ESMA 1GZ3A 2AHRA 2Q7DA 4BUJA 1YZUA 4WRRA 5JR3A 2ZRFA 3UF0A 3EIUA 3L6RA 2DTDA 4YMIA 1KBOA 2CB0A 4RFVA 5DP2A 2M6LA 1ZN2A 2B92A 3NRCA 4JLUA 3WQSB 3PWZA 5JCPA 5BQXA 3BEDA 3DL2A 1P60A 3SEAA 3AEZA 3CXRA 1T5DX 3HDJA 3T54A 3WG9A 4BRUA 1A8IA 4CNBA 3BB4A 3R7AA 5TPWA 3SHFA 2D2IA 4JJFA 1ADFA 2Z1DA 1KZ9A 2HLPA 4ZZ1A 1EJ2A 1G7RA 1N2EA 2NV6A 2YNMA 1N8TA 2JZOA 3EEIA 1RACA 5ERXA 2FB9A 3PE3A 4NG4A 5CIWA 1UEXC 5J59A 1G21A 1O57A 1ZHOA 5MF6A 1JLSA 1I4DD 2VBFA 3FZGA 3ZYCA 4A3SA 1IY1A 2IX9A 3A2LA 3I8SA 4BX2A 3RU9A 1C7ZA 3NAQA 3KUUA 3EGXB 2OBYA 3ACBA 2CV1A 1DV1A 1X74A 3B2QA 5JYEA 4YDRA 1X9IA 3BB1A 1HNZB 3JQGA 3RHFA 4TMWA 4GX2A 1YB6A 4I1UA 1GUYA 4FC7A 2WIGA 3F6EX 4L7VA 3CNOA 3RODA 5I7RA 5EP3A 5AR1A 1JI0A 3A1TA 1RHKA 1GZ5A 4G0WA 1SHKA 1FP1D 3EEFA 1EFPB 4M4SA 2PYIA 5A0VA 5B7NA 1M72A 1ORDA 1UFRA 2HWXA 1VGRA 3RASA 4IDNA 3IJ5A 2VHXA 4FD3A 4OSOA 1F2TA 4HPJB 4HXEB 1Z8HA 3JVEA 3W2EA 1T5IA 1IU9A 2FFJA 3C6BA 4KIJA 3RB8A 1WZNA 2ZDQA 4RFSA 3IDOA 4FFBA 3QV2A 2CLEB 3S68A 4A1OA 1WPXA 3RK0A 5EUMA 4AQDA 4HAIA 1DTWB 4TV9A 5DX1A 4ZI3A 5AW9A 1O6ZA 2G4LA 3N2GB 4JT8A 3QU7A 3I9MA 5FTWA 2E1PA 3A1FA 4PO9A 2YQZA 1VHLA 3D1JA 2TYSB 4GPIB 1TL7C 4BJ6A 3BHMA 5BRNA 3RU7A 4XVUA 3KP1A 2D8MA 1LV8A 2I2XB 3JCZA 2FZCA 4OJKA 1XDDA 3UCFA 1W85B 3KHUA 1E1RA 2OOSA 3ZWQA 1ZMRA 3EDOA 4YQFA 2P7HA 3GLIE 1N9GB 3S2YA 2OC4A 1XWIA 3OAAA 1YJ8A 4NXNB 3JQPA 3WBKA 2AXNA 1QHFA 3DFFA 4L8GA 3BFXA 4QWMA 5F7OA 2A59A 5LZ9A 5KYXB 3ZXXA 1QGUA 3PHLA 4I4TF 2XRYA 4HEHA 3L7JA 3I9NA 4ZVLA 4EG5A 2VDJA 3F7OA 4G0ZA 3BAFA 4RKWA 1T8PA 1E4VA 4B9EA 1CQPA 2I1WA 2Q1YA 4EY4A 3C3DA 5DM0A 3CX6A 2GNPA 2B1RA 4YX9A 3JAWA 3GUZA 2R5WA 1E9FA 2SECE 2JAXA 1P7WA 2YN4A 3GFTA 4XAQA 3COVA 5TEWA 3E05A 3V34A 1GLGA 1P1FA 2H0RA 1T9CA 5BMVA 4RH3A 3IQGX 3E35A 1G20E 1RBMA 2BDEA 2FSIA 3CH4B 4M9RA 4EW2A 2GX6A 2ZM6B 4RVFA 3E9NA 3G49A 3AEKA 4PWYA 2A9KA 1VDMA 3EA0A 3R0XA 3II6X 4L27A 3GAZA 3W1WA 1C9KA 4BECA 3NHPA 3QTLA 3KUXA 2A0UA 1VL2A 4PIPA 1J2TA 4BFLA 5JXHA 4IOLA 2DETA 4ME6A 3R20A 3ETHA 2AWNA 4G1EB 2IPOA 2RKWA 3FYHA 3NTVA 5SY4A 3UAGA 5B3LA 1N5OX 4ZCLA 2ZIGA 3CLHA 4H4DA 3D3JA 3HR7A 4OHZA 4HUQA 1OH8A 5JZ9A 1G9XA 1NZFA 2FG6C 2M9MA 1JFFB 2G8LA 1UDCA 3U26A 3AJEA 1YE8A 2VJDA 1EQUA 3PR2B 1XVVA 4JI7B 3WXMA 1X7HA 4MV6A 3EFOA 3H1EA 5E95A 2OCBA 3V42A 3OE1A 2X5NA 3OIUA 1KI8A 2MSCB 4QYTA 2IEAA 4CMKA 1G60A 1MAAA 2AJCA 4NZMA 4F2PA 2FEPA 5IBPA 5GVSA 4CFZA 4QOEA 1H22A 3T9EA 1JI3A 2OHFA 3JR3A 1E2PA 1T6XA 2YJ3A 5BT9A 5A3JA 1C80A 1XIVA 4E5KA 1X42A 4OATA 2Z5GA 1E1QA 2WU8A 3N39C 2DQSA 3FPFA 4WXMA 2GKOA 1UF9A 2O8VA 3JZAA 4TZTA 4PAOA 4V0ME 2O8EA 3KYBA 1FDRA 4FR0A 1Q0UA 4K05A 3W8EA 2ZXEA 3WL3A 4JITA 3UMCA 4A36A 2HHLA 4MIKA 1UPXA 1GT6A 3OQOA 3CJTA 4UVEA 4RJJA 5H7XA 2CNLA 1FNNA 3H84A 1EPUA 3GEPA 1SOUA 1TGVA 3GL9A 5AW6A 1IFXA 3GZTB 1UT6A 3HVJA 5D00A 3A36A 4OI4A 1HYBA 1PR4A 4TVKA 5K3FB 3TVYA 5DI9A 2B8WA 3WHKA 5KC8A 1BA3A 3OZSA 4RU1A 4TSRA 2XVXA 1YB4A 1U5AA 1JDVA 1V0JA 2OXCA 1P0IA 2AZMA 2GJSA 2H1RA 3PR1A 1Y37A 2VLIA 3MA0A 3OTQA 3R3HA 4FZ5A 2B34A 4I5FA 4HHEA 4DNXA 1S2GA 1NP7A 2BKXA 1J5PA 4RQUA 5JAQA 3PEYA 4XKJA 2JLAA 4ZA2A 3ROFA 2GXSA 1YQGA 2QRPA 3OG9A 1BS1A 2OT3B 4MW5A 3QWIA 5ISMA 3MPOA 3HPRA 4LJ7A 4NV3A 3Q10A 3RV4A 4AYWA 1H8EA 1XKXA 3MVEA 1AHPA 4NFSA 1AD2A 1XPUA 3OJCA 5EOVA 1UJ6A 2DQ4A 1F4LA 1W47A 4ZPJA 3FNFA 3V32A 4MTCA 3G5UA 1R9GA 2C7OA 5G0SA 3KEOA 2BC9A 4M53A 1O6GA 4PTYA 3TEJA 4OK5A 5I4CA 1QO9A 1GWNA 1PLKA 2FUCA 5B1DA 4DCCA 4ER6A 2OL4A 1CJBA 2EBFX 1GR1A 1XP8A 1KMIY 2BOVA 2Q1UA 2X3YA 3GDWA 3L1HA 4BYMA 4OAQA 4BLSA 2CN1A 4LYGA 2FA9A 2IXBA 2GCEA 2EF0A 3FROA 4O2BF 1CF9A 1H0HA 4BL5A 1ZJ4A 1C2YA 1U4SA 4JR1A 3WIDA 1KBZA 1E77A 3JSXA 3FWPA 1UZUA 2GJKA 2JK1A 3V8QA 3OZ7A 5FPYA 2PMWB 1DAOA 2F67A 5IXSA 4FGLA 2ET6A 4GP6A 3A6FA 1QFMA 3SXJA 5TR9A 4GRDA 4YDQA 1KMHA 1BVRA 1L4FA 3SLKA 3RFVA 1TTTA 4U2GA 3A1NA 4DUGA 4B4KA 1E9VA 2PZEA 3LQFA 4MRNA 2I3GA 5TPZA 4EQ6B 4OJYA 1Z47A 3P7MA 1TADA 1YI8A 3L7LA 4RPJA 2A1UB 2FZWA 2CVOA 4E5DA 4U2BA 2ATEA 2HA6A 3I05A 2H0AA 1DXYA 3I1IA 1C1DB 3M5PA 3GQBB 2YL2A 4MV1A 1AUPA 2X0DA 1XC7A 4WADA 4EHNA 1PWEA 3PXEA 3TFQA 5AOBA 1IZZA 3FCOA 1J21A 1YUNA 1EJ0A 3QEJA 2CUZA 1A04A 1V6AA 2BHRA 4TRMA 3SQLA 4CQJA 3OLYA 5IBCA 3ZUGA 1OB5A 1HMYA 3HXTA 1C9YA 4GXTA 4C1BA 4EFKA 1BGWA 4PZYA 5DBHX 3FX2A 3NT4A 1CLEA 1VPTA 1Z4IA 2HSJA 3CUSA 4W5RA 2XUKA 3TZCA 1V7PC 1L5YA 4G9BA 1LS1A 5C1OA 1ESEA 1SB8A 1SMKA 2B0JA 2VZEA 1YQUA 1NTRA 2ON6A 1EFKA 2ZBFA 3FHCB 4EDFA 1HFJA 3IDZA 4NYJR 2DB3A 1GNLA 1RPZA 1DG3A 3ZIDA 4PZAA 2P3LA 3ROGA 4A0HA 4HAWA 1YC5A 2YV2A 3H1TA 2JAOA 3DOFA 1XJCA 3R41A 4JL5A 1JZTA 4IV8A 3CS3A 4ZU6X 3D4IA 1J07A 2X9GA 2NU9B 3OM1A 3J80A 5K0ZA 4J0FA 3KZMA 5JHGB 3DE4X 2BFWA 5HMMA 3V7UA 1LB1B 3F5DA 2A33A 2PO7A 3ZWWA 1R00A 5ALVA 3HMQA 1OV4A 1PJ8A 1YUMA 3CRW1 1JFTA 3VPDA 3GVHA 1RAIA 3P9ZA 3TZQA 3G0CA 5ELXA 4F2HA 3GUUA 3I5AA 4P92A 1F14A 5DE3A 2W0MA 2NXNA 4CQLA 2P67A 2HTEA 4KAAA 1MXFA 2UU9B 4M0CA 3QLTA 3WGLA 3BK2A 4V02A 1P0CA 2RGYA 3EAFA 3F7MA 1C0IA 4Q37A 3T7RA 3WWOA 4CEJB 1QYVA 1LWNA 3TJRA 4Q1FA 1DT3A 2BFCA 1NXPA 3OJWA 3ZD9A 2NVOA 1EE1A 1L7OA 2WU0A 3HKCA 1YVRA 3GMSA 1MAHA 3W78A 1TCUA 3DWFA 4F9EA 1JLRA 2I6TA 4A92A 3L6EA 1D1QA 2MSDB 2OORC 2GRAA 3ONVA 1YFLA 3DBVO 2Q2QA 3AEXA 3NC4A 5JZVA 1QBKC 2WG0A 5GONB 4BNXA 3QE3A 4DKXA 4GLFA 2PGLA 1UWVA 1F6DA 2HSGA 2G5PA 4NR0A 3NHLA 4E88A 5KTNA 5J2TA 2CFTA 5C8ZA 5F9FA 2R1UA 1RCFA 3AY0A 1RBQA 2QL7A 1JSCA 2RAUA 1E8DA 1QHSA 3ABZA 1KIMA 3EVAA 1QE3A 1JDZA 2GCOA 3FCEA 3D2BA 1ATIA 4P3KA 4WPGA 3BC1A 2JLZA 1CS4C 4YTEA 1X1DA 2GCIA 1Q44A 2DVMA 2Q5QA 3Q2IA 5ESRA 5LJIA 1U1GA 3HGTA 3UWPA 3R0ZA 2A5FA 4L50A 4OIFA 4BKQA 3P45A 3T1NA 5C80A 2PKQP 1NF3A 1XJ5A 3F96A 2P91A 3FWKA 5IN5A 2VYNA 1T3TA 1ZITA 3WL7A 4AP6A 1PS8A 1CHNA 2FQYA 3SYKA 3W2FA 3QMMA 4C0QC 3HEAA 1IHOA 3N76A 1U0TA 4RPGA 4V0RA 1G8HA 3MT0A 1TDJA 3DZJA 4EG8A 4YRFA 2DTXA 2Z9BA 3AP1A 1Z29A 1I30A 1NAHA 5F12A 2IGTA 1Q1NA 2YIMA 4K6OA 1QGOA 4FCTA 2JJ1A 1B76A 1NZJA 1OIWA 2HO4A 4HWRA 3BJEA 2JAWA 5CT8A 2DJ5A 4KRGA 1XCBA 4Z8YA 3CGGA 3R2JA 3IEIA 1YU6A 2CJWA 3G2PA 4UCFA 2XZLA 1KO7A 4CF3A 2G77B 2PH5A 5GAJA 3UV3A 2QAGB 2CY0A 4YT5A 1QONA 3DCYA 3PP8A 4J0IA 4B9AA 4BEJA 4YFYA 3G0GA 4KLZA 4I2VA 4GX0A 1JLLA 1H6BA 1TQDA 3LVQE 1XAJA 4RC9A 4B8WA 1CUVA 4GLJA 4Y9TA 3F5FA 3ETJA 1NONA 3A6DA 2IEBA 4U00A 4M9QA 1I2DA 1BCRA 3JD2A 4H0FA 2YY6A 4REMA 1QVZA 2FH5B 3KEGA 3I3SR 5LDHA 1E5XA 4M0MA 1GILA 2C5BA 5I7EA 3INRA 5T6BA 2BGUA 3LT0A 3B53X 1WMBA 3IAS1 2ZB2A