1C81A

Michaelis complex of fructose-2,6-bisphosphatase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
191
structure length
191
Chain Sequence
MRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FRUCTOSE-2,6-BISPHOSPHATASE
publication title Reaction Mechanism of Fructose-2,6-bisphosphatase Suggested by the Crystal Structures of a pseudo-Michaelis complex and Metabolite Complexes
rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 60
structure length 191
sequence length 191
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1c81A00
3GW8A 3LL4A 4MA4A 3QPUA 2F90A 4D4JA 4ARVA 2P79A 2YN0A 1H2FA 2HIAA 3OI7A 3C7TA 2HHJA 3FDZA 3HJGA 4JOCA 4GPIB 5AK0A 1QWOA 3QPVA 1BQ3A 3GP5A 1FBTA 5PGMA 2P9FA 1TIPA 2DWOA 3NTLA 1QFXA 2H0QA 3PGMA 3NFYA 5AJVB 2ENUA 3E9DA 1ND6A 5AJXA 1RPTA 3F2IA 3K4QA 1FZTA 4D4KA 3R7AA 4HBZA 2P6OA 2P30A 1UJBA 3IT2A 3QPWA 3ZHCA 1C80A 2EKZA 3IT1A 4GPZA 1V37A 1E59A 1E58A 5CX4A 3E9CA 3FJYA 3DB1A 4PZAA 2A9JA 2PA0A 1DKQA 1BQ4A 4IJ6A 1IHPA 1YFKA 3MBKA 2H4XA 3E9EA 4ODIA 3EZNA 4JODA 4EMBA 4PZ9A 2P6MA 1NT4A 3O0TA 1QHFA 1SK9A 4FDUA 2DWPA 2AXNA 5CU7A 2HPAA 3D8HA 5AJYA 5CDHA 3D4IA 2I1VB 3EOZA 3D6AA 1DKPA 2P9ZA 1CVIA 1UJCA 4TSRA 4ARUA 4D4MA 4E3WA 2P78A 2YN2A 5HR5A 2WNIA 3KKKA 1C7ZA 2A6PA 2EKBA 2P75A 2GFIA 3FDZB 1SKAA 2P2YA 2ENWA 1SK8A 2OWEA 2EOAA 2WU0A 3MXOA 2WNHA 2BIFA 2H4ZA 1K6MA 3IT0A 5AJWA 2OWDA 3DCYA 3BIFA 4PGMA 3K4PA 4QIHA 1T8PA 1DKMA 1DKLA 3GP3A 3LG2A 4EO9A 1BIFA 2P9YA 1YJXA 1C81A 2QNIA 1RPAA 2P2ZA 5AJZA 2P77A 2H52A 5HTKA 1H2EA 4IJ5A 1DKNA 1RIIA 4ARSA 4AROA 1SKBA 1V7QA 3LNTA 4FDTA 3F3KA 1XQ9A 1EBBA 4JOBA 2RFLA 1ND5A 3IT3A 4D4LA 1DKOA 2IKQA
chains in the Genus database with same CATH superfamily
3AR2A 4MS4A 4G41A 2PRSA 2ZBGA 3EA4A 1WOMA 3FUXA 1X8JA 3EE6A 3F3YA 3OPMA 3QH4A 5LB4A 4CPDA 1TFUA 1FFXA 2FG6C 2PX0A 1QQ5A 1TVMA 2PGXA 3AR4A 4B83A 3ONEA 3VFDA 4ARBA 1RS0A 5DW3A 4QOSA 4L5JA 3GJ8A 5H9WA 2J08A 5AI9A 5HGJA 3C5WP 1UOEA 2LW7A 4XVUA 1GT91 2I0FA 4HQNA 1R4AA 3WGNA 4CL8A 1SM4A 1ZK0A 1GQYA 2OBBA 1ZK4A 3UOGA 1BOFA 1T13A 3ZHVA 3ZDBA 2H0QA 4Y2HA 3HG7A 3PGMA 1KHHA 3BTOA 3Q72A 1FL9A 1TM5E 4K5QA 4K9NA 5AVKA 3S1AB 5CNMA 2PCJA 3BMNB 3AVOA 3IO3A 3ITEA 4REOA 1KK2A 2Z3ZA 2AF4C 4PC6A 3CUUA 2I65A 3RS2A 1G8SA 1NVVR 3AUYA 1QH8A 4IZOA 2AUMA 1RCTE 2EFYA 2WP8J 4ZDWA 4M21A 5CB6A 3ED1A 3SVZA 3DBLA 3SBXA 2ZTLA 1W4LA 1DE0A 5A5VA 5I3ZA 1J7JA 5AVOA 3PV0A 2FMTA 2JGDB 2Q1YA 2XKKA 2QRKA 1Q12A 2PZJA 3BGSA 4DLSA 3ADKA 3ICPA 3RVMA 3DOCA 4UTXA 2VDNB 1VP9A 3SCZA 1W44A 2YX1A 2O48X 3E5MA 3TB4A 3Q7QA 4DV2B 4J2HA 1Q1NA 3HKDB 1RQXA 2EBFX 2UZ1A 2H1SA 3KUKA 2CL7X 2HV8A 4NONA 4RS3A 4YAWA 5GONF 1PTKA 3EZFA 2PUHA 1P1RA 2O0KA 3A1CA 5E3HA 3GA7A 4L5AA 3WRYC 1LX6A 2NP6A 1U0RA 4RDIA 5MFZA 1R9MA 4BX2A 5L9AA 2G7ZA 3ANXA 4P7JA 5IJWA 3I73A 1Y7HA 2QTFA 3IQFA 4YJGB 4AS1A 1KQNA 4F9TA 1DBIA 4BPRA 1PNQA 4EB0A 4R1MA 1PFVA 4O59O 4PX5A 4F2WA 5K3EA 3CVYA 1RWXA 3B60A 2A1IA 5J5VA 1JV2B 1AXGA 1QPBA 2VHJA 2WE8A 1LNQA 421PA 3ZX4A 5K8CA 1YO6A 4ZCRA 3QSGA 3UJNA 1TAQA 4IFIA 3LBHA 4MW4A 5C7YA 1FTNA 3DMPA 3WZMA 5LM3A 3PT9A 4JUDX 5LOVA 5BXYA 3ZV4A 1U0FA 1J06A 3M9LA 4MW7A 1XCOA 2BZ1A 2CJYA 2QORA 5CLGA 3LCVB 4B3MB 1YVPA 2HMSA 3P26A 3X2EA 4DIDA 3TNLA 1C2YA 2Z2YA 1J0CA 1T9DA 1NXPA 1PR9A 1TI7A 2GBPA 3KSRA 4KUGA 1UBGA 3GVCA 2OK7A 4MKZA 4L8GA 2PZAA 4GX0A 3STYA 4PPGA 3BH7A 4L7QA 3TBFA 5B57C 1JEEA 3MOSA 4E1BA 4CTMA 3ZI0A 2VQFB 2ZAGA 1UQRA 5DGDA 4EJ2A 3OOHA 3AUFA 5H4HA 4X64B 1EGVB 2WM9B 3C45A 2QD2A 2JI8A 2R44A 2XGGA 3IEIA 3LFUA 4KAXA 4M60A 5AOCA 1AKRA 1U2ZA 1I0IA 1D1TA 2K2WA 1BCSB 1R9GA 3KJQA 4K9KA 4RIIA 1JB9A 3B6EA 4UXJA 1XTJA 3A1TA 2ZJ0A 3BQMB 3MBOA 5DMHA 4ARZB 2FW7A 4U5QA 2G71A 1M7GA 4UXHA 3ZU4A 5KTOA 4JYAB 3PXXA 5KKAA 1AGPA 2XZOA 2RGRA 1P3Y1 5REQA 1PO7A 4D4HA 1CB7A 2DLNA 2KM1A 4PC2A 3OUUA 5JSKA 2Y6VA 3R3SA 4IHAA 4D7AA 1L4LA 3WGIA 3L7LA 1SIBE 1QHIA 2JH3A 1A2KC 2KBEA 3IIJA 1Q77A 2C1XA 4PNHA 4X00A 3WO0A 4ZYLA 1IEXA 1NDUA 3FWZA 3PZBA 4OFBA 4GPIB 4B46A 3HVJA 1J97A 1UIRA 4ENTA 3S2GA 3N6VA 3UWMA 1T5OA 5AKLA 4CR6A 4P36A 5BSKA 3Q1KA 4GLBA 1KK3A 3FVTA 4ZALA 1E3DA 1I1OA 1LI4A 1DTWB 2R8RA 4CM6A 4CETA 3WWEA 2IXGA 3HEBA 1PR5A 3IDAA 3ORFA 5K2MA 1YD7A 4RBNA 3REFA 4BMPB 4D9IA 2RHBA 5E4YA 1CRPA 3VR6D 1D4FA 3ICCA 3OM0A 3HYSA 2O3TA 3EDOA 2AI2A 3JD2A 4LS3A 3DUWA 1HDGO 1Z0SA 4HS4A 1MMFB 2BEWA 3RVLA 4YUVA 3S1SA 1W49A 2ODPA 2V7UA 4BX0A 3CKMA 2XQGA 4WXMA 3TZCA 1Z6QA 5SYAA 3UO8B 1GR0A 3KLBA 4DHWA 2XNCA 1YB5A 3GCGA 2FPIB 1CS0A 1WB5A 4EBFA 1IUOA 4ENUA 3EPKA 3O73A 5I8ZA 1INLA 5JYDA 3Q85A 3UUGA 6ADHA 2G06A 2WD9A 5K6TA 1VSQA 1M6YA 2AOVA 4MQFB 1SXJD 4NCJA 1GUZA 1NT4A 4BAGA 4CTKA 1UPFA 4P4TA 5HKBA 1FYFA 4IUCS 4B74A 2ZZNA 3TF5A 2RHLA 3VO1A 4RKEA 7YASA 3ELBA 4YP5A 2ZUEA 2GWHA 3MGCA 4CCSA 2NZ2A 1TZCA 3AZPA 3ZVRA 4ASUA 3PU6A 2H85A 1AIPA 1X9IA 3TZLA 2HI0A 2FNAA 2NZYA 3AR7A 5C81A 3WLJA 5AM1A 3N5KA 2NYRA 1MIHA 1KDPA 2J9XB 1LC3A 4OXIA 1Z0KA 1RHRA 5LA6B 1V6AA 3OPYI 1Y3CE 2FPWA 4MI6A 1F4LA 1J5EB 5HIAA 4DRZA 4PLFA 3BK2A 2VP5A 4UU8A 1KOGA 4WE3A 1DVRA 1UIMA 1XRJA 1NMZA 4ZOEA 1U0JA 5FP0A 1OAOA 5DZSA 5CXUA 2ETVA 1OBOA 2FSSA 5FA8A 1AQ6A 2V7EA 3LVQE 3WHPA 1QUFA 1ZCFA 3OOSA 3OZ7A 4OBWA 4RZUA 1KGSA 1E18A 1PWXA 1JTVA 1S8AA 1U2DA 2ZJYA 2B2XA 1O57A 1W36B 3I83A 1M2FA 2JI9A 1RP1A 3E58A 4K6OA 3EBOA 2DY1A 3JVVA 2FPGB 2QR5A 4OP3A 2CN1A 1XCPA 2NIPA 1M1NB 4PZDA 1OLXA 5ALTA 5IKXA 1WNTA 1VDZA 1HC7A 5JPCA 1X8XA 3L82B 2NU6A 3AL2A 3OIUA 2X4LA 4W63A 1EBUA 4QPDA 2QLLA 1DKUA 3FFXA 3I9FA 2DECA 4UPDA 3VH4A 1I80A 3AM5A 1TMKA 3B3QA 3EQ8A 4MWDA 3TPZA 2OE2A 4GYWA 4MW2A 1UPXA 2V97A 1XLTA 5CVVA 1KSJA 1BGVA 1JP7A 1JSLA 1Q1EA 1YHNA 3LC7O 2EGUA 1B1CA 1Y4ZA 3HS3A 3CLSC 3RVOA 2BGGA 2EVWX 4ND8A 4IPTA 4NYIQ 1EBBA 1GCIA 2Y2VA 1PEDA 4DLLA 2YVLA 1Z0JA 4MQEA 1IN6A 1W96A 5L3QA 3BA6A 1DARA 5AW4A 4ZQHA 1R3UA 4O4LF 2VT3A 2QK4A 3WSTA 4C5AA 2QRNA 2DRIA 2CMKA 4O2AA 4YN3A 2HSWA 5FR2A 3AEYA 4NJMA 2IEGA 1IK6A 2BI8A 2ECOA 2I4OA 4XOIA 4DNFA 3N2EA 5IM4F 4KREA 2WM3A 3D4PA 4I36A 1DWUA 4BAZA 4WK6A 2FE4A 5DTJA 4Q7LA 2BKXA 2C8LA 2YMLA 4GI7A 3BRQA 3KZOA 5L40A 1ZMBA 3MUNA 4YMLA 3AFMA 1NBMA 1NW3A 3BN3A 3A32A 4PYLA 4L73A 4LF9B 4HV4A 1X7WA 1T36B 1KQGA 1M2WA 4TZ0A 4HXYA 1Z7EA 2WU1A 3A9VA 2FN8A 3IQDB 3DT8A 2EX1A 4HB4A 5IBQA 5IMSA 4ILKA 2JHAA 2FEPA 2CF5A 3IMFA 2XEXA 3W04A 1KA9H 3GLUA 1P91A 3PD7A 4L08A 4B6OA 4V3BA 2OVFA 2OOSA 3RVJA 3MWEA 3TMAA 3FVRA 4WUTA 3B6KA 5TQ0A 3KOZA 3SZGA 5G2OA 5D1HA 1WW8A 3LDAA 4X91A 5JBIA 1D6NA 3ZLJA 4XB2A 1EVEA 4DLUA 4NZOA 4CQMD 4TUYB 1H23A 4OGWA 4JBNA 2YDXA 1Y3BE 3O8BA 5I9TA 3WIUA 5EKTA 4YCJA 1OXMA 3AC0A 2PJRA 3KTOA 1U1FA 2C2BA 4BNHA 1UK7A 3GWGA 4KVFA 1YASA 4DSNA 1E3JA 1D0SA 3DZBA 3PQ4A 1N4AA 1MVLA 2VUHB 4FSHA 3IIIA 1TGYA 3MELA 3GI1A 1GU0A 3FPAA 2PQ0A 3NX4A 4BYGA 1DCTA 1DRKA 2RGGA 1H1DA 1P1BA 4F5ZA 4EMSA 4F9EA 3VDQA 2Q5EA 1NVWQ 1K0UA 3HBFA 3VSEA 4DQXA 3IHKA 3N7TA 3OZFA 5DJ5A 1NGSA 1K27A 4NXNB 2C99A 3T61A 4JP5A 3L7OA 4TMVA 2VXBA 2ZJ7A 1QGUA 1WMAA 1VLQA 3LWNA 4O63O 1LBTA 3GQBB 4F8EA 3HB9A 5DGXA 5JJKA 2BFAA 4G9EA 2X5NA 4LZAA 2P62A 4W7IA 2PX4A 4IIUA 2HEIA 4HAYA 2FSVC 121PA 3Q2IA 1SN7A 1U8ZA 2WYOA 3FHCB 4R2KA 4DV6B 3NV7A 2XQVA 2EFDB 2WIDA 4DA9A 1YCDA 5LQCA 2F64A 1DBWA 5KX5A 3HA5A 4MV9A 2V74B 2O7RA 3QU4A 1SZCA 1UMDB 3PD1A 5TMEA 5JMOA 1T9CA 2YFQA 3HZOA 3WLOA 4P1ZA 3ZGLA 2VSFA 4AFNA 4GEKA 4PPNA 3MTJA 4MCAA 3BE8A 4M54A 2VDWB 1KO7A 4KE6A 2D2EA 3N53A 2XE7A 2BVNA 1LZKA 3AYZB 3GXBA 4OA5A 4R8SA 4PY2A 3OQPA 5LZ4A 3IAS6 3HXTA 1I6KA 3GLIE 2LCFA 2P9JA 3I5XA 4CKEA 2IDJA 2W5UA 3GPCA 3ND8A 4DCPA 4EG0A 5J1SB 1LXCA 1PJSA 4MMXB 4CEIB 3LC0A 1SVNA 3B1FA 1GRRA 2CB9A 2XZDA 2W2KA 2HMYB 3BHNA 3JATB 4C03A 3KO8A 3GT3A 4IZ6A 2IYYA 2LZ0A 4XYLA 1QGED 2GEDA 1A7JA 1K7CA 3ND5A 2J41A 4RPJA 1KIFA 3DL4A 4L8VA 2J3KA 3KLPX 3BICA 3NJ8A 4FBLA 4MKFA 4AKTA 5HRAA 5IANA 2VPWA 1E2MA 1KGDA 1RACA 1VJRA 3C7KA 2NU8A 2VQDA 1XHEA 2Q7DA 4O4JA 2XCUA 3U6BA 2YCBA 2IYRA 2DTDA 1FU8A 2XNDA 1XFDA 5E3JA 5K0CA 3WK8A 3U4DA 4M0EA 3B2NA 4UKDA 3LPLA 2ZWMA 3I3SR 3S55A 2BMVA 2HZ7A 1N5JA 2NN3C 3R40A 1QQ7A 1YGYA 2NAPA 3MUOA 4UTOA 1QE0A 2ZYGA 3F71A 3GMIA 4JQOA 2B4KA 4ENQA 1XMPA 2WWIA 2JD2A 1N8KA 2BM1A 3VSAA 1DDIA 1XWIA 4GLLA 3OSZA 3CUTA 4QDTA 5IDVA 4DV7B 1E69A 3TOZA 3TLMA 2QTGA 4MVJI 4QGAA 4AG5A 1NXVA 2AG6A 3Q7TA 5JXWA 2QM3A 4D44A 5EXEA 1NI4B 1S8OA 3L7IA 5K8JB 2C84A 2Y0PA 3MQ4A 4G4SP 5JAOA 1EFVB 3RU3A 3KQPA 1DXYA 2GGSA 5EUCA 3D7MA 2NV0A 1R66A 4JGGA 1TAGA 3H2HA 1U3FA 3MCAA 3Q3CA 4N3NA 4CDNA 1RCUA 4A15A 1DADA 2I2BA 4BO5A 2PFSA 3CCFA 3VZCA 4DBZA 2XX3A 4WN9A 2FJUA 4XZ3A 4MROA 1KU6A 4MQUA 3C7DB 4FS3A 2WKPA 1EAMA 2OLJA 3VTAA 2QYTA 3ZS8A 4RVUA 4BQRA 1E5DA 1F1JA 4EI9A 1FXWF 1GQSA 2R86A 3D2LA 1T9GS 2BMWA 3EDRA 1EGHA 3ZD9A 3F4BA 3VOAA 4JXZA 3LXUX 5A06A 2FCAA 3E22A 1X9HA 1SZJG 8MHTA 1DQNA 5COAA 4FUTA 4MPTA 3SLRA 5CFRA 4DV4B 1QRUA 1SCIA 2HA6A 4PBTA 3II6X 4II7A 3DFFA 4DY6A 2XVYA 3C6MA 3QVSA 4BN4A 2QUZA 5LYYA 3FTEA 1GZ4A 1I5RA 3EFBA 1FU7A 4QXPA 5KWIA 3NXSA 3ID6C 3ZXSA 5I4IA 4X7RA 5EWMB 5DBHX 1G2IA 2VTVA 2C7OA 5JECA 2HJ9A 1H2BA 5LKAA 3NBUA 3K0EA 3TIVA 2XCLA 4R41A 3QMPA 4S2EA 1ISMA 4KXQA 1GTRA 3BWMA 4FCWA 3QMWA 1E3WB 2XVAA 3G7SA 4IL5A 4JJ8A 4ZAZA 3SX0A 4HDRB 3K96A 1XOIA 4DCTA 1E1RD 2NT3A 4QOEA 1JSXA 1UL1X 1VGQA 1RFGE 2ZYIA 2WWVD 2LGJA 1YS9A 1GL7A 1U94A 1E6UA 5BYKA 4I19A 1KYWA 1N8SA 4QODA 4RZ2A 2JC3A 3WYBA 5FUXA 1SCNE 3TEFA 3CUEF 3L6BA 3MYYA 4IKPA 1YCGA 2FN7A 1RAIA 3QX8A 2QW0X 1APBA 3THXA 2PUDA 2EYQA 1U0HC 4QE3A 3D1VA 3OQJA 3D3WB 3HGTA 4ENWA 3PVZA 4F6LA 2PT9A 3A10A 1JXAA 2VQSA 2AN1A 2OXFA 2PWPA 2WJHA 2WU4A 4QT0A 5C9ZA 4RD2A 1JEYB 1MEJA 2AMLA 3MOIA 3D6FA 2WFAA 3OUZA 1NVKA 9LDBA 3OEHD 2ZJ3A 4M53A 2FW1A 3C5VA 1POWA 1RQ7A 5H5JA 5AVTA 3DF7A 1NUSA 2C78A 3U37A 2V7TA 1GNRA 1OAKA 1YU6A 3UOAB 4EI7A 1TT5A 3OJEA 5IXSA 3KETA 3AB8A 3A05A 3AG5A 5BVHB 5IYZB 4UAUA 5BR1A 2F43A 1E7SA 3BRSA 2B5WA 4QFDA 3TXAA 1CT9A 2FRDA 5LFAA 1A5TA 3QXJA 1Z6AA 2I2XB 2XYGA 2CKMA 3FROA 3PWKA 1UFVA 4ZMBA 4C7OB 2Q50A 3AFGA 1RQPA 4GMKA 3CRRA 1JEJA 3CLVA 3KEQA 1XN1A 3H2YA 3OLYA 5BN4A 4QNNA 2I6UA 1BWSA 3Q9LA 4P3KA 5TGZA 3RUHA 2JFVA 5I9MA 1L4BA 3VHQA 4AKSA 4UBNA 5DOVA 5LOVF 4JMPA 4N6GA 1CUYA 4AWXA 2WF6A 2R6CA 3TRFA 3ABSB 3EG9A 4D8WA 3L04A 3NC4A 2HN9A 3NAQA 3PE3A 2QVCA 4MWBA 4ENRA 1ZRHA 1TXGA 3BK7A 1QHYA 1KPHA 2RIPA 1VHDA 4LZPA 2X8BA 3O2NA 1GKUB 4G0ZA 4V24A 2GJ8A 2VZLA 2GETA 2NO1A 1NPTO 1VCOA 2BBWA 2AEJA 3O4VA 4H0FA 4DQVA 4URVR 3F4KA 3PDIB 5I4BA 1AMNA 1NQAO 3AVYA 1R10A 5FNVA 3U7QA 5K3BA 4RTJA 4PSAA 3E81A 4C0BA 1K68A 1QPGA 2GAOA 3LS2A 3E9QA 4Q4AA 4XUEA 1IXKA 1S4QA 3HNRA 3FZEA 2C54A 2WT8A 3ZIDA 2WVJA 2B8TA 1U7TA 4WKOA 3N0TA 5ICSA 3EJWA 3AHEA 1XYGA 1GAEO 3L0DA 2H7VA 3SFZA 3VR6A 1E5VA 1UEJA 1JMYA 3MGBA 3HXMA 4FWTA 4KAJA 1ZICA 4H3SA 4NU6A 3PUHA 5FXMA 4BKRA 2RMKA 5ECYA 3PKZA 4TSRA 1W93A 1PZGA 3TBKA 1Y1LA 1PJTA 3K1TA 2QN8A 4M0FA 3ZXIA 3M89A 4PYNA 1SCKA 3H1AA 2EKBA 3WYNA 1A9YA 1E4VA 1W52X 4TXMA 1DBQA 1WQ3A 5EP3A 4DOMA 2QM7A 3QXHA 2HLDD 1UF9A 5EIEA 1YFJA 3D4OA 4NCKA 4BNWA 1CF4A 1F0KA 3G1WA 3TQOA 4E5UA 1SXJA 3S5UA 3FZGA 3FNIA 4D56A 3A1EA 2ATVA 1WJGA 1SELA 1ZM3A 1WCYA 2FF5A 3NWEA 4HNGA 1NVFA 2PWBA 4RVFA 5CUQA 4CGYA 1EFTA 1X19A 2JKVA 2WKWA 1J22A 3AJRA 4LC0A 2IYWA 4NJEA 4WA8A 1TZBA 3Q7PA 3RFCA 4WFQA 2VPPA 3IBYA 4FHCA 3TTVA 1GUDA 2UU9B 1Y6ZA 3QEMA 3VC1A 4EF5A 3EC2A 4REQA 5FLKA 4QDUA 2VI5A 3D6TB 3UB2A 3FBWA 2P8JA 3ZHQA 1USVA 1ADCA 3WGUA 3EIEA 4G0XA 5FIUA 1U8EA 3DNPA 3VI4B 4RHEA 3ZKWA 5CFQA 3PQ2A 2NYAA 4KRYA 2QYOA 1LLFA 1IG0A 2MWMA 3O03A 3WKAA 3PXUA 1KEZA 3HJFA 2G9UA 1RJ9B 3ZDXB 4R16A 3AI2A 3U3XA 4X62B 4URXR 1QH1B 2GFHA 2MSCB 2Q9BA 5AQ1A 4KMOA 2ILTA 2WHEA 2Z30A 2BGLA 1I1HA 4P58A 3CN7A 1EHCA 2P79A 3LPDA 1MG5A 4LUCA 2WTAA 4MJ3A 4EY3A 4LZJA 3QOYA 4GGOA 2ZYHA 2PMCA 2VUUA 4UCFA 5KCMA 3RYIB 4NCBA 4IHJA 3GLTA 2FOLA 1WB6A 5FWYB 5TS2A 1JLHA 4PQYA 4UVHA 3UAVA 2WFZA 3KS9A 5AESA 3R8FA 1T1IA 3TRHA 2PVPA 1XDSA 4RA6B 1TIPA 2X7HA 4D0NA 5BNTA 1N32B 4PFJA 1ORTA 1HKUA 2VJLA 4Y2TA 5KOJB 3DDNA 5T8KC 1PNOA 1NSYA 3QWAA 1ZMTA 1J00A 2LIVA 3CLUC 3KAQA 4RMNA 4FW8A 5EMLA 5GV7A 3CR8A 5AD1A 2FMXA 2YVUA 3EY9A 1ZXBA 3ILHA 3T0FA 5H9VA 5IUNC 2FP4A 2RHHA 2B69A 3RS7A 1Q0TA 4GM4A 1Z25A 3LF2A 4WY5A 5JNRA 2I6SA 1JG1A 2YV3A 3TTUA 4C0QC 3ZD7A 3THWA 5A4DA 3QW4B 1Y8QB 4F3YA 4OQXA 3LU1A 1T35A 1ZUNB 1W88B 3FIUA 3G88A 4R2LA 1H1TA 4BS9A 4J1TC 1KAOA 5ILQA 1XNRB 4JLUA 3SAJA 1EJ0A 1OPXA 1WMEA 5KQRA 4P31A 2DKOA 3TG2A 5BV2P 1OJ7A 1R5BA 2Y67A 1W5AA 1B93A 2ZRCA 3D0KA 2DXIA 2XE4A 1I4EB 3RD5A 2A5FA 2EBUA 1A9XB 3D3NA 1W94A 1RLMA 3MWJA 4IIVA 5B2ZA 1YUBA 2ZSDA 4P7KA 3UXHA 4JFAA 1RBQA 3W9SA 4G1UC 1RRPA 1P9RA 2BOVA 3C3CA 3DKRA 3HCNA 4LEIA 3SF0A 1DRUA 1XAGA 3TW4A 4LXYA 4U00A 3S2EA 3BRWD 4DV0B 3SQWA 2W6ZA 4KVZA 4AP9A 5FOXA 3TTSA 4BO1A 5ES4B 3ZUPA 2VDPB 4YA6A 4IFTA 1O6CA 4GPTA 2RC6A 1YZUA 2QTBA 4KN6A 1SU4A 4O2AF 3KR1A 1FVOA 3V00A 4CQMA 3TZEA 1GA1A 2WA2A 3BKXA 3E1SA 4KFRA 2JGLA 3NKFA 2BDUA 1PJ2A 4N0PA 1Q50A 2PUWA 3R5HA 4JBWA 4IXNA 4R7GA 3GA0A 1CEEA 2ZAOA 3KOMA 3HFGA 2DFTA 2WUDA 2AA3A 3FKQA 4QICA 4IV0A 1IIBA 3S29A 2QUHA 3VJLA 4AS3A 4KACA 2I91A 2P0EA 3F46A 4X94A 2WIAA 2BSAA 4WNAB 4HFMA 3C3PA 4YAEA 1EIWA 2X9LA 4WQMA 3FAZA 3DVQX 3ONDA 1GU7A 1ECPA 3AB7A 4RCYA 3TDMA 2ALJA 3W2FA 3ZHZA 2IP1A 5JISA 4L02A 3KDPA 1IN1A 3HWX1 1HLPA 1V39A 2H52A 1L5MA 2DG2A 1ULHA 2BDTA 2VTBB 2C4UA 1FTGA 2FZ4A 2FFRA 2V6IA 2VBIA 3E0XA 4BKOA 3C8MA 4V02A 1X7DA 3AONB 4LI0A 4C5BA 2WFLA 4QUJA 3EUWA 1QYCA 2I5PO 4PG7A 3CU5A 3G9ZA 1ZVKA 1JJAA 1Y1QA 1Z5UA 4L8LA 4YMUA 3BMCB 4N8DA 5F3DA 1AKMA 5IFLA 3P9XA 4E22A 1N7GA 4ZYZA 1K5DA 3B6IA 2PUCA 3MJEA 5LQMA 1AN9A 2O3UA 1KVUA 1WU8A 3CCCA 1QX4A 3V4VB 1V48A 4C0WA 4XEUA 1B76A 4ZAGA 4PQGA 2WAYA 3ELDA 3WGQA 3WMFA 5BR7A 5IT4A 2KW5A 2FDCA 3QGMA 1J7KA 2CBGA 5C80A 4Z4FA 2IE8A 3IP7A 4UATA 5MN6A 3SKVA 5JJCA 3EUEA 4G3XA 3DW3X 5K0GA 1EK6A 4L2IB 3OSUA 2QUBA 1SUPA 1RLTA 2OHFA 2HW8A 4EVIA 1M2JA 4JOSA 4COOA 2CBZA 3O21A 1CZHA 4OK5A 4BWVA 4DLVA 2XMQA 2JLCA 4DA0A 4ZRDA 3Q9SA 3FI9A 2WD8A 4EB8A 2ZB2A 4X71A 1LCIA 2QY9A 2MT9A 4AMGA 3BJZA 1G8JA 1TMGE 3RSFA 5AW9A 1XJ0A 1L0BA 1KE1A 2OUKA 1NULA 5CCDA 5BNZA 2Z2XA 1RYMA 3RT7A 2BMFA 2ZRDA 3I32A 3RROA 3H4TA 3VKUA 3W7VA 4GKJB 4FYHA 2W22A 3FYUA 5KX5F 3MT8A 2DY0A 4W5HA 3N39C 3W3AH 3A1SA 3TFOA 2HT6A 3KVOA 4EYOA 3CX6A 2C83A 3IV7A 2H31A 5KNDD 5JZSA 1WP9A 2BMAA 1DJLA 1HTWA 1MB4A 2H4JA 4J16C 2G88A 2K6GA 4QARA 3SMQA 3SQOA 3QFFA 3S0JA 1F8YA 5AJTA 2IPLA 1UBJS 3HB4X 4HGZA 4Y2QA 3TSCA 1QLJA 4XI9A 2WB4A 4DAOA 2VKQA 4XARA 4P0PB 3S8MA 1GZVA 2HK7A 2BUAA 4P54A 2Z6QA 3H8VA 2HRCA 3GGDA 4HTFB 4E3WA 3C74A 2Q8PA 4QHSA 5E1DA 1GZ5A 5B2EA 2H92A 2ST1A 4I46A 2XODA 2QYSA 1A7AA 3LT5A 4IUDS 3I3OA 5E4JA 4Z53A 1M9NA 2WUFA 1DO8A 2RHOA 3MWKA 2PKWA 3OCYA 4L27A 4F6RB 2BGKA 1FXSA 4O4JF 4GKKB 4GE3A 3T94A 3DDOA 2KHZA 4OHRA 2CVHA 3CZ5A 1KOJA 3P2KA 3ZQJA 4RSHA 4UE2A 3OLWA 2HK8A 2C5EA 2D1FA 2UDPA 1FE8A 2P0AA 4JKOA 2FMHA 2X42A 1NDHA 2OGUA 2JAPA 3G59A 1G18A 3PUWA 1FQJA 3CH4B 3OZBA 1VLHA 3Q6MA 4EHLA 5CDGA 2E6UX 2GJ9A 1EZ1A 4UCXA 3HPQA 1P2FA 5I7EA 4P2BA 2F3UA 4PBRA 1X1DA 1NHGA 2H2HA 3GARA 4FJ2A 4RMHA 5M3BA 4W5OA 1LJUA 2BLLA 4D3YA 5BVGB 2YCLA 5ESWA 3DDUA 5TNXA 1UBFA 2E3JA 4CLRA 1YH3A 1WO8A 2R7MA 2QZZA 5IVKA 1VL5A 3CPHA 1P1CA 5AH0A 5K6AA 4F11A 4XFJA 3ZY5A 4DANA 2QP9X 3D31A 1OB2A 2A9PA 4JOBA 3CBGA 4JNCA 4PC7A 1O08A 1C9KA 2X8AA 3CLHA 1E1RA 1MDFA 3KKEA 2ZBVA 3MCWA 1P7PA 4TRJA 1A9RA 2CLCX 5HBRA 3P0FA 2ATCA 5JSQA 2ZUFA 2F1OA 4INAA 3WKCA 4JI7B 3CLKA 3H05A 2G9NA 1EG7A 2C5FA 4ZO6A 3LK6A 4I7EA 3ZWPA 1AK2A 1E3TA 1Y8RB 4JX9A 4AY3A 5KJ6A 1KEKA 5HSGA 3L0IB 1ZVJA 3NYRA 4QU8A 3WQHA 2R60A 5P8WA 1CWUA 5EI5A 3RS3A 2P1RA 5TIIA 3A06A 2D3TA 3WRXC 3HJCA 4QXRA 5C5CA 4NIMA 4EGCB 4NCXA 5GJCA 8OHMA 1IQRA 4QAQA 3R3WA 1FX0A 3HL0A 4YO7A 2QVBA 2FKNA 2IYVA 2Q28A 1T4MA 3H5LA 4JEMA 1T2AA 1KP9A 2QG4A 3JWPA 2QAJA 3MHPA 3R6GA 2HJVA 4I5IA 4POAA 1NL3A 4TT8A 4BFLA 3G85A 3FCSB 4PCVA 2ZIXB 2PLRA 1XL0A 2CSXA 1VBNA 1X1TA 4MVYA 1PYDA 3HUUA 3SJCA 3C43A 2ZBRA 3TCNA 4F8JA 5J4LA 2X4DA 3DLHA 4J6EA 5AI5A 1V26A 1Q19A 3ZDQA 2QQEA 3KXKA 5CYOA 3P9NA 3E05A 5HRUA 4FLFA 4M9XA 2ZZMA 1NOJA 3HLYA 1W4AA 4MCJA 5TXGA 3T06B 1CY0A 4FYIA 5EZYA 1S4MA 3AUJB 3WXBA 2QBYB 4BQNA 4W6QA 3LCMA 2YQZA 4LRUA 5GONB 4WESB 1WF6A 3BFVA 5D84A 1XJ5A 3O4RA 1PDWA 1QQBA 1X39A 4B48A 4YCBA 3STTA 1E9EA 2DJIA 4ZQFA 1N8TA 1G3RA 3VU9B 2OGWA 3TOCA 2IOHA 3DEFA 1CU1A 3ZDRA 2HGSA 2R8ZA 2X41A 5EVJA 5B53A 1O5IA 3EHDA 3V55A 3C3DA 3K94A 3UZUA 4CFSA 4RACA 1XZDA 3H9JA 2HREA 3RHZA 3CH6A 4LSWA 2GAJA 3NNDA 5JMPA 3VR6H 5C2JB 4LG1A 4K03A 5K8VA 4YQZA 3NKLA 1TPZA 3UWOA 4F4FA 1VG9B 3M3HA 3HRIA 1TIBA 5ED4A 2JA1A 2NO7A 2ZATA 3A11A 4TGLA 1NPYA 1VFPA 1YS1X 4ZAWA 4CEJA 2Q62A 3LYLA 5M04A 3T3MB 1S8NA 3DCYA 2VJQA 4MQ5A 4MW6A 1OGIA 3JZFA 3FMFA 3DDHA 4Y7DA 3ESDA 4V38A 5CDYA 3OIGA 3OQNA 2H4YA 3WQSB 5DYGA 2VJAA 2ZAMA 3H0EA 3QFTA 3FLAA 1HH4A 4UQLA 1EE2A 4DM7A 1C9MA 3VU3A 2ZJOA 1T2VA 2B5OA 1Z74A 5TPWA 4C2AA 1E9RA 4CLOA 3AVWA 4BBPA 1YL5A 5IJZA 1U0TA 2XIJA 1K3FA 4OSOA 1G38A 3ZIAD 2GI4A 3GLHE 2NVBA 1T2EA 3EPPA 4GH5A 4QSHA 1BFDA 2JI7A 2P6NA 3DZ8A 4KWEA 2EP5A 2Q9CA 1YOVA 1U8YA 3QBDA 4U2EA 3ZI4A 5IEJA 2UZ3A 2QN7A 4KR2A 3JQDA 1AS0A 3LQ4A 4W5RA 2BH2A 1E2NA 2HLDA 4YFVA 4QUEA 1SCBA 2BP7B 4HF7A 5FNVF 4L4ZA 4RPKA 1HK7A 3FMOB 5CX1A 1L3CA 3TD6A 1YDHA 3DE0X 4DQUA 1GGVA 2UZ4A 1PFQA 5C8XA 1H2XA 1QOZA 3LUJA 2NU9B 4K2HA 1II8A 2MR5A 2ZAIA 2P11A 2XMPA 2GCOA 2FUEA 4ID3A 4F3CA 2O14A 4G0UA 4J1QA 1CFJA 3TRJA 1FMLA 1NUAA 3WMWA 1Z8DA 1UP6A 2VJNA 3M4XA 3OE7D 4MS1B 5JCXA 3PTLA 1GOTA 2N42A 4NYMQ 4YRNA 4GYKA 1RSZA 5KCZA 4EEZA 2YKGA 3B2QA 3E27A 2EZTA 2YJ6A 4FILA 3MA0A 4PLWA 4RENA 3BVPA 1WCIB 5FYQA 4CCAA 2CXOA 5IN4A 2F1JA 4RD3A 4GP7A 1HLDA 4JBYA 1KK1A 3DAPA 3MRTA 1EFLA 2ODAA 4KQ6A 4L75A 4C4RA 2GO7A 3TAXA 1LPBB 1MV5A 2WIBA 3WXMA 3HR4A 1YR3A 2ZW9A 2OAQ1 1RQRA 3H97A 4RVSA 1EUDA 3Q2OA 4NC9A 1RHQA 1Z7YA 3DE7X 3QHQA 4MIYA 4NF2A 4R31A 2EG9A 3UMYA 3WWCA 1HNXB 3DXZA 3KE8A 1CP2A 4RY8A 3RYHA 3K2IA 1QTQA 3KSUA 4PAWA 2C4HA 4JEHA 5KTYA 1OH8A 5ENDA 4HG2A 1W73A 2BHRA 3G2OA 1L4YA 4IWXA 2POQX 1PBNA 4B3JA 2FA9A 3STUA 2ZJ4A 5HDBB 1BCRB 1G5PA 1NZDA 1NU6A 4FXPA 4NH4A 1L1EA 3RREA 1TK9A 3W6UA 1WKVA 1RU3A 1TAHA 2ZIUB 2R4QA 5FOSA 1THZA 4RDHA 3U7FB 1K1EA 4RV5A 2VYFA 3ZZTA 3A9RA 1MEEA 1V8BA 3N8NA 1SHKA 2YXDA 4Q4HA 3QYAA 2IZOA 3B12A 4MR7A 4D9BA 3OZXA 2VATA 1NIPA 2W48A 4PGFA 3QY9A 4MH0R 2F48A 3GRFA 3VKVA 1MO6A 3QG5A 1L6RA 4WK4B 3LBYA 4LCEA 4KPUA 5CITA 5KYWA 2C96A 4P3NA 1GCGA 1TGVA 4IHJF 4HPXB 1I14A 1FP7A 3HDJA 3T7SA 3TG8A 1T3SA 1YHYA 1BMFD 1T9ZA 5DX8A 2DOKA 2HSJA 3EARA 4RPLA 3PUIA 3QE0A 4PGMA 3O2QB 1JSCA 1XQ1A 1Y33E 1HDCA 3DLPX 4XIYA 5TE9A 4B80A 3B7GA 1XR3A 4YR9A 2R8YA 4XYGA 2QQ0A 4FVTA 3BRWA 4HBGA 3Q6NA 5KPDA 4BPBA 4R2WA 5D51S 2H06A 1NR5A 3T5BA 2F1HA 5A05A 1EVZA 2R48A 4E46A 4KR9A 2PE5A 1X7GA 2DSTA 5HTKA 2GXQA 3IAM6 3G8DA 2JJ1D 5ADVA 2L69A 4PYOA 4AYTA 2AS0A 3PIIA 4YAOA 3CE9A 1ZHHA 3FSRA 3HRHA 3ZEAA 4UNNA 3SWWA 4XH9B 2ZBFA 3O5AA 3ITNA 4B6QA 6ABPA 1NNI1 1GFZA 3KOWA 3V9AA 2GYUA 4O4LB 4JEIA 4V3CA 1OWOA 3F6BX 4GF5A 4LGMA 2XOEA 3PK0A 1PIWA 3NYWA 1XPRA 2GZ3A 1KH2A 3K73O 1FP6A 1HDIA 2ATIA 4WEQA 1U9IC 3TXXA 4ECEA 4EKNB 4QT4A 1XKQA 4B3FX 2ORED 2X13A 1LH0A 4J0HA 2E1RA 2V5VA 3ECSA 4FFSA 2VHEA 2Y1GA 5TARA 3D0QA 4BVBA 1E62A 5IDWA 1A76A 3JQBC 1EK2A 2N3ZA 1ODJA 3WL3A 2HBYA 4C87A 1P7YA 2TMGA 4KKXB 4ACBA 4YRDA 5HMLA 4P93A 5DTQA 5BWCA 2IXDA 3ONVA 3AINA 1JAIA 4J1SA 3DKVA 4PHTA 4G0PA 4EKIA 3M2PA 5FPTA 1U9YA 5K6RA 4RIGA 1M74A 1BEZA 1M5UA 4P33A 1E1DA 2WY2D 2WTMA 5KNCD 1RPTA 3P9SA 1FK8A 1G6OA 2Z8YM 2MSNA 4ER5A 2MSWA 4C4AA 1ZWKA 5IC6A 1Q0LA 2ZR7A 3DG9A 4K9DA 2IYEA 2YWEA 5AKIA 1V16B 1DC8A 5DLPA 1EIZA 3T9DA 821PA 1QO7A 3Q7IA 1NVDA 1MPXA 4HDMA 4A5SA 4ERXA 4YUZA 4RPCA 5AUQA 2D5LA 5K51A 3HLKA 1GLNA 2A5GA 2IHYA 3ASUA 3I01A 4GUAA 2PBZA 2WHPB 3TSYA 3AI3A 3VO8A 4R8RA 3ANLA 1L5GB 2G4LA 2IV7A 1AB6A 1W1IA 1IATA 5F5XA 2WRZA 1C3VA 1EZZA 1N7JA 3NBFA 4KYTA 2HU7A 5EIXA 4B3GA 3AF5A 2Q9AA 1MJFA 1WPQA 2QMUA 2RGEA 3EA0A 3V7YA 3B3FA 5EUMA 4KYUA 3WMEA 4KYIB 5CHEA 5C4IA 2J3JA 4G5RA 2ZS8A 2GD0A 4QSMA 1I6MA 3NT4A 3IPLA 2BFFB 1Z0AA 3R9WA 2HDWA 5JTUA 1G20B 3O8CA 4RD6A 2YZ7A 2GQ0A 1W1WA 1E8MA 3DE1X 2H00A 3LHDA 2AN9A 4E1VA 3H5AA 4P0QB 2Q45A 1E7QA 3GFGA 2WTXA 4DJ5X 3EZXA 3SG0A 3PI6A 1BE6A 1B8NA 2I33A 1QAMA 3K16A 2WTBA 3DDSA 4IW3B 4LQ4A 4BEBA 3EPRA 5K8IA 2AOXA 1AHIA 5KNDA 3UNXA 1M34E 1XZIA 2GH1A 2Q5HA 2VXCA 4OK6A 1XZCA 1CUGA 1LNZA 2B7BA 3CY6A 1OXUA 3P2IA 2RBKA 3M1AA 3OJ0A 4MUXA 4IS3A 3PGA1 1LI7A 4FYKA 1OKKD 3T5MA 1I4DD 1EFPA 3FCCA 4ZOQI 2RKOA 1PTJC 3N87A 1E2BA 1UPCA 5LMCA 3GLGB 1XLVA 3T3DA 5T6BA 5HKOA 4LX0A 1FNCA 1DC6A 1LPNA 1U3WA 1ZIDA 2ZJBA 4Q3BA 3L1UA 1ODIA 3IAFA 3NOQA 4MAFA 4U7HA 4CR8A 4DNPA 1OPRA 1R4NB 3JZAA 5BSFA 5E4FA 5F2OA 1U0EA 3UB3A 1RYDA 1H2EA 1O2DA 2BF7A 4I5DA 4WKNA 3WV4A 1JEOA 4MWTA 4EJSA 3F73A 1TJNA 1V1RB 3Q3JB 4MVWA 2R1ZA 5F2EA 5BQPA 2D1TA 2BWJA 3WL8A 4FHFA 1NN0A 4MSUA 1GL3A 1SKBA 1N5IA 3UJHA 1Q5PA 2V6JA 4LXIA 3NUGA 3NETA 1J0AA 4G5SA 1GYQA 3EQZA 3LJKA 1IJBA 3NHJA 4FGUA 4FLEA 1GDDA 1SWVA 3SQLA 2QTHA 2Z57A 3TOXA 3P19A 1FTYA 4D4IA 1TM7E 4Y18A 1D7OA 3I6ZA 3TO5A 3FVWA 3AM1A 3CTPA 3L7YA 5EJ6A 1D9XA 2G08A 1NATA 1G3QA 1RW4A 2PJZA 1CQIA 6Q21A 1T4BA 3GZ4A 4TZ6A 4WFKA 1KZYC 5FPPA 1CQXA 3WK5A 5B4UA 5JXHA 1CUIA 2G1JA 1NJ2A 3HCEA 4O8CA 2E21A 3QMMA 1YZLA 3ET5A 3NTLA 5KVVA 4AK9A 3UBMA 4IJKA 1IEWA 2A7QA 1GNPA 1TJPB 2PDAA 4WKGA 3M49A 5AMXA 4ZTUB 1DLJA 1W48A 3NHBA 1P7WA 2PFKA 4E5DA 2CXXA 4YRRA 4CG2A 4TXLA 1V1MB 4ENPA 1V35A 2H11A 4WXHA 4PX9A 4X20A 3OY7A 3TR5A 4DZRA 5ALYA 1CY1A 2E4ZA 2RJ3A 4MRSA 3C6ZA 3OIDA 3IAHA 5IAGA 3NORA 1XD2A 1IY2A 4AAYA 5JJLA 4FN5A 2EKQA 1J9GA 3N2KB 1QV6A 3GLKA 2EL9A 4QQFA 4BFTA 3BH0A 3SQMA 4HNHA 1UZNA 1C7EA 3AJEA 3UAYA 1IWBB 3DP9A 3QKUA 4EUHA 2AOWA 4PEVA 3W4JA 2FXVA 1LS6A 1NAIA 2WT4A 2PM8A 3LVFO 1K2VN 4AUKA 4JLOA 2RGNA 2PXAA 2WJ3A 1HBJA 3FUCA 2ONCA 2OCPA 2DWPA 5GINE 1JBQA 2OXCA 3GNLA 1UQUA 3LQ2A 4TWIA 4NV1A 4WZBE 1OZHA 2C9OA 2VP2A 3F67A 4WDRA 2QD5A 2IIPA 2ZIWB 3JYLA 4FGKA 5FI3A 1W36C 1JJBA 2WG1A 1AG9A 4EPYA 2OGSA 3KU1A 2SKCA 4YQEA 2J9RA 2EP7A 4CODB 5BSEA 4AJ1A 1E3IA 3NEAA 1FFXB 4LFCB 3ZXXA 1SG9A 2WHYA 4QWMA 5AHWA 1TYDE 3ISVA 3QE4A 5FUWA 3EZ7A 3MHTA 2D7DA 2KWIA 4I1UA 4GOMD 3SE7A 1B14A 1RWMA 3F74A 4M7WA 4PINA 5I9LA 5AQEA 5KREA 2GMWA 2OB1A 3PEUA 1IQUA 1GG8A 2PZEA 3B48A 3MJRA 2IEDA 1UBEA 4HDNA 1ZH6A 1GPKA 3L0OA 3DR3A 2GEKA 1TZKA 5JLJA 2PUVA 3ZWXA 5AK6A 3RJMA 3PCRB 4G4IA 2I7VA 5EESA 1N6OA 3SHWA 3A9WA 3I6BA 3IAAA 4XAQA 3OMLA 4QD3A 2JATA 3A6ZA 3U7RA 1BIFA 1O97D 2CHEA 1FTQA 2C3UA 2PZGA 4DLTA 5FBKA 2J67A 2WUGA 4Y1FA 2ZS7A 3QVUA 4LRTB 1G7CA 2I4RA 3DBLB 1XJCA 3ZVLA 1FDRA 3A2LA 4ADSG 1HE8B 5GM2A 2X1LA 3NTUA 5DT9A 5IUKC 1LJLA 3FB4A 4FHEA 4F3KA 5BSVA 5LVAA 3KQHA 2NZ8A 4WRRA 1JT2A 3LQYA 2CFSA 2ZTMA 3N0VA 1KEPA 4Q00A 2CV2A 1LD3A 2R5WA 3M83A 3ZHUA 1RYYA 4QUAA 4YRMA 5EZYF 2QRUA 1DAIA 1PNRA 5FORA 2NPOA 2UZ1B 3FNHA 1E79D 3R5FA 4EK9A 3FLBA 2DFDA 2FYTA 4TXHA 4JR2A 4CMEC 4EFDA 1Z38A 2FE1A 1KTVA 4L0QA 2PX8A 2QL9A 2YY5A 4GG1A 5EZ5A 2YFKA 2Q4TA 4A82A 3PDCA 4EVSA 4YALA 2PWYA 3GGGA 3I2FA 3GT7A 2XEDA 4DB4A 3H18A 4YXWA 4ND2A 3ZIAA 1CHDA 4C0JA 3AEQA 3L0PA 5H80A 2GEUA 4RSMA 3KL4A 3V1UA 2F4NA 2OK8A 3P0EA 3R0VA 1RPJA 1POXA 2WVAA 4ER6A 5E8JA 2BEUA 5LOVB 1XELA 4DMMA 4ZC1A 1U7XA 3JQ8A 5HF8A 5A6VA 3M6AA 4MRRA 3W2EA 5H83A 1UKZA 3ZE0B 1ZU5A 2WSIA 2H2WA 1PT5A 3G0BA 3HI4A 4E4RA 3M6FA 1NJ5A 3F5QA 1TC2A 3BB1A 1P19A 1W6UA 3DZIA 3I9MA 3R0JA 4IXDA 4Z8YA 3VBEA 1V47A 4XR4A 1BH2A 1FLDA 2EKLA 1ISGA 1ZGJA 3OEYA 3PIDA 4FDVA 4TTRA 2PEZA 4PXAA 4PE5B 1N3YA 3E03A 2ZUVA 1ZRMA 3OE7A 5DM4A 1ZCZA 1FC0A 1U6JA 2A0XA 2IW1A 3V1LA 2BGRA 1X7XB 3PWSA 5HXAA 4F7DA 2ZWAA 4Q1BA 5DHSA 2OV8A 5TMDA 1VDMA 1O6GA 1Y34E 3C3XA 4P3OA 3ZK7A 3EXG1 3ABZA 2IX3A 1IY0A 3F5SA 4A9AA 3RNOA 1O94D 2BGWA 5EQTA 2D3WA 2RGUA 3HSYA 3KOOA 2XUZA 5EHIA 3OIWA 1LRJA 3NNNA 3NT5A 4HN4B 1YV9A 4YV7A 3IO5A 1OWLA 1RJGA 2OESA 4RM3A 1FS5A 3KOXA 5EE0A 3QKSA 5REQB 1E2UA 3RTBA 2X2PA 3A6KA 5DWDA 3AIIA 4MS3A 4MEJA 2R84A 2WA1A 2JFHA 2EL7A 3L41A 1IJFA 1CR0A 3T4EA 5JZVA 1YZHA 2XR1A 3P9CA 5FH9A 4DS3A 3KR9A 2LKDA 4L8YA 2JHGA 3SIPA 1Z22A 1P72A 2AX4A 3ND9A 1D2CA 3UANA 2ZJFA 3PG5A 4PIVA 1ORDA 3GLSA 1LF0A 1U7UA 3NO4A 3Q8KA 1BVHA 1E96A 4N12A 4MV8A 2FAXA 1DBSA 2DVMA 3O7WA 5CYPA 5K3AA 5TJHA 3HCFA 3INRA 4RYLA 3RIHA 1KDOA 2ZE5A 4C7KA 5JQGA 5LBTA 4A6XA 1I7SB 2WSLA 3LSTA 4E21A 4BNDA 4PS1A 4G01B 3EGVA 3PRHA 4YGYA 4C07A 3G82C 4ZOLA 1H0RA 1P31A 1P7VA 4HWGA 1JQ3A 1GEGA 2RIRA 3MCVA 4U8HA 2BR5A 2C07A 1G2PA 4GBED 4HK4A 2BEWB 1N2GA 4ALMA 2OYSA 3KQLA 1JW9B 5KHAA 1GNVA 1UJNA 1WPXA 5F4ZA 1CS0B 2AN3A 2B34A 4IJVA 4KQIA 1FS4A 4MGIR 4WECA 2PKQO 4H31A 3RQIA 1BMFA 5FDFA 1KU0A 1PQPA 1QB8A 3ZWBA 1R16A 3EIOA 3R3XA 2YZMA 4ZVNA 2ZUTA 3WV5A 1XMQB 1H3EA 3U4QA 3I30X 3UJAA 3KEOA 5EWJA 2Y1DA 4UM7A 1UKYA 5TR9A 1BVUA 3JQRA 4EJ0A 1R18A 1JYFA 4W8GA 1DJOA 4RVCA 2XH8A 1D2RA 1NFFA 1Y5MA 1Y98A 2B8WA 3KVVA 1YONA 3FNEA 3H5IA 1IJEA 2REQA 2GCEA 4PHGA 4S0ZA 4KXNA 2OCLA 1JKJA 5AK0A 2JJ1A 1VG0B 3ESYA 3LP8A 1HZZC 1UDCA 2J6HA 1XMJA 4C2BA 3ZPXA 4EY4A 3W6ZA 2W6MA 2AOTA 4D98A 3CF6R 4BNUA 3WSWA 4BLTA 2ZRNA 1JKFA 3AEUA 2BR4A 1AUOA 3PSHA 4B76A 1OLUA 2XVZA 3RS5A 1HX7A 3SIXA 1VJ1A 2LVBA 4IS2A 5KSOA 1NY5A 1PL8A 3OT4A 1V6SA 1JLRA 3WJAA 1MJ5A 1J5PA 2AOUA 2OFOA 2YC2C 3LPMA 1K8XB 4IDEA 4KO4S 2BLNA 2YJ5A 1JTFA 4NZPA 3WMXA 4C14A 5A02A 4YT4A 1QIIA 2QN3A 3SI7A 4MR9A 3EWNA 2C1ZA 2CE2X 1QF9A 3BFKA 1OLXB 3GFSA 3K05A 5HKLA 2RGDA 1E58A 5AUNB 2MHCA 4M1OA 4ND4A 3RRBA 1IBMB 2GASA 2IYOA 4LXXA 5T64A 3RJZA 3DBHA 3ROTA 3WTCA 3WLLA 5JNWA 5KTRA 1VPTA 3MD9A 2WIKA 1DJPA 2YY6A 3DO5A 3HA7A 2IWRA 3RU7A 3ZE1B 1GKLA 3IBCA 4JENA 3VKWA 1F2UA 3GFPA 1IDOA 3UXYA 3WGKA 1R5OA 2P27A 3ZLBA 2PCLA 3CB2A 1ZESA 3OKFA 4JL6A 5KNCA 5MF6A 5CLLA 1EFCA 2RHMA 3I2YX 1NW4A 1NLMA 2DAPA 1NG1A 3D8HA 4ND8B 2Q6KA 4U6NA 1X2BA 2X0DA 1X9GA 4K0RA 4LXGA 1AHPA 1J21A 1VMIA 5L3QB 3U4IA 4N82A 2GZ2A 5J1TB 3AUAA 1UZUA 3Q9NA 3JWIA 1CQJA 4O2AB 1KMIY 1P44A 1S3FA 4BIIA 4R71A 3GRKA 1G5RA 4OXQA 5GJWC 4B0PA 1G8GA 3DCIA 3ILXA 5B3JA 1MTZA 3IQHX 5KVCA 5KBYA 1EDDA 3E8XA 3BMQA 1AQIA 2OL4A 3EXHC 4N7RA 4ZZIA 1NSTA 1P81A 4RF2A 4RKQA 2DWUA 3AVPA 2Z95A 3K5WA 2BIFA 2HJRA 3Q12A 1MB0A 4GGPA 3E3OA 4LDNA 4XTCS 5F98A 3PYLA 3R3ZA 3TLZA 4CIXA 4MHTA 1IONA 5ILGA 1NBAA 1X7WB 4H4EA 4UAVA 4L72A 1SC3A 4L57A 1H9AA 4XQ9A 3D3EA 4RTQA 4K1XA 1H1LA 1HYGA 1OT5A 4IEIA 4D5GA 3UMJA 5B1YA 3GPLA 1U5CA 1V2HE 2VEOA 4UTNA 3HNPA 1DZ3A 1Z2NX 4LF7B 1FDWA 3DM9B 3M4JA 4L85A 5DI3B 3OTQA 3CINA 3S2IA 3MWEB 4AJEA 9LDTA 2DPLA 1V7ZA 5TQ0B 3BTVA 4IVNA 2REBA 4XWKA 4LXUA 2O54A 4XJTA 3E0QA 3QE9Y 2GHRA 1UC8A 1B8UA 4CVNA 3VPHA 4C3ZA 1SHUX 1B23P 2FUKA 4D9GA 3O84A 2DQSA 3L7MA 2X9QA 5CT8A 1UT8A 4R1SA 3PL5A 4ARAA 3F3KA 4NR0A 3SYTA 4AZTA 1OKKA 4DR2B 3FWNA 2B8NA 2PKEA 5J2UA 1Z56C 2IOFA 2WABA 4TS4A 3KXLA 4AUNA 1GZ7A 2YJGA 2YBDA 1LQUA 3L8FA 3DBOB 2V7WA 4MCHA 2O2JA 3C5HA 1URPA 3CE6A 1U8UA 2EBWA 3LXMA 5KTMA 3GUZA 2Z9BA 4OXXA 4QXQA 2C5HA 4MLCA 4MVJE 1JJVA 1NURA 4X6UA 4DNOA 3H7AA 1PAUA 3TL2A 3GX1A 2OXTA 1G0NA 4G6ZA 4MI1A 1AN0A 2AZDA 5GV8A 4NPHA 1N5MA 3LCCA 5LQSA 1JAYA 1PGJA 4M9SA 3ND7A 1OTXA 4V1CA 1MB3A 3EVAA 2WFMA 3OT1B 1I3OA 2VNJA 1VG1A 3V8MA 1QGUB 2TMYA 5C3MA 2H2DA 2Q5IA 2EF0A 2YJZA 3I0ZA 2GA8A 5JBNA 2YNMC 3AKEA 4JI6B 1BJRE 2DPGA 1GUFA 3ZWWA 5T4EA 3GLHA 4G81A 5C8ZA 2ZUWA 1M0EA 3G2HA 2XTNA 2YDYA 3AR5A 3Q0TA 3AIKA 3D7LA 4Z2YA 4QDXA 1RTTA 5C37A 4EGFA 3K2QA 4OQYA 2FR0A 5KX5B 5HOQA 4PZYA 5BSMA 1QRAA 2I76A 3TZHA 4BE7B 3I9NA 3BE5A 3G2IA 5HCNA 2WQ7A 5KOHA 2UUBB 3MERA 2I29A 4C7VA 4CQLA 1C14A 3HCRA 3ZU5A 1AHNA 4ZFNA 3EPJA 3HEMA 4NBNA 5DTRA 4DILA 3FHTA 1GV1A 1BKDR 1RYEA 2A1UB 4H16A 4QLBA 5JXIA 4I9FA 4DLNA 5IN5A 1H65A 1SXQA 1YKGA 4HLQB 3G6KA 1V43A 1SHJA 2PQ6A 4B75A 4DJJA 4FDUA 2Q27A 4CKEB 1ZAYA 4ALLA 2XXAB 1LTQA 2FR8C 1E2HA 1G2QA 2SKDA 3JAKA 4FCCA 5SZKB 4N5NA 5JSFA 5JVDA 1Q1ZA 1RAHA 3ZVMA 1UPAA 2FJ0A 3K0HA 3DE5X 1L7BA 2GPNA 3IMEA 3I58A 1WTAA 4MYDA 4YJ3A 1N3LA 5M34A 3L6UA 4AWAA 4LPKA 4F8YA 3W5CA 3AVTA 2WPNA 2CCGA 2Q8QA 5HCIA 3SLGA 5KOIA 2NU8B 2IEAA 2ZYAA 4RGQA 3DMTA 4O4JB 3ZHTA 1HPLA 4MKHA 2IS1A 2OWEA 1FY2A 2C8VA 5D5HA 2BKUA 3MCTA 5FO1A 4QJIA 4RPIA 1S3SA 4E07A 4TMZA 1LQ2A 1SULA 2VH1A 5DLDA 4Q3KA 4E1AA 5HP4A 4BV8A 5I7UA 3A7EA 2IJGX 4YMSA 5DBOA 4B6SA 2B82A 4AX4A 5G1PA 3S5JA 5JPIA 3EXAA 1U0BB 1CJVC 1ZUHA 2CXRA 2HLPA 1Y6JA 2ZRGA 3I45A 3O8QB 5LIRA 1MNAA 2BKAA 2P2NA 3OTWA 4DXDA 1D03A 4GMGA 2BW0A 3PVCA 1SOMA 3QYFA 4WZ6A 3BUSA 4JJEA 4HH1A 1Q21A 2IA5A 2Q1WA 1DPGA 4IXTA 1ZVMA 3LBNA 1WZCA 3MSCA 4I1OA 5KYGA 5DGIA 1YFZA 3A4LA 2BUBA 4HH0A 4RPHA 2GLUA 3EIHA 4HQ0A 3UB4A 1QQTA 2JANA 2P90A 4Y67A 1O95C 4NS4A 3ROXA 1VXRA 1SOUA 1F1BA 3B1VA 4JELA 3VO9A 4QJBA 2PXXA 1QFMA 3WRWA 5AFSA 3AGPA 3BXXA 4IFBA 3CEJA 5EIWA 5I51A 1K88A 4WN9B 3H5TA 1PWZA 2ZQ5A 1RLOA 3DMFA 4D99A 3YASA 4AQ7A 2RGWA 1B2RA 1KR5A 4HPJB 4B43A 1E6LA 4G86A 1BX1A 2ISSD 4BC0A 2ROQA 4DLZA 3H8SA 3P0RA 1I2CA 2W9XA 5KU7A 3BIJA 5KYYA 3HHPA 1A5BB 3T9BA 3EMBA 5T41A 2FEKA 1KMQA 1DINA 4J0IA 1D09A 5E2BA 3SR0A 3BHIA 5DHAA 3IB6A 5ES3A 1Y37A 5EMHA 4DG8A 2LXNA 1WZEA 4INPA 3NS7A 2VF7A 2Q4DA 4N0EA 1C3OA 5EKUA 2PS3A 4ZWNA 1U7DA 2ENUA 2E7ZA 2YS7A 1N0IA 4GS5A 3EX7C 3HY3A 3K5HA 3R3YA 1TUEA 1M2GA 1E79A 2I6QA 1IB6A 2QTLA 2RHGB 5F21A 2I6GA 4JDUA 1IK4A 5CT4A 2EQBA 3E7XA 4GLOA 3V33A 5L95A 1IQ0A 4B3SB 3KAJA 5JC8A 4P92A 3L1IA 1O96B 5GP1A 3QBTA 3RIMA 4Z6KA 4LJLA 3ESRA 5JAPA 3VRHA 1DX6A 1JZTA 2OXEA 1AKYA 4O02B 2GOYA 1NM5C 1PS9A 2ECKA 1W5SA 1BW9A 3RANA 3EIUA 3THXB 1K6XA 1ADJA 5A4MS 3PGVA 1BEUB 3ZZMA 1XCJA 2RGBA 4NK4A 3WC4A 4XTRA 3R7FA 1Q0RA 3FETA 4L7VA 4TT3D 1ZOOA 3EIXA 4MQ6A 1LEHA 4HNVA 5JS6A 4NJOA 4B31A 1E8NA 1H0KA 1T9BA 2HDOA 4BEJA 4NHOA 4JBLA 1C0PA 1I6WA 4QPCA 4AIIA 3MD0A 1CVIA 1AKTA 1H0SA 1KI3A 1SOVA 1JVBA 4TS3A 3THRA 5SY9A 3RVBA 3HCOA 3L8MA 1TKBA 4UULA 4C4PA 4D0GA 4PYJA 5I8WA 3QG1A 1LK7A 2VDJA 4PYQA 1T15A 3RS8A 4RDXA 2RHWA 3H4VA 4UHCA 2O8BA 2J3MA 3R0QA 4M9UA 1J42A 1SUAA 2F43B 2C4MA 3G8YA 3GUVA 2O7SA 3DC7A 4JSRA 4C30A 3TH5A 1JU3A 1T6XA 3UUFA 4Q4CA 3NUZA 5KINB 2VCYA 4FW9A 2MDTA 1RZUA 2IYTA 3R76A 2M6RA 5EA2A 3H2GA 1TUBB 1K6MA 5JNUA 3E7FA 2QRLA 4ZREA 4ZD6A 4NAHA 1NIJA 1OTHA 3AJ9A 5E6RA 1WTCA 4DIEA 5AVUA 1O94A 1SUCA 2GRUA 3NHWA 4Y9TA 1E3EA 1JHRA 2HHCA 4QIHA 4NQRA 4B73A 5BWBA 1ORIA 3QYPA 5IAEA 4JP1A 2WC1A 1MIOA 3KD3A 1Z62A 4G8BA 4BLVA 1ZKMA 3RVSA 3EG9B 2VHZA 5ALIA 5IVDA 4DB2A 2OCAA 3G2LA 3RWMB 3WP0A 4EL0A 2FEWB 3PD0A 4KSYA 5TGTA 3ST7A 1IULA 5EQJB 3EY4A 1SIWA 2QUIA 3L40A 3ZCTA 2WIJA 1FDUA 4J9UE 4UJ5A 3UWPA 1NVTA 2QD3A 3LF1A 4R9VA 5ESDA 1ZZEA 3GPIA 5JZMA 3FFWA 1KQOA 1ZIXA 1NXWA 2OQ2A 5FNVB 3QUSA 3U7QB 4CG1A 2UYQA 4FI3C 1YKFA 1UBRS 3VO2A 4Q4AB 2ZRHA 3T5PA 1E9BA 3X1DA 5E7QA 4C0AC 2CLIB 3F7TA 1OH5A 2AGVA 1P2DA 5HF6A 4KDRA 4BN0A 2W4MA 2XZLA 3LVRE 5BV8A 1UBMS 1D0IA 3L1JA 4H1TA 4LNAA 3JD4A 1T2CA 3WO1A 3LW8A 1T8YA 3LKZA 1V8PA 1G42A 1M34A 3OQ1A 1YUMA 1FFDA 5MDHA 5L3SA 5LWHA 3P9PA 1OXVA 4DUPA 1RXYA 3C85A 3GN2A 4Q4JA 3QY0A 1NONA 3DULA 5FNZA 3GYBA 3RW9A 4TL6A 1VL0A 2CDBA 1NYLA 1OZ0A 1Z15A 3I52A 3O92A 4EZIA 3IKLA 3NFYA 4LRXA 1A77A 4BGEA 4CT5A 2PWAA 3N0RA 2HZBA 2WSBA 4NMMA 1W46A 4AZWA 2WSYB 2O2GA 1MQAA 2R6JA 3L8DA 3QLUC 2JRCA 3GFTA 1S02A 1QR6A 3KB2A 3P94A 4MVJD 3UMSA 3VH3A 3C6XA 1B0UA 1VIAA 3LY5A 3WLFA 3GV0A 5CA1A 3IUJA 2CHQA 4JJIA 2GRAA 4NJEB 2YZNA 2PGOA 1CX9B 1QKKA 3OG9A 4IM7A 4M49A 2H7CA 2DHQA 4XWGA 5JQGF 1L1QA 2JGRA 5F73A 3QEMB 2BI7A 1SG6A 1KJIA 2A35A 4REQB 2H57A 2PLAA 4NX2A 1KF0A 5B5SA 1P2UA 4A2PA 2AJCA 3SR4A 2QROA 2X9VA 3A3NA 2GAAA 2Q5JA 4U2GA 5B55A 1YDWA 4G37A 1NUHA 4O0MA 4DRXA 3ZKWB 4PZ9A 5C7LO 3GAZA 4CKCA 5B6PA 4K8OA 5IMBA 4NZZA 4N3BA 5JY1A 3CA8A 3LDGA 3SEZA 2HV9A 2YOFA 2J5BA 4FWBA 5CW2A 5A1JA 2QDKA 1EDEA 3MJCA 1EE1A 2HXYA 3INTA 1RT9A 3KKPA 3KHSA 4PU0A 4UEOA 1PFYA 1YJBA 3VU1A 2VHTA 4RY2A 5KNCH 2LBPA 1A50B 1TECE 3P1JA 4EY8A 5C32A 4XW2A 3FPBA 2OD9A 3CEHA 2TECE 3OZGA 2QVGA 4D6XA 4IHJB 3UGKA 1DNPA 4KR3A 3NQ41 4O25A 3RS9A 5I4CA 1RKQA 1U4NA 2ANBA 4TV8F 2PMKA 3WGMA 2FDRA 3HVUA 1GJRA 2V6GA 1UMBA 3DEIA 4JHLA 3BCHA 1GUBA 1UWKA 2D4AA 3Q9UA 4TWRA 1MQ8B 1W47A 1YJAA 4Y30A 3WYGA 2PIAA 3I8XA 3SGLA 1TJ3A 2B2NA 4PRYA 4Y0NA 2B25A 5BW6B 2DHRA 1Y89A 4GXQA 2FP4B 2X22A 1LSOA 3C5CA 4CT0A 1S9DA 4IJQA 1B6RA 5BWMA 2F2TA 2F9MA 4O2RA 3NPMA 1PL7A 3L9XA 4QGSA 4BY9E 1WBDA 3EOBI 3KTFA 4Z9YA 3X1MA 2AFIE 4WZBA 1A9QA 2AD5A 5DB4A 2WUEA 4XQ0A 2VYCA 4DMKA 4QJ3A 3LNTA 1VHJA 1THGA 4EAQA 5AW3A 5KDOA 5M2QA 4G4JA 4BXOA 3VU8A 3WDKA 3WICA 1MAVA 4O1HA 4RORA 4I1VA 4NENA 2PZFA 1U8FO 5ALDA 3AHIA 2VDRB 1GRCA 3WLSA 4RWEA 2P40A 2WYWA 1CKEA 1T3ZA 5BUZA 4KG7A 2ZPAA 2XCIA 3PNPA 1N9GA 2HIAA 4WLFA 4OMCA 2EX4A 2GKGA 3A26A 4F3RA 1QMGA 1QUEA 1NYQA 1EWRA 4NY1A 4DQKA 4L1KA 3AO0B 2OQVA 3GFRA 3HUEA 4JAVC 4AI6A 3JRWA 1C7IA 1FBTA 3L8YA 4QJ5A 2QSZA 3IESA 3JY6A 1Q1GA 3CVXA 3ZGZA 4ROSA 4G0QA 4AKEA 4YAGA 4RTPA 1M2OA 1VJGA 2Z2ZA 1ZH8A 4DCNA 3H9BA 5DNYB 5AJVB 4ON9A 3QVTA 1R74A 1ATZA 2CXPA 3TPFA 2VP9A 1I7LA 1I6LA 1QH9A 1UBNA 1ZD1A 2GBIA 3K0BA 2VAXA 4CJXA 4CWAA 1FZTA 4OU5A 2X5OA 1CJUC 1KZ1A 2V58A 5ALMA 3IRVA 3NNSA 4BFWA 1JYSA 5E3IA 5GVRA 2XDAA 4H6WA 4RWZA 1ZOLA 2XVXA 3K53A 4GE0A 3SZOA 3OCWA 1ADYA 3R23A 3C5EA 1YCHA 3EVBA 3LV8A 4NEGA 1M7HA 4U8GA 4E5SA 5BR4A 4KFCA 1LB1B 3VXKA 1D2EA 4ZO8A 2DC1A 4N8SA 3AXSA 3L7CA 2R6HA 3RRXA 1R8JA 3L7DA 3QA9A 3D8RA 1KIMA 5TEWA 5D00A 4TVOA 4MAAA 3BMNA 1GNTA 1TM1E 3AX6A 4RQBA 1XN4A 2D54A 5IK2D 4BCDA 1SKQA 1Y7PA 2R85A 4OHWA 1QHFA 1LPSA 4LE1A 4NFHA 4WT7A 1L8OA 3VPXA 4D8VA 4W5NA 1IN4A 1H6CA 1E6MA 3AP2A 3IFSA 3EAGA 3OKPA 3PQCA 1JXMA 1J23A 4GZLA 4ZRMA 1SKMA 3IEXA 3ED5A 4M6WA 4Z7NB 1DAMA 1JDJA 1XE3A 2A67A 4JVLA 5ALQA 4L5CA 3GYGA 5J2UF 3KZKA 4DMHA 4NYJQ 3LQQA 1SJ9A 1MB9A 1X1QA 1L3BA 1XZFA 2D62A 1DL5A 2ZB8A 1A9TA 3A3KA 1CERA 1GZHB 2ORWA 4WH0A 3VR0A 5B7QA 3QFRA 4UM9D 3O82A 4Y3UA 1UC5B 1O89A 2WYHA 3INYA 4ZCIA 1WEHA 2PEYA 9ABPA 3QLJA 4LY9A 1YRYE 5F78A 1GTMA 4CCWA 2A0FA 4NBRA 2DLCX 3OCXA 3AP1A 4HNRA 2IP2A 4A16A 2OPBA 2BMDA 3QQ5A 1M8GA 2QX6A 4GNKA 1U1IA 2NT4A 5GMOA 3UJ3X 3GFOA 4RMGA 1ZNYA 2O05A 4AMVA 3R7WA 2LE0A 4AICA 4AVYA 4B4OA 4LFAB 3ER8A 2JAWA 1ABBA 3HU1A 1RTKA 1CUUA 2NADA 4KWTA 1SBCA 4COKA 3D6UA 1EK5A 3SQDA 4QFMA 3PX3A 3QU7A 2LDXA 4D1YA 4B3HA 4EW6A 3EHEA 3KEGA 4DIUA 3NC0C 4YLGA 1A8UA 1RLIA 3MWGA 4HLUC 4LW8A 3WBFA 4IIDA 1MVOA 1ZCJA 2JD0A 4LSGA 5EP4A 3MQFA 4H7PA 2AQIA 1Z34A 4KAAA 1CUBA 2DPMA 1PQ4A 4XFDA 2HOQA 2Y93A 2H2GA 1DX4A 3PHLA 4DEYA 4D4LA 3NVKI 1G8AA 1SMKA 3IJEB 2F90A 3OZEA 2GR9A 1PZMA 4FXOA 2YWFA 4BP9A 1FFEA 1YQQA 4CXMA 5K0TA 5LIPA 2VQ6A 1Z2CA 3WS7A 3HGMA 3R2JA 5IKEA 3ICQB 5A04A 2BCJQ 5ALXA 3VHRA 1IM5A 2E4WA 5JVDF 4EX6A 4TYYA 3FSJX 2QTWB 2JIZD 1EXDA 1MPTA 4N5HX 2J3LA 2QX9A 3MB8A 2NTYC 4W5WA 2GKOA 4YJ3F 3RVDA 4B85A 1HT0A 2RHCA 4M9RA 3VPDA 1FQWA 5TX7A 4AS2A 2OCGA 3D4NA 4OGFA 1ZD4A 1LJ8A 3R24A 1PEAA 3WLPA 3BH6A 1QOQB 3ZV3A 1XQXA 1ZLYA 2C7GA 3LX8A 4PTZA 4IFEA 1Q17A 2H2AA 2CXHA 3ECCA 3IOMA 4RAOA 4WK0B 5EOVA 3W6OA 3WIOA 4E6EA 5HYVA 1PVOA 1OR8A 2AEMA 2C7RA 4WJZA 3MEQA 1BSVA 2V6MA 1PJRA 3MWDA 5B2FA 3T95A 1AV6A 2XI4A 1G1AA 1GD1O 3KOYA 4B9AA 4YRLA 1PW7A 2VP3A 1ZQ1A 2BTOA 4AU1A 4E15A 4HT3B 5JSZB 4R8LA 1QIDA 3IIEA 4TS9A 1UKVY 4MUIA 2JF0A 1DTEA 2WUVA 2HFKA 2NGRA 3K0FA 5FEMA 4EL5A 1N6LA 1MT3A 1OBVA 2WJGA 3C4QA 3RHSA 3MT9A 3PUKA 1W1UA 4Q3EA 2Z6AA 2PKCA 4CHGA 5D01A 4CLRB 2H9AA 2VRNA 3VZPA 1YI1A 5JCJD 2O8FA 4A23A 1U98A 2P6MA 1W581 4CN8A 1FMCA 1O9GA 2PYDA 1YI0A 4QDJA 4B9EA 1AB5A 1CUHA 1ZH4A 2ZPTX 1ID8A 4IOMA 3P96A 3DMHA 1CZNA 3KQSA 2NZXA 4JNKA 3KZXA 3J7AC 1Z5OA 2ZQYA 4HJRA 2J32A 2WF5A 3UHJA 3VSCA 2P65A 1XZMA 4FWIB 4LQLA 4ZT3A 1ZGGA 2QIOA 1SIUA 2VJMA 3FJOA 3PHHA 4IIBA 4WMLA 5TF4A 3TI7A 5CH5A 1SCJA 4I4TA 2ENWA 1GPJA 1MG0A 1MOQA 4OHXA 4JA2A 2IBMA 1SQ0A 3K9BA 3ZDZB 3RLIA 4BUCA 3QFCA 2R4TA 2AWNA 1Y4SA 3IULA 3NWOA 4IO0A 2D0DA 1P5RA 3C3BA 4LHEA 4TT3A 1FX0B 2NUAB 4KH0A 1KOFA 4BFXA 5B6JA 1KY3A 2E55A 4FUQA 4XD2A 5EY5B 3NBAA 4PONA 4BJHB 3PDJA 3KQQA 1M8FA 1YBAA 2QMQA 3A4YA 3C16C 3EDQA 2VNHA 2C97A 4OY3A 4QECA 3VV2A 3ZGVA 1KWKA 3NOVA 1XMOB 2PUEA 1EHYA 4C6HA 4J29A 4LF8B 5HZHA 3UXEA 3VDRA 2HYDA 1YRLA 4EO7A 1BQEA 1SCUA 4UBJA 1VL1A 1CNEA 4L76A 3PFGA 4YWHA 5KQGA 4FT2A 3K70B 3PXDA 4JROA 4YS6A 2G80A 3FUVA 3OEEA 3WIBA 4A92A 4F84A 1NJ1A 3Q8LA 2ZS9A 3ZGOA 3B70A 5D7NA 4KBYA 5HQ3B 1ESCA 3RHTA 3TRDA 3DKKA 4KDCA 3HCPA 1M1NA 4E03A 3WGTA 5FEUA 1ZM7A 3Q40A 2PZKA 1Q95A 2XKBA 2YVAA 3GEGA 4WIAA 3AF6A 1X7ZB 4XDHA 3WB2A 4H27A 3AEKA 2JFNA 3DEJA 2JAUA 3WHKA 3WGZA 4DDMA 4DIBA 3GDWA 5F51A 4BOYA 4HGQA 1HT1E 3ILVA 2GX6A 2B61A 3BMOA 4ZYTA 3TIGA 3WWYA 1K6IA 1QHGA 2QLNA 4OAPA 4DTCA 3KX2A 2X3YA 3A4VA 4MRAA 5U1PA 1DUSA 2PS0A 5ECDA 1W0KD 1XTUA 4KUHA 4BUJA 2QU8A 1RHMA 4DRYA 2P9FA 3V8QA 2XTMA 2O52A 4QTTB 5IARA 3CZCA 2HUNA 1CUEA 3QF7A 4Q7MB 2IYQA 4ZEXA 4CEJB 4BWYA 1NI5A 5BV7A 1D07A 3KXDA 1SBQA 4S24A 2JJ8A 1GIAA 3IQIX 5F7XA 3H99A 4JV5B 3T52A 1V4BA 1J33A 2FZ5A 3QFHA 2IZ5A 4MZXA 3D0OA 2OHJA 4F9GA 4YJ2A 1XZJA 2XB9A 3F2VA 3F6SA 4GWLA 4X65B 2GESA 3WRVA 1RMYA 2DU8A 2WT9A 3CZMA 2N9UA 1IXSB 4QX6A 5EMNA 1NC3A 2QLJA 2X7JA 5TPWB 1HL7A 2PX5A 3ETHA 4CLOB 2OCYC 3LWZA 4JMLA 1R3DA 2R47A 3U9TA 1DOZA 1WABA 2YYSA 3I61A 1JHVA 3AOEC 3EZGA 3HR7A 1L7OA 1JIVA 2V8OA 3QWBA 4BMNA 1KJ8A 2WPDD 5C53B 4RIFA 1GZUA 1R5JA 2ERYA 5ENVA 2HMWA 5LU9A 3A6PC 4BB9A 1OWPA 4KVAA 4P81A 3ZWYA 5I5EA 2F8LA 4EATA 2MCFA 4GOJA 1ACJA 4MVJA 1CQPA 2QTCA 3KQOA 4NLLA 5EIOA 1VGRA 1PS0A 5CX1B 1PUJA 2CJWA 3GFBA 2YJNA 3LH5A 1ZL0A 2ZBPA 1T5HX 1IVSA 2IHNA 5EC8A 1UC4B 2VSNA 1WUIS 3LLSA 1II8B 5EHNA 3H13A 3G5UA 2GCOB 4OHBA 4RHFA 2NTEA 5DCLA 4HC4A 2XWBF 1KC1A 4TLAA 3SX2A 3CH5A 3DPSA 2G17A 1OVMA 1TEVA 1G3MA 3JVEA 3VDNB 2BH9A 1HI9A 4F06A 3GGOA 1IH8A 1WXIA 2VAMA 3LT1A 4ZV7A 1R6XA 1Q7GA 3KUXA 3ADCA 5AK4A 3VNBA 4GI1A 4L9AA 5B7NA 4RTMA 4TM8A 5D2CA 3LX6A 1ONBA 2V3VA 3WYAA 1NSFA 4IGEA 4JBGA 4O08A 2NOAA 2O2XA 4HYYA 2H29A 4BZQA 2VLIA 4IMPA 1PZHA 4GX2A 1FRNA 4HATA 4Z4CA 4P35A 3RCBA 3CF2A 4V39A 7MHTA 1EUDB 1ESDA 3WADA 3ZY4A 4E4YA 4PGHA 1HTTA 4QQNA 5CA1F 5JSUA 2AJBA 5F23A 4N76A 2BFBB 3FCYA 4LCBA 1D6JA 3RYHB 2GBLA 2GZRA 1TQ4A 2VOEA 4P22A 4EA9A 4GL4A 3EZ6A 1KYXA 1BYIA 1SHLA 3HH8A 4GI3A 2PIDA 4J0FA 1VBKA 2BGNA 4XRGA 3DKPA 3ETLA 3K1JA 4URUR 5C8YF 3NAMA 2QV0A 1H4VB 1HDEA 3RK1A 1UJ2A 3VH2A 2N1MA 1YB1A 1FDOA 1JPUA 4G5GA 3RC7A 1YOBA 3W5JA 3DOOA 2PMBA 1VMKA 4EG7A 2IU0A 2OBYA 1XCBA 3TLEA 2WAOA 5U4QA 5IJ9A 3QPCA 3JVIA 4TQUS 4RGVA 4BVAA 4UTRA 1Z82A 4ISCA 1NR7A 2VDMB 3ZBPA 1DX9A 2OILA 2QI9C 2W8ZA 4NOMA 4CM4B 1XA0A 5EIFA 1PLJA 2E18A 2ACVA 4Q4HB 1YA8A 3B6JA 1CCWA 3M82A 4KUEA 1HM5A 4MR7B 5CT9A 1E3SA 3Q7EA 3VZBA 1U04A 2R2AA 4CEIA 5A9SA 2JB9A 3V1YA 5BMVA 3JATA 2JASA 4KPUB 1H8ED 1D1PA 2AD1A 2AMYA 3JWGA 1OI2A 2F8TA 4NBLA 4Q3OA 4J3NA 4TRRA 3GDOA 2JLXA 5EMKA 3PS9A 1ZBQA 4QNMA 1JKXA 1Q91A 4MGKR 4UUMA 4XCVA 3CNQS 3V8VA 1H3FA 5F1KA 3A8TA 2JVKA 3GUYA 2V0NA 2PKXA 4HAWA 3KUUA 3QPWA 2XCSB 2D2XA 1DAEA 1TW3A 2VUSA 5HNKA 3E8SA 1K92A 1ZC3A 2QLTA 3GELA 1PJLA 2EGHA 2JFUA 3U2QA 4ABTA 3A6HA 4JUAA 4R2IA 1PUXA 1OAAA 2GARA 2GBFA 1N2OA 3OT5A 4RFLA 4EYSA 1NY6A 2J6BA 2B35A 1E2FA 4MK4A 2YINC 4XCXA 5HF5A 3RLFA 3SJUA 4Z9BA 1FLVA 3VU0A 1W19A 4J8PA 4UHEA 4BKPA 4L3VA 4B2IA 1NDQA 3QLVA 3IEMA 1ES9A 1K3UB 4FMDF 4X8HA 1ZVQA 5EKSA 4F86A 5JZBA 1G5IA 4CIWA 2OEPA 4G2TA 3G0GA 3H86A 2WG2A 4J3JA 3UCXA 3HWSA 3NGLA 3OM8A 1Z4IA 2Q2WA 3R6LA 4IX1A 5BYAA 4YCAA 3WNVA 3AY6A 5DX0A 1GTSA 1MUUA 1UZAA 3CRNA 3R20A 4WKCA 4OI2A 2A88A 1PFWA 2H59A 2FW6A 1KI4A 3MJ4A 4FOLA 2C1EA 3RBAA 2GCIA 5HM8A 2IODA 4X9XA 2REOA 3AQ4A 5B1DA 4M36A 3ZW7A 1F17A 1FTSA 4F4HA 4PN3A 3S8EA 2EDCA 3GEDA 2QN6A 1QFJA 1Y9AA 2W2LD 4L16A 1FMJA 4MWEA 3UXMA 2QR3A 3TVTA 5IK2A 3U61B 1XCLA 4L0DA 2ZYSA 2XMGA 4HFNA 3FOCA 1FYXA 1N1MA 3KR0A 1U8CB 4TZTA 4OXKA 3OCZA 4YROA 5T3YA 2P9CA 3GB9A 4UASA 4XIFA 1XZ8A 2JEYA 3IPAA 1P4AA 3AFHA 2XRZA 1Y82A 2C2GA 5BQ5A 3PUVA 3CF0A 3NOOA 3ZWDA 1LC0A 2J0SA 2P4HX 3SIRA 4FCVA 5JI2E 2OP0A 2XMZA 1EP1B 1ZD2P 3WZ2A 3ZX5A 3W3ZB 3N7UA 3MMNA 4FR5A 4KLRA 4KBGA 3PTAA 1GDTA 2P2LA 5LB2A 2F3QA 1ADBA 3PXCX 1XD8A 4UBLA 5KO2A 1WDLA 3I1IA 4CKZA 4OOEA 1D4AA 4O4IB 2OHOA 2XXJA 1NWHA 2IOFK 4LKOA 3OOEA 4OFXA 4J91A 3OLCX 4OI1A 4YBZA 4NZNA 4BNVA 4EP1A 4Y1RA 1ZNQO 1P39A 3ZCRA 3VOBA 1ECLA 4C0LA 5JADA 2GM4A 2YHIA 3N5CA 4KQXA 4LJYA 3X1WA 2H9YA 4UNPA 4X8LA 1PBTA 3FRIA 2WV9A 3ZNOA 1MX3A 3AW8A 3G8BA 1SQ6A 5CJJA 1BDIA 1ZONA 2D13A 3D3WA 3L4BA 3AHGA 4KSBA 4WNCA 2QUJA 4LMRA 2PUJA 4AUEA 4Z54A 1SIOA 1PGNA 3TJRA 2BDEA 2NWQA 2DULA 3LLCA 3OWXA 4KMRA 4MV4A 4OLFA 1XMIA 1G21E 3HCCA 4I9NA 4PWYA 4EKYA 1I2DA 3G23A 4WEOA 5BMOA 1XQYA 3ZI7A 4WJLA 3B9PA 1XRNA 2BHLA 3WY9A 5DGCA 4OKIA 1EFPB 4DADA 3ISTA 1D8AA 4LJ4A 3DD1A 2C0CA 1BHO1 4NBUA 2P91A 5KYKA 1OD6A 4FOTA 2GF2A 4Y6QA 3O26A 1HO3A 2C4TA 4JUIA 5TLSA 1PJ4A 4FX2A 4OAQA 1XA3A 3JYOA 5CB4B 1G20E 3MINA 3NH9A 4ER3A 1FRVA 4UMFA 1WDKA 2FWMX 5BSHA 1IN7A 3L7BA 4NFLA 2JIZA 2PA0A 3RO7A 4DR4B 4I14A 4PYRA 4ZKDA 4EJSB 1FFWA 1A88A 5EL0A 4IQFA 1AGXA 1P2BA 1WMBA 3TUJC 3TQHA 2C9MA 2M32A 4GGMX 4HLCA 3P2YA 2DWCA 3QOWA 1PJAA 4CM5A 2XA1A 2NV6A 3I2JA 3RDPA 2ZB3A 1T2FA 1QE5A 2O7NA 5JMWA 3T3OA 1HRDA 2GHTA 4Q48A 5KWSA 1X87A 3SYRA 4BNFA 1HV8A 1PL6A 2RGAA 4KDFA 4PLZA 3KQKA 2IS4A 4RY0A 3TKYA 1S01A 4C20A 3DDCA 3GLGE 4TVSA 1H2HA 1Q7RA 3PDIA 2O50A 3TJMA 4PYIA 5C8DA 3QEAZ 5E9WA 1KDRA 2DUMA 1JLLB 2NO4A 2FH5B 1GLGA 3GUUA 3LO8A 5AK3A 5EZ6B 3OESA 4ND7A 1QDUA 2VCEA 1WB9A