3EDQA

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edqA00
1RWKA 2QL5A 4N6GA 3R5JA 1SC1A 4IEFB 1I4OA 1RE1A 4QUGA 4DCJA 1RWVA 1RWOA 2C2ZA 2J32A 5IBCA 1RHMA 2WDPA 2CJYA 4QU9A 2CNLA 3EDRA 1I51A 3EDQA 4QUDA 5IAKA 5IARA 1K88A 2C1EA 2FQQA 1QTNA 2QLJA 4ZVOA 1QX3A 1I3OA 4QUBA 5IBPA 4FGUA 1RWNA 1NMEA 3D6FA 1RWWA 3R6LA 4HQ0A 4QUHA 2J31A 5IAJA 5K20A 2QLBA 4JJ7A 2XZDA 3H11A 3R5KA 3D6MA 4NOKA 4EHKA 4NOLA 2H51A 2XYGA 4HQRA 3V3KA 3GJRA 1RHRA 5H0IA 2CNOA 1NW9B 1NMSA 2P2CA 3GJSA 4I1RA 1PAUA 4JQYA 4D3XA 3ITNA 2H48A 3IBCA 4EHHA 3DEIA 2H4WA 2Y1LA 4DCPA 2HBYA 2K7ZA 3DEKA 4JR0A 4NBNA 3SIPA 5IASA 2XZTA 4EHLA 4IYRA 1SHLA 4N6OA 4N7JA 4PS0A 2H5JA 4PRYA 2J30A 2C2OA 2XYHA 3V4LA 1NMQA 2HBZA 1RWPA 2H65A 2XYPA 4FXOA 5LUAA 4AW9A 3NS7A 1SC4A 5I9TA 5IC4A 3K7EA 4AWBA 1KMCA 3RJMA 5IABA 1SC3A 4EJFA 2DKOA 3IBFA 4PS1A 3H13A 4JJEA 3NR2A 3D6HA 4EHFA 4QU0A 3P45A 3SIRA 4DCOA 5IANA 3KJNA 2QL7A 3PD1A 3PD0A 4NBKA 5IAEA 4EHDA 3UO8B 4AWAA 1I4EB 4QU8A 5IBRA 5IC6A 5LU9A 3S8EA 2CDRA 1PYOA 4FEAA 1QDUA 5LU8A 2NN3C 3R7BA 5JFTA 4NOMA 2C2MA 4I1PA 1RHKA 2CNNA 4D3YA 4JR2A 1RHUA 3GJQA 4QTXA 3QNWA 4N6NA 1RHQA 3H1PA 3UOAB 2Y0BA 3BIJA 1RWMA 3E4CA 5LUBA 3V55A 4PRZA 4HVAA 3R7NA 4FDLA 4ZVSA 5IAGA 1SHJA 2QL9A 4QTYA 4N5DA 1M72A 1CP3A 1CVRA 2H4YA 2J33A 2FP3A 1RWXA 3V6LA 2HBRA 4D3ZA 2CJXA 4ZVUA 3H0EA 4N7MA 2CNKA 3GJTA 4NBLA 1GQFA 3R6GA 2QLFA 4JR1A 4ZVRA 3R7SA 2C2KA 4QUAA 2AR9A 1ICEA 3OD5A 1F1JA 3KJFA 4QUJA 3V6MA 4LSZA 4QUIA 3V4OA 1JXQA 1RHJA 2HBQA 3PCXA 4QULA 4EHNA 1K86A 4JQZA 4ZVTA 1F9EA 1BMQA 1IBCA 3DEJA 4JB8A 3DEHA 3P4UA 4QUEA 4EHAA 3H11B 2FUNB 4QU5A 1GFWA 4ZVQA 3KJQA 4ZVPA 2H5IA 5I9BA 4NOJA 3S70A 2H54A 4JJ8A 4M9RA 3NKFA
chains in the Genus database with same CATH superfamily
1Z45A 1QPBA 1R8XA 3L7CA 4Q7JB 4Q66C 1MMFB 1N2CB 1VJDA 3OPYA 3QX7A 4KAJA 4HYTA 5DXFA 5FNVB 1A3CA 3W1VA 3DBRA 1Y3FE 3TEJA 2P4SA 2Q2WA 1PUJA 2XNKA 3OM0A 1MBZA 3PJDA 1JZTA 3G8BA 3QXSA 1NG1A 5JRDS 3I01A 5BT9A 3ZZ1A 2ZIFA 1M6WA 1HRDA 1GZVA 1V2HE 1YB1A 1NPTO 4H7IA 5D51S 3RYFB 4DRXA 1E2GA 1KA9H 3UWKA 2WZDA 1QORA 2MIIA 3LCUA 4QBGB 4R41A 4CIDA 2YFHA 3D3QA 3CBQA 1I10A 2Q5CA 5E38A 2GRAA 3UMVA 2C57A 5ARCA 5EHIA 3L4SO 2YHIA 3KYIB 3RIHA 5J4VA 3KQNA 4IIJF 2DT5A 2O0LA 5GV7A 1UBHS 4G0VA 3OLVA 5C7IO 4FLMA 5K99A 4EG4A 4TS9A 5ALVA 1ZHFA 2J4CA 4C5CA 1LWOA 2YXPX 4UNNA 5AQ1A 3H8VA 2WVHA 5C46F 1HNNA 1GLNA 2C42A 4OAPA 3DC2A 4G85A 1V8DA 1E92A 1LS1A 1DAKA 2I3BA 5AWFC 4PLYA 3UGQA 5T7BA 3PWTA 4Z7JA 1H4TA 1G59A 1M2FA 2R8EA 5GQSA 4GMFA 1C7QA 2BZ0A 4Q01A 5FF9A 1CDDA 2IYQA 3AVYA 1YE3A 3G9XA 1JDSA 4MA4A 2GR9A 4GRAA 3G59A 1R4AA 2AMJA 2C4WA 1P4JA 4R9UC 5BSEA 3V8BA 1ILWA 1MRNA 4LJ9A 3SE7A 5DM2A 1TE2A 1OI4A 2YWFA 3PGMA 4OHXA 4L22A 4O4IA 4U2EA 4COOA 4DTCA 821PA 1WNTA 1UMDB 2IS6A 1FLDA 4YEDA 3C70A 3SEQA 1GNQA 3OKAA 3T34A 2RGEA 4LWPA 3NB0A 4ZTBA 2RK6A 3SXPA 3VHRA 4X6XA 4HTFA 4ZAZA 5IJZA 1A5TA 1IY2A 3TJZA 2EARA 2W6IA 3IUQA 5EXPA 3DZKA 4O4HA 5E4TA 4E51A 4F1JA 3LX6A 5EKDA 2XAAA 4TKMA 4Y6RA 3KQWA 1UWCA 2RAPA 1UPAA 2WG0A 2ZIAA 1DCKA 3ANTA 3BIJA 3B1ZA 4ND2A 4CUZA 3ICEA 2I1QA 3L6UA 2VDJA 4U7GA 3KZ1E 2V7WA 1SOAA 2C99A 3MAGA 5BSUA 2H0QA 3TXYA 3S2UA 1LTKA 2FP3A 3OCCA 1V41E 3ER6A 1XZDA 1FS4A 3IOMA 3SR3A 5BV7A 1X39A 2QAGB 1R5OA 2LTAA 1ZS9A 1VHJA 4B83A 1OT3A 1FA9A 3BBLA 1MQ8B 3R3SA 5F9FA 2QNIA 2C3OA 2W8BB 4BQIA 1SKQA 1T1RA 1DHRA 1V45E 2K2QB 5T41A 3N0TA 2HJSA 4IIYA 2ZCJA 4QFMA 1TW3A 4OYLA 1D09A 5L53A 5AM2A 1TUEA 1ORVA 2VHTA 4QU5A 3ZS9A 4BYMA 2BYTA 1ZSVA 4KO3S 1OXMA 1U2DC 2GVNA 4RCZA 1OI2A 2CJFA 5T3YA 2MCFA 1KI1A 5C9ZA 3K70D 4GMXA 4UARA 4Z4CA 4ZP1A 3STUA 4D99A 5IS2A 2YV2A 3AZOA 1U81A 2FSSA 5AW5A 1S89A 4F85A 2QORA 1GNTA 1FVOA 2N47A 3IBGA 5TR9A 4YAGA 3DA8A 1R0CA 4LRWA 3HUFA 4CIVA 5ALNA 4LGCA 4NAVA 1YIDA 3OPYB 1MEEA 1YB5A 1I2MA 1U4NA 2PQ0A 4MI1A 5IJXA 4AMUA 2QV7A 4ENTA 3FAKA 3IMGA 2G9ZA 1X7XB 2AYXA 3PHJA 4FWIB 4HWGA 5BWBA 4CCAA 4FCCA 1IY0A 3UV6A 3OA2A 3D1LA 1XLTC 4U7PB 1N33B 4KHPB 3F9CA 4DBLE 1VRVA 3TDMA 4FX5A 1CQWA 4AS3A 2H51A 4AY6A 3BZWA 4KV7A 3M6MD 4YBZA 4BNJA 1IY9A 4UMEA 4AYWA 1V39A 3NFRA 5KKAA 3THYA 1WLYA 4R2WA 2WQ6A 1L5ZA 1QPGA 1I36A 4Z4HA 1OOEA 3T7IA 4EG1A 2IIQA 1IBKB 2VN8A 2H2DA 1OZAA 4QNMA 4YV7A 2PLFA 3QKRB 2XGOA 5IASA 2NV2B 3C3PA 3X1YA 1Z74A 4PS0A 2ZRIA 3MPUA 3ABZA 2MHCA 4Y2RA 1YFJA 3E4DA 1RC1A 3QY9A 4F56A 4PRYA 5JWHA 2ZJ3A 4S05A 3HJNA 4KR9A 1EAYA 2C59A 3WGOA 4FOSA 3BMOB 2ZWMA 1OFVA 3ET4A 2A14A 4WLVA 1U5CA 4JB0A 3WLQA 1OU4A 4CKCB 4RULA 3L8EA 4YCCA 1TT7A 2IXDA 2WBLC 4IHQA 4RADA 1AGXA 2WWVD 2IZZA 3CX6A 3L4EA 3MQ4A 2OMKA 1L5GB 2FPIB 2AMLA 1K8QA 1NVEA 4HAXA 3UF0A 5KNBD 4RVDA 4LHSA 2PWPA 4BRUA 5EZYB 5AM3A 1VHTA 1AE1A 2VKTA 2QQ5A 4J90A 1Z5ZA 3K0HA 1W96A 3GCWA 4QQKA 2ZR8A 3WYEA 5K8IA 5IN4A 2BMWA 2G6BA 3PIDA 1V8ZA 3T7AA 1SC9A 1U2QA 4TMYA 3C0KA 4LY9A 1A5SB 4ZO7A 3R7BA 3MMNA 4I99A 2PANA 3E1KA 2QMQA 4NFLA 4AKTA 4J6FA 4G9GA 2VPYA 2VP6A 2VWHA 3MEQA 5JSYA 4ARZB 4Z53A 3L92A 2QDKA 3N8NA 1KHHA 1P9OA 5D6NA 1KARA 1WPGA 3G5AA 4O2AF 1C4OA 2ANBA 1BXRB 1WQ1R 4YQEA 2KQUA 2W48A 5K0EA 1EINA 1BS2A 2B2NA 2I2CA 5AKXA 2ZSDA 4M1OA 1UWVA 5F5NA 3CZ5A 2UXDB 1Z5VA 2CXUA 3HJRA 1CUDA 1QK5A 1VLLA 2CDAA 2CNKA 3DL2A 4KXYA 5DHUA 3U13A 2HTFA 3OI7A 1Q0HA 4Q21A 2R6GA 3T5GA 4XASA 1V8FA 2I99A 3D0QA 2FN7A 4WRRA 2RE8A 4B33A 4C87A 3I34X 3A6DA 3AWDA 3V46A 5A5EA 3NBMA 1XQWA 4KWCA 2W0MA 3K0EA 4OX9B 2J9FB 5K0FA 4YX9A 3CEPB 1IH8A 5BSRA 2W2KB 4GI3A 3KELA 1XC7A 4NAUA 3WAJA 3E48A 2O8VA 5G1OA 1E3DA 2Z09A 3C3EA 4I55B 5BWCA 4XPIB 1HXHA 3HN2A 3O7WA 3TRDA 3NHBA 3TBHA 2V9PA 4ZT2A 4A5SA 3U80A 4GGMX 1ZRSA 3QMVA 2Q3CA 4RH0A 1P9NA 1C7EA 2VHUA 3HUDA 4JZKA 1KDVA 1C81A 1QAOA 3WL6A 5F98A 3MJTA 4BAZA 1K75A 1XPJA 4V0KA 2SICE 3FVWA 2WTUA 10MHA 4C0SA 1L4GA 2H2IA 2RG7A 1L5LA 5KI6A 1YVEI 1PR9A 5SZKB 5I4KA 1E4EB 2WHPA 4DRYA 3CUYA 1RWNA 3T7DA 5JD4A 4PNEA 1HZJA 1UBRS 2OKCA 4CM1A 2XITA 2Q6OA 3V8RA 2J5RA 1JLHA 2J6BA 4Y1FA 4GO1A 4BQPA 1Z5NA 4DLBA 3QPDA 1NW9B 3HR8A 1VE9A 1V0JA 1R10A 3L6EA 1Y8AA 1R64A 2O57A 3BH0A 3SJZA 4EB6A 2PS3A 5A05A 2W90A 3PWSA 1A50B 3WMFA 4CE6A 1M1ZA 1N5JA 1JFTA 1UCFA 4HWRA 2VDLB 2P5YA 1BXGA 1D6JA 2YDXA 3DZHA 2ALJA 4TRNA 2IJGX 5EIFA 3D8NA 3WGYA 5FKJA 4DPKA 3TL3A 4D97A 4H7KA 4B40A 1N3IA 3U9LA 5EJGA 4ZALA 4E5NA 1EKXA 2EP5A 3IUSA 3HY6A 3IMCA 3KKNA 2AGVA 3OZRA 4MCIA 3SJUA 3MTDA 3T5TA 1LJLA 4L6CA 1A9TA 2KBFA 2MYUA 4PAGA 5CHEA 4MB2A 2R6ZA 3WLOA 1V5FA 1D8AA 2G6TA 3SLGA 3U3XA 4EJMA 1N6OA 3EIEA 1KSGA 4DT1A 3OHMA 4E03A 5AW3A 4FGSA 3GP5A 2R66A 3MA0A 4PBRA 1Q44A 2QUAA 1YQ9A 1Z22A 3FPKA 5HQ3B 1STOA 2JHPA 3K9HA 4DMHA 5MFPA 1KAHA 4YJHB 4HWPA 4NS4A 4P5PA 2Z58A 3LMKA 3DKKA 2JAQA 3TIFA 1GKYA 2VG8A 4B4VA 1WSAA 3I9V6 1ZA2A 2BVNA 2VATA 4D81A 3TIIA 4I3FA 5EWJA 4FD3A 1SY7A 2QUZA 4DLXA 4E1BA 4R83A 1X1CA 2V6MA 5C4IA 3LF1A 4HN4B 2PKXA 4TVBA 1FSZA 4L0CA 4WA8A 1OXTA 1JEEA 2PN1A 1PJ2A 2HYDA 2PX3A 5EYPA 1N1EA 3OZWA 5AJYA 3U2QA 5A5DA 1ZRNA 5JVDB 3FIUA 1Q5PA 2VNAA 2ENWA 1I9GA 1NI3A 1T6ZA 1U28C 3FI9A 4GBMA 4C88A 1IZ7A 2DJIA 4OBXA 1H23A 4B32A 2PV7A 2C8KA 1J23A 2GHIA 2H4YA 4GPTA 4NDAA 5CK4A 3UFXA 4DGQA 3EAGA 1QB8A 3RC3A 2VF8A 3N2EA 1DJPA 1HPLA 2F64A 2G06A 3FPLA 5JRJA 1G3RA 3OESA 5LP6A 1LCIA 2GK7A 3W1EA 1SOMA 4OATA 3RADC 1I1NA 1SURA 2DM6A 4LCBA 3TLKA 2XUQA 3KPJA 1WMBA 3PJGA 4QUJA 1YQQA 1POXA 1JJIA 3H86A 3AUAA 3DQPA 3ASZA 3WC4A 9ABPA 3RT7A 4BP9A 4KXNA 3P0HA 5TEWA 4ARUA 4QL3A 1XPOA 4AM8A 5DBOA 3BMXA 2QY9A 1QLHA 3PFWO 5JSUA 2AX4A 4J7XA 2O2YA 3QSYA 1RWKA 5BW4A 1M6YA 1JQ5A 2YOFA 5K2MA 1MOQA 3P9QA 1FX0A 1LB1B 2G1KA 4L8GA 1CS0B 5A7GA 3WL7A 1XZLA 3TZLA 3QX9A 1TC1A 5EKTA 2L82A 3PC8A 1FZTA 2C1ZA 1I0IA 4O4HF 4CU5A 3D4BA 4EY4A 1QK3A 5EAIA 1BMTA 4TWIA 1NIJA 3O94A 4V0RA 1XZNA 4MH0R 4Q9AA 4QWMA 5CG2A 1EFDN 1OF1A 1CRWG 3EZ7A 4P2GA 2R4TA 3RRZA 1N8TA 4H18A 3V4VB 4QX6A 2GZSA 4UBLA 4I50A 4HH4A 4JJ7A 1BCRA 3E8MA 1OWMA 2B8EA 2CCJA 3WL8A 4F2GA 5E7QA 1TT5B 1PJ3A 2B25A 3T1QA 5KQGA 3CZ4A 2IKQA 1BMFA 4WN3A 5JPIA 2D74A 1EZZA 4DMMA 3ADKA 2QPLA 4KNWA 1JMVA 4N3GA 2QD1A 1LV7A 2VDNB 2C88A 2OCXA 3AUKA 3CF6R 5F21A 3WLFA 2X0EA 2MSDB 1F4VA 3DMHA 3FOAA 4LC1A 2CDBA 3BPSA 4M7WA 3RD5A 4OFZA 4BQQA 3U19A 2JFOA 1D0IA 1QVZA 1YR7A 1SHLA 3EZ9A 3I3OA 2ONJA 2E6UX 1Z2OX 1ZN7A 3RRYA 4XUDA 2CW5A 5DCLA 2P75A 1NLZA 3RU3A 3HZOA 3V5NA 1JLSA 4G4IA 4OGGA 3B5EA 5AVJA 2IH4A 3NM5A 1VYHA 3A31A 1T0BA 4Q16A 2G9UA 4IIEA 5REQA 1SZPA 2WKSA 3A4MA 2AOVA 3D2LA 1XOIA 2E4ZA 5FHRA 4Z99A 1ZK2A 3R7WB 4Z9YA 4H3VA 3SJAA 4IYJA 4V0NA 1DADA 4YBRA 5H9VA 4DBZA 4ZI7A 2CL0X 2JATA 2JIDA 3H1AA 1KFJB 4BEBA 1NL3A 3BJEA 4NEQA 5SZJA 5BN1A 2VSNA 4AIIA 1YOBA 2JEZA 4PU0A 3I61A 3OO1A 1DAPA 4KKXB 3ZVNA 5EWMB 1XMPA 3TAHA 3LC2O 1OTHA 2FE1A 4BL5A 4RLSA 3VHXA 2ZUEA 3Q2KA 3FVRA 4AN4A 1Z7GA 2E4UA 1JBQA 4P58A 2FU5C 4IMIB 4NYMR 5CA1F 4QBHA 3MT8A 1K2WA 1FUUA 3EG9B 3CWCA 5JSHA 4ND4A 1BVYF 4QDTA 1WUJS 3DGEC 1RE0A 1Y6ZA 3VPSA 3LCVB 1IJEA 2AI2A 2PQ2A 3N2IA 1DRWA 1FCJA 2HJWA 5FOVA 2PKQO 4I1OA 1QR2A 2VDMB 3BXPA 2GPYA 2IHKA 3WGNA 4IGFA 4O8ZA 3RUFA 1HG1A 1A8SA 1W59A 1YZQA 1PFGA 2WI8A 4O2RA 1JSXA 3HCFA 2HIGA 3PV0A 4JC0A 5GONA 3UK0A 5K4AA 2WJJA 4O8CA 5FUYA 4C14A 4YV1A 5FORA 1MZPA 1EGAA 1ZESA 2DUMA 1FMJA 4P54A 2QTRA 4WXYB 5JJCA 2XB2A 4JV5B 5D87A 1I9CA 2HFJA 2ZRCA 1X0VA 3NAMA 3EPPA 3NIDB 2BHLA 4LZOA 1T8WA 3E1SA 4K40A 4XCXA 4QGSA 2MMGA 1IQRA 1G66A 4OLBA 3N8DA 1CNMA 3GLHB 1Y4SA 4HLCA 3TNJA 4A27A 2E4WA 4D0GA 1E4EA 4LXTA 4I81A 1GKKA 4PRKA 2BTEA 4ALJA 3L8ZA 4LDAA 1O95C 4OP1A 1AKRA 2FHSA 3IBSA 2HQOA 4RZIA 2ONZA 3M5DA 1TJNA 4CIXA 1HLDA 3AZQA 4M9RA 3UM9A 4KK4A 1OBOA 1E69A 4LMPA 2AE2A 2OAQ1 2GI4A 1TJ4A 4FMCB 3L7JA 2OTCA 2LD4A 1CIPA 2V6FA 1SXIA 1ZM4A 2K2WA 4FW9A 2E49A 2OKGA 4PLHA 3A9WA 4B7AA 4ACAA 4YMVA 1E9BA 3QV2A 1Y63A 8GPBA 1WV1A 3I30X 4JD5A 1M1NB 4E70A 4UEOA 5KTNA 1XZFA 2Z2IA 1U02A 2JH9A 3NASA 2OUKA 4UAVA 4X41A 4KVAA 5FWDA 1MAAA 2VDOB 3A6HA 2J31A 2VYNA 4EFMA 3ZE0B 2BMFA 4R7ZA 1NW7A 3GJRA 2Q2NA 4UCWA 1FDWA 4G8BA 1U7XA 2EKPA 2WABA 4KE9A 3WP1B 2CEKA 4QA9A 1PTJA 3TMYA 1JJVA 1J8FA 4IVQA 3X2SA 5HDQA 2GNOA 3EFHA 1HBJA 1Q17A 2QD4A 1JAIA 1W75A 3W5JA 4HX9A 2C9OA 1XGKA 3TINA 4LOAA 3ZHYA 1Z0SA 1ZA1A 1E1QD 4F3KA 1I33A 1Y1QA 1GUAA 3EODA 5JNTA 2OLJA 3ZN2A 1TX4B 4BASA 1SQSA 3FFTA 1AN0A 4WY2A 2IUTA 1MB3A 2B35A 1OV6A 3AP3A 3RRXA 4A3SA 4ER7A 2J8ZA 1J8DA 2ZRQA 1FSGA 2YRFA 4HNQA 3HHEA 4ZYLA 4DG9A 5IWCA 5J4KA 1LXCA 1EK2A 3LU1A 3T54A 3DS8A 5HZMA 3IT2A 3PFKA 4CM6A 1J9EA 1LBEA 2KM1A 1P7YA 3KJGA 4HADA 1DBQA 1G4UR 4HGZA 1SUDA 4AF7A 3IOBA 4FMCF 4YO7A 3FMPB 3EC2A 4X9XA 5EP1A 4D8TA 4FYPA 6YASA 1QBKC 3U7JA 1V1MA 3JQBA 5DFAA 3KT6A 3WIBA 2HT1A 2XYQA 3JQAA 1T2FA 1ZJ6A 4FZJA 2GD6A 4GFDA 1VL1A 2PZ8A 3KOWA 3NHSA 4XFJA 3HXPA 5HFNA 4G07A 1C1DA 3INYA 1H5UA 3S6JA 4FUTA 4PX9A 3KEFA 1ZZEA 4LHYA 2I3ZA 2EBUA 2EOAA 2VWGA 2VZLA 4NVRA 3FZGA 1U65A 3OZFA 3PHLA 4ALMA 3OA0A 1ZIXA 3TVYA 1SG9A 2OCIA 4MYUA 4HGQA 2VPTA 5L3RA 1DVRA 4LJRA 2GEKA 1CQXA 2EZ9A 2Y99A 3A7EA 5AKGA 2NXWA 1KDZA 4GP9A 2EGGA 3TLAA 3DCYA 3KLPX 2KE5A 4IV0A 5GGYA 1NIPA 5HIIA 5NULA 5TT1A 3KZVA 3D4PA 3TQCA 1G7SA 4Q1CA 1QFMA 3TCNA 3ZY6A 5CD9A 2Z6AA 3KKKA 2EX1A 1MGPA 3EQ9A 4RFLA 1QS0B 3VAYA 1HOTA 1RCUA 3EQ6A 4QDJA 1U7WA 3UC9A 4CTMA 5JCZA 2OL4A 4GH5A 4PZLA 3EZFA 5AKYA 4DCNA 3FCOA 4QQRA 1YR3A 3R3YA 1PNVA 3VHLB 1PW7A 3R0VA 4RF2A 1KJNA 4KRXA 2HMUA 4L4SA 3NG1A 1XYVA 1L5SA 2PUJA 2VZ0A 2ZXFA 3I5AA 5K2OA 1JTEA 3O90A 1E9RA 2QRLA 3SLRA 1HSOA 1O4VA 2E4XA 5ILGA 5HKBA 1SUCA 1Y9AA 4J4BA 1H6BA 1I4OA 1TF5A 1Z0KA 3V4FA 1VCIA 2WFZA 3NBZC 1RLOA 4PF1A 1ODCA 1THGA 3D8RA 1OFGA 4AG3A 1ZGZA 5F35A 1KEKA 1BMFD 4EJSC 5I8ZA 2PT5A 5FA8A 3E18A 1UZUA 4MSUA 4WV3A 2P4QA 4X6YA 4AMBA 2C4TA 4IGKA 1SEVA 2Q4RA 1IHDA 1UMBA 4IQ8A 4ZYVA 1P1KA 2G4LA 2GN9A 5IMSA 4F7WA 3PT5A 3RHFA 5KYVA 3ZWKA 3PKZA 3RS0A 4ZQBA 1CETA 1PWZA 1RHRA 3TE6A 3ZTWA 4R1TA 5HQTA 2GHTA 1KMHB 4ZCLA 3OEHD 5HRUA 2O2GA 2AOUB 3P9RA 1EP2B 2JD1A 3PHHA 3NTXA 2GYWA 3R7LA 5J5CA 2PX2A 2XZOA 3V4RA 3DGFC 3OLWA 4URZR 3IDSA 1D5CA 3N1UA 5A0FA 4BV3A 4L5CA 3SY8A 4X1OA 2BDTA 5E6SA 1I8TA 1FXUA 1WO8A 2CXRA 4RVNA 1X70A 1QE0A 2CXNA 4ZPXA 4X92A 2HRQA 5ELMA 1ZISA 3AC0A 3S2EA 1N4DA 3CPSA 1PJBA 2FSPA 2HJHA 3F46A 3TM5A 3K7EA 2RGCA 1G20B 2JDIA 3FYSA 4IJ5A 1FNMA 4P08A 2ZSBA 1WE2A 2CF5A 3CIFA 1MEOA 2BBSA 3IPRA 3CT6A 2XCIA 3DEYX 3TR0A 2A5FA 2XKBA 1BGWA 3OETA 1G6Q1 3QEJA 4K6HA 4OLHA 1QAMA 2QT0A 3IFSA 1K7FB 1I4WA 3EIQA 3O3NB 5LIPA 4LE2A 1IVSA 5A1TA 4C0WA 1WTCA 4Y7CA 4DG5A 3PJRA 1SKAA 2VDQB 4LJ8A 4YT4A 4BWVA 1PUIA 1PS0A 1UP4A 2ZVDA 4DLKA 2C7VA 1U4SA 2GCIA 2OLKA 1OIWA 4LBVA 3BSSA 1JP7A 3TSYA 3IALA 3Q8MA 4M8SA 4EQ6B 1ZUWA 5IM4A 4HQFA 1EDBA 1RAGA 3GEPA 1BWRA 4WNCA 4HQLA 4H27A 2X13A 2ZJ2A 2PGDA 2W6JA 4QLBA 1AZLA 2G1JA 3CGWA 3D8SA 4NDZA 1RWXA 1RP7A 4WCFA 5L45A 4MDEA 1H3EA 5JVDF 3ZDDA 1C0PA 4BNKA 1GPH1 3AF4A 4PICA 1AS3A 4JQSA 5CFNA 1AHHA 3SSAA 3OQNA 3EEYA 3IPXA 1NJSA 3B1XA 2PJUA 4FYYA 3DBLB 3K4HA 5DLEA 3V7YA 4F45A 1PV4A 2W71A 3P5BA 3OE4A 1NN5A 5I7VA 2H1HA 4ZU1X 4BB9A 3IP7A 3RR2A 5CB8A 1K86A 1KU0A 5A4MS 1XJCA 1JA9A 3DEJA 3DVQX 2WJIA 3QK7A 4BJHB 5KYKA 4S04A 2O1WA 1KJQA 3GLKA 4ZAFA 1XRQA 4LQDA 3GX1A 2H5IA 1XXHE 3NNNA 2AH5A 2V7QA 2XHZA 3T7SA 3W9YA 1QMGA 3TNDA 4JU9A 5EQTA 4EL0A 3GRAA 3GMTA 4WK2B 5FJIA 4ZZ3A 2JCYA 4OJMX 2J5XA 3ELUA 1NYRA 1U7UA 1OGIA 3OPYI 3QOWA 2Z43A 2VA9A 3QVVA 1BQ4A 4V1CI 4B09A 1B8NA 1JDUA 4IMRA 4G9EA 2Y1DA 4QU9A 4V03A 1IPHA 5ARBA 4IH9A 1ANKA 4J4HA 5CXQA 3MYRA 1MDFA 4A2CA 3VSDA 4EF5A 3CJQA 3VX3A 2BCJQ 3QX3A 4IV8A 4J0FA 3MVEA 1ILEA 2JVIA 4DQVA 3W78A 1WWKA 4TT3A 4MGIR 5FJJA 2WKPA 2Z3VA 2Q5OA 3WS7A 4UOQA 4BNZA 4ETNA 1P8AA 4PYJA 4XYLA 2P2YA 5KJ1A 5FCDA 4F72A 3T35A 2CFTA 4PXAA 4LDJA 2WHRA 1O9BA 4Y0VA 3G2HA 4ZCMA 3BX1A 1Q6YA 3WBJA 3RPEA 1V5EA 1P5JA 4G0QA 1P5HA 2FQ1A 1P8JA 2FPGB 1K89A 3F8WA 2N42A 3GHHA 1NQVA 2Y6UA 3AUSA 3VNAA 1YDMA 5I47A 1WD7A 1N25A 1OKKA 2BMVA 2IZ6A 4A92A 3ROMA 2BJHA 4UTZA 4E12A 1UBMS 4HBGA 3C8DA 3HNOA 1AK9A 2HXYA 4GXNA 4YP9A 1TUBA 3G2OA 1J7KA 3BRSA 3T7RA 2ZJAA 1M34E 1IRXA 4RZ3A 1YCHA 2CGEA 2J9RA 2VRCD 3FNQA 2KBEA 3OKCA 3C8HA 2FEWB 3C3KA 2FOLA 4O29A 1KMCA 1VKNA 1E5DA 1OXUA 3EARA 1N2IA 3ND6A 5AVRA 4NTZA 2NXJA 1F2DA 5TARA 4AKEA 4RU1A 4MQUA 3SJCA 1HK7A 4AP5A 4QU0A 4DWWA 5E6UA 3DLBA 2IXTA 4BVKA 1GD1O 3QA9A 2WHQA 1MFPA 4HVTA 4I14A 3NPMA 4IO1A 2ST1A 4MUKA 4RCVA 4LZZA 4UNIA 4F5DA 1QCYA 2JJ1A 1XA0A 2MINB 1N2CE 1N57A 1R27A 2SCUB 2DECA 4TL9A 4XJSA 4XGKA 3E03A 4HS9A 3L0DA 4FS3A 3TB6A 5LU9A 4AK9A 3L5OA 3G79A 1AKTA 1UJ4A 3EWNA 2ZLBA 4I5EA 4FFDA 3QUQA 1QYRA 4YRJA 1W8IA 4IJQA 4FKBA 4KPUB 3ND5A 3D4OA 1DO2A 2C2MA 2UZ1A 4JXJA 3KHUA 5DF1A 2XQFA 4RETA 2AQ8A 1EQAA 2XUIA 2ZRHA 3H1BA 2B6HA 1WP9A 5L3QA 1BNCA 4RPLA 4CGZA 2G0TA 4Y2YA 5BQPA 3MTIA 1AH2A 4FDLA 2VYQA 3VGJA 2PZGA 5DNWA 3A1WA 2JAPA 1EUDB 2J33A 3TB4A 2BKXA 3ZLTA 5KQMA 1M73E 5CLQA 1NM5C 2PLRA 2OCYC 4WMLA 5JNRA 4J7CA 3H9QA 5BNIA 5C1DA 1TCCA 2FEOA 1PG2A 4Q82A 3DV0A 4X93A 3H17A 4Q4CA 2PX0A 4IV5A 3VZBA 3LUDA 3CO5A 3EZGA 3N6RA 1QVAA 1VE7A 1XK6A 2YMPA 5FBHA 4AP6A 3DOUA 4BY9E 1JAHA 2VOJA 3NATA 3Q3VA 4LDNA 3LQKA 3Q8LA 1JWAB 3EZLA 5DWVA 1XCBA 3OC0A 2BH9A 4LRYA 1S2DA 2RBEA 1WOYA 2R7AA 3HKCA 1IWPB 2NPIA 1WCV1 1A82A 4B87A 2J9YB 3ZNQA 1JQDA 4RORA 4ZCPA 4EY7A 1YTUA 4QWWA 1E1RD 1GG8A 1IB0A 1PZHA 3AF5A 1A4IA 2TRSB 3NQ41 4IIVA 3ZY4A 4DJJA 5LQJA 4NECA 3LFTA 5M7EA 2FSVA 1J8QA 3FHOA 3KRTA 2WDPA 5EZQA 3BHIA 2YXLA 3BQ9A 3L8YA 3WOHA 4C78A 5A5GA 1JYSA 3ADOA 4ZHQB 3DC7A 3Q12A 1Z16A 1TEVA 2XOKA 3V9PA 4J8PA 1GT6A 2B7BA 3ABRB 3MWFA 4M1QA 3SEAA 5C8ZA 2QBYA 5AVYA 1ECFA 2VF7A 1RQRA 2QLLA 4FB5A 1PKEA 2RMKA 2O2EA 3DWFA 3L1UA 1VSUA 2QTBA 2BMEA 2ZBDA 1XJ5A 2QJWA 3D6JA 3ABIA 4IIDA 4QGAA 3GR6A 3U7QB 4IAOA 3WICA 1RTKA 2I54A 1O9GA 1D4ZA 2QUKA 2NUAA 3NTRA 2BGKA 4J29A 1YVUA 1OROA 2SKDA 1FU8A 1TQ2A 4S0XA 4CW7A 4E31A 3DEKA 3KR2A 1AB6A 1O5OA 4RKRA 3RJ9A 4P4NA 3N2ZB 3ZWOA 1T3HA 1EBUA 4KL8S 2H9AA 1UBEA 1NMQA 2HBZA 3INTA 4PLPA 2Q45A 1SXQA 4X24A 4TYYA 3AERA 3GA5A 3KVNA 1OYYA 3M33A 4L1KA 4MKIA 1T15A 2CNWD 4NG5A 7MHTA 3B13B 1ZH2A 2B4TO 1K8YB 2JD2A 2F7SA 1ID8A 2QJOA 2CL6X 2B8TA 1P74A 2ZPTX 4DCUA 4O4LB 1P45A 1X7WA 2BCGY 2RB4A 3A3PA 1O96A 2QW8A 3MFQA 4UW9A 3UC5A 4PLVA 4TX1A 2NUBA 4X20B 2Y1WA 3WNDA 4HMPA 4HTFB 2VDVE 5DN6A 1G5RA 1HM5A 1TJ3A 2IYYA 2QF7A 4G9BA 5EQFA 5CVDA 5F7ZA 1RYHA 3ETEA 4UHHA 4JYZA 1WSWA 3BGDA 3UBTA 4H4EA 4C03A 1U0GA 2PIAA 4TKZA 3QKIA 1EUCB 3AIOA 1TO6A 3AL2A 3LGAA 3DQZA 4CF5A 1T25A 3BWEA 4LG1A 1XHFA 3JQEA 3RK0A 1DAOA 1UFQA 1ZD3A 3DDNA 1NW3A 3KVYA 2W6ID 1J49A 4IM7A 4W9NC 1XDZA 4QPNA 4PZPA 1U6JA 5DRTA 1ESMA 4PFJA 1Z4IA 3WK8A 4ZA2A 3VYSB 2QP9X 3GRYA 4MTLA 4F0JA 2UV8A 3RFCA 4LGVA 3NVMB 1VIDA 1JKIA 1E5XA 5FTJA 3KETA 2EZTA 3UFBA 5FDFA 1GGFA 3T9BA 1AURA 4MW5A 4QBKA 5EUBA 3H8JA 5H8WA 2Q8NA 2QXTA 5JS2A 1UPTA 2GRJA 1M8PA 1RXEA 4KGVA 4QIHA 1AXRA 2KLBA 2CZQA 1X8LA 2HUPA 4P3KA 4KWHA 2XTZA 4ADSG 1JKFA 1F8YA 2BHRA 4G24A 2M6KA 3RUIA 3CNOA 4LVNA 4W5WA 1K4MA 4HAZA 3AEXA 4OJYA 1M2OB 1BX1A 1VJTA 1YS1X 2EAUA 3MLAA 2C7PA 3LNCA 3AB3A 4C08A 4TYQA 1XZAA 2Y76A 5CITA 4R3UC 4CKBB 4BKUA 2R6HA 5FOUA 4GR9A 1G8JA 1AU9A 4UQLA 1TEZA 2GX6A 3H2IA 4TTQA 2OHOA 1THTA 5FL3A 1BKDR 3BILA 1SJ9A 3PUIA 1MZVA 2ODTX 4JLDA 5TVKA 1NZFA 2C82A 4PR0A 4ZVNA 4BRWA 1JSLA 2QZZA 4Y2TA 3EOBI 2IL1A 3RS9A 2C7BA 2ODAA 4BE7B 5BWMA 1ESDA 4CR8A 4HXEB 4MR8A 5F1YA 3RBZA 1MGOA 4RGBA 1ECCA 1T3ZA 1T9GS 3K73O 3ZV3A 1Q16A 1A77A 1M83A 1NI5A 1P77A 3C2QA 3V48A 3HJHA 3UENA 3IVRA 4GSLA 5KTPA 4INOA 4QASA 3DT8A 4MGKR 3NEAA 3GFQA 3G8AA 4LK2A 4O3FA 4BNTA 4X95A 5AVVA 2GBLA 1U8YA 2I6FA 5E2IA 4WFJA 1LBSA 1AQNA 2HPAA 5CX1B 4KMMA 1AKMA 4PTZA 4ME6A 3DE7X 3TTXA 3QU4A 1E1RA 4INJA 1JILA 1YCGA 3TI7A 5AJUA 5JDIA 4BOYA 3LOQA 2JZNA 2BFEB 1L7RA 4B82A 2C9ZA 2BAGA 4XVCA 1IAQA 4PSDA 3CJTA 1SHUX 3CR8A 1G5QA 3HCRA 1OI7A 3UTCA 1U8EA 5FL7D 3P45A 1R8SA 4UBKA 1BEEA 1P9WA 3ABSB 3EVGA 5TC4A 3UJPA 3WR5A 5L95A 1HYGA 4GQAA 1LFAA 2OYCA 1DE0A 3IBTA 1CHDA 4MEBA 4YNBA 2EJCA 3DHEA 3WYAA 3GQBA 5HW0A 4ID3A 3QPVA 3ZDCA 1FP2A 1E59A 4YT5A 3N75A 4YAWA 3SQOA 5HWSA 1H42A 4YRMA 1J1ZA 5LB4A 3FUVA 3VBCA 3ZBTA 4G65A 2A35A 2R8YA 4Y6OA 1UK8A 3D6AA 1U2GA 4QYWA 1PJTA 4K9KA 4E1AA 4H6WA 4MI3A 1TI7A 2HQ1A 2B1RA 4BATA 4KTVE 2PKYX 3ASUA 2IHBA 4RD2A 5AKEA 2RG1A 2CFCA 2Z6QA 2POQX 4MO2A 2SECE 2X22A 1Q7TA 3LY9A 4PC7A 4MAAA 5TQ2B 5T3UA 3RBVA 1J9GA 1YSCA 3HKEB 4QOHA 1KJZA 4F04A 4Y6GB 1EUDA 4BNYA 5KTYA 1LVGA 1TUIA 2AMVA 2EDCA 3GZTB 3IOCA 3Q9NA 4RTOA 4EW2A 3L46A 1JWBB 3F6YA 4KZKA 2HHJA 1CRLA 1OAOC 4XGRA 3H97A 5AXDA 5A6SB 3U37A 3C5VA 5ILOA 2JS7A 1XQ9A 3FOCA 4UU8A 5L3QB 3VU0A 2A0WA 4F8EA 5JJ5A 2UZ1B 2NP6A 1KEZA 1QQ6A 1RADA 3NLLA 1Q57A 2B5VA 2ES4A 3Q5EA 5CHYA 3FRIA 5AK3A 1IVYA 3T7TA 4QT4A 4UM9B 5KQPA 1II0A 3G9UA 3OCUA 3ZDXB 5HX7A 1Z15A 5J2TF 4IBOA 2YBEA 3UMJA 4RD1A 2C77A 3V7UA 2FCRA 2ZJ0A 1QRSA 1K9SA 4DLYA 1TTTA 2IY9A 3DTYA 4FFPA 2XY4A 2IW1A 3T3GA 3V4ZA 1EQ2A 3NHWA 2B92A 4MKRA 2X4DA 2YJZA 1YL7A 3DJYA 3K4PA 4RC9A 4TWAA 5KNCA 2AJLI 1SUAA 1QIMA 2YMLA 3PXAA 3KXIA 4H31A 4LCEA 4QYMA 4BQFA 3FKJA 1N77A 1MX1A 2OXEA 1JEOA 1DL5A 3K5PA 3ZJVA 3D7MA 1JPJA 3GXBA 3KQUA 4NF2A 4TT3D 2ZS9A 5AJWA 5G02A 3PXGA 1WKBA 3GLRA 3GW8A 3OOSA 3QLVC 3WKAA 5A2QA 2XE7A 4E5SA 1II8A 5EHZA 1KYYA 1U8CB 2VT6A 4QT0A 1A76A 4X62B 3NT2A 2JI9A 1BJTA 3BXOA 2FZKA 4P7KA 5I7RA 3JASA 2I78A 4I4TF 1R74A 3FPEA 3IAEA 4PYKA 3VJRA 4G56A 3UHJA 2Q6IA 4TZTA 3WNZA 1EXMA 2VDWA 3AF3A 1E2LA 4UPEA 3VDXA 2B8JA 3P94A 4A0SA 4AG6A 3KQMA 4CF7A 5EUCA 4FHZA 3CLUD 3HABA 1KVTA 1QHGA 1QVVA 4E6PA 4G8DA 2FFAA 3GCZA 4Q0MA 1IN4A 3O4IA 4V0LA 4CMHA 2Y4OA 4ZOCA 1D2AA 1MEJA 2R2AA 4WCFB 1GQRA 3C3MA 1EJBA 3DF9A 2FGKA 2P35A 4DSTA 3DKIA 1UJ5A 1XEWY 1JG1A 1Z5UA 1U6IA 3KJNA 4W1SA 2WU8A 4OOFA 3QOXA 1S4QA 2HSGA 3ZEIA 4QE3A 5FIUA 3ZH2A 2IKSA 2OECA 3HM9A 1DXYA 1I4EB 3CW9A 5CLFA 5KWEA 4P7JA 3VR6H 1LW7A 1BN7A 5IJ9B 1ZVVA 1PW5A 5DZSA 4OM7A 1XA3A 2B3TA 2NW6A 5DRYA 4EMSA 1NN0A 4O1IA 3CZMA 1J0BA 5FOQA 5KWJA 3LUCA 4J94A 3M6LA 2NO5A 4C7KA 5TIIA 3VYVA 1JB1A 4B3RB 2Q2QA 4XJVA 4Q4HB 4WJKB 5P21A 1AVTA 1H65A 4B7ZA 3JQ8B 3Q41A 4J76A 3AESB 2GCNA 2XUZA 3LSTA 2EFCB 5K01A 4MAFA 1Y9DA 2ZYGA 3HNRA 4ZO4A 3FKQA 3WXMA 1I5OA 3BORA 5E2BA 4CQLB 4Z3KA 2IQ5A 1I0LA 2XTNA 1QYCA 1Y6QA 4KUEA 1MIOB 4XLLA 2Q9UA 4FM9A 4EGCB 2GLTA 1NLUA 3VR4H 1GSOA 1PS9A 4JB2A 3L04A 1CG6A 4RDCA 3WSVA 3Q6NA 1M7HA 4OJNA 4M0MA 1P5ZB 4YMLA 1UC5B 4FQ8A 1NNUA 1YJ5A 3C6ZA 5IVDA 1FSPA 3SGLA 5AKHA 5FBZA 1KO4A 1KORA 5CYOA 4CT0A 1KEEB 2F3UA 1HUQA 1NNI1 3ZY5A 1NZJA 3SQDA 3ORRA 3JV7A 3HFGA 5KOJB 1H2FA 4OG2A 2B94A 4B3CA 2PH7A 4FW8A 4Y2SA 4IDFA 3QVSA 4PWYA 4RZQA 2O3SA 4H6XA 2O1XA 4YP5A 5HE8A 5LOVA 3HN7A 3UJCA 3HB9A 5CFZA 1ESEA 1RWOA 2KI5A 4F38A 1DZIA 3LPCA 4GLBA 2VWQA 1EXDA 1QKKA 2O4CA 5K0BA 2UVDA 1BKYA 2JFHA 3G68A 3G2JA 3PNSA 4UEQA 3V8EA 4RNCA 1C4WA 1NP7A 1TL7C 1WABA 2WE8A 4QM7A 1V3TA 2I4LA 2R85A 2IZOA 3JW8A 2I1WA 1KYVA 3LQ2A 1D4AA 3M6AA 4XQ9A 3NBQA 5ALRA 2O2HA 5HMLA 5IAJA 2PWZA 3WMGA 4K26A 2C2XA 3C43A 5EMNA 2P9QA 4JC5A 4EHKA 1N9ZA 4NEGA 4HRVA 4UAGA 2JJMA 3O2SB 1MKYA 3D54D 3LOUA 3PUKA 3OLYA 2RGGA 1PR6A 3EY4A 4LXYA 1JHPA 2ATVA 5E9WA 3ZHOA 1KIMA 2P2ZA 4UZEA 2L17A 1TEXA 2NZ8A 1JBKA 1TAGA 2H48A 1ZKMA 3KR1A 4R2XA 4BDTA 1XKLA 1LBTA 2J6IA 3LV8A 4KUGA 1TVKB 3AKDA 5I9IA 3HDJA 2XWPA 1R3UA 4M1SA 3SC2B 1QP8A 1KQOA 2JFFA 1PGOA 2Q1WA 3DH0A 1Z4LA 3IO3A 1T6BY 2HA2A 2OZLA 3FTNA 4WINA 3N70A 4B6JA 4BFVA 5EIEA 3H9EO 4OXQA 3OCZA 1GRQA 3BRCA 2PRYA 1TW2A 3FWKA 1VFNA 3IUBA 3K0BA 1XTBA 2E18A 4AJNA 4EUSA 3ZVMA 3IELA 2DFVA 4ZC8A 5FPPA 3SBOA 5I4CA 3JQFA 1ATZA 2DSTA 2ZJZA 4QYSA 2OV1A 1JHQA 1UT6A 1L5HA 4X1IA 5ICFA 4D5EA 1JLLB 5JISA 3PEYA 1AQUA 2BM8A 4QXRA 721PA 1RYYA 3L7BA 1XD8A 4L85A 1YJCA 4HFNA 4RS3A 3I39X 2I7VA 5F64A 3QW2A 5IAOA 4QHTA 1Z6XA 4X6UA 4UTNA 4UC0A 1CLUA 1Y3CE 2BFAA 3FPSA 621PA 1RJ9B 1R8JA 5EZ5A 2C9MA 5C52B 1G9TA 1TFUA 4RD4A 1SQGA 2IOFA 4RK1A 3CA8A 4XARA 3RKSA 1A4UA 4R5MA 2V7BA 2ZIZA 3E23A 2D2FA 3CF2A 4CM4A 2I87A 2R68A 4AZSA 2PA3A 1N8KA 3LPNA 2AG5A 3PC3A 4FNMA 5HOQA 2IH5A 3MOSA 1TNDA 1O57A 3W2IA 1N32B 2D2IA 4AKSA 1C3OA 5C2JB 4FWTA 2KPOA 5BW5A 2WAAA 4UUAA 4PYNA 5ESWA 3RGGA 3UV7A 5AJVB 4GL2A 2REOA 3SHWA 4UTVA 5EJ4A 1GXSB 3ZC3A 2RH4A 5KVAA 2QL6A 3TG8A 1FVHA 3GBSA 4PCUA 3HU1A 3H0EA 1DXQA 3BXEA 1RXVA 1NF3A 4LV8B 4FGLA 1T8PA 4M6WB 3ASYA 3UB2A 5F7OA 3D6NB 3BEDA 2QP4A 5LZ2A 5ECYA 4L3OA 2WYIA 1U0FA 2V96A 1Z34A 2LIPA 2ZWAA 1XFAA 3KB8A 4PO3X 2HI0A 1GZUA 4OSOA 1J2JA 5C8YB 3RFFA 2BE9A 6ABPA 5KTRA 1XL1A 3LT4A 4IXDA 1L5QA 5AD1A 4X0EA 4N12A 4HC4A 3E0QA 4X8OA 5BWNA 4F4HA 4LAFA 4BBAA 3WDMA 3LA6A 4RFSB 1MJ5A 3C5CA 2IQIA 2P78A 4LOJA 2DWQA 3E5RA 1KQNA 3JQ8A 1T6XA 2JAWA 3QVTA 4EJ0A 4JEIA 1KXJA 1M2JA 1AK1A 1PVDA 1QH9A 2C92A 1LK7A 3R9WA 2OCAA 3N0XA 1CB0A 3IX7A 4G1EB 1GZ3A 4II2A 3WK4A 4C29A 3GRZA 4D56A 2E1RA 5L4SA 3HV0A 1JHOA 2Z4TA 4Y2JA 4E94A 5IVHA 2D1YA 1W5SA 1I3OA 1R3DA 4MB0A 4NL4H 2TECE 1M33A 4ECEA 1QLWA 4LOIA 2HXGA 4DB4A 3MT7A 3EFEA 1F0NA 1WVMA 1ST2A 3JRXA 1NHWA 4NOLA 3OHPA 4FFRA 2I6QA 4GC5A 4YJ2A 4EA9A 4ZRNA 2JJYA 1JVBA 1VBMA 4KEAA 5KYXA 1KC3A 4QNRA 2B4KA 3I2KA 4ZWNA 5LN1A 1E9AA 1V7CA 4REMA 1ZK4A 3OIGA 4M37A 1Q1GA 4ZQGA 2Z57A 3RF7A 1ISHA 4WK0B 2GS9A 2N46A 2OCPA 3KIPA 3WK9A 2HPZA 1UZAA 3OQHA 5DU2A 4FHGA 1J0DA 5TMDA 2PBFA 1J99A 4A2QA 5GADl 1YQUA 4A0RA 2Q3FA 1P33A 1M7BA 3GLHA 2BFOA 3DFMA 2Y05A 1YONA 1EFUA 5DYIA 1VOTA 2EHJA 1E96A 4FE4A 3HYRA 3PWZA 3TRJA 4MHSA 1LLDA 4RV5A 4AWBA 5CB6A 1I0ZA 4O1HA 1QV7A 3AEKA 4WOCA 2NLOA 5L51A 2E9SA 3EXFB 5T57A 4YMWA 1IXKA 1ISFA 1HLFA 2GZMA 2W37A 1YNSA 3FJOA 3LL4A 3H18A 3U0BA 1J2TA 5C7LO 5A9SA 1NHGA 2R00A 4N0EA 3PQ3A 4QLAA 1Q83A 3GF4A 3C41J 1RXSA 1DCTA 1VCMA 2GM3A 1J00A 3IILA 1EWTA 5AHXA 1LDBA 3EISA 4YJ2F 3ZWCA 4BVEA 4TZ0A 3H5IA 5LQSA 4RHEA 1T1JA 4IIHA 3T6KA 3H2HA 2JG3A 1ATIA 1AT1A 1E7RA 2H5EA 3R0XA 4HTAA 2FPIA 3MS7A 5HRCA 3M4ZA 4C2TA 1ZK0A 2V7VA 3L6CA 4FOPA 4FNOA 1CW2B 1FLAA 3I32A 2AWNA 4GOND 2VHZA 1N6IA 4AJHA 1HE1C 3BSWA 1E3MA 4KXMA 3IUNA 4A73A 2XGMA 1J8YF 1LC3A 1T3SA 2CLEB 3X43A 4JBGA 4TWJA 4UQPA 4C07A 3ZXUB 2QL9A 4AXBA 4QOEA 4ZI7B 3B82A 1AZWA 1C8BA 2UVPA 4UZSA 3H5RA 5TGDA 1AS0A 3AHGA 4FFBB 4RCYA 1TJPB 4KR3A 1C7JA 4M88A 4OQFA 5UKDA 1ECGA 1AGPA 1OUMA 2R6CA 3AH8A 5EVCA 1DG1G 3SSOA 2FSUA 1UAYA 1LS6A 4JR1A 1KYIA 4NRDA 5EP2A 1NAIA 3R3UA 4J0EA 2QSYA 5JXHA 2GAOA 4D1YA 2VZ8A 5IFLA 4CN8A 1FVXA 1ZGHA 4JN6B 3HKEA 2DPYA 4QQNA 2R00C 5GIPE 2ET6A 5FNZA 3I52A 2W2LA 4EL5A 3NTLA 1XI2A 2GHRA 4NZPA 2P5SA 2H0RA 3NRCA 5EINA 1YC2A 2WMNB 3F5FA 4MR7A 2VF4X 3VI3B 4CNQA 3DG9A 3AOEC 3KT3A 1QE5A 4UZFA 1W85B 4JUBA 1Z07A 3HXMA 2CFOA 1FJGB 5CDFA 4UVIA 1L4LA 1J5EB 2ZS7A 1VXRA 2DQ4A 2RD2A 4EPWA 4ZOLB 3AM5A 1RD4A 1BCRB 4BP8A 3O8OB 2K4MA 1JZQA 3O38A 3OY7A 4Q4JA 1DQRA 2AKAB 1A04A 2VXOA 3CUEF 1X86B 3A8TA 3EK2A 2A4MA 3HI6A 3WLKX 4ZYYA 1OAKA 5JEEA 3FJYA 1ARZA 1U0SY 3R7WA 5TS2A 4BUCA 5CGZA 3T3NA 3KYDB 3EVTA 1IZ8A 1P1BA 1WEKA 1R0RE 4WCFC 1EHYA 1U2SA 4NE9A 5HKLA 1P44A 3Q3EA 4A91A 5JJIA 1E64A 2V8OA 1XP5A 2IOYA 3EMVA 4N5HX 4LWQA 1D9ZA 1LI4A 2QI9F 4PHTA 1GRRA 3ILHA 4ATNA 5KU7A 1FFEA 2OORC 2V6JA 1OD6A 3CNLA 2OAP1 5ER6A 1RPNA 1VLVA 2ZJ5A 2W8BA 3F9IA 4KR0A 2GN2A 1H2EA 3AONB 4UVEA 1QCZA 1YR2A 3JWIA 1PJRA 2XT6A 3CONA 3FBWA 4IUCS 4YH1A 1A8IA 3RDPA 1B23P 1PK9A 1VI5A 2X5JO 4G01B 4LXQA 4WLNA 3WGJA 2QI9C 2DE0X 1C4XA 2NX2A 4DNXA 1SIWA 3MFYA 5BWOA 1NOKA 3ETDA 2FRDC 3WRYA 4CCWA 5LVAA 1PJSA 5LMUB 2NU6A 3B1FA 3F1KA 3N8KA 1EX6A 2JFVA 4RE6A 5CX1A 3ZZUA 1L7PA 1IHOA 2V7XA 1SC3A 1RPZA 1V71A 4Y2HA 4EHBA 1DFIA 2HKIA 3GA7A 1Q50A 4HZUB 4QEKA 2B83A 3THOA 4Q37A 4H0CA 3ZNNA 5K3OA 1BOFA 4MQLA 4ES6A 5FT9A 3O1JC 3HYNA 5IEBA 5CVJA 2QUHA 3FTCA 1C9JA 1T3TA 1Y8RA 3BQNB 4RSMA 4FMPA 5A1JA 1TTHA 3DUFB 1GGKA 5CGQB 4ZCTA 2XVXA 3K8ZA 2XVMA 1IULA 3EQ2A 2YICA 4DNFA 2ODQA 2J6HA 3WLMA 3GLGA 3B1JA 5JFTA 3G8YA 1N0VC 1ZIOA 3GWZA 1ZWKA 1Y8QB 5KYYA 1BTOA 2I9KA 1HE5A 1MXHA 3K8QA 3MT9A 1XDWA 4IIGA 2G1AA 5DBFA 2WC1A 3CEHA 5JHGB 1SAYA 4BX2A 4UOZA 1Z4JA 3IPYA 5BW6B 1L4MA 3I8SA 2XRYA 1YKFA 2FFRA 4N8SA 1T9AA 3H4IA 4QNNA 3WGZA 1O89A 4AURA 2ZR0A 4D74A 3FPHA 3KWJA 4TTJA 3VC3A 3UYKA 3U9SA 4DPLA 1BHO1 2H2HA 4D80A 2O6LA 2GUWA 4WLUA 1CUEA 3RS4A 1JG6A 5TVGA 3OECA 3K4QA 4MQFA 1H66A 4PYIA 1QH8B 4X7PA 4YB8A 4ZVRA 2ICAA 2C2KA 3WKCA 5JCJD 4PC1A 4CEHB 1T10A 2C2GA 2JJ1D 1ORHA 3R5HA 4JVMA 2XHEA 2ZKIA 3ZBUA 5ADUS 2REQB 2JARA 3QVGA 3MIIA 4DV4B 2RCYA 1IATA 1X0XA 3KX2A 4EY8A 4Z0HO 1D6NA 1R2QA 3LRPA 2R6R1 5LYJA 5E6RA 1YULA 5EJAA 1E2HA 3EAQA 3CH6A 3OJOA 3R77A 3GLFE 3ESAA 1PF7E 4JS0A 3PQ8A 3GLFB 2CLDX 4RS4A 4MVJF 3RIEA 3DUWA 1X7ZB 3ZNOA 3ZWWA 2WSMA 5GGXA 1LUAA 1W25A 2O59A 1KNQA 4DN6A 4KMSA 2C3PA 1FP4B 2B2CA 1V37A 3A0UA 1JIUA 2QTNA 2QRGA 3B2NA 5G4KA 4D6PA 5KWIA 4JI0B 4F3YA 4A8PA 3TZQA 5LZ5A 2CLSA 4D4JA 5F3WB 4B7XA 1USKA 3PFBA 4Y9UA 4C7BA 1QONA 5JWOA 1DGQA 1EUCA 1E3EA 3JAWB 3K94A 4O02B 3VPXA 3WL5A 1HRKA 5AI8A 2RK4A 1IJKA 4GBJA 1QS0A 4NLLA 2QGFA 1M1YE 2HT6A 1DC6A 3E3OA 4TS4A 4U2FA 1J8MF 3A9CA 1KTIA 1YC5A 1ADFA 2JNWA 2E5WA 5JAHA 4B4WA 2JB9A 3MJSA 1XBTA 4Z1MA 1Z6AA 4JEUA 3OZIA 4RQAA 3L1IA 5KTTA 3HADA 3SC3A 1FRVA 3OIYA 2X77A 2C7OA 3B2QA 1F7UA 3IQIX 3ABQB 3QKSB 5DMHA 5AUQA 2R60A 4CFSA 5LPNA 2WWXA 3FGOA 4BNFA 4YJ3A 4R2IA 3X1JA 2QBYB 1GUYA 1OYOA 2WEKA 2C4UA 3F5DA 1HMYA 2ZSJA 4KODA 5CH3A 3W3AD 1IJBA 2FPPA 3N2GB 1B0PA 3PRJA 1MX5A 1NVGA 2YHUA 4H7HA 2X9LA 2IYWA 2QX8A 5AW7A 2VNJA 5FUBA 3AV0B 4RSHA 1QYDA 1P75A 3UK1A 1HTWA 4Q7LA 5LL6P 3W5UA 1QCCA 2E89A 3AILA 1WB4A 4D7AA 1USVA 4XPZA 1T4BA 4RTRA 5FO0A 1XIVA 4GX5A 6Q21A 4MYTA 2LUOA 1NUSA 1P3JA 2VHCA 2AXEA 2MYPA 1I14A 3UUWA 2XMBA 4DBVO 3WB0A 5BVHB 4HB3A 2VJLA 4HDRB 1V9SA 5HBRA 1P6XA 2D59A 5CLJA 3WGIA 4JIGA 3AL0C 3F98A 4FLFA 4QTXA 1N8SA 1Q77A 1RFGE 3K2IA 2ZJ6A 2JGKA 3I9NA 2PUWA 4XD2A 1NQWA 2QUBA 4BVJA 4JFAA 2AD1A 3QUAA 4JEHA 2ZYIA 4RV9A 2WYUA 5FFMA 5KX5B 3CLVA 3KWFA 1M8FA 4R1QA 2B5OA 1RM3A 2G8NA 4O2BF 5IKPA 1S8AA 4J0HA 1M76A 5D5QA 1U1FA 5IT9A 5KO2A 4MKFA 2ZIGA 4TROA 2XGJA 1XTUA 3RSQA 2WAYA 3LQQA 1DKOA 5B3JC 3BMNB 1B3RA 3UT5B 1MO5A 2FJ0A 3D3WB 3LBHA 5DHSA 2PMCA 1RBZA 2BLNA 1WA5A 2OCLA 2FW7A 4JOBA 1QJ4A 2VJNA 1JB9A 4ND7A 1PTJC 3HBLA 4C4AA 5CT8A 2FFHA 5NLLA 1MC5A 1X13A 2NU8A 1QP0A 1KZYC 3R09A 2NZJA 3CRRA 4LQ4A 3EWAA 4BIIA 4W1PA 1OAOA 3HDVA 5F51A 2N0SA 6GPBA 1SCIA 2VP2A 2GZAA 1H5QA 2WRZA 3CX4A 4TLEA 2HLDA 1J2YA 3PXXA 4HD8A 4EYSA 1PFYA 2EBWA 1ESCA 4DBLC 1GYPA 4TTAA 5LQDA 3SIXA 1SBYA 3SI7A 2HV8A 4BWFB 5L3SB 3G0IA 2CSXA 3CW2A 4UPVA 2HPHA 3GRVA 2Q6KA 3L84A 2FDRA 2H1IA 4L0MA 2ZJFA 4DUYB 5H59A 2PLWA 4WD3A 1DG3A 1X7XA 1WY7A 1XZMA 1MRZA 3HNPA 3NWEA 4KPUA 4V39A 4AMYA 3IAXA 3ZQJA 4BO4A 1AUVA 1U1IA 2G4VA 2OG1A 3IA2A 1PT5A 5A9SB 3BL5A 3VZCA 1NJGA 3GJ3A 4CTNA 1A7AA 3W9SA 3FCAA 1XEFA 1NVMB 1XAHA 2FZ4A 2QE6A 2VWPA 2ZI5A 3GZJA 3H2KA 5CH8A 3HTXA 1P39A 4HQ6A 1VL6A 1VSVA 4K2HA 4K28A 4Q9IA 2ZAMA 1IXSB 3QXHA 5JPDA 2E85A 4QFBA 5CFPA 4JUIA 4H6VA 2PCJA 2PJZA 4RDHA 1KDOA 4JLMA 5EPUA 4YJ3B 4CBVA 4XTRA 2HLHA 1EVEA 1UK9A 1ZN8A 2R65A 1PNQA 3OT1A 4PGHA 5JECA 2MR6A 2XVAA 5AO9A 4UFPA 3A4NA 3O1HB 1LF0A 4D4MA 5U4XA 5BNWA 1JV2B 4WOKA 1URPA 2X5NA 4AJ2A 2WV9A 1A9SA 4P8RA 3D2BA 3EWIA 4I7EA 2XDQB 1A96A 4YAFA 3ZQ6A 4G8CA 1HA3A 5JMPA 3IP6A 5T64A 1CE8B 4Y1RA 4S12A 2PZBA 1JEYA 4W63A 1P2SA 4TQGA 1RZUA 1P0IA 3UY4A 3USCS 1M8JA 1P80A 5HIJA 3ZE8A 4QOFA 5H4HA 4Z51A 4I4CA 3JAWA 3HY4A 2GN6A 1M67A 5GVRA 4G67A 4DKXA 1F48A 1ODJA 1PD0A 1DO8A 4BC0A 1RDFA 3GRCA 5L6LB 5KYGA 2PKRA 2O7QA 2Q0HA 3VO2A 4Y9SA 3KZKA 1KYQA 4LY6A 4L4YA 1PV1A 2EG9A 2JKVA 3A58B 3L49A 4TLBA 1XVLA 3RB8A 4CG1A 1OA1A 4RTSA 3MCVA 4KJXA 1WXFA 2EJUA 2I1VB 3G9TA 5FWXB 3GGDA 2DMRA 1GL7A 2Y1OA 1KH3A 2R8PA 3B60A 3DOHA 2JJ2A 3I9MA 1OLUB 5IJAA 4MR9A 3EBLA 3W5HA 5LXTF 3I0NA 3DZJA 2ID4A 5LYJB 3WZLA 2OXRA 3V55A 1QU2A 4J16A 4FBLA 4WTOA 1V4BA 2F8MA 4FYKA 1T1EA 4JQOA 1UEXC 1P3Y1 4O4IB 5AXCA 3D7KA 1G8FA 1F8FA 1T5SA 3PX2A 1ND6A 2JKZA 2CBZA 2HBRA 3EVAA 4G1BA 3LI2A 2PUTA 2J9XB 2BGTA 3IO5A 4K88A 1U8ZA 5B2EA 3P2KA 3EJWA 4FHEA 4JY7A 4E2FA 3OIUA 4WASA 4JSYA 4AJPA 2QAGA 4K6FA 2FW8A 2QAJA 5IRCD 2DWUA 4KC0A 3IB3A 4GDMA 4KQXA 4QELA 4HDMA 1K27A 1EP9A 1JXQA 2B78A 5ES4B 3MJDA 5IWAB 4ZVTA 3L0PA 2CLLB 2XMQA 4GLLA 3AR4A 3IQXA 4PLWA 5D8DA 4B2PA 5FH9A 2B1IA 2E1PA 4UDOA 1H8EA 1H5NA 5LLSA 3M6VA 2HQSA 2QT9A 2A5JA 4QECA 1V1RB 3FNRA 2JVJA 3GN2A 4D9EA 2XUPA 1EJ2A 1D6MA 1R9MA 4AI6A 1RXYA 2VSFA 2FZEA 4NIMA 3REOA 3C74A 4PZCA 3RQIA 4MV3A 3HLTA 1QO0D 3AQ4A 4MINA 3L8CA 1DKRA 1F3OA 3STWA 3R44A 1P9LA 4OXYA 4H1WA 5J2UA 2PBLA 3BAFA 1XQ6A 4HYEA 1VHQA 1Q1QA 1E32A 1JBEA 3BWMA 4ZVOA 4BVGA 4M54A 2QMOA 3KNZA 4TWRA 4DEVA 2W0SA 1BOOA 2YWCA 3UJAA 4QGHA 7ABPA 2WYVA 4EMUA 1H3NA 3A3NA 3CR7A 1BX3A 1DQPA 3RT9A 2IK8A 4Z2AA 2R96A 2EGUA 1UJ2A 2W6PA 4Z7OB 1DC4A 3PLRA 5BWLA 3S2YA 2CVHA 1W2GA 4GZ3A 8MHTA 4PAOA 3W04A 1ETHA 3FD8A 4O3MA 2X8JA 3OTIA 4DMGA 4Q39A 2QVGA 2J46A 3MYYA 2ZU0C 2XTAA 3M0EA 4B9EA 2F1KA 2GSDA 4MW4A 2VJYA 3ZU3A 3RRNA 4KLAA 2B0CA 3TTYA 3A0RB 4DOMA 2P1ZA 1V16B 2G5TA 2WPDA 2Y2VA 5I51A 1V3QE 3EIFA 2G7MC 2PBZA 1GM5A 1KKLA 3M3DA 5CEEA 4AN1A 1QHIA 2P27A 4HRYA 4ZOBA 1W0KD 2NACA 4B80A 2FZCA 1BRMA 2BF7A 1PGJA 2A1UB 3JQDA 3NS7A 1CQIA 1KK2A 1PZXA 3IAFA 4IWYA 4F5EA 3CO0S 2WYWA 2E55A 3NHUA 3WYNA 2HIAA 4UM7A 3KJHA 4HUQB 1EP3B 3H3FA 1AO3A 4NMMA 4H08A 4YJFA 3FIJA 2O07A 3B7PA 5CVCA 3INGA 1MW9X 3GH1A 4MPJA 2AK2A 2M32A 2W00A 1Y6FA 4M9SA 2WLTA 4TMVA 1AV6A 2XMSA 2QE7D 5FI1B 3PPWA 2IYNA 2MDTA 8ADHA 3BL8A 4PG7A 4ZOLA 1JDBC 1GZDA 3GEIA 3TQRA 3RC9A 3FTDA 2AXQA 1XU7A 3ZV5A 4CV3A 3I9V1 3OZCA 1CYEA 1DBWA 4B73A 3GRFA 1JDTA 2PV0A 3G2QA 3UKJA 1UK7A 1DUSA 4MR7B 5CNMA 1C9MA 3IRUA 3TNYA 2NXNA 4U7JA 3ADPA 3E2PA 2JBWA 1E2EA 3HEBA 1ZGJA 3QVXA 4LBYA 1JHUA 3DW3X 4Q9KA 5H16A 4BQNA 4JUCA 1VL5A 2ZZKA 2IOFK 5CB4F 4N5NA 4DCMA 3FE2A 1HFKA 3LT5A 1E1NA 1LH0A 4QQFA 2CBXA 3EGWA 5ALDA 2CCGA 1FY2A 4DSUA 3NYWA 2QYHA 5EN4A 4ILKA 2Q5HA 1X7YA 3ESZA 3E61A 2RI6A 2XE6A 3GOHA 4ZVKA 1A72A 1FB5A 1GOTA 1VP3A 2WSLA 1RI2A 3IHLA 4CGYA 1O6ZA 4NYJQ 1RYBA 3LYHA 4PAQA 4Y6QA 1PV2A 5KOYA 2HYIC 2QJRA 2AN3A 2PMEA 4XRGA 5ITVA 1CR4A 5JDCC 5A6VA 4UXJA 5H1YA 4QYIB 1UJCA 3K2EA 3RTCA 1W46A 2OD9A 3WLJA 2PZLA 4MO9A 4I1UA 4R5HA 3N7AA 1E1QA 3DE0X 3JAKA 1ONPA 5ERXA 1TB4A 5BUCA 1EU1A 1AHPA 1FDOA 1KKUA 1EDOA 3SDBA 2C1XA 1L7AA 4OK6A 5F12A 1SXJA 1XJ0A 3SHVA 5KJFA 1O6BA 2ACEA 3AHHA 1S2OA 3I12A 1U7HA 4PZAA 5IAKA 4U00A 5JW6A 3JR3A 5K0ZA 2W6OA 3TBKA 4CLOA 4NBWA 4C0JA 3EPJA 3GT7A 3NYQA 4YFVA 4H3HB 3PDUA 1V7QA 1XZCA 1YBAA 3LCJA 5BSFA 4KYTA 1PX0A 1XMIA 2L18A 2BTQB 2IV2X 4KQ2A 3THSA 4MB6A 3UT6A 3QEMB 3WHIA 2CHUA 2XMRA 2ORED 1FBNA 4FT4A 4QG3A 3GG2A 5F23A 2GO1A 2ZRKA 1RVDA 2ZJBA 4HGNA 1NMSA 1W36C 2BH2A 2Z5FA 2DSNA 1KVQA 2VRBA 4I1RA 4D0RA 3H6KA 4XJTA 2G25A 3PC7A 4GZ5A 3KTAA 5AW9A 2C97A 1DB3A 2IPLA 4WCVA 3ND9A 1J33A 2Z8YM 2FEKA 3ZOKA 2HWXA 3GYGA 1RBMA 4PY2A 4B84A 1XZQA 4M9XA 2HRBA 4XCQA 4BRSA 2BCEA 1QO0A 3PGXA 3QEMA 2HK6A 4MPRA 3ZD6A 1SA0A 4P22A 5JR3A 1GTRA 3CVUA 4QBTA 4EF6A 3FOFC 2CXOA 2IDMA 2P2NA 1T2NA 2Q07A 1COZA 1TAUA 2D0DA 1CDZA 3F47A 5AVOA 1YZVA 2IUUA 4BNUA 2DPHA 3LLSA 3RH0A 4CMKA 4MVJG 2PLAA 5FA5A 2GD0A 1K92A 1XEWX 1XRRA 1QG2A 2AHRA 4YALA 2R4UA 3ZE9A 4V02A 1SD1A 1YHNA 2EFYA 5SY9A 3WDLA 3WQSB 4R71A 5JXGA 3SVTA 3HVRA 1ZW6A 3UO8B 3FPAA 3IVAA 4QSHA 1KPIA 1KJYA 4I19A 2WB4A 1Q1BA 3MINA 2XT9A 2C03A 3S8YA 1XXHB 4BQOA 4PVCA 2QZ4A 5I7EA 5JEDA 1JJFA 1RJWA 1QHEA 2E87A 5KBYA 3P9NA 1OPXA 2YQ4A 5EQJB 4E21A 1YASA 4HAOA 5IXYA 1U7OA 3FYTA 1OW3B 3BGWA 3RM3A 3JWGA 2GPAA 3P52A 4L8VA 3FNHA 4M86A 1B14A 2IUFA 2JBHA 5J43A 1Z5PA 2GN1A 2XPCA 2BHNA 3WVNA 4E07A 4B2YA 2QTLA 2J3QA 1JA1A 2XQIA 1S2LA 4K1XA 4N5DA 5DJ5A 2WAXA 1K68A 4TXLA 4D3ZA 2VYFA 4QEDA 3GJTA 4L4UA 1Q74A 1WBJB 4FC6A 2RH5A 2G9RA 2P40A 1Y9ZA 1U2RA 1E8NA 4MUFA 4RPIA 3S2IA 5FEUA 2OVBA 2LNDA 1TM3E 2J9ZB 3CF4G 1K97A 3K0FB 1L3CA 2EBHX 3B5JA 1MOSA 4A6PA 2C4KA 4F84A 2X7XA 5ALQA 4IIXA 2O5VA 3HLKA 4MQEA 4L78A 2GKGA 2QROA 3C1TA 3OLCX 4C89A 1RRVA 1T9DA 4H60A 1FRFS 4X6LA 4XQCA 4H35A 2I7XA 4FK8A 5H68A 3FCSB 5LP6F 3D0KA 1BXZA 1IMOA 1SCAA 4UD6A 5A5FA 3LHDA 3AI1A 2EKLA 2Z30A 2XEDA 2ZIXB 5TQVA 2VH2A 1IUKA 4Q3OA 3WIEA 1MC8A 1SKYB 2PM8A 3KSRA 3CFYA 1G20E 2QJFA 3JZIA 5C1BA 1N78A 2CY0A 1P29A 3O82A 5C18A 3DTVD 4JLBA 4WKNA 4FB4A 1SXJE 3N07A 3P2YA 5DX8A 2F9MA 4KPEC 1AQLA 1WMFA 4TS1A 5HUQA 2OGWA 2WWTA 3U7RA 4IWNA 2BM1A 1CZUA 1J5PA 1CEQA 2PEYA 3PI6A 1WUKS 2FNAA 5KUTA 4F3CA 2H1WA 2HHAA 3NJRA 4KE6A 4Q34A 4BMSA 4EJSB 1XQ1A 2CUKA 2K7ZA 1N7HA 4DQDA 1G6HA 3GRRA 4Z5XA 2DLDA 4JBNA 3WDKA 3FLEA 4WZBA 2FJUA 5ALJA 4BVFA 4C0XA 9LDTA 4LEIA 5C0OE 2H3EA 2ZUUA 1KU6A 2FP4A 5CT6A 5F52A 5GJVC 4GEGA 4DLLA 1QGZA 5AT1A 2X9GA 1ORRA 3KYBA 2EL7A 4UFNA 3JVDA 5JZOA 4WHMA 1QHFA 2EEPA 3AVOA 3ZOZA 5HS4A 3CRVA 4EI8A 2FWMX 1EXVA 1TTQB 5EWLB 3E53A 2GA8A 3P0IA 4C0LA 4BFSA 2I6SA 1N3YA 2HRCA 3G02A 4OYHA 4IIJB 1B16A 3JD1A 5B2ZA 3FNFA 2G3YA 5AXAA 2HGSA 2OFOA 4LV5B 1LK0A 2Q4BA 3IUJA 3TQFA 2VDUE 3F4LA 3IDFA 4AS1A 1E3IA 1G0OA 3K6JA 4XAQA 3C7TA 4EA6A 2KS6A 3NTQA 5HE9A 5CNJA 2YY7A 5LDGA 4JC8A 1GYQA 2GN0A 5F77A 5JQWA 2CLOB 2WPDD 4QC2A 3GUZA 2OGTA 2Q3EA 1JQJC 4QATA 2X2FA 4Z49A 2GCOA 5C3UA 3ZDRA 1LDGA 3JATB 1NRWA 1CQIB 4JYBA 4OBWA 2A1UA 3MTQA 1LI7A 1N2SA 2WUGA 3NC0C 5FNVF 1SVIA 2WU0A 2AVDA 2C61A 4PPFA 4OSPA 3PC6A 2CD9A 1F51E 5CXSA 3BWVA 4P4SA 3LDAA 1SD5A 4CQLA 3RE1A 5CK5A 1KEUA 3R7AA 2H63A 2FEAA 3DVLA 3OPMA 4L8FA 4Y8VA 5ETJA 1UC8A 3QE9Y 2ZB8A 4IOMA 4AJ9A 5LWQA 1C1YA 2H2AA 1GTG1 1YMQA 3HYSA 4LA4A 4Q48A 4R98A 1ISPA 3PNKA 3LIIA 1HSZA 1QG6A 3HI4A 2P2LA 4KQIA 4LV6A 3ZD9A 1DEHA 4E2XA 1WXDA 4TKUA 2YYZA 3OJFA 2VTBB 3A2LA 5C5EA 1PDOA 1ACLA 1ML3A 2JLAA 5J58A 1RABA 2FW6A 1BS9A 1L3IA 4QFCA 4RMNA 2XD4A 4W99A 5IVKA 1C2TA 1NW6A 1S0UA 3GELA 1UBLS 2D0IA 4JNKA 4MJ7A 2VR1A 4PPYA 3RVKA 4BZWA 1I2AA 1NNSA 3U49A 3TN7A 4UBIA 1J0AA 1A5ZA 1PR3A 2YNMC 4MRAA 3V7NA 5CDGA 3F3KA 1GTJ1 2C8LA 3C15C 3W2EA 1B8UA 2MU1A 2QYSA 3B3GA 3S29A 3SOZA 3WGLA 4EATA 1MHTA 1SU4A 1CY6A 4E5MA 4BNGA 4N41A 3HPRA 1ADBA 1G5HA 1PHRA 2GZRA 3LCRA 4DUZB 3ICPA 5IYZB 2HF2A 2YZGA 3PDIB 4XPIA 5COQA 1Z4NA 3UHPA 3KO8A 1N6HA 4TRRA 2CBGA 2PEZA 2PKWA 4NMXB 5A5VA 1ISJA 1DLIA 1FJ2A 1GV0A 2GDZA 2IYSA 1PWXA 3EUAA 3MUEA 1E89A 1ZUNB 1ZITA 3FSRA 3IJEB 4FHFA 4I4TB 4L4RA 4EO4A 4Z6KA 4C3UA 4CKEA 3DPSA 3M81A 1UKCA 1UFKA 4HDNA 3T5BA 3BB3A 4QSMA 4P35A 4KQKA 1MG5A 1NUAA 1KAGA 1JHXA 2XYVA 3JQQA 4ZAYA 3GEEA 4MMYB 3VMMA 1U0BB 3OZBA 2QMUA 3X2FA 3GVXA 3CNEA 3LY5A 4HZGA 3RV3A 4KITB 2HL6A 2ZSAA 2QT1A 4KXXA 5CNKA 1O94D 1CSEE 2I7TA 3C97A 3R4CA 4J2OA 1JQAA 4DVGA 2CUZA 5BQ3A 1ULZA 3K9LA 3KB2A 4XDZA 1RI3A 3PC4A 4H0FA 1NDQA 1PFQA 2DKOA 5C7YA 2B9EA 5FUQA 4YGYA 2OYSA 5EXDA 5I5GA 2JBAB 5JZVA 3GLIE 1TD9A 1EB9A 1E1YA 4DF3A 5FOTA 4MGHA 5J2TB 3KL2A 5GY7A 2GZ3A 2QL7A 4I55A 4MP6A 4CPDA 3Q85A 2F1IA 2M1ZA 2L69A 2AVNA 3RYIA 4ENQA 3LGSA 3OM8A 4PC2A 1XELA 1V9CA 2YN0A 3ZW9A 4X94A 3ZU6A 4B4UA 3FA2A 2EQAA 1OFIA 4Y2UA 5EZYA 1TM5E 1F6DA 3K1YA 3B3AA 2R8OA 2OFWA 3BS4A 4EJ6A 3QW4B 5CW1A 3SHQA 1DBPA 1JT9A 3KU1A 4B3FX 4OQMA 2BF4A 4UHJA 4X54A 4TSKA 4RL6A 2WJAA 3V2UA 5FPSA 4LKRA 1DRKA 1EK0A 4X7RA 1S3GA 2DBZA 3GOQA 2R7MA 4GS5A 2ZDHA 1ZLXA 5A3QA 1AKWA 5E9JA 3TJMA 3E3MA 4M0CA 1XL0A 2FRDA 3O93A 2ZDGA 3OM9A 3DV0B 4QXMA 3GPLA 2A3RA 4UHDA 2P4UA 3I0ZA 1ZRMA 4HLUC 4MYHA 3R74A 5EJ7A 1KFBB 2BFFA 4MDYA 5IUKC 2NM0A 4ARZA 3AT1A 1KYZA 4RK7A 3DMTC 4X45A 2ZBGA 2K7FA 4QUIA 1QCDA 3EFBA 1NXTA 4RYLA 3ZQKA 2R97A 4BZZA 1K7SN 1G7RA 3BIOA 3OFND 3PRYA 2GJKA 4M55A 3GJXC 2HNAA 3D3WA 3OIWA 4PSKA 4R6XA 3L0SA 3CN9A 4Y3UA 2O5RA 2EL9A 3KTAB 3A10A 1J56A 4QDZA 4M7OA 5BR4A 4GSYA 2FPWA 3ZLUA 4QODA 2IOHA 4M0UA 3E7XA 5F3DA 5JCOC 2NUTA 1AC5A 2B61A 3CZAA 2XSZA 4IH4A 4R1NA 3BWCA 1U8FO 1CX9B 1DC8A 1P2VA 1UM9A 4HQKA 1M2EA 4Y6LA 5CIQA 4YECA 1JDNA 1EVJA 3N53A 4P4LA 5IG2A 3ENQA 3IVCA 2EW1A 5JMTA 1I7DA 1W0CA 2AG6A 2MSKA 2WAMA 3TWOA 3L4KA 4ETWA 3FDIA 4AYXA 2Y77A 3ZX5A 2G4CA 4HQ0A 1G1MA 4RA6B 3N87A 8ATCA 3I2YX 5SYAA 5LP1A 1J90A 3MLEA 3NTVA 4JLJA 4M1KA 1GUZA 3WDSA 3BJRA 1HE8B 3NNDA 5JMOA 4J0KA 4DV0B 1OT5A 1EFRD 3JAKB 3K1AA 2GK3A 16PKA 4LC0A 4S35A 2G88A 3V7WA 2ONKA 4HX2A 1R88A 1ZH6A 3C8UA 1RWQA 1U0EA 2ZANA 3P5SA 5AVXA 1OE0A 1WPXA 1U1CA 2YINC 4JI8B 4DZZA 1ZVMA 3N2GA 4LN1A 1SBZA 1YJQA 2N1MA 1NQOA 4KOAA 1SVOA 1JQ3A 4FYVA 2OV6A 3C8MA 5LZ8A 2H5JA 2GA9A 5WRFA 1GSIA 3I6IA 1SVSA 2E4AA 3QPWA 3EQ7A 4G4JA 4ZAVA 5DGDA 4AP9A 4UREA 5JJBA 3AM4A 3R76A 1FYXA 3RSLA 1F5NA 1CUJA 2HF7A 2X9NA 3E9QA 3AZPA 2G76A 4MS3A 4ZYXA 5C8YF 2NT3A 3NI2A 3EVZA 1Y81A 4UKDA 4ZV7A 1JG4A 5T6BA 3QKSA 4X00A 3SQLA 1JMYA 1XTPA 5DI3B 1TKCA 1B1CA 2BGIA 1HT0A 1OXKB 4HEA6 2QR3A 3LO8A 3GGSA 3C6MA 3EUEA 1XRLA 3O8QB 2JHCA 4NBKA 3E22B 1A27A 4Q3KA 3HXTA 3BZBA 2JFUA 3T41A 1G2OA 1KYXA 4ZYWA 4OQEA 4ZOAA 3SK0A 2WFLB 4Q9DA 3HXQA 3THWB 1VG0B 1WZUA 4OMFG 3S68A 4V1CB 1FMLA 4ZC1A 1PDVA 5LXTA 3O6VA 1ODKA 1RPJA 2G82A 3HPQA 1E5LA 4NWIA 1C7IA 1U11A 3CLKA 2I2WA 2CF6A 3NTUA 4NFYA 4JI6B 1SQ6A 2RHCA 5LZ9A 3R9XA 3VYRB 2P7HA 4PRZA 3AGPA 1EWVA 3RG2A 3U4QA 1O8BA 1UBJS 2FKAA 2PYIA 3WQQA 5SYMA 1EK5A 1NLMA 4CHTA 2FUCA 1R8YA 2GTIA 2ZUSA 4UBJA 3OY2A 4RFVA 1PWHA 5DTMA 1QWSA 2V55B 4CQMD 3Q3GE 4N03A 1ZUNA 3OQBA 5CAEB 1DARA 2Z5VA 4MA0A 4Q3AA 4UASA 3WKDA 1BEZA 2NQ2C 3VNSA 4W5TA 2WYOA 4LF4B 1GL9B 1JG3A 3IURA 3OD5A 2RHGB 221PA 3FG9A 3J81k 4X85A 4K0KB 4O4HB 4F11A 2ZITA 2FMTA 3V8VA 1JIQA 3LFUA 4JQZA 1CJVC 2PWAA 3ICCA 3ETNA 4BGUA 5ERYA 3HFJA 3TM4A 4BLOA 3SWWA 4LYDA 3KJQA 1PK8A 4L7VA 3BXXA 3B1KA 4I46A 3UHAA 2O8BA 4N0MA 3QBJA 1I6KA 2GCOB 4FC7A 1VGRA 3H3JA 5C31A 1JAYA 1L6RA 4X1KA 3T15A 2RGAA 1AUXA 1P7PA 2YHSA 4Q6BA 4FPXA 1O5IA 1IY1A 1SVUA 2G09A 1L2TA 5FLXA 3MCZA 1EXNA 4AKGA 1WZCA 2CD7A 5JYBA 1Q1EA 6NULA 2OXCA 1INLA 1VLHA 2ZRJA 4F4JA 3ODGA 4TKUB 3PA6A 1RI1A 1VZ2A 2GZDA 3KUUA 5C4GB 5LM3A 3T3EA 1VBFA 3WQRA 2W4IA 3CH4B 2FN3A 4OMUA 2E37A 3QNUA 1NRXA 3EZ6A 3I72A 4X1KB 2VDKB 1W8DA 3LPLA 4IHJA 1YFKA 3D43A 3D8BA 3LDHA 5ADHA 1CUYA 1YQWA 5CJPA 3OQVA 1ND5A 2C5GA 1KPHA 2WOOA 3A1DA 2QNBA 4I9UA 2V97A 5HYVA 2PH5A 1T0HB 4OA8A 2JD0A 2Q2VA 1MNQA 3QYPA 4N3CA 4PLFA 2JLCA 2Q5FA 2XTMA 3DDHA 4RMHA 2HO4A 3S7TA 2MSCB 1P72A 3L4BA 2APJA 2JGFA 4NPCA 5G41A 4QAJA 2R79A 4JI1B 1TU0A 1F06A 2NU6B 4RWZA 3T5CA 5ANRB 2K87A 3HQ4O 3M3PA 2C2WA 4TXNA 1G4HA 2J30A 3OJCA 3SSNA 3IPCA 4K81B 3F3MA 4L15A 3NOOA 5EEHA 1ECBA 2FEXA 4JC4A 4GGOA 2WTAA 5LQMA 1S6YA 1U1DA 2GT1A 1RKUA 1GAQA 4O59O 5THQA 2AZXA 4CM5A 2N1BA 3LWZA 4FSXA 1SXPA 4N9WA 2VZEA 7ADHA 4B3HA 4IGAA 1B7GO 3I6MA 1ZGGA 2EC5A 4G63A 5AR1A 1XR3A 1GTL1 3JS5A 2BIFA 2VQEB 2PE5A 4QOSA 2C4MA 2YHIB 3DAOA 3H2YA 1EE9A 4CTOA 1TQHA 1GTVA 3JX9A 3W5VA 3B6IA 3TIXB 4A6DA 1FP6A 4NYJR 4OP3A 3U3JA 3M1IA 1XMJA 3HM2A 1GADO 4POOA 1ZFNA 3ISJA 2WNIA 3OKFA 5HF5A 1Z0FA 1YFLA 5HJEA 3AEUA 3I58A 3PXUA 4NYIR 3IH5A 1Z6QA 4PBSA 1ZGAA 3U3RA 1CUCA 3ZVRA 1KFKB 2GF2A 4N01A 4XXHA 1PVOA 5J5VA 2JLWA 2F90A 3FPGA 1TIKA 1YRAA 4N8EA 1B8PA 3TLJA 5BSGA 7MDHA 5JBQA 3EGVA 1CK4A 2YCBA 3W05A 3B9RA 4FUQA 1EWKA 1Y7TA 3PXEA 4X91A 3G3EA 4ZI3A 2NTJA 2A9FA 5A62A