3EDQA

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edqA00
1PYOA 2HBYA 4JJ8A 4QUIA 4ZVUA 2Y1LA 1SC3A 1SHJA 4M9RA 5LUBA 4LSZA 4NOLA 3PD1A 2C1EA 4EHLA 3NR2A 3K7EA 2C2OA 1BMQA 3D6HA 3KJNA 5I9BA 4FXOA 1RHUA 4JQYA 3IBFA 4ZVTA 1RHJA 1NMEA 3ITNA 5IANA 4QUBA 1GQFA 1M72A 3H11B 4JR1A 4QTYA 3DEIA 3E4CA 3IBCA 4FDLA 1RWXA 4N7JA 2CNOA 4QU0A 5LUAA 1RWPA 2HBQA 3D6MA 4QU8A 4ZVPA 4HQRA 3R7NA 3SIPA 5IAJA 3V4OA 2XYPA 2XYHA 5IABA 3R5KA 2C2ZA 1I4EB 3R6LA 1RHKA 4QUDA 2Y0BA 1NMSA 3EDQA 1F9EA 1I51A 3KJFA 4NBLA 3QNWA 2CNLA 4QUJA 3EDRA 1QTNA 2H51A 2HBZA 2H48A 2QL5A 4HVAA 3V55A 4EJFA 1IBCA 3PD0A 4JB8A 2H4YA 4AW9A 3V6MA 3S8EA 1CP3A 1RWNA 2DKOA 3GJTA 4NBNA 4N6GA 5IAEA 5IARA 1RE1A 3H0EA 4I1RA 1KMCA 1ICEA 1RWKA 1PAUA 3P4UA 3DEHA 2K7ZA 1SHLA 2H4WA 4QU5A 3OD5A 4N7MA 5IBRA 4JJ7A 4EHNA 4QULA 3RJMA 2AR9A 4JR2A 3UO8B 4PS1A 5H0IA 4JQZA 3S70A 4EHHA 5IASA 2J32A 3NKFA 2C2KA 2FUNB 4JR0A 4N6NA 1I4OA 5IC6A 2CJYA 2J30A 1RHRA 5IBPA 1RWVA 4N5DA 4ZVQA 3H13A 2QL7A 2WDPA 4FGUA 2NN3C 4D3XA 1RWMA 2P2CA 4QUHA 3V3KA 1K86A 4NBKA 3D6FA 2QL9A 4QTXA 1K88A 1QX3A 1QDUA 4N6OA 3V6LA 2J33A 4QU9A 3R5JA 3KJQA 3PCXA 4EHFA 5LU8A 3GJSA 5IBCA 3DEJA 1F1JA 2CNKA 1JXQA 5IAGA 1I3OA 4PRZA 3GJRA 1NW9B 4HQ0A 2FQQA 4NOKA 3R7BA 5I9TA 4NOMA 4DCPA 1RWWA 4NOJA 2CNNA 2XYGA 5IC4A 3SIRA 4D3YA 2FP3A 4ZVRA 1RHQA 1GFWA 2H5IA 1SC4A 3R7SA 2QLBA 2CDRA 5K20A 2H54A 5JFTA 4EHDA 4AWAA 4EHKA 4JJEA 1RHMA 2QLFA 1RWOA 3BIJA 4EHAA 4D3ZA 3V4LA 3NS7A 1SC1A 3P45A 2H65A 4IYRA 2J31A 2CJXA 2HBRA 4QUEA 2H5JA 4PRYA 4QUAA 4PS0A 4QUGA 4AWBA 2QLJA 4FEAA 3R6GA 3DEKA 5IAKA 3UOAB 5LU9A 2C2MA 4IEFB 4ZVOA 3H1PA 1CVRA 4ZVSA 3GJQA 4DCJA 4DCOA 2XZTA 2XZDA 4I1PA 1NMQA 3H11A
chains in the Genus database with same CATH superfamily
3IOEA 5JJKA 3NHMA 3B52X 5EKDA 3SE0A 2YXLA 3L7BA 1HE1C 3PWTA 5SY6A 5B1SA 4X45A 2LIPA 1MBZA 2RK6A 3D0KA 4LMRA 2ATCA 1E7SA 1HTBA 4RENA 4EB3A 1KAQA 5F98A 1GGVA 4EVIA 4YT5A 4HVLA 4ZYUA 4Q3CA 1CY2A 1RHJA 1E3DA 1JU3A 2VPWA 3DMFA 3DWGA 4WI1A 2YY7A 3NVDA 4ZVNA 4QNRA 1Z0KA 1Q50A 3ZDAA 1KJWA 2IYUA 3CE6A 5IT9A 4Y6GB 2XDQB 2W0SA 3E03A 4LKRA 4QBFA 5SYAA 1I32A 3AF1A 4IGEA 3VKVA 3WFIA 4AO7A 4JL5A 1RT9A 3AK4A 3E61A 4CN8A 1UPBA 3B6IA 2C9CA 3RVOA 4YACA 3IKVA 4OFBA 5BNTA 1R4NA 3F67A 1E9CA 1MD9A 1KY2A 1N5OX 2WKWA 2IA5A 4FD2A 4FMBB 1A4XA 2DFPA 5FL3A 1KZ7B 1JTVA 4D3SA 5LQRA 1U6KA 2XUAA 1G4UR 1L7MA 1RXEA 1GGHA 2W4MA 1JW9B 2BFPA 2WD9A 2O5RA 2GM4A 2W48A 2RBKA 1RZ3A 2A9FA 3E9QA 4I8XA 4IDBA 2W93A 1K7SN 3TTYA 4QLAA 1ZLXA 2C8VA 2CMGA 5DGIA 3WK8A 5I7EA 5BR4A 1RAFA 4DNOA 3K96A 5SZKB 4G0VA 4PO8A 1AY0A 1LUAA 3NH6A 4LMPA 3DL2A 5IC5A 2CNWA 5B1YA 3IAAA 2VHZA 1XVAA 3M9LA 1U2QA 1DQSA 2JFWA 2W90A 4KVGA 3DKKA 3GK3A 5BPHA 4XX1A 4YAJA 4LC9A 1R4MB 5B64A 4DLKA 1B00A 1UPUA 1TCCA 5IDXA 2QRGA 3VR4D 2PH5A 2NSJA 3OD1A 3U1TA 2WWYA 1L8AA 1TJPB 3O8BA 1BDJA 3RU7A 2R44A 3HFRA 3K9GA 1KSFX 1MOQA 5B58T 3IERA 5AHOA 2G63A 2OWEA 3ZJYA 1ISGA 1DQYA 3NNDA 4W8GA 5B1EA 1RACA 2VP2A 1T1RA 2HZBA 4FQ7A 4UHJA 1IPFA 1LPOA 1QK5A 5LU8A 2O8FB 2CJWA 3IEVA 3PVSA 1XKLA 3DULA 1CNMA 3EBOA 3RJ9A 4O1HA 5BVHB 1JR3E 2QB5A 5BPFA 1PBNA 4EMUA 4KO1S 3FRJA 2VRBA 3QLVA 4BMSA 3WTCA 2YKGA 3UB4A 1EM6A 2AXNA 2GPAA 2BKXA 1KDOA 3OU6A 1GPMA 3P52A 2A0XA 4MQEA 1T0JB 1M2NA 4ZO6A 1FNCA 2IF0A 3TMAA 4DSOA 5T6MA 3ZE8A 3E3OA 1PG2A 4EEKA 8ABPA 4TZ6A 3AIMA 1DBWA 4DT1B 1ZEMA 4MJXA 4BNLA 1IOWA 4ZJUA 2PUGA 2O7SA 3R3JA 2BC9A 4LY9A 2RGXA 2ZRGA 3NOVA 2WTXA 1ZGGA 4F2WA 3EDYA 3MINA 3ZWKA 2GKSA 4CIBA 4K9PA 1V3QE 3L9XA 1KWGA 1DJMA 2ZAMA 2IYAA 3WYDA 1TT5A 2XT0A 3AV3A 3KXLA 3WKDA 5HSGA 1VE3A 3KQMA 1ZW6A 1KP2A 2G36A 2KE5A 3CV3A 1SA0A 1VL2A 3JD2A 3EOZA 3I30X 5FV7A 5CB6A 3PHCA 4TGLA 4LQLA 3GFOA 1TQDA 3BE8A 5T4FA 3ZHZA 4M87A 4XVCA 3HCWA 3DGFC 3NIDB 1Z47A 3D6VA 5C5DA 3PTAA 1EUCA 3PPYA 2X7HA 4NNPA 3QI7A 2NGRA 5BNFA 4NOLA 5LNK1 3R3WA 3ADCA 2OZVA 4L3WA 4UAGA 3ICVA 2JIRA 3KEFA 4KLZA 4KQHA 3BMOB 1R3UA 2QAGB 4OIFA 5CT5A 1RTTA 4AUNA 2ZUSA 4LXYA 4HOYA 1E2NA 7ADHA 4OUKX 2DHQA 3PITA 4X92A 1QFMA 2G71A 1YB4A 3UA3A 3C6MA 4OUDA 2PIDA 1O94D 4IP0A 5SZIA 3B48A 1XAJA 3PE6A 1RAHA 3EIQA 3TBHA 3E9YA 1ZN8A 2F1OA 4YFVA 3GPBA 1PR5A 3ZGNA 2PJUA 5BQOA 2D3TA 4HUJA 1RQPA 2GOYA 1N6IA 3Q8LA 4GZ6A 1IXKA 3OOJA 4L5AA 1MA0A 4GVPA 4R5MA 5DK6A 1Y7TA 3MS2A 1KOLA 4MTCA 5KSZA 4IFTA 1DFHA 3LQRA 1VLQA 1JIVA 3IV9A 4HDNB 5D51S 2J5RA 4EBFA 2JGDB 1VC2A 2CCJA 1YUMA 2CL7X 3UEOA 3JD4A 3CT4A 3LYLA 3O4JA 1ODFA 1R8XA 1RU3A 2Z2XA 3KG2A 2XCQA 4NDZA 2ZGVA 2M98A 3A1TA 3UB3A 5KNBD 4PAGA 4CL0A 1Q95A 5JH7F 1YAJA 4A27A 1OMOA 1WXQA 3LBFA 5EE3A 4B1FA 4S35A 1FS4A 1SBCA 4JQZA 3EIEA 4S12A 1J8QA 1VHQA 3TN7A 2Y1OA 3JWPA 4EYQA 3A0RB 2IEAA 1J97A 2AJBA 2NOAA 5KX5A 1YE5A 1KF0A 4S1VA 1UP7A 3VNVA 9MHTA 2NXCA 4BE9A 1JEYA 2EP7A 1N75A 4M8IA 2R66A 4FILA 3GDWA 1I7LA 3BOSA 3CX3A 3NEPX 1QVZA 4FOTA 2EZTA 1U98A 2FYTA 3JR7A 1H5QA 3PGA1 4OJKA 4FGWA 4E5PA 4KRYA 4KN8A 1NW6A 1NMXA 3PCXA 4GBGA 4RYDA 3VDNB 4EK9A 1ITZA 1K8ZB 5FL7D 1R8SA 1NW8A 1GSIA 3STVA 1P4GA 3TD9A 4BVEA 1FPQA 1MG0A 2FMUA 2I2BA 3BDIA 1E4EA 3QV2A 3L3BA 4KX3A 4MR9A 4O4LB 1I30A 1C9KA 1FNSA 2R8ZA 2SNIE 2FN3A 2VNIA 2FB9A 1W73A 3AGQA 4DCPA 2FEOA 5C5CA 4C04A 5D86A 2GBGA 4OB6A 5ALOA 4C3UA 1J0CA 4DA8A 4FB4A 5GZ6A 2YUTA 1TQ8A 2L0XA 2J9FA 3P27A 1CW2B 1T5HX 2Q0HA 5JROA 1UDRA 2X7XA 4C5AA 1Z12A 2J3JA 2PTHA 5BRNA 2DLNA 4WCFB 1VYVA 2PVPA 3HABA 4U7PB 2O48X 3A0UA 5EERA 1ECJA 5JMPA 1TI7A 5EXEA 5FA5A 2W42A 5F7XA 5D5QA 3FGPA 3SX0A 4EGFA 3UMYA 2BGJA 3NH9A 2HO4A 3MRSA 1V39A 2A84A 3TUZC 2PAAA 5CB0A 2HA4A 4RZQA 1XZ8A 4DYDA 1QS0A 2IV3A 4JI2B 1MQAA 1P0MA 1XN1A 3EYWA 3GGOA 4E07A 2JGAA 3AKDA 2CJPA 2R1VA 2CFOA 3G9XA 3NOXA 3SN6A 3O26A 3P94A 3Q1LA 2Q8PA 3NALA 1XC7A 2OD2A 2PMDA 4NXMB 4UZFA 2HNAA 3BDVA 5J1TB 4ZHQF 4PPYA 4INAA 1Q7CA 3KSMA 3ZU6A 5IM4A 2B7BA 1H0HA 1S6YA 3GFRA 3GLHA 4DIKA 3K5IA 4KWTA 5DTMA 4BXOB 4X95A 3B1ZA 4IGKA 3IBFA 3GCGA 3SC2B 3HJRA 2F9LA 3AFHA 3OX3A 3PQFA 4JGGA 3TCXB 1W94A 5HKAA 1OCEA 4RIGA 1XJWA 4LDJA 3NC1C 1RWXA 2ADOA 4V2UA 3ANTA 1F8XA 1R0XA 3PA6A 1SCUA 2XYRA 3R5HA 5AOAA 3LBYA 1PS0A 1LX7A 3KWFA 3TE7A 2WHQA 4I9NA 3IJ5A 3HXOA 1T3TA 2ZRQA 1AJEA 2GAOA 5DK4A 3TKYA 4OA5A 1GO2A 3B36A 3RVPA 1K7YA 1DFGA 2O06A 2JC3A 3IO3A 3ZJUA 2P2ZA 4R1NA 3X2FA 3TNFA 1PGNA 2EYQA 2QPAA 3CGGA 4ICIA 3U3RA 1CP3A 3BH6A 2P0EA 2FEKA 3M4NA 1BN6A 1EGHA 3STXA 3PEUA 1Z7EA 2R3SA 2XKBA 3JQAD 1OI7A 3OQ1A 5BT9A 1FP2A 5G0VA 1RBYA 2IY9A 2OECA 4WBNB 2AOVA 3PICA 1BHO1 4OJNA 4CEHB 4GL4A 3KQUA 5JXWA 3UATA 1RIIA 4CL3A 4A0GA 1L6RA 2JGLA 1X1DA 3BA1A 4FK8A 4XOIA 3L7DA 2ZUBA 4IJWA 3ZYZA 3EWAA 1EU1A 4WLVA 3VYVA 2EYUA 2GPJA 2PSEA 2XEXA 3ODGA 3NQ41 1F2UA 5BMOA 1IE3A 3O2NA 3ZV4A 1QLHA 3EGDA 1Z18A 2HA3A 3LL4A 1IQUA 1ZNXA 3I39X 4XSVA 1JPVA 5IM5A 2DFNA 3DBIA 5K9ZA 1RQ7A 2JAPA 4OMDA 3KTFA 1IK6A 4TYMA 2I2FA 2O7QA 3BF8A 3BEOA 3HU3A 4HCJA 4LYEA 1QQ7A 3DKPA 5LQAA 3DLTA 3GZNB 3FGNA 4CG0A 1GY8A 4HDKB 4MUFA 3NC0C 2H0RA 5JHGB 4IS3A 4QJ3A 1TQ6A 4E5MA 1XVLA 1KERA 1QHNA 2QWXA 3C7AA 3L0YA 2G6TA 4JVSB 1ND6A 4K6MA 3ILVA 1XKQA 2QHXA 4L0QA 4PC1A 4WCVA 1A7AA 1JF8A 2B98A 3E3NA 1XNRB 3GLKA 1KI4A 1PWYE 2H1VA 3NEJA 3I5XA 3HWX1 1WB5A 1A9PA 4BEWA 4EHKA 4O08A 2EDCA 5HZKA 5ALZA 5DU2A 9LDTA 4PANA 5HS4A 3IDSA 1DGQA 3FDIA 4DMLA 1N2CB 2Z1NA 1XU4A 3BEDA 3H8SA 3I76A 4FHZA 3SCZA 3TKAA 4TOIA 5E9AA 3F6EX 5EWLB 1DHTA 3OMLA 4K6HA 3L0SA 4V0RA 3PUVA 4CCSA 2IBSA 3NYIA 4IO1A 4PQEA 3U56A 1XN4A 3DZIA 4CUJA 3NBMA 1LWNA 3DKIA 3N2YA 1HEUA 4G2TA 3WP1B 3FWHA 3AEYA 3L07A 4F12A 1DSSG 2H06A 3CKMA 5AXAA 4D43A 3EA4A 4DWVA 4GX2A 3ESCA 1DJOA 1LNQA 1RLUA 4Y6OA 4E14A 1M6VB 1HX7A 1F0KA 1LK5A 3ZZUA 1C1DA 2OLJA 2WJ4A 2X9VA 3EUWA 3G2LA 4QE3A 2AQIA 4LS3A 3IEUA 3ZU2A 3OIGA 2A30A 3O3MB 1XU9A 3HJBA 1KJ8A 3Q6MA 4MUHA 4I6GA 3U61B 1A9RA 2R4UA 5GINE 3E8XA 2OFWA 2Y1GA 3HXPA 4PPGA 4UFOA 1WUHS 1ZOLA 4XQ9A 2ZZMA 2E4WA 1P44A 3N2IA 1XI2A 3O73A 5IVDA 1CDDA 1GL7A 1LLUA 3RW9A 4CMCA 4IAOA 3MFYA 2XT9A 1PV4A 4DC9A 2BHRA 3SYTA 4EZIA 1Y6GA 1II9A 3LWDA 3P0FA 3WLTA 1SRRA 4Q3KA 1A8SA 4LYHA 2QD3A 4OHFA 3ULKA 4W5OA 2GD0A 1SKYE 1P4JA 2W5UA 1FA9A 1QXSA 2E4VA 4FUQA 4UM8B 2ABWA 4LECA 2X5NA 3MUOA 1CRQA 2QUZA 2CMFA 4CM9A 3OZ7A 3ZWPA 3AF6A 5H68A 4Z4QA 3RIYA 1M1XB 1OH7A 4JJ6A 1UPXA 4AKHA 4AJEA 1CQJB 4BO0A 5JD4A 1ZFNA 1L6IA 3CPHA 3CSDA 3EFBA 3SHTA 1E6EA 1DCMA 1DO2A 3EE6A 2FX3A 1OYYA 4KQGA 5EKSA 3AUXA 3RREA 1MAHA 4FZVA 5JS1A 1CHDA 3I9FA 5ECYA 5FLXA 1WHTA 4TVKA 3T3OA 4PBSA 2BV3A 5CGQB 3ZC3A 2O8CB 4GLFA 1JQ3A 5DZSA 4US2R 4JBGA 3ADDA 1EB9A 3Q2OA 4D4JA 2MSKA 3NWJA 2P9QA 5EAIA 2R68A 3NHYA 5A5FA 4JR0A 3OIVA 1ST2A 3VNUA 2FNAA 4PONA 1UMDA 3EH2A 2J3IA 3NT4A 3FPGA 1MJ5A 2WAAA 3OLCX 1UWKA 4FFVA 3RVRA 3ZBTA 2XUHA 4YP6A 2IEZA 1U9IA 3MSCA 1IFXA 4N5NA 4LZLA 1AHNA 3HKCA 2BTQA 4FFBA 4IIUA 3EHDA 4NU6A 1RRGA 4U7WA 4GVLA 2NVUB 5ALMA 4KPFC 3G2PA 3EFOB 1X7WB 2PKQO 1G55A 3KVVA 3ZV7A 4RKFA 1S9HA 2BEVB 2DQYA 2E0IA 4J3JA 4L78A 1U11A 4UVDA 2GXAA 4W9RA 3OICA 2IYQA 1FLVA 1VXRA 4FUTA 2IXFA 4G89A 3WLMA 5KINB 3HI6A 4B5LA 4MQMA 3PE4A 1BFKA 1DWOA 1N5RA 4B32A 3K4PA 4U5XA 4MI6A 1P2VA 4TT3A 4UD6A 2JDIA 4F9EA 3CR8A 1WHSB 4BFYA 4YLGA 3KJZA 3RYHB 4P0QB 1P1CA 1N5LA 1FSPA 1OROA 3IPRA 1POWA 4K9QA 3U37A 3DPSA 3KZOA 5ETJA 1P3DA 1ZC4A 4Y1RB 3R75A 4DCVA 2H18A 2BDUA 2IZZA 2TECE 2VPZA 1GCOA 2WV9A 2Q3BA 2IELA 2WJ3A 4TWBA 5FLKA 5FYDA 5TEWA 2ZFUA 2Z4RA 3BXZA 3JQ9A 4K6GA 4BNXA 3KWMA 3K94A 3WSTA 2I55A 1EXDA 1YDFA 1DUVG 1OA1A 3ZDDA 1C81A 1WNTA 1YQGA 3ODPA 5DWQA 3K0HA 4YIKA 3T6KA 3TH5A 4ENSA 4RIIA 3PDUA 4B4DA 5B2EA 4XX0B 4AU1A 1NG1A 3KYJB 4IIJF 4YRTA 4KQXA 5K8CA 3OT4A 2A5GA 3QQPA 2G1KA 2I33A 2YJZA 2V7BA 1L7OA 4P3YA 3EXEA 4TS4A 4DLRA 1YCGA 4DCUA 3WDMA 4C4RA 2PCLA 1E9SA 1BXGA 1Z4JA 2PRKA 5EFZA 3D4OA 3SYRA 3P71T 2LR0A 5E3HA 4C88A 5A03A 3D7RA 4L95C 3PKIA 4LZOA 4INPA 3VU9B 1J2EA 3CKLA 3AU9A 3NJ8A 4N5MA 3LPLA 1QUFA 1OC2A 1PLJA 2O1XA 5AP9A 1C8KA 1U3CA 2ACKA 4R40A 2H4FA 5BN4B 5BQPA 3A6PC 3DNFA 1DWQA 4HNGA 1U0RA 4RBNA 3PZBA 2BHSA 1UMBA 3CCFA 3ANXA 3ND5A 2C4NA 2VDOB 3P2EA 4W9MC 1PL0A 4GPBA 5HOQA 1N25A 2V7XA 3WMRA 1NL3A 1SY7A 4HO1X 4Q1DA 4KIWA 4WASA 4PCAA 1FFYA 4AMYA 3J7TA 1ZI8A 1C0IA 1KMHA 3KZNA 2B83A 1VJTA 2CXXA 4NS1A 1XD2A 4UBOA 1RP7A 3FNEA 1CR4A 3OO1A 5E8RA 4C3VA 3GAZA 4B6QA 4WFIA 4DWWA 4BO8A 2P8JA 4YJHA 4PIPA 1YZNA 3NW9A 3FSJX 1PR1A 2I6FA 3DFKA 2VZEA 4KDCA 1NWCA 4GWKA 2QZPA 3GJZA 3LPDA 4R0VA 1ZO8A 5I4CA 1NRWA 1E6MA 4D5GA 1F4VA 3RUIA 1XFAA 4TTRA 3BWCA 4FXPA 3T5PA 2R1UA 3OTHA 3V8BA 2BZGA 1A50B 4DHEA 1YJ8A 3P9KA 1C8LA 3R3YA 3RIGA 5FI1B 1H2AS 3AVQA 4GQIA 2I9KA 1MX9A 4TMVA 4DUGD 5HJ5A 4P35A 1NIJA 1YUNA 1IJEA 2D00A 3ZKAA 1S8NA 1U81A 3MT9A 5LIPA 4CW7A 4Z1MD 2WDPA 4FGUA 1XT6A 1A9ZA 1XP8A 3QE3A 3OKFA 3FMVA 1C9NA 5FOXA 3QWHA 4ZCPA 4NU0A 2AD5A 2C88A 3IDOA 1F4LA 3O2JA 2G80A 4E1VA 4K1XA 2RHHA 1U7ZA 2FE1A 1F1JA 2VPIA 3E1SA 3KT6A 3MTIA 2AG1A 2ZAOA 1JHUA 2A35A 2I78A 2XMPA 3KHUA 3L0ZA 4MR8B 4CKZA 1KRWA 2ZR8A 3W5JA 2YZKA 5J3JA 2SKEA 2DWQA 4H7FA 1E0DA 2CEKA 1F60A 1G20A 3O8QB 1NP3A 3SVZA 3OTIA 4I08A 4JFAA 1TYZA 4JJAA 4UQLA 4G36A 1I94B 1FU7A 1PX0A 5SY9A 1B6RA 1D2CA 4PEVA 3W2GA 3WNVA 1GSHA 1RYNA 1BCSB 1MV5A 1ACJA 4QVGA 3EAGA 4F4IA 1CUUA 1CEEA 2JEYA 4ALLA 2LKDA 3F7MA 1DC8A 2BSXA 1ONOA 4TL9A 4KR9A 1W7AA 1PWZA 5ED0A 3M9XA 4D02A 4NCBA 4FE3A 1XMJA 3ETEA 5BYBA 3TCNA 3ER6A 2G7ZA 2YZ7A 1HLGA 1WDLA 3NHLA 4FBMA 4MMXB 1TQHA 1U2RA 3USES 2ZDHA 2PX3A 1HT1E 3BA6A 2FVYA 3PUIA 4B40A 4XCVA 2CJFA 3TKLA 3ZV3A 1U04A 3KQQA 5GTDA 3RRJA 3OOHA 4JSRA 1CF9A 1LLCA 5AW2A 5A7HA 3W8DA 1ZAYA 3T7KA 2HD4A 1G5IA 1QH8B 3CH4B 5IHPA 2J0UB 1WUJS 3KKKA 4KQEA 4O0MA 2PN1A 3JARB 2C0QA 4DQ0A 3CVXA 2P2GA 2FPOA 4HXYA 1X0XA 4IJMA 4KV7A 1ODTC 3ANSA 4WK2B 2WY2D 4OP2A 5B30A 1ZG3A 3LHSA 1QWOA 2EEPA 3B82A 3CH5A 3LDFA 3CIOA 1QKIA 3QJYA 5JH7B 8OHMA 4YMSA 3AR4A 3HJTA 3FCYA 4KRXA 3R9WA 1NXPA 1FRNA 2R751 2VDWB 3EGEA 3K20A 3LF2A 2VWPA 3PA8A 4Y2SA 2ZJBA 1CE8B 3ITNA 3PQ8A 5CGZA 2XCSB 1GQFA 3OU2A 2QRKA 4YCCA 4F85A 3O8CA 4J3NA 4R5HA 2ONJA 2YRXA 3U13A 3MCAA 3LTNC 5J2UF 1MVOA 4PG7A 3COVA 4G0YA 4YAFA 2YFKA 2Z98A 4YVFA 5EUCA 1VI2A 1FUIA 1ZGAA 1RHKA 1QCYA 2QP3A 2WOOA 2Z2IA 4NLLA 1MPXA 4NVRA 4ZQCB 4NESA 2CCGA 5F4BA 4C1NA 3IPAA 2R84A 3I62A 4F3RA 3PUYA 1WL8A 5EA2A 1F7VA 4URFA 1EFAA 3ZDRA 2P9JA 4N3NA 4XJXA 1JHAA 1HEYA 2DHCA 2VNSA 4IKOA 1QGOA 3AXTA 3SHOA 1L9KA 3VSEA 4CIWA 5KO2A 1QP7A 2Y3IA 1TGYA 4A0HA 1G2QA 4YDSA 5EJ8A 1KBOA 2ASVA 2C1ZA 4GYYA 4KN9S 1A27A 2HRQA 1SZCA 1L8OA 2OAP1 2QTHA 4MWDA 5FBVB 3UOWA 3H7IA 1ZS9A 3JQGB 3OLYA 1YZGA 2CVPA 1WCV1 3FTDA 3ONWA 4UHHA 1IWBB 3U4HA 5KKCA 1NF9A 3NDRA 1CUGA 4QULA 1FCJA 1VECA 2GLXA 3F7NA 4Y8VA 2P41A 5K01A 3R7FA 4LGCA 3C8UA 4IFIA 1M1NB 4US1R 2B78A 4I4IA 4DTIA 1XZEA 3VC7A 4JIGA 3E9ZA 3KHTA 2ZVDA 1VKJA 4TMZA 3U3XA 1AZLA 5E4TA 4KBGA 3T7CA 1HYEA 1U0JA 3D6UA 4A6XA 1L4MA 2FVXA 1NXQA 3EVDA 2J5KA 2CFCA 2FZEA 3ITEA 1L4EA 3W7VA 3DVLA 3PQ7A 1EFCA 1TCVA 1E9BA 1FS6A 1QIJA 4QDOA 4V1CI 1R0YA 1Q0ZA 2VT7A 2Z8ZA 3T95A 3KETA 1YVDA 5BUSA 3DUFB 1H1LB 4CG1A 3ZE9A 1Z22A 2HHJA 2ODAA 5AVUA 1EVJA 4ZHQB 1T36B 3THWB 4QYTA 4ZKEA 1SXPA 1CUIA 2Q5HA 2A0YA 1EE2A 2O52A 1DTSA 1ABEA 2VQ3A 3F9RA 2R11A 1OY1A 1Z5OA 2QT1A 5HRCA 4XVHA 2PKEA 3THXA 3V8PA 5A4FS 2ET6A 3PIIA 1KHTA 4KWEA 5KX5F 2OFPA 2BJHA 2NSLA 2XMBA 3OIWA 5DYIA 5CAEB 4RK6A 1ONNA 4MKHA 1T26A 2BRUA 1I9GA 1M1YE 3V34A 3U0VA 4B79A 4TSFD 2IH2A 1Q5PA 1T2NA 5FPPA 2F55A 1X42A 4ZPXA 4GM4A 3I04A 4ILKA 4KSBA 4Q3EA 5JXIA 1KK0A 3FOWA 4QUGA 4DV7B 2VSXA 4EHIA 3DD1A 3M6LA 3B3GA 4BVGA 1FDVA 3BB1A 1UBFA 2ZE7A 3JQRA 4TQ9A 4U9IS 1ES9A 3CS3A 3H2JA 4Q1FA 5E1MA 3TD6A 2LIVA 2CBXA 3D7MA 1S96A 4MVJH 1O7JA 3TL3A 2G0NA 1E4OA 1CLEA 3MEQA 2O1EA 3JY6A 3BZWA 1JDVA 3DE0X 1QQAA 3B5JA 2Q6TA 5BYAA 3PKZA 4ER0A 4BVJA 5A5EA 4EF4A 5DFAA 3I9LA 3AHCA 3M6FA 2QTNA 4OCZA 2F3RA 1G2IA 3CNOA 5D87A 2DWOA 3BRSA 3DR5A 4BJ3A 1N6HA 3A28A 4BLSA 4ZOLF 3C7CB 4LUCA 2BELA 2AF3C 1P7YA 4ZO4A 3VR5H 4C07A 4D4KA 5HJEA 4LY3A 1KEWA 4QUBA 4F72A 4INJA 3EJWA 1C9JA 2UDPA 3N0XA 4Q4JB 1NUTA 1X7YA 2HQOA 2MDTA 4YJ2F 5DHRA 5IYZF 4YYEA 5IT4A 3PCTA 5DNUA 1O0BA 5EJAA 3Q8KA 4F5EA 4D9CA 4HRXA 3LZ6A 4JENA 2RHRA 1T8SA 4BFLA 4C6TB 2G67A 1QVRA 2BEKA 3WYFA 2ETVA 5A4IS 4C0XA 4YJGA 2NQ8A 3W2IA 3I2YX 4EG8A 5DHFA 1T24A 4EA8A 2MYNA 4X8LA 3UYKA 3WKAA 3W6OA 3RFTA 3H97A 5IM4F 4MW1A 3ROTA 1ZH4A 3U31A 3CE9A 3DT9A 2BI4A 2GJSA 2WSLA 4C6RA 5JDCA 3P4UA 2RHDA 4GT1A 3OJ0A 5LYYA 1S2NA 3VZSA 3ZY4A 4BEJA 2AKEA 3DBLA 5K3SA 2PGIA 3GXOA 3IEIA 1PVVA 5DX1A 1W88A 4CFZA 1X3SA 3FY4A 4M53A 3A2MA 4O1MA 2XE8A 2PL3A 2BFOA 3BMNB 2IFTA 4D9NA 2VF4X 2IL1A 4MKXA 3RAPR 4A8JC 4WESB 1VG8A 4TL8A 5LNK6 2XY4A 2C2KA 1V0JA 3JZAA 1F2VA 4LRSB 1UPFA 1WCIA 1XHFA 1ZJYA 2O59A 3Q10A 1J20A 2QX8A 2RGNC 3AERB 4PO1A 3WLEA 1GT91 2AMLA 1TVEA 4DR3B 1DG1G 1TZCA 4CEJA 1G8HA 4WINA 1WPXA 2K4MA 3DYBA 3IAM1 4R7ZA 4EJMA 4X3PA 1EWQA 5BQ3A 1TZMA 5ALFA 4QDJA 1VSQA 3ILSA 4AFNA 4ZCIA 4LYYA 1QPGA 2BOVA 5KMGB 4B75A 3GRUA 2ZVQX 3ZY2A 1E3WB 1M2VB 1WPRA 2C2YA 1EXMA 4RAQA 1KZHA 2FDCA 3K0CC 1UM8A 1VL1A 4AZTA 3O8OA 4IRUB 4CF7A 4CMIA 3QLJA 4M83A 3QKUA 1ZX1A 2ATEA 3I04M 4H7EA 4CDMA 1V96A 2WD7B 2MIIA 3O47A 1C3XA 5MN5A 4P08A 4DKJA 1XPRA 3CX8A 1H9AA 2B99A 2J3DA 3U7RA 4BO3A 2XIJA 1CT9A 3C24A 5E0KB 5F7OA 1PV2A 3UFXB 1E6CA 3I4CA 3L84A 1AKWA 2Z1MA 3BIJA 2IUUA 3HUDA 1D1TA 1DKLA 1Q1AA 3BCUA 3RAJA 3WMXA 4B31A 3CZMA 2HMTA 3CLUD 5U1PA 3WIDA 4MARA 4WD3A 4DMKA 3GLGE 1C2TA 4TX1A 4F38A 3P4XA 5DYWA 3ZLUA 1GQQA 4HB4A 2GEJA 2Y68A 3FUVA 2CLIB 4K28A 1QV9A 4R31A 3FYDA 4CPDA 2PT6A 4TZTA 2FUEA 2NV6A 1C8VB 4WY5A 3OFJA 2GS9A 2I80A 3UN1A 3TLJA 2HNBA 3DWEX 4JBWA 1Y3AA 4URXR 3ZLJA 5I4IA 1FJXA 5IS2A 2Z5VA 1N9GB 4LDAA 3BFPA 2J3MA 4CLOB 3EIUA 2HWKA 2IF2A 1FJGB 1JDNA 3W9YA 4N54A 4QWWA 2QQFA 4ACAA 1GQOA 2CVHA 4I4LA 1VTKA 4R9SA 3TAXA 1KZYC 3IHKA 3M1IA 3P2IA 4OA8A 2HO5A 1RKBA 2DMRA 2P7HA 2OXEA 4G1EB 4PLTA 1E99A 2B5OA 1G5RA 1T3HA 2JFXA 2EX0A 5IHXA 1FUUA 4W9NC 4E22A 5HDQA 2HBQA 3IBGA 3MIIA 4D9MA 1L4KA 3ZCVA 2DTDA 3FR8A 3W3ZB 3ZXUB 4BB0A 3D7SA 1K8RA 1P2BA 2BP7A 3GI1A 2GAFA 4M8NE 4O4HF 3TLYA 4DMCA 4QKQA 1NM5A 1XALA 3ONNA 5AKEA 2GZSA 5EEGA 1KDZA 3V7FA 1B41A 1JHOA 1K63A 4FEEA 5G0TA 2YHUA 2BFCB 4WDQA 3WTBA 4D79A 1IB6A 3G8CA 3KOWA 3ZVLA 4A91A 3OJXA 3D8UA 4PWZA 1CP2A 1XELA 4J0GA 1M10A 3KR0A 2IIBA 1J90A 3C1UA 1E6KA 2YIMA 4M9XA 2O3SA 2IU3A 1U8EA 3LT5A 2JFHA 2ZIFA 4B2IA 5IARA 5BRAA 3FZQA 2JH3A 3SEAA 4F1WA 2R48A 3H65A 3SR0A 4KP7A 2IE8A 3C1AA 3L6DA 1GNVA 1H2ZA 2EGUA 3VTFA 4M1EA 3RTGA 1UT8A 5CLJA 3D3NA 1FRFS 2QTGA 3DEFA 4PS1A 4N8EA 1DKQA 2IOYA 3ZLVA 5JADA 3CVWA 3ZGXA 4DDUA 4RFSA 5K05A 1THTA 2G77B 2AFHA 4OQFA 5FCDA 4Q19A 4B83A 4XWKA 5HQ3B 1GU1A 10MHA 2X7JA 1L3BA 1NV8A 2IJGX 1XQ1A 2ILTA 2YJ6A 4CKCB 2ODNA 1CNEA 3IOYA 4FWBA 1DAHA 5KC9A 2E4YA 1QYDA 3JVEA 2I3GA 3LECA 1ZDMA 1QMGA 4RMIA 3BK7A 1EUDA 1MO2A 3SBOA 4W5NA 1U2GC 2R2GA 2XTJA 3IRVA 4HGQA 3WP0A 1S4QA 3CWCA 4GSKA 4IIJB 4L0DA 1PR3A 4GXQA 4WACA 1NUHA 4F96A 5IJ9B 1IN6A 1NPYA 1ONPA 4ZIRA 1P9LA 1DQZA 4KAFA 4UATA 3UAXA 3AJEA 1MTZA 1WKCA 4LXHA 2ECQA 2WNHA 2Y66A 3A1CA 3NBQA 3PDJA 1GA1A 3B6EA 3RG2A 1NA5A 1U2ZA 4EKGA 4D5EA 4N0MA 5HYVA 2UYCA 5EHIA 1ADGA 2NZ2A 5JNVA 3H1AA 2OBNA 3C4VA 3PUJA 3WA7A 2JAOA 1RLOA 2AZ4A 1EWYA 3B3QA 3HUEA 3QLUC 4RM3A 4UCXA 1XEFA 4PQRA 3HLTA 3TLXA 2PLAA 3U7FB 1RZRA 3PFKA 3AEXA 3WLHA 4WK0B 3UJ6A 5FNZA 1CZOA 2GZRA 4B2YA 1YJBA 5LU9A 1Z5UA 1KP9A 2D62A 4LGYA 4XDZA 5JWRA 4FOOA 4DBLE 1OT5A 2XYVA 1KIFA 3Q2KA 4B80A 1GGMA 2K2WA 2VRWA 4FNGA 3TLAA 5BSVA 2LV8A 4A1FA 1QU2A 4LHWA 1G5FA 4YBZA 3L1KA 5THQA 4YAGA 3Q12A 3TTSA 3WHKA 4I8DA 2VDMB 4OH1A 1PDOA 2VYVD 4IL5A 5FULA 4RS4A 4OOEA 2WF6A 4MOWA 2W6IA 4GPEA 1NVDA 1YV9A 1XZHA 4GZLA 5JJIA 1RM3A 4E0BA 2ZP1A 1VHLA 1SXJA 1GNPA 2V6IA 5CXQA 2O0MA 2EQ5A 1GZ4A 2OBXA 4D0NA 4OX9Y 4P4UA 1SQ0A 2JB9A 1H69A 2O57A 2Q1SA 5DM2A 2NUTA 3S1AB 4R8VA 2AFIA 2R62A 4FYIA 4OGWA 2NTEA 4ECAA 3D6MA 4KGVA 3K09C 4YASA 2FZWA 3VMMA 2RBEA 3AGPA 1S0UA 3W77A 4BZXA 1M2GA 5T8KC 3N0RA 2MSWA 1RQRA 2GH1A 2CXRA 3R6LA 3GLIA 1GFSA 3PCRB 1ODKA 2B7LA 5EXPA 3EMBA 3JD0A 2OFXA 3A70A 1QHXA 4KYUA 4C20A 2WSSA 3LCVB 4H1VA 4EJFA 5CDTA 2CMDA 3KL4A 3L7KA 3VYUB 2BBOA 2JAWA 4Q3DA 4RADA 2JIPA 1QE3A 3NUGA 2FZKA 2F8MA 2FKNA 1A7UA 2HWYA 2HMAA 4AIIA 4D4MA 2GNOA 2WPDD 2WYIA 5I8WA 1FP1D 4JBHA 4NYJQ 3KJXA 1ZI6A 4F1JA 1CG6A 2YV5A 1SK8A 3SQWA 1SXIA 2CL0X 2PFKA 2UZ3A 1J23A 1RXUA 3ZHOA 3JW8A 4MV7A 1WCYA 4J75A 2H6EA 3BULA 4TQAA 5B37A 4EPXA 4EX6A 2BH2A 1KJ9A 1X74A 1G21A 1QCCA 2QR3A 3KR1A 4BL5A 4YI5A 1IATA 1WMAA 3DL4A 3UV3A 4C0LA 4BCCA 3TZ6A 1VHWA 2P75A 3QE4A 3K9HA 1B8OA 2CJWB 1OV4A 1Q17A 4JOSA 5C31A 5GVRA 5UKDA 3SLGA 3I28A 4AY5A 2AOUB 4D3XA 2FPRA 4XZ3A 3TDNA 5KBYA 1HDIA 4ND4A 4NYJR 1N5IA 3KQVA 3DE6X 4MQEB 1MAWA 3N2KA 3HY3A 1T9KA 1HBJA 4IH9A 1MRNA 1WUTA 4C7BA 1DS6A 3ZIAA 3LY7A 4IVQA 4D41A 4EHJA 4OX9B 2I2CA 1FYEA 2QRLA 1KKUA 2Z56A 3N1UA 1BWPA 4NAHA 3T0IA 4B3HA 5BSGA 2W4IA 5KOYA 2D1RA 3VZRA 1UC9A 1KO1A 2Z57A 1AKQA 3EXG2 4JVLA 4O59O 3CRNA 3ZK7A 2VNHA 4QFMA 1JIIA 1HPLA 1XDZA 1H66A 1YBFA 1Z08A 1ZPDA 3MIZA 1TM5E 2GF0A 5AI8A 4ZRNA 3ZVKA 3B9BA 1IAQA 5K0LA 1KKLA 1KJZA 1Y8RA 5K4GA 5J2UB 1QVAA 2O3JA 2QBYA 1AXEA 1SA0B 1E58A 2QQ5A 3M6WA 1FUKA 1E5XA 5CRIA 3RT7A 2HK6A 1RI5A 3ES9A 3FE2A 4GMKA 1K7EB 4V02A 4MLDA 5D01A 5FFMA 3CSUA 3N7TA 2C8JA 1JUDA 5ERGB 1VIAA 4O2BF 3H6HA 4QAJA 4BUZA 1GYRA 1Z75A 2TMYA 4QUKA 3PFFA 3GYBA 2O2YA 1W36B 1A98A 3NWPA 1L5OA 3Q3HA 2WJJA 3RYFB 3LH5A 3AW8A 3EVAA 1JE0A 4DA0A 3FOFC 3JQQA 3AR8A 4HEHA 2B3TA 2NSYA 3FWKA 3QVMA 4HTFA 1ZW1A 3RIEA 4O3MA 3H2YA 3SSAA 1U0HC 2HK7A 1NATA 4EM6A 3ONFA 2H1FA 5FBKA 4OUDB 1M2HA 1E18A 4CKBA 4I9FA 4RXTA 2HW8A 2CFIA 1K27A 3NT2A 4NXNB 5CDFE 3L7YA 3GNQA 4TUYF 5GQSA 1CUVA 3BQMB 1CY4A 2I1LA 4F97A 2PY6A 2JLYA 1W36C 1YMUA 3GJ4A 4Z6KA 2CVZA 4LV8B 4J0HA 4OI0A 1EVYA 3I45A 2FFAA 3NYQA 3ZWBA 4BLWA 2G5PA 1UMCA 3NGMA 1Z6QA 4KIJA 5DLQC 1F1BA 1OPRA 4ALJA 5K8VA 2WA2A 3NONA 1YJAA 1U2DA 3UQYS 1NX9A 1UBEA 4DDTA 5A6SA 4DV5B 2CSUA 1ADJA 4Q4DA 4AMZA 2UVDA 4Y2HA 2IW1A 2AUTA 2P69A 4DLUA 1EAMA 4DLZA 2G5TA 5LDDC 4WOKA 4Y2YA 3G82C 3JWHA 4OYRA 4QFCA 3PDIB 4KXNA 3RRZA 4C5BA 4G5QA 1EFVA 2I7CA 1MDBA 3NMUF 5J40A 4JOBA 4PAOA 4PLFA 1ZC3A 5DNAA 2GN6A 2C9ZA 1WKVA 4JKYA 5FBWB 1DXHA 2H4YA 3RVMA 4NONA 1A8QA 4XIIA 5KTKA 1FRQA 3UGKA 2WJGA 4ZWNA 3E22A 1JDZA 1OFUA 4XEUA 1QZZA 2POCA 3BE6A 4BZWA 3L6CA 5EXDA 2AWNA 2XZOA 4HNRA 1OH5A 2C7GA 5KX5B 1ZNYA 4CT4B 4HGOA 5CG1A 2C2XA 1V5FA 3VVMA 3ZE2B 2RJNA 2QD2A 1UT6A 1F2TA 3FPCA 3LKVA 1ZM7A 4GPIB 3RYIB 4G4GA 5BT8A 2XTNA 5EQJB 1M6YA 3O9VA 5JTUA 1U63A 2CLMB 5CEJA 1UM9B 4HX2A 3CLKA 1NJ2A 5LYJF 1CCWA 4LXQA 2XCTB 3V6LA 4XR4A 2YL2A 1NR7A 2IC5A 1MAVA 3OECA 4MRPA 1ZUWA 4MJLA 5JDIC 5LJIA 1X6VA 3LCCA 5EC8A 3E23A 2ZS7A 4RJIA 4AYTA 2COUA 4EI2A 3LO5A 4X93A 2Q3HA 4PZCA 4RKYA 5ALDA 2EX1A 4N82A 3W8FA 5ALUA 2PXCA 4B9AA 1CEQA 4C2BA 4XM0A 1KAHA 4HLUC 1W1UA 4YB8A 2EZ9A 4XCQA 4ZOLB 1F5NA 1U94A 3FKSA 3EVZA 4IUCS 5EJIA 3WDLA 3CJQA 2GN1A 1K3TA 1Z4OA 4BO2A 4M86A 3QVSA 3PJEA 4RWZA 2B21A 2W6JA 3DT8A 3MILA 3QKTA 1UAYA 3P2OA 4Y1GA 2QG9A 1KSGA 3WJ1A 4YJ2B 5IYZB 1HKUA 3HI4A 3WDKA 1R0LA 1IWOA 2YZMA 1SOWA 1S3SA 2KPOA 2QVBA 2VAPA 5K6AC 2QN2A 2MYPA 4ZCTA 4XVUA 3HM9A 5IX8A 3C4JA 2OOSA 3BMCB 1VCIA 1WD7A 2ZJYA 1Z25A 3WQHA 3DHWC 3LYHA 1KSJA 1XTIA 2A1UB 2FRDA 4EITA 1MN6A 1HE8B 3R5SA 3D64A 4UD2A 3TQSA 5FAKA 3AJ8A 2ZSHA 2HSWA 1SEVA 2JFUA 5HMLA 5I48A 1PNVA 4AZ3A 3SQXA 2CB9A 3I6ZA 4RPJA 1UFVA 3EISA 2WF5A 5DTQA 3M4YA 1C0EA 3MPUA 1QYIA 4ND5A 1OHHA 4UTPA 5B4TA 2X8JA 1BDHA 2EG9A 1YWGO 3GU3A 1P81A 1PR9A 4YROA 2XDAA 3L0IB 1LNZA 2QD5A 2EU8A 1FSZA 2Q4TA 3WWPA 4PRKA 1TTPB 4KXLA 3S6JA 1A5SB 1GN9A 2NXNA 4CF5A 2ZSDA 1Z06A 2P0YA 3LT1A 1AMOA 2BLLA 4J4HA 4Y2GA 1IHOA 1P39A 4F06A 1RPTA 1ZM4A 1SUCA 1IM5A 1E6WA 1I2MA 1CTQA 3EH1A 3MMNA 2E37A 3QMWA 3QXXA 4NKRA 1DG3A 3R0ZA 4FFNA 5KREA 821PA 5HNKA 1UPCA 1WVMA 4MYSA 3G9UA 2JJYA 1PNOA 2ZJOA 3F78A 1G8AA 1Z2NX 2I6UA 2JK1A 5F35A 1S2MA 3ZH2A 5FO1A 5B7QA 3GD5A 1QGDA 5D3QA 5DBEX 5B2ZA 2HEGA 3FB4A 4I5DA 3V2IA 2PUAA 1OTYA 1OU4A 2WZQA 4Z1OA 3W3AH 2QJRA 6REQA 1YAHA 2Y6UA 1HE5A 3AL2A 4ESVA 2XV1A 4OU4A 5D00A 2KW5A 4XB2A 6LDHA 1KQNA 2VHUA 4MVJD 1S1CA 4GDFA 1QBGA 1LB1B 3SZLA 3ZTTA 2I2WA 1T91A 1XZCA 4RJKA 3UMFA 1FDSA 5HKKD 3ADKA 1Z4QA 3OF2A 2WINI 1QO0D 1P73A 4MUYA 4CV3A 1WB4A 1XRPA 1LX6A 1W8IA 1I9CA 4YWHA 5ICMA 1KVUA 1TAGA 2G1AA 2YV1A 1TYAE 4L27A 2JIQA 2YWGA 3HA5A 3ZU3A 5JT1A 3HN2A 2CF6A 1Y5IA 2QN3A 3DNPA 2DR0A 2RI0A 1PBTA 3VC2A 4G84A 3DEHA 2Q8NA 4QTZA 3EF0A 4R0NA 4M36A 4B6EA 3LGSA 4EVQA 2Z8XA 3FSEA 3D6NB 1EUZA 2OENG 4WVFA 421PA 3EGDB 3AYXB 5IC6A 2QTVB 5IDVA 4JVMA 1JJIA 3MJ4A 3CW8X 4MIYA 5NLLA 1V9CA 1ZOOA 4NG4A 1P5RA 2E9SA 4YRPA 5ADWA 1VKRA 3HO1A 1O1YA 5KQMA 3ZCPA 4GICA 5B7NA 1APBA 2J6IA 3RFFA 1KYYA 1DB3A 1ZMOA 2Q0SA 3IQIX 1W5EA 1CJKC 3MD0A 3PU6A 5I5GA 5JXGA 2AMYA 1PS8A 4PG4A 4QQ8A 5JQGB 1E66A 2AI3A 2Q9BA 2VLIA 3TQRA 1RRMA 2IWRA 1MP0A 1JSZA 5TB5A 2IU0A 1PYGA 1LBTA 2A5FA 4KXWA 3S7TA 4EPWA 5J5AA 4LYFA 3WWCA 3OPXA 4IWXA 4BWVA 2CHUA 4X8HA 4D97A 3HR4A 1RWWA 2R97A 3IR5A 2Y1CA 3F46A 3MAGA 1MX5A 2I8LA 3IKLA 5B4VA 1UBUS 1T9HA 4EHDA 2CMKA 4HX5A 4KE6A 1E8NA 5U9CA 1RHMA 3QEAZ 3WLJA 5MFPA 1I1QB 1RLJA 1U0NA 2ZPAA 2ISQA 3MELA 4GU5A 2ALJA 3QBVA 4EZBA 4CMEC 3UCFA 1GJRA 1Y80A 4HB2A 4O4HB 3AKYA 2VN8A 2YJNA 3FDJA 3HC7A 4UBNA 1UQUA 2G4CA 2YOHA 5IXJA 3KUDA 3JS5A 2PWAA 5IXSA 2R6AA 5DM4A 3D3QA 1JIXA 2YFQA 5FWYB 1HZZC 5DOZA 4B3TB 4CEIB 1QVVA 3B8EA 3TSZA 4F3NA 4XGKA 2I0FA 4DBVO 3IA2A 1BXRA 2QRPA 1DOHA 3OEHA 1KI2A 5DN6A 1KYVA 4HAYA 2XH8A 3R5FA 1MGOA 2EHDA 3HDGA 3IESA 2IHJA 1K7FB 3VH3A 4ZDKA 2WABA 1GPKA 3ABOB 4AUEA 2P79A 1GAJA 1M0WA 2PS3A 2Q62A 4Y9TA 3SZUA 3JRXA 1DKUA 2J3LA 5L45A 4QPZA 1C7IA 1M54A 3K05A 2D1QA 2W6MA 1NQOA 4L08A 4A73A 1C4OA 5EJ5A 2ZWOA 2RHOA 3CB4A 1WU7A 3S2YA 5BV7A 4UOZA 1PWHA 3P0RA 3QXGA 3G1UA 4PZPA 2UXBB 3CHYA 3CZRA 3AEQA 4FCWA 3J7AC 5CA0A 3RVKA 2WI8A 3IVMA 4ZTBA 4EB6B 4CDRA 2XMZA 1KK3A 5A02A 3ZJTA 5THKA 1VRVA 3MBOA 3U16A 5AVRA 3OIDA 4L5YA 4KUGA 2MSCB 2UZ1A 2IXAA 1B0AA 2W2LA 3FI0A 3QNUA 1WMSA 2J7KA 2AYYA 5AVVA 1TD9A 1KVQA 1PR0A 2W4QA 2RGYA 4PAMA 1HOTA 1JQDA 1THGA 5M3BA 2J0QA 3A6HA 1H6BA 5IH3A 2ETXA 2LXNA 4DLNA 4E5KA 1A9YA 2BBTA 4DYVA 1UJMA 1L4HA 2KMLA 1C7QA 2FQWA 4EJSC 4XLZA 4I14A 4K26A 2ZUUA 5C1OA 5MFZA 1V7ZA 1ZN7A 3E2PA 2JRCA 4HWTA 3I0ZA 3D54D 2GVNA 2WVJA 2VAMA 2GRJA 1OX5A 3HKCB 3M3PA 3NKFA 2XCRB 3O38A 2WB2A 3TM4A 3TX6A 1KK2A 3G0IA 3TFWA 2AE2A 2HPZA 2WM9B 4TLMB 1NJGA 2QTFA 4IEIA 5K99A 3NWEA 4IZOA 4K05A 1Y4ZA 2CY0A 1FX0A 1XTUA 3AP2A 3G2IA 4N41A 5KHAA 2PX8A 4O2AB 2IP2A 2VJCA 5K3DA 1Y7HA 1D8AA 1KI6B 4R3WA 3Q41A 1AGNA 4F45A 5AUPB 1HXHA 2WMOB 3BWEA 3OZGA 2JLQA 2WBLC 3AG6A 4H3VA 4MV5A 2Q3JA 2OPHA 4I19A 1J8FA 3L7CA 1ZXXA 4WXMA 5IH7A 4J9VA 3UKOA 1MHPA 5I47A 2GCPA 1R27A 2PWBA 4HEQA 5E6RA 1OJ7A 4X20A 4ZC1A 1C8BA 4JC4A 1L5NA 4XYLA 1BS1A 5JNTA 4JBNA 4PNZA 1Y8QA 2Q9UA 3GV0A 3GQBB 2R7LA 3WLFA 4IZ6A 1R6AA 3M6AA 2WTBA 3EWIA 2ORIA 2NYAA 1WZUA 1BU5A 2PGXA 1G1MA 3FOBA 4OAOA 4EEZA 1YDEA 2C00A 2F17A 4S2UA 3IE1A 3OPNA 4CTMA 1MVNA 4M1OA 2CD9A 2O5VA 4JH0A 1HM5A 2XBLA 3C6QA 4FJ0A 4D4HA 4Y2QA 3MS7A 1K5HA 5C5EA 2VT2A 3ICOA 3MJCA 3CF4G 2AWOA 4GE0A 4Q5IA 4WZAB 4FHFA 2GHQA 2QAJA 4KE8A 4HDSB 3AZQA 3KYDB 4WJKB 1M8GA 5TQ0A 3TUIC 5B57C 2AA3A 1BMDA 2OCAA 4AK9A 4J94A 1WM1A 3Q7TA 1SUDA 2BMFA 2KBFA 3KX2A 3QTTA 4FCCA 1ZICA 3IQHX 4FN5A 4XTCS 3WX0A 5JCPA 3LY5A 2HJSA 4GBJA 1DHRA 1G9XA 1SPXA 4MUMA 4OFXA 5JNSA 1CQWA 1GUZA 3IAM6 3H2IA 1J5PA 3QKRA 3OHPA 4HPXB 1QR2A 1J0AA 4L3OA 3FJYA 3SNKA 1R6TA 1U8FO 2VTEA 1BMQA 1NZDA 4UARA 1OAOA 2I76A 3HEBA 5K3CA 1HNNA 5LQCA 2JCYA 2IP4A 2VP0A 3D9QX 3DLPX 3DMYA 5G4KA 1GDTA 3G68A 3RFCA 5G4LA 1U4NA 3WGLA 2UVPA 4ARUA 4B6OA 3TGPA 2FG5A 3BK2A 2QV0A 1V25A 4URZR 3VAYA 2VHQA 3TDMA 3ZTYA 1IPHA 5FIUA 5FB3A 3SIPA 5BVGA 3STWA 1XD2B 2Q5LA 2AW3A 1JT9A 4MRVA 1H2FA 4KQJA 4L9SA 3T5MA 3U7IA 1JIJA 1BCRA 3BFKA 1XRJA 2B82A 3IPXA 121PA 2WYHA 4HV4A 1KFKB 1MO3A 1PGJA 2CDCA 1Q14A 4BBJA 1W581 1YQXA 2ZIEA 3EK2A 2XKKA 1EM8B 1LDMA 1YJCA 1J9GA 2DPMA 3NHUA 3ZLBA 4U3JB 4D25A 1NSFA 2Q2OA 3U48A 3EVCA 3A3KA 1ICEA 3G8AA 3BMXA 3TLMA 4CGYA 3KSBC 1GKKA 3LHIA 5AW5A 3ZG6A 1PEDA 3UJNA 1VE1A 4ALNA 5JD3A 1V1JA 4E46A 1H8HD 3W6UA 5T64A 4N5HX 1QM5A 1P0PA 3M1LA 2C7PA 3GNTA 1WF3A 4JQOA 4IV0A 5A4MS 2AR0A 1EP2B 3ELWA 4FDMA 1I6WA 3GN2A 4YRFA 5AOCA 1NYTA 4XRGA 4J7AA 3WGNA 2GFQA 4BWYA 5IZCC 5EHXA 4O2BB 3QEBZ 4IV8A 2YV3A 3IXMA 2X42A 3U49A 2ZIXA 4DLXA 4B71A 4WGFA 1DBIA 4UXJA 3K9BA 2ZCUA 1O94A 1MH9A 4Z4EA 2HRBA 2DZDA 3AFMA 3SS9X 1EPUA 3VOTA 1QGUA 2IK8A 4EAAA 1QFXA 3BXHA 4KOAA 4COOA 1GQ2A 2VDJA 1ZVKA 1ULSA 4KUEA 3DC2A 5EIOA 3U3DA 3ROFA 5FHQA 1ZM9A 3ESBA 1ULTA 4TUYB 3AILA 1YRYE 2EVWX 3S29A 4LVUA 2G5GX 2C5AA 1DPGA 1FXWA 4FS3A 4ND1A 4YCJA 1KSHA 1NNLA 2PUHA 2W83A 4LRQA 3UHFA 5MF6A 1RYZA 1JQ5A 2J4DA 2XE7A 3OWHA 4D4LA 1LK0A 1NHGA 2PXAA 2YICA 3L4BA 4NBTA 5DE3A 2F9FA 2X5JO 4EYEA 3R4CA 5KNBA 3A2NA 3FETA 1SVNA 4KIFA 1FLDA 1G7RA 2IU6A 1RYFA 1V37A 3PUHA 4G67A 2GTIA 1RQGA 1Z5GA 4JLDA 4KXVA 3OC6A 1GKYA 3FYCA 4NAUA 2VRCD 5AH0A 5FPKA 2QW0X 1WE2A 4UOEA 3D6TB 1OR8A 1K7XB 1MH1A 3F74A 3IQGX 5FUBA 3LC2O 3LCUA 1JBKA 2VEOA 3PLRA 2F1IA 1NPDA 4ZV4A 2Y1LA 3E58A 1RBMA 3WYGA 5HF5A 1HKHA 3QG1A 3KCQA 1L7VC 3G9ZA 1AX9A 2HQSA 3AOEC 4EYSA 1D2EA 2G72A 2V0GA 2NG1A 2OQVA 2IYOA 5FL7A 1ZGJA 2CLDX 2Z08A 2ZG6A 5AKHA 4A8HA 2DETA 4IVPA 4OM7A 2QG4A 1EQUA 1V8DA 1LFAA 2JI8A 3Q8XB 2HPHA 4D0GA 5TPZD 4KFUA 3IT1A 4OF4A 2X0NA 1T9BA 2R7KA 1H6DA 3R44A 4MULA 4N7JA 5E38A 2WT4A 5H5JA 2ZUFA 2IOFA 4JQSA 4UU7A 1WU8A 5JFGA 2AB0A 2D5IA 2OSVA 3GD7A 4XD7D 1R9NA 2GILA 1MZVA 1AKYA 2ONYA 1U0FA 2J0EA 4UMFA 4E70A 4BQPA 4DV6B 3FTEA 3OPMA 2VOJA 3L41A 2CVFA 3EX7C 2B2XA 2AMFA 2YS6A 2OG2A 1EWKA 2ZVJA 1ULUA 4ROTA 1N5KA 4I3HA 2OT3B 2EP8A 1BH6A 1WSBA 1QOQB 5BW5A 4TYWA 4OP1A 4G24A 4TKUA 1AF4A 3EXIB 1CJSA 4J8PA 4WK4B 2WF9A 1C4KA 2RDMA 1GT6A 4QGAA 4X7PA 3WOHA 3IT3A 5ITVA 1HNZB 4LC0A 4HQFA 2WFMA 2QMHA 4NJEA 1GXSA 2X8LA 2F3SA 3AUFA 4B44A 3QE9Y 2BFAA 3O4RA 5HBGA 4LJLA 1COZA 5KAPA 3VPAA 4BQNA 4C7MA 5ITSA 1RKXA 2BMJA 3KKQA 3QMVA 1I3MA 1VPEA 3GDGA 1A97A 3M70A 4YCBA 1BX0A 4EG4A 4FW9A 2WZCA 2D7DA 1E8MA 4YCAA 1Y6JA 4R1OA 4E51A 4V0OA 1IIRA 3DKRA 5HFNA 3V8QA 3S99A 5ALLA 3VUFA 2PCJA 1B0UA 1PZFA 3GPDG 3QW4B 4TLEA 4ZQFA 1Z0FA 3ZI0A 3H3FA 4E2XA 1O6GA 1QFZA 4PX9A 5ARDA 5H83A 5LKRA 1VKNA 3KD2A 3QV1A 1BW9A 4CYMA 2A9RA 1KQ3A 3ZCXA 3J81k 1UJCA 1EFUA 4QPJC 3KBOA 3UXEA 2AXQA 2FMIA 2AC4A 5E3IA 3NAMA 4C22A 1BOOA 1FNDA 1R5BA 4PYRA 4JD5A 4TTTS 4GSYA 5CCDA 1XZPA 4L5JA 1RQLA 4XQ0A 1Z2CA 2DOKA 2O8BB 1KC3A 5GJBA 1KO8A 2MMCA 3OQIA 1KDRA 2VXBA 2ZRAA 4Y6SA 2YYYA 1XVUA 3PXCX 4PR3A 5IJ0B 4UULA 3EXHA 3E5HA 2FRXA 2YWFA 3O9MA 3TIVA 1NRIA 1UFRA 2JGEA 1K9VF 2EDAA 1QGED 1HG1A 2DM6A 1YZQA 3B7PA 1C9DB 2XD9A 2O2CA 3JQAA 3C6KA 4NATA 5T41A 3EZYA 2WNSA 1XYYA 4ZANA 3NWOA 3ELDA 2E48A 3DFUA 3I9MA 1WRBA 3UH1A 1KS2A 2IZ0A 5JOQA 2ZI7A 3DMHA 1Q6ZA 1KFEB 4PCUA 2EG5A 1YBVA 1TK9A 2GSWA 3LRXA 4N0PA 3MCVA 4QDUA 1IL0A 2FK8A 4G1BA 1H6CA 2FSHA 5F12A 3OQBA 2FFRA 4O5OA 2W70A 2OILA 1RAGA 1YDGA 2C9BA 3R5XA 4PCLA 5CR9A 3WLKX 5D3MB 2R6R1 1VOTA 5ALWA 3AHHA 4LHVA 2CXTA 1QTRA 2ZTLA 4E5DA 2X0RA 5CIYA 3DTVB 3WK5A 2ZM6B 2PMBA 1ZOSA 5B4UA 5LP6F 1J42A 2DRIA 4HAUA 4Q12A 3UQZA 1NVWQ 5A62A 3P9ZA 3OAAD 2IXEA 4NL4H 1MXHA 2JLAA 4K0KB 1X8LA 3H2KA 4IO0A 5EESA 3S81A 2CCKA 4JT8A 4B7XA 4CQMB 3N9IA 4JNKA 5DMXA 1IVSA 3GFGA 3X1DA 4J16A 4MO9A 2EERA 2B25A 3GIDA 4L9RA 4UDYX 1RMYA 3FNFA 4V03A 3QXJA 1ZNZA 2C2ZA 1JFLA 3ZCUA 1M2JA 2VVTA 1ML3A 4LCJA 4DV2B 1T8PA 1TEZA 1U5AA 2MMGA 1LWOA 3AT1A 3C3DA 3KWJA 3O21A 3AQ4A 3V7YA 3X0DA 4BRZA 4TYNA 3KJFA 3G02A 3KUXA 3L9WA 2DVMA 1A9TA 3KPYA 1QGZA 2LVBA 4WTOA 1U2TA 4D45A 1W88B 4FYYA 2VHYA 3E05A 3E9EA 5J5VA 3TQHA 2VYFA 2WYVA 1JSLA 3W5DA 4UC0A 2Q4RA 1NOIA 1RWKA 3BJMA 3LLMA 3R2JA 4WADA 1DL5A 5DIZA 3EC7A 4BU1A 4Y2TA 1WCIB 5E4YA 2I1QA 1YIDA 4JODA 1M2FA 5C8DA 3LQKA 4J0CA 5JYCA 4R6WA 2ZSIA 4LQDA 2IHUA 1T5LA 1ARZA 4FQ5A 2X0IA 1NDQA 5DCUA 4QXOA 1DJLA 3SPXA 4JL8A 3ZZTA 4R2KA 4QT4A 3N8DA 5CYOA 4LKOA 4U7FA 5EP3A 2FZVA 2L2QA 3CLVA 3A1DA 2MOKA 1THMA 1NXTA 4AJLA 2H7XA 2J07A 5YASA 2ACVA 4H17A 3W3AD 3FD8A 1U8XX 3WKEA 1FFAA 1Y8CA 2PS9A 2MSLA 1PGOA 3PX3A 1U1EA 2IZ7A 2WJPA 2QQEA 4MXDA 5HJ7A 2ZSUA 2Y76A 3ZWXA 1VB3A 4RVCA 3NTUA 2P65A 4RZHA 4E31A 1EWTA 5E7QA 3K30A 1NW9B 3DJFA 4RABA 2BUAA 5U4XA 4HH1A 3U5ZB 3SC3A 2ENWA 2C5EA 3QX9A 1HT3A 1YB1A 2AXEA 3KZXA 4XSHA 3C97A 3GB9A 3N53A 5CVEA 4B09A 2VQEB 2J0SA 1HYQA 4ND8A 4R81A 4YFYA 5SYMA 5HVNA 1POXA 2ONCA 3R3UA 5DGCA 5AJYA 4J07A 2ZWMA 3UG6A 1H0KA 1T4BA 4ARVA 1ZN2A 1T4GA 4PFJA 2WK1A 3QWIA 3K2QA 4MRMA 2HKIA 5K0NA 2J3HA 3WYBA 4B3MB 2B6NA 3TLBA 2Q7XA 3HDJA 1CS4C 1MDFA 4OSOA 4QUAA 1IY1A 2ZIVB 4B9EA 1AVTA 2VPYA 5EHZA 4QDXA 1GZUA 2CKMA 3JQEA 4QM6A 4MQFA 5CNMA 2P2NA 4Q1EA 1NC3A 4E6PA 4I1PA 5IG2A 1YZHA 3HPQA 1Q83A 4KKVA 3HYRA 4IHAA 4MS4A 4ZEOA 1ID8A 2AH5A 1WDTA 3BVPA 1PNTA 3HSYA 5GJWC 2ZB7A 2XJ9A 4JYBA 1DOZA 3SEQA 3SQLA 4XPIB 2RBGA 5K8TA 1NG9A 1G16A 3GEHA 5A4JA 3MD9A 1PRYA 3E7WA 3ZHSA 4Y7CA 3RANA 4YAIA 5ESDA 3SEFA 1LXCA 1ID1A 1MB9A 2HPVA 1ONBA 3CVOA 2PWPA 2BP7B 3IJPA 4M2LA 5EIBC 3CKKA 2FPGA 5CB4A 4EH1A 1DNPA 1DT5A 1JMYA 1KFBB 1HDEA 2ACEA 1R8JA 2O7NA 1T25A 3BWMA 3K9LA 1RAEA 1Q7BA 2NTJA 4JC0A 3T06B 5JMOA 3T94A 1EUQA 3A11A 3M6XA 2F1JA 4PLCA 1X80A 2HOQA 3NPMA 3UMGA 2C7BA 1NN5A 4DTCA 1UDWA 1M75A 2BKAA 2HPAA 5EIXA 3SXJA 2PNFA 4D44A 5DB4A 5ER6A 4B7UA 1ENZA 1PKXA 2PFSA 2M32A 1UP4A 2FTKE 1CUHA 2G3YA 1YBAA 2I7TA 2XUFA 2W2NA 2BL4A 3EEYA 2HBZA 2AVNA 2AZDA 2H5LA 2IY8A 2P5TB 2ZRLA 3M33A 4ITUA 1J9EA 4ZTUB 3DFIA 2NU9A 4N6GA 4DQLA 2BHLA 3KQPA 1ND5A 5G0SA 2GYWA 4BN4A 3DWFA 2JD0A 4ZA2A 3JYOA 3EZ7A 4M0PA 1UOOA 4LG1A 1NBHA 4Q9AA 1QZXA 3GRVA 1PSZA 2QRVA 4ZAVA 1AK1A 5DCWA 2C9MA 3SG0A 4DSUA 3OQNA 2RHJA 1RM5A 2ZE8A 3H5AA 3K0FB 3UVEA 3KALA 2GEFA 2QRMA 2YMLA 3RUFA 1S2LA 1YC5A 3TIIA 3RBVA 1RHRA 1B2LA 1IHXA 2P4HX 3R9XA 3TGWA 1AKVA 5KYXB 4FZJA 4IZHA 1T2CA 1V16A 3W05A 1M1UA 3B9PA 3ZJ5A 1TLLA 2XODA 4TMKA 2XE4A 1ZIYA 4MW6A 1MC4A 3EZ6A 5L3QA 4FMDF 4E2FA 2Y0PA 3KUKA 4TS3A 4TL6A 4JB3A 1XZJA 3PQCA 5HIMA 4F7WA 1EK0A 3KT0A 3CN9A 1D09A 3LWZA 3WGVA 4Y18A 2H52A 1GRRA 3HP4A 3N6VA 1SNYA 4UVIA 5EMJA 1H9CA 4DG8A 4JT9A 2BN4A 2VNAA 2J0VA 1GNLA 4LI3X 4DDMA 5ICFA 1BDBA 1M73E 2AOXA 2GO1A 3PF9A 2BFEA 1U3GA 1FC0A 4YUWA 1H2RS 3I6BA 1I0IA 4G5HA 1PQWA 2QLBA 4GP6A 2GGSA 2XNJA 4YY3B 1GWNA 4ZK6A 4I9HA 1RI4A 2VH1A 3N7UA 4ENTA 1VGVA 5JR3A 3A04A 3PLNA 2FRVA 1J99A 3BCHA 4U6NA 3CCBA 1EJ2A 4RIFA 4ML3A 3W9BA 1L5LA 3OFSA 3P9RA 4IKEA 4I9UA 1WSWA 5DP2A 2PUFA 1TO6A 1Z13A 4RVSA 4EP1A 2WJIA 1Z4KA 4DUGA 1IZ0A 3BGSA 3L8DA 4CLEA 5ABPA 1G5TA 4TWAA 4Z3DA 2H85A 3WO0A 4Z1MA 1SXJB 3TS1A 1P1BA 4MWZA 2HLDD 4E1BA 3A3YA 3ELUA 1LBQA 2EBFX 4JX9A 2FMKA 3LVRE 2ZUVA 2LBPA 2Q46A 4D57A 4EKDA 1O8BA 3MOGA 4HWOA 3H19A 2CV1A 1TJYA 2C82A 2V7GA 2ZSJA 4LOHA 1Z33A 2RKOA 4DDWA 3ANNA 1NQVA 4P0TA 5G40A 1GYPA 2RHCA 2JA1A 3DO5A 4BUJA 5LDHA 5F4ZA 4IDQA 4N3BA 2OGUA 1X87A 1VHJA 1DV1A 1O89A 4LC1A 1IM8A 2PXHA 5KNLA 3HH8A 1T4MA 3H4VA 3PUXA 4RGBA 4F60A 3WWOA 3C6ZA 4GX0A 1GRVA 1I3CA 3R0IA 1V11A 1NVGA 3AI7A 2UAGA 2PK3A 1H2BA 1ZJJA 2B9VA 2WJHA 3A4IA 1ZCFA 4P34A 4X9XA 5C52B 2ARKA 2I3ZA 2YJGA 3RC7A 1EVZA 1Q1QA 3IBTA 3PYXA 4M89A 2VTBA 3AIOA 3ORSA 3R7DA 4NHOA 2V6BA 1TMYA 3K73O 3GGPA 4DM7A 3KZCA 1P5ZB 2PUDA 3FCCA 3MNFA 1K5GA 2WVAA 2WTMA 1W36D 3H5TA 3HJCA 3OKPA 1GGEA 3V1TC 1DQRA 1E1KA 2Z6AA 3CMCO 4CG3A 3SYMA 1DOAA 5ICCA 3TG8A 2H3HA 2HF2A 5CVCA 1RKQA 1LGYA 2D5CA 3WIVA 3H3XA 4Q05A 5GAJA 3SKXA 3M6UA 3E3MA 1VI6A 4ZU1X 3L0BA 4G5YA 5L6MB 2GA8A 4LNUA 4BO6A 3G8BA 4JSYA 4R54A 4RHUA 3IUPA 1LPMA 3TPCA 3VYSB 2M1XA 3IB6A 4TRMA 1V1RA 5FLYA 3FYSA 5F7JA 3A2KA 3MGKA 3GDFA 5A3JA 4KZPA 3RVDA 3NXSA 1O57A 2PTGA 3UF0A 4DYHA 2ZRDA 2PKCA 4AG6A 4AMGA 2XQFA 4OXQA 3VYTB 4ZYTA 3BRWD 2ILVA 2C92A 1G17A 1CK4A 4O0LA 1II8B 4XUEA 5EVCA 1TPYA 4C76A 4KNYA 1UKCA 3ZXIA 2EBHX 4BO9A 1EDEA 1PX2A 2B0CA 1T3LA 2WAMA 2D54A 1PK9A 4Q3NA 1HTTA 1G0OA 1JXQA 2P4UA 1PHRA 3HMQA 2GJ4A 4P3KA 5FOWA 1NE2A 1JQJC 2UZAA 2EW1A 1V47A 3K0AB 1JPNA 5LM3A 3ZW9A 1M0SA 5T67A 4RVFA 3W6NA 5BWMA 1KQFA 3KHKA 4P1ZA 4ZAWA 1S8AA 1W85B 3PJFA 5CW1A 5JZBA 2JCXA 3KUCA 4UUPA 4WNCA 2QRZA 1KAEA 2QMUA 4U8HA 3R7WA 1P31A 3SIWA 3HKDA 5KUTA 1KQGA 1A9QA 5TMBA 3G0CA 4A5SA 2R5NA 4Z4IA 4HAXA 3R74A 1KY3A 1JHDA 3AJAA 4KO8A 1WZEA 3NO4A 1E2PA 1DMSA 2G6BA 3AHIA 4E88A 1UXHA 2QYOA 4M3NA 5A7GA 5BWOA 3AL0C 3DMGA 2P1ZA 1E3IA 1XL0A 3MCTA 2B20A 2PGOA 4ZV7A 2IYRA 2PR7A 3DYVA 3T5GA 1NASA 1ILWA 2JLCA 3KLBA 1EINA 1ZYUA 5FXMA 5A0FA 1A7KA 3BSWA 2GFIA 2ATIA 1IEVA 1SKYB 3L7OA 3E48A 3MOSA 3II6X 3PVZA 4CKBB 2UXDB 2IBMA 2EIXA 3UBTA 5KKAA 1ADBA 1BFUA 4UTXA 4K6FA 3NDBB 1UBKS 4UASA 4N12A 5KU7A 2VUSA 1FXWF 2JAXA 1F4PA 3GFTA 4W5TA 1ZESA 2RGEA 3G6KA 2QS9A 2VDUE 2VHJA 5I9SA 4BFWA 5E7JA 5ITZB 3PGMA 1ZWKA 3H1TA 1ODSA 3M9WA 3NHRA 3OT1A 5AHWA 4QOSA 3W2TA 1YRHA 3FW1A 5DTIA 5A6SB 5HRAA 1YOVA 1C3OA 1XAHA 1VLHA 2AN5A 1E1CA 1Z16A 1QHFA 2B8TA 2HSZA 3AUAA 3PXUA 3SJZA 4QTYA 4DL9A 5TRTA 4YUVA 4HQ6A 2B2CA 2VJMA 5LZ9A 1LLQA 3Q15C 3CUYA 2XYHA 4AJJA 1OX4B 4YRIA 3HCNA 4LBWA 4OXRA 4R7TA 1OBHA 3IUNA 3E2MA 2X41A 1BSVA 2B2NA 3BGOS 1E3EA 3QPUA 4JCCA 4YRSA 2XUKA 1R6BX 1X8KA 1STOA 2HMSA 2OO7A 2ZJ7A 2X2FA 3E22B 3I8XA 1SCAA 4QUJA 4QD3A 4RZXA 4BN5A 2J5BA 3OJFA 2Z09A 1WF6A 3O8DA 2ADMA 1QZTA 3C87A 4AX4A 4RFVA 2QRUA 2H2GA 2FW7A 2OMEA 2WIGA 3AF4A 1O0CA 2QJFA 3ZXYA 3NM6B 2R86A 1UK6A 2GJAA 4QXRA 1BGWA 1MQ8B 1JHYA 1N6PA 1F2TB 2ZT5A 4B33A 1OJLA 1N2HA 2K7FA 1P7ZA 4FINA 3WBBA 2BUCA 1CJMA 3T7IA 1GV1A 1LRLA 1SZDA 2CLKB 5FOSA 2Q7OE 1HURA 4G8BA 2B1QA 3PQ2A 4Q82A 2HAEA 1WJGA 2H63A 2XUQA 4W1QA 1GRCA 4CMJA 5BR1A 1RSZA 2P9ZA 3ABIA 1U90A 5AI4A 4NZYA 3BREA 2NZVG 1QG4A 1R18A 1Y1QA 1YGPA 3KLMX 4KQ6A 5ESXA 3ZDEA 1ZAKA 1C7RA 2V7QD 3HLKA 3A1EA 2EBWA 1CX9B 3R1IA 1A9SA 1PFVA 1S8OA 2HWWA 4FI3F 4MJ3A 4WA7A 5T7BA 1CUCA 3G2KA 4MGEA 3TQOA 2CHFA 2PMCA 4YK7A 1CUBA 1MPTA 2JL1A 1F0YA 2QD4A 4JI7B 3QBEA 1ZUD1 1OFGA 1DC5A 2QLMA 4AYXA 5H82A 4GM0A 4ROSA 5EMLA 3QVJA 1HC7A 1S01A 4PLPA 3IGFA 5DTEA 3EEFA 3MT8A 3BXXA 4PRZA 1PTKA 3COZA 1BWQA 3A9WA 3UPTA 3GUYA 4KYVA 3QQ5A 3U81A 1ZY2A 2ZE5A 2HLNA 2YY5A 4EW3A 2PKWA 5IJAA 4AYWA 1ZQ1A 1ZH8A 2AEMA 3NGXA 1QNLA 5K2OA 2B3DA 3HYTA 5LXTF 3FKJA 4HYTA 3LHDA 3ELBA 4G8CA 3TWOA 3ISTA 3VTZA 1QHYA 1UOPA 3HKBB 3OM8A 1OWLA 5AO9A 1DO8A 1GIAA 5E0OA 1ESZA 2H07A 2CXSA 1YVEI 1RLIA 1Z4PX 4TTPA 5LA6A 3REFA 3GBPA 2NYUA 4PXAA 2DLCX 1KMQA 4C43A 3W5VA 1GYQA 2YN0A 4JC8A 5EMMA 4AZ3B 1US8A 3RJTA 2ZU6A 3HL4A 4EMBA 3TIXB 1XUOA 3HRIA 5LP6C 3KL2A 4TWJA 3TZKA 3BCRA 1MOPA 4KIGA 4P5EA 2Q45A 1QBKC 4D96A 1NR5A 1QIIA 2DTEA 4I6JA 4TTJA 4H31A 1DC4A 3H86A 2PVCA 1U3FA 3W9UA 3ZZ1A 4OHWA 1Z62A 1BVYF 3SMQA 4YP5A 2HBYA 1NVXQ 1O0SA 3HVHA 4WAUA 4GC9A 1SHKA 1R10A 1R66A 3CXRA 2QI9C 3PJDA 5D85A 3GEMA 4TYPA 4A8TA 2ZJ0A 1DEAA 2DSTA 4AY4A 3GP8A 2PSFA 3DA8A 3PHJA 1ADFA 4MS3A 1VCMA 1EK6A 1SM4A 4MCHA 4CXMA 1DX6A 3GT3A 1Z0JA 2ZQYA 3Q40A 1Y6RA 3DOJA 3IOMA 3ND7A 1HDYA 1KJQA 3O8LA 4JEIA 4MP8A 1S8FA 2RG7A 4CCWA 3R5KA 5H4GA 1M7HA 1OBOA 1H2HA 5C1BA 2VQFB 1G3RA 2ANBA 3LUAA 5HTKA 2ATVA 1BNCA 4NU5A 4EGQA 2C3OA 4JJ4A 1S2GA 5IBQA 3AUJB 2LUOA 4G37A 4K03A 2C78A 3L49A 1BIFA 2VUIB 2FPLA 1QPZA 1Z29A 3QFCA 2WR8A 3MGCA 4ENQA 3D8TA 2IEGA 1SC9A 3UJ3X 2AMVA 4L50A 3V55A 4RM2A 1ZISA 3K6SB 4UHDA 1CZHA 1NHWA 1L5GB 3OM1A 5CLHA 1LJ8A 1ZRSA 2RONA 4D9KA 5CYPA 2FP4B 4BGEA 5AVXA 3EB9A 3JAKA 1KFJB 1D2HA 1XZKA 2IKSA 1AK2A 2IYPA 3JWIA 1AGXA 1C14A 1WQ4A 2I4RA 5LBTA 4CMKA 2JFOA 5JVDA 2QVCA 1JWBB 3UM9A 2IEDA 2FFBA 4LOKA 3TDKA 4ZO8A 1Z7BA 1V7PC 4A26A 1KH1A 3VRHA 1Z4LA 4N49A 1OAKA 5K3BA 2DQKA 4CV1A 3T5BA 1N3IA 1SQ6A 2D8MA 2NSHA 5BWCA 4KSCA 1V35A 3EZNA 4AMBA 3DBRA 1I1HA 4IQGA 1DDIA 4BKPA 1NLYA 2GK7A 3GRKA 3GL9A 4Y0VA 1V43A 3QUCA 3NDPA 3UMCA 1MRZA 4TKVA 3ETLA 1MFZA 5A71A 1HY3A 4O29A 7MDHA 2WKPA 8AT1A 1KARA 3BAFA 1R6DA 3TF5A 2DX7A 2H1SA 3ESAA 3QP9A 2CHQA 1KAMA 3SC6A 2VI5A 4JHLA 4BZPA 3KJIA 2B9EA 3BCSA 4H77A 1FVXA 4WW0A 1BXZA 5EZYA 1L4YA 3ITDA 1GV0A 5EZ5A 1E3SA 4MWBA 5LQSA 1SCIA 4KXQA 2QIPA 2QORA 4MP6A 3NJRA 1VL0A 3GWZA 3AUKA 3VV3A 1VFNA 4Y7DA 3FX2A 5A5DA 1ABBA 3RIHA 1WDKA 3I5UA 3VHRA 2VKQA 2OUIA 1J7JA 4Q9NA 3C1OA 4DADA 3IP7A 1PI3A 4XQEA 2RKWA 3L05A 1O5IA 1Y8AA 3INRA 1AC5A 3VR6H 2HRZA 3GGGA 4U00A 1KY5A 5E9WA 5HJ2A 2YV4A 1T3GA 3EQ2A 3H8VA 4HP8A 3NOQA 3P32A 2V9CA 3QTLA 2DB3A 1GPAA 2H2IA 2VPQA 1SAYA 1W4CA 2BUBA 3KOXA 3MWJA 1NDHA 1UWCA 3SXUB 5JNUA 1DAGA 1SBNE 5AM1A 4AXBA 4L8WB 4FC7A 4MUBA 3IUYA 5FQNA 3SICE 2VDRB 4ZC8A 2EV9A 3TTXA 2Y2UA 4QUIA 3U7QB 2ZWPA 2XDQA 3VZDA 3JZMA 3QEMB 4B3DA 3PXAA 1A5BB 2XA2A 1YTUA 1QUEA 3CF4A 4QGHA 2G1UA 2Z95A 3PGVA 1RI3A 3PQ4A 4GKAA 4OTZA 4TT3D 3ERCA 4EFLA 3MLEA 3C8MA 3P97A 4QLBA 5G53C 3M49A 4EKEA 1XEXB 4L7QA 4I1UA 3CBGA 3N0WA 5IANA 3PNBA 4RTKA 3DVAB 3H11B 2IYXA 3O0DA 1X70A 3QUTA 4URHA 3ZE7A 3A3OA 5CVUA 2UZ1B 5CFOA 1T2EA 5E9JA 4LPSA 5LB4A 5JZSA 4RTRA 5EPOA 3DOFA 2VHWA 1JXMA 4QPDA 5CH3A 3B60A 3ZD7A 4MWOA 1OFVA 2PA0A 3FMFA 3FSGA 3CZQA 2R8XA 4LCBA 3RVQA 3S44A 3ZDZB 1CB0A 4FMDB 5A9SB 4KHZA 1KTIA 3USZA 1M2WA 1UZNA 2GCNA 1M8JA 4Q9LA 4W5HA 1E7QA 3W90A 3N3AC 3QLVC 4YT2A 3ECSA 3KQWA 2F7SA 5BXYA 4INOA 5AJUA 1R4MA 1BE0A 4IDNA 4L7VA 2KLBA 1YR1A 4GI5A 1U7HA 3CLSD 3LLCA 4BASA 2E5LB 2IPLA 3PXBA 1R8YA 2JKYA 3JQ8A 3RS5A 5J4VA 3S8EA 4JOQA 2JLVA 4RKEA 3FTFA 5JAUA 5CM9C 2IE0A 3ZOKA 1S7CA 1XK7A 2OXIA 2UVQA 2FEPA 3F2IA 3NUQA 4U9UA 2XQIA 3UGJA 1U31A 2DYKA 3OD5A 3OO0A 3A1NA 3GZTB 2GASA 2QW1A 1Q2UA 1CSEE 1BYIA 2VYVA 3EOBI 1NVUQ 4K9OA 4MITA 2IQ5A 3WV4A 4CDNA 2O8FA 5CA1F 1K6XA 5CFZA 1M1YB 2OO5C 3JR3A 4GLOA 4AUKA 2P1DA 1QRTA 2WPNA 4KTTE 1UJNA 2WAOA 4W6QA 4YTEA 5AW0A 3NBFA 4X6LA 4EI9A 3SLKA 3I9V1 2P2CA 2Y9MB 3NAZA 4TXNA 4Y9SA 3D6FA 1UJ2A 1JQAA 1LSJA 1P1JA 3DFMA 4K8RB 4EARA 1RYYA 3I12A 4HQKA 1ENYA 3KJQA 3TQIA 5AUOB 5EIHA 3RUAA 2IOQA 1AV6A 4TS1A 4WXYB 4DT1A 4EKNB 2C1XA 2QW8A 2WTEA 4OYYA 3P8ZA 4KMMA 1CUDA 3GAMA 4QGGA 3RSOA 1SWWA 5GGXA 1KEZA 3KE8A 3SFTA 1XDWA 3G23A 1YIOA 4HWSA 1EZ1A 5F1KA 5JC1A 1ORHA 1G6KA 3L4KA 1CRPA 2CN1A 4JC5A 4OHCA 3HCPA 2ZIZA 3HMKA 1A9OA 3IE2A 4ES6A 1DCTA 1EUYA 4JEHA 5DNCA 3HPRA 4PWYA 2LKCA 3BRQA 2QE6A 4YV0A 2XVYA 2QLFA 1MGPA 4DBLC 2WPDA 3OLXA 5HW0A 3F5DA 3NHPA 5C8YF 2VS1A 5JMTA 5DF1A 1MJHA 3SC4A 3HXTA 3MWGA 3OA0A 4JDUA 2EZ8A 2QX7A 3WXBA 4EA7A 1K4KA 1HMYA 4HR7A 2ZI6A 1D03A 3IODA 1EMDA 2IXBA 4CHGA 3BMOA 5CD9A 2QAGA 3V2UA 4TXHA 1NY5A 1RXIA 3QKRB 3H9CA 3OLZA 4R8RA 1J0BA 3EN0A 3GBVA 1Q92A 3JD1A 2P9GA 2IY7A 1FTYA 2YJ4A 2FH5B 1N1EA 2PMEA 4TXLA 1EBBA 1YVUA 8ATCA 3JYHA 3VHLB 2MTBA 1XO1A 2YY6A 3ZK9A 3TEJA 4BO1A 1O87A 4INZA 2EQAA 4NULA 3EY4A 2N1BA 2QMEA 2UVPB 3FPEA 3LY9A 4Q03A 4KI7A 1GL3A 4UBJA 2MYUA 1Z2AA 1N5DA 3QBDA 2JFZA 1Z28A 2HSEA 4IMIB 1L5SA 2I8AA 3H99A 3VGPA 2FWRA 5HZMA 5TMPA 2OXCA 3Q7IA 4ACBA 3L82B 3SZMA 1ZJ6A 4X6XA 4ZVLA 2JVJA 3I3SR 4LAFA 1BCRB 1K5PA 3ZZ0A 4ZZ3A 4QELA 3NVAA 1Q7TA 2N75A 4K9DA