3EDQA

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edqA00
1RWMA 1SC1A 2HBQA 3KJNA 2J30A 4N5DA 4QU8A 4FDLA 4QUHA 1I4EB 5IAJA 4QTYA 3D6HA 4QTXA 3R7NA 3DEIA 3R5KA 4IYRA 4LSZA 5IAEA 1NMQA 1RWWA 1RHKA 3GJSA 3H11A 4QUDA 2J33A 3P4UA 3GJRA 2C2ZA 4N6NA 3H13A 2HBRA 3OD5A 3ITNA 2H65A 3PCXA 1RWOA 5LUBA 1GFWA 3KJFA 4EHKA 2XYGA 1QX3A 3EDRA 4NOKA 2H54A 3V3KA 4NBNA 2Y0BA 1RHRA 2XZDA 4D3YA 2H5IA 4QUEA 1GQFA 5K20A 4FGUA 5I9TA 2Y1LA 1SC4A 2HBYA 1NW9B 3GJQA 4JB8A 4JJ7A 4PS1A 3R7BA 5LUAA 4I1RA 2H48A 3KJQA 1RWKA 3RJMA 2NN3C 3DEHA 3V6MA 4DCJA 4QU9A 2FUNB 4I1PA 1K86A 4EHFA 5IAKA 4D3ZA 1RWVA 1QDUA 2FQQA 3QNWA 1RHUA 2CNKA 4M9RA 3UO8B 1RHJA 4N7MA 2AR9A 3K7EA 4IEFB 4DCPA 1RWXA 2CJXA 3V4LA 2CJYA 2H4WA 1PYOA 2QLJA 1BMQA 3PD1A 5JFTA 1I4OA 4QUGA 4QU0A 4AWBA 4QUBA 1F1JA 4FXOA 2QL7A 1I3OA 2CNLA 3IBCA 5IBRA 2CNOA 2XYPA 4QUJA 4EHHA 3GJTA 2J31A 4N7JA 4EHAA 4FEAA 4D3XA 3D6MA 3NKFA 4PRYA 1ICEA 2H51A 3BIJA 1KMCA 1JXQA 5IAGA 2C2KA 3H1PA 4NOJA 2FP3A 2H5JA 3H0EA 3S8EA 1NMEA 1SHLA 3P45A 4DCOA 2P2CA 2DKOA 3UOAB 5IASA 4QUIA 2WDPA 3E4CA 4NOMA 3NR2A 5IC4A 1QTNA 4ZVOA 3IBFA 4QU5A 5IANA 1RHQA 5IBPA 5I9BA 2J32A 4NBLA 1PAUA 2QL5A 5IABA 5LU9A 1M72A 4JR2A 4N6GA 2CDRA 4JR0A 4ZVPA 3SIPA 5IC6A 5LU8A 5IARA 3EDQA 3R6GA 1RHMA 4NOLA 4PRZA 2XYHA 3DEKA 4PS0A 3V4OA 1K88A 3D6FA 1RWPA 2C2MA 2XZTA 3R5JA 5H0IA 1NMSA 4AW9A 4EJFA 4QUAA 4ZVUA 5IBCA 3V6LA 2K7ZA 4N6OA 4ZVQA 4AWAA 3H11B 1CP3A 1SC3A 4NBKA 4JJ8A 4EHDA 4EHLA 3R7SA 3DEJA 4ZVTA 1CVRA 3PD0A 4HQRA 4JQYA 4ZVSA 4JQZA 2C1EA 4ZVRA 1I51A 1IBCA 4QULA 3V55A 4JJEA 1RE1A 1SHJA 2HBZA 4HVAA 4HQ0A 3S70A 3SIRA 1RWNA 2H4YA 2C2OA 2QLBA 3R6LA 3NS7A 4EHNA 4JR1A 2QL9A 1F9EA 2QLFA 2CNNA
chains in the Genus database with same CATH superfamily
1UXHA 3G5AA 2NZJA 3AP1A 2YMLA 2FPSA 1UKVY 2XMDA 3OZAA 1H2AS 4U7WA 3M70A 2J85A 2VSOA 4WY5A 2FSFA 3AHEA 3DOEA 1JHOA 1ORRA 3LXRA 4J4BA 1UQTA 2MSDB 1T1IA 1TECE 3ASVA 4EI2A 5KDOA 1Q12A 1C9KA 121PA 1KMMA 1SIWA 1PDOA 4DNPA 4O5OA 1RJFA 5FQOA 2Z2KA 1M1NA 3E9DA 1RBZA 4UARA 2CL6X 4BQRA 5BUQA 4HD8A 2Y0EA 3L8FA 3MMSA 4M1KA 4MTLA 4Q4HA 3S5UA 2DUNA 4OHPA 3VR2D 1E6MA 1W88A 421PA 1NWCA 3URMA 1AS2A 3E23A 3N39C 1I01A 3GJQA 3AWIA 4JP5A 4FT4A 1CFZA 2M9MA 3BSFA 2QRVA 5FTLA 1XYYA 4CVNA 4PY2A 2GNAA 1BOFA 3C3YA 4NPHA 3NYRA 4TLBA 2JL1A 1I4DD 1KBZA 2FI1A 4PXAA 3IBSA 3DZGA 3JQAB 2CHEA 3CO5A 4R01A 2VNAA 2DHRA 4PLYA 5LA6B 2AFHA 5KZMB 3GRRA 3E3OA 3GARA 1C4KA 1Y9DA 1N9GA 3OLXA 3RFVA 4V0KA 1VHDA 2D8AA 1YZLA 3B3GA 1OXKB 4YPOA 1VPLA 1HGXA 5DVZA 3T7JA 2YVUA 4GRAA 2WJ6A 4ILEA 4D4HA 2BSXA 4ZI7B 3AZOA 1JLSA 2COUA 4YAOA 3AOEA 5C5CA 3I6QA 4EO9A 5IUNC 3NAMA 4DNXA 3WG9A 4QHYA 3QKRA 1MG5A 1TJ5A 3NP7A 3FF4A 4ILKA 5EN4A 2M6KA 3RKSA 4B17A 4DV6B 1YHNA 1XCJA 1QRUA 5IAGA 5I7VA 1RTTA 3QVUA 1TRHA 3JQAD 7YASA 1NTOA 3JYLA 1VRVA 4FNGA 2YJ6A 4PO9A 4YNBA 1OWMA 3ONNA 5DHAA 1G8JA 1SHLA 3NHYA 4PQFA 2YJGA 1KY4A 1KYYA 2A67A 3F4BA 3UBMA 4IUBS 1SQGA 1XEWY 3IDZA 2AMFA 4OQDA 2YFQA 3VU3A 2WDPA 4EQ6A 3NDIA 4MQ4A 1HKUA 1DRUA 3WQSB 4BX0A 1KYVA 1XWFA 2HU8A 3IP6A 3T06B 1FTQA 4R9NA 3SF8B 1H6CA 3D3EA 5AW4A 5BT8A 1E8MA 5HBRA 1B2LA 4ZDWA 3NBFA 3HCRA 1WJGA 4S3MA 9LDTA 3TIGA 3BB4A 5IH7A 1X9IA 3C8ZA 2JGIA 2OCLA 2R8RA 2WJVA 5KYKA 4DNQA 4YJ3B 4KGZA 4BBAA 1VLMA 2BGRA 2PRJA 4YCNA 1Z4PX 3RU3A 1U4NA 4GQAA 3L1KA 3QY9A 2X9VA 3GNQA 3ME5A 2P9YA 4AN0A 2F7SA 4YV2A 1VECA 1LQ2A 4KN9S 2O7NA 4Q3EA 5ESXA 5BV0A 1M2OA 3NHAA 4J6EA 4Y0AA 1AF7A 5CLIA 4EKIA 2JBAB 3G02A 4KIUA 4LPSA 4S1NA 4H3SA 2ZE5A 4FFBB 1G18A 1MO2A 5T67A 3CRVA 1USIA 1CRZA 1KE2A 4KR6A 2VJCA 5FWYA 5I3CA 3HDVA 5B1SA 4LYYA 1A3CA 4JYPA 2OQIA 3CTMA 4H7HA 3LLMA 4GOND 3RI3A 1KJZA 4KQHA 3RS2A 3FTDA 4KQJA 4G65A 3O4HA 2QLFA 4WOCA 1UWCA 3SVZA 4LOKA 2XWPA 3KUKA 4LHYA 2DTDA 3KQKA 2C07A 4ARCA 3HV2A 3VU8A 3HI4A 2B5VA 4YB8A 2OHGA 1X1DA 3LXMA 2B9EA 3TPZA 4C4AA 1Z3IX 4I50A 1RHKA 4U9UA 2YOHA 1LVHA 2JAXA 5DXFA 1LBEA 2CB9A 4AX4A 3HFSA 5IDXA 5LBUA 1FZQA 4TKZA 4ZQFA 3OZVA 3MUEA 3M2PA 1RZ3A 3K5WA 3PPXA 2Z2IA 3CMMA 1X7GA 4L9RA 3EFEA 4S0ZA 2BHNA 2GJAA 5T8KC 2DQSA 5LZ5A 4D41A 1NGSA 2WK1A 2ZJ0A 4KMSA 4K2AA 4R71A 5K4AA 1KS9A 1RWKA 4K8RB 4DLNA 1JSCA 1CZRA 2FU5C 2QT1A 2FWNA 2R7LA 3IUEA 1KI9A 4YO7A 4BLSA 2E4UA 3II6X 4WNAB 1F9AA 1E2BA 5FV7A 1KH2A 4HQNA 3UO8B 1HI9A 1FIUA 1T8RA 4ZTBA 5TMBA 4BTEA 2JCGA 5KNBD 1HO3A 3C2QA 5TDHA 3L6OO 3FF1A 3AYXB 5KTRA 3OQBA 1W1WA 1AE1A 3TB6A 3EVDA 1MH1A 3THXB 3PD1A 5JWRA 2CV2A 4B85A 1P6XA 1SXGA 4FONA 2FSPA 4FOTA 4Q3AA 4TZ0A 3R3HA 4EPYA 4YRFA 3UIEA 2PNJA 3F74A 1PZNA 4M6WA 2CNWD 4ARAA 4OMFG 1PV4A 2PX0A 5DEIA 3KAJA 4ALIA 2AUTA 4XB6B 3DMTC 1WEHA 4RZHA 4QFCA 2H2WA 2ZTLA 3WGTA 1E3WB 1EXDA 1YC2A 2B94A 5TF0A 1S2MA 1U2PA 3AL2A 4BFUA 4YV7A 5BYKA 3VNBA 5LLDA 2XD4A 3H6GA 2Q50A 3GLGA 1NXSA 3V32A 3KQQA 3PS9A 4C6SA 1MKYA 3ENKA 2ZR8A 1Z4LA 3CZ5A 5FTKA 4BVFA 4ER7A 2NTJA 4AURA 1WXWA 2XR1A 1IBKB 1BX1A 4NYJR 1QVRA 4DR5B 4B0PA 5BVHB 5JCXA 3GLIB 3CY6A 4R0VA 1ODKA 1P5HA 4IV5A 4FFDA 5DYTA 2UUPA 5IG2A 3DMTA 4A6PA 1R0YA 2AYZA 2VJLA 3DE0X 1NUPA 2B3TA 1Y1RA 2P9CA 3F46A 3NONA 4LYFA 5T4FA 3D7LA 1TMGE 4OJTA 5TPZD 3U9LA 3V4OA 3HB1A 4ND1A 1N3YA 4DDTA 4IGKA 4HWSA 2TMYA 3UG7A 4AJ4A 2HK7A 3MWLA 4YQZA 3LIIA 3F5SA 2F1JA 2VDNB 3G9ZA 2ZR9A 2VBCA 1FMFA 3LQFA 1H65A 2R4UA 4UNSA 3RIEA 4OQXA 1M54A 4Y18A 5J2UF 1HYGA 1NG1A 2HIAA 2VUHB 5GQSA 1EFTA 2JRCA 4K3UA 4L02A 4C0KA 1F12A 5GPBA 5BRNA 3I09A 1X8LA 2GRJA 3VKVA 1L4MA 4N76A 1Z4JA 1AD2A 4ZQEA 4UCWA 1VYHA 4N3NA 4X7MA 1COWA 2ECFA 3IT0A 1GOTA 1YBAA 1MP0A 1EK1A 2V5UA 3C5CA 2DCUA 2YNMC 3O3CA 4TL6A 3MQFA 1LU9A 2BDEA 1P7YA 3KK0A 5K01A 2VJKA 4V1CA 1YNOA 3U4HA 4RJIA 4J0KA 1DKQA 1N1EA 1T0UA 5D3MA 5AVXA 4BFCA 1PDWA 4GVPA 5ELXA 2ZSKA 3Q8XB 4ASUA 4BN5A 1XXHA 1KK2A 4KYUA 2ZTUA 3VJMA 5CG1A 1NRIA 3L4SO 4O2AB 1LSUA 2IW1A 3LKVA 1XZDA 3D4LA 3K4PA 2A0UA 1S7GA 5JAIA 3TOXA 1N33B 4AKSA 3RWBA 3WL3A 2YY6A 3IR7A 4M99A 4RD4A 5FXMA 5DTQA 1QX3A 5JROA 4GWLA 2UYOA 4JI5B 1H4TA 3TUZC 4LDPA 3QFSA 4R8SA 4IW3B 3IERA 1Z0JA 1N9KA 2V7WA 1WXIA 2ZSAA 3C4JA 5DTMA 3U4DA 2NU7B 2BBTA 4HDRB 4DCGA 3CT4A 2RG7A 2HMUA 3GVPA 5DN9A 5EJ2A 2UYYA 4BYGA 4X41A 3U19A 3KB2A 2P4HX 1SVMA 3OOJA 3R3ZA 2I78A 3UMYA 2C58A 4GR5A 1Y63A 5D85A 5K8CA 2YJ3A 1ZESA 1G8GA 1VB3A 4MVXA 4TXJA 2GAOA 4OQZA 3NIGB 1PQPA 4O63O 1RHJA 1YCHA 3G3EA 1XQXA 3RVDA 1DAFA 4TYQA 3UJ3X 4IEEA 4OQ4A 4V39A 4LNUB 4EABA 1ECPA 2R4TA 4I1VA 2I1QA 2QYHA 2O14A 2Q3JA 2HC9A 1Q2XA 3DAOA 4L5CA 3GG9A 3OE7D 4YRDA 4AMGA 4EA7A 2FCRA 3P97A 3QXXA 1FLNA 3H1BA 2O8DB 1E1KA 2ZQYA 3GEPA 4KJXA 4RM2A 3RFCA 4RY9A 3VX4A 2B4AA 2ARKA 2I22A 2WOJA 1V25A 2Y6UA 3FCYA 3ZJUA 2C31A 3U1TA 5C7IO 1KYZA 3SSOA 5IZ4A 3ZBUA 4J0DA 4NJEB 3ELWA 1GLNA 1CHNA 1G291 3WO1A 3GQBA 4QBHA 3RSOA 3ZXSA 3PHJA 2HHHB 2ZI6A 1M6WA 2C95A 4FHEA 3IJPA 5E6RA 2N1MA 1JHMA 2OA0A 1E2MA 1PL8A 3LOQA 3N59A 4IZOA 2J3KA 1PV2A 4B4OA 4BNDA 5JAHA 4ZVOA 4PONA 4YYZA 1CJVC 3Q6IA 1JJAA 1HOXA 3A28A 2B7BA 3F1LA 4OI2A 1NI4A 4AZWA 5IJ0B 3PXAA 3FTEA 2GOYA 1OW3B 3PQ5A 2WT4A 4JB2A 2D74A 4NEHB 1JBEA 4JL6A 3Q6MA 3HCAA 4MAAA 4NVRA 5LQCA 3B6IA 2Y99A 1CNFA 4JI0B 1QV9A 2CWDA 1H4VB 1NMXA 1INLA 2RKOA 1V71A 3C3AA 4CQNA 4NBKA 4HQKA 4FN5A 3C15C 5CT5A 4BTLA 2QY9A 4IH1A 4L5AA 2FGKA 5C2JB 2CFIA 3GRYA 1OCEA 1ZIXA 3A6LA 4FI3C 4W5NA 4C6RA 1N5IA 2AFRA 5KX5A 3LGSA 5K51A 4GZMA 1HY3A 3PNOA 3RUPA 1DLIA 4BMSA 5JV5A 2DCMA 2QNRA 1AHNA 1DJLA 1X1EA 2UYQA 5BQOA 1M6VB 1ZZGA 3SICE 5AVVA 3T7EA 2WJWA 4D46A 4GRIA 5LJIA 3AKDA 5JARA 4QTYA 1S3SA 1M75A 2G6BA 2ZYTX 3F3YA 3GPDG 3V9AA 3WNZA 4B4VA 4B79A 2I4NA 2Z95A 5DM70 1GFZA 1MC4A 3ASZA 2AEEA 3C6YA 4BLVA 2O5EA 2OCPA 4DIFA 1QO0A 1NBAA 4XWKA 4DCUA 4RTKA 3OFSA 1LDEA 4LPKA 2I4IA 3ONWA 3ESDA 3PGVA 5K0GA 2JFFA 2NACA 3I0NA 2GD0A 1JA0A 4DIKA 2J6IA 1CR2A 3R5SA 2X5NA 4L07A 1O7JA 5EXDA 3WK5A 4D3SA 3GCZA 3RU2A 2Q9AA 5B3KA 1VTKA 4PNEA 1G5RA 5K45A 3O31A 4CR6A 2VTDA 4D6YA 4DNFA 3C6BA 1QPZA 1N7JA 2C7GA 2K2QB 3IR6A 4B8WA 5IXYA 2ETXA 2OV6A 3O5AA 5GAJA 2ZUVA 1C9DB 4HRXA 1VKJA 4IJKA 1JVNA 4PZYA 2QP4A 2WF8A 1M1UA 1NLMA 1A72A 1YQGA 2XXBA 2ECQA 3Q9NA 4H16A 2PJDA 4KMOA 3COVA 3K2IA 4J2HA 5SYAA 1SUCA 3FUXA 4HGRA 4B6QA 3PDJA 4EA6A 4CKWB 2WG2A 2H1CA 4EUHA 5B1DA 3A1DA 3F67A 3R5TA 4G63A 3A2LA 1PTJA 4BZPA 4I3FA 3WFJA 3VO9A 2GM5A 3JD0A 3IX7A 4ML3A 2F6RA 4OXXA 1O5IA 2HWXA 3ZY4A 4HVCA 3MAGA 4G0XA 3UH0A 3BH6A 1IUNA 1YR8A 2JLQA 3ADDA 1XQ6A 2FSVC 1ZHHA 3CRRA 2YVAA 2HLDD 4Z8XA 4E5UA 2X3UA 3GOHA 3HR4A 5J1SB 3TQSA 2EG5A 3PNPA 2ZREA 2W6ID 2G63A 5A0FA 1MIOA 1Z6XA 1UOEA 2P90A 4LA4A 3OCYA 3FKSD 4OKNA 2W2LD 3KCNA 1X70A 4JLAA 4BP9A 1U63A 4AF7A 1GKIA 1ZWKA 2FN9A 4UC0A 1V41E 2V7TA 2X9GA 1VPTA 1GRNA 2ACWA 4WK2B 1JB1A 3T5TA 3W06A 4BMOB 4X9XA 3A3OA 3L5OA 3S2IA 3WBFA 2AXNA 2EZ9A 1Z6YA 4NCAA 3O75A 2DECA 3PLNA 2EW2A 3UGKA 3WYAA 4KUHA 5HJ2A 2RARA 3NIBA 5IKXA 4G6ZA 3H7IA 3X1KA 3QWBA 3SZRA 4EJSA 4E11A 4YJ2A 2BGGA 4PYQA 1C30B 3DE5X 3H04A 3OX1A 4P4TA 3OTQA 5F1PA 1FTNA 1YH3A 1YJXA 3GDGA 5TPWB 2VSNA 1M2HA 2R7NA 3A14A 1EM8B 3KQMA 2PYDA 2GNOA 2IEDA 5EE9A 4RD0A 1BOOA 3EVTA 1LS1A 3QVLA 4OHUA 4GM0A 4WLUA 3T54A 2PU5A 5HTOA 5A3QA 3Q72A 4DLBA 3G7NA 2FOLA 2WUEA 1HPLA 2Q0XA 2W37A 3PA8A 4EB3A 2PKEA 4RTPA 5I9MA 4OHKA 4DQVA 3JQ8B 2IGBA 3PUKA 2CLSA 2PA3A 4OK5A 4IIJF 1HLDA 3DEFA 3U4IA 4UHKA 2FSUA 4CL0A 3NAQA 3OJXA 5K0NA 1Z06A 1I24A 2DX7A 1NP3A 2VTVA 3GLVA 4M8LA 3N8NA 4N03A 1D4FA 1PZHA 3S8MA 1TFRA 2YUTA 1N5DA 1GO2A 2C03A 3AR6A 1Y33E 4GQBA 4FMPA 4ICIA 1SGWA 3MJDA 1GAJA 3GJYA 2R6AA 3DL0A 5I5EA 2A33A 4P08A 2R4QA 1J97A 2XWSA 1AO3A 4MI3A 2WWFA 2FMTA 3AMVA 3KOWA 1ML3A 2WNHA 2PAAA 1NBOA 2CBXA 3AUXA 3C8MA 2HO5A 3KZVA 2IXEA 4IAOA 2JFYA 1IY0A 2FGJA 1X8XA 2R5NA 1BCRA 4P83A 3DM9B 5HSGA 3VYVA 2YW2A 4BNXA 1X92A 1EAYA 1EFPA 3KT8A 1G5PA 5AVTA 4IR7A 1M3SA 2I2FA 4I1PA 2WAOA 1BEZA 3QLJA 1XZGA 2VDQB 5DKFA 1HE4A 3MFQA 4W8OA 1SU7A 2C96A 5K6AA 2CZCA 5EZYB 4N3AA 4NECA 5KJ6A 1T5BA 5AYVA 4D9JA 2WJ3A 4YDRA 3M81A 4PCLA 3FNHA 4DHWA 3SXJA 2Z1MA 4L3WA 5J47A 6PFKA 2YZGA 3N2GA 3HP1A 5KKCA 2WPNA 3CR3C 1K1EA 2PWAA 3A4VA 2QSZA 2OZKA 4HX5A 5CT4A 1I2CA 2BEUB 2QP9X 2IP2A 1CERA 4I8IA 3SQMA 1X13A 3AB8A 4ATNA 3GF4A 1UXIA 2P1RA 4G4JA 4MPJA 1ESCA 2FWJA 1Z37A 4FCTA 3UHJA 2NU9A 3HI6A 3ZLVA 3CC8A 3LPLA 4FR0A 3LBNA 4HWTA 1JR4A 3NDJA 4PLZA 4B8ZA 4I7EA 4IOLA 4RACA 2BGTA 4NV3A 3GJ8A 10MHA 2QBYA 1OKKA 3PGJA 2W48A 4DC0A 3ICPA 3VISA 4MVCA 4PC2A 2H7XA 2IHZA 5DZSA 2OFFA 4IX9A 1L4HA 2YWRA 4HNTA 3K9FC 2XUPA 3HWRA 4KWHA 1T3ZA 3RAPR 1P77A 2QAGB 2PNFA 3HVIA 1NVUQ 1ZD8A 1V5IA 5ALUA 4UASA 3SBOA 2Y9PB 5ES3A 2J1LA 3HA3A 3N7UA 3WGGA 2J9GA 1U9YA 2I4RA 3I5MA 3K8OE 4QAJA 4Q15A 2M6LA 4ZEVA 5K6TA 5JMTA 3REFA 3WA7A 1YBHA 2X6TA 5DMXA 4M1OA 5B1EA 3L0CA 3R0JA 5J5AA 5FDFA 1FP2A 4RMJA 1DC8A 3WK8A 5JD3A 1T9CA 1T9HA 4AQ7A 3IAFA 4I1OA 3DFKA 1M1NB 4JIMA 5TRTA 1OYWA 4E7PA 3RSLA 4Q4HB 2AEMA 1UWKA 4L7VA 3GJ0A 5JT1A 3MEQA 1B23P 2DSTA 3ABIA 1S6YA 1E66A 1ZW6A 5K0TA 3EF1A 2IYTA 1W88B 3HL0A 1R0CA 2EP5A 4XFJA 4YMTA 2IXAA 4ZCRA 1HMYA 3ROQA 5CX1A 1Q5PA 2ZM6B 4LI0A 1VIVA 2QRVB 4M8IA 3O1LA 2GHQA 4O2RA 2HXYA 3MS4A 2XWQA 4BC1A 3L0PA 3FTQA 3Q3CA 1G8KA 1A8UA 1TF5A 4NCIA 4G0VA 1L4NA 1GJRA 1ZW1A 1QQ5A 2AL7A 2QGNA 5HM6A 2E4YA 1FOEB 1JNXX 1YC5A 2AFHB 5IT4A 4TV9F 3GPIA 2O2DA 5DW0A 1CUJA 4RA6A 1N9GB 3AB7A 1DKPA 1WPGA 1RLJA 1XQWA 1RVDA 2WW8A 5CTAA 3OCJA 3JWPA 5FUVA 2FLVA 1E92A 3NMUF 3U37A 2CL5A 3GRUA 5TIIA 4QQFA 2GB4A 3EG5A 1KDVA 3QKRB 4CLDA 2PEYA 3Q7RA 4DABA 2C8JA 1U6IA 2QGFA 2YXPX 2ZYWX 3PL5A 3EGDA 4OBXA 1NF3A 4PZAA 5GJWC 1ZD1A 2HQSA 3ZPXA 2LPMA 3K1JA 3I32A 3OIYA 1MV8A 2FF5A 4PIPA 2R8EA 7AT1A 4JYZA 4A0FA 3VV2A 1ZRSA 5FOSA 3DAYA 2C1XA 2GJ4A 4M76B 5TQ2A 1U2ZA 3AJRA 5CVJA 3ZW8A 4F2DA 1MOQA 4TKVA 4TS3A 3FMGA 4EQ6B 1N3IA 2X2PA 1GILA 2YDXA 5AK6A 2JGNA 2B2CA 2VSYA 3AU9A 2ENUA 4G23A 1ZN2A 3JQ7A 3HRKA 1WE2A 3LO5A 4LK3A 4QIHA 3WL5A 4CMHA 1IN6A 4F4FA 2AJDA 3FHOA 4CFYA 3PFNA 1AKWA 3BMNA 5LDHA 1M5RA 3K9GA 4OQEA 3SSAA 4MV5A 3IMCA 1SUEA 4Z7OB 4Y6LA 2BJWA 3VZBA 2OFOA 4QEDA 1ANKA 1KZ6A 3L6BA 4GEKA 2IEAA 2G76A 3FVTA 4NICA 1AHPA 1I2MA 4BNFA 1SZCA 4JYCA 5JJLA 5DGCA 5EJ7A 1MB3A 1ESZA 2C57A 1DIGA 4CQLA 5B30A 2AX3A 3MBIA 4IHJA 1B8PA 3DEZA 4G25A 1E0DA 2O3JA 2W83A 3TFQA 3WNQA 3CZCA 3T3EA 4UMFA 1M2OB 1E7YA 2WHYA 4M36A 4II2A 1ADGA 2YOFA 5FRDA 3BCUA 3DPSA 3G6WA 4F1JA 3ZJTA 5FWYB 2K2WA 3V8MA 3C4QA 1M33A 1L5OA 1MQ9A 3A7DA 3N8IA 1K3UB 1WVGA 4ZODA 1UOOA 1I0LA 3EA0A 2VYQA 2MWMA 3CUEF 5LDDC 3VH3A 5KMGA 4P2GA 4KHZA 4QJIA 5HYVA 1HRDA 1V8BA 2HA3A 3PHCA 4TN1A 1VE1A 4AIRA 5JNSA 3E22A 1ZNQO 1QNFA 5JPCA 4LFAB 1TZBA 4LAFA 5IW8A 1DVRA 1BN6A 5EXPA 5JWOA 4V0NA 3N70A 4I50B 1GZVA 1KJ8A 3BORA 1BH2A 1YTUA 1A76A 1QG2A 3LFTA 1ZXBA 4ND8A 2CJWA 2YHBA 2DH6A 3GT4A 3PXEA 4LZLA 3BIXA 2W2MA 1FYDA 3A26A 3DOCA 1EB8A 1L0BA 3GMDA 1TZ2A 1J49A 4CHGA 2J0QA 3KQVA 1RC8A 2PS3A 3V34A 2HOQA 3PDUA 4F2WA 3QEAZ 2GT1A 5C7OO 2O52A 2ZDGA 4HAZA 2P9ZA 2P6UA 5CVVA 1LBHA 1FQOA 4P98A 4RHYA 4YUAA 3VDQA 4M0UA 4CDNA 1T25A 1S2DA 4INAA 4BNLA 2WF7A 2XKBA 1YRAA 1QLWA 2PVCA 5E4YA 5IM5A 1QTRA 2Q5IA 3GJSA 4X3PA 5LQRA 4IG9A 4ARIA 2E48A 3GRPA 3EVNA 3KT0A 5KQRA 4FLEA 4C7MA 3GCWA 1T9DA 4G24A 4LDJA 1PI3A 2BFCA 4I8DA 2YN0A 5CUQA 4KPGA 2YJTD 4WH0A 5ESWA 1DWOA 1P17A 2JF0A 1X1BA 4XIIA 1DKMA 3BF8A 2G4CA 2RGXA 1XZBA 2XZDA 4M6WB 4MVJA 2WT9A 1KEWA 3CF2A 2PL9A 1BE8A 1VPEA 4B2IA 4ZJZA 2L0XA 3DTNA 1IONA 1F3OA 3OWHA 3RK0A 3TW8A 3UXMA 3UWSA 5A6VA 1GTRA 2Q28A 1V45E 2YASA 1X74A 2AXPA 5K05A 1Q1EA 1GZ3A 3JRXA 4P86A 2YHIA 3VPSA 3W4JA 3GLGB 3CT6A 3FPFA 1SQ0A 1R0LA 2VDOB 2RC6A 3IXQA 4RLQA 3VUEA 1Q20A 3ZKWA 3MIIA 4L4SA 1I3NA 2W71A 4YRRA 3SXUA 5AR1A 2QX4A 1T91A 3PWSA 2OBBA 3QWAA 4GI5A 4BEJA 3VR5A 4NL4H 4UVDA 5DNDA 3DMFA 1PNVA 4INOA 4JQSA 2N1BA 1TM3E 4NYIQ 4R68A 3LT5A 5C34B 1ORDA 3TBFA 4C87A 4EQZA 3WLMA 1Q95A 2JARA 4Y1GA 1P81A 3NO4A 2CJPA 1SB9A 5DCLA 3WGYA 3DMYA 1AJEA 4LRWA 1F60A 2YIVX 3HB0A 2JIMA 1VL8A 3OKFA 4R9VA 5E2IA 1M8KA 2HJRA 1MZVA 5AOBA 1FNBA 2I03A 2RGYA 5GGYA 3S8EA 4AC9A 3AJAA 2W6MA 2IEBA 3ZUPA 1RYNA 1VGRA 2DKOA 4JLJA 1NW4A 4BL5A 4C0BA 1ULAA 5LXTF 1LPAB 4WKOA 2QJOA 2P9TA 4XVHA 4LMAA 4EOGA 4OYYA 3OOEA 1SD2A 2VJNA 1A8PA 1W0CA 2DPGA 1JTFA 5FYDA 3RC7A 2RHMA 4RM3A 1D9XA 4NE2A 4D3DA 3P0RA 1SELA 2ZQ5A 2W6CX 1B0ZA 1GPNA 1NVAA 2K5UA 3CU5A 4HPXB 4P4LA 5JO9A 1D0VA 3S99A 1KEPA 3BCHA 1DO8A 2X0EA 2P3LA 5AWFC 1U7OA 2D2XA 4PS0A 3UJPA 1VLHA 1J09A 1SBYA 2AVDA 2VHUA 1GNPA 5GIPE 2BH9A 4UM8B 4V1CB 3TQCA 4OH1A 2E9SA 3RRJA 2R2GA 3C6KA 3LY7A 2H07A 5D3MB 4ENUA 1XVAA 5KYUA 3BRCA 3GFRA 5AUOB 1DG1G 1EVQA 5JSUA 3E8XA 3MCVA 1XXHB 2NZ8A 5E0KB 4DHEA 5KNDA 3V4RA 3B7GA 1VXOA 2V9CA 3NBZC 1J00A 2WG1A 1MB4A 2IPNA 3HCPA 4Y2SA 3RWMB 1J1ZA 3O8NA 4B84A 1G7TA 2GYVA 1Q77A 2XH8A 4B75A 2J3QA 3L1HA 4UEJA 2JFBA 2I34A 2JEYA 1FXSA 1COWD 2EOAA 3ORYA 3R40A 4IJ5A 4E09A 3RFXA 1PGQA 4EY7A 3B13B 3IESA 3OZUA 4RSGA 1OFVA 2JIZA 3PA6A 3SIRA 2E49A 3D6TB 3CHYA 1X39A 5K8LA 1E0KA 1YZFA 1RP1A 1GGEA 4FGUA 4DSZA 2C77A 1T2UA 2AQHA 2P79A 4EI7A 3H97A 3P8ZA 4L4YA 5DHTA 4ASUD 3PITA 2G25A 3RIHA 3KV3O 5F52A 5IJ9A 3V7NA 4CQJA 2SKEA 3B6ZA 1NMQA 2AFHE 2IYVA 3AETA 3LAWA 4F97A 3A6PC 3E81A 3GA5A 3CKLA 3QLVC 5IJZA 1OXTA 3HBMA 4CKEA 1DBQA 3FZQA 4QGGA 1V9SA 3NWJA 4RMHA 4IIXA 1KSFX 2X42A 5F77A 4BO4A 4J1SA 3FJOA 3INGA 1TVMA 3OHPA 1OGIA 1ZMOA 1KIMA 2MDTA 3U4CA 3RRBA 1J2UA 2GEBA 4TMKA 5CFLA 2LWIA 3VPFA 1UIRA 4EW6A 3BB3A 4OU5A 4DCSA 4MAMA 2IT1A 2ZJ5A 3WZ2A 1G4UR 3WMRA 2G70A 1FVOA 4RJTA 3ACDA 4EFKA 5F7JA 3JSXA 4TTJA 821PA 3ZHOA 4BLOA 5C18A 3EIWA 2A30A 2DYKA 3GQBB 3DWEX 2VT2A 1K5DA 1I0ZA 3IR5A 3QLVA 1KI2A 2B4QA 2EJVA 3KDPA 2F8MA 3QBDA 4FKMA 3ETHA 4WI1A 5E6RB 5BO5A 2R96A 1CR4A 4BNDB 1J20A 2AR9A 2I7VA 2X5KO 2IQ5A 3ABOB 4KMRA 3VA7A 4LK2A 1L5RA 5JD5A 1RD4A 1NE7A 1NI4B 1OD6A 1R0BA 1ULUA 2NVWA 1IIRA 3G1TA 2D54A 4H7PA 2FW7A 4RL6A 3N0RA 3AHJA 4QU0A 4RA9A 2ONJA 2CCJA 3MRSA 4IRUB 1Z12A 2BHTA 3BIFA 3TLJA 4JP3A 4BNNA 2CC2A 3R9XA 3SHVA 4MIKA 4MKIA 4GI3A 4IKOA 3N5CA 2E6KA 2XNCA 4EHAA 1XCBA 2Q5EA 1I4LD 4MKGA 3B3JA 3W78A 4F8JA 4CM4A 3WYCA 3S8YA 1Z0UA 3SFVA 1EWRA 1UK6A 1QOQB 1S3FA 2R8BA 4UQLA 5JATA 3ER9A 2A57A 4NXNB 4CR7A 1E1LA 2JGEA 1E61A 1MAWA 3QEMA 4I1SA 3JAWA 4EG1A 5CXQA 1GL6A 1JIKA 1GA4A 1U7UA 2ZRIA 2I80A 3K94A 3HN7A 2PUGA 4ZEMA 3WDKA 4EEKA 3VRHA 3EIXA 1WXDA 2P9FA 1CDDA 3PZRA 1WUTA 2C8VA 2WLTA 4CV1A 5KX5B 1A9XA 1W7AA 3DKPA 4P38A 5B3JA 1F0YA 5LBTA 4C0SA 2FEPA 3AR7A 4NOLA 4AO8A 3BMXA 1XC7A 1AURA 3IVAA 2O57A 3MGGA 1Z2DA 1NW3A 2A4MA 4PTZA 5H0IA 5EQFA 2B8WA 4CJXA 3HXMA 3R3SA 3ETDA 4Y2PA 4DKXA 4B35A 3BK2A 4JASB 3MWDA 4KAFA 3QYAA 1DKNA 4MWOA 3ZE2B 4H0FA 1U3GA 1VCOA 3CZMA 2Q2NA 3B2EA 3TQFA 4DC9A 1UEXC 5CEFA 3QOWA 1K75A 1V6CA 1J24A 2X58A 2Q8PA 2ZSIA 4TUYA 3UWPA 1XZPA 4LECA 3ZVRA 2A84A 3KKOA 2QI9F 2RI6A 1PG0A 3VHRA 2Q6TA 3N07A 3V7WA 3OT1A 2JHFA 1TK2A 4P54A 1HNWB 1CWUA 4QYSA 5CA1F 1DXYA 4H77A 5EE0A 1YVEI 3C45A 1NQAO 5KB3A 4AYTA 5B6PA 3FTCA 5NULA 4BTVA 4DLRA 5LFAA 5CR9A 1NAHA 1L7EA 2D1TA 2N47A 2GHTA 1A7UA 3T1OA 3PENA 4BEBA 1KXZA 1XZHA 3K0KA 3MRVA 2HBQA 1HQDA 3B9PA 5HZKA 1NI3A 4RWEA 2HHJA 4HY3A 3P27A 4TMZA 5EJMA 1AZTA 5CU7A 3KFVA 3V8VA 1XEFA 1JHUA 2G40A 2WJYA 2Z58A 5FPTA 1QO0D 1U7XA 3RS4A 3TZLA 2A2ZA 2X0KA 4ZYTA 3KB1A 1FQKA 2C8KA 4IXDA 4XCXA 1PSWA 3C6MA 3KO8A 3RKUA 2P4UA 4KR7A 3T35A 1E5DA 4X1OA 2WA2A 4D8WA 1QTIA 3OKPA 1C7IA 4MMXB 5G53C 5B7PA 1X8KA 4M0EA 2IE8A 3HBLA 1PZGA 4GX5A 3LSYA 4WIAA 1VZ3A 3W9YA 4KSYA 4A0HA 1T9AA 3LOPA 4I1RA 3MXTA 4ND2A 3TTXA 1HEYA 5DCYA 5CFQA 1GTSA 3OZRA 3ZTYA 1RKUA 1XZQA 3K2QA 3HABA 3FB4A 4X7PA 3H42B 3GLGE 5HZHA 2R87A 3KUXA 3QVWA 2NV0A 4KBFA 1ODIA 5G40A 1N2GA 3PVZA 3TMAA 5BSHA 1MIOB 5D7NA 2E4ZA 1WZEA 4AY2A 4LE1A 3I6BA 1ZH4A 3C5EA 5JH7A 3ADKA 2FDCA 4JUBA 4CUZA 4G2TA 1BGVA 2BV3A 2GUGA 5F78A 1VCHA 1IU9A 4JELA 3H17A 5CRIA 1V0JA 3HMQA 1OBOA 2HIMA 5AI9A 1HZZC 1J21A 4IDEA 4PYKA 2I7XA 3Q5GA 3K53A 3CLRC 4IFIA 5EXEA 1Z88A 1X42A 5EIWA 3VYRB 5FT9A 2H5LA 3G8BA 2V5VA 2Q1TA 4NBUA 1Y7IA 1O95C 4YJ2B 4EJSB 3HWSA 4ZVVA 2XMQA 3QE0A 2IHUA 3T5PA 3M3PA 4C14A 3VKHA 3QSGA 2QF7A 1MXFA 1GL3A 1M2NA 3JCZA 4WK4B 3UWKA 4A0GA 2G7MC 1UBOS 2XSZA 1ZK4A 3EY9A 4Y67A 1VGQA 4BV2A 2ZTSA 1OJLA 3DHEA 5BW6B 1BDHA 3H5WA 1HZZA 3NV7A 2NP6A 1UZMA 4QEZA 4XE5A 4HQOA 3WXMA 1A1SA 1JVSA 3TR6A 3DKRA 2PSFA 1LA2A 2ZANA 5JD4A 3PC4A 3PEEA 4ZJYA 1Q2UA 4D9BA 5TQ0A 3FI0A 1O95A 3KPWA 5JD6A 2ODQA 1Z82A 1BHQ1 2IEZA 1H23A 2Y1GA 3P2JA 3BXPA 3CLVA 4BEVA 3TCXB 1ZR2A 4ZVUA 3K1AA 4FLMA 3WYNA 5KKNB 3KYDA 4NONA 2JATA 3E2IA 2XTAA 4BWYA 4R69A 2V3CC 3NGLA 5DX0A 1W9HA 3MUFA 5JXWA 4EYSA 1GG2A 2OK7A 1PK9A 2OSBA 4F9GA 4MROA 1IMJA 1P19A 5KSYA 1IYZA 1U7ZA 3LU1A 3WBBA 1BU8A 4DWWA 3UH1A 3ZXYA 4YUVA 3NJ8A 5AKKA 2JLYA 3VR6A 5SZHB 4Y6RA 4D82A 4HMOA 4AY4A 1JI0A 2DR0A 4RL4A 4NNPA 2EVWX 1SM4A 1PR1A 1TE2A 4LWPA 3ZZ1A 1BCRB 2PR2A 5C8XA 2RCNA 3NTOA 3I4CA 4MUGA 4GMXA 1EFPB 2QENA 2EFEB 1H22A 3ZYZA 4KKXB 5E1DA 1HFWA 2ZVPX 1T10A 2EYUA 4B9EA 1TK9A 3CH7A 4LEIA 4QJ4A 5F51A 2JG3A 4M38A 5L3QA 1OI7A 2QK4A 4JA2A 1PD0A 4MJXA 3PTLA 5T57A 4LYJA 2XADA 1RI4A 2X76A 3N2IA 1ZLYA 1B2RA 1XZJA 3B51X 3ESXA 4RVGA 3RVNA 5I7UA 1TKAA 2DRIA 2MTBA 3IUBA 3N2GB 1TQ4A 3DL4A 4RNCA 3W6UA 4D74A 4HLQB 4HTFA 2FZWA 1UPTA 3E27A 3E18A 4Q9JA 2CYBA 4OMCA 1SY7A 3OWOA 5CNMA 5T3UA 3TIXB 4UREA 1L7VC 5T5QA 4AJLA 2RKWA 3B9QA 5CTJA 1E2JA 2XE8A 5TMEA 5JNLA 3FKJA 1T9ZA 3MT0A 3TVDA 2PL5A 3IGFA 2Q45A 2OO7A 4TKLA 4ZHQF 3OTGA 3ZJ4A 2CUZA 1HR0B 5DEOA 3KB6A 4LQLA 5LC1A 2QBYB 2ZPTX 2R60A 3DXFA 3FPJA 2BSAA 3KKMA 3HRIA 3KKQA 5ER6A 4OHBA 1CUEA 4OHZA 2GNPA 1V47A 1PBTA 3LUAA 3O8BA 1KI3A 1Q44A 4UCXA 4G36A 1QP8A 2XGGA 1JYFA 4B82A 5KSWB 1YJ8A 2DPLA 1SVUA 1FBNA 3F90A 1ZU4A 3HCCA 4X45A 3WB0A 1FFDA 3F6CA 4YHBA 4LZZA 1QZUA 3L1IA 3IHWA 1A2KC 4CXMA 3I72A 4YJFA 2GLTA 4PRYA 1KO7A 2V1XA 4A91A 1E2UA 4OAQA 4N18A 5AD1A 4L5BA 1QAMA 4N9WA 3BWVA 4B40A 1CRQA 4LG1A 4UUNA 4Q6WA 2CV1A 1OKKD 3IP7A 2BUAA 1M2JA 3Q8MA 3GFTA 1USVA 4QOJA 3D8TA 3IALA 3OQMA 1IJFA 2WNIA 2B83A 5IBPA 5HZMA 1DQNA 5LQMA 2IF2A 3FDIA 4C2UA 5K99A 1T4BA 3IT2A 4IGEA 3KOUA 2JJYA 3NWOA 2D5BA 2MIIA 4GOJA 2Q2QA 1N2CA 3DEKA 5CX1B 3ESZA 3IKLA 3QEBZ 2GLXA 5TNXA 4B5KA 2UZ3A 1FJ2A 4FOPA 3BYZA 2DTEA 1VMDA 3FYUC 4N3BA 3MMZA 1Y6JA 2GXSA 1Y9EA 1YCGA 3AI7A 5DYNA 4JEHA 4LXUA 1G7CA 5KTOA 4M98A 1FB5A 1NDHA 3B1VA 3WHKA 5I7HA 1NP7A 3V6LA 2VDKB 4FE3A 1K8YB 1U02A 1N1MA 4XRGA 2P6RA 3U49A 3LUPA 4QLBA 2WM9B 2JIOA 1N25A 4RA6B 1NSFA 4HNHA 1WZUA 5F2KA 3K31A 2X40A 1W8DA 2OG1A 3UMVA 1N2BA 1HQKA 3UOGA 1U1GA 3UFXA 5BN4A 1RYHA 4HVTA 4KREA 1P80A 1Z4KA 2HQBA 1KWGA 3FYUA 1EJ0A 2DR2A 4MJLA 5B1IA 4MQEA 3EC7A 2O8CA 2VH1A 3EGDB 4I5EA 1QQTA 2YBDA 5JC8A 1X1QA 3IKJA 4EL0A 5DT9A 3BDVA 1HDEA 1A96A 1SC1A 2Z1NA 1PW7A 3P7MA 4HB3A 5CFNA 1O9GA 2IZ0A 5TQ2B 1CQJA 4PGFA 4TKVB 4R0MA 3V4PB 3GUUA 1Z07A 3TD9A 3FCEA 1GU7A 1ZIPA 2A9OA 4PFQA 3CZPA 2BHSA 3FGZA 3JQ7B 2HHAA 4H18A 4QC2A 1OX6A 1AXGA 3RRZA 3TLMA 3WL4A 2XCQA 2DJ5A 1WM1A 2FPKA 3A1TA 3B2QA 3BMNB 3DMDA 4JOBA 4DMLA 2HPHA 5I6DA 1POXA 4RIHA 2C00A 3FNQA 3E9EA 3GAZA 2F3RA 4TSRA 4AWXA 5SICE 1C1XA 2HF7A 1E20A 3IP1A 5ISMA 2J6CA 3VSCA 1VZ2A 2QUZA 4RH0A 2IE0A 4CQLB 4WJLA 4IHJB 3JQFC 4MB0A 1KOFA 4HNQA 4V1CI 1N0HA 4HFRA 3O9ZA 2HQOA 1ZAYA 4X91A 3I2FA 3ZK9A 6LDHA 4OLBA 1Z33A 1Y81A 4EPVA 1U7DA 2Y05A 4IDBA 5GV7A 5JWHA 5ILOA 2CXPA 2I4LA 2IOYA 2VP6A 3QXJA 3NHJA 5FIUA 3AVYA 1CF9A 4DDMA 1BFKA 3ECCA 4ENQA 1KDZA 3OY7A 3HP7A 1I3OA 4ZD6A 4BQNA 3DQPA 5C5IA 1B73A 2Y8EA 2RHCA 1FSSA 3U6KA 2J3JA 1Z56C 4G56A 5KMGB 1LQTA 1T6ZA 1KKUA 2AMYA 4OQQA 5DI9A 5ILQA 1E5LA 2Y1FA 1QYXA 1YB2A 3D9QX 4B3CA 3P9SA 1YS7A 2ZWVA 3U5TA 1ADCA 1FX0A 2PX6A 3E22B 3TKLA 3KQYA 1H9AA 3O90A 4X95A 1BS2A 2BF7A 1Y5RA 2YJ5A 2GA9A 4ND8B 3FYHA 2CJWB 1QZXA 1A82A 2WJHA 3CONA 3TLZA 1IQUA 4P84A 2ZCJA 5A02A 2AQIA 4UBOA 3OFVA 2VCHA 2PMFA 4R40A 2CDRA 1J9ZA 2O8VA 4BNTA 2E6UX 3VHXA 1XEWX 5D3QA 1CJSA 2CLEB 2WF5A 3E70C 4YRMA 1TUIA 4X64B 3CWCA 3FPEA 4EB0A 2VDVE 4GPD1 1ZNXA 4OA5A 2B8NA 5A06A 5KWSA 1VL5A 3EIQA 1BMFA 4BRWA 4Q47A 3IJ5A 2AMJA 3I0MA 1EDZA 4O8ZA 3QEKA 5FJJA 2ZJBA 5IBCA 3C5HA 4DUZB 2GAIA 2I2AA 4Q1EA 5I5GA 5JZ9A 3U44A 2FPPA 4JJ8A 3KB8A 1DRJA 3SS9X 3SJAA 2LD4A 1AGPA 2OFXA 2VJYA 4D4LA 3ED1A 4DDKA 4C43A 3C3BA 3GYGA 1T4CA 1M0TA 4WCFC 2BFCB 3OPVA 4HB2A 5BWNA 2B25A 1XDGA 2I2BA 1ADBA 1UJ5A 3V55A 1CZOA 3A9VA 3W5UA 3WQBA 4F4UA 2V7QA 3A2NA 4I55F 1NBMA 5EHNA 2QX7A 5AI4A 5DTRA 4JEMA 1KDYA 3AB3A 1DINA 1Q19A 2XQJA 3CKYA 3P0JA 4Q3KA 3K0HA 4RZQA 1RPAA 2JKVA 3RPEA 3TW8B 3LT1A 4FX5A 2AF3C 5FR2A 2BKAA 3R7AA 5LP6F 3EA5A 4N5DA 5FEMA 3E82A 1RADA 2XGSA 4ZXFA 2GD6A 5CPBA 4BX9A 2YHIB 5CDTA 4WCFA 2QLTA 2A0KA 4I99A 4QT4A 3GW8A 1DRKA 5CW1A 5EPEA 1J8MF 1IXKA 4LTMA 2YWHA 1SU8A 4PWYA 3FGPA 4QWWA 2GAJA 1QPGA 1NPYA 3ZKWB 3SXUB 3IA7A 2P68A 3P9ZA 3PR3A 4ZOLF 2C4HA 4KO1S 1JP7A 3O8QA 2ZE7A 3W3ZB 3WGUA 2B2XA 1FJGB 1RACA 4MVJD 3CQ9A 4IGIA 4ABYA 1DXOA 3ABZA 3D3WA 1V3TA 5F9FA 3G13A 4I4LA 1V1MA 2B8TA 5HDBB 3H5TA 5HCIA 2BSQA 1TEXA 2ATEA 1EYZA 1GVHA 4HTAA 3ZHCA 1TYEB 1GAQA 2VRBA 2C9DA 3HH8A 1G6KA 4V0OA 1OGJA 4JL5A 2R7AA 1DEOA 4BQFA 2DWPA 1AIPA 2OC9A 1IBMB 3M6IA 2X9QA 3DDZX 2UYCA 4KVFA 1VIMA 4PGHA 1QCDA 4QXPA 3LY8A 1Q0ZA 2I4MA 4L8GA 3S2SA 1YAJA 4I46A 3VR5D 3BCSA 2R00C 4R3UC 5BV7A 3EA4A 3H3JA 1ZGBA 4KV7A 5ETJA 2IXBA 4YTEA 2EGHA 2B6HA 3SBEA 5CM2Z 1NQTA 2H18A 4OHCA 4ACBA 1QMPA 3IBCA 4HFMA 2UUAB 1HT0A 3CKMA 3VKWA 2ZR7A 4NHEA 3OG9A 1RLUA 3TTSA 3Q4GA 4G8BA 3IMKA 1FQJA 1SKUA 1ZIOA 5DNVA 5C8DA 2OBMA 5JQGF 1PS9A 3QG1A 4E07A 3FFXA 1C2YA 3WWZA 4CIXA 4ZO6A 1FMTA 1WCIA 1W5AA 3B7WA 3KJZA 3OQJA 1T15A 3B1JA 5I48A 2C92A 1L8XA 1KFCB 3WQQA 5KYUB 3HEMA 4LF7B 3ZCQA 4DY4A 2WWHA 3H9QA 3I04A 3PJEA 1TTTA 2CBZA 4MKHA 2EKLA 2YWFA 1ENOA 2R00A 3R6DA 1W94A 3BXGA 3WVNA 2F9LA 3BKWA 3PJGA 5G0TA 4CF6A 1UJNA 2O9JA 3NB0A 4P7JA 3MWGA 1DDIA 1DNPA 2QQ0A 1V26A 2V5AA 5KHLB 4AMBA 2WC1A 4XVRA 2FK8A 1B1CA 1EWQA 1N6NA 1BS9A 3O4IA 5F3RA 3T0GA 2OGTA 2HRQA 3GFPA 3JD1A 1G0OA 4RPHA 3QA3E 5ERXA 1OTXA 2EW1A 3KQNA 3QV1A 3IO5A 1ZUHA 2KE5A 3D7MA 5B53A 2F4NA 1SOMA 2F1RA 5ADHA 1P61B 2DBZA 1NU8A 2I2XB 5F73A 3BH7A 4BMXA 3OUTA 1YOVA 3A32A 4R1LA 5IJ9B 3FJ1A 3DZHA 3MN1A 5KNDD 3R3VA 4CBVA 4BWFB 1Y9JA 3IHKA 3AETB 3GD7A 1HRKA 1J33A 3BJMA 3QPWA 4N8DA 5AKZA 2GA8A 1MOZA 3HYNA 4UFNA 4XARA 5FPPA 4HV4A 1IBLB 4I1IA 5JXJA 3KJHA 1CIVA 1Q0LA 4CKEB 4LZWA 3IDFA 4W7IA 2OLEA 5HCNA 4A0RA 3H9EO 3SHOA 2VK4A 2X86A 5DOVA 5BUZA 2JIZD 2VXCA 3H1EA 4TVOA 1U1DA 2GK3A 3I9MA 3AKEA 1GLGA 2AGVA 2GAFA 1FJHA 1WF3A 2QTHA 4MDHA 4P32A 4TS1A 1GA1A 1TUEA 3OO1A 5F35A 3CV3A 4KR3A 1MAUA 2YV5A 3FUVA 1VMKA 3H8VA 4LVOA 4L74A 1JYSA 3TRKA 2I55A 3UTDA 4BVKA 2BFOA 4P7KA 1AU9A 4NFYA 4AMYA 5L9AA 2FVXA 3R4VA 4CMCA 4K86A 1GZUA 3FWYA 2ZRNA 5K0BA 2OV4A 1UKYA 1TIKA 4MULA 4D9GA 2WU1A 3WL6A 1ZM7A 1QFZA 2ZBPA 4P8RA 4Q7QA 1V37A 1YHYA 3U7QB 3ANNA 3R6TA 1RT9A 2Q5JA 1USKA 2O50A 1E7QA 2WVJA 4RA9B 2H1WA 5ENVA 4WA7A 4NDZA 3WLKX 4F8YA 1XVTA 5E7IA 3R9XB 2CYCA 1D2GA 3T7TA 2OCXA 1KSHA 1BWRA 2BZ0A 4QDOA 4EKGA 1N4DA 1XZ8A 4PHFA 1JHRA 1AK1A 4CM4B 4FGKA 3ZQUA 5EMJA 2ASVA 3FLBA 3QIAA 3DPUA 4GKVA 1K8XB 1VMEA 1YB4A 1RWQA 1KKLA 5K3SA 1G5FA 2P75A 2HD4A 3QEMB 4NCXA 3JAWB 5H1YA 3TTTA 3WLJA 1AXRA 4PAQA 4DCPA 5A0VA 2OXIA 3QPVA 4NQZA 1WXXA 2TMDA 3JWIA 4ZDIA 3FNEA 3O2SB 4H0CA 2K87A 2QMZA 2HYDA 4P5DA 1A9XB 2AWNA 1GU1A 2VH2A 4NH4A 1H8EA 3T9FA 4JYMA 4GXRA 5CLLA 3MXOA 5J2UA 1H42A 3ITDA 1TU3A 2NVUA 2BH2A 1G98A 3AIIA 3L92A 3UKDA 4X3OA 3OUZA 1VPWA 5T4HA 1BRMA 1OLOA 2QSJA 1ABBA 2LR0A 3AFOA 1IXYA 1JAIA 4AL4A 4RAQA 1Z36A 3MWDB 2W2PA 3EBPA 3HYLA 4NU0A 3LUKA 4NBTA 3WLLA 4HS4A 3VPXA 4FMDB 1NMEA 3BE6A 2NUAA 4F12A 2JZCA 1L5VA 1RYMA 3O2NA 2B0CA 2ZZKA 4TUYB 3VZPA 3OF5A 1C9EA 3FPLA 4RV5A 3ZUGA 4EA9A 4CM8A 4GE3A 5H68A 1XJ0A 3W34A 3NJRA 2ZBGA 3L7OA 1P73A 3OT1B 3GXBA 3FCXA 1AY0A 1IY8A 4IVRA 4RDHA 1GTMA 4UMEA 1SA0A 2YXEA 5AW9A 3CG4A 5EJ5A 2AJCA 1NFQA 2ZJAA 1L5WA 2OBNA 3FIUA 4J7XA 4KW7A 1RHMA 2R6R1 4L85A 1TFUA 3D7SA 4B3BA 1E5XA 1N4AA 1W59A 3FGOA 4G0MA 3IKVA 3NTLA 4ZCPA 2IZ6A 3O6VA 1GA6A 4JUIA 1AV7A 5C52B 4NF2A 1GG8A 1VE7A 2C5EA 2CMGA 3C7KA 1F0KA 2ZETA 4HR7A 5LQDA 2EAUA 3UK7A 4D4IA 3DKVA 2CCKA 1L7BA 4ZC1A 4J49A 3MA0A 4P5EA 5HF6A 1YIDA 3T0FA 3UKJA 3LO8A 4URXR 2A9RA 3OQIA 3TQOA 4EFDA 1ND6A 3F6RA 4PC1A 4BO3A 4C4YA 2NT3A 4WXYB 1F0NA 2BPOA 1DIBA 2WINI 3F4LA 4EB6A 1BNCA 1Z2NX 2QQGA 1OZAA 3LQQA 5E8RA 2YN4A 2GO7A 2QQ5A 2YWGA 1M9NA 2RGBA 1TYCA 1ZGAA 5C37A 1VLZA 4MVJE 2WBLC 1ZD9A 5DWQA 4EG3A 1IRXA 4KTTE 1JIVA 1JF8A 1TM5E 3L7IA 4JCOA 3ONFA 3WRVA 4AG6A 3ZHRA 4EHIA 2VQFB 3ROXA 1OB2A 2BFAA 1B00A 1O5OA 2ZAOA 1E2HA 3IQWA 4J0CA 4QXOA 1IEXA 4HCJA 5GZ3A 5B58C 3K70B 2AN9A 4NATA 4MICA 1L8OA 4QOHA 2RHOA 2WIJA 4NULA 2Z9CA 3R7NA 1PJLA 4JI3B 2JGJA 3TLXA 5A3RA 4TQ9A 1GXSB 1NZJA 1VKZA 2X8LA 1PW5A 2CXQA 3W1VA 4COOA 3PHGA 4YRPA 4ALNA 3WB9A 1SWVA 2CUKA 2DAPA 2RAVA 3QG5A 3CZ9A 3CG0A 2WE8A 3O0DA 2QU7A 1N32B 2FG7C 4EVIA 2YBEA 3L84A 4R8KA 4L4XA 3G59A 1R18A 2OHJA 3NX4A 2Y1OA 3ZQJA 2HLPA 2YCBA 4YDQA 3I4LA 3DV2A 3K70D 2AKEA 5SZIA 2JHCA 3A4NA 3AK4A 3L8EA 3SIWA 3AQ4A 1FTYA 2FN7A 2QTRA 1JU3A 4Y2QA 2OYRA 1G3QA 4WMLA 4LC1A 4B3XA 1XMSA 2AN3A 2JBHA 3GLTA 4BASA 4C0JA 4D3ZA 4DY6A 1UBKS 2XQFA 4ZAYA 1J70A 3NHLA 3B9RA 3LQRA 3LPAA 1M10A 2H17A 2BMDA 4GICA 4BB0A 4BXOA 3LLSA 1VI6A 3QUAA 1TXGA 3QU9A 4ZREA 1C7FA 1NKTA 5HFAA 2FN8A 4EG6A 2WR8A 4WLNA 4Z86A 2F3SA 1XJ5A 5TQ0B 5AQ1A 3E1GA 4U7TB 4AJIA 4P34A 3FSJX 3JVIA 4ZVNA 1RRGA 4F3RA 1GNQA 4N7JA 3KCQA 4K7JA 3L8GA 2C4VA 4X90A 3WS7A 4UTRA 3TR5A 2IOFA 1L7OA 1T5SA 4L50A 5IHPA 1TAGA 2B2NA 1GNTA 1ZH2A 2O3RA 3K1AB 3DEAA 4PVCA 3VKUA 1GCAA 1LV7A 3P9QA 2EERA 3GDWA 4N49A 4Q0MA 2V8OA 4JI1B 2XSZD 3C70A 3QOXA 2I3AA 1QBGA 1SUIA 1N6LA 1USUA 2FRDC 2Q99A 4QU5A 2X2EA 4CMJA 2BLLA 4PYOA 4LBWA 1V16A 1JMYA 4DC1A 4MYUA 2C29D 1RJGA 1WZNA 2ID8A 5JTTA 1AF4A 1XLTC 3OH8A 1O95D 1TQ8A 4HAUA 3ANLA 1ZUWA 3HMKA 4FFOA 4MV8A 3KEOA 1M73E 3NBUA 4Z1MA 1RWPA 2L82A 3FVWA 3IOCA 2J6HA 3QX9A 3D54D 1CR6A 4PPQA 5TJHA 3TK1A 1U1FA 2IYWA 3DLIA 5ADUS 5BWCA 1NMSA 1NJSA 2P2YA 2AMVA 3CZRA 3F8SA 4AW9A 1E2EA 1FP6A 4EJFA 5J5VA 3WKDA 3AR9A 5HRCA 1NSYA 2FRDA 3EAQA 3O92A 3MAJA 4O59O 5L3QB 1L1QA 1IL0A 3CF4G 3NYQA 1AKRA 1BROA 2WSYB 5DLPA 4IOKA 3VHQA 2E5LB 1JJ7A 2GD1O 1E2NA 3G2JA 1ZITA 4V02A 4UAVA 1Z6QA 5JEDA 3VR6D 2DKFA 3INNA 3QVXA 3ZY3A 4OREX 2XPCA 4QJ3A 3AO0B 1I3MA 1I51A 3KKPA 4U7HA 4BQIA 1MIHA 4WK6A 4F93B 4HTFB 2QMEA 3L7BA 3CLHA 4K9LA 4CE6A 4EHBA 5DI3A 5CX4A 2XUGA 5AM4A 2OHHA 3F0TA 1C4OA 2ZSHA 2H08A 3L43A 1Q92A 4IO1A 5H5JA 1A95A 4BWGA 3ILYA 4E1VA 3DV0A 1RYFA 5AJYA 5EHQA 2MSNA 2N9UA 4MKFA 4ZGBA 4AY3A 3QPBA 3MLBA 3UXHA 2RG1A 2J4CA 1Q14A 5KYVA 2E21A 5SY6A 1TC1A 3TSCA 3BMCA 1XPOA 3ML1A 5BSRA 2NXJA 4QFMA 2CHFA 1PUIA 4AJ9A 4RSRA 3TX2A 3ZWAA 2Z8YM 3GFQA 1KMQA 1A9PA 2Q1UA 1C0PA 1C3VA 2H6EA 3GCGA 1FE8A 1O6FA 3RS5A 1Y37A 4KE8A 4TQAA 1HEIA 1LLFA 4MI1A 2Z5LA 3GRKA 5ITVA 8MHTA 3U7IA 3D5QA 2PKCA 1XA4A 4QVIA 4E4TA 1PKEA 2XITA 4YJFB 4S2EA 4I6EA 3U1VA 3VOSA 1T9GS 1XLUA 1GHTA 4PG7A 1KP3A 2DGDA 4CG3A 5ALMA 1NOKA 4BZQA 4LXYA 1ZI6A 2J3EA 3ACCA 5H8WA 5I7SA 1UZNA 1DBVO 1UJ2A 3N3BC 4IRMA 1NIPA 2WP0A 2RONA 2YFYA 2K7FA 3T9AA 1NXOA 2C78A 4P7GA 1RE0A 3WKEA 1J0DA 1TGVA 2Z9DA 3ZJYA 2RGEA 1U04A 2H00A 4QL3A 1V48A 3WLAA 1U9CA 5LR6A 3QPDA 1N2CB 2ZIFA 3X1ZA 2UVDA 1XPRA 3L0DA 1S8OA 5AHWA 3F2VA 2PH3A 4OSEA 4FK8A 5A4DA 3T5AA 2V7PA 3P9NA 1PYDA 4MVJI 1KMHA 1E1QA 2CLCX 4INZA 4J7UA 2CDBA 4J76A 4WOPA 4XA8A 1GYQA 2HA6A 4TMYA 1TTPB 1U94A 4FHFA 5FHRA 4AS2A 4DYHA 3CRQA 4F5EA 1PN3A 2BBOA 3TM4A 3PF8A 3LXUX 4YAKA 5LLTA 4BBJA 5IASA 1CQZA 3H1GA 1NQ5A 2FZLA 1EH5A 2BISA 3LRXA 4PE5B 4Q24A 4CKBA 2J0SA 3DVRX 3PGMA 4I36A 4IIJA 1ESNA 3T6KA 4XKJA 4Y6OA 3EXAA 4N0MA 4JC5A 2VTBA 3D3KA 2JZNA 1BTOA 3EMDA 5BN4B 3UFXB 2RB4A 1NF9A 3UK2A 2HRRA 2O3UA 1WG8A 2XCUA 2FQXA 3FYUB 1MQAA 2XJ9A 3KEQA 4FKZA 2CF5A 4E5YA 4MQEB 3ZWDA 3RROA 2O8CB 2GF2A 4CETA 2Z98A 1H2RS 2Y0CA 3PNMA 2DBYA 4YAIA 3P9IA 2JLRA 2H16A 5D7BA 2REBA 2P2SA 2ZB7A 2PH7A 4GFDA 1J2TA 2XECA 1CQJB 5JS7A 1RXEA 1KPGA 1T3LA 1NX6A 2ZJ1A 4GL4A 4CLXA 3JQCA 2WZQA 1UBEA 2GX6A 4RGBA 4XX1A 5HUHA 2IUYA 2FFHA 1CVIA 4BMPB 4JJZA 2EFGA 2P41A 3IPLA 4QBFA 4AKTA 4X92A 3L40A 1B0UA 1U8XX 4A2QA 3UM9A 3SF0A 1M0SA 4DLLA 2MSCB 4BNUA 3E48A 1P9NA 1FRVA 1NR7A 1TIPA 2EV9A 5EC8A 3UT5A 1CJTC 4NEQA 3RS7A 3AHGA 4OKIA 1C80A 4A8HA 2YV3A 2UYHA 2G9ZA 5KQLA 2I9KA 3M7IA 5HVNA 1JQKA 1Z34A 1ISPA 3BRWA 1MJNA 3ZD7A 1C1XB 1I94B 5DULA 2DHQA 3NASA 1XA3A 3ADPA 3B8HA 1O6ZA 5BORA 4Y9TA 1GG9A 4FINA 1TU0A 4LCBA 4MR9A 3BL6A 4R1MA 3SBDA 3DEIA 1OU0A 4PYRA 2Z2YA 2ZUBA 2PFSA 3W6PA 4CN9A 1Q74A 1GSAA 3VGJA 3PJFA 1THTA 4CCSA 2GCPA 4C22A 4DF3A 4DLTA 4F11A 3VHXB 4YWJA 4UE3S 1R3UA 1HX7A 3BM5A 4JDUA 2I6XA 5DW3A 1G8MA 3JWJA 3PQ8A 4IIEA 3PE4A 2ZYVX 4RE5A 5IT5A 1E7RA 1P9WA 4DA6A 3W3AH 5B6IA 1RQ7A 3PK0A 3FBWA 4BMVA 4BP3A 3LBFA 1TJ3A 1OFHA 3IAEA 1IEVA 4C08A 2OV1A 2GLUA 2VJPA 1LJLA 1MOPA 3OSZA 1XTPA 3K8ZA 4KE9A 5DGDA 4R83A 4UUBA 1G5TA 5ENZA 2F3PA 2X7JA 4UQPA 3V7YA 3LYHA 1FX0B 1TM4E 4U39A 1ZD5A 2R44A 2Y71A 3LHKA 3NT5A 1T8SA 1YKFA 3PEFA 5AJTA 5TB5A 1A71A 1ZMXA 2ZU0C 3BEOA 5ICEA 3GP8A 3MIZA 5I4IA 4YCDA 4M9RA 3T5CA 5HEKA 1P0IA 3T3GA 2Q3CA 1G59A 1N1DA 3B38A 3P9PA 2DLDA 4IIFA 5KNCH 3ECSA 4KWIA 4PLPA 1QF6A 2CHGA 4FWBA 1Q1BA 1T35A 5JFTA 1UAYA 1EQAA 1FRFS 2WE7A 3K5HA 4IXMA 1ZKDA 4ZQHA 1V7QA 2UZIR 5A4KA 5CD9A 3AVWA 4KI0A 3N2LA 4BP8A 3O8OA 2IA5A 2GPTA 5EE1A 2Z6QA 1JEEA 3S27A 2DUUA 1GPH1 4IQFA 5CNKA 2ZJFA 1CB0A 3NV9A 3UAVA 4HT3B 1MJGM 1GPBA 2V55B 4ED9A 3UMRA 3DONA 2BR4A 5AJZA 1SVIA 1NL3A 1RI3A 4FX2A 4HATA 4K9DA 2JFWA 2FPPB 5ALSA 3T7CA 4DIDA 3U44B 1UC8A 1K7CA 3E4CA 1ZGZA 4HPJB 1T4CB 1VE3A 3NTRA 2V7XA 5GJVC 5KHAA 1ONPA 2H4XA 1NVVQ 2J87A 3E9QA 5E6SA 2C3UA 5J4KA 3GFOA 4IDNA 3Q15C 4GZ5A 4PNHA 4C3ZA 3H5NA 1XDWA 1FDRA 4G97A 4MV4A 3HM2A 1T3HA 2J48A 3H65A 1HFJA 4K9SA 2DFPA 2ZWIA 4TV9A 4L08A 3L7YA 3R6GA 2QMQA 2ZE8A 2PG3A 3KKKA 4Z0HO 1IN4A 4ZO9A 1QH9A 4WN9A 3CZ4A 3KR0A 4DMKA 1M83A 4D26A 5KTSA 2H9YA 4X94A 4H6PA 1BMFD 4YQEA 5TGZA 3U80A 3RSHA 5J4YA 2WQ7A 1GQRA 3KU1A 1XCPA 3U5ZB 2IYOA 2Q5LA 1UJ6A 2FX2A 2X8AA 3FWKA 3KE8A 2AI2A 4N0DA 4WCFB 4XDHA 2I6SA 4HAYA 2TSYB 1NATA 3M49A 2PUCA 2EP8A 1R6DA 2BONA 4DXAA 1ISGA 1UDAA 4CL3A 4MRNA 5DRYA 1YUBA 1FVFA 2E18A 3WHIA 4JZYA 2J41A 1DPGA 1QS0A 5JJCA 2WV7A 4JC4A 2V7QD 5FI0B 1NBMD 2FTKE 4IL5A 3DBHA 1JILA 3D3WB 2GPJA 2R65A 3OMWA 1QU2A 1V1MB 2NV6A 5FI1B 1QFYA 1UBTS 2PV0A 2M1ZA 1RWMA 1D2HA 1R6UA 2D1RA 5JSZA 4S12A 2VC2B 4QUHA 1PCXA 1NQXA 4BE7B 3U3MA 4PGGA 4NMLA 3RK4A 2PL3A 5L3VA 4D9KA 1G6Q1 1SHTX 2N42A 2QJRA 2QXYA 2PL1A 4IYRA 4LSZA 3I1FA 1RLMA 4XJXA 1YGYA 1A2OA 3V8EA 1E32A 3P4UA 2C2ZA 4KSBA 4NNJA 1K8RA 1PZFA 1WWKA 5EIBC 2V54A 3L93A 1GT6A 4IVPA 1KQOA 2PUJA 4PRKA 4LRXA 2A3NA 1YGPA 1K97A 4X85A 4Y9UA 1CF4A 5AI5A 1WBBA 1OC4A 2J9ZB 5FLEX 4Z6KA 2YQ4A 3NJ4A 4TRJA 1KI8A 4LI3X 3BBPA 1UWLA 1YRWA 3EWSA 5TVGA 1L7XA 1J22A 1P62B 3I3SR 2QYOA 2EKZA 3PQ4A 1L4LA 1TCVA 4EELA 2NN3C 5JDIC 1WCIB 2KBEA 3RSQA 3IELA 5K8VA 1MBZA 3E4DA 1HDIA 3G2NA 3HJCA 1J2EA 3NI2A 3PE6A 4ZO7A 4B7AA 3T7SA 3GLHA 2NYUA 4MCAA 3DXXA 3LPCA 4KIJA 4TLCA 1UL1X 4W8HA 5PNTA 3QRWA 3CVXA 3IL2A 4AS1A 3IILA 3T7IA 1M2KA 1I2ZA 2PU7A 3KKZA 4H1UA 4I9NA 4EVQA 5JDCA 1YU6A 5G02A 2OHVA 2RSLA 3GP3A 1O97C 4ODIA 1HDRA 1UPFA 4F9EA 4BN0A 4CT5A 5JDIA 1W4BA 2CVFA 2PMDA 1DBWA 1W4LA 4J6FA 2C59A 4YJGA 5CEJA 3ZD6A 1EFKA 1I7LA 3L1JA 4D5EA 3U56A 2J31A 4V2UA 2P2DA 5DK6A 4CR8A 2GBFA 1MTZA 2VDJA 4I5DA 3FRHA 6GPBA 3WSVA 1E99A 1Z3CA 2PYZA 2EBWA 3JYPA 3P1JA 2CK3A 4TM8A 3TRJA 1YOVB 4RK0A 2IZ5A 3R24A 5C1PA 4FC6A 4I08A 1RQXA 3WQRA 2VAMA 4FFMA 4PFJA 4KFCA 2I66A 4P3XA 5K1ZA 1NUHA 3CLSC 3DUFA 3L0OA 4UXHA 4BZZA 5JI3E 2F9FA 1OLSA 1D6JA 1QLHA 5U4XA 2ODPA 3ZGZA 1IN1A 3IBFA 3AEKA 2GGSA 5DNCA 2B37A 1H0SA 1IOZA 4LMBA 1FSPA 1ISFA 3BSSA 1RR6A 3IQZA 13PKA 3VJLA 1SXHA 2F8LA 1QGDA 2DFDA 2H7VA 3D4IA 3GAFA 3SIPA 2HMWA 4RLHA 3LA6A 1A77A 5KJ1A 3BFXA 3QLTA 1K68A 3QUTA 4G1VA 4ZHSA 5LZ2A 1V7CA 2BGIA 2PD4A 3RVMA 2ZQZA 2VHXA 1UJBA 2QPAA 3B9BA 1P5JA 2FAXA 2EKBA 5CJ2A 5ALRA 1Z15A 4GF5A 4YT4A 4KG7A 1PVVA 1HNNA 2DBRA 3MOGA 3MK31 1WBDA 3S2FA 4N3CA 5A3SA 1U3CA 4K6MA 2QA5A 1NP6A 3T94A 1PV1A 2ZWAA 3C3PA 4C6HA 3BFVA 3M2TA 2M6SA 2OR3A 1JQJC 5JMPA 5AW1A 3SZMA 1JAYA 3F5FA 5JISA 4HEA1 2W93A 3EVAA 3OU6A 3LQ2A 3PQCA 4U0KA 2WFMA 5FPKA 2HFKA 2WJAA 3N0XA 5JAMA 2YC2C 1T6XA 4UXJA 1POWA 2BELA 4PX2A 4E1BA 3EG9A 3WOHA 3A6EA 1EU1A 1AZLA 1R0WA 3KX2A 2Y1WA 3QYFA 2PXAA 1OBHA 1GFIA 2IF0A 1XZKA 3ASYA 4MCIA 1KO8A 5K3AA 1JEOA 1SULA 2ZI5A 1U98A 3NC0C 4GW3A 5CFOA 2BTQA 1PWZA 3A3KA 2IPOA 4LYDA 4GKJB 3OBBA 2L2QA 1A5BB 3T4UA 2P9JA 2ZS7A 4JS0A 1ST2A 2NO6A 1CEEA 2NTYC 1APBA 5TE9A 4OI0A 4OB7A 3RBZA 1KJWA 2QR3A 1EUCA 2IYPA 3RK1A 3EE6A 1SRQA 1FP1D 4TN5A 4LBVA 3SSMA 4NOKA 2PX8A 5GIOE 5LXTA 2P78A 4XVQA 3I05A 4IFBA 1L7RA 4QGFA 5J2UB 4P80A 1E5TA 2NVUB 4CIVA 1OH6A 3LYAA 5IEBA 4E14A 2VT3A 1VXRA 3R7BA 1Y1KE 3N75A 5LUAA 1SBZA 5JNTA 1W48A 3LQYA 4YAWA 3DEHA 5GMOA 5DNUA 1P0CA 5BNTA 1NAIA 2BM8A 1Z8DA 1W6UA 1CUSA 1ICIA 4TMWA 2AA3A 4IJWA 1MO4A 2SNIE 4M0LA 3EZFA 2NUAB 3QVTA 4WACA 4CIBA 3ZR4B 1A8IA 3PD7A 1JKJA 2MJLA 1BE0A 1TMYA 3BJIC 3HO6A 2ZRLA 4K6OA 1AM4D 4CM8B 1F8UA 3CZAA 2PBFA 2VHVA 4OPMA 1JR3A 2YMQA 2B36A 4G1FA 1YE3A 2A5LA 1H8ED 2GETA 3TN7A 3VR1A 1VI5A 1GTZA 2P7HA 3TW0A 4BJHB 4TL8A 1SA0B 2B1RA 3BS4A 1XVUA 3SM9A 3I5AA 1ENYA 2O5RA 2WHEA 2XYPA 1RP7A 3TZBA 3U48A 2WG0A 1HSOA 3QBVA 3LC0A 4G5OA 4YX9A 3T1TA 2CD9A 1FLAA 2OLJA 5K2OA 1PG5A 3FZYA 5PGMA 3K9HA 4BPRA 3H4MA 1BO6A 3G8DA 2WIBA 4MMZB 3IAUA 1PSZA 4JOCA 5BR4A 3AP3A 2GSDA 3AY7A 3BCRA 1Y3DE 3QGMA 3OQIB 5FOVA 2ZVDA 5JZOA 3LS2A 4BECA 3VR0A 2I76A 2IYEA 4F72A 1F2TA 4KFRA 4RKFA 3CE9A 4EB6B 4YLYA 1RI2A 1GQ2A 3Q41A 4UBLA 1ZSNA 2GZDA 3U7RA 1TCCA 1P75A 2Q4RA 4XYMA 1JDBC 2E5FA 1NBME 3NBMA 4LJKA 3ORSA 5KTPA 3FNRA 2XKJE 5BV8A 2FFQA 4K05A 4HRAA 2IYYA 1M2EA 1G6HA 4M7RA 4NU5A 1P33A 3PEVA 1FU4A 2P2NA 3TEJA 4IIUA 4NI5A 1B74A 3SWWA 1NJGA 4L3OA 3ETLA 1Z13A 3V2HA 1F3LA 4J03A 4PLCA 1U90A 2G5CA 4BO0A 2F59A 5ALZA 3HXOA 1D0IA 3MAAC 4LOAA 2JHPA 3I8XA 3MPOA 4KL8S 5F1KA 3U81A 3H84A 1JAZA 4JQYA 4DILA 4OD0A 3BJEA 1ND5A 3RT7A 2NZXA 1H0HA 2PWBA 3JD3A 3LY5A 3OQNA 2P6MA 4ZTUB 3PSHA 3CNBA 3UJBA 1FBTA 3BRSA 3DV9A 1TMKA 4G37A 4GD3Q 4MTCA 4RK7A 1S2LA 5AOAA 5IRCD 2XA2A 3USES 3ZXXA 3PTAA 2WWXA 4DCCA 1MQSA 3CW8X 2GARA 2PX2A 4P36A 3K4HA 1II8A 2QLBA 1XJQA 3Q85A 3BE4A 3W2GA 3G8AA 2ADMA 4YRQA 3OI7A 5EUBA 3WWCA 7REQA 4U2KA 1QAQA 4XTRA 1C4XA 3OHMA 1S96A 5AHKA 1DZ3A 1JU9A 2HM7A 2O7VA 4G0OA 1I10A 4RO0A 3SEFA 1LXCA 2QVBA 3ZXUB 3GN2A 4HS9A 2JIBA 2BKEA 3R5KA 1I6KA 3KALA 2ZE6A 2N75A 4BP1A 1KJJA 3N1UA 2YVLA 2ZYRA 4KE7A 4TVKA 4UE6A 4YRJA 4AQDA 2GEJA 3F2IA 3KNZA 5TEVA 3THYA 1MJFA 1Z4OA 3FLAA 4EG7A 4JJIA 5HIAA 3ZH2A 3LW8A 1RTKA 3IUJA 2GZ3A 3A6JA 2EJWA 2DBQA 4E2YA 1RYBA 1L5YA 1NYLA 4DV1B 1VLQA 1ISIA 1N8KA 3NC4A 5AKLA 3K6JA 3Q1LA 4P3OA 3B6MA 1RKXA 3KFLA 4PZ9A 3I9KA 4CM9A 4YRZA 4JB0A 1W1IA 2FHPA 2P3SA 1W2WB 1VG0B 2ZKIA 4LVUA 5F2OA 4DWJA 3ZVMA 3CS3A 1QH0A 5JVDA 2VAPA 4XWTA 4WCDA 2QI9C 3LT4A 3QLUC 4NFLA 1I0IA 2R47A 5MDHA 4I14A 1P2BA 3K30A 4U1RA 5A5VA 1MJHA 3AKZA 5EKSA 3NTVA 4NBVA 4C0QC 2QVCA 3K7EA 3U17A 5CIWA 4J3JA 4C4SA 1JKMA 1NNI1 2XF2A 2ZYHA 3ZE1B 1FDIA 5JI2E 3F9RA 1CFJA 1V16B 4H27A 2IIQA 1OA0A 2PTGA 4RY8A 2GCOA 1THMA 4X6LA 3R7FA 4LF4B 4PSCA 4QLOA 2GASA 5LWHA 3EEYA 1SHKA 1PQWA 2BLNA 3IQXA 3L4JA 1TJ4A 1L1FA 3QLUA 4JKIA 1K27A 2W98A 1XD8A 1E9RA 1SVWA 1IB0A 1HYQA 1VQ1A 3PNYA 4KKVA 3EBLA 5BRAA 3K1YA 5CA1A 3ZVKA 3HUUA 4K6KA 5JAZA 5D01A 1O4VA 1QORA 2NNLD 4DCOA 4A2WA 4AECA 1D4OA 4JJKA 3ZHSA 3UYKA 3HY4A 3A6HA 3HBJA 3OOYA 1C7RA 3EISA 2FETA 3VAAA 3GC6A 3ZE7A 5KSZA 4J0IA 1QBKC 1DAHA 4CKYA 2HR1A 3PXXA 4IY1A 4ZU1X 4YR9A 4DEXA 1X2BA 4PZCA 3A9WA 3I6MA 1VKOA 2YMPA 1KI1A 3JAMA 3WAJA 4FEGA 3D5TA 2VNJA 4PZDA 3OP1A 5DI3B 1U7TA 3LTEA 4LYHA 1FXWF 3GVIA 4Z1MD 2GBCA 3R44A 4Q05A 1B7GO 3X1WA 2D59A 4B3JA 3LK6A 2QTTA 3HXTA 2OHFA 2W2OA 1UT8A 3DV0B 3E03A 5IVKA 3ZVLA 1KI7A 2VNSA 3SCZA 4YMHA 1Z5PA 4XX0A 1J0XO 1Q83A 1CE8A 1NXVA 2A88A 2OMEA 2NW6A 2Q3BA 1V5FA 2OG2A 3SI7A 5D1HA 4CI0B 3BMCB 3NVKI 1AUVA 3GUHA 4TT3A 3NHWA 3N2NA 2W2QA 4GMFA 2WSLA 3LCUA 4E4RA 4FE7A 3KEFA 1Y1TA 4XD2A 1EGMB 5AUPB 4UBJA 2WJZB 1T2AA 4V24A 5D6NA 1C41A 3ZDRA 1XU9A 3M4YA 2QY6A 1EM6A 3OA2A 1H2ZA 3RC1A 4OQFA 3KUDA 3BWDD 3H4VA 2IX9A 2CFRA 4OF4A 1UCFA 3DNMA 2V6JA 2F48A 3H2BA 4PNZA 2VJAA 4B6JA 2SICE 4Z2YA 3M1YA 4X6XA 3DQQA 4N39A 3TAXA 5CYOA 2FJPA 3EVCA 5DHQA 6CHYA 1Z47A 4FPXA 4NYMQ 2JFUA 1YIOA 2Y6VA 1FTSA 1E6CA 3CNNA 4UHBA 4ZICA 1SOAA 4IJMA 1XK6A 3IQFA 3NKLA 3R74A 1OYOA 1DG9A 2DPYA 3NHZA 1JQEA 3TSAA 4KNVA 4F4DA 2IDMA 2JS7A 2WA1A 2R84A 2R97A 3DZJA 4B9AA 3PFWO 5J4HA 5C1BA 1SXPA 4ER0A 1QRRA 1SKBA 3LW7A 4BIMA 1I1HA 2VZ8A 1NJ5A 1YS9A 4ITUA 1DB3A 4JLPA 1WW2A 1ZRNA 4Q48A 5DBIA 4FFVA 1WMBA 3D8SA 5JC1A 5JO0A 1XGKA 1FU7A 4MUXA 1KMNA 5GOTA 1P8AA 1IHDA 2C3PA 2YXLA 4XYGA 1KU0A 1GD1O 2XDWA 1KMHB 1HE2A 1XP8A 2ACKA 2P62A 3EF0A 3F6SA 3I92A 5HIMA 4EKYA 1AH2A 1DTEA 4COKA 1E2FA 3MF4A 3M5WA 4G26A 4NPCA 1GPKA 1Z2OX 1AV6A 3GA7A 5LU9A 3LUHA 4Q21A 2OILA 4CKBB 1ZGGA 5DPMA 5LMUB 4C04A 1GG5A 1WPQA 3KLNA 3M6WA 1H5UA 3QTLA 4IIJB 3P26A 4GX0A 4WY2A 1D6NA 2VPQA 1IJKA 3MBKA 2VTBB 2XQVA 1PS8A 2BFDA 1GTVA 3HN6A 3MB5A 1X7DA 3Q7TA 1CUUA 4MV0A 2XRMA 4QTZA 5SZKB 3PRYA 4CGYA 1FFYA 1XWIA 5LB2A 2IIBA 1JEAA 1LLQA 1S2IA 2HU5A 1T26A 3GZTB 3IPRA 1SKQA 4FOLA 5JCJA 3SEZA 3TIFA 3THOA 3G79A 1OZHA 1E1QD 3MYRA 1EQUA 3DEYX 3EVBA 1Z5OA 3QFRA 3HUEA 1NN0A 4WZ6A 1DIOB 3CEAA 2NSDA 3LRTA 4OBWA 2WTUA 4AZTA 1THGA 4LZPA 4U2CA 4U7GA 4JA0A 4X1YA 1I4TD 1Z2CA 1ZHFA 4BE4A 2CJFA 4WZBA 1BQ3A 2B7CA 3LX8A 1QSGA 5AM5A 3UHPA 5TF4A 7ABPA 2V6FA 3ISVA 3LLVA 3DMNA 5DV9A 1SPXA 5JEEA 1M72A 3G2MA 5DYYA 3JQGA 2PRIA 3UT5B 1IHYA 5GM1A 2PZKA 3T9DA 4YCCA 2AUNA 3KXPA 1Z8HA 5COBA 2NO5A 2X14A 2QIPA 1QQ6A 1TO6A 2LCQA 1PEKE 4W5WA 5A3JA 3R7DA 1T9GR 3BTVA 3D3NA 1KYWA 3MJTA 5JTUA 2BC9A 4JITA 2JVJA 4MR9B 2XAAA 1LSJA 4M1ZA 5J4LA 3IV6A 2VVTA 3U4MA 1MT0A 4I9HA 4ZU3A 2XVZA 3FY4A 1PL6A 3UAYA 1ORWA 1USGA 3NH6A 1QFXA 5LIRA 1IHXA 1M6HA 1QU3A 4ZHQA 4D98A 1QYIA 1DCFA 1GN9A 4GP6A 3RHFA 3SX2A 4HQ6A 2IZZA 4C3OB 5ITZA 1LC3A 2CL0X 1CLUA 1MB9A 1WB6A 2BL4A 1ZOIA 4RY2A 4KE6A 3QPAA 1CR0A 3BRWD 1RXCA 5DH9A 3OECA 4LJSA 4F5WA 1WMFA 4P82A 4CU2A 3A1EA 1F06A 5FAXA 1FC0A 2YHUA 3DDWA 3WRWA 4QU8A 5HNKA 2G07A 2I91A 4H4CA 3ADBA 2O0JA 4GYYA 1AXEA 1C8BA 5FEUA 1U7HA 2JPDA 2KJQA 1UZAA 1JQ3A 3GEEA 3AW8A 3OOSA 2G0NA 3D2AA 4JLBA 2B92A 3G9TA 3MS2A 4XJSA 4ZAGA 4P6VF 3UFBA 4Y2UA 5K03A 2H65A 1B14A 1P91A 4D8UA 3X0DA 3I01M 3CFYA 1H85A 3KYCA 3VFDA 4W5JA 2B6NA 1VJ5A 1DWPA 1TLFA 1Z7BA 3NHPA 1KOGA 2W2XA 3O7MA 3O8OB 1Q0QA 3SYMA 1SVNA 2GDZA 2ODBA 4QG7A 4RD2A 3WGOA 3WV5A 1AB6A 1B8UA 5EP1A 5EWLA 1H66A 3EIUA 1JHAA 5D87A 3TL6A 5AP9A 4G0QA 1UANA 3OLQA 3ZCSA 2ZRMA 1IY2A 2PGJA 2GBGA 1AG9A 1J4AA 1U0FA 3CPSA 1QFJA 1FYXA 3TG2A 4EZEA 3KVRA 3K35A 4KX5A 4A82A 4OHYA 4K88A 3AF0A 2IU4A 1AQYA 1NXTA 4UMVA 3IP5A 5FA5A 2R79A 4OYLA 2F1KA 4ZYWA 1AS0A