3EDQA

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edqA00
5IAEA 1I4EB 4QU9A 4ZVPA 1K88A 4NOMA 1RE1A 2CNKA 3S8EA 4QUAA 4ZVTA 1SHJA 4EHAA 3BIJA 3GJSA 4JJ7A 5IBCA 5IASA 3D6HA 4HVAA 1F9EA 4LSZA 4ZVUA 1BMQA 1IBCA 2QLJA 4N6OA 4EHLA 3NR2A 4I1RA 3R7NA 3EDRA 3R6GA 3DEKA 4FDLA 3KJFA 2Y1LA 3QNWA 4QU5A 4JQZA 1PYOA 3V4LA 3H11B 3SIPA 4DCOA 4DCJA 1K86A 3KJNA 4JR0A 1PAUA 3H0EA 3NS7A 4JB8A 2FUNB 1NMSA 4PRZA 2J31A 1QDUA 4FXOA 1GFWA 5K20A 1QTNA 3EDQA 2C2KA 4ZVOA 4FEAA 4PRYA 2HBRA 3R6LA 1RHMA 1F1JA 3KJQA 2FQQA 5IABA 2QL7A 3V6MA 4N7MA 3PCXA 1RWNA 4QULA 2H5JA 1I51A 2J33A 3R7SA 4NBLA 5IAJA 3UO8B 5LUAA 2XZDA 4I1PA 4PS1A 3OD5A 3PD0A 4JJ8A 4HQRA 2Y0BA 4D3XA 2J30A 5IC4A 4JQYA 2H51A 2QLBA 1RHRA 4DCPA 2C2ZA 3GJTA 4AW9A 3PD1A 3DEJA 4ZVQA 1RWVA 3DEHA 3H1PA 4N6GA 2FP3A 1RWXA 4IEFB 2CNOA 3GJRA 1NMQA 4QUIA 2H48A 4FGUA 1RHKA 3R5KA 4QUDA 2AR9A 4AWAA 2K7ZA 5I9TA 4EHFA 3D6MA 2P2CA 2XYGA 3R7BA 4EHNA 1RWOA 2XZTA 4IYRA 5IC6A 1KMCA 1RWWA 1SC4A 2H4WA 2XYHA 4QU8A 1RWPA 2QL9A 2HBQA 1GQFA 4NOLA 5LUBA 1CVRA 3D6FA 4EHHA 5H0IA 2J32A 4NOJA 1SHLA 2DKOA 5IARA 4QU0A 4QUGA 4D3ZA 4QTXA 1SC1A 4N6NA 4QUBA 4N7JA 5IANA 5JFTA 2H54A 3RJMA 4QUHA 4EHDA 5LU9A 3E4CA 3V4OA 5IBRA 3GJQA 3IBFA 2C1EA 5IBPA 3S70A 3H11A 3V55A 1ICEA 2CNLA 4QTYA 1RHQA 2NN3C 4JR2A 5I9BA 1RWKA 5LU8A 1I3OA 1JXQA 1NMEA 3H13A 4JJEA 2H4YA 2C2MA 1RWMA 4QUJA 4ZVSA 4NBKA 4D3YA 4PS0A 2XYPA 2HBYA 3IBCA 3K7EA 2CNNA 5IAKA 3UOAB 4EHKA 2C2OA 2WDPA 3NKFA 1QX3A 3P45A 4NOKA 2H65A 4JR1A 5IAGA 3SIRA 1I4OA 3V3KA 2CDRA 4QUEA 1NW9B 2CJXA 3ITNA 4EJFA 1CP3A 1M72A 2QLFA 4HQ0A 2QL5A 4N5DA 1RHJA 2HBZA 2CJYA 1RHUA 2H5IA 3DEIA 3V6LA 4NBNA 4ZVRA 3P4UA 3R5JA 1SC3A 4M9RA 4AWBA
chains in the Genus database with same CATH superfamily
3N2LA 4YRNA 2VDMB 4IBOA 3PK0A 1O03A 1RPNA 4XD7D 1C9DB 4MEAA 1DBIA 3JQFC 1PL0A 4F9GA 4II2A 4P82A 1PSDA 4K87A 3IBYA 5LP6B 2XCUA 4CFZA 2IQ5A 3KR2A 4R7ZA 1BJTA 1F5NA 3H5RA 3LCCA 2QSUA 3U26A 3V5NA 1K2WA 1L5HB 1EGVB 1OXBB 4BDSA 3EZXA 2C0CA 1ZOOA 1ORWA 1QF7A 4IXDA 1TA0A 3HKCA 3RSOA 1W4ZA 3NNDA 4J0FA 1UC5B 3GMIA 1W25A 2OPHA 1CR1A 4PRZA 4ZO6A 5IKEA 1C7QA 2GJ8A 4DLNA 1M2VA 1BCRB 4L27A 5DHRA 1OC2A 5JDCC 2DHDA 2NAFA 3D3EA 4E5KA 3U6KA 2NU9B 4N0EA 1TLFA 5KEIA 2Z5LA 5JLJA 1NXOA 1W581 1YZLA 3HVRA 3STVA 3FN4A 1RI4A 2HIHA 4J4TA 1G41A 1JU3A 1NNI1 4I8XA 2W6IA 3GUCA 2XUZA 5G3ZA 4XH9B 1W1WA 2V9CA 2J3QA 1UDAA 4WNAB 3GJ6A 4NU8X 1ONPA 4H7FA 4IIGA 5DTRA 1B6SA 1QJCA 2A14A 4AY5A 1GKLA 2Q3DA 5IWCA 1PKXA 2NAPA 4TT3A 1P1HA 3TTXA 1W93A 1EHYA 2BM0A 4I4TB 4K46A 4IDGA 1TA9A 3I05A 1FK8A 5KX5F 2ZJ3A 1NLFA 1PE0A 1UPBA 1GHTA 1EK6A 2O57A 3D8UA 4UCFA 3U7FB 1KP9A 4TXLA 1JQBA 3EXHB 3WMEA 3ZVLA 1WQ4A 1DOHA 1ZKMA 4AYTA 1F2VA 1FUYB 3F7MA 4B75A 4ME6A 1EXWA 1H3EA 3HDGA 1FBTA 1SU4A 3G89A 1CJUC 1QCZA 4MVJH 1KKMA 1GA4A 2EYQA 4INZA 4RVFA 1I2BA 5ELMA 2GYYA 3O94A 3IALA 3TS1A 3WIBA 4B45A 1AJEA 1LBHA 3GQBA 5AK4A 1E0KA 2XXJA 4FFMA 4G37A 2GKGA 1VCNA 3A58B 1HURA 4QUBA 3GX1A 2DU8A 4N7JA 1TZCA 1LCIA 2H3HA 3A4NA 1JKJA 1Z15A 3L5KA 2OBLA 3LAWA 3G82C 1CUWA 1IN4A 5AKZA 2PX6A 5K8VA 1X38A 3JZAA 3ZWKA 5THXA 4EO4A 2DB3A 5LLTA 3FDJA 5LA6B 5BW8A 2VZ9A 2ZULA 3VKVA 4GDFA 1H2AS 3QYJA 1SNYA 1WSDA 3OZAA 1S4MA 3P2IA 3T3OA 1RYBA 2J45A 1EEXB 4MUJA 2J5BA 2JLUA 2AWNA 1ZGGA 2FWNA 5KAPA 2QUJA 5JZ9A 1FTYA 1DTWA 4F4HA 3L01A 1FDIA 5KMGA 1W52X 1XNGA 1IOZA 1C0IA 1HSZA 5EHQA 5KDLA 2IYPA 1COWD 1C41A 1G5TA 1NC3A 1OFIA 1U2TA 4GH5A 4KPUA 5EJ8A 2JB9A 2XF2A 2BTQB 3A27A 3SU8A 3DGEC 1WNFA 1UFQA 3RROA 4HYTA 1EA7A 4UTXA 4DMFA 2R6R1 1IEQA 3HL4A 3N2IA 3AVUA 1N2HA 2ORED 2VCEA 3M6MD 2BKEA 2CLCX 4IF6A 4UULA 3LOUA 2BMFA 1AO0A 4CCYB 1EG7A 1NT2A 1U8ZA 4WMLA 3CXUA 4YRFA 3V4SA 4R0VA 1T4CB 2IEZA 4G5HA 4YACA 1O7JA 2XUGA 1S7CA 3AH8A 1Z68A 2C77A 1EEHA 2M6SA 2QMQA 5U1PA 1DJMA 4GQBA 1T2CA 4H16A 3NWPA 5CB8A 3MGGA 3PNPA 1DAOA 2IH2A 3WDSA 1ESZA 2C4UA 1NBME 1VMDA 2YXPX 3UCEA 3IQWA 3V4LA 5JDIA 4HDRA 4N0PA 3S2GA 2OP1A 3UUWA 2I7TA 1XN4A 2EL9A 3CM0A 1V39A 3H1EA 1PAUA 4R3NA 3HK2A 4GLBA 4DHWA 4HAUA 4BGIA 1MJGA 2OL4A 1XRRA 3HADA 3P5SA 2R4TA 3WWEA 4HMPA 4JH0A 1CJVC 5FPPA 5TLSA 2WVJA 1D8AA 1XZBA 3RTAA 1H0KA 4BV9A 2XRYA 3C8DA 1I51A 3ANLA 1F4LA 3EASA 1EUCA 1TCUA 3KQWA 1GGEA 1KFKB 1WB9A 4TTQA 1APBA 1M34A 1ODIA 4X61A 4ZARA 3TM4A 4NZYA 1T9KA 3LYLA 1I5RA 1G20B 1J56A 1BX0A 4LXTA 1L7XA 2BMWA 3UMRA 5FL7A 3HCBA 5EXTA 2XTNA 3BRWD 3WL3A 1F1BA 4G07A 1BW9B 5K03A 1SVMA 2CMHA 5CDFE 4HS4A 3ZIAD 1HEIA 1PS8A 1Q12A 1XA4A 1NIJA 4AG6A 4ZCMA 1UBSB 2Y0PA 4P7JA 4BO1A 4XDYA 3L7MA 3W5VA 3WYAA 1O4VA 4AMZA 4M0DA 4BGVA 3HWRA 1C29B 4MWGA 1SC4A 3ASZA 3L6RA 4RQTA 2O8FB 1R0LA 1RWPA 4GYJA 3PEUA 1CY0A 1ZK1A 1T8RA 4IXTA 4QQNA 5ARCA 1OF1A 4C2BA 1X8KA 3KVVA 2R7NA 4O08A 2JDIA 1TW2A 4LCEA 1T9HA 4C7VA 3CT4A 4YJFB 3ZDZB 4YQYA 3FCOA 4XZ3A 2QYSA 2CHEA 3BYZA 1ZRMA 4CJXA 2NPOA 2J3IA 1X7YB 4I6EA 4J9UE 2GEUA 3AZQA 2HUNA 2ZZKA 3FTPA 3DVSX 3E3OA 4HDSA 2Y0DA 5IH7A 1EFAA 2D2FA 2QT0A 4D4HA 3D6VA 1MABA 2FSFA 1TC1A 4OLAA 1GYRA 2AN9A 5M04A 5I7AA 5K0LA 3ZU3A 4BNDA 4ND4A 4RTLA 1A8QA 2G9VA 4QARA 1A4UA 1K5HA 1W73A 3ND9A 1SOUA 4IH4A 4O1IA 4UXJA 3RH0A 3TLJA 3ZI7A 4D1YA 5LZ5A 1N7IA 2X6RA 1L5FA 1ZJ5A 3DHEA 4M9CA 4DGQA 4UZFA 4RPIA 5CA0F 2WIKA 1NVVR 2A35A 2XRMA 1A8HA 1T3SA 1REQA 4PXYA 5EVCA 1FVXA 1J33A 1IE3A 5JAPA 1N5OX 2A78A 1CP3A 3SR4A 1HUQA 2DPYA 3BGSA 3WFIA 5BXYA 3RM3A 2EZ4A 1FYWA 2RG7A 2QMEA 2XRFA 4IKEA 2BFCB 2QB5A 3B78A 1ZD4A 2WFLB 2H2HA 3FBWA 2NG1A 2XLCA 4GX2A 1KYXA 3LECA 4E5NA 1F6BA 1FP4A 1S96A 1QX4A 1UK6A 2O2JA 3EZGA 3RD5A 2ZJ1A 4X63A 2HJRA 3AVOA 2UUAB 1YIDA 4IDCA 4U7HA 5IJAA 3H2KA 3LD9A 3QWIA 2PM8A 1U3DA 1XCBA 1FFHA 4JNCA 3WLHA 1TQDA 5DM70 2VUUA 5F12A 2RGNA 4FJ1A 4G6ZA 4QJ3A 2H5EA 5LB4A 2YQ5A 3WGNA 4R8RA 4XRRA 1ZESA 1CU1A 3WMFA 5SZHB 4LF9B 4N5IX 4HXEB 1EB8A 5DNWA 1P3JA 4FDLA 2GSDA 1DPGA 2C4TA 2W2OA 1CNEA 3G9TA 2C58A 3LPAA 3BE6A 4HTFB 4O2LA 5D85A 3ZY5A 1U7HA 2BGMA 4PN3A 5KQGA 4MQMA 4DC9A 3FE2A 4X6XA 1U02A 1LLCA 4GSLA 2QUZA 4KBGA 4JX8A 5CX1A 3M3PA 3OJEA 1STOA 1E1RD 4BNMA 1MW8X 1P4JA 4HR7A 4A8TA 3VU0A 2EIXA 5K6RA 4N5NA 1DV1A 1B4DA 2C20A 3QK7A 3TJZA 4FK8A 2NNWB 2QT1A 5I8PA 1ZOSA 4H7IA 3I42A 1A5ZA 4C05A 1N0IA 3X44A 2VT6A 4PY2A 4UUPA 4CTNA 2GN2A 2QHXA 4YXWD 4QBHA 1H8HD 1QS0B 5F23A 3CF6R 2C5BA 2HMAA 3KSDO 2CVQA 1RRGA 2FR8C 3ODPA 1EP2B 4B82A 4DA6A 4KP7A 3G0GA 2MIIA 2ZYWX 5ADWA 2ODEA 3ZV6A 3T5AA 5JJCA 3PXCX 1LNQA 1JFLA 1M1NB 1EXMA 2P5SA 2VJOA 3I9JA 4KIFA 4LOLA 4GPEA 1H1LA 3HJTA 1LBEA 4PTYA 2PBLA 3CUKA 4XWYA 3WLRA 1EVJA 4RORA 2RHHA 2EFCB 3BXOA 3KHTA 4MPJA 5IVIA 4I55A 1DCFA 1G18A 3T5DA 1OCEA 5K3BA 3WB1A 4UMVA 4KR7A 3RVQA 3ZZTA 2VQFB 5ECWA 2VZ8A 1XD8A 1MP0A 4MB0A 5IDVA 4QVIA 3UXHA 3SZGA 1EK5A 1XELA 4LKRA 4RKWA 5DI3A 4PG6A 3PR2B 2HBQA 5GJVC 2V6MA 4RJ2A 3COYA 5TV2A 3F47A 1C3OB 1T9BA 5ALKA 5IW8A 1NU6A 3TZBA 3UT6A 2IOFK 3U40A 1M6VB 3WK8A 2ZTUA 4ZIRB 1NP7A 3HFRA 4H9GA 4Q4JA 2CHUA 2IU6A 2RHLA 4P5EA 3ZJYA 1FA9A 2YVUA 2CVFA 2CKMA 1Y1QA 4XKJA 4OJYA 5A71A 5JYDA 5DNEA 4HNAA 4G0ZA 4QYIB 1R1DA 3FHJA 1BHO1 1J8QA 2X4IA 3H4TA 2P78A 3RSGA 3WDKA 3EG5A 1DCTA 2R3SA 3EISA 3KT0A 4TMWA 3UOWA 1PYDA 2LPMA 3ILHA 5TARA 1WP4A 3I72A 5T6BA 1U8TA 3A3PA 2EJBA 3AR5A 1M2EA 1WNTA 1G6KA 1HM5A 2DTXA 4HQKA 3W7BA 3H5WA 3EVCA 4FWIB 4BUJA 4YV1A 5GINE 2AMVA 1ZIPA 4FYMA 2IS2A 4WACA 1IH8A 2C5AA 3X0DA 3K2EA 1SXGA 4V2IA 1FFAA 1OBHA 4M8IA 1BS1A 1R9MA 1P3Y1 1MH9A 1Z29A 2Y3IA 4G4GA 4MIEA 4UU0A 4E7OA 1KZ9A 1POXA 1NSFA 3RBAA 4REQA 3VJMA 4YRGA 1U1EA 4UEJA 3E9ZA 4W63A 1TEVA 5CDSA 3I5MA 4H1VA 2OM2A 5JVDA 4KPGA 2H00A 3TLAA 3VPGA 5K0GA 3K1JA 3OP1A 4GVPA 3I53A 5DPMA 3DOHA 3ZWXA 5I4IA 2HCTA 2BZGA 4IIYA 1U65A 4FYIA 1C2YA 3BGWA 3LT2A 5AVTA 2NT4A 3B6KA 3ZDYB 5IAEA 3SC6A 3K20A 3ZNQA 2JC3A 4B3DA 1YMQA 1E2GA 2EJTA 2VF2A 2J67A 2VJDA 3M4JA 3QWHA 4MUXA 1TO6A 4GM4A 4WERA 2OCKA 3DONA 4UBMA 5CITA 2C2YA 5IDQA 2GAFA 3AG5A 2IVZA 3DZKA 3F6BX 4KH1A 1FJXA 1DL5A 3A7DA 3R6DA 4R05A 1Y9JA 4PZ9A 3F6EX 3SYTA 4M1TA 1MUUA 1BWPA 4ETMA 3AUAA 4KDRA 3WZLA 5DB4A 2ZVQX 2PZLA 2YNMA 3GD7A 4NFSA 3DH0A 3CEPB 3DVRX 4JJZA 3CRZA 5C8XA 1R7RA 3G2NA 1JEQB 1SPXA 1T13A 2ZAOA 4P5DA 1TKBA 4MUGA 1KZHA 3SJAA 3WK7A 2R1TA 1U81A 3GRYA 3H3XA 5EE0A 1T3LA 1ZD5A 4DKJA 3DEFA 4ZYXA 3IP6A 4AC9A 5I9LA 2IXBA 3MINA 4JOQA 2Y27A 3L2OB 3ONNA 1T4MA 3IHLA 3HI6A 3RGWS 1UKAA 3ZU6A 4B6FA 5HQ3B 2OGWA 2I6TA 4II3A 3HFJA 1NX6A 1OSNA 1DPFA 2ZRAA 5JH7B 3NBAA 2I91A 2DUWA 2OWEA 4BLWA 3CS3A 3JALA 4HEHA 1ZI8A 4NBTA 4KSBA 4UBIA 3T7AA 1XPOA 4KUEA 2FLVA 1QRTA 3EHDA 1UR5A 3DE3X 4TN5A 5A7FA 2GERA 3F4KA 2RJ3A 2ZXEA 3ONVA 4QQFA 1SKBA 3LT4A 1NBEA 4K86A 2IYXA 1V2GA 1GV0A 2MMGA 4UHCA 2O3TA 3T1OA 2PFGA 4NHEA 3TWOA 2Q0QA 2GRJA 1O97C 3CTPA 3M1YA 2AFHB 2Z2IA 2WIBA 4EAAA 1Y33E 4MWOA 3RVPA 2B78A 3NGXA 3PR3A 1C50A 2R84A 1KHHA 5KC8A 3W4JA 4BB5A 4EQ6A 3GLFE 3CLUC 4B3CA 1LX6A 1QONA 2A0FA 3AHJA 4TMXA 4CMIB 3HTXA 2COEA 4LX8A 2F9MA 2PBRA 4OHRA 4PX2A 2CW5A 4C0AC 5JROA 2BDUA 1Q57A 5IKMA 3KXLA 5SYAA 1VJCA 1JQJC 1LPPA 1KMMA 4N49A 3ZWCA 1F06A 1JT9A 3TR0A 1J00A 2CXPA 2HO4A 4R7TA 3FDZB 3C4QA 1G291 3AWIA 3VJKA 5AI5A 4E2YA 2JZCA 4RJLA 4ZDIA 3PFWO 2O8BB 3PF9A 3PRJA 3O2SB 2EKPA 3EGDA 1X1CA 3H5NA 3O8OA 2WIAA 4TPKA 3DFIA 5P8WA 1J8VA 3PXDA 3GGJA 4N0DA 5JG7A 3TRHA 4B33A 5HZHA 1E2UA 1U0HC 2HMWA 4TTVA 1VHQA 2PZJA 4LISA 1R5OA 1V5WA 2FZGA 4NZOA 4RHEA 3RIHA 4DRXB 5A4AA 2HU8A 5HZKA 2JA1A 2ZIAA 2OBXA 5KMGB 3UG6A 3NCTA 2CFRA 3PWZA 1KS9A 1SIBE 3X1MA 4F6LA 1Y81A 2VRCD 4CLRA 3WFZA 2W2TA 2Q0XA 1Z33A 4KXWA 1KEZA 4X97A 2GA9A 2WU1A 3P0RA 1N6KA 5KJ1A 4H60A 4FVTA 2XUIA 2VP6A 1IZ8A 1H22A 1Y3FE 4BO7A 4UU7A 4GC9A 5DSZA 1DKPA 3TCXB 2ZBVA 1E7QA 1JHRA 4AP9A 4NAUA 3L8CA 5DBFA 4LDPA 3WKDA 3W2HA 5JCOC 3DZHA 2WF6A 4FJ0A 4KXFB 5HKOA 1I33A 4ER7A 1JPNA 1Q7RA 3EMBA 4EIWA 2MYNA 3AUFA 4MW2A 4G25A 1D1QA 4GS5A 3KYIB 1ESMA 4RTRA 4CR6A 1FUUA 3V1TC 5DJ5A 3WGMA 1QOPB 5EP1A 1BE8A 2GXAA 3ETLA 3GRKA 3M2PA 4Q00A 3E1GA 4IJWA 2HDOA 4GP7A 4NMLA 2QQEA 4IIJA 3WKBA 1C1DB 3HXOA 1KVRA 2QTFA 2WYWA 4JEHA 3H4MA 1QGUA 1N75A 2P9FA 4FFVA 2ZJ7A 3KSMA 4CEJB 1TLTA 2AQIA 2B0CA 2V5UA 4R69A 5ILGA 3OOJA 2X41A 1EZ1A 3REQA 1PD0A 3L8DA 4BATA 3AEKA 1E0AA 4Z99A 2GBPA 1GAEO 1C5KA 2QG4A 1SMKA 3L43A 4OHCA 3UAZA 3OPYA 4RPGA 3RSLA 4M0PA 5FFFA 2YOGA 4YIKA 3YASA 1H2HA 4B80A 1FRQA 1K8XB 1TKRA 2EJWA 2JJ2A 3IDFA 3EZ6A 4PLGA 4TXNA 3W78A 4CLDA 4IMRA 4AL4A 1GR1A 2BGGA 3I9V6 4HEJA 1TEZA 3KEFA 2FPWA 4FOOA 4MPDA 4IJ6A 3RRXA 1ONOA 5J23A 3OE7A 3PTAA 3AMVA 4UPDA 3RBVA 1RYDA 5CLJA 1U3UA 1ZIDA 2CCJA 4I50F 1E4OA 5E6UB 2I8CA 2RK4A 3P94A 3Q7PA 2PGOA 3HYNA 4XJTA 4GPBA 4D4IA 2WIDA 4QBGB 4L78A 1ACJA 4G23A 1RAFA 2GZ1A 5A9RA 2BUBA 1N9GA 5AICA 4WBNB 4N3CA 1U9IA 2QY9A 3EAGA 3S3TA 1Y6ZA 5T8KA 3I6MA 4FSXA 4BB6A 4KE7A 2Q5IA 2P9ZA 4LCJA 4YR7A 2AN1A 1ZHOA 1P91A 4YMTA 3EPLA 1CQWA 1XYGA 3H0CA 3SKVA 4I2NA 1B26A 3ZX4A 1W88A 3GDOA 3FTNA 3OH8A 1GGJA 2QJRA 5JO0A 1ZH2A 1PNOA 1GRQA 2ZRHA 4IG9A 5J4HA 3F6YA 3QE3A 2UVPA 4FDTA 5EJMA 4CIXA 4B47A 1PW5A 1ZINA 1E9VA 1XK7A 4OHXA 2C3OA 2X5XA 2YZ7A 2CHQA 3JQAA 4F93B 4UQLA 1DQPA 2UDPA 4YRAA 1OB5A 4XGKA 4GU5A 3DKVA 3NH6A 1JSCA 4LSMA 3OQ1A 1PBTA 2HSJA 4ZI3A 5KDDA 5IF3A 4MLDA 4ZRNA 1CY6A 3WLTA 3WLNA 4QUJA 3IUMA 4HNQA 2IPAB 4JUFA 4UEQA 2YZGA 3QF4A 2DKNA 3O3NB 5A0TA 1QPBA 3A3NA 3DMYA 4NYMR 2CL6X 4FDAA 1WWKA 1ZX1A 1YS6A 5E1MA 4EJSB 3IL2A 4GL2A 2WB2A 1QF9A 1XCJA 4CHGA 4PR0A 4JMPA 2OQRA 1E59A 1QOQB 2XVXA 4PCLA 4PZDA 4BLVA 2YN4A 2Q4EA 3GGPA 4E4TA 1ZW1A 3GCXA 3QQPA 1PR1A 3K0CC 4DSTA 3PLNA 4CLOA 1CQXA 1T0JB 2H2IA 2ZIWB 4AKIA 4UMEA 2VP5A 3R5JA 4O4LB 1ECFA 2XB2A 1K06A 2FV8A 4AWBA 3I76A 1DFGA 3K0AB 4DLLA 3SE7A 5GOZA 3AZOA 2R6AA 2PSFA 2VDWA 4IQ4A 3G2HA 1Z9BA 5EERA 1XDGA 3VR3D 2A4KA 1CQJA 3BWYA 3HJUA 3HU1A 3O4HA 1D4FA 1K8ZB 1RZRA 3ZQKA 1YBAA 1ZUIA 4MKHA 2EF1A 3I09A 1ZH4A 5BR4A 3U7GA 3THYA 1L2TA 4MUYA 4D79A 5CFMA 5JPCA 3EEFA 3C1AA 2Z4SA 1A96A 2NP6A 3OMXA 4IZIA 2EL7A 1IG3A 3UM9A 3BEOA 1U8UA 4O8CA 2C4VA 1NBHA 2WF8A 5JD6A 5EKUA 3K9HA 3TSYA 4E13A 2WW8A 2IH4A 2Z09A 2O2EA 1XV5A 1KY3A 1L8LA 2QUHA 1NKVA 2ZS9A 3ELYA 4BQEA 4B4KA 5HKBA 4B3GA 5JVDF 1ZBDA 4G85A 1Z2DA 2RI0A 5HM6A 1LQ2A 4OYYA 3AJEA 5JXGA 4US2R 3MT0A 4MRAA 3KTAB 3MLBA 5C51B 1N2SA 1YSCA 4EDHA 1DAPA 5BWBA 3GVXA 1LVGA 1VCHA 2VWHA 4GD3Q 1DXQA 4ASUA 3MJTA 4KAXA 4S0ZA 2R00A 4IQGA 1YFLA 3HPRA 1QM5A 1T5TA 3ESXA 4ZQHA 4C6HA 4EVQA 5CCDA 1DJLA 2BFAA 2X2PA 2XB9A 3JR7A 4PICA 4C7BA 1Y8RB 2BF4A 4IGIA 2ZRCA 1U2RA 1V43A 3EK2A 5F1PA 3HHEA 2HL6A 2P4EA 3B6MA 3E5HA 1AGPA 1J70A 1QV6A 1XEAA 2B2NA 5LBUA 4OG2A 1G0OA 5CP8A 1JBEA 3UG7A 3GLQA 3HCAA 4Q21A 1ACLA 5THKA 2J7KA 1BGWA 2NQ8A 2JK1A 3TR5A 1SBZA 2RC5A 4J49A 5J4KA 5KX5B 3LLSA 5FKJA 1QH9A 1X9IA 1YKFA 3K16A 3K30A 1DZIA 5E4FA 1I3KA 1QOZA 3AIOA 3Q2OA 4DCCA 1A97A 4EYGA 1RQLA 4XASA 3OO1A 1C8LA 4X6UA 2O54A 4L9RA 1Z26A 2Y9MB 5C9ZA 1B8NA 3NTUA 4NE7A 1U6KA 4W8HA 5HW0A 4JC4A 2WG1A 3FZNA 3RC1A 2NZ2A 4B09A 1PR5A 3IEIA 1N2OA 2XJ9A 1C3VA 2OHFA 3M49A 2P6RA 1N4DA 1UP7A 5EJIA 3C39A 3FFXA 3F4LA 3GG9A 1WCIB 2ECQA 3DR5A 3UC9A 2WU0A 3EXIB 3W5DA 3NAZA 4W5TA 2JLVA 2XT6A 2COKA 1XA0A 3PPVA 4ZAYA 4ETNA 4MCJA 2QX4A 1DS6A 4NWIA 4BMPB 1U0FA 4CL8A 1P2FA 2CYCA 2GKOA 1H05A 1ORRA 4F3TA 4GL4A 3AYZB 4EQZA 1ZSNA 1W4LA 3E27A 1X8LA 3SS9X 1N9ZA 3I73A 4NU5A 1KQ3A 2KQUA 1H5UA 4P92A 5EPUA 3TQHA 5HCUA 4GBGA 4JUAA 5E1DA 2VJMB 4YJHA 2ODPA 3DPUA 2VP2A 3L0PA 3SEFA 1KIFA 1BXRB 1Y6QA 2GK7A 5IM5A 3C8HA 1T8WA 1GRRA 4AUEA 4EG1A 1A1SA 2H5IA 1PFUA 3T3IA 1A5AB 1KORA 1ZH8A 4KQFA 3SXUA 2EW8A 4Y2PA 3OQOA 3H2GA 2FZCA 3PNSA 3DE7X 5BT9A 4IS3A 1SD2A 2F90A 3JU3A 3AFGA 4JJ7A 1N3BA 3D0RA 3AUYA 1R6DA 2ZTSA 2HT1A 5KOIA 2IKQA 4Z4EA 2D5AA 3PXBA 5KYWA 5KSYA 3RRJA 2KX7A 2QMOA 2QTZA 3MILA 3TOSA 4B3IA 1V41E 1A8UA 1XYYA 1Z6TA 2JIDA 2KS6A 2O4CA 1KJWA 2F17A 2FLWA 3R6GA 1VL0A 3I39X 4NBRA 2O0HA 2BFEB 2XAAA 3QKRA 5K05A 4G09A 3X1KA 2A1TR 3F46A 5K3CA 4EKDA 3A04A 3HJRA 4N5HX 1HE3A 2J31A 4D6YA 4WJLA 2ONKA 1GSIA 4OHVA 4EG4A 1K7YA 2WT9A 2NO0A 3L0BA 5IABA 2DLCX 2QE7D 2H5JA 1ORVA 3G6WA 4UEWA 2XZDA 4CEIB 1QAQA 5KYTA 4GI2A 2IZ5A 3RTGA 2XE7A 3CN9A 4MEBA 2YVKA 3LBHA 3BGIA 3BQMB 1L5OA 1EG2A 2RH4A 1SVWA 4D96A 1R88A 2AUNA 3PUIA 4K6OA 4QNMA 4DQDA 1CLEA 3A37A 5D3MA 3C45A 2C4KA 1E2KA 1KK1A 3GEMA 5J4VA 1NR5A 1ZWKA 4Y6RA 3EW7A 1P77A 1CERA 1O5OA 2AIRA 2A57A 2V65A 4WOCA 1XHFA 2O8CA 1CUGA 4NZ9A 3IEUA 3TNFA 5ARBA 3VNUA 1CHNA 4FE3A 3E7PA 4IIJF 2C9YA 1NR1A 3RK0A 4U6NA 1QIFA 4DLPA 5BV1A 3P97A 2FHPA 3KEGA 3GDHA 4TYYA 4BX3A 1ZVVA 1GQSA 3N5CA 1EUDB 5DM4A 3KKNA 1NXXA 1DMSA 1U04A 2I7CA 5HJ7A 1U4NA 4RV4A 5DEIA 1WDKA 4XX0B 5DGTA 3P19A 1XZ8A 4IS2A 3CPJB 3IESA 1CSEE 7YASA 5A9SA 1UZUA 3ZVKA 1DTEA 4CQLB 3V2IA 3L1JA 1L7OA 4F4CA 4HX2A 4UPEA 4JZKA 1PJCA 3OESA 3RJMA 5JNUA 3MMSA 4CKEB 2DAPA 1JFVA 5T6MA 1RC8A 3JQ8A 2VOEA 3U7JA 4DLSA 1SVNA 1DAEA 3BJZA 3FAZA 4WJZA 4JT2A 5FCDA 1O97D 1EVLA 3I9OA 1RC1A 4PAQA 4V24A 5I7VA 1KYIA 2GZRA 3FR7A 1E9RA 4RK4A 3VTAA 1PZEA 3A6HA 1YS9A 3OQJA 3ZCSA 3CLUD 4Q48A 1OREA 2PD4A 4PX3A 1LDEA 4O4IB 5LFAA 5JJIA 2DHQA 4AF7A 4P7GA 5HRAA 1EMDA 3DT8A 4G01B 4LPKA 2FMUA 2R1VA 1J21A 1E98A 3IVAA 3K5WA 1U0SY 4XFJA 3EVTA 1E1QA 1H3FA 3RYHA 1WW3A 2G9QA 1BCSB 2AI1A 1JPVA 3LSTA 4KNYA 3DVAB 1A77A 2ZCUA 3I04M 4QUEA 3QLVC 4XVQA 1E2EA 1DKLA 1KBQA 3AKZA 2ZSDA 4YVFA 2YYSA 4N9WA 1MVNA 3B12A 2P30A 3RTEA 2O5EA 1A9SA 2VNAA 3R7AA 1OBVA 3DP9A 2BIFA 4OATA 3O0TA 4YP5A 2QM0A 1GNTA 3IAS1 3Q72A 2FSHA 4JSYA 5AKYA 3V4VB 4C89A 4EB0A 1Q92A 5DDIP 5AVKA 1IBRA 5AT1A 1QC5B 3N0RA 1BA2A 1GG8A 3P4YA 3BPSA 4P81A 4XJSA 2DM6A 1OZ0A 3OJFA 3GELA 3NTOA 4GR4A 5JZSA 2C78A 2GBCA 4PWYA 2RG1A 3CH5A 3QOXA 4Y6QA 2AG0A 2BTEA 4RKQA 4M22A 2WKSA 4OLFA 4I9HA 3TL2A 1NVKA 2JFHA 2PTGA 4J16C 2X5NA 3K8QA 5CFQA 1LSUA 4QXOA 3T3HA 4I1PA 1Y6JA 4PC3A 5FHQA 5TPZD 4A0SA 1I32A 4Q7QA 5E1BA 4QLBA 4YUXA 3P9YA 1KDTA 2SCUB 4PZ0A 1K3UB 3HKBA 4WUVA 1XQXA 1IOVA 1OXSC 3GN2A 4O5AA 5C80A 5A7HA 5DCUA 3FCEA 4D6PA 2IZ1A 2YTZA 4UAJA 2F3RA 5GM2A 3V4FA 3PEEA 3U4QA 2A0UA 2JH3A 2QL7A 4GR9A 1RT9A 2C4WA 3LPDA 1MORA 4OB6A 1RU3A 3OFND 5GGXA 2ISSD 1E9DA 3GA5A 4ERXA 4TV8A 3Q2KA 5AK3A 2ZXFA 3R0XA 3OBBA 3ZDEA 4EW6A 2I33A 4RZ2A 5CVUA 5IUNC 4MAFA 1ECPA 1IEVA 3DAOA 3O5AA 4CKBA 1G9TA 4BJHB 3IDSA 2G76A 1L5YA 4UVGA 1YVPA 1X92A 3JVUA 1FNNA 1E2LA 1OIXA 4YP9A 2Q2WA 4GRDA 1YHNA 4Z2AA 3DT9A 1EPUA 4JC5A 1AZLA 1YL6A 2YZ2A 4IIVA 4ECAA 2DFTA 4WEQA 4EPWA 2GBLC 3RUDA 4RCVA 3PFHA 3TOXA 5GJBA 4JI3B 3IKTA 1TYBE 3C4VA 5CT4A 3AW8A 2IEIA 5HK8A 2VPPA 5DTEA 1BEZA 2Y67A 5G3YA 3IVGA 3B6IA 2HSEA 3KTDA 1KI6A 1NKTA 3QI7A 4J0IA 3V8QA 4FEEA 1KRHA 3OLXA 3A06A 3ZJ4A 4PAGA 2VXOA 3MD9A 1UZMA 5IARA 1TJ5A 3D1LA 1PGOA 2I66A 1JMYA 3HKCB 3I4CA 1Q15A 2WF9A 1IZ0A 2P90A 3ZZUA 3BFKA 4W1SA 4HPXB 2JIPA 1ZVKA 1FDWA 1KO5A 1M2VB 1LPSA 1HLGA 3HB5X 2Q9UA 3ZU2A 1VP3A 2ZANA 4MUAA 5CRIA 1IQPA 4MAAA 3FFTA 1GQ2A 1PLLA 2Q5EA 4UEOA 4YAIA 1VB5A 1O95C 4Q9LA 2FW9A 4CG1A 2ALJA 5K4GA 1FLAA 3D7SA 1S5PA 4C87A 1I3OA 3AJDA 2GAAA 2IXDA 2P0YA 3ELDA 3NV9A 3Q7IA 4KJXA 4Q05A 4R1NA 3DBHA 4U2CA 1KY5A 5JWHA 4CT5A 4XR4A 1YR7A 3BWBA 1OROA 4NMXB 1DBQA 3CIOA 3D8RA 3DLPX 5JFGA 2MHCA 4Q4AA 5DP1A 3RSCA 3U19A 1ORIA 3S4YA 2XMDA 3WGJA 2XADA 1HTBA 4XSHA 1RHUA 1L5SA 3KLBA 2B35A 4DCJA 1AMUA 1GL3A 4BX9A 4D9BA 4G1VA 3TDKA 1QF6A 1E9BA 2R8XA 4QUAA 4UE2A 4FYYA 3MRVA 3U4AA 4FW9A 1SB8A 4UUQA 3D5QA 3FR8A 3FSRA 3GQBB 3VHQA 3PUVA 5AKLA 4ZAWA 3R7FA 5EP3A 1O4WA 1T2FA 1ZUHA 3GC6A 1NDHA 4OQLA 5FJIA 4YUZA 3C24A 1JKJB 4N3GA 1SQSA 1U1DA 5FWYA 2NYUA 1CZUA 1QUFA 1CD5A 2C5EA 1QJ4A 1M74A 3WGLA 4LTDA 4DCUA 2HXYA 3S44A 3DKIA 1SU7A 1FDRA 2B4AA 2D4HA 2YOHA 1JDJA 3NEYA 3LIIA 5LP6C 2QX9A 3ZQUA 3VOTA 3PKZA 1Y6RA 5DFAA 1I3LA 1SXJC 3ME5A 1EFDN 2IITA 2R7LA 3WBBA 3R6LA 2ZWOA 4A5OA 1EFRD 1F3LA 1W9HA 1P2DA 3JQ9C 3ZDCA 3IIEA 2ZR7A 1ADCA 3KKQA 2J33A 1MU0A 1DTWB 1XAHA 2D8MA 3VTFA 1N6RA 1FP7A 1S0UA 1VLMA 3IPXA 3MRSA 4QE3A 1XAIA 5CVVA 4OHKA 5HFJA 2QJFA 3K4HA 4HVCA 5KTYA 4KPUB 3AVYA 4ZCQA 4HWGA 4EF5A 2YASA 1CWUA 1DAIA 2VAMA 3OIWA 1CVIA 3TPFA 2W0MA 3KHSA 3ZY6A 6LDHA 8LDHA 4F6RA 4O8ZA 2R87A 3AHEA 1OIVA 1WXDA 1WZEA 1GRVA 4TM8A 2VAPA 4ZMBA 2D0OB 4MGKR 1P31A 4DLBA 2GF9A 1M0TA 1DINA 3EFHA 4MV3A 5D6NA 4H6WA 1I1HA 1VJDA 2JZOA 2C00A 3GGSA 4CM9D 2J5KA 2L42A 1NONA 3O03A 1F3OA 2XD4A 2Q6TA 3U7RA 4F11A 3PE3A 1GYQA 2BFFA 3ZIDA 5JXJA 3RC9A 1G4UR 3AY0A 3L7BA 4JI6B 5BNTA 2FX5A 4LXHA 4X71A 1EDBA 3L0OA 4AJOA 2OO3A 3EZ2A 1PL8A 3OKCA 4IOKA 3EXHC 4HDRB 5A4IS 3B3AA 1OI4A 2EZ9A 4DAOA 5G2OA 1ORHA 4KRGA 4GMKA 1VDZA 1YE3A 2YDYA 2P6UA 1P6UA 5A7GA 4ARVA 4R8MA 2BHTA 2NTYC 1XVVA 1YRBA 5EIEA 3LKDA 3DWGA 4OGLA 1PJSA 4PV7A 3E23A 1GRCA 2ZIVB 3AM3A 4HDMA 5EMHA 3UJCA 4B79A 4BNTA 8ABPA 1L5NA 1EUCB 2A5DA 1Z0DA 2OBYA 2IOQA 5IFLA 1M34B 4DA0A 4J43A 3OX4A 1Y1KE 4RZQA 4HPJB 2GX6A 521PA 3WQHA 1LBTA 2PH3A 3N2EA 4LJ5A 2JCSA 3SVTA 3LVFO 1NPYA 3P2OA 2QR2A 2GD6A 2VUSA 4PBTA 1OZGA 1DWOA 4KW7A 1OAOA 4TTSA 3MGKA 1A5SB 2ILTA 3WBJA 1N8TA 1LNSA 1Z6GA 2VWGA 3FCSB 1JW9B 1GT6A 2GPAA 3BWDD 1QPGA 5C7YA 2HFJA 5CTJA 1YI1A 2B8NA 4HK4A 4CCSA 4UE6A 3M81A 2XDWA 4IIFA 4MLCA 2BCEA 1RAAA 3OD1A 4PYOA 3WLOA 1PDVA 2OENG 3VDMA 3T7KA 1AMNA 1EDZA 1VKRA 4C3OB 2YJ5A 2E89A 2R8RA 5FUMA 3KFLA 1NVDA 3LBYA 3NM4A 1GZ7A 1NN3A 1N2XA 2ZAGA 1FFSA 2FW6A 4URXR 1PYGA 1TVEA 1ZWLA 5DLYA 3WMWA 4DM3A 4Y6OA 2IUEA 4ZKEA 2QSJA 5DULA 1Z5GA 4LSZA 3QOFA 4ILEA 3ICQB 2I3BA 2CK3A 2HRQA 3OCWA 4MRSA 5FP0A 5AVOA 2JLAA 2AFIA 2OV1A 5KUTA 2UUBB 2LCFA 3RFFA 2C31A 2GN4A 1KYVA 3GGCA 3MMXA 1HQYE 3BS4A 4HDSB 4L8LA 3L7AA 3TD9A 1QFMA 1MABB 1GZ4A 1P17A 2F62A 3EF0A 1JA0A 1JJIA 1Z39A 2WI8A 4BNDB 4ZQBA 1NTRA 3OM8A 2PH1A 1O94C 2GNAA 1TNDA 3GAFA 1MEJA 3NFYA 1E62A 1I0LA 4GM0A 2PGDA 4RVUA 3RVOA 3WGGA 4CFYA 4AF8A 5LSAA 4L1KA 3QEBZ 3W3AD 3AUKA 1T3GA 3UO8B 4Q1AA 4BKQA 5ES4B 4TKUA 4MI3A 2PUJA 2TMGA 3K0BA 1L3IA 2X76A 3QBTA 4RCZA 1REQB 1Y48E 4OO3A 4HXFB 1JR6A 2O4UX 4CKWA 2VKQA 3DE6X 2NUAA 1KOFA 1XKLA 1IK4A 1GO2A 2QG9A 4RHFA 2GLUA 1PK7A 2HIGA 7MDHA 4TL9A 1QHNA 2BI7A 4KH0A 4TRJA 4TLLB 4P83A 3PQ8A 3IEXA 4PFJA 3H9UA 3CLSC 2QV7A 3T61A 1A9XA 4KXNA 3VNBA 3W6UA 3RVDA 4OXRA 1FP4B 4UUMA 4IJQA 2Q2QA 2YW9A 2AJ8A 2ODAA 3O38A 5JECA 4FX2A 3CRRA 1NXSA 1U8YA 3OUTA 2IPLA 1K08A 1XG5A 2CFOA 4I5IA 4BIMA 3UMSA 4JBGA 2IWHA 2WQZA 3A9UA 4GOKA 1FFYA 1XCPA 3ZWVA 3DZBA 3PYLA 1Y5MA 3BRSA 1QYRA 2IUTA 2WJYA 3Q5GA 5GGYA 4ZXFA 5BY2A 9LDTA 1J5EB 2QU8A 4OU4A 4AKGA 4C1BA 4H7DA 5EOVA 2H7VA 3VZRA 5F7JA 4ZAZA 1UDRA 3ZHCA 3RC2A 4E14A 5CX1B 5LJLA 1QNLA 4YQZA 2PMWB 2EGUA 3TLZA 1VPDA 4J1TC 1L4LA 2BHRA 1S3IA 1QVWA 1U2DC 3E9EA 2ZYAA 3NAQA 3EJ6A 4HNSA 2IW1A 3AHFA 2CUKA 3QE4A 2Q3FA 1CZRA 3E2MA 3O4RA 3DS8A 1YCDA 4C3ZA 3DL0A 1G7RA 2B6HA 2FG7C 1M54A 3ZQJA 4NV0A 4EFMA 1MH1A 4PE5B 3LY5A 3RFTA 2H4HA 1L4MA 3QFCA 1H1LB 2FLKA 3KQVA 1IB0A 4JITA 3O90A 1AB6A 1EWKA 5GMOA 3HR7A 1GL7A 1M8GA 1XDZA 5ELLA 4I55B 1J0AA 4IDOA 1GARA 5P21A 1YGPA 5E38A 3VH1A 4F04A 2ADMA 1NJGA 2VTEA 1M1YA 4RHCA 1GAQA 3GAAA 4WLFA 3RVJA 4ZTZB 4N8DA 4PZAA 1L4EA 1BGXT 2V98A 1JV2B 2Z04A 2GM3A 4G1EB 4GC5A 5DI3B 3KDSE 4ZQGA 5FADA 2FMFA 3CRQA 4IOJA 4KAFA 3SFTA 4LI3X 5AI4A 2X3UA 5I7SA 3NEJA 3VDRA 1IUPA 1WPRA 3UT0A 4D98A 2APJA 3T3EA 1ZM2A 1J2UA 4Q4JB 4QBIA 4ZYUA 2DBQA 1P0FA 2QMZA 3FNRA 1HMYA 2SBTA 4IIEA 4MLPA 4X3CA 4HNAB 3CGWA 1DLJA 3RSSA 1QIDA 4WN9A 1N77A 2DECA 3IQDB 2BFOA 4Y2GA 3R3YA 1OPRA 3B6EA 3CB2A 4L50A 3HG7A 1U63A 3ND6A 5K0JA 4FZJA 3CZMA 2BE9A 1T0BA 4UTZA 1UP6A 1VYUA 4HYYA 4LC0A 3FHOA 2OPBA 3KOWA 3JZFA 4K9SA 4EVSA 3JCZA 1V5IA 2GN1A 3EC2A 1Z38A 2GPBA 4CZ2A 1MHTA 1E2BA 3RC8A 1B93A 1FFBA 3G2IA 4MV9A 4F56A 3SZRA 1BHJA 3LTNC 3IIIA 4WHMA 4JJGA 4PWZA 2DR0A 4MICA 2GTIA 4X8MA 4REQB 2BFNA 2REBA 5E9JA 5JVDB 3QU2A 1AKEA 2ROQA 2JLZA 2AD1A 2NACA 3AFIA 3WLPA 1SBNE 2C54A 5BNZA 2P9QA 2ZBRA 3HDQA 4GSYA 4D3FA 3QI2A 1YS2X 2P1RA 1TKAA 3DBOB 3FLBA 1R16A 4PLCA 1Y1RA 3GDGA 1YZQA 3QLTA 5EE1A 4BBJA 2Q3HA 4ZVKA 2AJBA 3E5MA 4DB4A 3JQEA 1D7AA 4EO9A 1RJDA 1XTJA 3KXDA 4CWAA 2D0IA 2R47A 1GLNA 1KMCA 3JWIA 1U7UA 1RJ9A 4LJYA 1D0SA 4OB7A 4NOLA 1IN5A 1DFHA 4C3VA 4BFWA 2ZYIA 4B43A 1ETHA 5FRDA 4YUWA 2QF7A 4RKEA 4JP8A 2QROA 2Y1OA 2XV1A 1LJLA 1P7WA 3DB2A 3LPNA 2ZR8A 3IXQA 3HH8A 1N8SA 4Y1RA 2DQZA 2DWUA 2IHVA 3CH7A 4LN1A 2P6NA 5ILOA 1G6Q1 3OUZA 1Y34E 1DSSG 2H54A 3CVOA 3L02A 2BDTA 4TWRA 4YP6A 3WKAA 2R1TB 2JGRA 3LQ1A 1I3NA 3STTA 1E8MA 4MUEA 3AP3A 4F2WA 3W2EA 4EGQA 2CL0X 3MINB 1QFYA 2HADA 1KDOA 4MEJA 5CNKA 5FLEX 4RTJA 3U6BA 1CV2A 4OF4A 4EX6A 4KE6A 3JVDA 5GADl 1AGXA 3IQIX 4AKEA 1IM5A 1U1FA 3JALB 2CJWA 1ODCA 5IWAB 2F48A 1D2EA 3KRTA 3MTGA 4B1FA 1V5EA 3DB1A 9LDBA 2QP3A 2WC1A 4OBXA 5C0OE 1S3FA 3BZBA 4QLOA 1JHXA 2XSZA 5JNLA 1ZC4A 3BHJA 4G5RA 3ET4A 1Z2OX 2PVCA 5A6SA 3AQIA 5CVDA 1X39A 3QFSA 3TVYA 2PQ6A 4H18A 3S68A 3KQLA 1O95D 1ENPA 1YS1X 2J3HA 4KMMA 4MVJP 5EZ6B 5HF5A 1MF7A 4EQ6B 3MLEA 3PNKA 4LXXA 1P4AA 1OFUX 2JHPA 4XYGA 4K3UA 1OC4A 2J0SA 2NV0A 2HY7A 2RB5A 3TLYA 2IXFA 5H16A 2HB6A 1GPJA 5IXYA 2G88A 1YT5A 2WAAA 1XALA 5T4HA 2V59A 2GF2A 4N7BA 2QRPA 3L5OA 1W2HA 1MTZA 3C6ZA 3QP9A 3EGDB 3R5XA 1TCCA 1D4AA 3O8OB 4ZOLA 2R62A 4EF6A 3B70A 4ZMSA 2YIMA 1QTIA 3OF2A 4JBLA 1EXVA 3H2BA 1E7SA 1ODLA 4LVNA 3ZX5A 2FE1A 1QSGA 3DJYA 3IODA 2PFSA 2OZPA 3FH0A 4MI6A 4DXDA 1AQ6A 4CLRB 3JAKA 1O9BA 2R48A 3ETJA 5SV2A 1MXHA 3A6PC 2C3YA 4G0UA 5FV4A 2P62A 3HBNA 4XRGA 3VSBA 1M8PA 1S3SA 4P7BA 2QUKA 1OXUA 4BMDA 1G8KA 4L9WA 2W83A 1V6CA 2Q1SA 1H0SA 2OFPA 3OLWA 5HIJA 1Y4DE 2QK4A 5H82A 3V97A 1P1IA 3L7JA 1JNYA 1VI6A 4M0LA 1VL8A 3OC6A 1TUIA 3KKOA 2V54A 4PZUA 4RD4A 4AXXA 5CBPA 3K1ZA 2KYRA 4C5BA 1SXJD 4OGFA 1IMOA 1B1CA 1UMDA 3NTQA 1TX4B 3REGA 5BYKA 5JEEA 5A0VA 4ZGWA 4KDEA 4F2PA 3NHMA 4DV0B 4CMEA 2ETXA 4UE3S 3VSAA 2H1OA 4CN8A 3EQ7A 2BOVA 3T1NA 4NG5A 2OD9A 4EYQA 3PDUA 3IDQA 4JJAA 5BYBA 1IN6A 1UBEA 4KFUA 4FYVA 2CYAA 3KFXA 4IIJB 4NE9A 4I1VA 5EN4A 1HNXB 1SC1A 1NM5C 1QGUB 4K0RA 3C3XA 2MSEB 3JQBA 1TKCA 2RK3A 4KKXB 5I9IA 3N3BC 2Y2UA 1TUBA 2EV9A 4FXPA 2XUDA 1R4NA 1CUBA 5E2IA 3ZDFA 1H42A 3TLCA 5LU9A 1OYWA 4GI1A 5JO9A 1PZFA 3RAEC 1GV1A 4PYRA 4Z1MD 1WHSA 3REQB 5JEDA 4Z51A 3AEKB 4A2QA 2PHZA 2A9QA 4L4ZA 2BGKA 4TOIA 3PPXA 2P2ZA 4H31A 2G7ZA 2RH5A 2LR0A 3OPYB 4M0MA 4U7TB 5J1TB 4A2PA 2HLDD 3SI7A 3ZWYA 5CNIA 3VNVA 4EL5A 1K6EA 2VJCA 1GAJA 4RDHA 1JQEA 2HLHA 1OWOA 2ZB3A 4EMBA 5CGQB 4MAMA 4Y18A 2Y4NA 3DE1X 4YLEA 1MA3A 2IZ6A 1KYTA 3CGGA 2Y6UA 3CBGA 4J7XA 4YJ2A 1B3BA 2WM3A 2H2GA 1J1ZA 3SQNA 3GXBA 1JLHA 3N75A 3WL5A 1IN8A 3MAAC 5DNYB 4BQQA 3G9ZA 2ZVJA 4QFMA 5FBKA 2CNBA 4E1BA 3PEWA 1N9GB 3NM6B 3R3XA 1ISJA 2H6EA 4OQEA 9ABPA 5KQPA 3IHKA 4NRDA 2XZLA 4X6LA 1S6YA 1YE8A 3KLMX 2FU5C 1O6FA 3WIDA 1MJNA 3I8XA 1IQ0A 3LHKA 1XOIA 4GEKA 4LDAA 3VU9A 1UBTS 3K9FC 3OFKA 1W88B 2BGLA 1ZRNA 1Z0AA 4N47A 4RHXA 5SZJA 1VL6A 4OOFA 1OI2A 3BJEA 3K8OE 4J0CA 2XWJI 2EW2A 2FSVC 4FHFA 1A0OA 4INOA 2XRZA 3QYPA 3GLHA 2IH5A 2UVPB 3G2OA 4NICA 4XCVA 1KK2A 1UC8A 4YK7A 1PG5A 4PFQA 2VJAA 5FWDA 3KU4A 3O31A 1WXFA 1ADFA 2IF2A 4P80A 3JQAB 3ZY2A 2F64A 4D26A 3TG8A 4ALNA 2PKQP 4RIIA 3IV7A 1MRNA 1UK9A 4O0LA 4B84A 1DXOA 2EOAA 1R15A 2CEKA 3VMFA 3TEFA 4ZYVA 2R4QA 4BMVA 4QXAA 3KYBA 1T1SA 4CUKA 3RTDA 4N0QA 1UJ5A 3N58A 2J6BA 2R2GA 4WXMA 1HV8A 5AH0A 1E99A 3B85A 3NPMA 4B2PA 3QF4B 1YJ8A 2QU7A 5IAJA 3ORFA 3KPWA 2HWXA 2R79A 3MHPA 3VVMA 4PNZA 3TMYA 2JS7A 5B58C 2R6HA 3PC6A 2TMDA 2AE2A 3P9SA 5H81A 4A8HA 1XP5A 5DYGA 3MJVA 4CR7A 4J91A 4RD0A 2OB1A 2DE0X 2WYVA 3ZVNA 4CLOB 1DEHA 3HU2A 4LDJA 1UWVA 4BO4A 3MC1A 4GX0A 3V2UA 2AYXA 2VDWB 2LTAA 3L7CA 4G63A 4HLUA 1CQJB 4MGZR 4H17A 1JKMA 1N1MA 1Y1SA 1EBBA 2JK0A 2RHRA 1HYHA 2UAGA 3Q7TA 2PVSA 4HFNA 4Q03A 3SEQA 6ABPA 3THYB 2H4WA 3NOQA 3T7EA 1IEXA 3JRNA 5KTMA 2ES4A 3E18A 4QL3A 2RHMA 3QM1A 2ZPTX 4MYUA 2Q7XA 1SGWA 1BSVA 4WZZA 4M53A 3WMXA 3HJGA 3DMDA 3RSZA 3U61B 4JJFA 5L53A 4C6SA 5A62A 4L3VA 2ET6A 2VNHA 1U7WA 2CE7A 2F6RA 3UTCA 2JHCA 3Q0IA 1Q7EA 2O6LA 4WKOA 1YFJA 1PWHA 3AQ4A 1T9CA 3GN1A 4P08A 1GA6A 3HYCA 2X3FA 4MWZA 4BWVA 1ICEA 3BK1A 4FNGA 1L9XA 2B82A 1CUXA 2J09A 4Y67A 3RGGA 1EUZA 4NCNA 4PSVA 2XCTB 4RC9A 2YYYA 4OQQA 1H4SA 3N0XA 2P9TA 4EARA 2OV4A 5BVGA 4QOGA 3T99A 2VP3A 4YWHA 1K5DA 4ACBA 2PE5A 4Z0HO 3F71A 1ZNWA 1CCWA 5JNWA 2ZOSA 3LYHA 3E84A 2BKAA 5CT6A 4U2DA 2IUSA 2PL1A 5AIAA 3RVSA 3V9PA 1L6IA 4PS0A 4UKDA 1C1YA 4D3YA 1UXGA 1D2NA 5U4XA 4IZOA 4JLMA 4RCYA 1CR4A 2IZZA 1N1GA 1WETA 4I5EA 2H65A 1ZGAA 1PD1A 2J4FA 3TF5A 2R4UA 3BGOS 5BV2P 1RMQA 2V45A 3TFWA 3PUKA 1QGYA 1F6DA 2WSSD 3EIWA 3IB3A 1YL7A 4QJBA 1E5DA 2B2XA 2ZRPA 1MJGM 3CV3A 4M98A 2ERXA 2FQXA 2VT3A 1XU4A 1ZH0A 3GDWA 3QUAA 1V8OA 2IDKA 4J2TA 2VAXA 4JXZA 2LIPA 3H5OA 3HYSA 2V7TA 1OHHD 5PGMA 4FCCA 4Y9RA 1IK6A 3EMKA 3F9IA 4ZCLA 4KPEC 5TGDA 2XNJA 1CUIA 2Z6QA 4TMKA 4TMTA 1N6LA 4D8YA 1II0A 1Q0HA 1TTHA 4PLPA 3J81k 4RA6A 1RP1A 1RYEA 1NF2A 3R6WA 1IIRA 2D1TA 4BO5A 3IEPA 1KU6A 1TIBA 1U1IA 1XUOA 1RRFA 3GA7A 3KWJA 3ER9A 1U7ZA 2VHXA 4N3BA 1HTTA 2VDQB 4I81A 1Q1EA 1LD3A 5K3EA 3DJFA 2QVGA 5C32A 4KTVE 5T4FA 4G4JA 2MINA 5CTAA 4M1SA 3MXOA 4ZVMA 2QXTA 1JX6A 2ZB2A 4HBGA 4P84A 3R8XA 4KXUA 3WA7A 2OGUA 5B3AA 3R0ZA 1ZJZA 4LZNA 3EZ7A 1JXAA 3HB7A 3Q85A 1KMQA 4CCWA 3IDOA 4PO9A 2R8PA 3N74A 2DR3A 3I4FA 2AFRA 2WHXA 3AB3A 3NVMB 4EATA 5BSVA 2WABA 3GCGA 4X1OA 2VZ0A 3SNKA 3CQ9A 1S1MA 2X4GA 2QRUA 4ECEA 4DQUA 3DXFA 4YJHB 3LG2A 1L8QA 4P4LA 5L6MB 2FX3A 1ABBA 3U0BA 3CYFA 4JKIA 4A6DA 1CIPA 1SXJE 1H23A 5AR1A 1MX5A 1MB3A 5H70A 5H8WA 1J99A 5HUHA 3L41A 3SXUB 3HB0A 4FGUA 2H11A 4DG9A 1JZSA 3A28A 3IR5A 5DBOA 3PFFA 1NYRA 1UXKA 4TQUS 5EESA 5GPBA 3TX2A 3ZDDA 4ZOLF 2N42A 3JQRA 4BVLA 3M5DA 5FOWA 3TLGA 3N28A 3KR1A 3ZNNA 2CHFA 1T4BA 1TVKA 2HF2A 3V7FA 5KYWB 2VJQA 1LZKA 1DT5A 1EQAA 3K6RA 2GEBA 3OEWA 3NRJA 2VH5R 1X80A 3K6JA 4KDCA 1IN7A 1VL2A 3QKRB 4NG4A 2MMCA 3R5HA 1FNMA 2E87A 2NQ2C 2JCYA 1HDGO 1W0CA 3B3JA 1DBPA 3MWDA 5IANA 1N5JA 2VDLB 1Y37A 3DO8A 5EZQA 3RS9A 2X4DA 3E82A 3O7MA 2MDTA 1FP1D 3FTQA 1EHIA 1XR3A 3D5EA 4BVJA 3EXAA 1J23A 1QDLB 5DNVA 3H2IA 4HMOA 4C21A 1HX7A 3SDBA 4EI7A 4NARA 1JXQA 2W2PA 3W8DA 4D8TA 3PL1A 4HN9A 5T67A 1G8FA 3GJ5A 2CE2X 1O9GA 1QYDA 2WF7A 3X1YA 1IZ7A 4BQSA 1C1XA 2A0KA 4CF3A 1BEUB 1ZO8A 5D3MB 4MGIR 3LP6A 1AF7A 3QVOA 1NMYA 3WGTA 2F9LA 1K4MA 1XHLA 2G08A 2W8BA 2XWBF 2JBAA 4QT0A 4BB9A 1UDBA 3LFTA 3Q9LA 1YUNA 1BYUA 2O8CB 2X0JA 5KOYA 5C4IA 2CXQA 2TMYA 4KU4A 2YC4C 4X7BA 1B23P 4M38A 1XQYA 1J9EA 3WSTA 5C3MA 4QX6A 1YB6A 3F7OA 2GLTA 1NRIA 4HCJA 3CUVA 1X0VA 3WYGA 5IC5A 4BOYA 4HH1A 1QAMA 1MQSA 1NV8A 3F3SA 3FPHA 4N8SA 4PZEA 4ZCRA 1E0SA 5I51A 4M87A 4QOHA 1E3SA 2G1KA 3GA0A 1F9EA 2L2QA 3OIDA 4I36A 2X0FA 3S40A 5DN6D 5A9SB 2ZM6B 1DEAA 1GADO 3AR6A 4NCAA 1XVLA 3RSFA 1BZYA 2XOKD 2ZWIA 2D5IA 2WM2A 5CURA 2XUAA 3R7NA 5BWMA 4TQAA 4ZA2A 2O2IA 1E20A 1UQRA 1B8PA 1GGKA 3AETA 3JQ8B 4IIUA 1YK1A 3IAM1 2PWYA 1TM4E 3H0EA 1AV7A 1HT0A 3TI7A 3OAAD 1J2JA 1YXMA 3MWEA 4UREA 2Q28A 2ZTLA 5JADA 4RD6A 4TSFA 3TTUA 2IF0A 3P2YA 4DVGA 3N7AA 1NATA 1V4NA 2DT8A 1CNMA 1O5IA 3CH6A 4YJ2F 1G64A 4BU0A 1RTKA 4WDRA 1U28A 3NC0C 1R8JA 1D1SA 2GUGA 2J0VA 1NBAA 2R1VB 3E7DA 4JELA 1UBKS 3DD1A 2FUG1 2RHTA 1TZMA 3OKFA 3RYHB 3HVIA 2Q99A 3ZTYA 3C6MA 1XL0A 1XEFA 1LBIA 1T43A 2G4LA 2PMKA 4M0CA 5KVAA 2HQ1A 4A92A 1ZHFA 4F8EA 1A9PA 3H3JA 3BTOA 3VKGA 1NI3A 2WBLC 3FSGD 4IFBA 2BCGY 1VLLA 1FDVA 2IRWA 1HDZA 1KI4A 1I2MA 2VDRB 2ZI5A 1W2WB 3C7KA 5FORA 4HH0A 1Z8FA 3OU7A 2ETVA 5HKLA 3PIRA 3PQ6A 2IDMA 3SC4A 1RYHA 4LRQA 1Y3DE 1RI3A 4YR9A 3U4MA 2GCOA 3IR6A 2B94A 2G3YA 2PKEA 3IH5A 5CA1A 2P6MA 5AW1A 1QQAA 1VE7A 3NIGB 3O8BA 4G5QA 3VDQA 2H2WA 1OOEA 2CJFA 3UICA 1CVRA 4E12A 3HB9A 4ZYYA 2JIBA 3OOWA 1I1OA 4C7MA 5HS6A 5K0ZA 4PYJA 3LW7A 1RAEA 1X86B 4UFOA 4PGHA 3HKBB 1GGFA 1DTSA 1HO3A 1G5QA 1TUGA 2VG8A 2QEQA 3C87A 2QV0A 3N6RA 1VBNA 5LP1A 1XXHA 2XGMA 2VBGA 2DSTA 5KSOA 2V5VA 2AG6A 3U4QB 3CX6A 2EBFX 4NYIQ 2GETA 4R1OA 2BHNA 1EDEA 2ADFA 1HZZA 1JG4A 2RC6A 1B74A 2UZIR 2VT2A 2VSXA 2Z83A 3T4XA 1A95A 4TV8B 3AM4A 4ARZA 1X14A 4P4NA 4YJ3F 4P4UA 4P0QB 5TEWA 4AURA 1W59A 3QPVA 4OGGA 3S2IA 1XLUA 1V11A 5BRAA 3ZV7A 4KUHA 5GVRA 4CKBB 4ZEWA 1E1LA 3T8YA 1NURA 2OKGA 3R09A 5IK2A 3EH2A 1W4BA 4NBKA 2IPMA 1J0XO 1Q0QA 3R3UA 1PJ2A 3V1YA 4JMLA 5H7XA 3BICA 5CDFA 1JHVA 4I46A 5K4HA 1P4GA 1L4KA 3AKCA 1P8JA 2BZSA 1IVSA 4LXYA 1I30A 4UUNA 2AHRA 2IXTA 2W9XA 3GPBA 2XNKA 2OXFA 5EKXA 1Z0IA 2CJYA 4EF4A 1EK0A 1YQ9A 4GR5A 3NGLA 2AT1A 2F8MA 4Q3KA 1KI6B 1KETA 4KPYA 2P4SA 4YS6A 4AY2A 2Q4OA 3HUTA 3K2BA 1DDIA 1UXJA 2DJIA 3H9GA 1T2VA 3HCFA 3L05A 4XB1A 4DDWA 1WXHA 4DE5A 1T6ZA 3W5IA 2WDZA 1WW2A 4JD5A 1DEKA 3HXLA 3CVUA 2O2XA 1ABFA 5ENDA 1A27A 4JP5A 4JYCA 1VYHA 2DHEA 2NWQA 4OREX 5ITZA 1I24A 4BC0A 3R8FA 1OAAA 3I8SA 4ER5A 1ANKA 1SK9A 3RO7A 3BULA 2GM5A 2W4MA 1KGSA 3FTEA 3T9CA 4KOEC 2NM0A 3QVGA 3S99A 2B36A 4ND8A 1ZNYA 3KYJB 3L6CA 4GZ5A 2XNSA 2VPQA 3NEAA 1UJNA 3FPFA 1VJGA 1NC1A 1VOTA 4QJ4A 4Q3AA 1UWKA 3J7TA 4UEKA 3DBHB 1E1YA 1IB6A 3D7LA 1Y82A 2P9BA 3V46A 1WEKA 2BGWA 4HZUA 1EVEA 2OG2A 4DWWA 4B3HA 4YCMA 5L3SA 4Q4AB 4B81A 1M6NA 2BISA 2GLXA 4OXNA 3DAGA 4KQ6A 3CU5A 2MYTA 3TBHA 3X1JA 4ZZ0A 4OI0A 2HPAA 1Q95A 4CU5A 4A1OA 2W00A 1K9SA 3CUWA 3T0GA 4C29A 4YCNA 3QSYA 1T5SA 2IIVA 5B3KA 2H1LA 3GZJA 4WRRA 3IT3A 2F8LA 1WRBA 1Z6YA 2Z5FA 3B2QA 4I3GA 3WP0A 5J2UA 1MB2A 1Z4IA 3CR3C 3E61A 3QEMA 3SY8A 1XQ9A 1EGHA 3M5WA 2MR5A 3BMXA 4RE5A 1I6MA 4PW0A 6YASA 1MQ8B 4JVOA 3R7BA 4C3UA 1SBYA 2OB2A 1U8XX 2B34A 1W35A 4KGVA 1RWWA 2DH6A 4JOSA 4BFUA 2C7OA 4CF4A 1L7NA 1AHIA 4L02A 3H42B 1YCHA 3ICEA 1NXWA 1R4ZA 3KD2A 2PUBA 2D3TA 3NJRA 5FWYB 2R11A 5JMOA 1VLQA 2H31A 4HDCA 3SFZA 1IVNA 2AXNA 3BILA 2QMYA 2ZUBA 3E81A 1T2AA 4UD2A 2G28A 1G66A 1X77A 4WLOA 1OMOA 3R0QA 2YY7A 4YDRA 3IP7A 5JS6A 5CFLA 3M4YA 2ZRLA 3VNSA 4XUDA 1BMFA 1MC5A 1PZXA 5IM4A 4WFKA 3VC1A 4R9UC 2YS7A 3X2SA 1T1JA 4DWJA 2VDPB 3HNOA 1ULTA 3S70A 2PFKA 5L3VA 5AOVA 2O7NA 4PHFA 2D1FA 4C6RA 1VPLA 2Q6OA 4YP7A 4LHXA 3B7PA 4REMA 5CYFA 3HUUA 3ZGOA 1AS0A 4IF4A 3VX3A 2MSNA 3ICWA 4BX0A 3RYIA 5B1YA 4FMBB 1PFYA 3L7YA 2AFVA 4F6RB 1EE2A 4J90A 2P7HA 2BW0A 4MV1A 3HDYA 4BIIA 3GRPA 1TK2A 2H7XA 1I4TD 5F76A 3CNQS 5FPYA 2VYND 4DQ0A 3VO2A 1BXZA 1PFVA 3SBDA 5JWOA 2C2HA 1KDPA 2XW6A 4NJMA 4G2TA 1PKEA 1SQ5A 3W5CA 1EGQA 2HQRA 2R6CA 1C7JA 4OKIA 1CFJA 2BFFB 3WZMA 2AS0A 3PC7A 2FSIA 4MA5A 1N5KA 4M0UA 4QNNA 2BPOA 4ZEVA 5BYJA 1P29A 4OIMA 3HEAA 1FQOA 1KYWA 2OV2A 1W0KA 4DMRA 5BNIA 3EWIA 4XOUA 3IV9A 5ECYA 4CKZA 1JNXX 4CYMA 2OCLA 3IMKA 4W5RA 4UZEA 1VKHA 1NR7A 1W0JD 4MS4A 3P2JA 5IBCA 3S1SA 5EMMA 2RHDA 2SKCA 2JEYA 4URFA 2XQKA 4C0WA 1N36B 2N75A 1VKOA 2TS1A 1J7KA 1KEPA 5IU6A 4OLBA 3X43A 4Y7DA 1UODA 1QRSA 4J9VA 4N0MA 3FPGA 4KIJA 1W4CA 4BO2A 2WYOA 4HDMB 4EVRA 1UDWA 4LOIA 3GWZA 2VDOB 1PFQA 1YE5A 3VUFA 3WYFA 2FZVA 1RYZA 3RODA 4X3OA 3D4BA 2VHVA 3UB3A 1BD3A 1ILEA 2OILA 3QX9A 4Y2HA 5FNVA 2GILA 2VS1A 2PS0A 1EP1B 4G9EA 3V6MA 3PRHA 4ITUA 1RYFA 3H3FA 4M9QA 3O73A 2PL5A 3TXXA 3Q3VA 4FC7A 2J5RA 2BGJA 4DR3B 2G9UA 3COVA 3PD0A 1Y42X 2QZJA 1ZONA 3IUQA 4HQOA 1T6BY 2JLYA 2WNSA 3H7AA 3M1IA 3VR1A 5JHGB 3UXEA 3QW2A 4DNPA 4LBZA 2WJ6A 3C8UA 3KKZA 1NSYA 1WDLA 1MENA 3IUEA 2C4NA 3FZYA 3F74A 2ZJ5A 3M1AA 2Y76A 2B6NA 3NTXA 4PPQA 3U7QA 3ZXXA 2V6GA 4Q18A 4UUOA 3EGVA 4Y2YA 4C4XA 5AW2A 5ICCA 3EDCA 5EAIA 2BBOA 3QUCA 3SD7A 2B8EA 4MTCA 1GFSA 4QAJA 3BA1A 3RTBA 3Q7QA 1CUUA 2QWXA 3FPEA 2WK1A 4HFJA 5JYEA 3N59A 1G38A 1V7CA 3U2QA 5BSHA 3OM0A 2SICE 1P5HA 1XXLA 2DP4E 3M6XA 5K4AA 5I48A 3FI9A 1W96A 2AFIB 2SHKA 5A5EA 2RKBA 3WGQA 2G5CA 4PBSA 3WOVA 4CN9A 2P9GA 1YCFA 1A82A 1NQAO 2C07A 3INYA 3USCS 2E4XA 2IDJA 1BTOA 4JEIA 2BT4A 4O1MA 2C7PA 4DPLA 2AOTA 3UPUA 2JGJA 3A1VA 5HTOA 3ITEA 1D1PA 4NEGA 3O0DA 1ZMOA 1UPFA 2F4NA 2GZDA 2YC2C 3EIOA 3DW3X 2Z9CA 1T6XA 1CQPA 1UMBA 5C4MA 3P9RA 5JDIC 1CEXA 1IJFA 1EDOA 3SG0A 5K0BA 2PYIA 2EP7A 1YRAA 3CKLA 3HVHA 3M5PA 1W87A 1PQYA 1X8JA 3C6BA 2VTKA 3DAHA 4TKUB 4D5EA 2R5NA 2H0QA 3LZ6A 5DGHA 5ALVA 1RXVA 4MUHA 2IA5A 1UKVY 2GTHA 2WT4A 1QAOA 1T3ZA 3BBPA 4F1KA 5I7UA 3QPWA 1MJHA 4CKWB 1FTGA 3ABSB 2XT9A 4QDZA 2VDUE 4DJEC 4NIMA 2NUAB 3VKFA 2E5FA 1K66A 4BZXA 2C2MA 5ALJA 3TW4A 1KPGA 3IHTA 1YUBA 4WLNA 2PMBA 2Z1DA 4X84A 4Y6LA 5CA1F 1A9XB 4QVKA 1EWVA 4L28A 3URMA 3I58A 3ROPA 1HLPA 3UWPA 4BMCA 1WDWB 2RKWA 3FPKA 4C4SA 1T6NA 4G67A 1NW5A 3VBCA 2O05A 2ZUUA 3H84A 4GPTA 3ASVA 3H19A 1DUSA 3G2PA 4CM8A 5B57C 2WSIA 3E5NA 1SD1A 3AKDA 2PV7A 1LBQA 4BO9A 1FLDA 1WKBA 1JLRA 5DBHX 4PC6A 2P5UA 4DIOA 2AMFA 1JA9A 2Y4OA 4MS1A 4XM0A 4LXIA 3SJCA 3HFGA 5FTMA 3MTJA 3BHIA 2PK3A 2HK6A 1XF1A 1Z2EA 1RM0A 2WOJA 4EGFA 4FNMA 2H4ZA 3ZLTA 1I13A 4TWZA 1MAUA 3G5AA 4UTNA 1GPUA 1YDMA 5IN5A 3GJXC 4PSCA 3NR2A 1FZTA 5AVUA 3JQ7A 1RJWA 1O0BA 3OPXA 1WP9A 4JL6A 4IVPA 3DOOA 4OH1A 3A1TA 3DEKA 4C4AA 3BHMA 3KQOA 4LJ6A 4RU1A 2VK2A 1KEWA 4FONA 1Q22A 3CEJA 1G3RA 1SXIA 2PSSA 3ANMA 3PQFA 4JXJA 1NHWA 4QD3A 2M6KA 2EJCA 3WC4A 5AXDA 3ZDBA 3CINA 1QDUA 4KYIB 4P4TA 1H4TA 1QO9A 4BE7B 1OX5A 1ZICA 2GYUA 3SQOA 3KOYA 3BD9A 2C95A 2PY6A 1JDBB 2CLMB 1KI8A 4N7MA 1N7GA 3D2AA 1MX3A 3AF6A 3ND8A 1JTEA 1F8YA 3LRXA 3KZNA 2RBKA 4O02B 5AM0A 4U2BA 2ZE6A 3HLYA 5DBIA 2OHXA 3CRMA 2ZT8A 3STUA 4BKUA 3ZHYA 3OZUA 4YJDA 4F5WA 5IKXA 1IULA 1EJBA 1CF2O 4AQYB 3HYLA 1M1YB 1NFQA 4RSGA 1VJTA 5EEHA 3RIYA 2P35A 3ZQ6A 3AR3A 3M8KA 4Z7OB 3LYUA 1W29A 1YMUA 4MRMA 1ORDA 2J3KA 1F6WA 1RHKA 1XAJA 4NR0A 3K5HA 4PQEA 2DUNA 4MVJF 2XGJA 3MMZA 4RF5A 3UMCA 1AX9A 4EHNA 2ERYA 3NT2A 3FI0A 4WFQA 4QSHA 1MCZA 4D4GA 4JCCA 1HH4A 1U0LA 4WN9B 1V25A 4FKBA 4ZICA 5JR3A 3D6FA 3GQVA 4F5DA 4R41A 3P27A 4LV6A 5M2QA 4QU0A 1KIMA 2RGNC 4QBKA 1VE9A 2J5XA 4QYSA 2FKAA 2PO5A 2WZBA 1F4PA 1BS9A 1P7CA 3AWDA 3UMFA 1XJ5A 1RC0A 1ZJJA 4DNQA 4OP1A 2HA4A 2XYVA 3DOJA 2OV8A 3C6KA 2HNBA 4GOJA 3ZBPA 1LS6A 4QUHA 3F5QA 4U3JA 1UM9A 5MFZA 3EZFA 3DZDA 5H83A 3WWZA 3OIUA 2C1EA 4WKPA 4WZAE 5J2TA 1NBMA 2ZJBA 3AHGA 1QG2A 3JS5A 5H3LA 1TJ4A 3QMVA 4PSAA 1UFOA 4BEBA 2PGNA 2WTMA 2V8BA 3OEED 5ICSA 3O95A 1A8SA 1GNLA 2QN6A 3FGOA 3JRXA 2DBZA 4M9XA 2XEXA 1F0KA 4YLYA 5J2UF 4HAVA 5I4CA 5CT5A 5FBWB 2BTOA 1Z74A 2XDAA 3CKKA 4KJZA 1NP3A 1DJNA 2V7XA 3N2ZB 3QXHA 1BE0A 3PZBA 1PR0A 1XTBA 1RP7A 3C8ZA 2OZVA 3SF8A 3VDXA 2F59A 4IJMA 4RUKA 5L4NA 2RDMA 2QORA 4DUPA 2RAVA 2Y0CA 2AN5A 3H65A 4FIZA 1KXJA 1E6CA 2A9OA 3TOVA 3ZYCA 1CUCA 1FSGA 1U90A 2M32A 4OJTA 1OU0A 3A9VA 2A3NA 4HQ0A 2EF0A 4OUKX 3RW9A 5KJCA 5EE3A 4NDNE 3PLAE 2WM8A 4LQDA 1A9QA 2UKDA 1I3CA 5LZ8A 4RY0A 1WW8A 1RJ9B 4YPVA 3OIVA 4DV5B 3AJ8A 2IW3A 3KWMA 3EPJA 1GXSA 2ZSUA 5JBIA 2GGSA 2IE8A 1ST3A 2DFDA 3FVQA 4PYQA 1N32B 3ZGNA 3L07A 4R5MA 2GEVA 3EGXA 4KZPA 2PXCA 5EXXA 1N2ZA 3NV7A 1AKMA 3KLOA 4E51A 3IUYA 4M9ZA 3M83A 4Y1RB 3BG5A 4MGEA 3R0VA 1DBRA 1M7GA 4OKNA 4YALA 3GRCA 3RRZA 4CNBA 4JEMA 3OJLA 1L4BA 1JAIA 1OU4A 4PN7A 2N1MA 4ZOCA 5FWAA 1QCYA 3EUWA 3KJNA 2DFNA 3RBXA 1L7EA 3AI7A 4WIAA 1RBMA 3O4JA 1CE8A 2QJTA 1C14A 3C5CA 1OKKA 2ZJFA 3EDQA 2ZUTA 4ARSA 4PC2A 5K20A 5BN1A 3BSWA 1ISSA 2Z8YA 2BH9A 4ZT4A 1G5IA 4UD6A 4EMTA 2CJWB 4TLAA 2QMUA 5H9WA 1D4OA 1E79A 4RELA 2PH7A 1XMOB 1E8NA 4KVAA 1K98A 3FNGA 4HQRA 3QBDA 4IMJB 3R0JA 4BNUA 5EQFA 1F5SA 1B7GO 3E3LA 3LVRE 4PLYA 1OUMA 4TS1A 4IJVA 1V4BA 4LBYA 3JARA 1XJCA 2BFDA 4R54A 5A6SB 2OLKA 2IY9A 1RKQA 2IBMA 5KYKA 2JFVA 2UZ0A 4P3OA 1NZFA 2GH1A 2N1BA 3IT2A 4G8DA 1QORA 4K9MA 1X15A 3SHOA 3A8TA 3U1BA 2OMKA 1PL6A 4WFJA 4YONB 5FO0A 4Q12A 3MTAA 1A2BA 3VV2A 3FKJA 1RMYA 2PXAA 2P2CA 2J4DA 4WCVA 4D80A 4DUGD 1WBDA 3AKYA 3I6ZA 1DJPA 1ZUWA 4Y0AA 3ZW8A 4DV3B 3S7ZA 3NHKA 1BIFA 5F7OA 4XD7A 3G49A 3QFRA 3AHHA 3BJRA 4UBNA 1TC2A 3T3NA 3P9KA 5ECGC 4RZ3A 1PLJA 2V0CA 4IOMA 1LLDA 3G9UA 5CNJA 5FNVF 1T0HB 3R9XA 3FETA 3FUUA 4ZOLB 2QD4A 3OF5A 5G1NA 4JI7B 1KVUA 2VFAA 5GY7A 1DEOA 1K7SN 2JFGA 2VYCA 3T1TA 1KY2A 1GDTA 4B3TB 3BH0A 1P6QA 4LWPA 3M4XA 3HUDA 1HSOA 4KMRA 1MNAA 1ZITA 4W5QA 1E2IA 3PGA1 1YASA 4K8RB 2AYZA 2JFOA 3P1JA 3RADC 1NAHA 2P1DA 4IVQA 3N8HA 3QMWA 4QWWA 2DBYA 3JAKB 3OZFA 1QB8A 1KP3A 1T15A 2B7BA 1B15A 2DZDA 2IP1A 1Z62A 2YNMC 3FPSA 3H6HA 3Q9SA 4UJ3A 5CW2A 3W6NA 2XMCA 1IN1A 2W6OA 3EFOA 4ZAFA 3WQRA 2P5TB 4FYKA 3HP7A 3K9WA 1BDIA 4OHPA 1QMPA 2GZMA 5T3YA 4Y0VA 1R0BA 3A1WA 4ENSA 1AF4A 3U5TA 4KXXA 3VAYA 4ATNA 1NJFA 4Q7MB 2VBIA 4UUBA 3BE8A 4O5OA 4WZBE 4MR7A 1PS0A 4PHHA 3S8EA 1OXXK 1JQ3A 4UNIA 5CBPB 3K35A 4X91A 3OP4A 1B8UA 1Q0ZA 1UMDB 3MBIA 1QLJA 1PNVA 2F1HA 2QL5A 1DV2A 1L6RA 4FFOA 2ENUA 3WK5A 5DWQA 1XZMA 2LDXA 1PTKA 1K9VF 2I62A 2XE4A 1YJXA 2Y77A 3CIFA 5AI9A 1KK0A 3INGA 1UDXA 3G59A 1ISHA 3LDAA 3BXGA 3Q98A 1PUXA 1Q1NA 1QIGA 2QJWA 3GFPA 3MCAA 5DWDA 4M46A 4PIVA 4ZODA 2IV2X 3RREA 5CJJA 1JILA 4DMKA 1M10A 1MG0A 2CVOA 1TUBB 3VR5D 4Q01A 3K70D 1CUJA 1R4NB 2C29D 2JLQA 1QE5A 2ZYUX 2Y1LA 3E3MA 1KPHA 1WHSB 1PG2A 3WADA 3DWFA 2I4LA 3ZU4A 5KKCA 4DAEA 3A1NA 4MUIA 2OAP1 3QTLA 4LVUA 4E5UA 3HCDA 3ZWPA 1GGHA 3A4MA 3F3MA 3TB6A 3C3AA 2NXCA 3I52A 1LWOA 4TUYA 4WSOA 1HKHA 4J7AA 2FPKA 4O33A 4ZOBA 3IEKA 1T8YA 4IO0A 3SM9A 1X70A 1VBFA 2G5PA 2YVAA 4G5FA 3UWSA 3WL8A 1YRHA 1QRAA 4OJNA 3HSSA 4K40A 4MV5A 2WICA 3BZUA 1Z25A 1NQXA 4YJ2B 3G5TA 3JY6A 2IBSA 4MRPA 4BLPA 2B92A 1ZXBA 3IUNA 1COWA 3MOGA 3MVEA 3RUEA 3W2FA 5E3HA 3VR4D 3UT5A 3WGOA 1GPLA 4UFPA 3VVBA 4FFBA 2FPSA 4WVFA 4I0WB 1R0YA 2AMLA 4B3XA 4F2DA 5B7QA 5C5DA 5L7WA 1D7OA 4XGIA 3RT7A 2JHFA 2ZKLA 3U49A 1GPAA 4NKRA 4KQHA 2R8YA 2XI4A 1LDYA 1R5BA 3QBJA 5GZ6A 5JANA 3VU9B 1C7ZA 1LVUA 2J48A 1PIWA 5IC6A 1QTRA 2PZ8A 2DPXA 3HZOA 1UBJS 3GUVA 1WXGA 3EEIA 1M1ZA 3GLHB 3IIJA 1ZNZA 4NBUA 3CF2A 4BTVA 3W9SA 3Q87B 4EO7A 1P2BA 3PNQA 4FSDA 4D3ZA 5CDUA 5C8YA 4U6SA 3LBAA 1OZHA 5B36A 4X1KA 4U7DA 3HL0A 2ZYSA 1Z34A 2W70A 3C43A 1DDOA 5DHAA 4LTNA 2GYWA 4FHEA 4NE2A 4DSZA 3FCYA 1FNBA 1L1EA 3NRBA 4QWMA 2M6LA 4LHEA 2XWQA 2AWOA 2XIQA 3W6ZA 4JKOA 4YCDA 5MN4A 1GNQA 3LP5A 8GPBA 4ZANA 3COWA 4KV7A 4C14A 1EYZA 5HXAA 2FR1A 4AU1A 4DILA 5KQMA 1ZD9A 2ZBUA 4AJ1A 5KHLB 1DAMA 2W6CX 5J59A 1FVOA 4AJKA 4TV9F 5EJ2A 1XWFA 3D8HA 1EVKA 4J7CA 1ZMXA 3WAGA 3CO5A 3SKXA 3UOAB 2N3ZA 1FSZA 3B9RA 4Z54A 1GTMA 1F2TA 2AL7A 4OFZA 4U2EA 5GOTA 2CWWA 2I6SA 5ALHA 5EC8A 3VAAA 3BRWA 1HQCA 1CZLA 3FCXA 4FILA 5G53C 2WZCA 4DV2B 1Z17A 1RHJA 3ZIAA 1AUPA 4KO3S 3OTWA 1XLTA 1H5QA 1WPGA 4TLCA 3T7TA 1HT2E 4CHTA 1Y3BE 2HMUA 3PNYA 5A3VA 1GQFA 5ESRA 2ENWA 2QRGA 3HKDA 3A0RB 4P0TA 5ANRB 4WOJA 3UMBA 4YT5A 4KMOA 5BN3A 4YX9A 1R8YA 3BK2A 3G2KA 5CLIA 5J2TF 2Q8NA 4AB1A 1H1DA 4CIVA 5FTJA 4XGRA 4F3NA 1N0UA 1U9IC 2G09A 4PG4A 4G0PA 4A03A 4BRZA 5BR7A 2D74A 1Y5LA 1KOJA 5T8KC 4ALIA 3ER6A 4B6OA 4C7XA 3GLFA 4GZ3A 3K92A 4G9GA 1UPTA 2AEFA 4R2HA 1Z06A 2CMGA 2NSLA 4IPTA 3TIVA 5HQTA 4KX3A 1WMFA 4L5IA 3L1VA 2VJNA 1PR9A 1U2GC 2GK3A 1GCIA 3PWTA 2QTAA 4A0GA 4BGEA 2BD0A 2E49A 5BVGB 2H2FA 4IDHA 3T12A 2JAOA 2DYKA 3L1HA 1G8GA 4QPZA 1KDZA 4H7KA 1GAXA 4P93A 3CCFA 1NUUA 3IQGX 1KDYA 3AX6A 3BDAA 3QVKA 2BMDA 3ZUGA 1CT9A 1U1CA 5FR2A 2LGJA 1Q0UA 3KYCA 3PQ7A 1W36D 1Z4LA 2H18A 3LHFA 3KQTA 2Z9DA 3MW8A 4YAUA 3CVVA 2FRDA 1RXUA 2H0AA 2XBUA 3DEHA 2QRQA 2JJ8A 4WKNA 1GZDA 2PJDA 3HCCA 1KZGB 1J2RA 2D1QA 2Y1DA 3LBIA 2BKUA 1LLFA 3GBVA 4FR2A 5EJAA 1Q3KA 4D0NA 5CAEA 2E4UA 4H1TA 5B12A 3HB4X 3L06A 4KR9A 4CW7A 1R2QA 2L17A 2QN3A 3EB9A 2AW5A 3BGVA 1JFRA 2AK2A 2IXAA 2YYAA 1TZJA 1RLOA 1S8AA 1VE3A 1JQLB