3EDQA

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edqA00
4JJ7A 2C2OA 2XYGA 3UO8B 1IBCA 3BIJA 4HQRA 4JJEA 1I4OA 3H1PA 4IYRA 4FGUA 2CNNA 5IBCA 3R7BA 4ZVTA 5IC4A 1RHRA 1RWXA 2CNLA 4QUIA 4ZVSA 3OD5A 4QU5A 1RWWA 4ZVOA 4I1PA 4PRZA 4N5DA 5IAGA 4QUDA 1ICEA 1RWOA 2QL7A 4FXOA 2QLBA 4NOMA 3GJSA 4QUGA 1RE1A 4ZVQA 5JFTA 2HBYA 2H4WA 4EHLA 4DCPA 3PCXA 1I51A 2NN3C 2K7ZA 3GJQA 4EJFA 5IABA 3V4OA 4M9RA 3R7NA 1I4EB 3K7EA 3R5JA 4QULA 4N6NA 4N7MA 1RWMA 5K20A 4ZVRA 1BMQA 4NOJA 1RWVA 3KJNA 3E4CA 3V3KA 2H54A 3SIRA 5LUAA 3R7SA 3R6LA 2Y1LA 1M72A 3ITNA 2H51A 3S8EA 3NKFA 4NOKA 2FP3A 2H48A 4QUEA 3P4UA 4JR2A 3S70A 4D3XA 4EHAA 1RHMA 3V55A 2WDPA 1QX3A 2H5JA 1RHUA 5I9BA 3GJTA 2XZDA 2CJYA 2DKOA 2J32A 3D6HA 2XYHA 3D6MA 3H13A 4HQ0A 1SC4A 4N6GA 3V4LA 5IANA 2J33A 3DEKA 5IAJA 3QNWA 2CDRA 3NS7A 3GJRA 4JQYA 5I9TA 5IC6A 3V6MA 2CNKA 1SC1A 1PYOA 3D6FA 1RWKA 1NMSA 4QU0A 3DEIA 3P45A 4EHHA 3DEJA 4NOLA 4QTYA 4AWAA 1RWNA 2CJXA 1SHJA 2J30A 4JR1A 3DEHA 3SIPA 1GQFA 1NMQA 3PD0A 2H5IA 3IBCA 1I3OA 4QUAA 1JXQA 1SC3A 3R5KA 5IAEA 4PRYA 1QTNA 2H65A 2P2CA 3H11B 5IBRA 5LU8A 1PAUA 2Y0BA 2AR9A 4JR0A 5IARA 4EHDA 3R6GA 5IASA 2C1EA 1RWPA 2QLJA 1F1JA 4DCJA 4NBNA 4AW9A 3EDRA 4QU9A 4EHKA 4NBKA 4QUHA 1NMEA 4AWBA 1F9EA 2FQQA 2H4YA 2XZTA 4LSZA 1SHLA 5H0IA 3UOAB 3NR2A 4JQZA 4QUJA 3KJFA 3PD1A 2QLFA 4EHNA 5LUBA 3V6LA 2HBQA 2CNOA 1NW9B 1RHKA 2QL5A 4QUBA 4IEFB 3H0EA 2C2KA 2C2ZA 3IBFA 4D3YA 4D3ZA 2J31A 4PS0A 1K88A 4ZVPA 3RJMA 2C2MA 1RHQA 3H11A 1RHJA 4DCOA 2HBRA 1K86A 4I1RA 4PS1A 1KMCA 4EHFA 4QTXA 3KJQA 5LU9A 4QU8A 1GFWA 4N6OA 2XYPA 4NBLA 5IBPA 2FUNB 1CVRA 1QDUA 2HBZA 4N7JA 1CP3A 4JB8A 2QL9A 4FDLA 3EDQA 5IAKA 4HVAA 4JJ8A 4ZVUA 4FEAA
chains in the Genus database with same CATH superfamily
1E2BA 1E94E 1YVEI 2HNKA 2PWZA 3ASYA 3TOVA 1OKKA 1NXVA 4KV7A 5DZSA 1XROA 4PF1A 3VR3D 3JATB 1P2FA 3DZJA 4RW0A 1DFHA 1GA6A 2OQVA 2C54A 3LWDA 3FCAA 3TQRA 3B6IA 3ZHCA 5HF6A 4NYIR 3UENA 3WK4A 1UMDA 2JD2A 3HHPA 5DX8A 1A98A 3U9SA 1VLQA 3OZUA 4D44A 4Q00A 3RBVA 4ADSG 2O19A 5IZCC 1E5QA 1BCRA 2XMPA 2CYBA 2X4DA 1N2CB 4C6HA 1VE9A 1ZMOA 3IELA 3ZX5A 4JL5A 2IY7A 1QRUA 4CM5A 1O57A 2AJBA 4Z7OB 4CL2A 3NKLA 4HN9A 3TS1A 2BN4A 1JQJC 3EGWA 1AN9A 1ZCAA 1KIAA 1QHNA 2EKLA 3GDOA 4HDNB 4HXEB 4R1UA 4ALJA 2GBPA 1OWMA 3KZCA 1GKLA 3MFYA 4R9UC 3BE5A 2C07A 4R1QA 3W78A 4PGAA 3LTNC 1CY4A 2OBLA 2PJUA 1U0FA 3CLSD 4J8PA 3NH6A 1AO3A 2VJCA 3NW9A 4NDAA 4P92A 1O2DA 5DHSA 4CODB 4L0DA 2FFJA 4YT8A 1HNXB 3NOOA 4X7MA 3QNUA 2FQ1A 3T9FA 2HB6A 2XGJA 2ZBRA 3DDNA 2GCOB 2VP4A 2QIOA 1EFVA 3C7DB 1U9YA 4I9GA 4LZAA 2G8LA 2NTJA 4UHDA 5C80A 2QYHA 4G0ZA 3QVTA 5KDDA 3TTUA 3UV3A 3DBIA 4IVNA 3WBFA 3S8MA 1KO1A 5GZ1A 4NSNA 2ISQA 4Q9JA 4YO8A 3WL8A 4P7JA 3GLIE 1JEYB 1K5DA 4C88A 3RPEA 3SEZA 4AKEA 1SZPA 2XAUA 3HXMA 3CC8A 2IYEA 4HRXA 4ZRMA 5FBVB 3GA7A 1UJ2A 2QJFA 3ER6A 3NP7A 5H59A 3UB2A 3C24A 5BR1A 4HH1A 5AOCA 1H2BA 1YTLA 5TV2A 3H1GA 2GDJA 1Z2DA 3NBXX 5EXEA 4MWZA 2OM2A 2Q50A 1HDOA 3E22B 3I2GA 4ENQA 5LFAA 2D7DA 1AH2A 3MCZA 4KR3A 3TKYA 3UHAA 3VU0A 1S9HA 3E9MA 4BGVA 4RXMA 4A8PA 4C7OB 2A94A 2AJCA 2DGDA 5IN4A 3USZA 5BVGA 4B3GA 2GAIA 3DO8A 3GZNA 3HY4A 2AB0A 5AI5A 1U1DA 5FBWB 3W77A 3RH0A 1W93A 2XNJA 3HV2A 3ONFA 4NBNA 3E81A 4R2MA 3T1HB 3WMEA 1WCIA 4J1NA 4MUGA 3QXSA 1R4MA 5FOQA 5DSTA 4B84A 4LSZA 4MLPA 5T41A 1UAYA 3PLRA 3R41A 5ALDA 3TSOA 5C5IA 3W04A 1T3GA 3VR5H 4ECEA 2CLSA 1QDLB 2FPXA 1SH7A 1H9AA 2VZ9A 1J1ZA 4WOJA 3ENKA 4I9UA 4O2AB 4OHCA 3DNMA 4ZEXA 3SXUB 5KYGA 1IBKB 1OVMA 2OD9A 3HR8A 4XPZA 16PKA 5LIRA 5AXBA 3QE9Y 1FFXB 2YXNA 4EQZA 1WXHA 3KZNA 2FE1A 3LVQE 3A7DA 1SUIA 3AFMA 3TSWA 4MRMB 4L8FA 2QVBA 1X77A 2VOEA 4BVEA 3U6KA 1H1LB 5IP5A 2FDXA 3JZAA 1PKEA 4N1AA 2YJZA 1X1QA 4H6PA 4IIGA 4BHTA 1BS1A 4C22A 2Z5FA 2BEVB 3OP1A 5CGZA 2QF7A 4Z8YA 3W34A 3QJGA 3ZGNA 4AMYA 4IIEA 4YUWA 3AOEA 3NNNA 1GPMA 1R27A 3GT3A 2PSHA 1KJ8A 1KHTA 3TNJA 1RCUA 3VOAA 4DDTA 4RTPA 5EMNA 5ADVA 3OJ0A 4Y6RA 2JBWA 2Q1UA 2BGNA 3DZFA 3P9YA 3PEWA 2QN7A 1GN8A 1LXCA 1T2DA 1TYEB 2VNJA 1G8KA 4HDKB 4KPUA 4Q03A 4IDEA 4XYMA 5IX8A 1IQRA 3K09A 3KBOA 1CBUA 2YVUA 1I3NA 1PSDA 3A1DA 3F9IA 3DGFC 3I9LA 3LQ4A 2VKTA 3EF3A 4FYPA 4E07A 4MVJD 2FVXA 1ZN2A 4Q39A 2R2AA 4IHKA 4M7PA 3O31A 3DLCA 2MYNA 3VQTA 5MFPA 1WPXA 4HD8A 4DLPA 3P9IA 4IDNA 4UNPA 3DQZA 1M7HA 1WBJB 2I91A 1Y1KE 1OYWA 1RWQA 1T2AA 2QRNA 1DQYA 1PK7A 4EPWA 2VHXA 3A0UA 2JFUA 3A4MA 3RKSA 4L6IA 3ZKWB 2OHGA 2V3CC 3HP1A 1BA2A 2JKVA 4NZPA 1GPJA 1EGHA 3SZGA 1BXRA 4FDAA 1D8AA 4GAEA 3FNRA 2IZ7A 5GOTA 1AA6A 2X0DA 2R1VB 5CX4A 2EYQA 1X1TA 4EI8A 3JQAD 1OBFO 1IIBA 2Z0MA 4CUJA 5HFAA 2F6RA 4QYIA 3QIAA 5HTKA 3N2YA 4XQ9A 4BNUA 1CLUA 2BEKA 2GN0A 2NZ2A 2L19A 2FMUA 2WJAA 1NDQA 3TL2A 3HXKA 3TSZA 2LV8A 4MCAA 3IURA 2DBQA 2WVGA 4MQLA 1WZEA 4RK5A 2GPWA 4UU7A 4CQLB 4QG3A 1JHYA 4G9EA 1XXHE 3UXYA 3VNBA 4CMIB 5B4TA 1DQRA 1RYEA 2AJDA 3ONNA 4XEHA 5FEUA 4KGZA 4F2GA 5JWHA 1J23A 1GTVA 2RK3A 3DW3X 3NGXA 4AG5A 2UYHA 2I54A 3K0SA 2F1RA 2EL9A 2H92A 4UREA 2AZMA 3VH1A 1BGWA 3AR6A 4OFZA 2WTMA 5JY1A 1C2TA 2CN1A 3ETDA 4KKXB 5L4LA 5JROA 1AO0A 4JC0A 3I5AA 5EJIA 1OX4B 3Q2OA 2OK7A 3QBVA 2EKZA 1YVRA 3P4YA 4A82A 1T0JB 3C7AA 2DR2A 3MMPA 5KKAA 2P8JA 3L43A 3ZV6A 5JJCA 3HLKA 3TYXA 4PQFA 4J2OA 1JKJA 2O6HA 1IH8A 2XA1A 3OLWA 1YVPA 2X7XA 3QELA 3FYDA 4G0PA 1UDXA 1AKRA 3PEVA 1RMTA 3JY6A 2P11A 3Q10A 4XIJA 2G9RA 1HE8B 4L4UA 2AD5A 4R7ZA 5LQNA 2MU1A 4E21A 5EQJB 1US8A 5CLJA 2MSWA 1C9DB 4D9IA 3NAQA 4G24A 4MQFB 1EH5A 4CKXA 2VK2A 2YWFA 1I4LD 1O08A 1WTAA 4YJGB 5DI9A 2E89A 4KVFA 4N8EA 1W36D 2OENG 1VHTA 2BTQA 1ACJA 1JW9B 1MLDA 4M0DA 4EHFA 2VPXA 5F9HA 2RGCA 1H5NA 2JJ8A 1JDBC 2HJWA 1G41A 2NT4A 2VDWB 1XWIA 2OKCA 1JDZA 3AR8A 1NBIA 2R8EA 1AKUA 2YS6A 3JSXA 5BNFA 4H9GA 4XVCA 1GARA 1LNSA 2VK4A 3R3VA 4WNAA 5IS2A 2W0MA 3AVOA 1R10A 2V7XA 1CXZA 1Z0KA 1Z6YA 3TIGA 1MQ9A 4BO7A 1XZFA 2DRIA 4K88A 2PNFA 4M8KA 4YHBA 1J07A 2O3TA 4CQJA 2YQZA 1IOLA 2ZYUX 3E70C 1CUAA 4ILKA 1VKNA 1WEHA 2IH4A 1A8UA 1HGXA 3JZFA 1G7CA 3K05A 2BZGA 4WH0A 3K0EA 1ZD4A 4KOEC 3AHFA 2YHIA 4URZR 4Y2HA 1DKRA 1X39A 1ZGZA 4YCBA 2R5FA 3KSZO 3R5HA 3RJZA 3JQDA 1RIIA 1XD2B 4EF5A 4ZOQI 4L3OA 1WOMA 1YC5A 2HSZA 4YAUA 4DR2B 1S5PA 3BXZA 4JYCA 4U7DA 4HNAB 2ZTLA 3KPWA 4Q1BA 2B3TA 2HJ9A 3QMWA 4C78A 2WU3A 3OICA 1A7KA 1J5EB 3WJAA 3IPXA 2F9FA 1CQPA 2P77A 5EVJA 4YJFB 3R9KA 5HG0A 3U2QA 1CUYA 3BWCA 3I37X 3T5DA 3IP5A 5KQMA 2IUTA 4KR2A 1UC4B 3ZXSA 2XR1A 3PX2A 1ZOIA 2FLWA 1XVLA 2ZR8A 1AUQA 1M2VA 4JLWA 1USWA 1VL0A 2ZDQA 1KYQA 1RAGA 1K08A 1Y3AA 3IQGX 5D5PA 1N5IA 5H16A 2ET6A 3B6JA 1NW7A 3I6QA 2P65A 3SOPA 3TBFA 4DUGA 4EHAA 3KLMX 1S2GA 5E3IA 5EAIA 5FBHA 1M67A 4KWEA 1H8EA 3OPNA 1R0ZA 2X9VA 1N7JA 2TMDA 1R6AA 1CRLA 2OCDA 3UAWA 1QZ3A 3DBVO 3JCZA 1LLCA 3KYCA 3BXFA 1MXFA 2BGIA 4TS9A 5BNZA 4JQYA 5A71A 4ESVA 1CYDA 2E4XA 2QW8A 4IUYA 2MR5A 1CETA 3HQ4O 3PA8A 4PWZA 1AOXA 5U4XA 4EKDA 3IUEA 1XK6A 1XMXA 1BN7A 2A9OA 3MG9A 1XLUA 2WYHA 3D6VA 3FFXA 3HFRA 4B31A 4GECA 2XVMA 3HDTA 3S7ZA 5HUJA 2Q0SA 2YV1A 3GRYA 5EUBA 5AWFC 1TMOA 2C3MA 2D00A 2GZMA 4RH1A 1KIFA 5FUWA 3VPSA 5JTTA 3L93A 1CEEA 1GAXA 2EKQA 1GA4A 2O3UA 4BP8A 4F6RA 5EIFA 1V25A 3HXOA 2E0IA 4CDNA 2AD1A 2E37A 3OQJA 2ZTUA 1Z68A 3ETNA 1ORRA 5PNTA 4EYSA 3HJUA 4DMGA 1NYTA 4XIGS 3EODA 2G80A 4QQNA 1SIUA 4XGQA 5TARA 1DX6A 2DX7A 5B58T 4E15A 2PX5A 1XCLA 2Q4TA 2WV7A 3MT9A 1JLMA 4B4OA 4HGRA 3VGJA 2CHVA 4IIVA 5LLTA 3L4KA 1E1CB 2XAAA 3D3WA 4P5EA 1IN7A 1P4RA 2C1XA 2C88A 1DT3A 3NR2A 4G8DA 1HORA 1TAGA 3KJFA 3ZWOA 2AKYA 2D6FA 1P7WA 1KAEA 3GLFE 3IUMA 3SR0A 3P96A 4KYVA 4MA5A 3T9DA 1PJRA 2ZBQA 1JHPA 4R1LA 3CM0A 3F4LA 1JPJA 3QEAZ 2O07A 3BK7A 4M38A 1Y3FE 2ZRLA 4K8RB 3ES9A 1QK4A 2A8YA 1TF7A 4K5QA 4EJ0A 2LCFA 2XJ9A 2ZBEA 4MR7B 4MWEA 5G4LA 4OXIA 3OQBA 3QF4A 4P34A 4W8OA 5IYZB 1W85B 5EWMB 2P7HA 4UAJA 4KIJA 5TJ9A 3KKNA 2UV8A 4MZDA 2WJJA 1MNQA 4HWPA 4JJ7A 1LUAA 4L5IA 4XSHA 1C1HA 4LDNA 2KW5A 5FOVA 1CY7A 4QIHA 2QR3A 4UUNA 4CM8A 4E3WA 2VZLA 2DETA 4JDPA 3CZPA 3EXG2 4I9NA 1CVIA 1NNSA 2PGAA 4GR4A 5JTUA 1Q2XA 5JYEA 4FZRA 2W2OA 3OOJA 3I05A 5T3YA 2JRCA 2CF6A 1LLQA 2ATXA 4JKOA 2JFWA 2CDCA 4IJQA 1G4UR 3MGAA 4EHLA 1FNDA 3KSBC 8ATCA 3T3IA 1ZP6A 1GGFA 3FHJA 4OHRA 1LQ2A 2HCBA 2P0AA 3G9ZA 2PUFA 1NN0A 3T9AA 1UFQA 5ED4A 2GEKA 4PWYA 3QEMB 3U4GA 3B1YA 3ZY5A 3PLAE 4N76A 1KWGA 1S8OA 3EA4A 1J90A 1JV2B 3IQXA 4RK4A 1KDOA 3QFTA 2BKEA 4W9NC 3FOCA 1UC8A 1YA8A 2FW7A 3MF4A 4NG4A 5J43A 5J4LA 1SCQA 4N65A 2FSGA 3A9WA 2H1WA 3TNDA 3GLSA 3IRUA 4ZYWA 3N87A 2VZEA 1TK9A 2R8RA 1B3BA 3CURA 2DBZA 4OFBA 3GEDA 1MU0A 3OF5A 1UFRA 2FPLA 1RAFA 4B4UA 5IK2A 3E8MA 4CIVA 1C0KA 3H83A 1RT9A 5IVKA 3D6HA 4CEIB 4HQ0A 3CNOA 3LQQA 2EXXA 3UXMA 3TLMA 1SUEA 2BOVA 2R48A 4EG6A 3FOAA 4BXOA 4CI9A 1LPMA 2H7XA 1E9BA 3KUDA 2D2IA 3L1HA 3R0VA 3PDIA 5DYIA 2I62A 1C7IA 4FXPA 4AN4A 1R7RA 2CEKA 5I7WA 4N4AA 4HNUA 2DBRA 4OX9B 4WV3A 1BWSA 4ZJPA 4GBED 1V6CA 1JHRA 2N46A 3VI4B 5DCYA 3BAZA 3JAKA 4V1CI 1FSSA 4EITA 3LPCA 2IPLA 1QUEA 3MBKA 4UXHA 3SX4A 1HURA 1UEXC 2CHQA 3NAGA 2H4JA 1XTVA 4KO4S 1JHMA 2J46A 3IO3A 4PCVA 1W8IA 1VLHA 5ALPA 3E7DA 4LZWA 3K0AB 1R6UA 4FJ1A 1JPNA 2IYLD 4L72A 3QM1A 4RTSA 5I7EA 3DWGA 4HDNA 3KUUA 4FIZA 1JR3E 2GWHA 2Y1WA 4BKRA 2WWYA 1GZVA 4KPFC 4YWJA 2EJCA 3S1LA 5BVHA 3RT9A 1AZTA 5JYBA 5LWQA 2OFPA 3KFLA 3L79A 2GJAA 3VH2A 3KOMA 1FP4B 4D8YA 5LQUA 3P2YA 3F9RA 4Z5XA 1KRHA 1DS6A 1WHSA 5E0KB 1CR0A 3NC1C 3W9BA 1XQ6A 2BJWA 3H9GA 4Q3DA 3ZV3A 5L3SA 3R9WA 3GEGA 4UU1A 1VSBA 3PC3A 3SQOA 3DB1A 2WQ6A 1YKGA 2RH5A 4MKRA 1QKIA 4R0MA 1D0SA 3QPWA 4KH1A 3ENQA 2WVAA 2DB3A 2V96A 3NV9A 4F1KA 3SM3A 1D9XA 3OTIA 3SHOA 2WMDA 4C0LA 3PHCA 1J2UA 3N2LA 4LOHA 4H6VA 3NNSA 1BX1A 4PIVA 5LXTB 5KX5A 4CTNA 4IYJA 1I7QB 1FU8A 5B3LA 4BMCA 4C4XA 3C5WP 4XM1A 5T8KA 3QWFA 5GGXA 4YAIA 3PGLA 2FFQA 2AHOA 4S35A 3WI7A 3C41J 2AJLI 2BGLA 2JCXA 4J2TA 2QGZA 3OE1A 3PB3A 2G71A 4YXWD 3U3DA 4JI8B 2K2QB 1RE1A 3GFOA 2UUOA 2B20A 3GEMA 4BZZA 1CUFA 3HZZA 1PJLA 4DCPA 1BE6A 3RFVA 4RFVA 3F4KA 3H99A 4BO8A 5A06A 1WUJS 5ESXA 4WE3A 2OCBA 1DX4A 5F77A 4YH1A 4NBWA 5ESWA 5K3FA 3U80A 4B87A 1ATIA 3IH5A 1VKJA 2V7PA 3PGA1 2FF5A 3C4VA 2R96A 2VT7A 1ISFA 1CJMA 3Q7EA 3TZHA 1Q95A 4BAUA 4TN1A 3W6UA 2I34A 1C8VB 2MSKA 3FDZA 1XTSA 3CW8X 3FMFA 1EHIA 2BFDB 2J0UB 2QTVB 3NTOA 5DW3A 4JI3B 3UG6A 4OFXA 4KR7A 2DY0A 4Y1RB 2P9TA 1O03A 4HXFB 4YJ2A 2P9ZA 4YC7A 2HNBA 4Y0NA 5F52A 4BNZA 1R4NB 2KWIA 5T7BA 4LDZA 1R9NA 1Z26A 2BM9A 3PJDA 5H7XA 2DF8A 1YRWA 4IQ0A 1G20A 4Y30A 4ZRDA 2F7SA 1OMOA 4QYWA 3S2SA 2RJNA 1FW8A 3GEHA 1F8FA 3OO1A 3UB3A 3QVMA 4B3DA 1T4BA 1WP9A 1I6LA 4HNRA 3TLYA 1H66A 1VJTA 3O4HA 4XX0B 3VDMA 2IXBA 5DW0A 4UOEA 1I0ZA 1N3YA 1N3LA 4ZCIA 1Q0RA 5B58C 3VPFA 5FKJA 2I7DA 2EEZA 4GI1A 5A3RA 1TDJA 3BHNA 1OKKD 2QXYA 4XE5A 2WHRA 3FLEA 3NDBB 1JG3A 3CVWA 1GQSA 5A4FS 3NM6B 3JQ7A 3FXAA 1LI7A 3ETEA 3GW8A 1M8JA 5H02A 5C34B 4E70A 1E3MA 1MC8A 2H17A 1TOAA 3O90A 4LSWA 3LOQA 1AHHA 3K0KA 4ISBA 5KNBH 3V32A 2A9FA 2EFYA 4RHTA 1GUYA 1MB4A 2FG7C 3G82C 3BICA 4NE7A 3ZNOA 2B94A 4AY5A 3PFNA 2XBUA 1KS2A 1N2ZA 2BFFA 2FTKE 3DXFA 1L7AA 2ZCJA 1Q0TA 1TB4A 4JMLA 2Q8QA 3Q2KA 3AR2A 4EHDA 4M46A 2QN8A 3CF6R 4GPEA 2WWVD 2JLSA 1CRZA 4O8ZA 5ALIA 1FS4A 3FBWA 4LCBA 3TLGB 4NZNA 4B2PA 4ND5A 3GLGE 4OLAA 3BZBA 4WESB 3GIDA 2JC3A 5CT5A 5AVKA 2HEGA 1Q1EA 1U8ZA 3I3SR 4YT2A 4QGHA 5KNBD 4QQKA 4UHJA 1DBVO 3VZQA 2VTDA 3M4NA 1POXA 1J24A 1KBOA 2RB5A 1QGOA 3HB4X 1OD6A 3MJFA 3O4VA 3DNFA 1ZZGA 2JI8A 5EZ6B 3WLTA 1BS2A 3PDIB 4I8DA 3UGTA 5C7OO 2JZNA 3TAUA 1CRPA 3KB8A 4PGMA 2NZXA 5ADUS 2VCHA 3F9CA 4I6EA 3I64A 4ER7A 5LQDA 3A26A 3HEAA 4RD0A 1I4TD 1M2OA 4G56A 4K2AA 2G5CA 2HM7A 3NNDA 4LOKA 3SQNA 4AUNA 2CCGA 4NNJA 5LOVF 4POOA 2YN2A 1EFHA 3JQQA 3OT1B 5IAKA 1SRQA 4K9QA 4W5WA 4P4SB 5HOQA 2FJUA 4U6QA 4BNDB 3OLCX 4HWKA 4XASA 5CCBA 4HAXA 2XVXA 4ZOAA 2XMBA 1QR6A 5LDGA 3GLRA 4I08A 2RE8A 3H1PA 2GF2A 3MHTA 1VJCA 2Q9CA 3FF1A 3TDKA 5HDBB 3P0HA 4LF4B 4EUKA 4X6UA 1YL7A 3WK7A 1ZUWA 4NABA 4CKCB 3RE1A 3WGLA 2VBIA 2R6JA 4PBSA 3UJ8A 1AKQA 1Z34A 2V74B 3E1SA 1SXJC 4K9RA 2OHHA 1KYTA 2GPYA 2HU5A 3E05A 2HA3A 4H0CA 2IW1A 3RT7A 1PDWA 3MSCA 5SYNA 3W3AH 1EA7A 3VZDA 1A0OA 2HV8A 2I1VB 2PSJA 1XZEA 3I6YA 5B4UA 3G2KA 1ISSA 4Z0NA 5H4HA 1BTOA 2YN0A 3H4MA 4OP3A 4WDRA 4X54A 3R7SA 4YJKA 4MI6A 3FHLA 4QTTB 3E35A 3AM4A 3QA9A 4JBLA 3AB7A 1CUDA 4TMXA 5JI2E 2LNDA 3IMGA 4YIHA 2G6BA 3ESRA 2GDZA 4RKRA 4E5VA 4EGAA 2JHGA 1ZA2A 5E6SA 2H5JA 3D4NA 4ZDJA 3U7EB 4AJPA 4ZI3A 1HXHA 1T5TA 2GASA 2RCNA 2ZBDA 4Z4CA 5B1YA 1J2JA 2A4KA 4R31A 4INPA 1NUTA 2R3SA 4CMEA 2FZWA 3H8SA 4M1KA 4B3XA 1RI2A 4CEHB 3RF6A 2H2IA 3AL2A 1U2EA 2JLQA 2QB5A 3PRYA 1MO4A 4IG4A 4N3GA 4DVGA 4FT4A 2PYIA 2VG8A 3NHRA 3I1YA 4ZQGA 2F55A 5FWDA 4PXYA 1JBQA 2EFJA 2Q1SA 1YT5A 2OCYC 3FJYA 4PZEA 3MILA 1O4VA 3U40A 1G5HA 1MJHA 2FOLA 4XQGA 2NLOA 5J59A 4J3FA 3MTAA 4OXXA 4R2KA 1IY8A 2WY2D 1VCHA 3TUIC 2OZPA 3QW4B 2OG1A 2CXUA 1J39A 3FWPA 3MMSA 3OQHA 4J3JA 4ML3A 4XUEA 5WRFA 1QUFA 1VHQA 4AS2A 5JCJD 2XA2A 3O5AA 1QRDA 3CBQA 2QTVA 4XWTA 4E7OA 3V4RA 3TXXA 1X8LA 1Z5OA 4BNGA 4B3SB 3UUWA 2J41A 2HLPA 4Z99A 2JLYA 3EIOA 4AJ4A 3SR3A 1JBKA 3MGCA 5KDLA 2Q5IA 2B25A 3KKOA 4MVJI 3KSDO 4BTLA 2AS0A 1SQSA 4WN9B 5GGYA 4E51A 4ZEMA 1PV2A 2UYGA 5H0IA 3IAM6 4UBOA 2ZIZA 1WVMA 5COBA 2O2EA 2VJQA 3GN2A 4U2FA 4UQPA 4YPVA 1JU4A 1L4UA 3BMNB 4R7GA 2CUNA 1P9RA 4IEFB 2C2GA 4ITVA 4QEZA 3RT1A 3SBDA 4EBFA 5L51A 1DEAA 2GESA 1QU2A 4HQFA 1LB1B 4LTDA 4K86A 3Q8KA 4Z53A 2C2MA 2ZYWX 3EULA 2J7PD 3H11A 3WLRA 3ADDA 3ETHA 2LCQA 3HLYA 4YUVA 3R77A 4JBIA 4OBBA 4REQB 5REQB 4C06A 4X8HA 5B55A 3L7AA 3GGCA 3HRHA 1G1AA 1QDUA 4O4IA 4TYMA 3WYDA 4BE7B 2CXHA 2OD7A 4K26A 4EMBA 1JHVA 3FYUC 1FP1D 2KBEA 4WRRA 5AUQA 4AXBA 3GNSA 4IIHA 1NXXA 2IW3A 5HA5A 5LC1A 3TEJA 1NBMA 3H8VA 4GP6A 4G37A 1YRHA 4WK0B 2V3WA 1VC2A 1HX7A 3WFJA 4BMSA 1JR3D 2BFEB 1NQXA 3ZWVA 1P2VA 2NU6B 4M9ZA 3ZZ1A 1SZJG 2HDOA 2AH5A 4BRSA 2VF5X 2AIRA 3UCXA 4KGDA 3M6VA 1A7AA 1O8BA 3QWIA 4HZIA 1XCPA 3S7TA 2OK8A 3AIIA 3DMTA 5HKAA 2CLEB 4AB1A 3ZCUA 3IDQA 4GOLD 4V0LA 1CPYA 3ZZ0A 2GM5A 1KZYC 4AJJA 4OHVA 4OHPA 3TJRA 1ZD5A 2ISCA 2LD4A 2HA5A 4PAOA 1QIJA 5J1TB 4E2YA 4C2UA 2ZG6A 3CX4A 1FYXA 3LA8A 3QPUA 4IXNA 4R9NA 3I6IA 4Z7NB 4DDUA 1L3BA 2QS9A 3K6SB 1T9AA 4FFNA 4GGMX 2XEXA 4OA5A 1A9XB 2CYCA 3DE2X 4C4ZA 4LRUA 3MJSA 4EF4A 1DAKA 3H9BA 4HQ6A 2EL7A 4MVYA 4CMKA 4FX5A 2PKYX 4HYEA 2X5OA 4F3RA 3EGXB 2NQ8A 4GZLA 4HNTA 4BTVA 1D2GA 1JZTA 2YXBA 2C9OA 4J43A 1RKUA 2X9NA 1GSHA 4WOCA 5GWXA 1K27A 2A5GA 3I9OA 5ARBA 2H4XA 5JYDA 5JISA 1D8TA 3C5HA 3CRZA 1HRDA 4YI5A 3WB2A 1B23P 2HCJB 1AIPA 3VR3A 1UP7A 1K3UB 3SS8A 3SNHA 3QEMA 4BLPA 4H3HB 4JUDX 1SC6A 1NMXA 2DWPA 2O0KA 1OPXA 5BW5A 4TWIA 2PT9A 3FCXA 3ZDEA 1U1FA 5KNCD 5H82A 4TLBA 1JALA 5C31A 5H4GA 1KMQA 1UOPA 2GBCA 3NIBA 4IIJA 3IPAA 2VP6A 2XB6A 1OLUB 1G0NA 3LGAA 3NJ8A 4NRDA 1A77A 2DWOA 5AOAA 4ZT6A 3ZZMA 2ECFA 2RHBA 5JZBA 3UJNA 3RSSA 1XHLA 1YB4A 3GGGA 4L2IB 3N7UA 1JS1X 2MT9A 3RUCA 1SK9A 1BH2A 2C94A 2ZQZA 1I3OA 2OHOA 3WL7A 3KPJA 3OIWA 1NNLA 4V1CB 2FPIA 3JYHA 4YRRA 1V4BA 1AM4D 1CUEA 4OO3A 1PCXA 2VHWA 2Y0BA 4TRMA 3ZJTA 1YIAA 2XX3A 1YRLA 3JWGA 2PZLA 4HDQB 5CDFE 3R8XA 4KDCA 1COZA 4Y2YA 1LQUA 2QLNA 1GZ4A 1MD9A 4MI1A 3LSYA 2XGSA 2PMEA 2PZFA 3FTQA 1EDZA 2J3MA 5F33A 3NC0C 1JQEA 3Q2IA 1SCJA 4N9QA 5EGNA 4BASA 4BL5A 2GTHA 4H1VA 4KEAA 1MC1A 2WT9A 3IVRA 2C5LA 1OLXA 3Q0EA 2SHKA 1P1RA 1HNZB 1E3SA 1V11B 5CDYA 4CEHA 3AU8A 1DUVG 2ZS8A 3EAGA 5BWBA 1JMKC 2PCJA 2XYVA 3FGNA 2UXCB 4PGGA 5C5CA 2IPAB 4K87A 1TW2A 1KDPA 4N5HX 1VL5A 1DQSA 1EEXB 2OLJA 4E5SA 4E31A 3PFWO 1NVGA 1ZRHA 4L78A 2VF2A 1AMNA 5ALNA 3QVJA 1W4BA 3GCDA 1QP8A 2C97A 3E9RA 4MQ4A 1JG7A 1M83A 1FEZA 1RQLA 2WYVA 4PCLA 3U3JA 3AOEC 3OX3A 4I1OA 4N54A 5TF4A 4UBNA 3CH6A 3WIUA 5AOBA 2AFRA 2JGRA 5E8JA 4OX9Y 4BEJA 3EPHA 4IIYA 3BWMA 3UH1A 3CRRA 3Q7SA 3F7OA 4E88A 1Z13A 2Z8ZA 1QFMA 3KVNA 4DV3B 3T4XA 1M76A 2G5PA 4TQAA 4FGJA 4PQGA 4NCJA 3EZ9A 1IATA 4G26A 1XCBA 4I66A 5D7BA 1FXWA 3I9KA 3EVBA 3NTXA 4LI3X 2W6JD 1U5CA 4NOMA 4PCUA 4XB6B 1IN4A 2I65A 4UD2A 2QV7A 5F64A 1W35A 2G09A 2OYSA 2VTBB 2IEDA 1RQXA 1DUIA 3AR4A 1E61A 1I4EB 2NNWB 3TJZA 3JYQA 3A1TA 3AIMA 4BNHA 1XNRB 3QFFA 1GRVA 4U4AA 4WEQA 3T5CA 4WIAA 5F7XA 4PSDA 3O2SB 2G5TA 1ZI9A 4BZXA 3MTIA 3PQCA 3QXCA 5J23A 3PQ4A 1V45E 4YK7A 2GZRA 3EQ2A 3HU2A 3HA2A 4FMBB 4I4TA 1YB7A 2UUPA 3CRW1 3IUNA 5JQWA 2ILVA 1TUBA 3U09A 4FCTA 4M9SA 3WP1B 3NCHA 4HEJA 3RTGA 1YFJA 3LUHA 2GA9A 1I6MA 4U9HS 4CKYA 2O0HA 4BCDA 1Y7TA 1SU6A 1RBMA 2JZCA 3KWMA 4NCIA 3D8SA 1NV9A 3B3AA 5L3SB 2W48A 1QH8B 1DWQA 4DIMA 1KFCB 2IYZA 4D0NA 2IU3A 3G0OA 3T0FA 1TPZA 5KSOA 2RK6A 3IJEB 3AFIA 4LJAA 3NMUF 2ZB4A 4K9KA 3T1YB 5LD2B 2O5VA 1Y6FA 3ZU2A 2PGXA 2UXBB 4KMSA 4PQYA 1MVNA 4BQNA 5JEEA 5ERYA 2ZI5A 3PG5A 3SYTA 4TL9A 4R1TA 5H81A 3CY6A 4H18A 1RACA 4GPD1 1G3MA 3DULA 4YRCA 5J2TA 2BKAA 1EE2A 3DO5A 3GEBA 3PNBA 5D6OA 3L8MA 1T36B 5GZ6A 3PP8A 5IKMA 1JLKA 3UHJA 4TN5A 2QUJA 4QUAA 4RHEA 5CB4B 4N9WA 4LJ9A 3UWKA 4H4EA 1Y1RA 3KPVA 4JI5B 4MIKA 1QHGA 3BJEA 3TW4A 1U94A 3AHJA 3JRXA 4ZQBA 2NMVA 1LLFA 1TJ5A 4R0VA 2UVDA 3OU7A 1F1JA 3DMRA 1XDWA 1GTL1 3L04A 3OQIB 2Q8PA 4NTZA 4JJIA 5C1OA 2B35A 3ONEA 4BNNA 2OCKA 1IB0A 3QG1A 3QOWA 4CBVA 3UAVA 3HJHA 2O8FB 3LFUA 1DJPA 1DQPA 4DM7A 1U90A 3VVLA 2XB8A 1LV8A 3GFQA 1TA9A 4CT4B 4MAMA 4R3UC 1EJBA 3LT0A 3UTDA 2K5UA 1NDUA 1WDKA 4OXNA 1JR3A 1OILA 2BC9A 2DM6A 4UVHA 3RVDA 4FFBA 1PJ2A 3N5CA 4IPTA 4LQDA 3ESDA 3KX2A 3R7FA 5BPFA 2CLKB 1ZICA 1M1YA 1Z47A 5TS2A 1IPFA 1ILWA 2YOGA 1G8AA 2OO3A 3CMCO 1G291 3ASZA 2NO6A 4MV7A 4F1WA 1DJMA 4X3OA 3NBZC 1B73A 1QP0A 4PFSA 3LVBA 4JMPA 2I6UA 3TLJA 5EZQA 4HR7A 4LYEA 2B8NA 5JD3A 1VLVA 4LHZA 2QA5A 1J8QA 4WESA 5FYQA 1V8ZA 1HYHA 3IUYA 1SURA 2R8BA 5DI3B 1NAIA 2JANA 1KERA 3J7TA 2X76A 1HOTA 4URFA 1HF3A 4H1TA 4PHGA 4C3ZA 1XZIA 4DPMA 1DCKA 5C4IA 1HQYE 3OH8A 4B7ZA 2R25B 3JQ7B 3KKKA 2VTEA 2FY8A 2GPBA 3L6EA 4JP8A 3SXPA 4B76A 1ZI8A 4BYGA 2C7QA 1R5JA 2ZU6A 4IWXA 1A5SB 1NUUA 2QG9A 5DHTA 4PX5A 1R0SA 4WUVA 1T8SA 2AWNA 1AUXA 6Q21A 4D9GA 2R8ZA 3TMYA 2XE6A 3RK0A 1N0IA 1NBME 4TXJA 2XODA 1JJFA 1JSXA 3AF0A 3T4UA 2I6TA 1FDUA 3GLGA 1Z63A 4PNEA 4OEHA 4YI3A 5HBRA 2OGSA 2YIMA 3TWOA 2DPGA 3ESQA 1QHEA 3L77A 4Y3UA 1VP9A 2O0LA 4L5YA 4PYNA 4LYFA 5IDXA 9ABPA 1KOLA 2EEPA 3THWB 4CLXA 1PNTA 5AW6A 3AI1A 1KXZA 3IALA 4BLWA 4CKCA 4DR5B 1DOZA 4P38A 2JKZA 2Y2VA 4R01A 1Z45A 2CLIB 1XF1A 4WOKA 4BX2A 3AL0C 1EM8B 1WD7A 1ZBQA 3DLPX 1N4AA 3V5NA 5HUQA 3B9PA 4LTNA 4QWWA 5HJEA 1TUIA 3CA8A 4G89A 3N0RA 2R2GA 2EBWA 2G4CA 1GZ6A 3ZKAA 3WKEA 3O8QA 1ESDA 1D5CA 1CS0B 2XGGA 3NIGB 4NWIA 4NJEA 5D1NA 3EGIA 4AQ7A 2NWQA 13PKA 1IRXA 1Q0HA 4YAFA 1JB1A 3X1MA 5AJZA 2QQ5A 5EJGA 3K94A 3GZNB 2Q0HA 2Q1TA 3KZOA 2G9QA 3GVIA 1U0JA 1XRMA 1IDOA 1U2PA 1Y3CE 2VCEA 3ELBA 1U0LA 5JEDA 4KXYA 5FADA 5CEFA 2BTOA 1GSIA 1NP6A 5THXA 5BV0A 3RWMB 1L1EA 1NSYA 2PE5A 3KE9A 1CQWA 3T7JA 1Y6RA 2NP6A 1ZJYA 4NAVA 1NLZA 2YS7A 4O4IF 3F71A 4IF6A 4M89A 3RS4A 3U3RA 4MIYA 5C4GB 2IIVA 4CMBA 2IZZA 3TQCA 5HRUA 1Y8QA 3DCYA 4KN8A 3DD1A 2YRXA 4Q15A 2JGFA 1UZMA 2RH9B 4CFZA 2GK7A 2H1FA 2IZ5A 1M6EX 3GGPA 4ZOCA 3ZIAD 2DPXA 3A7EA 3GFVA 4HPWA 2P0EA 4CUKA 2QTZA 1YDGA 4HEQA 2VQ3A 4QEDA 3JYNA 3T7TA 3B2EA 5JBNA 5KAMA 2I3GA 2VAXA 3P97A 4TM7A 3MLBA 1K66A 2I0FA 2ZDGA 4J07A 4ZVPA 2H57A 3DMNA 1JAHA 4BVHA 4XGKA 3E7PA 3IOBA 1ZVMA 3PJGA 3H5VA 4DJAA 5E4FA 1N0UA 4XX1A 2A7QA 1L8OA 3EPRA 5CPFA 3ASUA 3UXHA 1WNTA 4P83A 3ZBQA 2Q5CA 5JVDA 2MWMA 3USES 2QL9A 2ZT5A 4FDLA 3JWHA 4IRXA 1QWOA 1TIBA 1W2HA 2NYRA 2Q7XA 4OAPA 5CA0F 5CFQA 2WLSA 3HDQA 3QVUA 1FTGA 4L5JA 1OX5A 3LU1A 1DEOA 1E2LA 1G4AE 1P4JA 1H2WA 1TQDA 1Y1QA 2IEAA 3FTNA 3IESA 4IKPA 2QUBA 3PVSA 3AW8A 1I0LA 1TTQB 5JHGB 3AESB 2A5JA 4FDVA 5A9RA 3EIXA 4IXWA 5G3YA 2NO4A 3LNTA 3TD9A 3LPMA 3C43A 1P7CA 2WF7A 1P17A 1R6TA 5A4IS 2HK7A 1TCBA 2PVCA 2XTJA 3T35A 1SZCA 4MXDA 1DXQA 3EWIA 2L18A 2EDCA 3H9JA 5AVOA 2OV1A 3J81k 2IP4A 2ZJ0A 3RM3A 5JARA 2JLAA 5BRJA 1L4EA 2FEOA 1ZDMA 3KCQA 3GR6A 4WCDA 3RF7A 3WKAA 4A26A 2CZGA 4A3SA 4B4VA 1KHHA 3H19A 4FT2A 4FFPA 4B1FA 5LUAA 4H59A 3VHLB 2HL6A 2PSEA 3LOUA 3CX8A 4HT3B 3GFFA 4L08A 4ENVA 4N48A 3CLRD 5KB3A 1JSLA 2COEA 2YQ4A 4MGZR 1OIXA 2H48A 2WAAA 3QIVA 4KWHA 5K0BA 3KSAC 3HKBB 2Z6QA 5MGNA 2B7BA 2D0OB 3W5BA 2YRFA 1LWNA 1IJFA 4V2UA 4DLBA 2RKWA 2HMAA 2P91A 2VI5A 3QTLA 3TLEA 2YYAA 4C08A 1QYVA 1EUQA 2YX1A 5K6RA 2BISA 2QK4A 3ZE2B 5IWCA 2HJSA 4Q4AB 1KO5A 2BJVA 4UUPA 3RS0A 1V5IA 1OTYA 2Q9UA 3JQRA 5DPMA 1KEWA 4RY8A 4XVUA 2ZRHA 3FCEA 4FM9A 5CVEA 5CP8A 5E1DA 3VKFA 4U5XA 1OX4A 2P78A 1OSNA 4P9NA 4HPXB 3UMSA 1Y1TA 2QX4A 4GICA 5KQPA 4I8IA 5FA5A 5BMVB 5C53B 4E6EA 1URPA 3QOYA 4D9BA 2GFIA 4MW1A 1YVUA 3IUPA 3QVXA 3BGSA 1JKJB 2ACEA 4RKWA 1MCZA 3PKJA 1JTFA 4UMDA 1I33A 3PD0A 3VZSA 2P1RA 1RYDA 2PU5A 5LNK6 1L5ZA 3I2JA 1Q7CA 5C9ZA 2TYSB 2ZT7A 1ID1A 4IILA 1R0BA 1YBHA 3LX4A 3EEQA 3SJBA 4KR9A 3TM5A 3RIEA 5KOJB 4UOZA 3Q15C 2H2FA 1J56A 3D8UA 3A2MA 3R6GA 4PYIA 3O8NA 4U2BA 3SK0A 4B2LA 5HHTA 2WUGA 3KQNA 1M0EA 1AKYA 2QLJA 1B0ZA 4Z0HO 3AEUB 4FEYA 3ID6C 1BMFA 4W7HA 1XLTC 4UAUA 4OQMA 2ZPTX 4KXWA 4WXEA 1OFUX 3T1TA 4NPAA 4HDRB 3M4ZA 4HDOB 3AVPA 2GPAA 1COWA 1NGSA 1RP7A 3FNIA 3NHSA 4OMFG 5DWQA 5HCNA 2AVNA 1O0SA 1E9DA 2Q62A 1DJOA 4FFMA 1GPNA 2WB2A 2QD2A 4EUHA 1EXDA 3VPXA 3OJOA 1QC5A 2B9VA 3QV1A 4UUQA 5AXCA 4FVTA 1VE6A 1C9JA 3CVXA 3DBOB 1UM9B 3KJQA 4JYZA 4BBPA 1EK1A 4YCNA 4FNOA 4FD2A 3ICPA 2X6TA 3ABRB 1KMMA 2VTKA 4MS4A 1Y9DA 2O1SA 4KPYA 1JEOA 1QPBA 1SD5A 2CL0X 3ZY3A 1YF3A 1RXYA 1J0XO 2BF7A 4MLCA 1C29B 3SMQA 4CCYB 3OLXA 4S1OA 1YB6A 4B7AA 3QX3A 1E3EA 4FGUA 4WUTA 3FG9A 4UFNA 3DDZX 2B1GA 1FK8A 3A9VA 5JO0A 1FP7A 1V1RA 1WZCA 3SVLA 1GYQA 3E58A 3C6MA 4I1PA 4GXQA 3WKDA 1CQJA 3LAWA 4YUYA 2PKRA 5CDTA 5EJ5A 2I33A 1B76A 1J1IA 1N2OA 5HXAA 1XMOB 4PLWA 3LLVA 1GCOA 3GMSA 2QU7A 5EJMA 5EYPA 1VL6A 3T9EA 3EQZA 1LTKA 3JQ8B 4XVHA 3QWHA 4Y18A 5T4EA 1A4RA 1MO3A 2VHUA 2XSZA 1X1DA 4ZWNA 4BAGA 4LKOA 5AVXA 1M8KA 1LDGA 1FVFA 1F7VA 2HF9A 4NV3A 3W05A 3TECE 1BKSB 1CK4A 1E4EB 1HLGA 1LGYA 2R79A 1V5FA 2Y1LA 3IIJA 3JVDA 4F56A 1OAOA 1O1YA 3GDFA 3S8EA 1MFZA 4K9DA 3WZMA 4N0EA 4B6EA 1TQ4A 2PHZA 1Q1QA 3H5RA 3ZBPA 3KOYA 1DIOB 1ZGAA 1OLXB 2ZYDA 1SM4A 2AG6A 1PZMA 3WDLA 4ZO7A 1WETA 2JLWA 4QOEA 4RK0A 5TXGA 5CA1B 1KP3A 2DPLA 5FCDA 2YZNA 3OLZA 5J63A 4D8UA 4B3RB 4LFBB 5DB4A 1AGNA 2HD4A 4OM7A 1SOVA 1P1KA 1SRRA 2OTCA 2PLWA 2Y68A 3P9XA 5JLAA 3TPCA 5BWCA 1DNPA 5EJFA 5JADA 4V39A 3M33A 4U39A 5M04A 1MX5A 2E48A 3X1WA 3W2EA 3G0HA 1QORA 2CBXA 1I1HA 4RC9A 5MGBA 1E66A 3NFYA 2DTEA 3EDCA 3TVTA 3WKCA 4DCGA 1UK9A 1NC3A 1WOYA 2DJIA 1ND6A 2QW1A 2XNDD 3KNZA 4LF7B 4AP6A 5FFMA 2C5HA 4KYTA 4CM1A 1HT2E 2BBTA 4I4TB 2V7WA 2LVBA 4UEJA 1IWOA 1ZGCA 2PANA 3M6XA 3ZWNA 3KYCB 4OB6A 4Y1GA 3GCGA 4EPXA 5U9CA 2H85A 2OP1A 1X3LA 3AUAA 3P26A 2BH2A 3T7DA 1U7OA 1JHQA 2XVAA 3C39A 1GXSB 1U4SA 3VNQA 3EXEB 4KZKA 3EVGA 3K16A 2VAMA 3VDNB 4HNHA 3OQMA 1E1QD 2OZVA 1IE3A 4KJXA 2EYUA 2Z1DA 1IXRC 3JWJA 1XZLA 1Q20A 1KQGA 2IYPA 1EFCA 1Y7IA 1ZM4A 4RDCA 1UP4A 1GRQA 2YH2A 3AI3A 5C5DA 4DB4A 3PD1A 2DFTA 3F3YA 2I99A 4IR7A 5IXSA 3LUFA 2W11A 3TIIA 2HSDA 4KYIB 2FRVA 4G2NA 4J16A 4O4LB 6AT1A 4QDXA 3LT1A 3LQ2A 4HZGA 2Q0QA 2N47A 4TLMB 2ZQ5A 2R6GA 5ALMA 2UZ0A 4CM8B 3LECA 2P5TB 1H22A 1BNCA 1YJ8A 3RBZA 2AX3A 1SJ9A 3TE7A 1XMPA 4MDHA 2WTXA 1BH6A 3TGWA 3LYUA 4TOIA 4JBWA 3OEEA 5JAPA 1QFSA 5TMBA 3FI0A 3C7CB 3Q9UA 1V41E 4ZPJA 4JKYA 2GEDA 4RIEA 4DV1B 1OI3A 1M74A 1JAYA 2JGLA 3HPQA 3IEXA 3MWDA 4LQLA 5ENDA 4R54A 1X7WA 3KSUA 3P4XA 2R0QC 2P4EA 1RU3A 4I3HA 2XXAA 3ZE0B 1UDRA 1WRBA 2HRBA 2QZ9A 3GRUA 4YV7A 2O2DA 3WG9A 1LSSA 4D99A 5ITZA 3R0JA 5IAGA 3A58B 1VGVA 1S8AA 1Z4PX 2F1IA 2PL3A 1M7GA 2ZJ2A 4WWHA 2XVZA 5DLQC 5FOUA 4DL9A 5IVHA 1KRWA 1X14A 3LCVB 1E9SA 3NALA 1CDEA 4F93B 4C20A 1YGPA 1DINA 1T6XA 4UNSA 4EJFA 3RC7A 5BQ3A 3QBTA 4RKFA 4BQPA 1N33B 4EABA 5L53A 2HWWA 5C52B 1W581 4GM0A 1FFSA 3G02A 4URHA 3KVVA 2X4GA 1Z5VA 4K6FA 4L95C 3TSCA 1ISGA 1G21E 4J49A 4DFDA 3BERA 4MROA 4W5JA 1INLA 1UBGA 3FUWA 4CKEB 3ER9A 3EFOB 3N28A 1IAQA 1WY5A 1RM0A 3IJPA 3ZGLA 4AQDA 4BQQA 2G04A 1TEHA 1PS9A 3HFJA 5IXYA 2BI7A 2HWKA 2OBXA 2DWUA 4TQGA 3OZTA 4XPIB 4YCAA 3PF8A 2ZRCA 4K9PA 3ME5A 4BKPA 2G83A 3OTOB 2OO5A 2F8SA 2FEMA 5KHOC 1KYVA 1SBTA 2O2IA 3C1AA 3KVOA 4F4UA 1KWKA 4EW6A 3WL4A 1BZYA 4ATNA 3SIXA 1C50A 1E3WB 2Z08A 3AL3A 3QU7A 4N0QA 3TLCA 2EGHA 3IUQA 1ZNYA 1U2GC 5TQ2A 2WM8A 3PLNA 2VHTA 2VVTA 3ETJA 3QWBA 1QB8A 1A95A 1V1RB 4XARA 4DUGD 4EB8A 2CNWA 4IJ5A 2RG1A 3DZCA 5DYTA 1HTWA 4ZGWA 4RD2A 1H8ED 3OTGA 4UEQA 4XH9B 5CK4A 4B4DA 4C03A 3CR7A 4I81A 1UAGA 3JRWA 5LR6A 2FMKA 3GUCA 2HT6A 2IU0A 1OI4A 3MYRA 3SC6A 4EG4A 4MGEA 1Y1PA 2AOUA 1OHHA 1K6EA 2R8OA 4QM7A 3QKSB 4G5SA 3VA7A 1XN1A 4FQ8A 1H9CA 4KR0A 2J7PA 2QLMA 4QPJC 3FE2A 1Z7GA 3O73A 4I55A 2WEKA 4LZLA 5TC4A 4A73A 4QKQA 4YP7A 1QG4A 3KB1A 5FNVB 1DJQA 4WGFA 2IVZA 4D5GA 1J7JA 3HN6A 2G6TA 1P81A 3UMCA 3QKIA 2X5KO 4V03A 1BQ3A 3ROFA 1ZU5A 4KX5A 3BFVA 1PRYA 3DV9A 5H1YA 1CZHA 3IE1A 2WKWA 3WLJA 2F43B 4WXMA 5AQEA 3MW8A 4FIDA 4I9HA 4L5AA 2QL5A 3WV5A 2G25A 4O25A 3VSCA 1VE7A 3ND7A 3CXRA 4PAQA 5DISB 1EUCA 1OWPA 1ZUHA 2E1PA 4A5SA 1V0JA 1A04A 3RIGA 2ATCA 1GRNA 1PJ8A 3L82B 4X1YB 3SFVA 1L4YA 3RUHA 3BRSA 1EBFA 3VR4D 4EKGA 1NKTA 2FA9A 3I9MA 1V1JA 2EW2A 1NZFA 3TG2A 1DBSA 4QJ4A 3KZKA 4UPDA 2J9FB 4RPCA 3MGGA 2ZAOA 1IEWA 3KOXA 4Z1OA 2PUEA 2GPTA 5E38A 4HX9A 3IHLA 3IA2A 4HV4A 4E5YA 1X80A 2QENA 3AF6A 1ULZA 5ELLA 4W9MC 2QMYA 4B6OA 2G5GX 1VPWA 1OYOA 2JAXA 4BJ1A 3ACDA 3JXEA 1O6CA 5AVWA 4FZJA 2QROA 3ZH9B 1L3CA 2YHUA 5C32A 4E22A 3CEHA 1NOIA 1E6KA 2H63A 3CVJA 2IIQA 4LYGA 4Q3LA 5F5NA 1JFFB 2Z6AA 2B83A 1J8FA 3ORHA 3VBEA 1P0FA 4GRDA 4ZQEA 3S2EA 3MTQA 2ZCUA 2DQZA 3CRMA 4M0KA 2DFPA 1QQ7A 1XCOA 3A1NA 5HE9A 3WLLA 4S3MA 3WICA 4BYMA 1RWVA 4DADA 1T5SA 1WXXA 1Y8QB 2PH5A 1NXOA 4ARZA 2FPPA 4DG8A 2ATVA 3FSRA 2IOFA 3NDJA 4B75A 2RI0A 2NZWA 4G81A 4O0LA 2OOSA 1J9ZA 4B40A 2ECOA 5DHFA 4Q21A 5KQSA 2IHTA 1RHMA 1YAHA 2J0VA 4L6CA 7MDHA 4OH1A 4AG6A 1G4HA 1JQ5A 1TZ2A 3FMPB 3PIIA 3RVLA 3MK31 4R6WA 3DUFB 5KJEA 4FC7A 2QDXA 3NC4A 1XVVA 2QVLA 1KARA 3G8BA 4QNNA 4MV4A 3AEQA 3VZBA 2ZM5A 3SQXA 4E2XA 3JASA 1PJ3A 5LZ9A 4BNKA 2XZLA 2XCQA 1XLWA 1NF3A 2CXQA 1RCTE 2AXNA 5ARCA 5B1IA 1S01A 1WF3A 2QD4A 4K03A 2XWJI 4QOHA 4C14A 4QOJA 1SEPA 3EVDA 3I30X 3CRQA 5CVCA 2ODWA 4D4HA 1JJ7A 4IOMA 2BFWA 1YRQA 2PBFA 3BMXA 3GT0A 5GMOA 5T6BA 4CG1A 3WLMA 5JAQA 1E2EA 1M54A 1I24A 2N42A 1CUWA 2WOJA 3GYGA 1E1KA 3C6QA 1AKNA 3CF0A 5G0VA 1WMDA 1ZN7A 2EZ9A 2VATA 1RI3A 3E3AA 3HB9A 3TDNA 1GGNA 3K5WA 4E12A 3BCUA 1TX4B 1Z12A 2JJ2D 5U1PA 4HG2A 3ZGVA 1ZUD1 2ZWOA 3OMXA 2NADA 2KYRA 1C14A 1JX6A 5C8DA 3C74A 4J4TA 5DO9A 3ZWCA 1RRVA 2YKGA 4L85A 3WRYA 2ZSFA 2WSYB 4F3CA 1OC2A 721PA 4AUEA 2W42A 3K1AB 2RKOA 4NE2A 3CVOA 2ZR0A 4UCQA 1ZH0A 1EFRA 1UODA 4Q9KA 1E4YA 2RHOA 2UUAB 3RBXA 1V8BA 1C5KA 3WIDA 1F20A 5CM9C 1XRQA 1E3WA 1XL0A 4X45A 3COSA 4A0FA 2VHYA 4X66B 1HDXA 2IF0A 1NVVQ 4OSEA 3DDOA 4FWBA 2ADOA 4JYBA 5DMHA 4GSYA 3RARA 3UMBA 7ABPA 1IVYA 2GLTA 3AV0B 3LFTA 3FYTA 2P0YA 3LP5A 3M6MD 1ODFA 2SKDA 3B82A 2XDQB 1NI4B 2HA4A 3CLSC 3P2MA 4IRMA 5C8YA 4ZCMA 4P7FA 3QRWA 3OX2A 4D0GA 4RD6A 5JXJA 1Z4OA 1Q0SA 3FNHA 3OP4A 3T3GA 2OGWA 4ARAA 1N2CA 5EKDA 2XNDA 3CLUD 3D8BA 3DTVA 3ZWXA 4D0RA 5FI0B 3ZE7A 1GU1A 1VTKA 1MF7A 4KKVA 4UASA 2ZUDA 3LI2A 4OGGA 1O9GA 4S24A 1CNFA 2P75A 3IAUA 3UCFA 1SKAA 5BT9A 2VPPA 1M1NB 2PKEA 1DG3A 4HLUA 2PMBA 1YNOA 4LHVA 3GRAA 2D2XA 4H27A 2BGUA 2YWBA 4ND6A 3BDIA 1OBCA 3ZCRA 3MMXA 3M9WA 3KQQA 3C3MA 1MDFA 1GTJ1 1NR7A 4E11A 3E7WA 3OC6A 1ZUNB 3OO0A 1N6HA 2R6AA 1U9CA 3N2EA 1JXMA 3GRRA 1O3YA 4AZ3A 4ECAA 5K8UA 2YHBA 1EESA 4GXRA 4DEYA 1Z2NX 1UPXA 3G2HA 3AM1A 2QX8A 3R44A 1UXOA 5E6SB 5FBRB 3GUZA 2X7HA 3SHTA 1ZJ5A 1HT3A 3U7QA 2WWTA 1TIPA 2AXEA 2PBRA 4C3VA 5JDCC 4RPJA 1PL0A 4BN4A 4Q1EA 3UPDA 2OMKA 4LEIA 4MVJF 4DR7B 5KSYA 3FD8A 1FFCA 1GNVA 1YZYA 4QECA 1JQLB 3FWZA 4IDGA 1R5BA 2HMUA 3L07A 4OXRA 5MFZA 1HG1A 1PR2A 3QG5A 2TMKA 3FCUB 1K97A 1ZD2P 4YPOA 2J32A 3QI2A 3OBBA 1TZKA 4MRMA 2DQKA 5EIBC 3CH4B 4C0HA 3MWYW 1LD3A 1EJ2A 4HUTA 3RABA 5EXDA 1YS9A 2ZYTX 3GH3A 3AHGA 2OHFA 3O8OB 2QMZA 2IYVA 1OT5A 1MTZA 1IBRA 1ONSA 1Z08A 2Z98A 3RC1A 1JDPA 4RLSA 3V46A 4F60A 1TYZA 1GADO 4BY9E 4GI7A 3EF1A 3DB2A 3RFTA 4TTVA 1O54A 3NT2A 4NU0A 4LDQA 4QOSA 2JDIA 1EZZA 4H7EA 4OYLA 3G7NA 3ZG6A 3HYCA 1ZH6A 2HDHA 4HWTA 3CJQA 1ZS9A 4ME6A 3X1XA 3MBIA 4PG6A 5E7QA 1ARZA 4YRKA 3K1JA 3NYQA 3OJEA 3GNTA 4TKZA 3JVIA 3FR8A 3L6CA 3VYUB 3G5AA 3QLTA 4M88A 5IBRA 2FPPB 5ALYA 1UBEA 1DX9A 5CDGA 1XTJA 4ZI2A 1W5TA 3AR5A 1ZESA 4G36A 4MR8B 3SC4A 3SXJA 1VDMA 1MP0A 1TLLA 5LN1A 3NHBA 3AHEA 4EENA 2ZI4A 3HE3A 5M7EA 4DV0B 1E2JA 3E9CA 4GYYA 4D0LB 3BQ9A 3SZ3A 1TQ8A 3ANMA 3WMWA 2Z3WA 1BRTA 3X2EA 3AGQA 4OD0A 2OORC 4R1SA 5J47A 1ZCBA 2WWHA 2XA9A 4PC1A 1WXDA 4QXOA 1UMCB 3AUYA 1SMKA 3LM8A 4LV5B 4QNRA 3CR3C 1Q91A 4INJA 4V24A 2B30A 3SX2A 3A31A 3W3ZB 1PVOA 3DGEC 3O1JC 3HKCB 3KK0A 3GT4A 3V1TC 3BMOA 5LMNB 3JTEA 2VQEB 3EXEA 3AILA 4M98A 3SS9X 4D9CA 5EMJA 1R88A 5KU1A 4P3PA 2V9CA 2VSNA 1HQKA 2IP1A 3OA0A 1Z6AA 4N0PA 3SF0A 3BZUA 4OK5A 1QOPB 1DRVA 4P4LA 6CHYA 1KRXA 2HKIA 3WFIA 1H2AS 1ORDA 3R5TA 4TYPA 1GQRA 3L41A 4UUMA 3SSMA 5C1BA 1I3LA 5ELMA 2W0SA 1HFKA 3BMCA 4CV0A 4C7XA 5AHXA 5HTOA 3U4QA 3WGZA 3BIJA 1O96A 2WD9A 1N0HA 1RYZA 2EF1A 4FWIB 2XITA 1C30A 2WD8A 4JXXA 2BBOA 4XUDA 4KQEA 5IVPA 1DVRA 3DZGA 2YNMD 3BH7A 3H7AA 5AM2A 4IOLA 3SKYA 2NX2A 4O1IA 4AF7A 3V1UA 1A2KC 2W58A 1Z4NA 2A14A 1Z8HA 3AF3A 1T6YA 5HM8A 1MVOA 1QRSA 2NAFA 3GOHA 4HTFB 4LJ7A 2NN3C 4URWR 5DGTA 5JCJA 5FH9A 4TV8A 1T35A 1DKUA 1FPMA 4M9RA 1ZOSA 3D81A 3K7EA 3RSLA 3MGKA 3KFVA 1H6AA 1UWKA 4UW9A 5KVSA 1XG5A 2VRCA 2BMAA 3A70A 2QN9A 3NUZA 1FUUA 4WKGA 3I0ZA 1ZI6A 2CVPA 1DAPA 4BOYA 4EA7A 2V7EA 1YQTA 1FSGA 4RV9A 4WKNA 1Q5PA 3IX7A 2GN8A 1AZLA 3AIOA 1LA2A 5DBIA 2HRCA 2V03A 4O4HB 2GCNA 4RELA 1NA5A 4KQXA 2I2CA 1ECJA 3FFBA 4WBNA 3FPEA 1N9GA 2A6PA 3AEKA 1SR8A 2XQKA 3JPYA 3N6VA 1LTQA 1XALA 1T4GA 2I8LA 5B64A 2RAUA 1C7QA 3RK1A 4IF4A 4PO8A 2LBPA 2CVQA 1RXWA 2OILA 2OQRA 3C1UA 3H4VA 3R7LA 1U80A 3W2IA 2I6SA 1ZSVA 4B32A 2ZRAA 4RMJA 5ILOA 4TL8A 5KREA 3WRVA 1NUPA 2VC2B 3R3ZA 1RWKA 1KH2A 2ON6A 3N8DA 1QG6A 2H18A 1UT8A 3A6PC 1FJ2A 2AZDA 3LY7A 2I66A 4V0KA 1NM5C 4DAOA 1MXHA 4KDRA 3KQKA 1K4YA 2CJXA 2BI8A 2WIDA 2RHWA 4E5MA 1KY5A 3SCZA 1VLLA 4YJGA 4ZK2A 2BSXA 4W5TA 2NIPA 3SYNA 3TO5A 3VVCA 4JP2A 2RK4A 2O14A 2KS6A 1G42A 4CIYA 1Z15A 2I71A 5AICA 4YRZA 3KQLA 3STVA 4W63A 4HGOA 2YXDA 5ER9A 2V1XA 2AFIB 3AFOA 4CMAA 4YMWA 5DJ5A 2BONA 4YV1A 1XNQB 1Y1LA 2IYNA 5EUQB 2ZRFA 2P9HA 3A6DA 3NOVA 3T52A 4DDWA 1AS3A 1I0IA 1V47A 2A67A 2Q21A 2O1EA 3BRWA 1HDYA 3GA5A 4H0FA 1A4UA 4ND7A 4XJXA 5TE9A 2W37A 1Y5RA 1VE5A 1GILA 2IGBA 4KRGA 4YJ3B 4BFLA 2GEJA 3UOAB 4BPBA 4K0KB 1GUBA 4CKBA 5I7UA 2AOUB 4JXKA 3TIXB 5KTYA 3B6EA 5NULA 2GEVA 1K9VF 2ZPUA 4PGHA 4FCWA 4D9KA 1GV1A 2W90A 3GWZA 4RULA 1T0BA 1K6MA 3QEOA 3NXSA 3ECCA 1UBNA 5KWJA 1JKXA 1G9XA 2FZEA 1G6OA 1YE3A 4RJJA 5HUHA 4P3KA 4QHTA 4S0XA 5AESA 1JWLA 1YWGO 1IBMB 2E6UX 2WYWA 2WBLC 1L5VA 2NO9A 3H42B 3GJZA 1JE1A 3THXB 1T5DX 4F8EA 5JD5A 3AK4A 2NU8B 3FROA 3MUFA 5FUXA 5FBLB 3PXUA 2F8MA 2JS7A 1D4ZA 2Q2VA 3PFIA 4ENUA 2BIFA 1KBZA 2L82A 4TXHA 2VK8A 3WZLA 4DA8A 1A3CA 2GZAA 2QM3A 1ONPA 4ROSA 2DT5A 3AERB 5F2OA 1DWPA 3QXHA 3D9QX 4CIDA 5I7RA 1QO0D 2XQGA 1JA9A 4RL6A 4JLKA 2AL7A 2SNIE 2ZXUA 4IDQA 2R85A 1ZLYA 2W2XA 4O4LF 1TTHA 3DF7A 2NQTA 3WGQA 3QLVC 1A8QA 2HI0A 1O0CA 2P2YA 2ZRNA 2EBUA 2GWRA 1H0HA 1J2TA 1TXGA 4M1QA 1T6ZA 1YJ5A 3ZS9A 3D6TB 5BV7A 4WPGA 3PUIA 2ZGVA 1C7ZA 4EA8A 5LP6A 3E22A 3GY0A 5FTLA 4POAA 5DLYA 3DMDA 2G0TA 4DBVO 1EEHA 4R84A 2Z1MA 3F6YA 4LJSA 1U31A 2VNHA 2V7GA 2QMOA 2CNDA 4Q19A 5C3UA 2GCIA 3RD5A 3RHFA 3SQLA 1UDAA 2YJNA 4BMVA 4JY7A 1NQOA 4JQOA 1RQGA 3P4UA 5CITA 4ARIA 2AJTA 3HTXA 221PA 4GR9A 3F8WA 4GT1A 3MJVA 9LDTA 1YZUA 2QYSA 1TK3A 4I5GA 2Y0DA 5I4CA 2LDBA 4OIFA 2CJYA 2DKOA 2F62A 3MMZA 1JMVA 1THGA 4LXQA 4TKUB 2PV0A 5A5GA 3CLHA 1OY1A 3UWSA 1MC5A 1VMAA 4B73A 4TZ6A 2D06A 2ZW9A 3T8YA 4UTRA 4BZPA 4DTIA 1M1ZA 2YVLA 4RPLA 1HYGA 4FKMA 4FLEA 4PV7A 1KE2A 2Q5QA 1V3VA 2QTGA 3T5AA 1LFDB 1NMSA 1DU4A 1ULBA 3E9EA 1UR5A 2CF5A 2CGEA 3V2UA 3X1KA 2L2QA 4DR3B 2A5DA 3H9CA 2PZBA 3ZHRA 3T5MA 3CUKA 3OQIA 1R64A 2P2SA 4D56A 2FN8A 4KFTA 3X1JA 1JQBA 1NY6A 2DZDA 1KEVA 3QUBA 4MKHA 2CNBA 1BXKA 4U00A 3W1EA 1QCDA 1P7ZA 3AHCA 2WTBA 3ABOB 4OQ4A 3FRHA 4PGFA 3V4SA 4DVJA 2XBMA 3F3KA 1VPVA 2HJVA 1ZW6A 3HACA 4YEDA 1XPRA 1P4HA 2AR9A 1DWUA 1IULA 1QIFA 1P0QA 3I2FA 4GUDA 4QGSA 2QP4A 5BR7A 2CWDA 3L1KA 3BK1A 2AMFA 1H3EA 3FCCA 3H84A 3JALA 4UAGA 4H16A 4PZ9A 1JN0A 1L7MA 3CZRA 3DDSA 1BWPA 1X0VA 3OESA 3R0XA 1JAIA 2ZI7A 3NEPX 4XRGA 3F46A 1CT9A 3DZBA 2B4AA 3C8DA 3M4JA 5EP4A 3KALA 3AIKA 3LHSA 3LO8A 1P4GA 4NYIQ 2D5LA 3U3OA 2Y67A 3RR2A 1Y6GA 1BGVA 1F4PA 2XUHA 3MT7A 4HLDA 4TT8A 4YRDA 3C6BA 1SUAA 3RFCA 3ZCTA 4JFAA 4FGLA 1QYRA 3SDZA 4RHFA 3OCJA 3E2IA 2YJTD 4JK3A 4OB7A 4PR3A 3MJRA 4KPGA 5BN4B 2ZWPA 3ZKWA 3MIIA 1PNVA 3A0RB 3FZQA 4UTPA 1LBTA 1WB6A 4LF8B 2YVKA 2FPUA 1YFLA 1QLHA 4TWBA 3L5OA 2C61A 2R1VA 3A4NA 2A88A 3AVXA 4JYMA 2WOOA 3EXHC 5FULA 1W6RA 3W5UA 4JGBA 2ATEA 3T1OA 3NAMA 1X7YA 2MMCA 1Z25A 4M0FA 1J0AA 3Q3EA 5CT4A 4B3CA 1QKKA 2LZ0A 4J03A 2JAOA 3R6TA 4FXOA 5TT1A 1EXNA 2FUG6 5CHYA 2H9AA 3M5PA 1ECGA 1E18A 2FW6A 3DC7A 5LBTA 3KHUA 3NM5A 2PX2A 1MT0A 3E3MA 3HFSA 3ZWWA 4BN5A 5LSAA 3U60B 3QU9A 3MQ2A 2F8TA 1UJ6A 5EE5B 1T3ZA 1U3DA 2FSPA 2N3ZA 4JU9A 1F6BA 3AEZA 2X8JA 3U56A 4NV1A 4KDFA 1BMQA 1I3KA 1UZAA 3KOOA 3F6RA 2O2GA 2QTFA 5KVQA 1W2GA 1U0GA 1ZGBA 4TV8F 2RHHA 4BVKA 3DT9A 1FRQA 2OFWA 3RDPA 4CW7A 3DPUA 1TF2A 4D0SA 1V8FA 2WP8J 3PITA 5CNIA 1HM5A 4EFKA 3NKFA 1YFKA 4FNGA 3NCTA 4KHZA 1KJYA 2E6KA 3DHYA 3OJXA 2VPIA 2ZJ8A 2JIOA 4QE3A 3AXTA 2X6RA 4G25A 2VUSA 2HMSA 3KUCA 5G0UA 4E08A 4F72A 2C5SA 1ULUA 2A0YA 1W7AA 1ZK3A 5JALA 1FRVA 1I2MA 3H1BA 5IYZF 7MHTA 2KBFA 4PN3A 5CIYA 1ZVVA 1RXEA 3FBTA 1S8NA 2IXFA 4O4JF 5FL3A 1V43A 1KVUA 4RA9A 5HGXA 3FVTA 5IFKA 2KB0A 4ENRA 3K3PA 1E6CA 5MN6A 2C84A 3D54D 2AFIE 3M1LA 1JEEA 3F6SA 1XU4A 3LIPA 4YLEA 1E1NA 4PNZA 1FRZA 5CAEA 3F3MA 3V8EA 5EKSA 3ORRA 4RVNA 5FWXB 5AW4A 1JKFA 1J49A 1SC1A 4HZUB 4CM9D 2O52A 4YX9A 2YZGA 1YCHA 4UBMA 5E2IA 5IPFA 4TLCA 4MUNA 3LGSA 4G0UA 4O2AF 3ZU3A 4O8CA 3SIPA 4B5KA 1CJTC 1GQFA 1R0RE 4GMDA 2H5IA 3FPJA 4M1TA 4DLLA 1DKOA 5IAEA 4B0PA 5BY2A 1AJEA 1JE0A 1YS7A 3L8GA 4P53A 3VSBA 3HM9A 1CWUA 2WG1A 3H3XA 2ZUEA 3QKRB 1OTHA 3JQFC 2GAOA 4F96A 4W99A 4QLOA 4F6LA 2W98A 2Y05A 5L3QB 2D0IA 2XQJA 4MLDA 1AK2A 4GZ6A 1EM6A 1LNQA 4CLDA 4DCJA 4FWTA 2ABWA 4Z2YA 2O8CA 2F1JA 4INZA 2IE0A 1Q7GA 3I62A 4RPKA 4G01B 1G8PA 3OIUA 5E3JA 2O05A 3CVVA 3RAGA 1UBOS 2XTNA 3ET5A 4Y1RA 4OU5A 4CMEC 5DWVA 3BH0A 4JEUA 1YJBA 1MMFB 1MQSA 2WB4A 3IMCA 1MB0A 5BSKA 3VX3A 3N2ZB 3HGTA 3EPLA 3EGVA 3CZ4A 2NVUB 1OH8A 4WA8A 1FDTA 1WQ4A 1CJUC 5KYYA 2P69A 2IPNA 2R1UA 4NMMA 2GAJA 2VUIB 3H2GA 6ABPA 1DP4A 5ITVA 4Q82A 1E1RD 5GAJA 5C7YA 3FYUB 3LFHA 2J3DA 3TKAA 1XD9A 2X2PA 3NJ4A 4CLRB 1OLSA 4FEAA 3CEJA 5HRCA 3KQOA 2JCVA 2FWPA 1PD0A 1JH8A 3UYLA 1JG6A 1HUQA 2CVOA 3OZEA 4WLOA 3KEGA 5UKDA 2PUCA 4DR4B 5A4KA 3KD3A 1RNLA 2W6MA 4FR5A 1H5QA 5CK5A 1Z07A 5DK4A 1UJMA 1IWBB 4FOLA 5IC4A 1GCAA 3EGDA 5A9SA 1QJ4A 1JHZA 3N2KB 4OOFA 3B7WA 1V7ZA 2R11A 5IAOA 4XIFA 4FHEA 2CXTA 1M0TA 1ZNZA 3K4PA 4E03A 2IOYA 3KQVA 2ZKIA 3HXTA 2HDNB 3KEFA 4KUEA 5SYMA 3D6UA 5JRZA 4DNPA 4RVHA 3V34A 2IP2A 5JJLA 3U1TA 1O95A 2AK2A 2Z4SA 1ZFNA 4NULA 1YRAA 5HQ3A 4QUKA 3SF8B 3U4MA 1G8MA 3GELA 4M9QA 4OKSA 4RH0A 3E8SA 2I4OA 3OIDA 2FG5A 2UZ1B 3ZEIA 4W7SA 3BCHA 1C30B 2XUGA 2H51A 4BE9A 1PFUA 2NO1A 3LC2O 1NP3A 4MW5A 2VDPB 1OZFA 1YI8A 2JFOA 3MTBA 1OXSC 1GTG1 3TOZA 3ND8A 5I6DA 1H6BA 3HUUA 4KH0A 2PX0A 4QEKA 5ALZA 4U2KA 5DBHX 1XB2A 5TSDA 1YMUA 3VR1A 3VU9A 1A5ZA 2C2HA 4A92A 2JCSA 5IUNC 1HR0B 2ZIWB 1V8PA 1AU9A 3OT1A 3A05A 3PUWA 2PX8A 3PWZA 3EJWA 4JC8A 5I5GA 2ZRJA 3WA7A 4HQLA 2AW5A 1XEWX 1N0WA 4RLHA 3MTGA 3ZXIA 4BKMA 5KPJA 5I9TA 5KOJA 1XQ1A 2QDKA 4ZODA 2Z43A 2MIIA 2DECA 4M76B 4HWRA 3TVDA 1IFXA 1PYOA 2GF0A 1LCIA 5FTNA 4KSYA 1GR0A 4TYQA 1ZVKA 2W8BA 1JAZA 5CFPA 4Y7DA 4JEIA 3ETGA 3O4FA 1MEJA 5C8YF 3U7FB 1RM3A 3EDYA 3HEBA 5FBKA 4KVAA 1M1UA 3Q7PA 1XA3A 3DM5A 4H7JA 4JXJA 2Y9PB 1EGQA 1JVSA 1L3IA 1W44A 4FYVA 4QQFA 2D1FA 5J2UF 3GX1A 1EQAA 3NO4A 2XWBF 4MVJP 3VDQA 1APBA 1NQVA 3G7SA 1GIAA 1TZJA 2P2CA 2VWPA 1KYIA 5AIAA 1QAMA 3DOHA 5A7FA 1GZ3A 4KYUA 5AXAA 4OBXA 2GTIA 2W93A 2XVYA 1CUSA 4QJ5A 5IKOA 3O93A 4KE7A 2HSJA 1NX6A 2B98A 4BFXA 3ZJUA 2ID9A 3L40A 1W48A 1Z5WA 1KO7A 5C1DA 3L1VA 5DHRA 2I9KA 3BEDA 3CLTD 1VKHA 1XD8A 4KE8A 3UT5B 1HZJA 4BN0A 2XCUA 2OC4A 4CLHA 2J7KA 4NFYA 3CONA 1PGOA 2FP4B 1BRMA 4MMZB 4PC6A 3W2TA 1VJRA 3DVSX 4A10A 2CDNA 2GM4A 2JD1A 4P54A 5DM2A 1VSVA 3HCPA 5BSTA 5KSWB 1E7WA 4TYYA 1IK6A 1EWVA 1ZCFA 2EBFX 1QIMA 1R0YA 2X19A 1WF6A 2G9VA 3DYVA 4G5GA 3A9TA 5AUPB 2O5RA 2AKAB 3TZQA 5JLJA 2ADMA 2YCLA 3NEAA 4N12A 4NBLA 4ED9A 1ZR4A 3FDXA 1MABA 1L8XA 3DE5X 5ADWA 3I3OA 4J0FA 2HZ7A 3K8ZA 3SP1A 4M4SA 1UBHS 2GOYA 1ZQ9A 3R9XA 1RYHA 4FP9A 5E8RA 2VRNA 1GPH1 1KKLA 3S6JA 1QAOA 3U4HA 4NAHA 3GROA 3SLGA 3PQ2A 5JRDS 4U8GA 4E2WA 3ZX4A 2XKJE 3FZEA 3ELDA 3LKBA 3MB8A 4TS4A 2Q6OA 4LMBA 4DA6A 5IBCA 5KJ1A 4BXOB 3T7CA 4CM7A 2W9XA 2H1OA 3ZS8A 1HC7A 2O7VA 1WU7A 1MHPA 2PKQP 1XMSA 2ZVQX 3OY7A 4N41A 3DEYX 4CF3A 4IHAA 4G5HA 4D8XA 2ROQA 3RU9A 5CJJA 2RGUA 3QQPA 5J40A 3QEJA 1MR3F 2ZB8A 3IDSA 3TI9A 2D7JA 4OP2A 4DV2B 3G0DA 1I51A 1YQWA 5CW1A 2QRVB 2QW0X 3B3FA 3OM0A 1DO8A 3UC5A 1R12A 3C7KA 1AS0A 4BNFA 4ZMBA 2RD2A 1DAHA 1C0IA 4KVZA 4RYLA 3VKGA 1LF0A 3OBIA 3TZEA 3O47A 1EVZA 1SOWA 1KU6A 4XGNA 2X8AA 2RMKA 2ZE7A 5JPCA 1I2BA 3B60A 4CV3A 1MAWA 4XD7A 2F1KA 4GM4A 3LW7A 5FTMA 4B80A 1NT4A 3O4IA 1E2UA 3B3QA 4HQNA 1XU7A 1SB9A 4MQEA 4P7KA 2YOHA 3GUVA 3MMNA 4TV9B 4NL4H 5EEGA 1I01A 1B8PA 1E2IA 2AOWA 1XUOA 4WFKA 4CQMB 3ANTA 3U17A 2XYRA 4Q9DA 1NVVR 2ZUUA 4EK9A 3PUYA 3LPDA 4DIBA 1BEZA 2IX9A 1ZGGA 3B1FA 3QXJA 2DFLA 4XTCS 3N2KA 1VM6A 5E0OA 1ZRMA 4HPJB 4ZAFA 1YHNA 4D96A 5D5QA 1MUUA 1NQWA 5F51A 3V8NA 4Q47A 3WXMA 1FPQA 2BJHA 2H5EA 3IKVA 5AR1A 3GVHA 2RSLA 1QK3A 3ESBA 2AC2A 5IH3A 1N34B 3F5QA 3NGMA 1KEPA 5MN5A 1SELA 4URUR 1Z73A 3HB0A 1N3IA 3GP8A 2OSBA 4BV2A 5G02A 2YC4C 1ZITA 3DPSA 5DSXA 3WLAA 3CLKA 2R7LA 4JLAA 4PO9A 5I51A 3H5LA 1NBOA 2G1JA 2R6CA 1EFKA 2CCKA 4AVYA 1FJHA 1II8A 4F9GA 4J1TA 5CJPA 1OCEA 2A3RA 2ZETA 1C3XA 4RS3A 3GPIA 1S2LA 5IFLA 4K6MA 4U1RA 1GJRA 1TW3A 4MUXA 4AWBA 3BXOA 2EX0A 2QTLA 4TUYF 1QM5A 3VU9B 4BIMA 1G6Q1 3AY0A 4OI2A 1FDWA 1AKWA 3G7UA 1C4OA 3PHHA 4Q4CA 5BPHA 5JBIA 3SS7X 5DN6A 2H16A 3DOJA 1YJAA 1YR7A 4FOOA 4TVOA 5EEHA 2RHLA 1KEKA 3TRFA 2Q29A 2LRHA 1W0CA 1T2VA 2NSHA 5KDOA 2UYCA 1WXEA 1G60A 4CDMA 1K7YA 3NI2A 1I32A 1Y33E 1R0XA 3CB2A 5JXHA 2H6EA 5I4BA 1WB4A 3Q3JB 5FHQA 2CNWD 1X1EA 3FJOA 1SBNE 3I5YA 2JIQA 1B14A 2O7QA 1CF9A 1BFUA 4ETMA 1FVXA 2QZSA 3DM9B 3PIRA 1IZ0A 3E5RA 3QMPA 3EH1A 1K4MA 2CLDX 3MLAA 1NE7A 4DJJA 4YRJA 1E7YA 2GD2A 5FWAA 1H3NA 1Z83A 1R16A 2C4NA 1FFAA 1N8NA 4Q9AA 4BB6A 3W5JA 4UMFA 4PC2A 5IT9A 3WB9A 3VNRA 5KC8A 2DQ4A 3JQ6A 1M6NA 4X20A 4RK7A 5EJ2A 4CCSA 5JNVA 4D5EA 1HZZA 1EPUA 1LU9A 1NPDA 1RWOA 3KKMA 2HR1A 5H8WA 2FR8C 2X22A 3CO0S 1C9YA 1US8B 1GPUA 3UAGA 3JZIA 4ZCTA 5A5EA 3B70A 4AMZA 5JDCA 3TXYA 3FPLA 1N1DA 2I2WA 2Q6VA 2ZYHA 3EZXA 4Q9LA 1T24A 4JZYA 4OMDA 2Z04A 4OHOA 5ICSA 2I8AA 1CG6A 3E53A 3Q5GA 3QY9A 3VYSB 4AO7A 3QVLA 4GMKA 5NLLA 1XPUA 2ZUCA 3GZJA 3A3KA 3NHWA 4LF5B 4KTTE 3S2GA 2X42A 5BW4A 1KOGA 3TR5A 3BFPA 4YNBA 2AGVA 3ZDQA 5KWEA 1M72A 2IHJA 1GZSA 4JNCA 3WYBA 3DCNA 1LRKA 3F2VA 4L8LA 1I3CA 1FQJA 2O8DA 1NVWQ 2ASVA 1XL1A 1PX2A 1UJCA 2NZYA 3IXQA 3QEKA 3L0BA 4OYYA 1ZJWA 3RS2A 2PWYA 3VU3A 2VHZA 2IYOA 3JAWA 3HWSA 3ZK8A 4AROA 1LJLA 1Y4DE 3IAS1 4CM9A 3LZDA 1C4WA 3D6MA 1KQOA 3RLFA 4UBLA 3UUFA 5KYUB 1P9OA 2J5RA 5KZMB 2YJGA 5BSWA 3A6LA 1IOVA 2XYQA 4XPIA 1SKMA 1XKLA 2VN8A 2VJDA 4J7AA 4A03A 1L7DA 5LZ5A 5JXWA 2I4RA 3M6IA 2B82A 2QSZA 1AMUA 2J45A 4J1TC 1OH5A 4MS3B 3WNQA 4H7PA 4QTYA 3MRSA 2GXAA 4KQIA 3PC7A 3LQYA 4NICA 1FDVA 4X1KB 2O20A 5KSPA 5TT0A 1X1SA 5K6TA 4NYMQ 3BL6A 5IJ0B 1AHNA 2RB4A 4YAKA 2O3RA 4QSHA 2R87A 5KOHB 1Y6JA 2P27A 1VIMA 3JQCA 3R23A 2ZPAA 3PKZA 3E61A 1BCRB 1CDOA 1ZEJA 4UBKA 1T2UA 4FOSA 5A05A 4CDGA 1JHOA 2QSJA 4OGLA 2NUBA 1GN9A 4HNQA 4I1YA 5EKXA 2GHRA 2BR3A 3OI7A 4JLDA 3U3MA 3UFXA 1ZHOA 2C4TA 2F48A 1CKEA 2HY7A 1WPQA 5CVTA 1ODTC 1RBZA 2FMIA 4PLHA 3WWEA 3PFKA 2X2FA 3NUGA 4JA2A 4MS1A 4Y2SA 5CLHA 4N3AA 2YMQA 2ZS7A 3CVYA 4AJ1A 5DEOA 4IMIB 2FETA 1TVKA 3BB1A 3L7IA 5DGCA 1TTTA 2P3OA 5ITWA 4AJLA 3LP6A 2PRIA 4YFYA 4Z4HA 2PZKA 2Z8YM 1CV2A 1ZK0A 2VF8A 2Y92A 2M1XA 3BAFA 1DIGA 1Z22A 3L0YA 3LGXA 4OREX 4BMYA 4KXVA 5H80A 3CNEA 3FJ1A 4OLBA 4QGBA 1Z6ZA 1G21B 4GOKA 3SEFA 2FW8A 4N6OA 2Q5JA 5L3QA 3A4YA 5EHNA 1DC3A 1EJ0A 3TRHA 4HAOA 5BUCA 3RC3A 1FY2A 3BF8A 3O94A 1XDZA 1ITZA 2ES4A 4FI3F 1WUYA 4K6GA 4OUDA 2GH1A 2BFPA 1UPTA 4RZ2A 2EERA 4LAFA 4C7VA 4DAEA 1OPRA 1IWPB 3P27A 1IBCA 3LUAA 4O3FA 1E1YA 3C8UA 4X1YA 5E6RA 3V8PA 3F7MA 4GL2A 2MR6A 4ARCA 1TVMA 2BZSA 4YRSA 5DNYB 5DBFA 4ODIA 4PFQA 2CNLA 4GNRA 4M8SA 5L45A 1EAYA