3BWYA

Crystal structure of human 108m catechol o-methyltransferase bound with s-adenosylmethionine and inhibitor dinitrocatechol
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMT protein
publication title Crystal structures of human 108V and 108M catechol O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwyA00
1QZZA 2NXCA 5FA5A 2GPYA 3P97A 4QVGA 9MHTA 2ZBQA 2N47A 4X60A 2O0LA 1PRYA 3LKZA 1NW8A 5D1HA 5EPEA 3ERCA 2NP6A 4OX9Y 1KXZA 1FBNA 1Q0SA 2YXDA 5EZSA 1NW3A 3UJ8A 2OB1A 4KRGA 3LBFA 4F86A 5E9WA 1XDZA 4FSXA 4PIPA 2PJDA 1G6Q1 3PVCA 2WK1A 4HH4A 5HIIA 4PYQA 5EMKA 3EVCA 2VDVE 3C3PA 2PXCA 5GWXA 5BW5A 2ZWVA 3JWHA 3KQWA 2EG5A 5DWQA 2PKWA 1VL5A 5FA8A 3T0IA 4E2ZA 2P40A 3EGIA 2V74B 2ZBRA 3QOXA 2YVLA 4GUAA 5GP1A 4NECA 2PGXA 1RJDA 5GINE 3GRUA 1JQ3A 1KP9A 2PLWA 3FUTA 3RW9A 4RTMA 3O31A 4C03A 4KIFA 2NYUA 1XTPA 4OQDA 2NP7A 4R8SA 2Y1WA 3GWZA 5CM2Z 5LSAA 1JQDA 3ELDA 3BKXA 3A27A 5DXJA 4A6EA 5KVAA 3NMUF 5E1MA 5HEKA 1I1NA 3HA5A 5CD1A 3KQOA 1RJGA 1KR5A 2NXEA 2O06A 4PGHA 3SM3A 4BP1A 1NW7A 4U7TB 2PT9A 4WXHA 1VLMA 2V7EA 3LBYA 5H02A 4WVLA 3TLJA 1MJFA 5MHTA 1NT2A 3FTFA 5ERGB 2ZZNA 3NVMB 3OCJA 3PTAA 4DCMA 5M5BA 4AUKA 2PY6A 5DM0A 3TQSA 1H1DA 1QAQA 3M6UA 2GAFA 1D2HA 1VPTA 3DR5A 2OXTA 2QE6A 2ZIGA 2JG3A 2G72A 4X63A 4OBWA 4YUWA 2GH1A 3A26A 4CTKA 2H11A 3DMFA 1INLA 4E30A 1BC5A 3G7UA 2B78A 3FPHA 3MCZA 1Y8CA 1XVAA 1L3IA 2F8LA 3LX6A 4HC4A 4C06A 3G5TA 2EX4A 2G8NA 3HVKA 4DM3A 2NXJA 2OBFA 4IKPA 5EVJA 1VIDA 7MHTA 3E23A 4LWOA 5DM2A 5CVDA 3CJQA 5EEGA 3A7EA 3HTXA 5FHQA 5DTQA 2Q41A 1X19A 2JH8A 3OZTA 4PCLA 3T7TA 4C04A 3JWIA 2ZCJA 5E2BA 1RI5A 2EJUA 3G8BA 3EVAA 3FTDA 2YQZA 2P3QA 4AZSA 1N7JA 2O07A 3WSTA 1YZHA 1NV9A 3IV6A 5EIFA 2OB2A 5T64A 5IKMA 4PYMA 3GXOA 4L7VA 4EMSA 1JG3A 2ZFUA 3HCBA 3IHTA 5GOZA 3THSA 3FPJA 4LECA 5CVJA 3CVOA 4OBXA 4ISCA 1JTFA 4RTNA 1R8XA 4RTOA 3C0KA 4M38A 3VSEA 3MTIA 3OU7A 4EVIA 2IGTA 3DXYA 2G70A 2BR3A 1AF7A 1L3BA 2KW5A 2ZIFA 2UYOA 3NTVA 4YUYA 3NDIA 3UA3A 4HTFA 3A7DA 3DMHA 3BXOA 1G38A 3QOWA 4XUCA 4PYLA 3AXTA 2HV9A 2PVCA 3KR2A 3EVEA 5KQRA 1O9HA 2GA9A 4AZWA 1G60A 1EQAA 2I62A 2ZLBA 1AQIA 3KQQA 4Y30A 4QDKA 3OZSA 1BHJA 3HVIA 5DXAA 4ZTBA 3ER8A 3MTEA 3NVKI 1TW3A 3BZBA 3EEOA 4KW7A 4BLUA 2YTZA 2IH4A 2PBFA 3BKWA 1JSXA 2C7QA 2IBSA 3PB3A 3EMDA 5DM1A 4CXMA 1UFKA 3SMQA 4R05A 8MHTA 2GS9A 4RVGA 3AY0A 4P7FA 3AXSA 2B25A 2OY0A 3KKZA 4KWCA 1O9GA 4DZRA 5HZMA 1R6AA 1T43A 1FP1D 3H2BA 2K4MA 5FHRA 2E5WA 4GOMD 3S68A 5GM2A 5EG5A 4X1OA 4AX8A 4PGGA 2P1DA 1XDSA 3KQPA 4GC9A 5FTWA 5CUQA 4DF3A 3EEYA 2UZ4A 4FSDA 5DSXA 4E33A 3GIWA 3AWIA 1XCJA 1JSZA 1WXXA 2B3TA 4MQ4A 2FK7A 4HGYA 1D2GA 5K0CA 2C7PA 4PIMA 5DPMA 1I9GA 3ELWA 5JUWA 3UBTA 1RI2A 4P7KA 4CKBA 2Z6UA 3FYCA 3B3FA 3TKAA 4RTQA 5G02A 2VDWA 5EKXA 3P9NA 3R24A 1VP3A 1Z3CA 3B7PA 2ZULA 3KQSA 3P9KA 3I9FA 4GEKA 5CIYA 4X61A 5EOVA 4CKCA 3DXZA 1WXWA 3L8DA 4C4AA 2HWKA 5FADA 5HIJA 4UOEA 3FRIA 4E2YA 1O54A 4DKJA 1JQEA 2AOXA 2CWWA 2QYOA 3R0QA 5EC8A 3UJ9A 1B42A 1KIAA 5K09A 2Z6AA 2P7IA 3I64A 3QV2A 4RSRA 1FP2A 1UWVA 3R3HA 1DUSA 4GOOD 4IV0A 5DX0A 1YZ3A 2PWPA 4RTKA 3KPJA 1NBIA 1WY7A 4FGZA 4RV9A 4CWAA 1P1BA 4PYKA 5K03A 2FYTA 2CMGA 4YV1A 3M6VA 3KQVA 3HCDA 4FP9A 4EQZA 3CJTA 4RVFA 4OA8A 3SVZA 4BY9E 1EAMA 3I53A 4HSGA 2P7HA 1BKYA 2PWYA 5JR3A 4FR0A 1YF3A 2HMYB 5FCDA 1F38A 2OYRA 5K0LA 3OU2A 1AV6A 1KYWA 1KHHA 1SUIA 4EKIA 2H1RA 3GCZA 2AN4A 2UYHA 4R6XA 4ER6A 4OQEA 3G2OA 2FPOA 4BP3A 1PJZA 4M36A 2B2CA 1YFLA 2AZTA 1P1CA 4BLWA 1X1AA 3MERA 5E8RA 5EIWA 3KQYA 1ZGAA 3DTNA 3A4TA 3FUVA 3CBGA 3NWEA 5DRYA 3FTEA 1RJFA 3GRYA 5HILA 2R6ZA 3C6KA 1JG2A 1V39A 2CL5A 2OZVA 2AN3A 3I5UA 2NNWB 2YUIA 3NWBA 4K6MA 3PFGA 2OO3A 3C6MA 3LGAA 3UA4A 2BR4A 3UJ6A 5K0JA 5KS2A 2UYCA 1SVUA 4YUZA 5FULA 5F2KA 1WG8A 5F2NA 4DCGA 4POOA 2CMHA 3KQMA 2AN5A 3EGEA 3GU3A 1F3LA 3UJBA 1M0EA 3SGLA 3NW9A 1JG1A 1DL5A 2AOVA 3BT7A 5P8WA 3UWPA 5DTMA 3HVJA 3UJDA 5BP7A 1D2CA 1XDUA 5E8JA 5LQNA 3PS9A 5B1SA 5CVUA 1P91A 3OPNA 5DT2A 2IH2A 2QRVA 3ID6C 3PX2A 4HTFB 5E1OA 4GBED 2JHAA 3MGGA 1HNNA 4JXJA 5T6BA 2R3SA 3FUXA 5U4XA 3REOA 3EVFA 3NDJA 3SXJA 5K01A 1MHTA 3EVGA 2VP3A 5BXYA 1TPYA 5K0EA 2ZTHA 3FRHA 5IH3A 3K0BA 5E2AA 4RTSA 1RI1A 2JJQA 2AOUA 4FT2A 2I9KA 3M4XA 2EFJA 2YXEA 2UYQA 2ZVJA 5EZQA 1ZKDA 1R74A 4ER3A 2XVAA 2BH2A 2WA1A 1P39A 3THRA 3TKYA 3RODA 2ONZA 4MIKA 5EKUA 5DM4A 4DQ0A 1RI3A 3B3JA 3O7WA 3MCTA 5C1IA 4GF5A 3UJAA 2ZW9A 5LQUA 1NW5A 3DH0A 3G5LA 2I7CA 4KIGA 3SSOA 2HNKA 4KVZA 2ZZMA 1YUBA 3DMGA 2PX5A 4E32A 3BGDA 4V0RA 1WZNA 3KR0A 4XUEA 3BWBA 3ORHA 4GOLD 4P7GA 5FWDA 3BGVA 1Q0TA 3FTCA 4F84A 2YXLA 2GB4A 1VE3A 2IP2A 3C3YA 3OFKA 3P9IA 1QAOA 4YV0A 4GOND 1SUSA 3FPGA 3F4KA 4PYNA 3P2KA 2AOTA 2B9EA 4DMGA 4E70A 5K05A 3ER9A 3DLCA 3OE5A 5K0FA 2P3LA 2AS0A 2XBMA 3VC2A 3Q7EA 2BM8A 2IIPA 3JWGA 5DRTA 3OE4A 1NBHA 3GJYA 5DX8A 5KYGA 3LSTA 1L3CA 2VZ9A 4PYJA 1N2XA 4RWZA 2IPXA 3G2PA 4O29A 3FUUA 5DTRA 1JG4A 4YMHA 4MHTA 3FUWA 3VYWA 2ERCA 1R18A 2ZIEA 4B17A 5CVVA 1YFJA 3X0DA 5D1NA 3GGDA 3DP7A 1YB2A 4HRAA 4ER7A 3EVDA 5E1BA 5E9QA 5HOQA 3KPUA 4QQNA 4U7PB 3TPZA 3ELUA 1QYRA 1ZGJA 2OPBA 3PX3A 2XVMA 3M6XA 4OA5A 2NXNA 4P7JA 5E1DA 5E9JA 3SSNA 3KPVA 1ZG3A 4YUXA 2PX4A 4RTJA 3PFHA 3HEMA 1ORIA 1WS6A 1EG2A 3HA3A 4RTLA 5ICCA 3LHDA 3MQ2A 2OKCA 1NE2A 4R6WA 3DUWA 3KU1A 3MAGA 1L9KA 3TMAA 3LCCA 3TM4A 1X1CA 4RTRA 3JWJA 4HG2A 4LWPA 3GRRA 1G8SA 1NW6A 3ME5A 5T67A 5FWAA 2ZSUA 3KHKA 2FCAA 2FHPA 1KPHA 2WA2A 2PXXA 3MHTA 3PLAE 2AOWA 5HFJA 1M6YA 3LDUA 2XYQA 4RYLA 4AZVA 4YV2A 3PT9A 3P71T 5K0BA 4FT4A 3CC8A 5CCXA 1VQ1A 2ZZKA 4MWZA 3SX0A 2GLUA 3TM5A 1N7IA 3HA7A 3HCEA 4RX1A 4QPNA 2ADMA 3TRKA 1L1EA 5EEHA 1R8YA 3FPEA 3SR4A 3M33A 4M37A 1AQJA 2JHPA 3V97A 1ORHA 2AVNA 3B3GA 3M6WA 5ICFA 3TOSA 4IV8A 4QDJA 1XXLA 5EMJA 1EJ0A 2HR1A 1KPIA 1VP9A 4LG1A 4EKGA 4C08A 1SQGA 1RJEA 5HIMA 1FJXA 4GQBA 5DSTA 2IDKA 3BUSA 4A6DA 2CKDA 2JHCA 3EVBA 2AR0A 3U81A 3Q87B 3HCAA 3RIEA 3BWMA 2HTEA 3LDFA 4R8RA 4Y2HA 2P8JA 2PSSA 3UJ7A 5LQCA 5CVEA 2BM9A 2PX2A 2IH5A 1FPQA 3P8ZA 2VDUE 5LR6A 3G2MA 3GRZA 3P9CA 5DLYA 3R9XB 2VS1A 3LKDA 1G55A 3OZRA 1KYZA 3LPMA 4XUDA 3DXXA 4P58A 5KQSA 2QRVB 3ANXA 4IWNA 4F85A 4PYIA 2PV0A 3G2QA 3GDHA 4H0NA 4QTTB 5LQKA 1ZQ9A 3B5IA 4ATNA 3MB5A 5GM1A 2AOUB 2ESRA 2LD4A 2XYRA 3I58A 3CCFA 3OU6A 2BR5A 3EGVA 3E05A 3UJCA 3ELYA 4YUVA 1XCLA 5FQNA 2YX1A 5GIPE 1QANA 5EMLA 3EPPA 1SQFA 2PXAA 3KR9A 1TW2A 2XYVA 2O57A 4PONA 3OFJA 5LQJA 4FS8A 2FK8A 4QTUB 4ER0A 4PYOA 1EJ6A 4MTLA 5ICGA 3DOUA 2QY6A 3FPFA 1OR8A 2Y1XA 3GRVA 2A14A 3NJRA 2O05A 2ZWAA 3O4FA 5EMMA 1G8AA 1JTEA 2H00A 4RVHA 1R00A 3G88A 4EK9A 5BW4A 1EIZA 1IXKA 3BWCA 3KPYA 5FUBA 2C7RA 4KDCA 4PWYA 2ORED 5EGSA 4ER5A 3IYLW 5LQRA 5GIOE 10MHA 2PT6A 2AOTB 3HP7A 4QVKA 5K0GA 1XJ5A 3LL7A 1SG9A 1KPGA 3G8AA 4DA4A 2FRXA 2IBTA 3V8VA 4X41A 4E2XA 3LDGA 4PCAA 5EHGA 3FZGA 1ZHFA 1HMYA 3LCVB 5EHIA 2DULA 3CKKA 1RI4A 3E8SA 4QQKA 2Z6QA 4PNEA 3CJRA 4GC5A 2I6GA 3LECA 2P35A 2ONYA 4E31A 4CKEA 3FYDA 3P2IA 4XCXA 3KR1A 3BGIA 1NKVA 3GO4A 1IM8A 3G89A 4BLVA 1UIRA 4Z2YA 3CGGA 3VC1A 3D2LA 2ZBPA 4AZTA 1DCTA 4HGZA 4G56A 5LQAA 4FZVA 3DULA 3UFBA 3SSMA 2YR0A 5K8VA 5HIKA 4PINA 1U2ZA 4E2WA 2G71A 1I4WA 2P41A 4RVDA 3UZUA 5CCBA 2PX8A 1BOOA 2EJTA 3TR6A 2BZGA 3B89A 3KQTA 2IDJA 5ICEA 5FQOA 1X1BA 3R6TA 3LCUA 4C07A 3K6RA 2G1PA 3EMBA 5DX1A 3HM2A 2C7OA 3BWYA 3M70A 3DLIA 4KDRA 2P3OA 3E7PA 1M6EX 4C05A 4YMGA 3T7RA 2JH9A 2IFTA 3TFWA 1NV8A 4RTPA 3HCCA 1JR4A 3GNLA 3IEIA 5C0OE 3P2EA 1IY9A 1X1DA 4V0QA 3AJDA 3A25A 4CTJA 4M7RA 1SKMA 3HNRA 1VBFA 4QPPA 2DPMA 3EVZA 3HVHA 5F2OA 3T7SA 5C9ZA 5K0NA 5EQJB 3HCFA 3KPWA 2AVDA 2QM3A 1QAMA
chains in the Genus database with same CATH superfamily
5GADl 3D8RA 4D8TA 3IJ5A 1UPFA 4DKXA 1UWCA 4R1TA 3WS7A 4H1WA 4YMLA 3DVLA 3F6YA 2AD5A 3C8UA 3HRIA 2BGNA 4R2WA 4WLEA 4QLBA 3DE5X 4BNVA 2J5XA 3D4BA 1NLMA 1CVIA 3AGQA 1WUJS 5HFAA 3BRWD 3WMXA 3N58A 2Z2JA 4MB2A 3EUFA 2ACKA 4GMDA 4UOQA 3RUPA 3I6MA 4TSFD 1LDNA 2C4HA 2E48A 3X2EA 1VLZA 1TUIA 3IE2A 3W4IA 4BL5A 5LDHA 1AKRA 3MBOA 3LY8A 2AD1A 2HHJA 3AOEA 3KQWA 1QFXA 4S1PA 1ZLXA 2P40A 3ND8A 4RHYA 2BTEA 1SXJD 2I1QA 3TNFA 2B7CA 2WTEA 4TS4A 3OQOA 4LXUA 2B61A 2XT0A 4EVSA 3ZD7A 3SZUA 2EZUA 3UMCA 2Q3CA 3KYCA 4TLDA 3Q10A 2WJVA 2JJ2D 2WWYA 4X93A 1QIDA 2XNDA 5CM2Z 1CZNA 3GRCA 2FGKA 4G8BA 3KSMA 5DLPA 5EIBC 5BVGB 5EHZA 3RVJA 3NJ8A 3QKSA 2W8BB 3G1UA 4QM7A 4BFTA 2OBBA 3IO3A 4YP0A 2D5CA 1Y3FE 5DYIA 2CB0A 4F4FA 1SKQA 1B41A 4OMDA 4E4RA 4DMMA 4TLMB 3UOWA 4B7XA 4CGZA 2K7ZA 2I8AA 2WJ6A 2ZI3A 1EB9A 2C03A 1KMNA 3X1JA 2A5JA 1J2EA 1JA9A 1Z88A 1U1GA 3NHRA 4DCMA 4YJ2F 2CLSA 4G41A 2HRRA 3FPBA 1KQNA 4PSUA 4KYUA 3UTDA 3C15C 3QUTA 1FDUA 5G4KA 1LV7A 1Q7GA 1WO8A 2VDQB 3DB1A 4QYIA 4EI8A 1JT9A 3A26A 3FCYA 4IJWA 4CV2A 3JVEA 2QY9A 1LKZA 1NDQA 2B78A 1XG5A 2AJCA 3PDWA 4YLEA 4K6OA 2IXGA 3G5TA 5KOJB 1QH1B 1TZKA 1UKZA 5C34B 2X40A 1DE0A 1P1JA 2QAJA 2V9ZA 2YY5A 4RL6A 3VHLB 2BFDA 1O94C 2FWAA 4KR9A 3B7GA 3DS8A 2F9MA 3N2YA 3K8OE 3OZTA 3F5FA 1Y7HA 2GF2A 3G8BA 4IM7A 2OD7A 2F9FA 4E3ZA 3WSTA 3QNWA 1L6IA 2B1QA 3I8XA 4OXYA 3GXOA 2ANCA 1T4CA 4QU0A 1I4OA 3UK6A 3S1AB 1VE7A 2GASA 4KR3A 1I30A 1SC1A 4WA7A 4UC0A 4LRYA 1RRGA 3P2YA 1PG5A 2O1XA 2EYQA 4QBHA 5FNVA 1VMEA 5JSKA 1JMKC 2CCJA 2QTTA 4FDVA 4JKIA 5ALRA 1FXSA 5EWMA 2XOXA 4RJTA 3FMGA 5DK6A 4E5SA 1MLDA 4CKYA 3CZ5A 4C88A 4W1RA 2H54A 1QBGA 3HN6A 4AI6A 1KEEA 2BEUB 2H06A 1GQQA 3K5PA 3K1AB 3LBHA 2VH5R 1U3VA 1YIDA 3GXBA 4JB2A 3O8QB 4YI3A 5T8KC 4R0NA 4DUGA 3BMOB 3MOIA 3JPYA 4RQAA 5DTJA 5A2QA 2J5RA 3PE6A 1P2TA 3O8DA 4LXHA 1C9YA 2BGLA 5G3YA 4YRPA 3BZBA 1F6WA 1OI7A 5FLEX 3REQA 4RV4A 3A4LA 4W7HA 3K0KA 5TQ2B 2VPPA 5BWOA 3R5SA 2M6SA 5F3RA 5F64A 5IDWA 5DM1A 3S0JA 4GRAA 1ADFA 1I0IA 4N03A 1DEXA 4IINA 1CETA 3WGLA 4YV7A 3EWAA 1NHGA 4NYIQ 4R3WA 3ZV4A 4HBGA 1TO2E 3R5TA 4CL0A 1R8SA 3I9JA 1UBHS 4KYVA 2FMXA 4DF3A 4DV0B 3SQMA 5B30A 5FOXA 2ECKA 4UXIA 2R5WA 3TVDA 1Y8AA 4OQZA 2JI7A 1JPVA 1XCJA 1CZKA 2ZPUA 4GPEA 3WK8A 4PLYA 4MQ4A 4RPLA 4NZ9A 4HGYA 3ZWOA 2OAQ1 2PS9A 2Q9BA 3PQDA 5TMBA 2H1SA 5U4QA 3UH1A 4AP5A 1E3LA 1RI2A 1MUUA 4CIBA 1E7WA 3U4CA 4L9WA 4CKBA 3LKBA 1CIPA 2AR7A 5B3LA 3CZMA 3CNBA 5AW2A 1GL9B 2BMAA 3B7PA 1XP8A 5M04A 2GF9A 1Z5OA 4RD6A 2UYGA 2QS9A 4ITUA 4JNCA 4WZ6A 1XMIA 3VJLA 4CIDA 1VXRA 1NAIA 2B6HA 1LFAA 1NJGA 1X80A 3DVSX 4WCFB 5DE3A 5JISA 3PEWA 3R0QA 3IMKA 1DAKA 3TB6A 4F4CA 4BXOA 1KY4A 5FUVA 3T5GA 4AJOA 3KVNA 5F7XA 3ZU6A 1MIOB 4TV8A 4FGLA 5JECA 4WVFA 3I34X 4H6PA 3QLJA 3OEHD 5D2CA 1RAIA 2C54A 3EYAA 3LFTA 4HBZA 2E5LB 4X20A 4IH9A 4AMUA 4EYQA 3KKQA 2QRHA 2OCAA 1TM3E 4BY9E 3RWMB 1KFEB 1AB5A 1Z13A 1ZJJA 1A8PA 3OU2A 4MA5A 3O6VA 3QVMA 5EE0A 2WR8A 4FFOA 4UEOA 2VYVD 4ZQBA 4ZRDA 5CFQA 3AQIA 3KAQA 5FLKA 4UTVA 3EFHA 4D45A 1RFLA 3ASUA 3UWDA 1YZUA 4F2WA 1YS7A 4K7JA 2EFGA 1JJBA 1KQ3A 2OM6A 2B2CA 4IRMA 4WNIA 4ZI2A 4FYYA 4RHFA 3VU3A 4M76B 4D92A 5ED0A 3JARA 2WWIA 3OZDA 1KGDA 4Z3DA 4LMPA 1G42A 3O47A 1M6HA 3TSCA 2ID9A 2RCYA 1XRPA 4LSGA 4F2GA 2JAXA 2Y1DA 2Z57A 2O8BA 3V4OA 3GX1A 4C20A 1DC5A 1GCOA 4LZWA 4D4HA 4GP6A 3WBFA 3WYEA 3CR7A 1IQPA 4XAQA 3AHGA 1GDTA 2LDXA 4DCGA 2CMHA 3TLZA 3HWWA 3ZYCA 4DC9A 2B1RA 3D64A 1XDBA 3EGEA 2YZGA 3R0VA 2KM1A 4UJ3A 4YAWA 2NU9A 2QMOA 3TMKA 5C32A 1M0EA 2QLMA 1HL3A 4HWSA 5HUQA 1SA0B 4BCCA 4V3BA 2WU3A 4R2XA 5KVCA 2B99A 4B79A 4CV1A 2ETXA 3TSZA 4UASA 4ZA2A 1ZR4A 1ISIA 2VTDA 1DIAA 1OFUA 4X5OA 5U4XA 2O1EA 3W8FA 4DRZA 5ALMA 4M60A 5EIOA 5CB0A 3FRHA 5IH3A 4IGFA 3WLTA 2BM1A 2EZ9A 4H16A 2GVDC 2I9KA 3TW0A 5K6AC 3GJ3A 3M4XA 1ZFNA 3FWZA 2JIZA 3CN9A 5FOVA 4KVGA 4EVRA 1YL6A 4BNTA 4OB8A 1WKCA 2C4TA 2XVXA 4DLRA 5IVDA 4DQ0A 2I4TA 1OX5A 2A8YA 2DJ5A 3L0SA 1EP9A 3MCTA 3KOUA 4ZEMA 4M0KA 1VCHA 4LF7B 2R25B 4WEQA 2RH5A 4OK3A 3RSHA 4MQLA 3RE1A 3T5BA 4YCNA 1TM5E 4GBJA 4I4TB 5CJJA 4B0OA 4ZALA 4LPSA 1WZIA 3W3AD 2YNMC 2H5JA 5JNTA 1NMZA 3M6FA 1TRKA 4HX9A 2X4LA 3JZAA 3WGIA 3CVYA 1FW8A 1WXGA 4YP6A 4KVAA 5ALLA 3D8BA 4TZKA 4PG6A 5AD1A 5GONA 3PNPA 1M66A 4OKNA 1NJ6A 5LU8A 4EHLA 3VR3D 2QAGA 3WGYA 4C6TA 1RD4A 1A8UA 1QV9A 1O0BA 3OE4A 1DKQA 1TD1A 2A33A 1ZD8A 1CHDA 3EBLA 2V6BA 3ENNA 1PNVA 1L5FA 1ZL2A 4MCJA 4HEA6 4RQTA 3TIFA 3TZHA 4ARVA 1TM2A 3CIFA 3LE8A 3MS2A 4OL9A 3ZI4A 1HZZC 5F35A 3UK0A 1DG1G 2WIBA 3LNCA 3QLTA 4F4JA 3R7DA 4GP9A 4YRSA 1F2DA 4Q7JB 1PW7A 4P0PB 3U4GA 1YIAA 3K6KA 3WGHA 1YUNA 5FXMA 5IHPA 1LVGA 1DRUA 3HBAA 4QAQA 2FE1A 2B8EA 4O4IA 4D97A 2H2HA 4KXLA 3IAXA 3G0CA 1GP2A 4ZDJA 1IWPB 1DBSA 4B8ZA 4RD2A 3U4HA 1GAEO 2VNAA 3DMDA 2L69A 2PO5A 2IYOA 2OP0A 1Z6TA 5L3ZA 4EF6A 4CQMA 1KQFA 1WOMA 4PSCA 2O3SA 5JJLA 1F2VA 1F6BA 4MVJD 2WTBA 1JPJA 1N6OA 1UAYA 3MWFA 5G4LA 3MNFA 1HETA 2HCRA 3A0UA 4IHAA 2X5KO 4MUGA 3OO0A 4A1FA 1Z7WA 3GBVA 5H9WA 2YWDA 1KYVA 1W48A 3AR9A 1JHXA 4QNMA 2R47A 4RE5A 5AM0A 4IMRA 3DEKA 1KI6A 2Y4OA 2ZDHA 4BBZA 4F97A 3ZY4A 2QPTA 2XYQA 3IB6A 2VJMB 3B70A 2N0SA 2NVUB 3AKZA 2ECFA 1K3FA 1YUMA 1FFEA 1CV2A 4XX0A 2GLUA 3KXPA 3ADCA 2N75A 1KZYC 5GV8A 2ZI6A 2BZSA 2IQIA 2ZU6A 1M2JA 2HADA 4XGKA 4A8JC 3FDIA 1M34B 3B3GA 1JSCA 3CRZA 4JL6A 1PV1A 4J76A 1DS6A 3QPVA 4MUMA 4NU0A 3RK0A 3TOSA 3OTOB 3NANA 2HR1A 4RK5A 4TL6A 3ZWNA 2YN2A 1VJTA 3OP4A 1R0BA 5HCIA 1ZD9A 2IZZA 1RZRD 3VUFA 4XH9B 4N47A 1TA9A 1JIKA 5ALFA 1B3BA 3BUSA 3ZCQA 4I4TF 1J6UA 1V7QA 2DBZA 2ZYIA 3WLMA 4AM8A 3CGWA 4RKWA 1N57A 2B6NA 1EWYA 3AEUA 4LBWA 3UMGA 2BM9A 3AEQB 3OIFA 3DOFA 5EZYA 5BQPA 2WAOA 3I12A 4U0KA 5ERYA 3UYLA 3ZHXA 1NVVQ 1QTQA 3DE1X 2W70A 1UBRS 2JGNA 3HCOA 3KAJA 2H5EA 4ZT4A 3STHA 3ZDFA 3TQFA 1LI4A 3DFMA 2O0JA 1CW2B 4I81A 2D5LA 4NV0A 4K9KA 4PZCA 4ENRA 5KNDH 2MSKA 3LT0A 1E8DA 3RTCA 5K6AA 2LV8A 4FX2A 4NZPA 2FEMA 4JXZA 1KVQA 2XE8A 4GU5A 4J9VA 3G2KA 4H0NA 1NLFA 3S1SA 1LI5A 1UK7A 4Y2TA 5JAPA 2FMKA 2B4AA 2WSSA 4S35A 5BN5B 2JEZA 3MB5A 3NNDA 3TGWA 5B4TA 5BR1A 4UHDA 1M1YE 4HAXA 3UG7A 4X54A 3JQ9A 5DBEX 5K7SA 1MB3A 3D7RA 3O83A 5TGDA 3TDKA 3QEOA 3D1VA 3OEWA 1PUJA 1X42A 2DGDA 2I34A 4S1TA 4L75A 1TCVA 3E3MA 5CW2A 4OXQA 1F1BA 5IDQA 1C8VB 5IT9A 4YRZA 1W36C 1Q20A 1R0LA 1RQPA 4LYEA 4JJ8A 2ZWAA 3B13B 4BKOA 1G8AA 3WL5A 4F3NA 2IHNA 3G88A 4JUAA 1JRLA 5TSDA 1CPYA 3GZNA 4GWGA 3IALA 4TTVA 4CEHA 3VKHA 4KDCA 1URPA 2ORED 3W8EA 1A9QA 1Q44A 2VAMA 5D3QA 3ZKWA 5JHHB 2AKEA 1T2CA 4K28A 5K0GA 1E3WA 2IK8A 3GFQA 3BD6A 5AK0A 5FF9A 4LBYA 1GTJ1 2FRXA 1XKTA 5BNWA 2IBTA 2VH1A 1CUBA 2A5YB 2FHSA 3A9TA 1LPMA 1UT5A 1T3GA 2XGMA 5IKOA 1Z6YA 1H3FA 2UV8A 4REQB 2B5WA 4GC5A 2GJSA 1I2BA 3QVUA 3OO1A 4ND3A 4JJ6A 4JS0A 3V3KA 1TMKA 5BSFA 3OPYA 4E2YA 1NC1A 3EGWA 1NASA 1Y5MA 1AZWA 5M2QA 3J81A 1ST3A 4CL3A 5AVVA 1IEQA 2VF5X 1SCUB 1ZUIA 2AQKA 3O1LA 5DP2A 4UUBA 5ALXA 5T4EA 2VHEA 3A6LA 1QXSA 2DH6A 4PINA 2I76A 3UFXB 4IIBA 5JS7A 2J3LA 4WKGA 2F4NA 3MCUA 2QX6A 3NKVA 5C53B 2CFIA 4MV4A 3W6UA 2BBOA 3S2YA 2ZUDA 4LHYA 1D5CA 4O02B 2R9VA 1CCWA 2YCLA 4IL5A 3EMBA 3LY7A 1AN0A 4XOIA 1PG2A 3A6DA 4FB4A 5C2JB 4XQCA 2GEJA 4ERXA 4WXEA 4NHEA 1R16A 1U31A 5ULLA 5IAKA 3TFWA 1Q16A 2WDZA 2WU1A 3KNZA 2GBLC 3OKPA 3KZNA 2HLNA 2Z58A 3U19A 3WLRA 3X3HA 2DBYA 1CX9B 4YTEA 3UVEA 4HDRB 2FQYA 1Z25A 2E87A 3LYAA 4BNXA 1N78A 1WPQA 4AWAA 3SIWA 3E9QA 3WL6A 5JJCA 3D4NA 1RLUA 1UH5A 1D9ZA 2Z5LA 4M0DA 1W46A 4WHMA 3TUZC 3HDGA 3LVQE 5CCEA 9MHTA 2QMQA 4IR7A 5D87A 3R76A 2VNIA 3X1WA 3GUCA 4IMIB 121PA 1FBNA 4ZICA 2ZM5A 2OB1A 1RYEA 5LZ7A 1P2SA 4L16A 1BW9A 2HWYA 4ZU1X 4BRWA 4F86A 3DBLB 3UENA 2XDYA 3PFIA 1AUOA 1J56A 1RADA 3ZV6A 4HH4A 1R5NA 4KYTA 3GPBA 2WQ7A 2Q3EA 1ADBA 3JWHA 4E2ZA 5LWQA 1T9BA 2DYKA 2OR3A 3NNNA 4IXDA 2JGRA 1N3LA 1DKNA 1I6KA 2TMYA 3EGIA 3K1YA 4I4IA 3V1NA 1VIVA 3IQFA 2PGXA 4YCLA 1K0UA 2HHCA 1GSOA 3GD7A 3W9SA 1AQ6A 1IXSB 3FNQA 1K5HA 2UUAB 4QICA 2GCNA 3EW7A 1VSQA 4HMQA 1K0FA 1FSPA 3V1KA 3BEOA 4QOSA 5C5CA 1RRKA 3V80A 4Y9SA 1ZXLA 3ELDA 3O91A 4C4OA 3DDWA 1IBKB 1U0FA 2JKZA 4P0TA 4P84A 5AUOB 1E96A 1Q2XA 2CBXA 3PFKA 5MFPA 4IJKA 3D3JA 4EJSC 2OXIA 4KWHA 3S4YA 4B2YA 3QI2A 2YFKA 1THMA 2NAFA 1XLWA 4HDNA 4OAQA 1L4HA 4QTXA 2HCBA 3QKUA 4YCBA 3TR0A 3BHMA 1PO7A 1T5IA 3HL4A 3OCJA 4P32A 5CT9A 4DDMA 3PUYA 1KMHB 2GAFA 4CMBA 3MTBA 4L8GA 4JC4A 4GOXA 4OBWA 4L6CA 5IS2A 3T06B 2JASA 1WZCA 3MG9A 4BMNA 3LP8A 5CGZA 4MQFA 2KSQA 2NOAA 4C06A 3LX6A 4HGRA 4DABA 4RVOA 4I5IA 4R98A 1R0CA 4PM4A 4GSLA 5EVJA 4U00A 3OJWA 3ZNNA 2P6MA 2QTHA 1GO2A 1F06A 3D54D 5MN4A 2Z9BA 4I99A 1ADYA 3OX2A 4EELA 5DTQA 3DAOA 5HWSA 2WW8A 2VUSA 4EPWA 1RQ2A 1YDWA 3GK3A 4TOIA 4L78A 5A7GA 2XTZA 1AN9A 2FF5A 4TKVA 3ZW7A 5K20A 5J2UB 2O07A 3WP1B 1X0XA 1NF3A 2RARA 2OXCA 1VYTA 2YCBA 3JWEA 5ECGC 4L7VA 3ZGYA 3ZCVA 4CKEB 2WNHA 4DAOA 2GPAA 1AUXA 2NWQA 1GADO 1H8HA 1N2ZA 1SO8A 1I7LA 1U2GC 1XGKA 2AFHA 3L0IB 3O8OB 4TT3A 3T1YB 4LHSA 3QKRA 3UW1A 4AG5A 1DTEA 2JGDB 3TE7A 3ZHOA 4BNNA 5KWJA 1H9BA 3MMXA 1BO6A 1PBTA 2C4WA 1G5PA 3H1AA 1NMXA 3O8NA 4Q39A 5TT0A 4CKCA 1JEQA 3CF4A 2G70A 4EPRA 4LZZA 1JBQA 1VE6A 4H4CA 4XJVA 1P5RA 1V2HE 3DBRA 1PIWA 3L7KA 3KXDA 3NTVA 5CIQA 5CVTA 4HTFA 1G3RA 1NSFA 1V9LA 4AIIA 2GBLA 2H4ZA 4EKYA 1JHZA 3W7VA 3DMHA 3QVVA 4R68A 4AN0A 1I10A 5LQSA 3A36A 2OFWA 4YDHB 2P9GA 1ORRA 2WD7B 3TLCA 4HNQA 4EATA 2LXNA 2OV4A 1V26A 2AUMA 1U9JA 2CHQA 4DA9A 3N3BC 5HZKA 4TLEA 3EQ6A 1N2CE 1M5TA 4RKEA 1L4YA 2AWNA 1P2UA 3FDJA 3IKLA 2G4LA 5AK5A 2YW9A 3CZ4A 4RS3A 1EE1A 2YVKA 1VSTA 2Q3FA 4HEQA 4E15A 3QPWA 2DERA 1YJCA 2GS9A 1KAOA 2BY4A 3O1HB 3PXAA 3V42A 5JRJA 2MSDB 1YNOA 3KJNA 4HPXB 4EVQA 1RMQA 1ITZA 3QHPA 1QVVA 3VR5A 1PT6A 4RMGA 4JYZA 1W25A 5AW6A 1NMSA 1V8FA 2IEZA 1LDMA 1J00A 2R97A 2ZJFA 4C7KA 3THXB 3CBQA 1YR2A 2P2DA 1D3AA 3LUFA 5L4SA 4JL8A 1U0HC 4E33A 4B85A 3ZLTA 4K8OA 3AKDA 3THWA 3RRXA 3HDQA 4OFXA 4B81A 4N39A 4NBWA 5EZ5A 3OOSA 4QELA 3LV8A 1QHGA 1I7NA 3T7KA 3WYBA 1H2HA 5JPIA 1YDEA 1QVZA 4P7KA 4ZAFA 1AS0A 1LD3A 3H2HA 2F00A 4GI5A 3KWLA 4GPZA 4X7PA 3L4KA 1KK0A 3Q41A 4DV3B 2A57A 2PBZA 4LJ5A 3PUVA 2P2CA 5LJLA 2V7PA 3UNXA 4C4AA 4GT1A 4DVJA 4OATA 4WZAA 4XD7A 4U7DA 2PMBA 2WJGA 3JYQA 4P0QB 4W5OA 3AU8A 5I9BA 2NSLA 4HVLA 4G81A 4B3JA 4PPGA 5IW8A 1ZA1A 4RK0A 5J2UF 3BJIC 2R6HA 2LCQA 3Q8MA 1GNQA 1XA3A 3QE3A 3HZOA 3JD4A 1WKBA 2GD6A 1T4MA 2WU4A 4KFRA 3TEFA 4L4ZA 3E84A 2IE0A 3Q6NA 4G1VA 3E3LA 2W6CX 2QN9A 5AVRA 3O0TA 2DHEA 4L2IA 4YMIA 3ZGVA 4TKUA 4UDYX 3AP3A 1DKUA 2R5FA 4FYKA 2V7QD 5EESA 3TW8A 3U9TA 5BURA 3U2QA 3PFFA 3TL2A 4TZ0A 1MH9A 3CTMA 3EXAA 1LC0A 3NYIA 4LV8B 5EA2A 1UBLS 1G7CA 2X2OA 2H7VA 3CSDA 1L1RA 3EDMA 1MB4A 4HFMA 1G16A 1WHSA 4OVKA 3BDVA 4DJFC 3H4MA 4LBVA 2OILA 3ZNQA 1A4XA 1U2DA 3ZEIA 5C1PA 2NQ8A 2ZU0C 5JSHA 3KZ1E 4Z9AA 4D0SA 3I2YX 4AKEA 4OGWA 5ES3A 5DCWA 3FCOA 2QN6A 4J3JA 1OBVA 3IR7A 3UC5A 5FUMA 5G40A 1LDGA 2GBCA 1Q11A 3IPLA 1N32B 4AJIA 4Q34A 3U7HB 1GDHA 3LO5A 4MR8B 2OZVA 3NGMA 4E94A 3I5UA 1PJ3A 3O2SB 3NWBA 2WILA 5GTDA 3CUYA 1C3XA 3C6MA 3H4TA 5KS2A 1R4MB 1ULAA 2PVSA 4JLVA 1WDTA 2QT1A 4L5CA 5B36A 1OX4A 3OZUA 3C3MA 3IPRA 3KRTA 1OBHA 4KN8A 1Q0QA 1IXZA 4MYSA 1FW6A 3J81k 3F97A 1C7EA 2QZSA 5LDDC 4J1NA 3ZLBA 1S2OA 3UW3A 2ES4A 3ETJA 1EDOA 2QLJA 4C4ZA 3QBTA 1IU9A 1KMQA 2VP2A 1XTIA 3OM0A 1IUOA 1K9SA 2CEAA 2GXSA 4KE9A 3D31A 2PFSA 5BP7A 1UOPA 2W6QA 4D6PA 2ZYAA 4B82A 1CUDA 3ROGA 3GFSA 2QRVA 3L0YA 5KOYA 2GF0A 1SQSA 2WZCA 3MGGA 3P9QA 1EVEA 4H18A 3ZWYA 3EVFA 3SXJA 4ZCIA 2XGJA 3FMVA 3GYGA 2DKOA 3MGCA 2JJMA 3PD7A 3FSGD 1XOIA 3PXDA 3KQHA 1H3EA 3ICEA 5IBCA 1A2QA 1I4TD 1QYXA 2YWXA 2YXEA 3U09A 4KQMA 4ER3A 2JJ1D 4BDSA 1ZVMA 2W58A 5K4AA 3I2IA 3UIEA 3W04A 4I50A 2ENUA 3Q11A 2YFHA 2HT1A 4S3MA 1A97A 2FUNB 4HQNA 3C5VA 2C0QA 1P5HA 2YVUA 4O4JB 4WZZA 1BMQA 2GZHA 3CSUA 3E1KA 3HZZA 2ZE8A 4L07A 1WZNA 3TD6A 1LVUA 3F5QA 3WRXA 4DIBA 3BWBA 1ZK0A 3KZVA 2X0DA 3Q8KA 3G13A 1QHYA 1BS2A 2YYYA 5HRUA 4YRKA 1TEVA 4ZP1A 3C24A 4EPVA 1XFDA 1O8CA 5CB4B 1HNWB 4ZO8A 2HGZA 2WAMA 1O95A 4G65A 1WXHA 4NTZA 2ABWA 1W0JA 3BXGA 1PL7A 3HRKA 2F17A 4TV9B 1XAJA 3DHWC 1P3DA 1TLFA 2HUPA 3ORQA 4ZYUA 1SXHA 2EKPA 3EFOB 3Q7EA 1FRFS 3LWNA 1IJBA 4Q6BA 3WNQA 4EKDA 1NBHA 4YRTA 1DNPA 1G4UR 4JI2B 2VZ9A 4J3FA 4R54A 5JD3A 3QE9Y 2YL2A 3JVDA 1JG4A 2VDWB 4CQLA 3N3AC 3ZIAA 1SOMA 1A4RA 2IPAB 4HDAA 3VYWA 1WX1A 2J31A 5L53A 3H18A 2JC3A 4RY0A 1EFTA 1GUDA 3DV0A 4HDSA 1UKCA 4GI1A 4RABA 4Y67A 3RM3A 2XQVA 3P7MA 4DLVA 3A2KA 1TMYA 4M49A 3AKCA 2NV0A 1JWLA 4HS4A 3NM5A 4EECA 3C43A 2NUAB 5DNAA 4BNZA 5JDCC 1Z0IA 3H5IA 4MULA 5E0KB 4G1UC 2C8VA 3KPVA 4E1BA 4LRUA 2ORYA 3NBZC 4IIJA 2JK1A 1KIFA 1E7YA 2V6GA 4PFQA 1FXWA 3AY3A 2D4AA 3OLZA 4F46A 4YMTA 4NAVA 1F8GA 3MAGA 1L9KA 3EIHA 1EWVA 2HOQA 1Q3TA 3C4QA 3EPHA 1E58A 1RXSA 1Q50A 1WB6A 5BSKA 1U7UA 1OD6A 5EPUA 2HJRA 2PZGA 5A06A 1XL1A 4ZEXA 1JBEA 1PT9A 2CDAA 2PXXA 1XZLA 2DUMA 1PD0A 4AP6A 1MRNA 4H9GA 4KSCA 4CMKA 2NTEA 2JFWA 2ZSFA 3L0OA 4XWKA 3GLHB 4H2DA 2GK4A 4KQ1A 3U4DA 3WIBA 3JR3A 3QLUC 1MAUA 4WFQA 1IH8A 1MT3A 2I78A 1UKVY 4ZO7A 4N5NA 1J2UA 1BD4A 3F7OA 4QDJA 2VRBA 3ONNA 2GARA 3FVRA 1CJCA 1PGNA 5GY7A 2EDAA 2X3FA 4NU6A 4YHHB 3TZEA 1SQGA 3PSHA 2FVXA 1QDEA 4O4JF 3RABA 5J2TA 2YKGA 5DSTA 4HHEA 3F67A 2O5CA 4A6DA 3AKEA 3EVBA 2AR0A 2GJKA 1RBYA 3OSUA 1IQ0A 5HFNA 1EU1A 1G17A 1V3QE 2BRUC 2HXGA 2EIXA 2WVAA 2BV3A 1SVIA 4PE5B 2C2XA 2K5UA 1EXVA 3B52X 1RKUA 4FR2A 4TMKA 3T12A 4KWIA 5DLYA 3RUEA 4ASUA 3E0QA 4ZYWA 4IZ6A 5C5DA 4ENWA 3H3XA 1KI1A 4JBWA 2DAPA 2JRCA 4MRMB 3IVAA 3BK7A 4LBZA 3CU5A 1UT8A 4P58A 2KBEA 4V0ME 4JI6B 3WV5A 3LUJA 2XGSA 1N1EA 3B1WA 2ZRGA 5BOSB 3I9KA 4XB2A 1DIGA 3B5IA 4X1KA 4ATNA 3PHJA 3RT7A 4EPYA 1ZHOA 5DHFA 2ODBA 4KR2A 1C0IA 3WWDA 2PUHA 2W6IA 4FMDF 2X8BA 2EFHB 5CYFA 1N9GB 5I8WA 1HC7A 1FYWA 1OLSB 3W5BA 3P94A 2Z4RA 4XLLA 1UDXA 3UXYA 4D9CA 1ELOA 1EQ2A 2PGOA 1WQ3A 4FS8A 1GDDA 1JPNA 1LLFA 2B2NA 3IC5A 1SVMA 2JIPA 5F1YA 4ER0A 6NULA 1U8AA 3S70A 5ICGA 5ALOA 2FFBA 2Y1XA 1PNQA 4PC3A 4H59A 2UU9B 2X4DA 4X8LA 2XTAA 2PLRA 5FUBA 3UAXA 4F9TA 5AIBA 2I91A 1MP0A 2YQ4A 2GAOA 3DBHA 4IJUA 1LPOA 1HNZB 3W1VA 2C29D 1X1TA 1QPBA 1KI2A 1TJ3A 4QVKA 4GM0A 3LGXA 3OPYI 2KBFA 1OYYA 1SU6A 1WF6A 2LBPA 4X41A 3ZWPA 1FLNA 2QMEA 3AR7A 3F6PA 5C7LO 1NPTO 4HI0E 4RU1A 5T4FA 2OCGA 3FAKA 3E8SA 4J6FA 1UOQA 1ZSYA 1PVOA 5I9SA 1ZBQA 2CLDX 1NG9A 4PBTA 5A5VA 2AJDA 1T9GR 1GUBA 4LK3A 4YP1A 1U0EA 2PYDA 3FH0A 1NHWA 2WE8A 3H0KA 3JATA 2KE5A 1W87A 1WSDA 2VOEA 5JYBA 2X5XA 4LVCA 2ZTMA 5F21A 4D8YA 5HIKA 4JBHA 4JGIA 3ZK9A 1RTTA 1RCUA 2BFBB 2I3BA 3E2MA 2CSXA 2OG1A 5F3WB 4C2BA 4MUEA 1YWGO 5SICE 4NJMA 2F1JA 2BZGA 5CB6A 2JB9A 3P4XA 1DBQA 1Q7EA 2PKCA 2VR1A 3GLTA 4Z51A 2WJAA 3NTXA 3CSSA 1GV0A 3FMIA 2Q3LA 1PYDA 4EYGA 4MWCA 3EDQA 1E89A 4EI7A 5EL0A 3A70A 3I39X 4A0GA 4K9QA 3AUYA 4QOIA 1KFCB 4H4EA 2JFFA 1JR4A 4ND2A 3LM8A 2P5SA 4V38A 4MA4A 4I3GA 3P2EA 5BN4A 1F0YA 3AJDA 3R4VA 1G64A 2G25A 3OQIB 1L5HA 1CEQA 1UDBA 4GLJA 2FW6A 1UK9A 5FUWA 4JIGA 3BMCA 4WN3A 3L84A 2FZEA 1EGVB 1Z07A 1NW5A 1I80A 2R2AA 4DYDA 4DQDA 1M9NA 3KB1A 2R66A 4QVGA 2Q5HA 3ASVA 1GNTA 1NJFA 1OWOA 4R16A 1U02A 3TSOA 1Q0SA 4YJ3A 5EZSA 4KC0A 2VF8A 2CHUA 3CV3A 2P2NA 4G0QA 4XYLA 5JPDA 5EIXA 3WAGA 1DLJA 1PJBA 2Y0CA 2CK3D 3Q2OA 2PJDA 4M0MA 3WL8A 2HIHA 1CF9A 3HSYA 4NAUA 4KQXA 3T9CA 4NCIA 4EDFA 3ESAA 1DAFA 2QDXA 5FKJA 4Y2RA 3SOPA 1HOTA 4BJ1A 5FEUA 5DWQA 1FEZA 2X58A 5FPTA 2GBPA 3L0DA 2AZ4A 1JIVA 1Q1AA 3BS4A 4FZ3A 3RB8A 4BN0A 1IZ0A 3GRKA 1IAVA 2BC9A 5EYPA 3NXKA 5JU6A 4UNPA 3SHVA 4C03A 1U80A 1WABA 2CUNA 2HBYA 4NJOA 4OQDA 4FONA 3O0DA 1QPGA 2D5AA 4QUEA 5BNIA 1KAQA 1B6TA 2XV1A 5J23A 4TMZA 3W3ZB 1KVRA 3LWBA 2H4XA 4PR3A 4CW7A 2W2TA 3F46A 1TAGA 3R4CA 5EJ4A 2QSYA 4KI7A 1KBZA 4A6XA 1R0SA 1KZ1A 2PT9A 1G3UA 4QXPA 5CLQA 3SEQA 3LBYA 2KPOA 4MKRA 1IZZA 3HPRA 3OX3A 3DMTC 3GLUA 1NNEA 3AF5A 1JX6A 3OEYA 4GI3A 5ILQA 3CF0A 4LFCB 1QIIA 4OHXA 2ZRPA 5LA6A 3B6EA 3HWX1 1BRTA 1ZUNA 4JI0B 4R2MA 2K6GA 1O77A 5DNEA 2OXTA 4CMIA 5ALTA 1EGAA 4KSYA 4FKBA 3NX4A 1A7JA 2Z3WA 1J0XO 1T15A 4DG5A 1XDDA 1E2IA 1Z6PA 1VECA 3EGDA 2VHXA 2GN6A 1BC5A 3ORYA 2P6OA 2QN1A 4L0QA 4WXPA 1XVAA 1WHTA 3EW9A 5K2MA 3GPIA 2GZMA 4CT5A 4IHQA 4ILEA 3R3VA 2JIRA 2OCLA 3WK4A 4Y6GB 5EXDA 3DOCA 1IIRA 1IULA 3HYSA 1SR8A 3K70C 3JVUA 2AYYA 2XQJA 2GETA 1X38A 4FLMA 4G4JA 1GLVA 3SEZA 5JXWA 1NNSA 4QDUA 3RAJA 2QYHA 4ZIRA 4G4GA 4DBLE 4QUHA 1LQUA 3FPJA 4E5VA 5CVJA 3RC3A 3EC7A 4DW8A 2HXSA 3K20A 4OJYA 1JTFA 3ED1A 1V45E 1MPXA 1J39A 1W4LA 3BYZA 3LPAA 3C0KA 3NAZA 3ZGNA 1R5OA 2B8TA 2Y0EA 4BDTA 3GLGE 4X3PA 3WGVA 1TA4A 3DXYA 4UNNA 1JTVA 4RANA 1QMPA 3SZRA 2OZLA 2J5QA 2JARA 2ZJAA 3VM6A 5FTNA 3SE7A 2VI5A 1K4MA 4B80A 3PGMA 4GYYA 3UA3A 5IYZB 2VPWA 1TXGA 3I01M 5K45A 1U8UA 2QR5A 4HZUA 4MYRA 2WKQA 2J0SA 5ITVA 4EHIA 5ITWA 4CBVA 1AB6A 1EQAA 4RD1A 2I4OA 2IKSA 1ODFA 1ORTA 2GN4A 4IIGA 1KNQA 3RRJA 2PUBA 2P1ZA 3RAEC 4X3OA 4KRFA 1IJEA 3CEMA 4KQ9A 4BKMA 3DE2X 1SPBS 1VL6A 1QZXA 2FFJA 3B6ZA 1I14A 1Z7GA 3HKBA 4F6RB 2GD2A 3ACCA 3RHFA 2FWPA 2A5DA 3N9IA 1P9RA 4RH1A 1TZ2A 1E3TA 4F71A 2VC2B 3CH5A 1CIJA 3ETGA 3IDFA 2OY0A 4G1BA 4P7FA 3SOZA 1U7OA 4AQDA 4ZOQI 5JDIA 5G3ZA 1YAJA 1KO4A 1QYCA 5HZMA 4D26A 1R4ZA 1R6AA 3JTEA 3X44A 1EZZA 4BTVA 1A7AA 4IZIA 1RPAA 2O3QA 1P8AA 1Z4MA 2W4QA 3P45A 3QY9A 1XVTA 1XDSA 3MTQA 4N5LA 2LCIA 2WICA 2WG1A 2H1VA 2ZXEA 3EEYA 4FSDA 4L6IA 4QRHA 1I2DA 4TS1A 3O90A 3LT1A 1U7TA 2YW2A 1JSZA 4CETA 1MF7A 5DF1A 3D3EA 4OHCA 5DPMA 1ENZA 3A8TA 1XZMA 3DM5A 1Z4NA 3EJWA 4ZU3A 4LI3X 1C50A 4G8DA 1MJHA 5I4KA 3L0ZA 1EHCA 1A9XA 5G02A 4A2WA 3ZHZA 3NORA 3KOZA 3E7DA 4M22A 3SJZA 2L82A 4PS0A 4ZDWA 3OOJA 1NYRA 2Q5JA 1G8YA 3U9SA 2ACEA 3VC7A 1IRIA 2VPXA 3KYCB 4DCOA 3E9DA 4IUDS 2CNWD 5FBRB 2D5BA 4BFCA 3MLBA 4HGQA 1VOTA 2WYVA 4W7SA 4MLZA 3KVOA 1VE5A 2V8OA 5D5QA 3QKSB 2Q5OA 4AKTA 4N01A 1VC2A 2SKDA 3KPJA 4QHTA 4RV9A 3BL5A 1OHHD 1OGJA 3N8DA 4I1VA 4M9QA 1SH7A 1A5ZA 1SN7A 4IJQA 5JCJA 4KU4A 3AV3A 1DBIA 3KQVA 4LDNA 4FP9A 3GLIE 4EG8A 2HO4A 4BV3A 1ZM3A 4HSGA 3ICPA 1BKYA 2CNDA 1ZISA 1B3RA 1VSUA 2X1VA 1O5OA 3DPSA 4IGEA 2QENA 4YYEA 5B7GA 5IYZF 3VAZA 4H35A 1N33B 1C9JA 1PDVA 1HQKA 4XB6B 4D3YA 2RHDA 4G1MB 5G4KB 4TLAA 4UFOA 4QYIB 1L7EA 1QX3A 3RC7A 4NFYA 1QHXA 5K0SA 1W581 1PJZA 4RESA 5MN5A 4K86A 1CRPA 1QJCA 1XQWA 3I5AA 4O2BF 3R74A 3NHFA 4UNRA 4IQ4A 3KETA 3FTEA 4NP6A 2BFDB 3AFIA 1P0CA 2EL9A 4KP7A 4D5EA 2MHCA 2ZJ7A 4HN2A 2XUGA 3CNOA 5FR1A 4LDRA 2HCTA 3TRDA 4BVBA 1PL6A 2NNWB 2OZPA 3LGSA 4HY3A 4O0LA 4BMYA 1E0JA 1S2IA 3AJAA 4GMGA 1L5YA 3U17A 2BR4A 3RRBA 1MG0A 2OWDA 3SJBA 2LKDA 1QO0A 3COWA 1L4BA 3QX8A 3QEMA 3LUBA 1T4CB 1UBCA 2JANA 1GTSA 3IEUA 1T0IA 3I9V1 4IW3B 5CURA 2FSGA 3KWJA 4EPXA 4AQ7A 3WGQA 2ZJ8A 1TYBE 1F48A 3CUVA 1ZAYA 2BBSA 4C3VA 1SUDA 1VHLA 1XF1A 1F3LA 3UJBA 2O0KA 3E5RA 1AOXA 2BF4A 1BX0A 5FNVB 5FBVB 5EWMB 2GT1A 1MR3F 1S8AA 2AOVA 2X19A 3PWKA 4PQFA 1I2MA 1QVRA 2V5VA 3WHPA 1P91A 4PQRA 5DM60 2PWZA 2WUDA 4DA7A 1KEEB 3FAZA 4UHHA 3P0RA 5KHLB 1MXFA 4EG1A 3JRXA 1QZ3A 2RFLA 2WIDA 1A1SA 3A32A 5K0EA 4DIKA 1RCTE 1DBVO 4HNUA 5C80A 5FPYA 3ZV3A 4Y9TA 3T52A 1H93A 1F3OA 4FEGA 4Y98A 4R51A 5BPFA 5JR3A 3ONWA 5C7OO 1SU7A 1GNVA 2ZVJA 2G9RA 3JQ8A 1UXIA 5ICMA 2RHTA 1VCIA 2AYXA 3G9TA 5CT8A 1GM5A 4MIKA 4Z8YA 2VT2A 2OYCA 2NPFA 3R9WA 3OM8A 3C7TA 5K8CA 1B93A 1FTWA 3CX6A 3KLNA 3ND6A 5EP4A 3I61A 2O7VA 3LBIA 4BYGA 2ANBA 2FOIA 4KVZA 5HDBB 5BMOA 4Z4EA 1O2DA 4LVNA 4YQZA 4C4RA 1REQA 1TLTA 4V0RA 1PEKE 1PQ4A 1CD5A 3JS5A 3HJRA 3CX3A 4WSOA 3VYTB 3F74A 1MTOA 2DC1A 2R8ZA 1XKQA 4GOLD 5BN4B 2FSVC 5B3JC 1Q0TA 4UMFA 3O84A 3P19A 2YXLA 1EK0A 1KK3A 4Z7QB 4MAFA 4OQXA 2M1ZA 4FWTA 1U0OC 4YGXB 5AM1A 2EW8A 3U6KA 4E70A 4AECA 5J4VA 3B1XA 1RHJA 2AC2A 5B58T 1EVQA 1GRVA 2PIDA 3WLEA 4UXHA 1ZESA 2HT6A 3DXFA 5JCOC 4Q3AA 3LK6A 1J2JA 3BG5A 4JKYA 1J1ZA 4CKBB 1Z7EA 1S2DA 4CE6A 1D5WA 4L8WB 2VUTA 4RETA 2REQA 3ZDQA 4YRBA 5IT0A 4LQ4A 4U6NA 2ZIEA 5KHOC 1W5EA 2HZ7A 1W96A 1HLFA 1YV9A 2PZFA 3DEYX 1AS2A 3FR8A 3OQBA 3HFGA 3PPVA 3GZ4A 4HRAA 4UFNA 5F9HA 1X80B 5ALJA 4BMOB 4NNOA 2P27A 1LNZA 1FNSA 2PL3A 3Q3HA 1JG7A 3DKRA 2C97A 4BXOB 3PX3A 4AJJA 3O5AA 2Z5FA 2ZT7A 5IT4A 1DFGA 4ZHSA 1E2UA 3D5TA 4IFBA 1BMFA 1X9HA 3ZZ0A 1YCFA 2M1XA 1RYNA 3STVA 5FPSA 4KFTA 5T57A 1ORIA 4UQLA 3SFVA 4ZCLA 4X20B 4WPGA 4QDZA 1WMSA 1JU3A 2C9MA 4U5QA 1DOAA 3E5NA 3K7EA 3E53A 3TM4A 1W6RA 4BVEA 1NBMA 4I6EA 4F45A 3DFFA 4OLBA 3BSSA 1ULSA 3GRRA 2QJTA 1GG8A 2QP4A 1YKFA 1F0NA 3IA7A 4JKOA 5FWAA 2Q29A 3MJHA 3WMRA 3QM1A 4A0SA 1MC5A 4DB4A 3HE3A 4UHBA 2FSIA 3AUJB 2F7SA 2JAUA 2NSYA 1ORVA 5BSRA 1VQ1A 4G07A 4CM8A 3CZAA 4F8EA 3MXTA 1G9SA 2IPLA 2R8EA 3IUSA 5LD2B 2WWRA 1E9AA 4C89A 4DCVA 4H1VA 1GAQA 4B3CA 5KYXA 2H18A 5AW3A 1LV8A 1X1SA 4RLFA 3OBBA 1XRMA 5JXHA 3UK2A 4OKSA 4LXXA 1WMBA 2DUJA 1II0A 3JARB 2QN8A 4WDQA 5ICFA 1BYIA 1WTAA 3RUDA 1SUCA 2X9LA 4L02A 3RRZA 1UMBA 5IX8A 3K15A 3LY9A 4X95A 5C37A 2O8BB 2GYWA 5F1OA 5HIMA 1R3UA 4GQBA 3ZJ4A 4BECA 1ETHA 2FW7A 4I46A 1XQ6A 1E1QD 1VDMA 4AAYA 2LIPA 2EZ4A 4OM7A 1MABB 2HPVA 2PSSA 1B8PA 1IWBB 4IIXA 2B8JA 3WKDA 1IK6A 5IN5A 4ZHQA 3N0XA 4IDAA 1L4NA 2NU9B 1ID1A 1XU4A 3ZJTA 4FU0A 4F7WA 4UTPA 2JLZA 3LPMA 4A1OA 3OWHA 5EJMA 2DPXA 3BREA 5LKRA 2JFVA 1DX4A 2PSEA 5THXA 2N42A 3PF8A 4PYIA 1OF1A 4YAUA 2GDZA 3BGWA 3D8HA 5KJ1A 4OOFA 3HUEA 3C8DA 1U5BA 5JZBA 2F4VB 4DCUA 1AHIA 2I8CA 1MO4A 4NBLA 5EJIA 4XOUA 2DUUA 1WV1A 3URMA 3VJMA 5HXAA 4XPIA 1MW9X 4QYXA 1QU2A 1P1HA 3CUKA 4MJ3A 3SFTA 1RZVA 4ZAXA 1XCLA 4AZ0A 1YKSA 1ID8A 4IICA 1G8FA 2FPRA 2ZVPX 3UM9A 4YPFA 3TF5A 1O96A 1PE0A 1XEWX 4JI7B 2JF0A 5H4HA 2DWCA 4TV8F 5LQJA 4L4RA 4DPKA 3CXUA 3FFTA 2J5BA 2X86A 3JYNA 1QRAA 3RFTA 3BE8A 4GEGA 1LC3A 2QRKA 4ML3A 4P4GA 3HR8A 3F8WA 3PA8A 2E7ZA 1YZYA 5FFNA 5IK2A 1IY2A 5EMMA 5DZSA 2QLLA 1TU3A 1EIZA 4FDMA 4FHEA 5A1TA 2QX7A 1SCNE 3BWCA 5ISMA 4I9NA 1DRJA 1X87A 2A3NA 2WUEA 3F4LA 1O6GA 3S1LA 1QYDA 1L7MA 3UJHA 5GONB 1DO0A 1L7PA 1WU8A 1GVNB 2CDBA 4MS1A 5LP6C 4EGJA 1CTQA 2QAGB 2ZPAA 3L46A 4C6TB 1YULA 4I8XA 4MICA 5CNKA 4U9IS 1MXHA 3DMYA 4U02A 4NYMR 4WMLA 2KI5A 3UB4A 1M2HA 1TCBA 1NXWA 5IKPA 1DGQA 1D03A 1GRQA 5EN4A 2J30A 2VWQA 3LECA 1ISFA 4KXVA 3FI0A 3DTVA 1T5OA 1NKVA 2WUFA 4Z2YA 5A4FS 1QLJA 4WLUA 4B4KA 2CDNA 3V1LA 1X39A 3TN7A 2H4WA 1EDZA 2DHRA 1V4VA 4O4IB 4H3KB 2G9QA 1F6DA 2J6BA 3V2IA 1YB1A 4FZRA 2A0UA 3J7AC 4P4LA 4DQKA 5AW4A 2RSLA 1B0UA 2OG2A 2BI7A 3N86A 1FSGA 5J5AA 2YYZA 3BHJA 3NUZA 4ES6A 2O8DB 3QMVA 2C2GA 3UAGA 4CQMB 4UREA 4U2EA 1HLGA 3JR7A 4OU4A 5DX1A 2YYAA 3VR4H 4CQNA 2Z3VA 5FV7A 3EZXA 1FP6A 4YALA 4AICA 1M72A 3IBGA 2QW1A 1Z5WA 2G40A 2BVNA 1RQRA 1RWQA 1Z2NX 3I72A 1G0OA 3IAHA 3OJFA 4NC9A 1BE8A 4ZMBA 1ODTC 4FJ2A 5ALEA 4Q9AA 1KI6B 2D7CA 1MW8X 3ILSA 2VATA 2W2XA 3DVRX 3F3MA 3QWIA 1IONA 2H0RA 3AJ9A 4PIVA 5J40A 1A8IA 1GFIA 2UKDA 3H6HA 5G0WA 1SKMA 4XX0B 3S3TA 5CFPA 1W8IA 5A0VA 1Z45A 4C7JA 2Q2VA 4G09A 2HQRA 2VDPB 3T4XA 5JAUA 1T2AA 3LOQA 5I7UA 4IF6A 1SZPA 2GZDA 4KCGA 2D59A 3TTTA 3NHMA 4QULA 4QUGA 5KTMA 5I7HA 1FFGA 4HFRA 2BEKA 1SBTA 1KXZA 1P2BA 3G1TA 4J90A 2H7YA 1UJ6A 3GBSA 1XCMA 4TYWA 3WZLA 4BFYA 1XEAA 1QWSA 2OK8A 4LA4A 3MJEA 4E07A 1F5SA 5SZKB 1EG7A 3WXMA 1WJGA 4MWSA 5DDIP 1NVTA 1WLYA 5JJKA 1CUYA 2PRIA 2X22A 3O2QB 1U1EA 3PVCA 4C22A 4CFSA 1Q83A 5HQ3A 1UMDA 2O2GA 3QKTA 2DUNA 4AKHA 4C43A 1PT5A 3AEUB 3C3PA 1CP3A 2PGIA 3AU9A 3EF3A 1UR5A 3FRJA 2J08A 4F1KA 5EZYB 1Y6RA 1FJGB 4E13A 1C81A 2YHSA 2CV2A 3EJ6A 1XWIA 4XIGS 4BCBA 1ZI6A 1X92A 2YVLA 1RAFA 1Z4QA 4NECA 2HBQA 2CMKA 5GONF 3WISA 2PLWA 2BUAA 1OU0A 2BOVA 4RVUA 4R71A 2A35A 2ZXFA 2W2PA 3MCWA 2E18A 2QTWB 3VDMA 1B00A 1Q0HA 1OWPA 1UQUA 1BU5A 1S9DA 4G5GA 3OBIA 4I1IA 5CXQA 5DBOA 5DXJA 1IY1A 2KHZA 4EQ6A 1MVNA 5AUQA 2JIMA 1LQTA 4C0AC 1LJLA 5BXQC 2PGNA 1XC7A 4MJLA 5CD1A 1MQAA 1IHXA 2F3TA 1RJGA 1PUIA 1XZEA 2OEPA 1NQAO 1QTIA 1WB5A 2I3DA 3EYWA 3N0VA 4L8VA 1DAPA 1BQ4A 1UBEA 4O4IF 1CWUA 1VI2A 3VGJA 3TLJA 5AVTA 3ZCRA 3ZY6A 3K9FC 1TIBA 3I1IA 1DWPA 2Z8XA 3S2ZA 1DAMA 5M5BA 4N6NA 2FDRA 2C98A 2POCA 2D2FA 2I4MA 4DDUA 5CAEA 1QAQA 2O7NA 2OECA 2HO5A 4L72A 2HMAA 4NS1A 1I94B 2VRNA 2XUFA 3U0VA 2BF7A 4HYTA 2XY4A 4PAMA 1FMJA 4YRIA 1U65A 3WSWA 1E6UA 3GZNB 5FOUA 1TCUA 3VR1A 4CEHB 3FPHA 3MCZA 4K0KB 4GMFA 1UEXC 3F8TA 1JAIA 3GFTA 2DP4E 4PAOA 3HVKA 4XYBA 1FP4A 1TPZA 2HUNA 4OHBA 3RG2A 5DCLA 3ZKWB 4F93B 5LP1A 1E3WB 2OSVA 1KOLA 2VFAA 1FFHA 1GR1A 2W4IA 3PJFA 4EIWA 1M7HA 4I3FA 1AQYA 4KBFA 3ILYA 3U56A 1NR1A 3IRUA 4JYBA 1ZWLA 3LMKA 2IV2X 1ZDMA 2IX3A 1ENOA 1MJGA 2YMLA 1AHNA 2CGEA 4BZZA 3GIDA 2BGIA 1T0BA 3DKKA 5JD4A 2W8ZA 4MO9A 3AZOA 3OMLA 3C6YA 4BVAA 4NX2A 4Y1GA 3PD0A 4I9UA 3OPYB 1JDZA 4CU5A 2D0PB 2GZSA 2VKTA 5ALHA 5FI3A 4J16C 2X0RA 3MYYA 4MVJG 1G0NA 1H1LA 2PH1A 2Z1DA 3LRTA 2WG0A 5TV2A 1U3GA 3C3XA 4XVCA 2IZ0A 4Z7OB 2H0QA 3H2SA 4ESOA 1OJLA 3NG1A 2IODA 5BWCA 4Y1RA 2D1TA 1PCXA 4JVNA 1DQSA 4I0WB 1IOLA 2YJGA 4YO7A 3P0EA 4XTCS 5GZ3A 1MV8A 1YD7A 2I1WA 3EBOA 4BNUA 1P18A 4CTMA 1JHAA 1TK3A 1PSWA 1YR7A 4N5IX 5EZYF 4B6QA 2J87A 4QXQA 3D2AA 3EA5A 3PIDA 4MLPA 4TWJA 5KQRA 4HAWA 4RXTA 5J47A 3KQQA 3FVWA 5SY6A 4AO8A 3DV2A 3OZSA 1ZZEA 4P83A 5KTKA 3D3QA 3TD2A 1QG6A 3W5CA 4N3NA 1QGUB 4H7EA 1X0VA 2CHEA 2O2JA 2YTZA 3BFKA 4BLUA 4INPA 2Y99A 3KXKA 4YS6A 4DMKA 4EP1A 3K35A 1LPPA 2VJAA 1MEJA 1Z4OA 5B6PA 4DR6B 1P77A 4LOIA 3R8CA 3SHFA 3LC7O 1GRCA 4GDFA 1QNLA 3W1EA 1Y9JA 4HB4A 3FPCA 3GDOA 1UBOS 3UAWA 2EKZA 2J48A 3HLKA 4JEIA 3DL7A 5ESRA 4WD3A 5FRDA 3WRYC 4HQOA 1H2EA 5LZ8A 2BBTA 2P1DA 3FDFA 3L9XA 3UAOA 1JE0A 2GZ1A 1BW9B 4PANA 1L5OA 4YO8A 2OHOA 3IUPA 1AUQA 5A3JA 1SIUA 4M53A 1J9EA 4MDFA 1E9VA 1O7JA 2I6QA 4FINA 2JGKA 1LDBA 2QVZX 1L9XA 3ELWA 1BXZA 5AM4A 2HB6A 2AK3A 3UMRA 3DUFA 5CLIA 4ZOBA 3IKTA 3P0HA 4KBGA 1T8RA 4X8MA 1DKRA 5HGJA 5C31A 3RSFA 2JLBA 1VTKA 4B9EA 3I62A 2C9ZA 1VP3A 3TCNA 4CF5A 2V8BA 3LP6A 3GA5A 4ZMSA 2MYNA 2Q6VA 3HJGA 3I5YA 4CM5A 1PWYE 2C7BA 4ZEOA 2D1SA 1RLIA 1QGAA 2YC2C 3RKSA 3TR5A 4CMEA 3LT2A 4UOEA 1U6JA 2BKLA 2IYQA 3NEJA 4ENQA 4WNAA 2QPAA 4MVCA 3MWEA 3UOAB 2ZBEA 1B8NA 3WQSB 2GCOA 4RPCA 2B35A 1DUSA 1UAAA 3EA4A 1E2PA 1EH5A 3QU5A 2I3AA 1ZN7A 4CWAA 1EAYA 1TU4A 1NOIA 3SLKA 4D02A 4A26A 5CBKA 1O97D 2BMVA 4UE3S 3NHUA 2QU8A 3ND5A 4KIWA 1S3GA 1W29A 3HCDA 4Z4QA 1Z15A 4HDNB 3BMNB 3CINA 1U7PA 2ZQZA 3KM0A 1Y34E 4DR7B 1WMEA 2WWFA 4PTLA 4M0PA 2UVPA 2ZIAA 4R81A 7REQA 1Q7CA 2DTEA 2XNHA 3AW8A 3Q3GE 4G0OA 3U60B 1IL0A 2IOFA 8LDHA 4R2LA 2SBTA 4E08A 2AKAB 3TWOA 2FN7A 1VKOA 5HOEA 4J0IA 4O3FA 3QVGA 3R7AA 2DFKB 4IKEA 3SQLA 4DLKA 4MQFB 3ACBA 5LOVB 1PX2A 3EQ8A 2BTOA 4N8DA 4BLOA 2R7LA 2PA0A 4EUNA 5TS2A 3TQQA 5KQPA 3KZKA 4KN5A 2NPOA 3KOWA 4TKMA 5JSYA 2SKEA 4LGCA 3GH1A 1M1NA 1IOVA 1GD1O 3H9UA 3BQNB 2R6ZA 1DU4A 1OH5A 3IAS1 4MV6A 4QFBA 1PR0A 2Z5GA 4OXKA 5L7TA 2H8GA 4FN4A 1DQYA 3PFGA 4TKVB 4TTIA 4QRDA 1XZHA 2WNIA 3TLKA 3BCHA 3UA4A 4MS4A 2E5FA 1DC7A 1POXA 4QPZA 3ZZMA 2I2CA 3SC3A 3T5MA 4CQJA 4GE3A 4TQ9A 3AVQA 1N9ZA 1T5DX 1B0PA 2QVXX 3I37X 3IP1A 4CM1A 4YMUA 3LDAA 4DV5B 4WASA 3GU3A 3QKRB 5F4ZA 4A5SA 2CF5A 1W49A 4ZPXA 1BFUA 2QJFA 5ADVA 2X6QA 1R0YA 3R9XA 4C7OA 1DL5A 1I6MA 3L92A 3B2NA 2F64A 3R7WB 3BT7A 2CY0A 2QDKA 3OZXA 2OC4A 3DBRB 2GRUA 3FWNA 4OXIA 3PS9A 2XD9A 5D7NA 3SBEA 5ARDA 1UZNA 4HTFB 5E1OA 3D4IA 4GBED 3A1WA 5AJZA 4PG8A 3L79A 3ZJVA 3KB8A 4FPXA 1ILWA 5JZSA 4B6OA 1H4QA 3VHQA 4V1CI 1OKKD 1SPXA 2EFJA 4KFUA 4NBVA 4JC8A 4D9NA 2I67A 4W1QA 1T6YA 3A1UA 3EXHB 5E7MA 2IU0A 5I7RA 3RU3A 2ZSEA 1UPUA 1RI3A 1NYLA 1OPRA 4J29A 1AGYA 1QV7A 2ISCA 1TM4E 2OBMA 3R0JA 4MKZA 4MVWA 3G5LA 2E4UA 4JLAA 1AKNA 1Y1KE 1G9XA 1UODA 4CKXA 5DGHA 7ADHA 2O8EB 3HU2A 5JARA 3OICA 4XYMA 4M9UA 4C5AA 3RSSA 3HO6A 5LC1A 2B3DA 1Z18A 5LMNB 2OBYA 4DV6B 4NFSA 2PUGA 3BGVA 4EG3A 4LJ7A 3A05A 1AMOA 3T3IA 4AMBA 5IRCD 3E58A 1VFNA 3KL4A 1XKXA 1A95A 5HTKA 3TSAA 4PYNA 5AM3A 2PZEA 3GJ0A 3HC7A 1LWNA 3DLCA 4ZARA 4Q9DA 5FOWA 3THWB 4JENA 1O0CA 1QFJA 2P0YA 3ZY3A 2J46A 2VJCA 4TMWA 2J3EA 3A9SA 4Y2VA 4CZ2A 4FHCA 3ZOZA 1USKA 1DC4A 3I4CA 5TMPA 3TB4A 4P33A 3ZTWA 4MHTA 4LNUA 1TGYA 5F98A 2NV6A 5CM9C 4OO3A 3SF8A 3HXQA 3WMFA 5C8YA 4B17A 2CMDA 4BBAA 3HA2A 1EFRD 4NYIR 4WZAB 3AG6A 1QFYA 4FGWA 2AF3C 4EGFA 1M1YA 3BMXA 2JA1A 3L4EA 3BAFA 3NT5A 4BZQA 1SOUA 5KZMB 2C8JA 1GQOA 3ELUA 2X0FA 6ADHA 4A15A 2RAVA 2VDNB 3ISVA 3L6UA 2PUDA 5E9JA 2PUJA 4XI9A 3RTDA 3TBFA 1KERA 3OZAA 4YUXA 2C9BA 1I13A 1N7GA 2ZT5A 4UUOA 4ZK6A 4BNWA 5C51B 1QHNA 3PC8A 5IM4A 1J22A 1XTTA 3RT9A 2DY1A 3EH1A 3F5MA 3I73A 1BGVA 3K5HA 1Q2UA 4LQLA 2BSQA 4CL2A 1THZA 4L2IB 3KTAA 4QLAA 4TKUB 4H7KA 3TW8B 1NW6A 3HCWA 2PUEA 1RM4A 4O1IA 1OIWA 2R48A 3O74A 1IVSA 2AOWA 4N6GA 4MQEA 1PLLA 1UBMS 5DYYA 5HFJA 2NZWA 4UZSA 3RTAA 4AYXA 2YS7A 2ZZKA 1WHSB 1C1HA 3IESA 3HBMA 4NXMB 3ST7A 4W5TA 3QVLA 1RKBA 1U2SA 3WX0A 2JFNA 2W71A 5KREA 5H7XA 4Y9UA 3OTIA 3NDBB 4EG7A 4W8OA 1A9ZA 1ZGBA 3FPKA 1Z0JA 2VQFB 3AW9A 3CZCA 1Z47A 4ZVOA 1NXTA 4YLYA 5IWCA 5KYWB 3G49A 1QRUA 3NUGA 1KPIA 3NS7A 3QWHA 4J2HA 4BVHA 1RJEA 2ENWA 1DZIA 4CNBA 2HHLA 4ND8A 3GGCA 4G1CA 2LNDA 1R9GA 2XIQA 4FWIB 1OX4B 4OI2A 5I7SA 5JPCA 4HLUC 4ZOLA 1M2NA 1JF8A 3RYFB 4C01A 3Q7PA 3BILA 2BGJA 2IUEA 3HRHA 1GA4A 4S1WA 3CX4A 4RJKA 4YK7A 2IH5A 3NGXA 4GKJB 1KDYA 5BRAA 1Y37A 2FSFA 2H2DA 4KKXB 3WGTA 2X6RA 4LSWA 3TDNA 5CLLA 1G55A 1QOQB 3DF7A 3KT3A 3QZUA 1ZLYA 2PM8A 4LVUA 3EQ9A 5HF5A 1M0WA 2V5AA 2QRVB 4RDIA 1XRJA 7GPBA 1ZPDA 1VRWA 4FGJA 2W00A 4LXTA 3RVMA 5L3QA 2GESA 1P0MA 2RH8A 4XGNA 3SWWA 2FXVA 4WIAA 2IS1A 1V8BA 4OYYA 1FK8A 1W73A 6PFKA 2LD4A 1D2RA 3E48A 3MFQA 3SKVA 3TZKA 1VJCA 1R0WA 3QPDA 5JAOA 3R5FA 4NONA 1IEXA 2JAWA 2FEXA 1E63A 4IF4A 2F3PA 4DCNA 2H52A 2NVBA 4I50B 4U2FA 4U2DA 1JDBC 3VYVA 3V6MA 1JJ7A 3KDPA 4Q47A 3HNPA 2DEUA 1DT3A 3GFFA 1SGWA 4Q21A 1JR3E 3H1EA 1GPBA 4PX5A 5HM8A 1I3MA 5EE9A 2ZSDA 3OCYA 3NBUA 2GRAA 4RVHA 2IF0A 3I9V6 4E2FA 1WY5A 2PIAA 2AEFA 3CUSA 4Q0MA 1N2BA 3SBXA 2ZRMA 3TH5A 5MN6A 4XYGA 3A6ZA 10MHA 1RKQA 1PEAA 4DHWA 4ZCPA 3QHQA 1BXRA 1OU4A 2VNHA 3D8SA 1GTG1 4A27A 3S2SA 1QIGA 1PLKA 4WOBA 2WIAA 3IP5A 1Z82A 3AGPA 3E5MA 4N0MA 3TZQA 1DWOA 1FB5A 4PAWA 3QSYA 4QXRA 4DFDA 3JWPA 2PPVA 2W6PA 3LWDA 5BT9A 1AG9A 3VMMA 3KJHA 3TQCA 4CQLB 1NQ5A 1KH3A 3FYDA 4D6YA 3RVPA 4ID9A 3HU1A 1PJTA 2VDJA 3CCBA 5CHEA 3CGGA 1LBTA 3GELA 2ZBPA 2IDMA 1DCTA 5DISB 3WKAA 3DV0B 1B2RA 4RE6A 1I1QB 3L1HA 3QXXA 4MMYB 2DFVA 4UULA 5G0VA 2QZ4A 2E2WA 2IV3A 4ARCA 1K3TA 4H08A 3U37A 3X2FA 4EY6A 3GCWA 3X1MA 3V55A 2Q1TA 4XDYA 1NRXA 2PX8A 2EJTA 3WLIA 2WHQA 2H65A 4R4JA 3TTVA 2H4FA 4IUYA 2RIPA 4IIJB 4G01B 5PNTA 4KWTA 2C7OA 2RAUA 4EPTA 4BFVA 4XR9A 2PMEA 2ZVDA 2QLTA 1JN0A 3DDOA 4XCVA 1JA1A 3GJ5A 3NYRA 4N0EA 1C1DA 1SD5A 1J90A 4AN4A 1XTVA 2FW1A 2AG0A 2VPTA 4ZQGA 3B9QA 3B78A 3A4VA 4AROA 1FJHA 1QIHA 1FUKA 4WUVA 1HQCA 4XUGB 1N77A 1JXMA 1DAHA 4UBKA 5F2OA 1U0TA 4LOHA 3TINA 1OILA 3RAFC 1B8UA 1U8TA 2FQWA 1FQOA 4P54A 1NBEA 2EFDB 3TZCA 3ESYA 1G2IA 3A06A 1SKYB 3LKZA 2Q3DA 3MZ0A 3UWMA 4GWKA 2HDOA 2XH8A 2XOKD 1NP3A 3QFTA 2J3MA 1EPUA 2GFIA 3HJAA 3K9LA 3TXXA 4KRGA 5J2TB 3BAZA 3KKPA 4BQRA 4AXXA 5JC1A 1XDZA 4F96A 4LOAA 1YCGA 1M2FA 1CQZA 1Q1QA 3AKYA 4PFJA 2WMDA 4W5QA 2PUAA 1GL6A 2CVQA 3R7BA 2BL4A 4IIFA 1WXFA 3HB7A 4ROTA 3SCZA 2BDEA 1TEXA 4NVRA 5CFRA 2AQHA 2Q5IA 3OIGA 4QOGA 4BLQA 9GPBA 1BCRB 5EXSA 1QCZA 4GUAA 4AF7A 1DT5A 2IS4A 1UEIA 3GRUA 4RTMA 2X77A 4JJ4A 4NPHA 1XWWA 4UM9B 1JLSA 1EB8A 3GFPA 3L01A 1HV8A 2P9CA 4QQFA 4KIFA 5DVZA 2SHKA 1U3FA 5FI5A 4B46A 3VKFA 2NP7A 4DDVA 1KJWA 1NTOA 3QKWA 4LQCA 2NUPA 2G1JA 1ZSVA 2JJ8A 3BKXA 3NBQA 1QRDA 1SWVA 4U39A 4UEWA 5FB3A 3KYBA 1R1DA 2TECE 1V1JA 5IJXA 2HLDD 3NBKA 2WYWA 1UC9A 1V4NA 4CLXA 3F1KA 4G24A 5JALA 2BMEA 4II3A 3TQIA 1NUUA 5H02A 1CRLA 4ZDIA 4LYAA 2Z2KA 4AF6A 3DTTA 5HKBA 1QLWA 2V7XA 4MW2A 3IIMA 1SCDA 2IBMA 4S0ZA 2VUUA 5AQ1A 4KO1S 4IIJF 2JD1A 2I55A 3DT9A 1TIKA 1FXWF 3H0CA 3SC4A 2G72A 4IYJA 2P69A 3QU9A 4MVJM 3S5JA 2CV0A 1C9EA 1MAHA 1G1AA 2RK3A 2GCPA 2DLDA 4KNYA 3ETLA 3DBHB 1W75A 5AVUA 3ZHQA 3E23A 4OJTA 1OOEA 1P9OA 1K98A 3FSRA 3ZQJA 1SC9A 3U4MA 1TD9A 3IHWA 1QCDA 3EZGA 1WU7A 5B58C 4LF5B 2XAAA 3JWIA 5HCUA 1DVRA 4QLOA 2YV4A 2EBFX 1RMTA 2RGEA 4B3DA 2PYZA 1ZW1A 5D5HA 1YZHA 5KNLA 1R12A 2VWHA 1Y98A 5T64A 4PYMA 3ZY5A 2P2GA 1JFTA 1JG3A 1GSAA 2G17A 2ZFUA 4ZKEA 3H5VA 2OV8A 3ZJ5A 2XQIA 3JATB 3CVOA 3WMWA 1U0LA 2AN9A 2QUKA 4KDEA 1LSOA 4CXMA 3OLCX 4RELA 2IHYA 4TRMA 1VXOA 1MOPA 5DP1A 4RTOA 1U4OA 4ECEA 1QDLB 1HA3A 2OGSA 1KDVA 1J0DA 3RGWS 3UMFA 4YYZA 3KBOA 4NJMB 4B71A 3N2KB 1R9MA 3BA6A 3K72B 1QF7A 4FW8A 2ZJ5A 4NZMA 3I2HA 2XB9A 4EB0A 4YRDA 2F6RA 1E9DA 3VHXA 2P79A 3LVBA 4MEJA 1W0KD 1ABEA 3C6XA 5ADHA 5KNCD 2XRFA 4R1QA 4DTCA 4ZTBA 5F73A 4Q9HA 3WWOA 2WSLA 1VRCA 4BGVA 4NHOA 3ZCTA 5MGBA 4QGAA 4AY6A 3AHDA 1UPXA 1U0GA 1P0PA 4KW7A 1X8LA 3A4IA 2BMFA 4P31A 1L5HB 4UZFA 4F06A 4UOZA 2VH2A 2AMFA 2VXBA 2ZJ4A 3DMNA 2FPLA 3BMCB 3CR3C 3EULA 4GOJA 3UWOA 1UINA 3AY0A 3INGA 5IEBA 1ZC3A 4TSRA 4YAJA 3DEZA 4MOWA 2H57A 3GT0A 3OIWA 1FTYA 4J2OA 5AK3A 3R3ZA 2ZSKA 3D02A 3H2BA 3DVAA 3BD7A 4IG4A 1T3ZA 4ND4A 4YJ3B 4HK4A 5EG5A 1COWA 2EV9A 2UZ3A 1JFSA 5GOTA 5DSXA 2UZ4A 3TTSA 3MWGA 2QX9A 3AWIA 2YV3A 4V2IA 2FK7A 4UPVA 3OFSA 2YFYA 1EA7A 1TI7A 3H2IA 4V02A 2A9RA 3R44A 5DV9A 2RGCA 3H9EO 5C1BA 3DBIA 1W4BA 3NWOA 2FFQA 2MMGA 1XMQB 2YJ6A 3HI4A 4LKRA 4XUDA 3RUHA 2H0AA 4F9GA 4BGIA 3T1TA 2A4KA 2NNLD 3LWZA 1BKDR 3WRWA 3ADDA 1G9TA 2VJQA 1KH2A 1WW2A 4DN6A 4PPQA 4D41A 3REFA 1PQPA 2RJOA 2YJ3A 4HQ6A 2QTLA 2AJTA 2OMKA 1JKIA 3ENQA 3IUEA 5HIJA 3RUFA 3I2FA 3K0AA 4OTZA 4DXAA 5L3RA 1N3YA 4L51A 3LDHA 5AKJA 2RGGA 2AFRA 3MWLA 4IV0A 2E9SA 1YRQA 1N5KA 2CB9A 1CEXA 2VCYA 16PKA 5I8PA 1KOGA 2OBNA 1P1BA 2Q6KA 5ALWA 3ZI0A 1KSJA 2OP1A 4X1IA 2QTMA 2FYTA 2WUGA 3WTBA 4YV1A 4D4IA 2BHNA 5KQGA 3VKGA 4ZANA 1XVVA 4P4SA 2P4HX 1AGXA 3AF3A 2WMYA 3JV7A 3NATA 5EE5B 2K2QB 2PWYA 5EFOA 4QXMA 1FQWA 3L5KA 3BDAA 4HX2A 4ZQIA