3BWYA

Crystal structure of human 108m catechol o-methyltransferase bound with s-adenosylmethionine and inhibitor dinitrocatechol
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
b'GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMT protein
publication title Crystal structures of human 108V and 108M catechol O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwyA00
4DCMA 4PCAA 2QE6A 3FUTA 4AZWA 1ZGJA 4QDJA 2C7QA 3PX3A 1F3LA 4OA5A 1I9GA 4AZVA 2NP7A 3PS9A 1AF7A 2CMGA 2Z6AA 3UJDA 1XCJA 2BR4A 3TR6A 1R74A 2C7PA 2PVCA 4RVDA 3OU2A 4ATNA 5FADA 2EX4A 5LQCA 3M33A 3M6XA 4YUWA 3FZGA 5GOZA 2OB2A 3UJCA 1L3CA 4M36A 2NXNA 5FQNA 3VYWA 4GQBA 4IWNA 4RTLA 3BKXA 5EEHA 1NV8A 4FT4A 3DXXA 3TRKA 2G72A 1Z3CA 3DUWA 1M6EX 3PT9A 4XUDA 5KYGA 3KQQA 3ER8A 3IV6A 1R6AA 5EG5A 4H0NA 4PYMA 1G6Q1 3BWCA 1KPGA 5CVDA 1DCTA 1MHTA 2IGTA 2OBFA 1QAQA 5E9WA 3HCCA 4CTJA 1JTFA 3E8SA 4E70A 2PSSA 3C3PA 3BGVA 2EFJA 2P8JA 2V7EA 3CJQA 3TKYA 3R3HA 3VC1A 4XCXA 2ZLBA 2AOUA 2QM3A 2BZGA 1MJFA 5E2AA 4PYJA 4OX9Y 2ZBPA 3ELUA 5HEKA 4ZTBA 1WZNA 4RTSA 1EIZA 2NXEA 3O7WA 3CBGA 3OPNA 3VC2A 4Z2YA 3GRUA 3MHTA 3ID6C 4PNEA 4PGGA 4GC5A 1DL5A 4BLVA 3EVFA 4PGHA 3GIWA 2B2CA 3KPYA 3EMBA 5GP1A 2Y1WA 1WY7A 5CD1A 2JG3A 2ADMA 3RODA 2H1RA 5GIPE 5DRTA 5CCXA 4R6WA 4QTUB 4PYLA 2ZULA 3V8VA 4RTPA 5G02A 1NBHA 4RTNA 2PBFA 3THRA 5EGSA 3WSTA 1FPQA 3LCCA 1NV9A 2PY6A 4M37A 4RVFA 2AVDA 1NW8A 3D2LA 1TPYA 1XJ5A 4LWOA 3SGLA 3T7SA 3Q7EA 2NP6A 1AQIA 1IY9A 1AQJA 4LECA 1VQ1A 5ERGB 5K09A 2B3TA 5HFJA 3T7TA 2XVMA 3FUUA 4QDKA 4QQNA 3QV2A 3KR9A 5EZSA 4RX1A 4JXJA 2ZBQA 2HMYB 5ICGA 1BC5A 5E2BA 1RI2A 5DSXA 5DX0A 3O31A 1U2ZA 1FJXA 2NXJA 2ORED 4BP3A 1TW2A 4HGYA 2C7RA 5FA8A 1YB2A 1NW7A 2O06A 3C6KA 3UA4A 5K0BA 5E1OA 1N7IA 2YQZA 2IDJA 4C05A 1JG3A 3KQWA 5DTQA 1SQFA 2OB1A 1BKYA 3DULA 4GEKA 5M5BA 4YMGA 3CJTA 3JWIA 3KPJA 2ZSUA 1X1DA 1XCLA 2P35A 2CMHA 3EVBA 3P2EA 3SM3A 3KKZA 4DF3A 4E2XA 1VE3A 3LDFA 3EGEA 3B3GA 1NBIA 3A7EA 3HCDA 3R6TA 3DOUA 4AZSA 4E31A 2P7HA 2XYVA 3OU7A 1I1NA 4EMSA 3NWEA 4YMHA 3I58A 4E2YA 5C1IA 2JHAA 5FWAA 4DA4A 2PX2A 3G2QA 1JR4A 4POOA 4HTFB 2VP3A 3P9NA 5EVJA 5GWXA 3SXJA 2PT9A 4F85A 2OZVA 4PYKA 2ZIGA 3HA3A 5LQJA 4RVHA 5CVEA 1QZZA 3HVKA 2G70A 2NYUA 5FTWA 1G8SA 2A14A 5F2KA 5K0FA 4LG1A 4OQDA 2G71A 2R3SA 2YX1A 1JTEA 3P97A 5E1BA 4CWAA 3CCFA 3FPHA 4HC4A 2PV0A 3UJBA 3FPJA 1JQ3A 3T0IA 3LECA 4OQEA 2O07A 2JHPA 4A6EA 4R6XA 1EJ0A 2PXCA 4F86A 5ICCA 5EMKA 2LD4A 5EEGA 3G8AA 4HSGA 2C7OA 3G5TA 3G5LA 3GRZA 3LGAA 3JWHA 3PX2A 4P7FA 3FTDA 3UJ8A 5LQUA 1ORHA 3FPEA 5LQAA 2FRXA 5FULA 3GO4A 4FT2A 3G2PA 3THSA 3HA7A 3BZBA 3P9KA 1XDZA 2Z6UA 1JQEA 1SUSA 1VP3A 3RIEA 5EPEA 3KR2A 3HP7A 3I5UA 4X63A 3M4XA 3NDIA 4KIGA 2E5WA 3DXZA 2ZIEA 5P8WA 4BLUA 4C06A 3FTEA 3NWBA 4RWZA 3OFJA 4K6MA 4E32A 3KQYA 2PJDA 5K0JA 4Y2HA 5DXAA 2BM9A 4DQ0A 3GXOA 3R24A 2WK1A 4P7JA 3CGGA 2ERCA 1RI4A 1KIAA 1TW3A 5DT2A 5DLYA 3BUSA 4AUKA 2KW5A 3AY0A 1YF3A 2O57A 1FP2A 2I6GA 2YXLA 5EKXA 5K01A 5CVUA 1KR5A 4KRGA 3BWMA 5K0GA 1KP9A 3KQSA 4ER0A 1VL5A 2AN4A 3GU3A 3P2KA 5BP7A 5C9ZA 3ERCA 5LQRA 2VDUE 5GM1A 2B25A 2VDVE 2ZWAA 4R8SA 3KQOA 5FCDA 5BW4A 2ZZNA 3AJDA 4M38A 4KVZA 4BP1A 2IH4A 3TOSA 2PLWA 4GOMD 3LCVB 3P2IA 3SR4A 3IHTA 3SX0A 1YZHA 3TPZA 1VP9A 3GDHA 5DM0A 3DLCA 4FSDA 5K0NA 1P39A 3LDUA 2AOUB 4HG2A 4RVGA 5F2OA 4MIKA 5HOQA 5GINE 1WXWA 5HIMA 2VS1A 4KDRA 3X0DA 3KPUA 5ICFA 3UJ9A 3K0BA 3ER9A 4WXHA 4WVLA 1XTPA 3BWYA 3ELYA 3KU1A 4ER5A 3LPMA 3O4FA 4A6DA 3DH0A 2YXDA 5D1NA 5T6BA 3ME5A 3PLAE 4XUCA 3KQTA 2FYTA 1G8AA 3G88A 3NDJA 1PRYA 3GWZA 2JJQA 2PKWA 1RI3A 2WA1A 3P8ZA 2G8NA 2QYOA 3HM2A 4V0RA 4EQZA 4XUEA 1ORIA 1X1BA 3JWJA 3EMDA 3LCUA 4OBXA 5EHGA 5FUBA 1D2HA 4G56A 4PCLA 4RTQA 3HCAA 1QAMA 1KYWA 3P71T 2OPBA 1XXLA 2O05A 3UJAA 3T7RA 2CKDA 3ORHA 7MHTA 4MQ4A 3I9FA 4P7KA 2B9EA 5K8VA 2YVLA 1KPIA 3UJ6A 2XYRA 2GS9A 4U7TB 5K0LA 2XVAA 4HH4A 3V97A 2I62A 3EGIA 1NT2A 1OR8A 3LDGA 4B17A 1XDSA 4F84A 2PWYA 2EJTA 3C0KA 5BXYA 4DKJA 3DR5A 1O9GA 4X60A 2GAFA 3A26A 4YV1A 2ONZA 5EZQA 2O0LA 2GPYA 5E8RA 3HCEA 3PFGA 4QTTB 4V0QA 3A25A 3EVEA 2P3LA 2H11A 3HVHA 1IXKA 4L7VA 1EAMA 3DMGA 4RTRA 1VLMA 4ER3A 3B89A 3MTIA 2GB4A 3CJRA 1O9HA 2PXAA 3FUVA 2V74B 2AZTA 3KR1A 3TM5A 2AOTA 3U81A 5IH3A 2OY0A 3DMHA 2ZWVA 3LSTA 3VSEA 2G1PA 5DWQA 2IIPA 3IEIA 4NECA 4PYIA 2OYRA 5KVAA 3MCTA 4KW7A 3HVIA 9MHTA 2AR0A 1AV6A 1VPTA 4QVKA 3BT7A 4R8RA 5EQJB 4R05A 2IP2A 4EVIA 5IKMA 3FTFA 2YTZA 4HRAA 3UA3A 1INLA 1JG1A 2OO3A 3LBYA 4YUZA 2ZTHA 3LKZA 5T64A 5JR3A 3R9XB 2CWWA 4EK9A 1UWVA 3EVDA 3IYLW 3MB5A 3GRRA 2Q41A 3EGVA 4RTKA 2H00A 5CVJA 1G60A 2EJUA 2UYQA 2YR0A 2DULA 5KQRA 4RTOA 1Q0TA 4QQKA 5DTMA 1M6YA 3EVZA 5E1MA 5CIYA 4GOLD 3JWGA 3FYDA 3L8DA 2FK7A 3HA5A 1NW5A 2P1DA 4C03A 2IFTA 3NTVA 1F38A 2R6ZA 3OZTA 2AOXA 5LSAA 1X1AA 3EVAA 3M6VA 2IBTA 4UOEA 3DP7A 3KR0A 4YUYA 2FK8A 1I4WA 3NJRA 5FHQA 5K03A 1G38A 4FP9A 5GIOE 1H1DA 1L9KA 5GM2A 1VBFA 3OZRA 3S68A 4DMGA 4DZRA 5KQSA 1QYRA 1IM8A 2QRVA 3EVGA 3K6RA 4GOOD 5DM2A 3REOA 4E30A 1SVUA 4RTMA 3EEOA 3G7UA 2I9KA 2QRVB 2FPOA 3ELDA 3DXYA 5B1SA 3MTEA 1BHJA 3HEMA 3RW9A 1FBNA 2HWKA 5DTRA 1UIRA 3B5IA 1V39A 3B3JA 2VDWA 5CVVA 3BGDA 1G55A 4BY9E 2AN3A 2JH8A 3M6UA 2I7CA 1SQGA 1X19A 4FGZA 4U7PB 4CTKA 5CCBA 3LL7A 5LR6A 1FP1D 1JG2A 2ZW9A 5FWDA 4EKGA 3QOXA 5EMLA 1R8YA 2PX5A 3KQVA 1KPHA 1KXZA 2PX4A 4C07A 4ISCA 3SVZA 3FPGA 2Z6QA 3GJYA 1JG4A 3CVOA 3DMFA 1WXXA 2PGXA 4YUXA 3I64A 3SMQA 1EQAA 5EC8A 1BOOA 5CM2Z 3TKAA 2PT6A 3NW9A 5EOVA 2BM8A 3GNLA 3KQMA 3LKDA 4QVGA 5EHIA 5T67A 4EKIA 2P3QA 3Q87B 2ZCJA 2AN5A 2XBMA 1WG8A 4C08A 1XDUA 4QPPA 2UZ4A 4PINA 3A7DA 3EVCA 4C4AA 1NW6A 1JQDA 2UYOA 4GUAA 2DPMA 4AX8A 4YV0A 5K05A 3UZUA 2AS0A 3HVJA 4X41A 1SUIA 5DX1A 2P40A 1EG2A 1T43A 2FCAA 4CKCA 1KYZA 3PTAA 4HGZA 2HV9A 3OE5A 4Y30A 5E9JA 8MHTA 2IPXA 4PONA 4PIPA 3NVKI 3GGDA 1L3BA 4FZVA 3C3YA 3GRYA 3TFWA 3FRHA 3TMAA 1YZ3A 3G89A 3H2BA 4KIFA 3OE4A 1HNNA 2PWPA 2AOWA 2CL5A 5K0CA 5E9QA 4CKEA 3OCJA 1NKVA 3ELWA 1RJDA 2HNKA 1RI5A 3UWPA 2BH2A 5DRYA 2UYHA 1Q0SA 3LX6A 3FUXA 3CC8A 2WA2A 4GF5A 1Y8CA 5F2NA 1VIDA 2JH9A 2IH2A 5H02A 2ESRA 2P3OA 1XVAA 4AZTA 5E1DA 1ZQ9A 3E23A 5DM1A 4IKPA 3FTCA 2IBSA 3E05A 3G2MA 4KWCA 4OA8A 3GCZA 2NNWB 1D2CA 4YV2A 2P41A 5FQOA 3QOWA 5C0OE 2BR3A 3BKWA 3HTXA 3P9IA 1JSXA 1RJEA 4YUVA 3LHDA 2PXXA 3MGGA 3M6WA 5ICEA 3E7PA 4E2WA 4MWZA 2ZFUA 1QAOA 3SSNA 1YFJA 1ZKDA 2Y1XA 3FPFA 3AXSA 2AVNA 5LQNA 4IV8A 3SSMA 4P7GA 5LQKA 2PX8A 4RV9A 3MERA 5KS2A 5D1HA 5BW5A 1YFLA 1DUSA 3G2OA 2OXTA 2EG5A 1R00A 1R18A 1N7JA 5EIFA 5K0EA 1L1EA 1RJFA 1YUBA 2FHPA 4O29A 5DSTA 2AOVA 3B7PA 2AOTB 1EJ6A 2XYQA 3F4KA 5EMJA 2HR1A 3AWIA 3SSOA 4MHTA 5HIIA 3EEYA 3OFKA 1B42A 2JHCA 3PB3A 4RYLA 1R8XA 4ER7A 3ANXA 3DLIA 3PFHA 5EKUA 3OU6A 4OBWA 4RSRA 3M70A 1JSZA 2GH1A 3G8BA 4E33A 3MQ2A 5HZMA 4GOND 3TLJA 2B78A 2NXCA 1UFKA 2N47A 4FR0A 2HTEA 3P9CA 3TM4A 2ZVJA 4M7RA 3UFBA 1PJZA 3NMUF 3PVCA 5DPMA 1P1BA 5U4XA 2UYCA 1NE2A 1SKMA 4DCGA 4HTFA 1QANA 3CKKA 4BLWA 3HNRA 1X1CA 2K4MA 2F8LA 3R0QA 5CUQA 3KPVA 4IV0A 1ZHFA 2ZZKA 5EMMA 2GLUA 3C6MA 4X61A 2ONYA 3KHKA 3UBTA 1WS6A 4C04A 3BGIA 1P91A 3A27A 3AXTA 3NVMB 5DX8A 2YUIA 4P58A 4PYOA 1M0EA 1HMYA 2ZZMA 4GBED 3FRIA 1ZG3A 3BWBA 5DXJA 3UJ7A 4PYQA 4ER6A 3HCBA 3KQPA 4FSXA 1RJGA 3OZSA 2ZBRA 2VZ9A 5FA5A 4MTLA 2BR5A 3EPPA 1D2GA 3KPWA 2ZIFA 3GRVA 5DM4A 5EIWA 1P1CA 2GA9A 3FUWA 4RTJA 5MHTA 2OKCA 4KDCA 3BXOA 3DTNA 4LWPA 4PYNA 2P7IA 3LBFA 4FS8A 4PWYA 4X1OA 4E2ZA 1ZGAA 3I53A 5HIKA 5JUWA 2IH5A 5HILA 3MAGA 1NW3A 1KHHA 3FYCA 3MCZA 5E8JA 4CKBA 4CXMA 4GC9A 1RI1A 10MHA 1N2XA 2IDKA 1L3IA 1SG9A 4QPNA 3A4TA 2YXEA 2QY6A 4PIMA 3TQSA 3HCFA 4DM3A 5HIJA 1O54A 3B3FA 5FHRA
chains in the Genus database with same CATH superfamily
4TWBA 1KC3A 3WGLA 3VBCA 3T7KA 3FUTA 2IWHA 5EP4A 5FLKA 1TF5A 3TTVA 1D5WA 4CTOA 4HHEA 3TFOA 1CQXA 4D44A 2PH3A 3VPXA 1G3QA 2Z08A 1C4WA 1P72A 3OPMA 2ZJOA 1YUMA 3HR7A 4GQIA 4DR7B 4IQ4A 3M6XA 4M0UA 5D87A 2VF7A 1FLAA 1QNLA 4D97A 4E1VA 2X0KA 2FFBA 1P4GA 3TJZA 5DM70 4RTLA 1BRMA 4OXRA 3MRSA 3SF8A 2NYAA 4FHZA 5DHQA 2VH1A 3H9UA 4NY1A 4C4TA 3ER8A 4H7KA 2EP7A 2I7TA 2V9PA 4TKVA 1WOMA 1G4HA 4ISBA 5HQ3A 2QTLA 3TTSA 3NU1A 2NZWA 3B53X 3DSRA 2D7JA 3H97A 2XKJE 1I5RA 5IYZA 4LQ4A 4H6WA 1U0TA 4NZNA 4MAMA 4OQYA 4AJEA 3E5NA 2Q27A 2VZLA 1BXRA 2WIFA 1Z6YA 2Y1CA 4I1YA 4CW7A 3RK4A 2PQ6A 1QM5A 1NXVA 2AMJA 2Y05A 3DE7X 3GJ5A 4KBGA 4L9AA 4NJEB 1SD1A 4NX2A 4XJTA 5DW0A 4Z4QA 1W8IA 5CBPA 4GXTA 1PD1A 2FZGA 1AMNA 1EJBA 5K3CA 1EX7A 1E1MA 4A8PA 4BLVA 2WMDA 3GFVA 3PNYA 5GP1A 1Z07A 2CYCA 2Y1WA 4OKIA 3ZDDA 4IVRA 1E58A 1NIPA 4UEJA 4ILEA 4R6WA 4QTUB 4NABA 3MAJA 1KAMA 4JB8A 4MUKA 4P22A 5EQTA 1GUFA 4KV7A 2XB9A 5C1PA 4RTNA 4Q7LA 2C2WA 2AEFA 4IGIA 2ISQA 2I66A 3WLLA 2BBSA 1KP2A 3G0OA 5LYJF 4AWAA 4LQLA 2JGLA 3AF5A 5UKDA 4BQQA 1GUBA 3I1IA 4Q7QA 2Q46A 3Q7EA 3QEKA 1TYCA 1LGYA 2F3UA 4MP8A 4OIFA 4B09A 2EHJA 1K5HA 2BFCA 3TDKA 2B3TA 4MS3B 3U19A 1K2WA 3C1OA 4C4XA 2IYXA 3GDWA 3R75A 4CI9A 1J22A 1MA0A 4RX1A 1Z4LA 1V5FA 1JALA 4MB6A 1TTHA 4OHCA 3UT5A 1EVYA 3FBGA 3FVRA 3OESA 4KUEA 5BPFA 4S1OA 1PQ4A 4KODA 1CUHA 3IEXA 1MQSA 2TMDA 4MV7A 4BP3A 4XM2A 4CT4B 2V9CA 3WK7A 4CM8B 1DNPA 1JTVA 4ZOLB 1D0VA 4PO9A 1E2JA 3HCRA 3W5VA 1Y8RA 4C05A 4ZK6A 2ID4A 4TUYF 1WCIA 1MDBA 1ULAA 1W49A 1ML4A 4IFBA 4GG1A 3VC3A 2VKQA 4CN8A 1V35A 1OJ7A 1IXYA 3VUEA 3KHTA 3UFXB 5GTDA 3RBXA 2D5BA 5TIIA 3UUFA 1Z82A 4OHBA 1ACMA 4RA6B 4W4TA 1V3QE 3SDBA 3V4OA 3X1WA 3ZDYB 1IM2A 4IG4A 3EGDB 3GJ3A 5FWAA 4D9BA 4EO4A 2GF0A 4QUGA 1F5NA 2FY8A 2QOEA 2P62A 1EFPA 1Y33E 4UTNA 5K6RA 1TVCA 1LDEA 4A8HA 1G8GA 1TE2A 1RMQA 3DL0A 2LGJA 5I7SA 2X14A 2Z9CA 2DFPA 1G18A 3I2IA 4LTMA 4Z6KA 1RAHA 2A7QA 2RE8A 1BCSA 1GVNB 1OOEA 1UJNA 2BGKA 3Q7IA 4YCJA 2QYSA 3MJFA 5FTLA 2XCRB 4ND8B 1JDZA 3O1IC 5E1BA 5C8VA 4XLZA 1AKTA 3W9BA 5HE9A 1OI3A 1VL1A 5T4BA 4TLBA 3KZVA 5JVDF 2HJHA 4U2KA 4F1JA 4EYQA 2CYAA 4MUJA 1HYEA 1WDTA 3E7FA 3G8AA 4FB5A 3I39X 2HA0A 2EKPA 2YMQA 2ZYGA 1AKUA 521PA 5JSKA 1SBHA 2JRCA 3SZLA 3WL3A 2XNJA 3FTQA 3S0JA 2P2ZA 3DO6A 2G1AA 2XYHA 1LK7A 1O7JA 3MUOA 2NACA 1Q20A 3WKDA 2AFHA 2C94A 5EPEA 2VUHB 1YMQA 2JZNA 4C22A 3KQHA 4YO8A 1G98A 1WZ2A 2AE1A 4MYHA 2IHUA 3DVAB 5IM4F 4U8GA 1XGKA 2H48A 3OFNA 1U9CA 2X8JB 4EIWA 2YIDA 4OJQA 4DSTA 2BM9A 2ZYVX 3LHKA 1Z4PX 2DUNA 5LZ7A 1T9HA 3WISA 2WSYB 1OFHA 4JUCA 4YP7A 4Q7KA 4CKYA 1P29A 4ZODA 5E6SB 3FB4A 2X76A 2XA1A 3DKPA 3RRJA 4NCKA 3NBAA 1WVMA 4XD2A 1GD1O 1BQ4A 1MX9A 1C7RA 2IU4A 4IKOA 1AG9A 4AWBA 4CKWA 1VLZA 4PWZA 1E96A 1CJVC 1NPTO 2X9QA 1DC6A 2XT0A 2Z30A 4BNZA 1WEKA 4PM4A 3MK31 3RIGA 3G9TA 4ER0A 1AGRA 5BP7A 2IX3A 1VKJA 1FNCA 3RASA 4L5IA 3UAZA 3ZWBA 3NP7A 1OLUB 1N2HA 3AGQA 1J8DA 1LDMA 2EZ9A 4LBYA 4XJSA 5FCDA 5BW4A 3Q72A 5HBRA 2IH4A 2OXIA 1H8EA 1FC0A 2Q5LA 3OQ6A 4ZEMA 1RRGA 3DNMA 4MKHA 3DYBA 4N0DA 1GADO 2H9YA 3W05A 1V9LA 3ZU3A 4YRMA 3BQMB 1B0AA 3DAYA 1DBWA 1UODA 2H59A 3OOJA 4AKTA 3UYKA 4D45A 1HX7A 5IJ9B 4Z3DA 1GNTA 3GDOA 4RZIA 5ICFA 4BO9A 2R8XA 1Z83A 1Z9BA 3I6ZA 3ZV6A 2WWIA 2JJ1A 4LYDA 2HSJA 4KLCA 3IT0A 5I7FA 3IJ5A 2R25B 4YEDA 1C1DA 1AK2A 1UUFA 1NWHA 2MMGA 5K2MA 3JALA 2X2OA 4G9BA 2EJBA 4PS1A 4ZQFA 3X1DA 1VSVA 3EZ2A 3IEPA 3B36A 5IAOA 1E3SA 1Q1QA 4DCTA 3P8ZA 1UMKA 4QWWA 1QTQA 2MYNA 5C51B 3RT7A 3DOIA 2XADA 4ZCMA 1M5TA 2CD9A 1UXOA 2IE8A 2PS1A 3O82A 5HA5A 2ZIXA 3LKBA 721PA 2IS6A 1EWTA 1FRZA 3JWJA 3LCUA 1WBDA 1JBQA 3E9ZA 1VBKA 1XDDA 2JJ2D 1E32A 4I2VA 4JBGA 2OCIA 4PCLA 5IFLA 3WYGA 1QYIA 4L8VA 4ND7A 5REQA 2AJLI 4PVCA 1U0RA 1RXWA 5GZ3A 3KALA 3OPXA 4GYKA 2GR9A 1EXVA 5IAEA 1RWBA 5K8VA 1S9DA 2DHDA 1AM4D 1U2GC 1KPIA 1PLKA 2OM2A 4X8HA 3Q2KA 2PCLA 4RFLA 4V24A 4HYEA 2FH5B 5KOJB 5CDGA 4BUCA 2ZTUA 4C2TA 3QVKA 2VHWA 2ONZA 1U2GA 4D9CA 5AM4A 2PLFA 3GT4A 2FDRA 3F8SA 3KT8A 4RLQA 4UCQA 3SC6A 1GLGA 1L5FA 4DB2A 2JB9A 2OEPA 1LUAA 4L27A 1IDOA 2X41A 3M1YA 4B47A 2HA4A 1ADFA 4A2WA 5DGCA 2V74B 2JIQA 4YALA 3T9CA 2OY0A 1HH4A 4UPEA 2EV9A 2FPIA 2ZYAA 1YMUA 4BASA 3JQ7A 3IR5A 1JMKC 5AP9A 2ZSFA 3AUJB 5LDHA 2EIHA 4MYCA 2ACWA 4GLFA 3KJIA 4Q3NA 3IQEA 1XEXB 2WJPA 3BCRA 1Q1GA 4CF3A 4CG2A 5AKEA 1WP9A 3HACA 3NBFA 1V7ZA 4RH1A 3R9XA 2C2BA 1RAFA 1X92A 4D02A 3AVXA 3HFJA 1VLLA 3KWLA 5TQJA 4EZEA 4G5SA 1Y7PA 4AYTA 3UUEA 1NW9B 2NVUB 1CX9B 3BMCA 4X1YB 4CHTA 5B57C 1OLOA 2HF9A 2OMEA 4P3XA 1XHLA 2DULA 4PQRA 4RV4A 4DG5A 3R6LA 3RS9A 3ZGLA 3EWIA 1FFEA 1GLVA 4BEWA 3CYFA 4ND3A 2R6ZA 6REQB 1VMAA 1VPVA 4ZO6A 1MPTA 3T1HB 1QPZA 1X1AA 2YJ6A 1NIJA 2VG8A 1QQAA 3DP7A 2ACEA 2ASVA 3SI7A 2G5GX 2GYVA 2OBLA 5K03A 2JLUA 2G36A 4CEHA 1KC1A 1AURA 3GD7A 4ZVOA 4DMGA 1TTQB 5KYWA 3JASB 4RAOA 4GPZA 1ORTA 4Q48A 1U98A 2BFOA 2HQSA 2R6GA 2X3YA 1GG5A 3LVQE 3QVMA 3REOA 3VR4D 1PFYA 3DD1A 4FEGA 1MT3A 3LGXA 2ZYRA 1UIRA 4JBXA 1OSNA 1NMSA 1QE5A 3O73A 4R9SA 5I6DA 3FSGD 3M6UA 5KWJA 2DB3A 2QVBA 4WZAA 4RDHA 2VHTA 3C8HA 4X84A 5JCOC 2H54A 4G8JA 4PLPA 1L5YA 4Z54A 3IBTA 5FWDA 3E0XA 3RROA 3ZIDA 1ZA2A 2HUNA 3QOXA 4XDYA 4D8UA 1ZAKA 2JLAA 4EA7A 4GU5A 1R8YA 1QORA 4ARIA 2FLKA 4RLSA 2C98A 1A4RA 1Q3KA 1NVVQ 3ISVA 1H1TA 2VHUA 1Z6GA 1FUYB 2BGRA 1V11A 2DECA 4PY2A 5JCOA 3WBBA 4DT1A 4LISA 1WXXA 1BXKA 1DKLA 3NIBA 1OJLA 1DOZA 1EQAA 3Q6MA 3NAQA 1T6XA 5DKFA 1VLJA 3GVHA 2ZUVA 2B1RA 3TF5A 1KY2A 1NHWA 2P3QA 4C6TA 2O1WA 3BMOA 4QUEA 4BMPB 1N5RA 3A2LA 1EUDA 4TYNA 2ZBGA 3TL3A 2R8OA 1NSYA 5I8WA 2P2NA 3HKCB 3RU3A 5FTMA 1XNQB 2DPMA 3UZUA 2RHGB 3QKIA 1M1UA 2NU8A 2HO5A 3GA5A 2LR0A 3GLRA 1M2EA 5JEDA 1E6MA 1I7NA 1R0RE 1SXHA 1XVUA 2JASA 2NG1A 2YV2A 4I1IA 5ALGA 5TGZA 2I76A 5J5CA 3VC7A 2W9XA 3EPLA 3DKVA 2YYSA 3IO5A 1YZ3A 3H2BA 3NBMA 4O5AA 1JDBB 3X1XA 5F7ZA 1EVJA 2B0JA 4BXOA 2OL4A 2ONJA 1EFVA 5IT5A 3H5WA 3DWIA 4FR2A 4CQMB 4NYIR 3V5NA 2CUKA 4GH5A 1RPAA 5BMOA 1PP4A 4YAWA 3VR2A 1UOOA 1DKMA 1Z0DA 2C61A 3WJ2A 1MAWA 3EG9B 1IAVA 1FE8A 1KK2A 2QW1A 1SEPA 1ZHHA 3LUFA 4H7FA 1II0A 3GZTB 3G2KA 4RENA 4ND4A 2B9VA 5LZ5A 5J43A 5LQCA 3AZOA 1HE8B 5J59A 1OY1A 1SFRA 2WPDA 3JZAA 2HA7A 1HO3A 1OLSB 3HDGA 4IINA 1D4AA 1QKKA 1ZXBA 4FZRA 2NZ8A 1QNFA 1RXCA 4EQ6A 1BIFA 3BCSA 3DTVD 2FETA 5CH3A 2BELA 3SSMA 1F8UA 3T7EA 5HTOA 3D8RA 3QM1A 2BSAA 2J0UB 2XHEA 1YQUA 1LBTA 1FMLA 5K0EA 4G0WA 3O26A 1WTAA 2XLBA 1Z8NA 3OT4A 4YT8A 1VKNA 4JQYA 3HDVA 2AOVA 3IEUA 2ZTSA 4UU7A 2J45A 3AWIA 3O9VA 5HIIA 2O9JA 3P0IA 5JYDA 3CRQA 3H1EA 4UUNA 3WRYC 3FN4A 2VI5A 4Q3LA 2WV7A 1R8XA 1HKUA 4OGGA 2DBYA 4MO9A 1KO1A 1DCKA 5LUAA 2GO7A 1N2SA 4IXTA 3CR8A 3PDCA 2YHSA 4GOXA 4UD2A 1NSFA 3CLHA 1XFAA 3HEAA 3B3QA 3N8HA 4UAJA 3WRYA 4F11A 4HKTA 3I9V1 2EQBA 4B43A 3PVCA 4FCCA 5AJUA 4IIJB 1N6OA 5I4KA 2P9GA 1SKMA 3TQIA 4YN3A 3FZQA 1QANA 1AQ6A 1ISGA 1F4VA 4QXMA 4YJ3F 3GPIA 4DEYA 4E12A 3ZHOA 1N8NA 1HURA 2GLUA 3F6YA 1XAJA 2H5EA 5FH9A 4QLBA 3FVVA 2VPTA 1V6CA 2XRMA 4XD7D 4XLLA 1RAGA 4WLNA 4IJ5A 3G9QA 4D8XA 2Y1EA 3ZHZA 2NTVA 3QHAA 1UMDB 3SJUA 4A03A 1MO2A 1W4RA 2OO7A 4YB8A 1OA0A 1PZMA 1FX0A 4RD1A 4S12A 1N9GB 3IQZA 3MS7A 3L6BA 1ULHA 3O2SB 4UUOA 3W9UA 1Y6RA 4QD3A 1F8XA 3P32A 4KI7A 3BWXA 3R5KA 4DFDA 3QFTA 1IYZA 4LF7B 5IAJA 4OTZA 3AI7A 1QBKC 3BXOA 2IEBA 2X0IA 3V8NA 4PWYA 5JVDA 5KTNA 2WWGA 4JYMA 1NTRA 1ZGAA 1WUYA 4DDHA 3HTXA 2QX8A 4M2LA 3L9XA 4U00A 4GPAA 4ZDKA 4DPLA 1R3UA 1L4KA 1QFSA 2C5HA 1MFZA 3H16A 4DG9A 1PDOA 5GPBA 2OLEA 3NAMA 2IDKA 5HR5A 5IEJA 2JFUA 1XELA 3F8WA 2IXFA 1VSUA 4DM3A 4GR4A 4YPVA 4IEFB 5KAPA 3JATA 4YJ2A 1B74A 2JLZA 2YHIB 4EYGA 3JWEA 3N07A 1GPDG 4QDJA 3TG8A 1D1TA 1E60A 1RYFA 1LZLA 1KSHA 4RCVA 2FLWA 3DV2A 2CMGA 3F90A 3FKSD 3TLGA 3TR6A 1DRVA 1P9RA 3KZCA 3OU2A 3PXCX 5FADA 1FQKA 3LXMA 4CM6A 5LWQA 1U8UA 3RBZA 3ZDZB 2OB2A 1DFGA 1WA5A 4DLWA 1P73A 1RAEA 3CBQA 1SGWA 3ZK8A 5KYGA 1YDGA 2C2OA 1L2TA 1VCHA 4HB4A 5KDDA 2VAVA 1L4BA 3JW8A 3Q0IA 1YZNA 5THKA 3WLHA 3NHBA 1G6Q1 2PHZA 4NNPA 2FEWB 4P3YA 1P7WA 5ES3A 1DCMA 4NFYA 1R0LA 1JTFA 4BJHB 4E70A 4HDAA 2W6MA 4L15A 1N2ZA 3CLVA 3UT0A 2WWTA 2VLBA 1U7WA 2FWBA 3AM4A 3PFIA 3R0VA 4ZMSA 5BUCA 3WL7A 1PTKA 1AKVA 5J23A 3IPRA 4JL8A 3KQUA 1ZS9A 5KC8A 3JRNA 4QLAA 3AV3A 3T61A 1B0ZA 4Z2YA 3FXAA 1U9JA 4UCFA 3N70A 3D6HA 3NUGA 3QI7A 3AJ8A 2JG3A 2X19A 1NI4A 1YJQA 5ALWA 3QG5A 4D3SA 4FYYA 4DUGA 1XYVA 4X95A 3UK1A 1ILWA 1ZM9A 3IHWA 4YYEA 3SBXA 4KLAA 3T38A 4RTPA 1QFJA 4N5HX 1VBNA 4R7GA 2FDCA 1DHTA 2EDCA 1GAWA 2HX1A 3AONB 4AJPA 1T8YA 1AO0A 4CM4A 4MGEA 1IBKB 4LJ5A 5FOXA 4Z7QB 1UBLS 2QR5A 1NI5A 1EEHA 3VJMA 3F5FA 3D2LA 2BEVA 1GTZA 2WJWA 1AQIA 2IE0A 3I9MA 1EINA 1CIPA 2HJRA 2RI1A 2GPTA 3T0GA 3E58A 3NAZA 5B55A 2XWJI 2P6PA 3V4PB 5JJ5A 1BVYF 3DVLA 2XSZA 3ASUA 1U2TA 3MWEB 3PF8A 3U09A 2WUEA 3CXRA 1IZYA 3M1IA 3NV7A 4OHWA 2YASA 3V2UA 5DNVA 1CVRA 5JXGA 1FTSA 3WTCA 3RRNA 2CB0A 3IAAA 5K0BA 1P62B 1TZBA 4GGOA 4NOMA 1AH2A 1UBUS 2C88A 2ZQYA 2J32A 1HDEA 2VJBA 3QUCA 3GD5A 4U2DA 2VEDA 4L51A 3ADCA 3HWRA 4JV5B 3D4OA 3ADBA 1X1DA 3UF0A 4M9RA 3FNIA 3SQLA 4DPKA 3MD9A 3KKZA 4JT4A 3BSSA 5G0TA 5CDYA 3CPSA 2O8DB 4H3SA 2J5KA 4KE9A 1IWOA 4UQPA 1BX3A 1DDGA 3MS2A 3I58A 2GJSA 4IO0A 3MINB 3ILHA 3MNFA 1JZSA 2VP3A 4TN5A 3L7NA 4AMBA 4TKZA 1UPCA 2J9FA 4CFYA 3JQAD 5JZMA 1Z2EA 2AR7A 1CF9A 4JX9A 2G70A 4CEIA 2Z4RA 4RGBA 5EJIA 1L8XA 4RM2A 3HVRA 4YFYA 2GFIA 3B13B 2Z4SA 3L0DA 2FX3A 2Z1NA 5K0FA 1FW6A 4YRBA 3BMXA 8ABPA 2NT3A 4Q4JB 4HD8A 5CJPA 3RS4A 3SC2A 4Y6SA 2KPOA 4N5DA 1ODKA 1T6BY 2O07A 4W9MC 3S3TA 2QLLA 2YIMA 1W87A 1OXUA 1OIVA 1MG5A 3VH4A 4DMMA 5AW3A 1U63A 821PA 3G5TA 5LQUA 2R87A 4GZ3A 4L3WA 1OXTA 1W0JD 1T1SA 5FULA 4HEQA 2VQEB 3CH4B 1PFUA 2FWRA 1Q1NA 4P3KA 4C0AC 3UXMA 1UP7A 5ITZA 1NU8A 5TGTA 2O2IA 1GZ3A 1QCZA 2FZLA 4HZUB 2WF8A 3KEFA 3MT9A 1RZUA 1SOWA 4KI0A 5IN4A 4A91A 3IRVA 1GRQA 3HWSA 4H15A 1OBFO 4IOJA 4I6EA 4XGKA 1XTRA 4OV6B 2G9NA 2ZETA 1VPLA 2PZAA 4ERXA 2DR3A 3PPIA 3NDPA 4FFRA 2AF3C 2GBGA 2XGGA 3BUSA 3NRCA 1J42A 1GGFA 3K9LA 4JBHA 1W44A 4XQEA 1EX9A 3ZY4A 3QBTA 5AW1A 1FP2A 1JR3E 4PG5A 2AGVA 3GYBA 2FFHA 4NBLA 3RC8A 2XUIA 3F1LA 3LX4A 1YQQA 3NUZA 1P45A 3EH2A 3QWAA 2JCVA 5GM1A 1C0PA 3QE2A 3CZRA 3LCRA 2P6UA 3DT8A 4TL6A 4RCYA 3AIMA 2A59A 3KSMA 1B93A 1WZUA 3LCVB 4FYXA 3RRBA 4Z49A 3WYNA 2O8EB 4M1TA 1NF8A 1Z5PA 2GHQA 2WYOA 1K4MA 1CDZA 1PGOA 2SCUA 3DLCA 5IS2A 3CCBA 2L18A 1RLTA 4LFBB 3U3OA 5EWJA 2J3QA 1IQPA 1Z26A 3JQBC 2XTMA 1WBJB 5FV7A 3VO1A 4OKSA 5KDLA 1EWKA 3Q3IA 4G4SO 1TKRA 4R7ZA 3K0BA 1CQIB 3RTDA 4NDAA 1S2DA 3A37A 3EXIB 1OT3A 2QPLA 3JQBA 4GFDA 3WSVA 3K05A 3CLSD 1V0JA 3I04A 2F1OA 1S8FA 1B43A 3H8SA 3TRHA 4QUDA 3ZLTA 4YMWA 2ADFA 2CJXA 1WHTB 2PAFA 3B2QA 2HRQA 4GYJA 3BH7A 2QAIA 5A4DA 1ENPA 2C2ZA 2IYFA 4EKYA 1P2SA 4NCJA 5BSMA 1C0IA 5EHGA 4L07A 1ZMRA 2R86A 4CM1A 3SPXA 3BBPA 3P71T 1Y9DA 4JT8A 4M0LA 5IKXA 3BIXA 1W25A 1NP3A 3Q12A 2FQYA 3NT5A 3HJHA 3WQSB 3ZJ4A 1W93A 3VDRA 1SOVA 5EUBA 4MIEA 1W85B 3R1IA 1ZEJA 1NP6A 3KUKA 3NX4A 1HXHA 1X14A 4H3HB 4DA7A 4E4RA 1JBEA 4KXLA 3UW3A 5G1NA 3TQRA 2WTEA 1PF7E 3NOVA 4OCZA 3CGWA 2C5AA 1YVEI 5LP6F 1KEUA 5CDTA 1O9GA 4HCJA 4X60A 3ZWXA 2MSNA 5A2QA 1L8OA 3JSAA 5IKOA 1CC1S 2O0LA 4W5TA 4IJUA 4V0QA 3PFGA 4UU0A 1IXKA 3GJQA 3OLCX 3OF2A 1CUJA 3PR3A 2JW5A 4UTRA 1MJNA 1UXIA 1IBRA 3EZGA 1IB0A 2JVJA 3UC9A 1YE5A 4JVNA 1FBTA 4FEYA 3WJAA 1EHIA 4LY3A 4R4JA 3C4QA 4R83A 2BMJA 1SHUX 1V5EA 4CUKA 1KWKA 2NO1A 3KBBA 1NVKA 1IPHA 3VSEA 3B7GA 5IP5A 1HV8A 3IP8A 3IVCA 3IEMA 2HNAA 4UKDA 1DDOA 1DC4A 4L0CA 1M54A 4Q01A 1GAXA 4NECA 1U1DA 2WFMA 3QLEA 3MCTA 2I2WA 1BS9A 2GCPA 3ZE0B 2FVXA 1Y3FE 2CE2X 2P0YA 2AR0A 4P7BA 1YXMA 4BNIA 3USZA 3R7DA 4ALLA 4F8EA 4ZYUA 4OHZA 4IIJF 3OQ1A 5HK9A 4J4BA 3UA3A 2ZB2A 2W7TA 3O2QB 3GJ7A 4FBLA 1N4DA 3HB5X 2BYTA 1ZJ6A 3F5DA 3ET4A 4OEHA 3SX4A 1L9XA 5BV7A 4FQ5A 3GRRA 5DULA 5K7SA 3PJEA 4IR7A 5BRNA 3RVPA 2Z98A 1HE5A 2IHYA 1XT6A 2UYQA 3OP4A 4G0PA 4LJLA 4I3HA 3FWYA 1E5TA 2QPAA 1RWVA 3HJGA 1USIA 5E1MA 3RSQA 5AKYA 1YAHA 2Z3WA 3KV3O 1TT5B 4ABTA 1I3CA 4ZPJA 4UHDA 2FMXA 3BFJA 2FPPA 1PDVA 4E7OA 2J7PD 4DNXA 5A5VA 4IQ8A 2VSFA 5TRTA 1ZJYA 5J2UA 4R0MA 2TS1A 2PANA 1JJ7A 2XECA 4R1UA 3TAUA 4DLPA 3OZRA 1X9IA 4P38A 2W6ID 4P4NA 4TX1A 3VUFA 1JQBA 1J1UA 2GF2A 4A2PA 1S4QA 3K6RA 4GOOD 1UBNA 3EF0A 2B8JA 5IT4A 3EEOA 2GM4A 2BEUA 2XRZA 4OQFA 3L1HA 4AP9A 3JYQA 1W5TA 1FBNA 5AW7A 5JNSA 4V38A 2H1CA 1DJNA 2H31A 3I4LA 4XXHA 3I9NA 1NVVR 4NBUA 1X19A 4NOLA 1USVA 3D7SA 4LV6A 1HQYE 3FNHA 3GLHE 4NAHA 3OZAA 1QZ3A 4XWOA 2H06A 1Q3TA 1US8A 4JQCA 4YJFB 2ZM5A 2Q3BA 2Z8ZA 3V4LA 1Z2OX 1W73A 5F7OA 4QUAA 1UMBB 3GFRA 1NNLA 3R5FA 3WLQA 1KTIA 3C7KA 1H93A 1YR9A 4IPTA 4C0XA 2JIRA 1XPRA 1DZIA 1GKUB 4LXUA 1BOOA 3CUSA 1XCPA 3QVGA 3HCNA 4JLUA 1AIPA 2PS3A 2UZ4A 1FNBA 1VA5A 3UEOA 1WV1A 1MOPA 2VDRB 4TVSA 2LCIA 4R1QA 1B4DA 4BB9A 1YA6A 3KSZO 4PPYA 4DCCA 1KYZA 4YP5A 4G4GA 4UUPA 4X9XA 4O2AA 5H59A 3TW0A 4G67A 4PONA 4WINA 2CCGA 5M2QA 4ZAWA 1RQ2A 1VB5A 2IUTA 2O4CA 3M4YA 4MV4A 1ZC4A 2QJWA 1BDJA 2HAEA 4F72A 3G89A 1S9HA 1F14A 2PJUA 3HZOA 2HMTA 3SJ7A 1WSWA 1NMZA 2KM1A 4XWTA 3L7JA 1JFTA 1V37A 2P11A 5IH7A 4IS2A 2G5TA 2XQJA 3NFYA 5LQSA 5CRIA 4RHFA 1IMOA 4C6SA 1BKDR 3OETA 4LBZA 2GZDA 5F77A 1T4CB 2FUG1 3FYUC 3IVXA 4JJGA 5C7OO 1EDEA 3OM9A 3IQHX 2AMFA 2YJZA 3KV1A 3OZWA 2FOIA 3AQIA 4O2BA 2P67A 2AUMA 3VDMA 2IXDA 3K1JA 5HFAA 1AUXA 3FDZB 1DV2A 3C6QA 4OHFA 4X85A 4GSLA 2JFFA 5HCIA 2BL4A 5KCMA 4BQIA 4IKPA 4EUFA 1BYUA 1JVNA 1Z39A 3MRVA 3FYUA 3JQ8B 3O2NA 5HF6A 4RS3A 3VKFA 2C03A 4GDFA 1NOIA 1ZVJA 2J41A 4FFDA 3SKYA 2P6RA 1HSOA 3E7PA 4LXYA 4PLYA 1CQPA 4F91B 2XDWA 1IQRA 2WMYA 1DOAA 4IUBS 4MS1B 1PFQA 3E1GA 4NG4A 2LIPA 4ILKA 5A3RA 1JG6A 2YIJA 3SP1A 3O91A 2GWRA 3QHQA 1KMNA 4D92A 4RF3A 1J1ZA 3KD3A 2FMIA 3IE1A 2CK3A 3ONWA 4UQOA 3V55A 2V0GA 3Q6NA 1H1LB 3RC1A 5BN3B 3CCCA 4UOZA 1Z6ZA 3N0WA 3JD0A 2CZCA 1XDWA 2DFNA 2H9AA 5KYYB 1B15A 2IY7A 3FNEA 3D4IA 3SSOA 5M04A 1WP4A 2NW6A 4PNZA 3DLIA 3SJZA 3CF4G 4LHVA 1ATZA 4OYYA 1V7PC 1FYVA 4LC0A 4OBWA 4WAUA 5D51S 4P53A 3AI3A 2V6MA 3IBGA 4N9WA 4F4IA 5JT1A 3I0ZA 3QJ5A 1C3XA 3AEKA 5DCUA 5LA6A 4RACA 4RD3A 4B48A 1TK3A 5DASA 4CM9D 1RKUA 4IUYA 1ISRA 1EK2A 2GGSA 4G0ZA 1WOYA 5SV2A 3W1VA 1Z6QA 3QBJA 3SXUB 3WOHA 1XHEA 4YAJA 1F8YA 2X5NA 2X9NA 1R6TA 2FE1A 5I45A 4LFAB 1NQOA 4CGZA 4D3XA 1X7XB 4BLWA 5KNBH 2EFEB 3F67A 1KYXA 1OAKA 4RC9A 2FN9A 1MCZA 3FGOA 5EMMA 2WT4A 4CMBA 2YYZA 3ZZUA 1NL3A 4YPFA 3ZQ4A 5JD6A 1P91A 5IVHA 2QUBA 1U4OA 1ZAYA 1LDYA 4B9AA 1UC5B 1L4YA 2H08A 1S8AA 1ELOA 2C3YA 4NFHA 4MJXA 3UJ7A 3KOXA 4KQ9A 3AR2A 4M8NE 4BTVA 2FW1A 4E15A 1X7WA 2BGMA 3CPEA 4PPFA 4RUKA 4DDMA 3CTPA 1NUUA 3IEVA 2ZIFA 2IEAA 2PSJA 4YECA 1DS6A 3A70A 3FUWA 2YY5A 1N0WA 3OQBA 4D4HA 2B7BA 2NVBA 2RMKA 1MXHA 2XNHA 3OCWA 3PC4A 1V48A 4DANA 2ZSDA 1P74A 1OH8A 1FFXB 4KPUA 4MYDA 3RSZA 3V00A 4MRPA 4P98A 2XNSA 4D4KA 3TMYA 1UT5A 2F7SA 2HSWA 2A5JA 1S2OA 2YQ4A 4LHSA 4XB2A 4BEJA 1BCRA 3AI2A 2YXEA 3NTUA 5C4GB 4YIHA 4ARUA 5BWNA 1PL7A 3VI3B 4AZ0A 1QYXA 3HH8A 4AG5A 2FFQA 4JVLA 1JL3A 1SB8A 1P2TA 4ZZIA 3MOSA 4RESA 2W8BA 4GP7A 4UUQA 3PS9A 5F1YA 3RUFA 4M0MA 4JC4A 4S1NA 4PZYA 5JMWA 1ND5A 5LCXA 4MW0A 3TW8A 2EX4A 2GF9A 2P65A 2YV3A 4JUIA 4BNUA 1XF9A 2EATA 2PYDA 4US1R 5K3DA 4X1IA 4CYMA 3IVMA 3NXKA 1F06A 1N6LA 2OQIA 4HQ0A 2M6RA 3PGMA 5C4IA 3QKSA 3SLKA 3DJFA 4DHEA 4P83A 5DNWA 5A5GA 4WJZA 4EGAA 4BYMA 2NM0A 4GKVA 3I5AA 4BIMA 1SXJD 4CTJA 2YMPA 1E3MA 9GPBA 1XROA 3E8SA 3IOYA 2PSSA 3BGVA 5I9TA 4EJ0A 2VTDA 1YQ9A 3JAKB 3WK5A 5EJEA 1M1YA 1ZOIA 1FRVA 3B1XA 2KBFA 4P4UA 3BULA 4X62B 3BERA 2WU1A 2R1TA 4EAQA 2RG7A 1ND6A 4GR9A 4QYIB 1ODCA 2WC1A 4TM7A 4ZTBA 3VYSB 4A0RA 2CLEB 1JHUA 2PUHA 2QKYA 2R97A 3MJHA 4KMSA 3V1UA 1MZPA 4Z8YA 1JNXX 1VG1A 4HN9A 3EIOA 4Y67A 3CVWA 3KOUA 3R7LA 3N75A 1GNPA 1WY7A 4O02B 3K2EA 4M76B 5AJTA 1VZ2A 2VNJA 4X8MA 2PBZA 4MR9B 1TCUA 3CF6R 3P9YA 1J20A 2QJOA 1C3OA 2Q2QA 3HGQA 4O4IB 3V2IA 5DK4A 421PA 2I6UA 5DGXA 3ND5A 1CRLA 3DBRA 2ZRGA 2F90A 4ZT3A 3SYTA 1QTRA 3OIWA 5LQDA 3LC0A 2HIMA 1RM4A 1VM6A 1E7YA 2O2HA 3CN7A 4MQ5A 5DBFA 4CT5A 5K09A 4E4TA 4QQNA 1ZOPA 2YXBA 2GO1A 2HHAA 3LUKA 6AT1A 2YOFA 1L7OA 5CEEA 4M83A 3ZLBA 5B2EA 1RI2A 2X9VA 2PFSA 2D2XA 3CH6A 4JHXA 5LP6C 2NXJA 3OA0A 3U13A 3UMVA 3DDZX 4TMTA 4TSKA 4YMLA 4WSOA 3KWJA 3WNVA 2P9TA 3E82A 1YB2A 4MLZA 3ZHXA 1DQRA 3ONFA 5EWMA 4M46A 4OJNA 2R7LA 1M73E 1O4VA 3TSCA 4PQEA 5DTQA 1YR2A 2WJ4A 1A9SA 2G63A 2XAUA 2YL2A 3A4NA 3LLMA 5DW3A 4YMGA 3PF9A 3ZHCA 3A9SA 2OCLA 2FEAA 3CJTA 4G3XA 3U44B 1V4VA 5FLYA 2C4KA 3W1WA 2OLJA 4OO3A 1VE3A 1OZFA 3F5QA 3KFVA 1ZL0A 2BMDA 3MRTA 2Q5EA 3PPXA 4FE7A 5IVDA 4BN4A 1XVVA 3AEYA 3Q9UA 1AGPA 1RE1A 3HV2A 3T5CA 4RY9A 4OQQA 6PFKA 1U9YA 5KYXB 3OJOA 1CQZA 4R69A 2JI8A 3P5BA 2UZIR 3OT1A 4NZOA 1SHZA 1R6DA 3IX7A 4DIBA 4X6UA 4PRYA 1Z2AA 3IAFA 5CVEA 1LI4A 3OZIA 2BP7B 4S1VA 3RAEC 3L4SO 4IBOA 2PS0A 4RHYA 3GRAA 3EYAA 2HH9A 4LGMA 3K1YA 1QVWA 1C7FA 4MWSA 1O96A 2BEKA 2MIIA 1MQAA 1J9GA 1Q22A 5EKTA 3P97A 3KBOA 4RH0A 5JWRA 1EVKA 4HC4A 2SKCA 3FNGA 3O8QA 4PQFA 1PCXA 1ADCA 1GV0A 1Z5NA 1C30B 5FPTA 3RG8A 5DYTA 1WW8A 4IHKA 3BILA 3GV0A 2NU6B 5D3MB 1XDBA 2JLWA 1QU2A 1ZVQA 1BXGB 1NBWB 4KMMA 3T1QA 5JYBA 2DTXA 2O2EA 2X5OA 2NAFA 2ZWMA 4WFJA 4INZA 1MC1A 2CVZA 4JYCA 1RQGA 3L0PA 3A05A 1Q7BA 1L5LA 3LK6A 1BFKA 2V7QD 1R4NA 3KLMX 3HYSA 4JKIA 2A0XA 2ZJ7A 4K9LA 4EPRA 5KTSA 3ZDAA 1PG0A 2HC9A 4LDZA 5ENDA 1D2EA 2I3DA 1E20A 2R6R1 3IESA 4C0QC 3WQHA 1W0CA 1WKCA 3OJ0A 4MROA 1VGQA 4TTTS 1ODJA 3ENNA 1SUFA 1U04A 2HU7A 3IP7A 4HYTA 3IP1A 1V8ZA 1B1CA 2GEDA 1NYTA 1WUKS 1VBMA 3B6KA 4QQRA 2CL7X 4Y2HA 5JCJD 2Z3VA 1FF9A 4TS3A 1TADA 1BZYA 4DMKA 5LN1A 1R4MB 4QG7A 1R88A 3A1DA 3WHLA 3IAHA 4EARA 3RUPA 3TR5A 2J4DA 2OC4A 1RWOA 4WN9B 2EQ5A 3C1AA 3S2FA 1JX6A 4GYWA 2CVOA 4I14A 2FF5A 2WVAA 3BWMA 3P9PA 5CVUA 5BSTA 1U2DC 2X4IA 3HGMA 3WXMA 4DJTA 1IN1A 1TF7A 2JIBA 1NHGA 3P2KA 3OLVA 1PL6A 4HEHA 4I7EA 1KE2A 5H5JA 2J6HA 2XTZA 3K96A 4PS0A 3KQOA 5JIBA 4JWTA 3JVVA 3SIXA 3ZZMA 4LF5B 1QX3A 4HDQB 3UB4A 3HSSA 4ITVA 4M38A 1U2DA 3QEJA 3LPNA 1B8PA 4BMXA 3PWSA 4BP1A 4OSEA 3AF0A 3U2QA 4C4RA 4XM0A 1RAAA 4RJJA 1VP9A 3ESXA 3ZXXA 3D6TB 5BMVF 1JPJA 4LEIA 4QGSA 4NH0A 4K81B 2M6SA 2DQYA 4EUSA 1IY0A 1V1MB 1WXWA 2ZYDA 5JTTA 1XOIA 2H07A 4ETMA 3EEQA 5EZYA 1Y37A 4YJGA 4TT3A 4U3JB 2WICA 1Z4OA 3CH7A 1FVXA 4AN4A 1RM5A 4FI3F 4CPDA 1PYOA 2XOKD 2G06A 2QRGA 4RKRA 5ADUS 2ODNA 2EW8A 4GECA 1YC2A 3P2JA 1HR0B 2HBRA 1DINA 2W6JA 5A1JA 2J07A 3C3AA 5A7GA 2R7AA 1H9BA 2JJ1D 2WWRA 5AO9A 5B30A 4MKZA 2MT9A 1KMQA 2C0PA 4YHHB 2OT3B 3AR3A 4COOA 4TS4A 1LS6A 2VQ3A 1PVDA 4B3DA 1FJHA 1R16A 4TTJA 1U11A 4W63A 1II9A 1G3RA 2C95A 4JIGA 4DSAA 3PIRA 1L7AA 4NMWA 1CV2A 3UJAA 3VHXB 2X23A 1O6BA 4AKEA 3P20A 4IMPA 2HQRA 4LTDA 4MQ4A 5JALA 2GJAA 4ZYZA 4MRNA 5HUJA 4J03A 1NMXA 2Q3LA 4QATA 2VF5X 1D6MA 3ANNA 2CY0A 2O14A 1E3DA 2EFYA 2BZ0A 2H92A 1KFEB 4KE6A 3T5GA 1E1CA 3PQ8A 4ARZB 5K20A 1O89A 1E7WA 1HT2E 3DR5A 3M81A 1RVDA 1BAPA 2HADA 3OF3A 3L18A 1Z38A 3UUGA 4A6DA 3ICEA 4TXLA 3NNSA 4QTTB 1GO2A 4F3CA 2B4RO 1EB9A 2XUOA 2X3FA 3DLAA 4R2XA 2AC2A 2QTCA 1Y6JA 4R8MA 2A1UB 2SKEA 4OMDA 1Q1EA 2JK0A 3SYMA 2AEEA 4DZTA 3WADA 3ZWWA 3LTEA 5JZBA 2NLOA 4L4SA 5SY6A 1O9HA 3CLUC 4KFTA 1VIAA 3L4BC 1FDTA 3D8SA 2H1HA 4KJZA 4CEJA 1CLEA 5U4QA 4XYLA 3ABIA 3RSLA 1AS3A 2LTAA 1NOKA 3LXUX 4WZZA 2H5JA 2IUUA 1BQEA 2QRUA 3G85A 4M1MA 4UU8A 2AI3A 3WZMA 1CRZA 2JI7A 3RAFC 5FEMA 1GTMA 3L4BA 2GYWA 2OYRA 5K0ZA 1WW3A 4KW7A 1BS2A 2DJIA 4JKYA 1ID1A 4KWEA 1VPTA 4MKFA 1G5RA 4ZO8A 4R81A 5IDWA 4YAFA 1ARZA 4JCOA 5JXJA 3GEMA 1W4LA 3GXBA 4LMPA 3O2JA 5EE3A 3E3OA 2C20A 1ESCA 4O5OA 3BE5A 4R71A 1RPJA 1HUQA 1SCIA 3LXXA 1CUIA 1M5UA 3IAM6 4Y9RA 2RHRA 4X20B 5TF4A 1B23P 2WJIA 5DTIA 4JMPA 1VHLA 4RZSA 3TZQA 4HJXA 1D8TA 1BVUA 3CNLA 4MS4A 4M8IA 5BQPA 4ESEA 5C2JB 2AI1A 3W8NA 3GARA 5IDYA 4FDMA 3NM6B 3DEJA 4KKVA 3QLVC 1PS0A 3NOOA 1ZNQO 2R48A 1YB1A 2GAAA 1RZ3A 3QA3E 4BLTA 1TECE 2BFDA 3EVAA 1W48A 4BEBA 5P21A 4BDTA 1WXFA 2WMOB 3T9DA 4D57A 5KCZA 4D5EA 5BOSB 4KXYA 5TQVA 2RB5A 2VP6A 1VCNA 3ZY2A 1Z6XA 3TN7A 3QLVA 4UBKA 4LF8B 1D2RA 2XGJA 3OEHA 3L6EA 3DV9A 4MV1A 4D98A 4RGQA 1XZGA 4RVUA 2E4XA 4UATA 2GDJA 1T13A 4F71A 4RTMA 1Q7GA 3GRKA 4M22A 4D3DA 5TB5A 1BHJA 2O52A 2RGXA 3M0EA 4LKRA 2GK3A 2W11A 3IERA 2FR1A 5JSHA 4PGMA 3AVOA 4BO0A 1A1VA 1Q84A 2W83A 5EHZA 3HO1A 4BKPA 2JH8A 5CCBA 1XTZA 4K46A 3RT1A 1XZIA 3QVJA 1KOJA 3FCOA 4HWKA 2WT8A 1L7RA 1PK7A 1Z0KA 2QT9A 2I4IA 4W82A 4WJLA 5LR6A 2HU2A 5DBEX 4ZEWA 4OQLA 4DXDA 2B83A 2GA8A 1II8B 2ZWPA 3CLTC 3DBHB 2W4IA 1RKVA 4ZC8A 3GHHA 1OWMA 1JFRA 3SVZA 1Z18A 1QHGA 3MQFA 1C9JA 2QTHA 2ZJ1A 4Q47A 4B5LA 2CJWA 1GGNA 3FOBA 3ICWA 5K51A 4WFQA 2CMFA 1EZZA 3D54D 2ZDHA 1JA0A 1T8UA 4F9GA 4D9IA 3DDWA 2JH3A 1O2DA 4EENA 2P9ZA 3PXDA 1KJIA 1THMA 3AU8A 2W2VA 3QX7A 3SXPA 3UMFA 1E2PA 4QPPA 5KNCA 2C1XA 2DXIA 3GP5A 4C4AA 3EVCA 3K8ZA 4G4IA 4IHJB 1TCCA 3TNYA 4JZYA 4AB1A 4F96A 1OH6A 1U3TA 1XN1A 2G4CA 3IMKA 2Z2YA 2VC2B 3KCNA 5JTUA 1EG2A 3AK4A 2HV9A 2QVLA 3NHFA 3R5JA 1QONA 4YNBA 2IPXA 4BVLA 4FZVA 4F6CA 4N7JA 3CG0A 2V97A 4TTVA 1X39A 2E4UA 3HBLA 4OD0A 1WMEA 3BRWD 3I76A 4NRDA 1L4EA 2J3KA 1QYVA 5DIZA 3ZOZA 2NMVA 2FP4B 5B37A 3MJDA 4L08A 4G9EA 4CKEA 2XX3A 2X8WA 2X1MA 1EM8A 4H60A 3G9ZA 2VRWA 1Y5LA 2VNKA 1YC5A 3W4KA 3NC1C 4WTOA 4KWHA 121PA 2WJ3A 4MR7B 4YJHB 4A8JC 3D3JA 2RI6A 2IYLD 3K5PA 5JV5A 4D6PA 2GCNA 3RU2A 3OE7A 4NKRA 2R00C 3DCJA 3S44A 1CZKA 4OA8A 4ZREA 4QPDA 4FPXA 2NPFA 2NNWB 2WF7A 2OXEA 4O4IF 3WGHA 1EZ1A 3X1YA 3ZWVA 4A8JA 4W9NA 4K6GA 3ZTYA 2OG2A 3ED5A 2OXFA 4JQZA 1D2MA 1A5SB 2R00A 5ILQA 4J6FA 4B6JA 3T5PA 3JZMA 3VR3A 4UDXX 4JYPA 5LM3A 1X1RA 5DLDA 2DERA 1JFVA 4JEUA 4D0LB 1EMDA 1P4JA 1FYDA 3DZCA 4CDRA 1REQA 1X9HA 1W7AA 1Y1TA 1PG2A 4KP7A 3R3SA 1G8HA 1YB6A 2HUPA 1NXWA 3COWA 4I3FA 4MW9A 4TTAA 2II6A 4YT2A 5LZ9A 3KQKA 4KXVA 3V4ZA 3HE3A 3SJBA 2O3UA 2BKAA 4ND6A 5HPYB 3E84A 1F2TA 3LBIA 2ODPA 3Q1KA 3RUIA 2FVYA 2JD1A 4JJFA 3EEYA 4ZT6A 4LK3A 2VHJA 4RK6A 3L84A 4REQA 4BV9A 4ER7A 1G2IA 5F51A 4IRMA 5JSUA 4GMFA 3IB3A 5ECGC 1VYVA 4DJ5X 2ORYA 5CA0B 1YOBA 2BGJA 4M54A 3L6DA 1B8OA 5BYAA 1ZVMA 3PIIA 3VNSA 5LMUB 4D9KA 4Z0HO 3N2EA 2DQZA 2QWXA 4XDGA 2FW8A 3TW6A 5C7YA 2OBMA 4DSOA 1ISMA 4LMBA 3EDYA 4KACA 3FWNA 2O5RA 3NB0A 1XZDA 1C1XB 3SEQA 2X6QA 2CUTA 1D7AA 4DL9A 2H85A 4YLYA 2XCTB 3RHZA 1LS1A 3WNDA 4DV4B 4HS9A 2Y1GA 1TF2A 2BBTA 1CUAA 1FL9A 3E18A 1HMYA 2BBWA 3LT0A 2XWSA 1R6BX 4YAOA 4KMOA 1GU1A 1W5AA 1ZZGA 1E3QA 2VHCA 3BWBA 1GDTA 4OQMA 1A4IA 3Q5EA 3Q5GA 5C1DA 2L82A 1D2GA 1FYWA 2H0QA 2R2GA 4MHSA 3GRVA 5FWXB 2J46A 1C41A 4D82A 3HXOA 3NETA 3ZY6A 1KEPA 1HY3A 4IIFA 4FS8A 5SYNA 4M0KA 4JQSA 2V55B 5BXQC 3DYVA 1L1FA 4QDXA 1LBHA 1Y5RA 2B21A 3MAGA 3QPUA 2YBEA 1KHHA 4ARVA 1K68A 5DN6A 1Z7WA 1JQ5A 1XMOB 2G9RA 2V3WA 4CM5A 1A4UA 4MOWA 1PN3A 1GM5A 1JGTA 3U1TA 4JROA 3D3KA 4L75A 3UV3A 1D9XA 1NTOA 1TDJA 3JWPA 1Z6AA 3TRDA 3M9LA 2OESA 3TVDA 1F3OA 3AEZA 3K70D 5J9FA 3LAWA 1O54A 1P77A 3TAXA 4LHZA 5B6PA 1PJSA 1PR1A 1X13A 2GK7A 4NJOA 1FFWA 1HE2A 1Q21A 4C88A 2BDUA 4EKEA 3WGOA 3DHNA 5L8VA 1A50B 4QREA 4FILA 3P52A 1T29A 3AHFA 1TIPA 3Q3VA 5BYJA 3AJRA 1LPOA 3LQFA 2ON6A 3GUVA 4HDKB 1STOA 1U5BA 2PVCA 1XZCA 5TMBA 1I4OA 4JOCA 4OYHA 2HCJB 5JAPA 2JJ8A 3MJTA 3AESA 4LVNA 3ODPA 1QFXA 1Z33A 3IMFA 4OHVA 1NLYA 1G9XA 4Y1EA 3UANA 3UHOA 1X7DA 4IVQA 3E9QA 1BMFA 1PJ4A 5LBIA 3ZHTA 2YCBA 1B16A 5AKLA 1EFTA 1ZK0A 5K45A 1DJQA 1DCTA 1GSHA 3BWCA 1A9RA 1XFDA 3PEUA 2IGTA 1XRRA 3HCCA 4IXWA 2IF0A 3VNQA 1SKQA 4HDOB 3VKVA 1Q92A 3ICVA 4RY8A 4QUIA 4RBNA 4MCHA 4RD0A 5KJFA 1M0SA 3NNDA 2AOUA 2IW1A 5AI6A 2WNSA 3GJXC 4P0PB 4DRXA 2JEYA 1YONA 1H4VB 1EIZA 2WD8A 1N2CB 2FPSA 3PEVA 2UVPB 5FBQB 1BE6A 2Y8EA 4BQNA 2JGFA 4GC5A 2EFCB 4EPXA 4N5MA 1GZ5A 3QKRB 3HZZA 3UIEA 2DUJA 4JDUA 1ZN8A 3IT2A 1GL9B 1B0UA 5I9LA 3QVTA 4OXXA 3KETA 4LS3A 1XALA 2B4YA 2ZBUA 1J99A 4CMEC 4PR0A 1DAFA 1LNZA 2MINA 2QN1A 3LUJA 4J7AA 4KQXA 4G5GA 5HFNA 1JHDA 1ONOA 1JEYB 4HNVA 4ZOAA 4A5OA 1ZNXA 4J1QA 2ZWOA 2WY2D 2NVOA 4DUGD 3T7SA 1X0XA 4W5RA 1L5MA 2G40A 4CMEA 4ZQGA 4LECA 4AS2A 2VPQA 3MJCA 3RFCA 4I4NA 2ZWIA 3QV2A 3BH6A 4OLAA 3LZCA 1OH5A 5E2BA 4EELA 1JFFA 1CUYA 2WSMA 3CB2A 2HDHA 3I01M 4NZZA 1VXRA 3WAKA 4NC9A 4JDPA 2X0RA 5DGDA 1JWLA 1NPYA 3KJNA 3B1KA 4AJ2A 1YVRA 5FA8A 4NENA 3ZHSA 1J0DA 4CG3A 1TU3A 1K7EB 4Q18A 4C87A 2PUGA 3GJZA 3EZ6A 3AETB 4DWOA 4JI8B 3AB3A 3IGFA 3GH3A 4P82A 4WIAA 1X87A 4DEXA 4R98A 4RDXA 2HIHA 4RZXA 2A30A 2ENUA 4FHCA 4BRSA 4DF3A 1QO0D 1P1KA 4H1WA 1DUIA 3QE9Y 1QVZA 2D4AA 3JYNA 1Q6ZA 4CF5A 3HO8A 2WUDA 2NSJA 1U3FA 3BK2A 3CRRA 4ND2A 3WFZA 1ZLYA 3O8CA 3BXHA 3DHWC 3NHSA 5EJMA 5FUWA 4B3BA 4B4UA 3TCXB 2J87A 4QRDA 3UUWA 1O97D 4OM7A 2EGHA 3OX1A 5IDQA 2E1RA 4NBTA 1Z6TA 2XNKA 1FYXA 4CIVA 4B32A 3SE7A 4C7KA 1QZZA 1M34B 3KZKA 5CHYA 4IVPA 4JR2A 1KH3A 1UBJS 4MQEB 4Q1AA 4E5NA 3HU5A 1THTA 4WMLA 2WE7A 2WKPA 2JFZA 4TYMA 3U3ZA 4N82A 2YX1A 1TZMA 5AM0A 1E69A 2HHLA 4UCWA 3UJBA 1ZUWA 1IUNA 2OWEA 3C45A 4Z9XA 1PSWA 3U17A 4TRJA 4CV1A 2PR7A 1AA6A 4NCAA 2UUPA 3TOZA 2WZCA 5AHWA 1QMPA 1EJ0A 2PX0A 2V7BA 2RK4A 1QC5A 3I92A 1GUZA 2ZE8A 3ZI7A 3PX2A 1WZEA 4UM5A 3ZZNA 2FTKE 4H0FA 4Y1FA 3FPEA 2FOXA 4M88A 1TVKA 2W00A 1LWNA 4Q4AB 2H4ZA 5AW2A 4GOKA 3ICOA 5J63A 4QGHA 4BMCA 4Q34A 3PRKE 2ZVPX 5A1TA 3HP7A 2ZP1A 2D0IA 3NDIA 1W1UA 5LD2B 4ACAA 3WBKA 4PZCA 5CX4A 2GPBA 1J8QA 3KFXA 1ECJA 1HM5A 2CXUA 3W5AA 1WB6A 2PJDA 2JCYA 1DAKA 3I4FA 3MMNA 2X0DA 3M83A 1QH9A 4BO6A 5SZKB 2IXAA 2WK1A 4QUKA 3UG6A 3NBXX 1ESDA 2IYOA 3KC2A 2ZK7A 4M1OA 5ALZA 1RQ7A 3EG5A 2QJFA 2ANCA 1V41E 2H2DA 4EMBA 5L53A 2WP0A 4HVCA 1L7QA 1COZA 3H4TA 2VWHA 2YXLA 1EB8A 2ZSHA 2GM9A 4FJ2A 5IDXA 1ICEA 3O4HA 2WG1A 5GGXA 2AZDA 2VPXA 3U3KA 3GU3A 3VSBA 3HJCA 5LQRA 4F8YA 2XA2A 3BMQB 3K6KA 4HI0E 4LOHA 4QPCA 3A4VA 5E95A 1I1QB 3VU1A 2E9SA 3LD9A 3LHSA 3QPCA 3NGXA 2QBYB 3CWCA 3DF9A 3T12A 3EIQA 4G65A 4C7BA 3JQPA 1U4SA 1RWPA 4MVJI 3SX2A 4BNDB 4MHOA 4BO8A 3SNHA 1L5KA 4DA8A 4QARA 3QG1A 1UBKS 3ZLJA 4N8SA 1N8TA 3WNZA 2ZCUA 1GG8A 4WBNA 3F7MA 4K05A 3ZXIA 4KQ6A 3U7IA 1QS0B 4E08A 1JHAA 4B6GA 2V7TA 2WIGA 1T2EA 2ZBVA 3X0DA 3RWBA 5HM8A 3E9CA 5J4HA 1I1HA 3BWYA 2Q2NA 4Y2UA 4LE2A 2XDQA 4UOQA 3RE1A 5EHNA 4A10A 4BNHA 4S04A 3FHLA 3O8OB 4H31A 3T7CA 4PTZA 3L4KA 1WD5A 2FZ5A 4L9SA 3QJYA 2XZTA 3G88A 4UULA 5E9AA 4AULA 1SC3A 1DXQA 1SVOA 1YFKA 4G8BA 3GLFE 3MB8A 2G8NA 4PLGA 1JR3A 1CY2A 3PITA 1MV8A 3O4IA 2YN4A 2I2BA 3AM3A 4TMYA 4RV5A 4U9IS 3WB1A 5FBVB 3D7KA 1TFUA 3D3WB 3GJRA 4OBXA 4XQCA 1DBSA 4RKEA 1BJRE 1ZOLA 4OAQA 1QAMA 2VZ8A 2W90A 5B1IA 2J08A 3GOQA 2OPBA 2RGBA 4QL3A 4BGVA 3LF2A 2Y9PB 5IK2D 5AHXA 3KXPA 4YT5A 1YAJA 2O8FA 4UHBA 1E6LA 4P7KA 4MJ3A 3O83A 1E2DA 1KSJA 3F49S 3TI9A 2CV0A 4LRQA 5ALIA 4M0CA 3QU7A 3OHPA 3PGKA 4B17A 4C43A 3OTGA 4I0WB 2DBZA 1SHTX 1LNQA 2P4SA 4QYMA 3OKPA 3P0RA 4EHDA 1G5IA 3X2EA 3VZSA 1ZR4A 3ZH9B 3HJFA 2F3SA 1XF1A 1LBQA 2LKDA 4I55B 3SM9A 3WX0A 4EJ2A 1EWVA 1SVLA 3PWKA 1OX6A 2W93A 3LG2A 3B89A 4HFJA 2GB4A 3OFVA 1N6RA 4HNGA 4NZMA 5GAJA 5BW6B 3SG0A 2AZTA 4YAKA 3V1LA 3JQFA 4F6RB 3DV0A 3N0VA 2GMWA 3CZ4A 3PPVA 4IQGA 1M3SA 4J3JA 4ZCRA 3LSTA 1UDXA 4QVIA 4QSMA 3V8PA 2GNPA 1EFUA 4FBGA 4DCVA 4PO8A 5CH5A 1T5OA 4D81A 1MNAA 5BNFA 1TGYA 2XYGA 2C77A 3QP9A 3VYWA 1TM2A 1UIMA 2BFEB 1OCEA 2H0RA 4QUBA 3PI6A 5EQJB 4EM6A 5IBQA 1ZM3A 4AM8A 4X7PA 4RCZA 4ZANA 1J7JA 3RYFA 1Q1ZA 2HQOA 1GKLA 2ID9A 4HEJA 2CHFA 2ZTHA 3SIPA 1CYDA 1UQUA 2J48A 2C5SA 4OU4A 2IYUA 2SHKA 2H00A 1S8OA 2Z8XA 3GEEA 3OIFA 4XIYA 2VLIA 4D4GA 3FI9A 2QIPA 3H1BA 1YR1A 2JVIA 3OCCA 1XZFA 4HNAA 2VDMB 2CL0X 5H9VA 1WEHA 4EVSA 5CIYA 2GN2A 3Q88A 3FYDA 2FK7A 4NCIA 1WB5A 5G3YA 4JU8A 3OZTA 4UZFA 1HYGA 2C4TA 2R8EA 4FW8A 4YQEA 5K0SA 4LJ8A 3IKMB 2XUAA 4QBGB 4EITA 2AEMA 4GDMA 2FWJA 4LPSA 5IW8A 3RD5A 3CWZA 1HSZA 2Q4EA 2WI8A 3TPFA 4CR6A 5K4HA 4QTYA 2VP9A 5LXTF 4X66B 4Y2RA 1N92A 1TAUA 2A0UA 4Y2YA 1UFOA 3LFTA 3SOPA 3QSYA 5FBHA 5FPYA 4WKOA 4M6WB 2PUFA 4GKJB 1YKGA 2N1BA 1LQTA 3O95A 2MJLA 1ZJWA 1LBIA 3K6SA 1AZTA 2O2YA 5AT1A 3BGDA 3H86A 3IKJA 3T15A 5K2OA 4RO0A 3SYRA 1QH1A 2G6TA 2Q0XA 3AEUB 3I42A 3I2GA 5DCYA 5JCXA 4IF4A 5EP3A 1U5AA 4IKEA 4RA9B 2WUGA 3HO6A 3OJEA 4EY6A 1V8DA 2ASEA 5FBLB 1K75A 4PAQA 2XWQA 1YULA 3CU5A 2OMKA 4K26A 1ZK3A 2IZZA 5G1PA 5GONB 3V4VB 1FMCA 1E5DA 3N58A 3FNQA 5DJ5A 3EIXA 3GJYA 4INPA 2QSYA 3MWDA 5DO9A 1P0IA 1N6PA 2GFHA 3KUXA 2EARA 1NY5A 4O6VA 4ND5A 2VCEA 3KQMA 4PC2A 5EOVA 2CD7A 4A82A 5GVRA 1SHLA 1OI2A 2W2QA 1NNSA 4TMZA 4G5QA 4AX8A 3CM0A 3OIUA 3IDZA 1T36B 1D07A 2QPTA 3CNBA 4Q7MB 2WIDA 4O1MA 4C7OB 1RYNA 3GN1A 3GRFA 5ESWA 3ZIAD 4FZJA 2XEXA 2EBWA 4JOBA 4PSVA 1X1QA 5ALJA 1V1RB 3C3YA 4Z1MD 4EGQA 1TC1A 9ATCA 2HU5A 1B2LA 2D8MA 2G0AA 2QEQA 3M49A 1P1JA 3AR9A 4KYUA 5CT4A 1TM7E 3SNKA 4DMCA 1PX0A 5D2CA 4JP5A 4TMXA 1PO7A 5AOAA 3GLHA 4JL6A 3ELWA 1CR6A 2Y66A 2PE5A 1AD2A 3LIPA 2CLCX 3SF0A 3D81A 4FDTA 3ZDQA 3FUXA 5FV4A 1MB0A 2GWHA 2IH2A 2GZRA 5H02A 3SCZA 4QKQA 4XJXA 4AZTA 5LC1A 2WU4A 5HSGA 5JEEA 1E0KA 2DWCA 2E89A 1TUBB 4B76A 4EVQA 3WIBA 3RH0A 4Q1EA 2EERA 5FQOA 1OYVA 1CRPA 4MDFA 1E1RA 2NUTA 3EXAA 1JSXA 1O94C 1V45E 4EY8A 3H6GA 3EB9A 3VKHA 2J5RA 2L19A 3KKPA 3BFKA 4G1BA 1Q57A 2UUCB 4WXPA 3NHYA 4L5BA 1GKKA 1DIAA 3HXPA 3BIWA 1O94A 2QIOA 5H70A 2BF7A 3B1WA 1U8YA 3LPLA 3O93A 3KVYA 5M7EA 1KYYA 2KX7A 2H1LA 4BQEA 2EJWA 5CCEA 2AK3A 3F7NA 3G2OA 3B3AA 3AKYA 1R00A 5EIFA 5CFMA 3JQQA 5CB6A 3VH3A 1AB5A 2DTDA 1GPH1 3C14C 3D6JA 1NUSA 2Z5VA 2MOKA 1XI2A 3F4KA 4L8LA 2MSWA 5CYFA 1AJEA 3JRXA 2W43A 3LC1O 2ZRFA 5DWVA 4YMVA 1B3RA 1GZHB 4YA6A 2QY9A 4MWOA 5AM2A 5BRJA 2Q0SA 1TUIA 3JQCA 3H7IA 2Q9UA 1SIOA 2IEIA 4HAIA 4MPDA 4RH3A 1AS2A 1JSZA 1DKOA 3QVSA 4WK4B 3ESCA 4B7UA 1X74A 2JIZD 4B46A 1H2YA 5F5LA 1YMVA 3OI7A 4Z4HA 5KBYA 4UNIA 3QWHA 2XQVA 3RS7A 1ULBA 1T6YA 2Q8NA 3E3LA 4G23A 2DPLA 2JGJA 3HNRA 4JEHA 2B98A 4BJ1A 3NORA 5F33A 1OX5A 4KAFA 5KWIA 3WTBA 3U4CA 3N87A 4B7AA 2H3EA 3R8CA 2JKYA 1G2QA 2ONYA 3SHWA 2WOOA 1PW5A 1WM1A 4HRXA 1I2CA 3B6MA 5WRFA 2J0EA 3NVMB 4E1BA 3NDRA 4P58A 4CLDA 4NESA 4RKFA 5K3EA 1DTWB 5KSOA 2H29A 2NU7B 5DXJA 4O4HF 1VMKA 1C80A 1OFIA 1Q16A 1I4EB 4FE3A 1RJGA 4MR8A 5FA5A 2UUBB 5KHLB 1ZNZA 2PAAA 1L7BA 2CLFB 3K32A 2P4UA 4CV2A 4S0ZA 5IT9A 1VFPA 5DBHX 4PHCA 4IJ6A 2GA9A 4MEAA 2O7VA 3NBKA 5EI5A 3SHQA 4TTIA 4RTJA 1OZ0A 1NAHA 3RREA 1QOPB 3G8CA 4GXRA 4MA0A 4PG7A 2COKA 1L1QA 1RWMA 1MRSA 2CVPA 2HMSA 3EDQA 3RC3A 3E27A 3JYHA 4ETWA 4YQFA 4GC9A 2OZLA 1TJYA 2BFMA 2GN4A 1WDKA 5L3ZA 1HLGA 2JFXA 2AKEA 5JE8A 4I4TB 4M7PA 5NLLA 2F1IA 3TQSA 1UM8A 1CUUA 4HL6A 1SBTA 1Y4DE 1AVTA 1NFQA 2PKCA 3OC0A 4BGIA 1KK0A 1PX2A 4XEUA 3TL6A 3GDGA 1ZWKA 2PNFA 1KQNA 1AV7A 2D74A 4OA5A 3R7WB 3VR5D 4AZVA 3G02A 5K0TA 5L3QA 5IVKA 5KTYA 4DC9A 3R3VA 3ZHUA 3B5JA 3L8YA 1UR5A 1MEOA 4QXPA 4G5HA 2BCEA 3IP6A 5IC6A 1SU6A 2ZRNA 3HBNA 4JC8A 3UV6A 1PJCA 2QXYA 5D5QA 5FFNA 3S8YA 5GOZA 1JZTA 1L3CA 4F2DA 4KO4S 4PC3A 1BJKA 3TLYA 1QHSA 3DXXA 1PHRA 4G5YA 1Z3CA 5F73A 5LBUA 5JXWA 3AL0C 4BFCA 2AQ8A 2CNOA 1C7ZA 3GBVA 5EG5A 2Y0PA 1MABB 1SU4A 1XA0A 1JXOA 4HDNA 4V0LA 1GTVA 7REQA 5FUQA 3K9NA 1QF6A 3TSWA 1CZNA 4O4LA 5TPZA 1YRQA 3A32A 5FYQA 1EA7A 3UENA 4AJOA 4YV7A 1F0YA 1LPMA 1DX4A 1G7TA 1K9SA 1QYDA 2J0SA 1XD2A 4UNRA 2QRMA 1NF9A 1P81A 2QM3A 4JLPA 4Q21A 1MJFA 1WF3A 4YQZA 4KPFC 1WCYA 3DEZA 5KSPA 1FFAA 3MXOA 4IDNA 3VC2A 4AYWA 4EI9A 1YNOA 3MOGA 4KPEC 4ZVKA 3H19A 1NKSA 1Y6QA 4N6OA 4Q4DA 1X7ZB 2AJTA 2YDYA 1S3FA 2JKZA 5ALDA 4PSKA 4EI2A 3DBLA 1G3MA 3R4CA 4MVWA 4XQ0A 1FP6A 3W5UA 5JCZA 2YS7A 2CW5A 4U2FA 3U3RA 1Z73A 2QT1A 3AF1A 4B82A 3ZJUA 3H6HA 3AVUA 1UBMS 2B94A 4I99A 3F9CA 3CF4A 1A72A 2FRDC 1R7RA 2ECOA 5ALOA 2XUFA 5ECDA 1BQ3A 4MJ7A 1IDN1 3GT7A 1A04A 4NS4A 3LFUA 4IJWA 2WZDA 4ZIRA 4TTSA 5KPJA 1AHNA 1ZINA 5AI0A 1M8KA 5CURA 1LK0A 2Y68A 4PC6A 3GGCA 5HFJA 2FRDA 3DDOA 3LA8A 3STYA 2ZJ5A 4O2RA 3EIHA 4MTCA 3AW8A 4J0HA 2IZOA 3RYHB 4UHFA 3AUYA 1K9VF 4JUBA 4LRUA 4CQMD 1OZGA 5IUJC 1UINA 4M9SA 2GJ8A 4ZOLA 2ZAYA 4M9XA 2P2GA 2QMHA 1H9CA 2O2XA 1MGOA 1DIRA 3RS8A 4V0ME 4I55F 1AHPA 3D6NB 4GEKA 4WJKB 1IE3A 1UZLA 2IWRA 1A8PA 2NOAA 3KPJA 2M2IA 2FSVC 3IDSA 1NFFA 4MVJG 3P2EA 3EDMA 2X0FA 3SM3A 1EEXB 3ACDA 3DEKA 3DS8A 1G8MA 5CBKA 1ZWLA 3LDFA 1CNMA 1SVNA 4ITRC 5FNVF 2ZE5A 3TNLA 5E3HA 1C9NA 2Y67A 3TLKA 4X90A 2IL1A 3Q3HA 1A8IA 3L01A 2R6JA 4G1CA 3DEHA 2FSVA 1XZLA 1TJ4A 4U0KA 3MTQA 2XQFA 1GU0A 2HRBA 3O4JA 3FVTA 1E99A 2JGMA 1VE7A 1O03A 1AUVA 1QH8A 2P9JA 3WIVA 4EY7A 3NYQA 5I9IA 3GHYA 2IXGA 1B3BA 2YVQA 3FTNA 1FFCA 4FWTA 1X77A 3RYCA 3H04A 5TS2A 1I7QB 2HFJA 4M55A 2NSDA 3QXCA 4CLOB 3UATA 1ZIOA 3CRW1 3GQBB 5T3UA 1EPUA 3JYPA 5JECA 1M2WA 2A7XA 1I7DA 1G8YA 1TJ3A 5L3VA 1G0OA 2PXCA 3QXXA 4XCQA 3TIFA 1V8FA 3LU1A 5B4UA 3GRZA 2VCYA 2P75A 3TLMA 4KNWA 1Y4ZA 3GO4A 1Q0LA 3COVA 1QE0A 2JGDB 3TNJA 3UBMA 4ZGWA 4O3FA 2C8KA 2PBRA 3IXMA 1WMDA 2N75A 3M5DA 4MCJA 3DVAA 1KOFA 2E5WA 1DZ3A 3LOPA 3N6RA 4PQYA 5JS1A 4ZQIA 1PU2A 1HZZC 5ED0A 4KXWA 1AK9A 5ECYA 4E5SA 3C5HA 2FWIA 3GBPA 3SE0A 1JKJB 2WWWA 4IYRA 4X7RA 5GJCA 3UICA 3SWWA 2E0IA 1XC7A 1M9NA 3VOBA 3V46A 1TMOA 2VQ6A 5LXTA 4GLJA 4EGFA 2ERCA 2P9EA 1C0KA 1Z7EA 3RARA 4TLLB 2NPOA 2R11A 1HZZA 4GI5A 1U6KA 4NZ9A 1SOUA 3DOFA 4EF6A 1IWPB 4L8YA 1KA9H 4FLEA 4AUKA 3I5XA 4MS4B 4ZRNA 1YF3A 3P9QA 2D7DA 1GQYA 2IOQA 5K01A 5C5DA 4MVJE 4LXIA 5AK0A 1HE4A 2BAGA 3N74A 5HG0A 4WGFA 4IMJB 4NMLA 1F1JA 4R8SA 5B4VA 5IHPA 3W90A 5FWYB 4LKOA 2IDMA 3D31A 3CNHA 1UJ6A 4IUCS 3E1SA 4MZXA 4Q9IA 1ZRMA 4TWZA 3C85A 2QLNA 3P9XA 3QV1A 1QWOA 2REBA 1E1LA 4MYRA 3ETJA 2PRJA 2X1LA 4DJDC 4RVGA 2FEKA 5EKDA 4MIKA 5IJ9A 4ROTA 3TJRA 3GLGB 3QEOA 2FEXA 3CF2A 4GQAA 4HY3A 4KXMA 2VTBB 4JLMA 2HOQA 3HA2A 3PGLA 2P5TB 5COBA 2IDZA 1BW9B 1DO2A 2HLNA 5HCUA 1V6SA 2AFIB 3RO7A 4DBLE 1EIWA 3TEJA 1J5PA 4F9TA 1KI7A 4MUEA 3L7CA 3B1FA 2OFXA 5L7YA 5FAKA 2IU3A 3F1KA 3IIKA 4NP6A 2G5CA