3BWYA

Crystal structure of human 108m catechol o-methyltransferase bound with s-adenosylmethionine and inhibitor dinitrocatechol
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human 108V and 108M catechol O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords COMT protein
total genus 84
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwyA00
5T67A 3HA5A 5DM2A 3AWIA 3DUWA 5DM0A 1G8AA 3HM2A 4BP3A 1XDSA 3BGVA 5C1IA 2HNKA 2AN5A 1RI3A 3LGAA 5LQRA 3MCTA 3GXOA 1JQEA 3HCEA 3LCCA 3IV6A 5DX0A 1KHHA 2JHPA 3EGIA 3GRZA 2UYQA 3HCBA 1L3IA 2IGTA 3G7UA 1WY7A 2OBFA 5G02A 5E9QA 3OFKA 4QPPA 3PTAA 3SSMA 2A14A 4PONA 3EGVA 4E2XA 2PWYA 1SUSA 4MTLA 1JSXA 3M6VA 1D2GA 4DF3A 2AOXA 2B25A 4CWAA 2PJDA 2PLWA 1QAOA 2HWKA 5DXAA 1NW8A 2IP2A 5FQNA 3TM5A 4C04A 5LQNA 4KDRA 5EC8A 5U4XA 4AZTA 3PX2A 4RVDA 5ICCA 5DWQA 2PY6A 5K0CA 3ERCA 1BOOA 5E2AA 1ZKDA 3KPWA 4YUVA 3FTEA 1NKVA 5E1BA 3EVEA 4PYOA 1JSZA 3TQSA 3FUUA 2N47A 3I58A 3P8ZA 4GBED 1VBFA 3E23A 4G56A 5EOVA 2ZWVA 3KR1A 4DKJA 2FK8A 5DLYA 3A26A 3CC8A 4E70A 3O31A 4Y30A 4X63A 1SVUA 5DTRA 4MWZA 2I62A 4YUYA 3ELYA 1VE3A 4DM3A 2O05A 3FUTA 2ZBQA 2AN4A 4EKIA 2R3SA 2QRVB 3DXXA 3DOUA 5BW4A 3PT9A 3I64A 2Z6QA 2CMGA 2P8JA 2VDWA 1SQGA 1SUIA 3HCAA 3RIEA 3NJRA 2QRVA 3R24A 2Z6UA 3TPZA 4GC5A 3FTFA 2C7QA 3B3FA 3P71T 1JQDA 4B17A 2PV0A 5E2BA 2XYRA 5B1SA 4BP1A 2PKWA 5DX8A 4QQNA 3UJDA 1JQ3A 2ADMA 4NECA 4OA8A 1NW7A 4IV8A 3DMGA 4GQBA 1RJDA 1QAMA 3M6XA 2PX5A 4RVGA 5E1DA 2ZLBA 4DMGA 3B7PA 4R6XA 1DCTA 1VIDA 1WZNA 3NWBA 3HEMA 3P2IA 1AF7A 5EPEA 1YFLA 3FPGA 2I6GA 3PB3A 4HGZA 2O06A 3CJQA 4CKEA 3BGDA 3LDUA 1KPGA 3FUWA 5D1NA 4OA5A 1M0EA 4PYNA 3CVOA 5K0BA 3EVFA 3UJ7A 3DLIA 2YXLA 4C03A 3FUXA 4FS8A 5KQRA 3Q87B 4E33A 3MCZA 3P2KA 4HTFA 4P58A 2YQZA 5EEHA 5LSAA 1RI4A 2PBFA 4ER0A 1ORIA 4ER5A 3HTXA 2VZ9A 3PVCA 3NVMB 2FRXA 5F2KA 3NTVA 1R8YA 3EVDA 1P39A 5JR3A 4PYKA 4GEKA 2P40A 2NYUA 3CBGA 5CVDA 2AZTA 1VLMA 4FSDA 2GLUA 1P1CA 3C6MA 3FPFA 1MHTA 3SSOA 3HA3A 3EEOA 2O07A 3KPYA 2PXXA 5K8VA 5LQUA 4OQEA 3FPJA 1JG1A 3KPVA 4MQ4A 2IBTA 3ER8A 1R00A 5CVJA 4KDCA 1XXLA 1JG4A 5K05A 3GRUA 3UWPA 4QDJA 4O29A 4KIGA 2QM3A 4F86A 2AN3A 3TR6A 2G1PA 1XTPA 3M70A 3GRYA 3M6WA 3Q7EA 2YX1A 5GOZA 4YMGA 2ONZA 3A25A 4RYLA 4E31A 2YUIA 4ZTBA 3FYDA 5CD1A 2G8NA 3DXYA 5K03A 4C05A 5K0EA 2PXAA 4R8SA 3UJAA 4POOA 3DLCA 2ZIGA 3BZBA 1L3CA 1N7JA 3L8DA 3QOWA 1Q0TA 4EKGA 3B3JA 2IFTA 4QVKA 1N7IA 4LG1A 2F8LA 3IYLW 2AVNA 3LDGA 5LQJA 3I9FA 3S68A 1UFKA 3NMUF 3WSTA 3KQSA 5KYGA 2ZSUA 1YUBA 1X1DA 3PLAE 3SVZA 2NP6A 2JG3A 1O54A 2ZCJA 3TKAA 2G70A 1RI2A 4YV1A 1M6EX 3GO4A 3EVBA 1TW3A 2PX4A 4FP9A 1AQJA 3HP7A 2IDJA 2Z6AA 3BWMA 2IPXA 4EQZA 2ERCA 1Z3CA 5FHRA 4KVZA 2OY0A 3P97A 3LKDA 1KYWA 4MIKA 1X1BA 2CKDA 2PT6A 4GOOD 2PVCA 4RTMA 3QOXA 5BP7A 1EJ6A 2QY6A 3AY0A 1X1CA 4HRAA 4X60A 3KR2A 3HNRA 3KQOA 3UA4A 2NXNA 1VQ1A 5GIPE 2VDVE 4Z2YA 3EVZA 4IKPA 4PYLA 1WG8A 5FADA 4EMSA 3G2MA 4PNEA 5H02A 1IXKA 2B9EA 2ZWAA 2P3QA 3C6KA 3T0IA 3RODA 2UZ4A 3OFJA 3EEYA 3A7DA 1FJXA 3ID6C 4E30A 4PYIA 4YUWA 1F3LA 5K01A 3AXTA 3FTCA 5C0OE 2PSSA 2E5WA 4QPNA 5CVUA 4AX8A 5K0FA 3FPEA 3C3PA 3FUVA 3P9KA 4HSGA 1IM8A 3CGGA 3MHTA 9MHTA 3KQWA 4QQKA 2BR3A 3C3YA 3M4XA 3UJCA 2JHAA 4FGZA 2NP7A 2BM8A 3C0KA 3EMDA 2GB4A 3E7PA 5MHTA 1WXWA 3BWBA 3MQ2A 3P9CA 3DULA 2GAFA 3I53A 5DRYA 4RV9A 3DR5A 3UJBA 1RJGA 2UYHA 2HTEA 3GWZA 4RWZA 3MB5A 1PJZA 4P7FA 2OXTA 3KU1A 3G5TA 5HILA 1QANA 1ZGJA 4FR0A 2ZZNA 3DMHA 1OR8A 1RI1A 3FZGA 3G2QA 3P9IA 5T6BA 1JTFA 1DUSA 3VC1A 2H11A 3SR4A 5E1MA 1P91A 3MTEA 3TLJA 2ZIFA 4XUDA 3U81A 5LQCA 4C08A 1R6AA 2IBSA 5EKUA 3SM3A 1M6YA 4RTSA 3H2BA 3LKZA 4GOLD 4RTNA 5GWXA 4PIPA 1L1EA 3OPNA 1FPQA 3QV2A 4C07A 4M37A 1RJEA 3TOSA 8MHTA 2OO3A 2O0LA 2P1DA 4LECA 5GM2A 4YUXA 3BXOA 2PT9A 5EHIA 3LL7A 3MTIA 5EMMA 3BKXA 5DTQA 2H1RA 4QVGA 1G55A 1G60A 2VDUE 5LQKA 1NV8A 2GS9A 2PX2A 5CVEA 2AOWA 5F2OA 2FPOA 3THRA 4A6DA 3SX0A 5IH3A 2XYVA 2WA2A 5HFJA 4EVIA 5EMLA 5EVJA 1L3BA 4KWCA 5EG5A 3TRKA 4UOEA 3ANXA 1SKMA 1KPIA 1R8XA 3CJRA 1QAQA 4LWPA 4ER7A 2AOUB 3GCZA 1NE2A 2JJQA 3LECA 4R05A 2EG5A 3GRVA 2CMHA 3FTDA 2AOUA 1D2CA 2YXEA 4XUCA 4DQ0A 4OX9Y 1RI5A 3LPMA 5HIKA 5BXYA 1INLA 4PCAA 1QZZA 4U7TB 4WXHA 4FSXA 4PIMA 2BZGA 1NW6A 5ICGA 2HR1A 2ZZKA 3I5UA 3CKKA 1KXZA 2QE6A 3JWHA 3R9XB 5EQJB 3TFWA 4PGGA 5M5BA 1EQAA 1FP1D 2YR0A 1FBNA 3KQPA 1DL5A 4CKCA 2NXCA 5FUBA 4JXJA 5FA8A 3HCCA 4X1OA 3TMAA 1H1DA 3E8SA 4BLWA 2ZBPA 2OKCA 2IIPA 3OZSA 4ISCA 5EIWA 3T7TA 3E05A 3KPJA 3UJ9A 5DTMA 1NT2A 3UZUA 1G38A 1JR4A 4RSRA 5FTWA 2PXCA 4RTQA 4R8RA 1BC5A 3HVIA 2ZZMA 3IEIA 3NW9A 2B78A 5FULA 2G71A 3OZTA 4PYJA 1F38A 4FT4A 2AOVA 4XCXA 3V97A 4YMHA 3BWCA 5K09A 4V0RA 2DULA 5KQSA 2UYOA 1XDZA 3LCUA 5EGSA 2AOTB 1JG2A 5EMKA 5EKXA 5GIOE 4YV2A 4E32A 2KW5A 3KR9A 4RTPA 1ZG3A 1UIRA 3VSEA 3KPUA 4FT2A 4HC4A 2ESRA 4RX1A 5DX1A 2B3TA 4PYQA 3B3GA 3VYWA 2P3LA 3EVGA 1KR5A 4F84A 1ZGAA 4L7VA 1YZ3A 3P9NA 5GP1A 4E2ZA 4ER6A 2NNWB 2C7RA 1KPHA 5K0JA 2Y1WA 2AVDA 5DSXA 3ORHA 3FPHA 2YVLA 5HZMA 3LCVB 4LWOA 1VPTA 2AS0A 3LBYA 5CCBA 2NXEA 1FP2A 5FWDA 3NVKI 2OYRA 1KP9A 1X1AA 2K4MA 5EZQA 3M33A 3G5LA 3ELUA 3OU7A 5K0LA 2QYOA 5EIFA 3MGGA 5BW5A 1HNNA 2IH4A 3MAGA 3NWEA 2GPYA 5DXJA 1KIAA 2OZVA 3A4TA 3ER9A 5LR6A 4P7KA 3VC2A 3LDFA 3KR0A 2FHPA 3GNLA 2PGXA 4IWNA 2EFJA 2P41A 2BR4A 3LX6A 1AV6A 1R18A 5K0GA 2Y1XA 2P7HA 2ZW9A 2AOTA 3P2EA 1YB2A 3HVHA 3T7SA 3A7EA 3UFBA 1G6Q1 5KS2A 4CTKA 3OZRA 1JTEA 3G89A 2YTZA 2JHCA 3HA7A 3AJDA 3DP7A 1VL5A 2IDKA 4H0NA 1EJ0A 2BM9A 1XCLA 3EMBA 4DCMA 2JH8A 4HTFB 3LBFA 2P3OA 2IH5A 4M38A 2PX8A 5E8JA 5ERGB 3SGLA 1N2XA 3KQQA 5E9JA 4X41A 4GOMD 4PCLA 4PGHA 4QTTB 1L9KA 1U2ZA 3PFHA 4RVFA 5DPMA 5DSTA 4HGYA 1TPYA 4DA4A 5HEKA 3BGIA 4ATNA 2BH2A 3BKWA 5E1OA 3NDIA 4X61A 1SG9A 5E9WA 2ZTHA 4AZSA 7MHTA 3HCDA 1IY9A 3DXZA 3R0QA 4P7GA 3UJ8A 2B2CA 3SSNA 3NDJA 3IHTA 5LQAA 3LSTA 3M6UA 4V0QA 5FWAA 3X0DA 3PFGA 5FHQA 3UA3A 4R6WA 5DM4A 5ICEA 3KQTA 5HIIA 4ER3A 4RTOA 3HVJA 5CVVA 1D2HA 2FYTA 3THSA 2HV9A 2FCAA 4FZVA 2OB2A 4PINA 4U7PB 1YF3A 3TM4A 3KQVA 3GRRA 3HCFA 3V8VA 5HOQA 4BLUA 1YFJA 3LHDA 3F4KA 4RTRA 3JWGA 3JWIA 5FA5A 5K0NA 1AQIA 4XUEA 1WS6A 5IKMA 1XVAA 2LD4A 5HIJA 2C7PA 4IV0A 3K0BA 1XJ5A 3GJYA 3OE4A 1I1NA 3ME5A 4P7JA 3FRHA 4Y2HA 5HIMA 5GINE 1NW5A 4QTUB 5CUQA 2ZULA 1BKYA 2XVAA 3PS9A 3OU2A 2VP3A 3KQMA 3R6TA 4OQDA 2OPBA 3DH0A 5EHGA 4C4AA 2C7OA 3G88A 1I9GA 1V39A 4MHTA 2G72A 4GF5A 3CCFA 4QDKA 2P35A 1ZQ9A 2DPMA 4M36A 5FQOA 2ORED 3TKYA 2WK1A 4CXMA 5CIYA 2AR0A 1EIZA 4DZRA 3B5IA 2ZBRA 4KIFA 1HMYA 3G8BA 2NXJA 3FYCA 1XDUA 1P1BA 2YXDA 1ORHA 3KHKA 3PX3A 2EJUA 2CWWA 3AXSA 3T7RA 3GU3A 3BT7A 1BHJA 4HG2A 5EEGA 4E2YA 4OBXA 2XVMA 5FCDA 3RW9A 4M7RA 2XBMA 2I9KA 4HH4A 4C06A 5DT2A 2GH1A 5JUWA 3DMFA 4RTKA 2EJTA 3OCJA 1G8SA 1PRYA 3KQYA 1VP3A 4DCGA 2OB1A 2UYCA 1UWVA 2JH9A 3B89A 1KYZA 1T43A 4KW7A 3HVKA 1JG3A 4CTJA 3EPPA 3D2LA 1SQFA 3G2OA 2P7IA 5ICFA 1X19A 2CL5A 3BWYA 3SXJA 2Q41A 5E8RA 1TW2A 1I4WA 1YZHA 4GC9A 4GOND 2V7EA 10MHA 5GM1A 4RTJA 2O57A 3FRIA 1VP9A 1WXXA 2XYQA 2BR5A 2V74B 2VS1A 5DRTA 3A27A 3OU6A 1B42A 5DM1A 3MERA 4OBWA 4A6EA 1NBHA 1EG2A 3EGEA 5EMJA 1EAMA 5KVAA 4WVLA 5EZSA 4K6MA 4F85A 4AUKA 4YUZA 3GDHA 4BY9E 3CJTA 3EVAA 2HMYB 4E2WA 3JWJA 3ELWA 1Q0SA 2FK7A 5P8WA 3REOA 4GUAA 3GIWA 5D1HA 4BLVA 2I7CA 1NV9A 2R6ZA 4CKBA 2ZIEA 3KKZA 1Y8CA 3UBTA 5CM2Z 3G8AA 2GA9A 1XCJA 4PYMA 4RTLA 3BUSA 4RVHA 1NW3A 1ZHFA 4PWYA 1NBIA 4KRGA 3EVCA 3DTNA 3O7WA 2EX4A 5C9ZA 1MJFA 3GGDA 4AZWA 1O9GA 3K6RA 4EK9A 3SMQA 5CCXA 3OE5A 1R74A 2H00A 1O9HA 2PWPA 3O4FA 2IH2A 4YV0A 1QYRA 2ONYA 3ELDA 3G2PA 5F2NA 3UJ6A 5T64A 3R3HA 2ZFUA 1RJFA 2ZVJA 4AZVA 2WA1A
chains in the Genus database with same CATH superfamily
3HKDB 4MQ5A 2CMFA 2H1CA 3FKSD 5L7TA 4RM3A 2Y1EA 1WOYA 1YI1A 2RG1A 4HHEA 3L49A 1KYXA 1BXKA 4HR7A 5AESA 1SHKA 4IZHA 4M21A 5KX5B 1AKRA 2GHQA 3KZVA 3NORA 3DO5A 3O21A 4A15A 3N58A 1NE7A 1JEEA 2Q99A 2WU4A 3IV6A 4FIZA 4L95C 5JCXA 1NJ6A 3HCBA 4WBNB 3SIWA 1XTIA 3ZN2A 4C0XA 2O2JA 2G77B 4J76A 1PWEA 4KAFA 4TSKA 1ZNZA 4RPKA 1I01A 1ST2A 5FBRB 3UOWA 3HHPA 5JOQA 4GSLA 3SIPA 4I50B 5AKHA 3GGSA 1SUSA 2Z5VA 1Y3HA 4XB6B 1DUIA 1YQQA 3NTOA 4OREX 3JYPA 3FSJX 1TJ4A 2ZRGA 2EJBA 3GA0A 5KX5A 4U4AA 1IDN1 3TOVA 1Y34E 1A5BB 2O0JA 3JAWA 1YZQA 2XUGA 3ZJUA 2VP6A 3VR1A 3DO8A 3INYA 2XE6A 1S7CA 5KVVA 4LXHA 1AKVA 2I71A 1QHFA 4WKNA 2X41A 4GXQA 3ZHCA 5IT5A 3A1VA 2XXAA 5IAJA 3PNVA 1D0IA 4PVDA 4QPDA 1Y4DE 2GKOA 3E23A 4G5SA 4X8LA 4BU1A 3CRNA 4C3ZA 3EPRA 2R62A 1CQXA 5IUNC 5CK4A 2QG4A 3V8RA 3MT7A 4P3KA 4XEUA 5FR2A 5A71A 3X2EA 4LX0A 4UU0A 4FYMA 4MWZA 4CEJA 3TE6A 2JJ1A 3FUTA 3RS7A 1RJ9B 5DYNA 1GCAA 2HQOA 3SJUA 3AVTA 3OESA 3QITA 4INAA 4IIHA 3TEMA 4KG7A 1E20A 1K89A 1YR7A 4LHZA 5H3CA 3ADDA 1XZHA 3L84A 9GPBA 4MP6A 1LV7A 1X14A 4R7ZA 3FTFA 1A9XB 2YOHA 5JCPA 3PPXA 4H59A 4PPYA 1PR1A 2WJ6A 1D1QA 1YKGA 3FHOA 1N9GA 1OF1A 3BSWA 2I4RA 3PQ7A 1P44A 1VG1A 2D54A 3ILVA 4IV8A 3E5RA 4OA8A 5HA5A 1E1DA 2JDIA 5ICMA 4DSTA 4MR9A 3S8MA 1GUBA 1SXPA 1L8QA 4BLRA 5E1DA 1Y9AA 3LHSA 2ZLBA 1DCTA 3EHDA 4CR7A 4I55B 2JLUA 3SHVA 1ILWA 1NF2A 2C88A 2I6GA 2R6R1 3OO0A 3AG5A 3LVRE 1X8XA 3GGJA 1FYDA 1KGDA 3FUWA 4MDYA 5JAPA 1Z0JA 1IBCA 2FFJA 1P81A 2ZJFA 3FNRA 3KEOA 1HOTA 1PL0A 2NX2A 1N2JA 2GK6A 2VDMB 1VL8A 2GYUA 3GUVA 4FS8A 3UK6A 1VJ5A 3O95A 3OO1A 5KC9A 2BE9A 4I19A 1ZI8A 1QG6A 4MYSA 4QNMA 1Y4ZA 4Q18A 2W11A 1RWBA 3ODGA 3ZVMA 3N2LA 1E1QA 2FZKA 4P4GA 3PVCA 3IRVA 2H4ZA 1FFXB 4DM4A 2AR9A 2Z09A 3EDMA 2BMVA 3BMCA 1MHTA 1JI0A 4S24A 1M76A 3LZCA 2GXUA 3NPAA 1F0KA 4M1WA 1C9MA 1JG1A 2F8MA 1OMOA 1YL7A 2DJIA 3NTXA 3FFAA 4JELA 4YJGB 3FOEC 3IT1A 1WQ4A 3J81A 3NTLA 2VEDA 2XKJE 5JYBA 4KR7A 1TD9A 3DYBA 1OWOA 2J4DA 2LIVA 1V5GA 3KRTA 3PDHA 2I7VA 4KIGA 4RK7A 2JPDA 1KMHB 1XZ8A 3NPMA 1ODFA 3IAUA 4WY2A 1CYEA 2WYIA 2VJPA 2UDPA 3I6YA 4PC3A 4W5TA 2OPHA 1PW7A 4S1PA 4C05A 1NF3A 1UBHS 2Q07A 3WLEA 3ZCQA 4KITB 1Q20A 4AQ7A 4PG4A 1T3LA 2OC4A 1VC2A 3PITA 4J43A 2QVGA 2O52A 1SBQA 1L5KA 1XNJA 5COBA 5KSZA 4RPHA 1LU9A 5BNIA 1I8TA 2VDJA 1JDPA 4U2BA 5CDUA 5KYYA 1C7JA 3EIWA 4MGYR 4IXWA 4J1SA 1W9MA 2BONA 4FFSA 3OIYA 1D9XA 4GYWA 3C7KA 1UPTA 3GZ4A 3EIEA 4R3NA 4DJJA 4EG4A 5KNCA 2XY4A 3TI9A 2BMFA 4FP9A 3HB9A 1VCIA 3DZKA 3OKAA 5FHRA 3TZCA 3GLGB 3LWZA 1T2EA 2GZMA 5J2TF 4QXOA 4PS1A 2GD2A 1U3WA 2XNDD 4JLBA 4BRZA 2CXUA 3R3WA 5JRZA 2ZRCA 3G0DA 1U0EA 3AH8A 2FPIA 3TE7A 4FKMA 4HS4A 5BP7A 4RTMA 3M7IA 3PFFA 4QO8A 2GRUA 4D45A 3HVRA 4DNOA 3HNRA 4KXLA 1XJCA 3S1LA 2X5XA 3DJYA 3MFYA 4YMTA 1WZIA 1B41A 3T3OA 3EVZA 3PPIA 4PYLA 1G8PA 2VHTA 4MJ3A 3QEKA 3STTA 2ZWAA 3Q3HA 4N41A 3S5UA 1UBSB 3OCZA 3QBTA 2M32A 3NI2A 4HAYA 4J0IA 1SVSA 3SKVA 3QJ5A 3W2FA 4DWWA 5KYTA 2NWQA 4RK0A 3BMOB 2BTEA 3H9BA 3WYDA 2GM5A 4G5HA 1T0PA 4CCYB 4YMVA 3BVPA 1S2IA 3CURA 5DF1A 1UM9B 4OHOA 2CWDA 3E9QA 1JEDA 2P1RA 3SXUA 3SVTA 3UJCA 1SKUA 2WINI 4Q3NA 3ICCA 1GFSA 4PBTA 1U4OA 2VIIA 3TBKA 2QZPA 2EFCB 5FBQB 4DUGD 3VHXA 1ZI9A 3I6ZA 4KBFA 5DI3B 1JDSA 3IULA 3UJBA 4EHNA 4F4UA 1N3YA 4G8BA 1L5VA 4JB8A 1E89A 1V96A 1TJYA 1K66A 2X1HA 3PDCA 2J31A 4X7RA 5HILA 3K8OE 2VQDA 4DRYA 3GP5A 3NIWA 2RI1A 1RKBA 4Y6GB 1XZNA 3ZJVA 2HPZA 1DUSA 1XZEA 3R1IA 3SR4A 4B0OA 4MUFA 1HFWA 5LQCA 3TLGA 5LP1A 4IQFA 3U81A 4EKNB 1W9HA 1K6XA 3ESQA 3FYHA 4I3HA 3MJVA 3GVCA 4TKUA 3MPUA 1VGVA 1ORRA 3HG7A 1EK5A 1O6ZA 1CZUA 1KC1A 2E85A 5GWXA 3TLYA 2IX3A 3LY5A 1L4FA 5BSMA 5C8YA 4GXTA 2QVLA 2FSGA 3HJBA 4KODA 4KR0A 1YNOA 1NPTO 2EZ4A 1SK9A 2XNDA 1TD1A 2FLWA 3BL8A 1EE1A 3KUUA 2GPWA 5TF4A 2GF0A 3EFHA 3F6RA 1NV8A 4WDQA 4A6DA 2R79A 3S99A 3VPFA 3ZZ1A 3NOQA 2G9QA 3U4IA 4LRYA 1RBQA 1C9DB 4QLBA 4D8XA 2JLSA 2R66A 1E2HA 1PFYA 1Z15A 3F8TA 3L0SA 1JS1X 2ZK7A 3Q2KA 2JI8A 3WGHA 2QGFA 5LP6C 5ED4A 1BXRA 2W5UA 3NBFA 1JAYA 3TS1A 3WLHA 3GLIB 2GBPA 5I7SA 3VPBA 4DXHA 5AVXA 1LPBB 1R9NA 3LLVA 4JDPA 4CHTA 1L7OA 3I9V6 2QTHA 3TZ6A 3R5SA 1Z7BA 2WD7A 4D1YA 1GZ7A 1HSOA 1V16B 2Y92A 2BTQB 2ZXFA 4CT5A 1PSDA 4G1MB 1OH7A 1LLFA 2AFRA 2GNAA 3QLVA 1QIKA 1ES9A 2R4TA 1XELA 3VAAA 1KXZA 4XARA 4LY3A 5JJIA 1B6TA 2CNDA 1IBKB 1CUHA 4FMCF 1UXIA 3TFQA 4IO0A 1Y6RA 3E8SA 4BNFA 1T24A 1XBTA 1R8JA 1OV6A 3OZSA 4ISCA 4ALNA 2AD1A 4AMBA 4QA9A 4E11A 1AUOA 4LYHA 1RLUA 4TXLA 1YDGA 3FPSA 3EJ6A 2GASA 2E4XA 2Q3HA 2PXCA 1GPAA 1QM5A 2R6JA 2WR8A 2YS7A 3TF5A 3GXBA 1E4YA 1E3TA 3QTLA 4R81A 2XKBA 3OZTA 2NQ8A 4O6VA 4NAHA 5TJ9A 1Z7YA 4YTEA 5LLTA 2IHYA 2XTAA 9LDTA 2EKBA 1G63A 5JSHA 3EBLA 5F4BA 4BX3A 2BCEA 3TAUA 3K31A 1CS4C 3I2JA 4DANA 5HR5A 4QDUA 3KPUA 1TQ2A 5AKIA 1OV4A 3ZGXA 1AM4D 3KLMX 2J3QA 3AL0C 2P3LA 3JV7A 3JATA 4MRNA 4DSOA 2ZUTA 3IMEA 4YP0A 4ER6A 4F84A 1KFCB 4JIMA 2ZVPX 1K3UB 1YFKA 3X43A 3SIRA 1Z8FA 3ORHA 1QPBA 2AMJA 5CCBA 3LFHA 3T5MA 4ABTA 3GVPA 1FP2A 2IPNA 3FB1A 3OLZA 3QVVA 3ZV4A 1KP9A 1NYTA 4NYJR 3WQQA 3RAEC 3OU7A 5C37A 3M5CA 5GAJA 4GYYA 1MB9A 1QZUA 2IZZA 5DXJA 4Y8VA 4NXMB 2WW8A 5C4GB 2EATA 3BB1A 1AQ6A 3OY2A 4PRKA 5AI4A 3T4XA 2EFJA 3WNZA 2NUTB 4FB4A 5BVHB 4X1YB 5DNYB 3WDLA 1UBGA 2DUJA 3HVHA 4BO8A 4N49A 1USIA 5E7JA 1SEPA 3E82A 5BNTA 5FH9A 5CXXA 5K8IA 3VR3A 1EWVA 2SECE 3DZHA 1RFGE 1C7QA 1OFHA 2EFEB 2J5BA 1SPBS 4Q1CA 1V71A 4JLAA 4A0RA 1V6SA 3L9XA 1RE0A 3KG2A 3UMFA 4EIWA 5JFGA 1J0DA 1GZSA 2Q0SA 3LLMA 3MIIA 3NQ41 4ZFNA 5IZ4A 3S8EA 3U80A 4BU0A 3QPUA 4GZ6A 4LBVA 3BULA 3BB4A 2H0QA 4KLRA 4JSTA 5DPMA 4HGYA 5F1PA 1LX6A 2ORIA 3QMVA 2GZ2A 2ZSAA 4W5JA 3QY0A 5E9WA 4LC0A 1WDMA 2NTJA 3KLNA 3H75A 5CYFA 4AIIA 4BJ3A 1DQPA 3AVVA 2F1OA 3VPXA 3X1XA 1A0OA 4EO7A 4IIGA 2FHSA 1A8SA 4YIKA 2WZDA 2VWQA 4RK5A 1E98A 1IQRA 3I4CA 4YK7A 2WMNB 3V34A 1ECCA 2X0RA 4Z7NB 4KV9A 1NJ5A 1DZIA 1WL8A 4IMRA 3AI7A 1VMKA 4FYHA 2OB2A 1U8EA 2F90A 2LIPA 1SU6A 2VTVA 3H8WA 3K9HA 4H08A 5DULA 5IP5A 1D7OA 1H8ED 2HFKA 2VJMA 4BGUA 1YFJA 1BW9A 3ZVRA 3HXTA 5A2QA 3MYRA 5FA5A 1JVBA 4BXOB 1WS6A 5ESXA 5HIJA 3W9YA 4L85A 4PAGA 3NO4A 4J4TA 4Q1DA 3N0RA 3GY0A 2Y0PA 1SBZA 3WK6A 5LN1A 1YMVA 1DWUA 4MS3A 1RWMA 3ENWA 5DHFA 3R6TA 2RHWA 4MHSA 4HN2A 3G88A 2AZMA 3K2IA 3TK1A 3N6VA 3T38A 1MEJA 1QB8A 4FINA 4POAA 1C14A 3BMQA 2DWOA 4FU0A 4UJ3A 3TSZA 1TM4E 1EIZA 3U1BA 5T7BA 4J90A 1XFDA 4KIUA 5ALWA 5NULA 1J0CA 5CFPA 2EW1A 5HQTA 2ENUA 3LUHA 1Z7EA 1J33A 3H83A 2VDWB 1NN1A 4UXIA 3NHRA 2CWWA 3PHBE 3IALA 3MMNA 5DSZA 4LFCB 4UCXA 3T7RA 2EZ9A 3H6HA 3UXEA 3ZWDA 1F8XA 4E2YA 1EVQA 3OQVA 4YCMA 3HFJA 1QFJA 4DJTA 5IVIA 1E5DA 4H7JA 2IXAA 1ILEA 1K8XB 5G0WA 1EDEA 4BC0A 2LW7A 1E8MA 1OBVA 5EZYF 1W4CA 2F8TA 4F5WA 1GV0A 2GLXA 5AVSA 5ALRA 1W7AA 3TIGA 4E5DA 2AXNA 5EWJB 3BAFA 3D6JA 4DJFC 1X19A 1UT6A 5IJ0B 1XXHB 2Q41A 4OX9Y 1HE8B 1A5AB 4RM2A 4AYWA 3K53A 2WY2D 1OFVA 2O57A 3CISA 3COWA 4NX2A 3ZYZA 4FKBA 4QWWA 1M83A 4K86A 1JU3A 5JVDA 4Q39A 1EH5A 1D03A 1NUQA 2QS9A 4BV8A 3B48A 3CCCA 4EW2A 4DLSA 3DWFA 4IWYA 3AP1A 3I6MA 4BLTA 1XD2A 1E4VA 4G1CA 3NYWA 4IF4A 1M33A 2Z2KA 2B4QA 1PWZA 2PBLA 1HEIA 5FBLB 2GXAA 1WXHA 4WZAE 1U94A 1QIHA 5GIOE 2XCOA 4CEIB 1OGIA 5JY1A 1H3EA 4UNNA 5D1HA 3KWLA 4QDTA 2ARKA 3V1MA 4MRVA 4D4LA 2P9ZA 1ST3A 1U90A 3H19A 4LJ5A 2G67A 4EY3A 1AURA 5IJ9B 1T6NA 2ZJYA 2EX4A 4FW9A 4R1TA 2OSVA 1VMAA 4F6RA 3FMVA 1R74A 3OE5A 3ZWVA 4YLGA 5FAKA 5SZIA 2FSVA 2XVXA 4ZYYA 3COJA 5FV4A 4XKJA 2VWGA 2FEKA 1GPYA 1U1CA 3DO6A 4CKEB 4B3TB 3V8NA 4AZVA 3MJFA 2GEUA 3HV0A 1Z4PX 1WRBA 1C30A 4ED9A 1CNEA 2VJCA 1JKJA 4YNBA 4QXMA 4RPJA 1J00A 4I6GA 3RIMA 3TDNA 4CIWA 3ICWA 2HNKA 1VM6A 2RJ3A 4IXTA 1Z4NA 3ND9A 1EDOA 4K9PA 1ND5A 3L06A 2Z3VA 3ZXIA 1RYNA 1THZA 5FL3A 1A2KC 4LF7B 1KOGA 1ESZA 2LP4Y 4BZXA 2VF8A 3ESBA 2XCSB 1WULS 5IT0A 4KQKA 3IODA 1QCYA 1X7ZB 1C8VB 3WC4A 3W5SA 4D0LB 2XB6A 3D3KA 1S2LA 4R2MA 4I8XA 3O4RA 2QBYA 1RLJA 3SG0A 5F5LA 1H0SA 2AHRA 3DM9B 3OF3A 4N5HX 4X8MA 4AMUA 1FBTA 3AGQA 4DF3A 1LDGA 4CWAA 1MMFB 1M34A 3HXPA 3NHMA 4QEDA 1M0SA 4N5DA 1KI3A 1N9KA 1YQXA 4WOJA 4Y7CA 1PI3A 4Z4QA 4AJNA 1ZM3A 5AM4A 4DARA 1ZD3A 1PNRA 1CHDA 2DFDA 2JARA 3JAKA 2JDID 2NTEA 5EJGA 3HY6A 3T3EA 3GD7A 1SXJB 3SD7A 5I7RA 4M0KA 2X42A 2P6MA 1MZPA 2NSJA 3LYHA 3JYOA 2PRSA 2IOQA 1HQDA 1J9GA 3FUUA 3L4BA 3L8GA 4UTVA 2XMQA 1VBFA 2YUTA 2JGIA 2FPUA 3G1UA 3LHIA 2FEWB 2O8DB 1MXFA 2NVBA 1YQGA 1BN6A 2C94A 3KKOA 3N7TA 4KZKA 1ZCZA 4BFSA 3AYXB 4OEHA 1DMSA 1XAGA 1MTZA 2C9BA 1IEQA 3GFFA 3RG2A 1IZ0A 3IMKA 3Q41A 2H51A 2VVTA 1NPDA 2HBZA 2PH7A 2P8JA 2COKA 3PQDA 4EPRA 3NJRA 1GTRA 3RKUA 4L5AA 1TEZA 5A6SB 4EJ0A 3VOBA 3W7BA 1FFCA 2X86A 4C2BA 4HQ0A 3CRVA 4R2IA 2PV0A 5EGNA 1Z18A 1J5PA 2G88A 3ZXXA 2XMPA 4QQNA 4OIFA 1JQ3A 1EUCB 4KO2S 1D6SA 4IQGA 1GFWA 4RELA 3ZH2A 4TM7A 1JFRA 1RHUA 2BFMA 3O7MA 3ONWA 1PR2A 1Z6QA 3I1JA 4KXMA 1E32A 1FJHA 1P61B 2CVZA 4NU0A 4BNJA 1E77A 1Q22A 2H48A 4B3HA 3JQ9A 2Z5FA 3JQGA 1QCZA 2CNWA 2CCGA 3R77A 3OOWA 4DIFA 3HEMA 4H77A 1W8IA 4LZOA 2AZDA 3NHSA 2FJPA 2QN9A 4MUIA 4MQEB 1HOXA 4YH1A 5E6UB 5C46F 2IYPA 3AERB 3LDUA 4MINA 2FF5A 3U44B 2REQA 4MWEA 4FMBB 1P7YA 3WGYA 5D01A 1SD2A 1ECLA 3EVFA 4LTDA 4Q7JB 5DHAA 3UJ7A 2WJJA 3ZLJA 4IDAA 5A3VA 5KAMA 5JHHB 4TWIA 2BEVB 2A1TR 3GEBA 3KSDO 1DE0A 4CL2A 1HZZC 3P2KA 1QIEA 3PI6A 1N2IA 1XU7A 2PBFA 2PMWB 4BBAA 4OLBA 2R4QA 4NARA 4ZQIA 2QNBA 4OY3A 5FWXA 4ZYLA 1U2RA 4S35A 4NENB 1NURA 4YRTA 2IUTA 4X92A 3VTZA 5EHZA 3H1BA 4GPEA 3G7NA 1MP0A 2HJRA 3OJCA 4LVCA 5TGTA 2J3HA 1AN9A 2AHOA 3H18A 4PYKA 3RYFA 5K9ZA 3S2IA 1Q16A 3IAM1 1W87A 1WU7A 3IUBA 5KTKA 3UO8B 3AM4A 2CYAA 3DG9A 5K4AA 4UEWA 4DA0A 4E4RA 3DAFA 4J3FA 2P9TA 2ZYVX 4HNAB 3V33A 3ER8A 2G80A 3DL0A 3RLIA 3OMXA 5AK0A 3DEJA 4RKFA 3RVDA 1VLLA 5J9FA 1JF8A 1DLJA 3T7IA 2JD2A 1Q11A 4CIDA 4YRZA 2O8CB 2ID7A 2PKRA 3H5NA 1DADA 4NJOA 3WLSA 1S9DA 2OQ2A 2X1MA 3X1YA 1EM8B 1I4DD 2P11A 1CWUA 3MVEA 4WADA 4QECA 1DBQA 4WH0A 4D57A 5JIBA 1DT3A 1ECFA 4BNLA 3Q9SA 2CJPA 1XU4A 4YQEA 2IDZA 2F9LA 4BCCA 1ZRHA 1I3MA 1YR3A 1A4RA 1G3MA 2H92A 2Y6VA 2ZAYA 1UPXA 1YDWA 2G4CA 4PLTA 4EG6A 4EM6A 2VNJA 1KZ6A 2FWMX 3D4OA 1HL3A 3T0GA 3HKCB 3DV0A 2CF6A 3EEFA 3VDMA 4FJ1A 4QVKA 1PJBA 4MW4A 2I03A 2W8BB 4WNAA 1JFFA 3D6FA 4XJTA 1YSCA 1EVEA 4ODIA 1MIHA 2FPMA 2QIOA 4MUBA 4OHPA 1HR0B 5ITSA 4IVPA 1RZ3A 4ZT3A 1JFTA 1O54A 4DLPA 4DUZB 4ZQEA 3WYAA 3RSHA 1BKDR 1UPFA 2YN2A 3T3NA 4TYYA 3K7EA 2PX4A 1G20E 2D00A 1WD7A 3BCRA 1CERA 3LRTA 1EX6A 2Z6AA 1J2UA 5KQPA 3O0TA 4ZDWA 2OY0A 3F7NA 5ALQA 3ZGYA 3KAJA 3JQ9C 2NO4A 3ZHTA 1JDBC 2QN6A 2Q9UA 2VJMB 4KB5A 4OL0A 3RI3A 2BBOA 3W8DA 1KYWA 4F7DA 5B3KA 1UCFA 4KQGA 3DMRA 4G0UA 4EECA 4WVFA 5DBEX 3MRVA 1UEIA 2PVCA 5HCUA 3IIIA 4BVGA 4HGRA 1NUPA 4M1ZA 1A76A 5M3BA 4II3A 3UA4A 1JAHA 1HUQA 2A4KA 2XKKA 2HBYA 4L08A 1ZGGA 3FDJA 5AXAA 4IJVA 3BK1A 1C8LA 1TJNA 1LDEA 4N3CA 4S2UA 1W48A 4G4SP 3VR2A 4ZWNA 1YV9A 2NZXA 1HZZA 1DVRA 4YUWA 4ZODA 3BICA 5C0OE 5MGNA 2C5EA 1ZWLA 4IGIA 1NATA 3CUSA 3E7FA 2IYLD 3OETA 1TUBB 4ZIRB 5L45A 1EK6A 1Z0DA 3CG0A 1V5WA 1NZJA 3KQWA 3STWA 4Q16A 4HDKB 5HZKA 4E09A 4DR6B 4U3JB 5JTTA 2PGAA 4JOBA 1NI4A 1UBFA 4B6GA 4M0PA 5EAIA 2C98A 2JLVA 2H57A 5DRYA 1KKUA 1OLXA 2XD4A 5F23A 2CVOA 1DTEA 3MB5A 1KFEB 4NBVA 5E4FA 4TVKA 4B6SA 1U0JA 3QWHA 4QUKA 4BATA 5EJ5A 3VXKA 5CT8A 2DWCA 1G59A 4K3UA 1J56A 5BNFA 3FHJA 1SKAA 3Q4GA 3SQLA 4C4SA 4E6PA 4PZUA 5FNZA 1UR5A 5BSRA 1C0KA 2J07A 4MWBA 4QFBA 2QL9A 4HUJA 4NJEB 3PWTA 1YMQA 2Q1SA 1JT2A 1SVKA 4TS1A 5IU6A 1PTKA 2A35A 3LLCA 4IVNA 1N8NA 3WIUA 3PKIA 3OPNA 1FP7A 2ZDHA 3ZZUA 4Z4EA 4ZV9A 2I2WA 1TUIA 2DUWA 4TTVA 1ZOSA 5H3LA 2PKQO 3AETB 4D3ZA 3JD4A 1MU0A 3A6PC 3HDYA 2PK3A 4W9MC 2WJZB 2WSLA 2PD6A 5B3LA 3ZDBA 3HO1A 2XYGA 3W79A 2QRJA 3K9QO 3Q7TA 1QIMA 4OGFA 1K4KA 5K3OA 3N86A 4B3BA 5ARBA 5TGDA 2IY9A 2NVOA 3A10A 4TV8B 3R9IA 3ZUGA 3I4FA 2HMSA 4UBJA 5CMLA 1QLJA 2WFZA 4BMXA 1FYVA 4TYPA 1RYYA 2AX3A 2QTFA 3HN6A 4Q12A 1MQAA 1Z08A 2GCOA 2KJQA 2XGGA 3EIFA 3IBFA 1KQNA 3RH0A 4ZYUA 4RPGA 5JNTA 5DNEA 5JCJD 1M6WA 4R3WA 4MDHA 1L7DA 3C8DA 1OX6A 2PAFA 3AEZA 2OE2A 3G6KA 1NYLA 1SIBE 2BKVA 3NJ4A 3SF0A 5BYJA 1S4QA 1EP1B 1Q7CA 1V43A 3DOOA 1Q92A 4PIMA 5A7GA 2X14A 3JVIA 4R2LA 2ZUUA 1YH3A 1PF7E 4DR1B 1P45A 4KNWA 4BQEA 2UUCB 1KK3A 3QOFA 4MROA 2HXGA 1II9A 3BXEA 1KKLA 3PC7A 1DL5A 4CETA 5EJ4A 4FE7A 2NXCA 3ZDYB 5IPFA 2VPYA 3I45A 4AZ0B 1KJJA 2ORVA 3AUKA 3DZCA 4JDUA 3TX6A 2FQWA 4C9BA 2VZ0A 5I45A 3W8EA 3DC2A 3CQ9A 3KZNA 4RSRA 2BFPA 2BBWA 2R85A 2Z3ZA 3VH3A 3BL6A 2HA7A 2OK8A 3GJSA 2EXXA 2JJ1D 3OTWA 4JVNA 3OD1A 3UIEA 5B55A 3CT4A 4PYJA 2B78A 3FIJA 4XDGA 1B0UA 3N2GB 4B3FX 4PG6A 2O3UA 3BWCA 5CEFA 3NYRA 3P4YA 4NCHA 5FYQA 4AQYB 1K7CA 3O4GA 5AUOB 4QYXA 3NS7A 2C4TA 2OV6A 3VGPA 3D8TA 2O4UX 2OFPA 3CPEA 4ZMSA 2ERXA 3CUTA 5JBQA 1FTSA 5BPFA 3FMIA 1IOWA 4JI4B 1Z25A 4G0NA 3PE4A 1DWPA 4JI6B 4ABYA 3KOYA 3K9NA 2O5CA 1T0BA 2NNWB 2ZYRA 1N3BA 3RUPA 3PGJA 3TRDA 2CXRA 2PGLA 2VA9A 2WZCA 2YVLA 5CGZA 3AFMA 4KR9A 4Q7QA 3CH7A 1SVNA 4LWOA 4U9HS 1KVQA 4XVHA 4F2GA 4I4NA 3SQXA 4PZLA 3IPRA 2OHVA 3VO1A 1JDUA 3ZK9A 5K0LA 2WD7B 4OXIA 1C7RA 1TYEB 1Z13A 2EV9A 3NOXA 3RAJA 3BIWA 3WMRA 3G82C 1T5OA 1D0VA 1U0FA 4LBYA 3RJ9A 4LC9A 3G68A 3ZH9B 3ZHVA 1EA7A 1J8FA 1FMTA 3GNLA 4JXKA 5CBPA 1GCUA 2D7JA 4RLHA 3HYTA 4MV0A 2F3QA 3KHSA 3BWEA 2Q49A 3I62A 4ID3A 3AJ8A 3OLCX 3B3QA 3KTOA 4KGDA 3TW6A 2ZBUA 4EHJA 3A28A 2V4UA 5BWNA 2CNWD 1PR3A 4QNNA 3DF9A 3NBXX 2IS1A 3UYKA 1A7AA 1OE0A 2HGZA 2VDNB 1IBLB 2WV9A 1PQWA 3EZXA 1RYEA 2P6UA 1RZRD 1Z4MA 1ZK0A 4PX3A 1BG6A 1C0LA 2WTXA 5B53A 1E6EA 4YFYA 1U2ZA 5THXA 2A7XA 5K3DA 1NIJA 1WCIB 1SC9A 4PNZA 4LS3A 4RY8A 5H4GA 4XE5A 2BH2A 4OSEA 1UWCA 4MP8A 3EAGA 3PUIA 1T4BA 3DAPA 1K7FB 4HQNA 1I24A 1YI8A 4M88A 3ETCA 4RAOA 3LA8A 3F5MA 3IC5A 3Q6MA 4BVHA 4JROA 5L3SA 4MWCA 3PZRA 2HOQA 4GR5A 2O7QA 4RHFA 3FOWA 1CIPA 2ZBGA 1RQ7A 4L22A 5I5GA 2WFAA 2WM2A 2VHVA 2C8LA 5KJEA 4C22A 4ZU3A 3MGBA 3UA3A 4G1EB 3FMGA 4FOLA 1BWQA 4A73A 2ZRMA 4KXXA 4CU2A 9ATCA 4MUYA 1AS2A 3CT6A 3EUEA 4MV3A 4C2UA 1NXTA 3GRRA 4MO9A 1DC6A 3MTJA 3DTYA 1XTJA 4CYMA 3HYLA 1CUUA 2EYQA 4C0QC 2V65A 4AMVA 1ONNA 1DAFA 4A8TA 1DX6A 1KGSA 4N9WA 4JI7B 3F78A 1O95D 1DUVG 1UKCA 2AV6A 4WXPA 2F9MA 3BWXA 4INOA 2W48A 2GQ0A 2WSSA 4UUQA 1AKWA 2R65A 2G72A 1PZFA 1VLVA 4YRGA 2PR2A 2P35A 1DCKA 4CE6A 2HADA 4MQBA 1YJQA 3N2IA 1U4SA 1ETHA 4QOHA 2VJOA 4QU5A 3HDQA 2WF9A 3OJEA 1XA0A 5JAMA 2NXJA 3TAHA 4YY3B 1U3GA 1IMOA 1OBOA 3FNHA 4WZZA 3T3MB 2OA0A 4YT2A 2ZUFA 4OAPA 4WKPA 2GYVA 2OXIA 3T9EA 1R7RA 3HL4A 1UDCA 1U8TA 2JI6A 3NWOA 4L1KA 3T5GA 1C41A 3UK2A 5BN4B 2XBMA 3RW9A 3GG2A 1RC8A 3SFTA 4RTKA 3OCJA 3UWOA 1KJIA 2P5TB 2P9HA 1PQYA 2JFWA 2FP4B 1KYZA 2FW9A 1SM4A 4TYQA 1W44A 2D5BA 1M72A 2X4IA 2R8OA 1VGQA 3ITNA 2RGCA 4MW2A 5AKKA 5DWVA 2E4UA 1OZ0A 1OBCA 4EA6A 2BSXA 1HXHA 2YWBA 4DS3A 4CV1A 4UDXX 1HORA 4PRYA 2NQ2C 2YZ7A 4HPJB 3L05A 3VR0A 3PIIA 2DLNA 5IDQA 3OU6A 1U1EA 2VH1A 3GP8A 1K9VF 2QM8A 1EG2A 1Q6ZA 4HAIA 3L0IB 4C0LA 1SC1A 4IP0A 1YAJA 2LDBA 1KYYA 2OCLA 2QD1A 1BJKA 1PR6A 2NT4A 1GNLA 2VFAA 2Y1OA 3KKKA 4HS9A 4PPQA 1WPQA 3UNXA 5K6AC 3U19A 1E1MA 2Q28A 3MRTA 3EVAA 1CY0A 1YMUA 3GMSA 3DT6A 4FQ7A 4JENA 4PXAA 1DC7A 1WDLA 4BAZA 3A1TA 2AJ8A 1JSCA 3CF4A 3REOA 5LU8A 4G6ZA 1B3BA 4MCHA 1ULZA 5IULC 4LCBA 5LA6A 1NV9A 2R6ZA 2ZETA 4JGGA 2R6HA 1M2WA 3FYUA 3GVHA 4AJ9A 3F74A 4FX2A 4DBVO 4AO7A 2ODTX 3AHHA 3GYBA 4BE9A 5C9ZA 1JTVA 2PZGA 1NVGA 2VDKB 1QO7A 2EEPA 3B52X 4EPYA 5B1EA 5B1HA 4UM9D 1WDKA 4Q4AB 4K9LA 2QJWA 1RXUA 4CNQA 3L1VA 2ONYA 4Y1EA 4D8WA 2JCYA 5T64A 4WA7A 4JI0B 2W6CX 4F5YA 4UMDA 1FDRA 2YHUA 3H0KA 2ILTA 5EUCA 4LV6A 2RGDA 1P3Y1 4KR6A 5TMPA 2ZI4A 1TJ5A 4L5IA 4R2JA 1AE1A 3I1YA 3AJEA 1SULA 3ROFA 2NU6A 2GK4A 1ZICA 1IY2A 3CX8A 2JLYA 3IP3A 1TYZA 1NU6A 2GRJA 3OI7A 4Y7DA 3ZHUA 3LCCA 5IJ0A 2I76A 4PCVA 3K70C 2DR0A 4J7UA 4LHYA 4GGMX 5HCNA 6ABPA 2XQJA 2J41A 3IE0A 3ZE2B 3RG8A 2YYZA 4G09A 2GERA 4CM8A 3O2NA 3T3IA 2B4RO 3RTCA 3DC7A 2C9DA 5F76A 3I1FA 4N01A 2HK8A 2BDUA 2D4HA 4Z9XA 3PQ3A 4DUGA 2L17A 3UMSA 4BE4A 4EFMA 4UQLA 2BGTA 4X90A 3FHCB 3E9RA 2WTMA 4GVPA 4NK4A 1QLHA 2WG2A 4F4DA 4QT4A 4IINA 2ZSEA 5DXAA 4M1MA 1TM3E 3ZYCA 3GLIE 2E2WA 3F6EX 3F6SA 2J3KA 4EUNA 5JMWA 1H69A 3BJMA 3SFVA 4HCJA 4ZGWA 1BA2A 1M0WA 4NICA 3OZFA 4F9FA 2WU3A 1Q21A 3WMEA 4LF4B 1QFXA 1NVMB 4FFOA 4JHXA 4ENUA 2PIDA 3M3DA 4RHUA 1PJ8A 3NNSA 3GD5A 2A9JA 2XE7A 1KY3A 5LC1A 3FVVA 4BX2A 1GY8A 1M1ZA 1T35A 3IR5A 3I5MA 3KJNA 1YGPA 2WILA 5D7BA 4EO4A 1DOHA 4I50A 4Y30A 4Y9DA 3ET5A 4ZRNA 5CX4A 1OX5A 3MMXA 3DONA 4GKVA 1PLKA 1U5BB 4LXXA 3WGOA 5CD9A 2YINC 2F17A 3U13A 3I64A 3IEXA 3RSQA 1NF8A 5E4JA 2OORA 5LB2A 4W4TA 2QRNA 3D5EA 5CTAA 1Y1LA 2VTBA 4Z4CA 4B17A 2VDRB 3IKMB 4DEVA 2R6GA 3GT4A 3AR8A 4IJMA 3H9QA 4E21A 5AUNB 4W5NA 2ADMA 3AOEC 1PSWA 1NW7A 3QKSB 2D5CA 2Y1GA 2WLTA 4RWEA 2GXQA 4OV6B 5FNVF 5K1ZA 3W06A 5JDIC 1PD0A 1C1DB 5DIFA 1QQ7A 5A5VA 1A72A 1ZCBA 4B44A 1JVSA 4M6WA 1PV4A 1Z7WA 3VSAA 2AW5A 2GI4A 3FMPB 3O0DA 4HDAA 2YRXA 3IAS1 1H2BA 2FZVA 4EJ6A 1MPXA 2AQIA 2BT4A 2R1UA 4EYEA 2B36A 4YCCA 2JK1A 4GD3Q 4ZVRA 3L1UA 1KIMA 3HKCA 1I3LA 2NU9B 3G9XA 4I3FA 4JUBA 1GA4A 2V55B 1XFAA 3TSAA 3E1SA 3F98A 3Q87B 4GXRA 1E7WA 2X3YA 3VKHA 1FRFS 3IJ5A 4IS2A 3QU9A 2R8EA 1GPWB 1SCIA 1H2YA 3VKUA 2WIGA 3HTXA 1KDZA 2C5HA 1EGMB 4G86A 1UBRS 4BX8A 4M1EA 2NGRA 3GR6A 3NTVA 4L3WA 2B0JA 3E3AA 1XEWX 1Z5GA 2CNOA 4MAAA 3VYUB 2O8DA 3CBGA 3ZJ4A 4X97A 3W5CA 3AUYA 3NKFA 3EPKA 2D2XA 3SSOA 2FFQA 4L28A 4NU6A 3E3NA 1YZTA 5E38A 5LQUA 1I0ZA 1E2MA 2BFWA 2BKAA 3NALA 3EZ6A 4KFTA 3PXUA 4LY6A 4PZYA 2AT1A 4QGSA 3AKDA 1MO5A 3KYJB 4U5QA 4TV9A 3S2EA 1DX9A 2OLEA 1N6PA 3T99A 1L5WA 4IHKA 4E4YA 2A5JA 1HM5A 1WNTA 1KS9A 2IYEA 5FPTA 3JAWB 4MI6A 5AVWA 2AG8A 2DBVO 3PU6A 4HTAA 1CJBA 3KK0A 1D1PA 1XTPA 1Y4AE 2JBWA 1DIGA 1Z0AA 2JLQA 3CX6A 3H9CA 1N2GA 4QLOA 5TQVA 3RRNA 2LVBA 4FI3F 1VKHA 1ZNQO 4KH1A 5DV9A 1S0UA 3MINA 1U1GA 5E6RA 4X62B 2DLDA 1Z8DA 1TLTA 4TKVB 1AIPA 4X8HA 2ZIGA 2GZSA 3KD3A 4WGFA 2ZJ8A 5IKXA 2GEDA 3QPDA 2OOSA 3AFHA 1C30B 3FIUA 4U6NA 3AERA 4ME6A 1JLSA 1DKUA 1XQVA 3HZHA 5B2ZA 3IAS6 1V95A 1WF6A 4XPZA 1P5FA 2JHGA 3MWFA 2PZJA 2GZRA 3G13A 1HDOA 2H3HA 1X1DA 1CP3A 3SVZA 5BSWA 2PJZA 2G06A 5CLGA 5CHEA 1AHPA 2CXNA 1YQWA 2I7DA 1OH8A 1B8NA 4HXEB 3INGA 1CZKA 1YRYE 2UVPA 3D2BA 3KNZA 4KXNA 4FVTA 2RB5A 4BNMA 5BSGA 3ZV6A 3BWMA 2ZU6A 1Z3CA 3FE2A 4DYHA 3WAGA 1G3RA 4LI3X 2RK4A 1G9SA 4FHCA 1ITZA 3D7LA 1YIOA 4LHXA 3JVDA 5CA0B 3I09A 1ZJYA 1M2FA 3DE0X 3H1EA 3P9QA 1Z47A 1NX9A 1E3WB 1Q1ZA 1QP7A 2P6OA 2XJ9A 1X1CA 1Z16A 1AMOA 4P82A 1Y3BE 4NBNA 4Q9HA 4G25A 4RCZA 1W0KA 3CRZA 3SS8A 2QPLA 2ZDQA 2ZRPA 1UUFA 1FDUA 3QYJA 3I34X 3S27A 1MB2A 3C6KA 1XNQB 1T2VA 1ZN8A 2QSUA 4JH0A 4NY1A 4RKYA 1E2NA 5LDHA 3UK7A 3HUFA 2OBBA 4AC9A 2YYSA 2ASEA 4TL8A 4OK5A 3TRJA 4ZALA 3B82A 2E5WA 4CMGA 2J32A 2XTZA 1Q74A 1SXJA 3WWDA 3QG5A 4BP8A 3CRMA 4CIVA 4Y6PA 5CB4B 4O4HF 3TSYA 1ZUHA 4QQKA 3ZWMA 2GKSA 2O1SA 4UHEA 4YGYA 1UC5B 1N4AA 2IHVA 4NEHB 2B7LA 2G63A 4WN9B 3LL4A 4X24A 1T5BA 4CIXA 4FGJA 4V0OA 5KTSA 5ELXA 2JGDA 1ZL0A 3FTQA 1H42A 1J23A 1YCHA 4IW3B 1STOA 5JMPA 2E5LB 2VR1A 4N3GA 3BD6A 4R9SA 1KI7A 1PJZA 1YD7A 1EM6A 3PE3A 3IVAA 2NZVG 3W2EA 1UKEA 3BFJA 4FQ5A 4EGAA 3HACA 3ORRA 2HHLA 1FTQA 1KZYC 1P5RA 2ECKA 1QYCA 3DMHA 3PQEA 4GX0A 4NU8X 4WCFC 5AM5A 5T6BA 1T29A 2FN8A 1RAAA 3LIPA 3LM8A 4G9GA 4KACA 2J48A 4UZFA 1CJTC 4WCVA 5ALXA 1A8IA 3DEAA 4AF7A 1SKBA 2C4MA 3P94A 5JFOA 3QMMA 1FUUA 4O08A 4WN3A 4L3VA 3C5CA 3JPYA 4ZCRA 2ET6A 3QV2A 4HX9A 1K8YB 4RPCA 3GFBA 2BF4A 3LUPA 3TUIC 2OECA 2DFNA 2VH2A 3HGQA 1S4MA 3DMNA 5SZJA 4B71A 3RS4A 4XXHA 4P4UA 3A2KA 1C3OB 4QXRA 4V0NA 1ZH0A 3KB8A 4UCQA 5D5HA 1AKUA 3B51X 2P9FA 4M87A 4Q19A 1Y42X 3QUSA 1Q50A 3QPCA 1SKMA 3FCOA 4U5XA 4Y2UA 1UK9A 1GL9B 2O7NA 2VF2A 1OD6A 1ECPA 3K3PA 1QAQA 2CBGA 3LUCA 4R9UC 3HDVA 2RGNA 5GV7A 2B30A 1W6UA 4J1NA 1G1MA 4M0MA 1P9RA 3UYLA 4I1IA 1W5TA 1Q5PA 3QUCA 5AK6A 1G8GA 2XOEA 1J25A 1JI3A 2D5LA 4NJMA 3RWOA 1Y5LA 1J8QA 4LYJA 4OPMA 1D1SA 1RXIA 3R7NA 4DV7B 4GZMA 4AWAA 2VAXA 2WPNA 4MVJH 1DFGA 1YS4A 2GBLA 4M54A 1ZL2A 4FFRA 1T9HA 4Q01A 3SZOA 1J21A 3FJYA 4ACAA 1I7PA 4WN9A 1EVKA 2FE4A 2INGX 3GJ0A 4N8EA 4ZO9A 6LDHA 1L5OA 3L4JA 1AC5A 2ALJA 1L4UA 4UAUA 2IIPA 2XBLA 2XRYA 3CM0A 2PMCA 1VSBA 4NE2A 4RD2A 1PT5A 2PBRA 3E05A 2OM2A 1YVUA 3ZV3A 1EA5A 5JD5A 2OGWA 1NT2A 1XRNA 4ZI7F 2KPOA 2B9VA 4I4IA 4R8RA 5HBGA 3W3ZB 2HJWA 4BFTA 2GETA 2H0RA 2QTRA 3VZSA 2PUGA 2O20A 1PFWA 2ES4A 2F3TA 5K09A 4V0RA 1N1EA 4HAWA 2UYOA 2Y9PB 1T3TA 3LV8A 2R5NA 3I8OA 5FAXA 3E27A 2HSGA 2IIVA 5T41A 2PAAA 1EAYA 4D4MA 1GNRA 1O6GA 3NBUA 3RABA 2PRIA 4RBNA 3PTZA 3B1VA 1VFPA 1YCDA 1JFVA 4CLXA 3E53A 1WSBA 5B57C 1O0BA 3VR2D 3FM9A 2WFLA 3F3KA 4XEHA 2GHIA 3WYNA 3THXA 1DC5A 1NQ5A 2EP8A 4KQMA 1TM1E 4RMHA 4WAUA 3UHJA 5JSZB 3ZU6A 3TIIA 3FPHA 2IYAA 2X13A 1V8OA 2X23A 1K88A 3UANA 2CFIA 2YDXA 1XDWA 3BRWD 4DCJA 2WAAA 3EOBI 3WNQA 3H9GA 4Y9TA 4AJKA 3ABQB 4US2R 2CB0A 4H0FA 4QTYA 3U56A 4Y9SA 4OMUA 2CUTA 5COQA 1E4EB 2IYWA 1A69A 2OZVA 3DNMA 3EMKA 1O77A 3O8BA 4GDMA 4LXIA 4IWNA 4D0RA 2UZ3A 4RZ3A 4CFYA 1YB4A 2YYAA 1H85A 1W29A 2F8SA 2XWQA 3TR5A 5DJ5A 3H1TA 1QF6A 2Y6UA 4DQVA 1LLQA 2Q0QA 3AILA 1P4SA 3H84A 1YJ8A 4BNDA 2L82A 1Q7GA 5B1YA 3OOYA 4NZMA 3AUAA 1EJ0A 1L5YA 4JT8A 4TUYB 4Y3UA 1UK7A 4QYTA 3I23A 2IH5A 5AW4A 1BFDA 4JEHA 5EXEA 2MSDB 1Z4LA 1EI9A 2BEUA 3AZPA 3UXYA 3GLHA 2H65A 4JMPA 3A32A 4QASA 4JQSA 3KQUA 3C70A 1ZGBA 4J16C 1IY8A 1L9KA 5JS1A 2HUPA 5DSTA 1BKSB 4IHAA 3T0FA 1HTTA 1LBEA 1LX7A 2NV6A 2YFHA 3UTDA 3TW0A 1FXUA 1ESCA 1U3VA 3KZXA 5E1OA 5JLAA 4MRMA 3X1WA 2QR3A 5LZ8A 3DLBA 3DB1A 3H1GA 4UFOA 3H5OA 4A27A 5AM0A 5CT4A 1JHYA 3H4MA 4C7XA 4E7OA 7MHTA 4OJKA 4FJ2A 1PFQA 3M2PA 5EJ6A 2BAGA 2YFQA 4CT4B 5HP4A 2BLNA 4RMNA 2W8BA 3PXEA 3W3AA 4GQAA 4NATA 1RU3A 4ZAGA 4TMFA 3M6UA 2XRFA 3UMRA 2EDCA 1W76A 3WY9A 4TWJA 2XUPA 1RAFA 1GILA 4GM4A 5D6NA 4PQEA 4BQOA 1A8QA 2VSXA 3K2QA 3P2JA 1S3SA 3GLFB 4U3JA 5I7WA 1OX4B 1B23P 2G4VA 1BXZA 3HCFA 4F4JA 3QHQA 1H2XA 2IYYA 4U0JA 1KP3A 2PPVA 1HNZB 5D2CA 3RHFA 4ANFA 4PAWA 1RRCA 4IV0A 3I3SR 2WLSA 2XT9A 2IUFA 3SNHA 1WWKA 4KQCA 4F7WA 3BHNA 1I1NA 2OGUA 3FRHA 1YRQA 3GIDA 5GINE 3TLCA 4JXXA 2O2DA 1LRLA 1XRSB 3Q7RA 3JD1A 3R7AA 3DKKA 3Q0EA 3HR4A 1KI8A 4K6KA 4JC4A 5IBCA 3G5UA 3MW8A 4YAGA 4F71A 4UHCA 2PQMA 2VTDA 2WWHA 1R0LA 1CDEA 2X6QA 5FFMA 1C9NA 5ECGC 3RO7A 2ZYUX 3QLEA 1M74A 3KDSE 1P2UA 5HUQA 4TSFD 4QFDA 3U4CA 4GM1A 2IY8A 1W4AA 4MEBA 2O8BA 1J5EB 3QSGA 2XAAA 1L5RA 3Q0TA 1FLAA 1P19A 4IIBA 1ORHA 4KL8S 4NYIQ 1XZGA 2XDAA 3BT7A 3GU3A 1COZA 3TINA 4LYFA 2Q6OA 4B46A 2JGFA 2I9KA 4LGYA 2CSXA 4Q3OA 4Z1OA 4F97A 2FW1A 3IH5A 1CUVA 4XSGA 4JV5B 5HGJA 2WJVA 1SZPA 1MUUA 2OB1A 4L4UA 4WWHA 5A1JA 5K8CA 1QP0A 1J2JA 2FVXA 3EQ9A 2Y71A 4N3AA 4X6UA 3ROXA 3WRYC 4WBNA 5LDDC 1VPLA 1TJ3A 1NKSA 4I4LA 1FW8A 4FHEA 2WJWA 2DYKA 3NAZA 4E94A 4FPXA 3R7SA 1GPNA 1WXXA 4IZIA 5F35A 3CWZA 1VCMA 5U9CA 4BMPB 1YZLA 1CLEA 1Y89A 1QK4A 2Q3EA 3GRCA 3JQGB 3PLNA 3QLTA 1AKMA 3R5JA 1D8AA 4KPFC 1IVSA 2C8VA 1YACA 1F1JA 2J1LA 4LXTA 1DXYA 2C4WA 5EZSA 5IDXA 4M1YA 4KFUA 3PRJA 4DPMA 1LBTA 2O8VA 4ITVA 1M8KA 4MGKR 4UULA 4AJJA 4NSNA 2PUJA 3F3YA 2GJAA 4H2DA 4M0EA 4ZAXA 4HPXB 2HSWA 2ZXUA 2QUHA 4ZEVA 3L1JA 3QX8A 1JH8A 1WPRA 4HDRA 3WYGA 1RAEA 1CT9A 4YT4A 1XC7A 4LQ4A 4D3XA 1N2HA 5B7PA 4NYIR 2YVKA 5KSPA 4LJRA 2AKEA 4J1TC 5JNRA 3EY4A 1VHQA 1ESNA 5EKDA 2V5UA 5EHNA 1EG7A 2Y3IA 4RQUA 1NI4B 2OK7A 3P7MA 4IS3A 1RWKA 4JP1A 3WL3A 5B6IA 5IK2D 4D9GA 1YQTA 4LJ6A 4AAYA 2XAUA 3KHTA 4IZOA 2F55A 1NRJB 1O9HA 2I2FA 1R0YA 4REMA 2D1RA 4X71A 3OF5A 4DJ5X 4EL0A 1JIJA 3ZTYA 3E9ZA 2ZFUA 4MKRA 3B7WA 5A4KA 4BGIA 1QE3A 1Y37A 4M9XA 2PMEA 4EABA 3F6YA 1D2MA 2OCPA 3FD8A 3U31A 8LDHA 4GW3A 2ZSKA 3EAQA 2NOAA 3CR7A 4TTTS 3USCS 1XDSA 2ZGVA 4RMGA 5C1IA 4B7XA 3LGAA 5PNTA 3TD6A 1DFHA 1K08A 2B37A 2QXTA 4YAFA 1UFQA 3K9BA 3SC3A 2E89A 2H59A 4MMZB 4X85A 4DT1B 5A4DA 1X2EA 4XYGA 4D8TA 1UF9A 2AQHA 2PWAA 4NRDA 3PCXA 4CTMA 1A7UA 2H06A 3KE8A 1RRGA 1FMLA 2V8OA 2G82A 3LFUA 2CVFA 3MMPA 1ONBA 1J1ZA 2HMVA 4OGLA 4O8ZA 5FQNA 2QVZX 4MAFA 4XGRA 5JJBA 1BCSB 1MRZA 4KDRA 1CEXA 4FZRA 1LDMA 2MIIA 3CN7A 4DV1B 2PY6A 3C3CA 5JRJA 2AK2A 2CXPA 1XPUA 3ITEA 3S3TA 5KCZA 2E4ZA 2X8WA 3D5TA 3G2KA 2NSYA 1PR0A 3IB6A 5EFZA 4ZV7A 3RE1A 5DHRA 1JE1A 4YDQA 1A04A 3Q6IA 5LNK1 3C1TA 1FU8A 3ND8A 4TLAA 3U3OA 2P2CA 3NHUA 3FNBA 4JT4A 4HNGA 3NIBA 4OQQA 4E1BA 2X8BA 1PFKA 2RGGA 5AW2A 2B6HA 4Z8XA 2BISA 2BHSA 2JRCA 4QBGB 2Z6QA 2BD0A 5BR7A 1E3WA 2DAPA 3FPCA 4QBHA 4C4YA 2HF7A 1GKLA 1S6YA 1XPRA 1I7DA 4C01A 2ACVA 3FJ1A 3R6LA 4JBLA 2WOJA 4RZHA 5E2BA 4YBRA 2QLBA 5DLEA 2NXWA 1C4WA 1T9AA 2JD1A 5EP1A 4LMAA 4MVWA 1ZSYA 4PLCA 3W90A 3D8HA 3JZDA 1VDZA 2BFBA 4UE3S 4YONB 2XMDA 2VNIA 3EIXA 2YW2A 1EDZA 2OHJA 3X1KA 3MJHA 2O9JA 2NT3A 1EZZA 3HE3A 5TY0A 4QHSA 1Z2CA 1EBFA 2RGUA 5A4JA 5BY2A 1SIOA 2WSMA 1X77A 1QE0A 1T91A 3FPGA 3VPCA 5I8WA 3PWKA 4HGZA 5DM1A 2I54A 4OQMA 2Z2IA 5KYYB 1I4LD 2O06A 4RE6A 1UZLA 2A58A 5CLFA 2J8ZA 3C14C 4J49A 1WCIA 4QYSA 1M0EA 5A0VA 3V8BA 4PHTA 2CXSA 4X54A 3DEIA 1Y3IA 1PUIA 1AB5A 2YCLA 3DLIA 3DKIA 1OXSC 2XKAA 3C74A 3PXDA 4NFLA 1JKJB 3OQIA 4DLLA 5C81A 2PMDA 3FGPA 4PGMA 2AF4C 2DLCX 2WKRA 3ZWOA 1RRFA 4ISBA 4JOSA 4Y1FA 3ANTA 1YVDA 3OPXA 2FZGA 2O3SA 2PQ2A 1LFDB 1NW9B 1PEYA 2ZYSA 3OFSA 3QMPA 4JN6B 4CCSA 5D00A 2G5TA 4EARA 3D4IA 2Q1WA 3NCTA 4L8YA 2XWBF 1EWQA 4DQDA 1YB6A 4FGWA 3T3DA 2XLCA 1NDHA 2Z3WA 3AP3A 3RS9A 4A8PA 2V6JA 2SCUA 3B1YA 3D6HA 2ZJ4A 3N2KB 4O0LA 3FPJA 3WIDA 2WF7A 1QQ6A 2JGNA 2X7JA 3BMCB 3WTBA 1G0OA 1N2OA 1GGHA 4PHCA 5KQGA 1XXLA 1JG4A 4N0MA 1MX5A 3D81A 4EYQA 1XGKA 4K2HA 4KMOA 1EGQA 1KORA 2PSDA 4KRXA 2PUDA 3V4PB 3WIVA 2A30A 1ZY2A 3D3WA 2B8NA 3K5PA 2AFIB 3DOJA 3U3XA 2WKSA 4AVYA 1AQNA 2I80A 2CNLA 3EH2A 1AZTA 1HC7A 1L9XA 1W19A 2FUEA 1QIJA 2PXAA 2WZQA 3B85A 3C4VA 4IIUA 3RBVA 5HK8A 3ZWQA 5T4HA 1XAHA 1UBUS 3IEUA 4I08A 1L3CA 5G53C 1C4KA 4C88A 1UMDB 3VZQA 5ARCA 3AVYA 2W2QA 2BCGY 4HDNB 4AJ2A 1KFKB 1VIMA 3SNKA 2A3RA 5FTNA 2R48A 5JZ9A 2VSOA 2P4EA 2CHGA 1HG0A 2W37A 3BIOA 3KQSA 4G84A 1L6IA 4KQIA 4L74A 1FE8A 2ZR0A 3PKZA 3G02A 4CQMD 2VH5R 3EW9A 3HP7A 1ENYA 3OIVA 3H9UA 4N54A 1AKTA 4OSOA 5CT6A 4KVZA 3IOMA 3ZY6A 2JI7A 1M5TA 2UKDA 3D8BA 4PGFA 3S5JA 4Q7KA 1P0QA 1WA5A 4KQ6A 4PC7A 1NJ2A 1X7ZA 4XGNA 4CMIB 1LSJA 4XVQA 1PL6A 1R2QA 2EZ8A 3Q12A 1SCUA 4MA4A 4X20B 3RSZA 2HBRA 5HZGA 1KHTA 3CVXA 3O2SB 2XUAA 3WJ7A 1A7JA 5CAEB 2GUWA 1CUGA 1UKAA 1XPJA 4H60A 2ZIUB 4R2KA 3V1YA 5FADA 2VZEA 4EMSA 1LZKA 2Y2VA 4WOBA 4G5FA 1QG4A 3OPQA 3FBWA 2EARA 2GWRA 5AD1A 3F5SA 4Z4FA 1W47A 2IE8A 3LCJA 1P3DA 1ZUNA 3AXTA 3JY6A 3BJRA 3U9LA 3FTCA 2BSQA 4J2TA 5CVUA 4D8YA 2GK3A 3OCCA 1OQAA 4KDFA 1PSZA 2CXOA 1QZTA 1ZLYA 4UDOA 1HT0A 4G0ZA 3I3OA 3Q2OA 4BGEA 1J2YA 2I8AA 2L2QA 1TFRA 3R2JA 3WGMA 4BE7B 5FB3A 4LJKA 3WO0A 5G0SA 4WD3A 2XA9A 5I7HA 1F8UA 3BJIC 2VHXA 3V8QA 3D2AA 2G0NA 4CV3A 4C29A 1KARA 4F06A 4V2UA 1QG0A 3KU1A 1EGAA 2SBTA 4OHKA 1V7QA 2O14A 4DCCA 1P0FA 1NFFA 3HB7A 1SQ5A 2R11A 1G8YA 3IP8A 2IDMA 5CLLA 2H1VA 5TE9A 1II8B 5BQ3A 4DB4A 4HZIA 1SHZA 1W4BA 1QQTA 3ET4A 3A2NA 5AK4A 5EKUA 4J0QA 1BWPA 1H2RS 3WWOA 1E9FA 1MG5A 1MX3A 3FBGA 5L3QA 1Q0HA 4KHZA 1TUEA 3NT4A 4DDUA 3KJIA 2QORA 3M5DA 1IUNA 2RJOA 3WE7A 4IUDS 4TVBA 5LL6P 4J94A 3I04A 4MH0R 5FLYA 3VUEA 5A06A 2H2AA 3PVZA 1VL6A 1SKYE 1R0WA 2NW6A 5B58T 4H6PA 2PZKA 1CUAA 2VDUE 2NYRA 4YAJA 3T3GA 2AOWA 4MLZA 5BRJA 3GMDA 3TXYA 3H5AA 5EMLA 1RQPA 1YCGA 4PY2A 1MLDA 5KEIA 1SOUA 4PBSA 4YXWD 1SWWA 4FS3A 4FDTA 5JARA 2RK3A 1EWKA 1NXOA 4ZPJA 1CUCA 1C50A 3M89A 1QB7A 2DVMA 5T4BA 4A8JC 1ZIYA 2QD2A 2BFDA 3QBJA 4P54A 4X93A 2VC2B 4K7JA 5HRAA 4LGCA 1UMCA 2QAGA 1LI4A 1L4MA 4O4IF 4DQ0A 1NX6A 1Y7PA 3PI7A 5AOVA 4YAIA 3V4SA 1HNXB 4ND4A 1O4WA 4FLMA 3VOAA 1YR9A 3KOWA 2BGWA 4ZI7B 3RVMA 1BIFA 3PR3A 5JSQA 1AMNA 5FPHA 1T13A 2QE6A 2VPPA 2WM8A 4NZPA 4FEYA 4YB8A 4HEHA 2C5LA 4IQ0A 4RIGA 3OEWA 3M4NA 4ARUA 1WBJB 3CF2A 2Z43A 3QVXA 4R68A 3RFXA 1PW5A 3RIXA 1L4GA 2BL4A 1OKKD 2X9VA 3IT2A 1EK0A 4IXNA 3PC8A 3AR2A 3K05A 1D5CA 1BC5A 2BP7A 5DISB 4DNPA 5SYAA 3SOPA 4EF5A 2GM4A 4D4JA 3ETEA 1SCQA 4KPUA 1ZD4A 2QLJA 3DDZX 4AY2A 1AA6A 3BDVA 3LCUA 3PWZA 3SYTA 4OHBA 3OWHA 1A9SA 1JG2A 3RK1A 1H2AS 3GQBA 4JOQA 2EBFX 2CLFB 1IZYA 3DV0B 5KU7A 1DC3A 1ZG3A 2RHMA 3O9MA 3QEMA 1GD1O 3PHHA 4JJKA 2ZRKA 4NCKA 1JJFA 1VXOA 2ESRA 2I34A 3U40A 3M9WA 1QRAA 2YBEA 1JT9A 3LCMA 4DLWA 5F9HA 3GVIA 2RHCA 3KKNA 5GP1A 4CL3A 1DOAA 2Y1WA 4F4HA 2APJA 4Z53A 3A6HA 3N3AC 1F17A 2I8CA 3LCVB 4RYDA 4UVEA 1FVFA 3DKRA 1GGFA 4UU8A 1N1GA 4BB5A 5E9AA 2C0CA 3L0BA 3T1YB 2COEA 1GG2A 2VOEA 4H17A 3FNGA 1UM9A 2R84A 3WGLA 1ZR2A 5EIFA 3CG4A 1F0PA 1R12A 1Q12A 2EW8A 4HGNA 4MVJG 3WFIA 3WKDA 1JHDA 5D3ZA 4QUGA 1ZEJA 1O6CA 2ZB8A 3KAKA 4I66A 4M89A 1DBSA 3SQWA 1P60A 1XZLA 2JGEA 5ER9A 1T34A 2A3NA 3KKPA 4EL5A 5HQ3A 2AOTA 3GUUA 5ESRA 1Z4KA 1YB2A 3T7SA 4UM8B 3IPLA 3UAWA 2VJKA 3QVUA 3UFBA 3A2LA 2CLKB 4O4LB 1JSRA 2EBHX 3OIGA 2V58A 1N4DA 3M4YA 3TSCA 1L4HA 1CVLA 2ST1A 3BBPA 1NP7A 3CWCA 5IN5A 4DCMA 4F2DA 3W3AD 1ADJA 2P4HX 2WC1A 3RIHA 3TVTA 4F5EA 4XGKA 5DI9A 1OKKA 1QV9A 1TMGE 1T5LA 4BV3A 1KZGB 1QRDA 1YVEI 1GGNA 5CDSA 3SI7A 3KE9A 4UNRA 2JVJA 5C8YB 3E22B 3W6OA 5C7YA 2XH8A 5K4GA 3ZK7A 2VNAA 4GBMA 2JLBA 3CRW1 4MPPA 5HEKA 3D0OA 3DDCA 3H9EO 3RVNA 2P9YA 3ASYA 4MK4A 5DGDA 5EZ5A 4PYRA 3ZDCA 1JHRA 5AM1A 1K3FA 2EFYA 1TMKA 1VMEA 1H8EA 3QENA 3LUJA 4YPFA 2JIZD 2BGJA 2ANBA 3V1KA 4YPOA 3O8OB 4WSOA 3FDIA 3RM3A 4LJLA 4DDWA 2BSAA 5BT8A 4EHIA 3QIVA 4O2AA 3E3OA 3WKCA 3VSDA 4XB2A 3MOGA 3BJZA 3R7DA 5ICEA 1SD5A 1HKUA 1MV8A 2P2DA 3DMDA 3F9IA 4Y2GA 4DV0B 4AS1A 2YZGA 5CXQA 3AESB 1HG1A 1Z9BA 5K99A 2HV9A 2FCAA 4XTRA 3A9WA 4AG6A 5HYVA 4DRXB 2Q5IA 3FF1A 4LZPA 4D9FA 3IIMA 1UBTS 2WQ6A 1C7IA 3LHDA 1G16A 2FZ5A 3U61B 5K0NA 1AQIA 1EB9A 3KKQA 1CPYA 2X15A 2YN4A 3SZUA 1XEAA 2QPOA 3LT0A 1DEAA 5L3VA 4OK6A 4J07A 5KOJB 1ORVA 2VRNA 1BQEA 5AW0A 5EE5B 2NU7A 4MSUA 3RTEA 1OGYA 1X42A 1Z3IX 1YBHA 4LI0A 2XE8A 4AM8A 2H5EA 4QODA 5KKAA 3UUFA 3FSGA 3OJWA 1F06A 5CYGA 2DPMA 2ZYGA 1LTHR 1RHQA 1YB7A 1XWFA 3QBVA 1KK2A 1OWNA 3IVMA 3AF4A 1BWRA 4D9CA 3V7WA 3M6IA 2C92A 3LY9A 3OKPA 3FYCA 1N3IA 5HVNA 2D0OB 2XTNA 4OYHA 4OHYA 4EF6A 1QORA 2JCSA 1R5JA 1TF5A 3WTCA 3OM1A 2AK3A 2RONA 3IX7A 1CNFA 4Q82A 3OLXA 5FYDA 1H5QA 1K0UA 5G4KB 1ACMA 1KJ8A 1R5OA 2P4UA 3Q3VA 1FMCA 3QUAA 3VBEA 1X1TA 1TYCA 2QBYB 4JLPA 1W4ZA 1FYEA 2N46A 2PPLA 2HREA 4DDMA 1OBHA 2J85A 5KWVA 4FN5A 4FZJA 4M9QA 1O08A 1KJ9A 2WHRA 3N2GA 1P4JA 4KQEA 2V7XA 4DIUA 2YJ3A 2W2XA 1E1RD 2WIJA 2YWRA 1E9SA 3Q1KA 2QMZA 1MTOA 4KQ2A 5FTLA 2XODA 2V7EA 5BORA 4EUSA 1PQ4A 1VP9A 3ZV7A 2BR5A 4X7BA 4BV2A 3KBOA 1NAIA 2DTDA 2HD4A 4OBWA 2QT9A 2VYVD 3RHZA 2YBDA 2H2HA 5LDGA 1I5EA 4F72A 1KVUA 2QEQA 4N3NA 2HA6A 1F8YA 4XRRA 2YASA 4B74A 4E4TA 4XVUA 2VK1A 4BY9E 4O1HA 1BGXT 1G20B 4E2WA 1QPGA 1N5RA 1Q0SA 2J6CA 4C7KA 2KE5A 1P7WA 1W35A 4JQCA 1CUXA 1SZJG 1OI3A 1YJ5A 4HB2A 2GAAA 4RL4A 2XV1A 4TTIA 3MCWA 1HYBA 3WBFA 2CV0A 4IG9A 3PNSA 3Q3EA 3QVGB 4BFZA 2ZG6A 4QDZA 4Y9RA 3DTNA 1DINA 1C4XA 3EJWA 3EA0A 4R5MA 4RAQA 5U1PA 5KBYA 2BFEB 3PQFA 4X5OA 3ZE7A 5A1TA 2WTAA 3GHYA 4JLUA 3PJGA 3DZJA 3L7KA 4LISA 1B3RA 3EFEA 5JEEA 1N2EA 3L7AA 4RVOA 3UJ6A 2ADFA 3QQPA 4KVAA 4ARCA 5K0ZA 2VP0A 3VNVA 1O03A 3OC0A 3R40A 3P5SA 4IKEA 3SQOA 3OQMA 3CVJA 5T67A 2ETXA 4YV7A 3E84A 5CNJA 2KB0A 3FWZA 3DUWA 4J1QA 2FWPA 2D0PB 2C1ZA 3KVRA 3HM2A 2PU7A 3TI7A 5B30A 1RI3A 1PLJA 1KNXA 1PZNA 2QQ5A 3M9LA 4G4GA 5EXXA 3U0BA 3FNFA 4DB2A 3LQ4A 3GXOA 3HWRA 4WEQA 2Q8PA 3KYCA 1WXEA 1O4VA 4J7AA 2UV8A 2IGTA 3V2GA 4Z3OA 3AWDA 1WY7A 2IYSA 3DT8A 2V7TA 3PVSA 3HU1A 1IM5A 2OZLB 1T5IA 2O2ZA 2R60A 1K6IA 2YFYA 4BNVA 3OX2A 4I55A 4ZRDA 2A14A 2JEYA 4NBKA 2EZUA 2ZANA 4ROSA 1WZUA 3EXHA 4IMJB 3NU1A 1M6NA 2QTZA 1FQJA 2ZYIA 2WRZA 4IH9A 3V4ZA 4EA9A 1YOVB 1P62B 2FPPB 3NX4A 3PCRB 5LYJA 3U48A 4KR2A 1U8ZA 4EI7A 2J87A 4H6XA 4F9GA 3IPAA 1KZ1A 1U7PA 2XDYA 4FFBB 1H2ZA 4MS1A 4BB6A 2G1JA 2IP1A 1PJTA 2ZWIA 3C85A 4ZICA 5K0CA 1Y6FA 1KDVA 3WGTA 1KY5A 1ZKDA 2BOVA 3ECSA 3UH1A 1L8XA 3H4IA 3PC3A 2TMYA 3GAZA 4YJKA 5YASA 3J7AC 3PCTA 5IDVA 2DF8A 1C7ZA 4ZQFA 3S70A 5L40A 2QRLA 4DKXA 2XQGA 4BNNA 3AEUA 2E0IA 3D0RA 2ZB7A 4W9NC 4CN8A 4AY5A 3O3NB 2NSDA 1K4YA 2GUGA 4HEQA 2YJNA 1SVUA 3I72A 4CM4B 2I62A 3AEUB 3OKFA 1VE3A 2ZCUA 4Q5IA 1OCEA 4DM3A 2AN4A 4JBHA 1WXGA 2PJUA 4KFRA 2NTYC 2H1IA 2C4VA 4DLUA 1ATZA 3BCUA 4CIAA 1U7DA 4M98A 3ADKA 5L53A 3GLTA 4KK4A 1Q2UA 2QRVA 4R8VA 2FSUA 1R1DA 2Y67A 3OCXA 3TGWA 3TPZA 3X2FA 3SZLA 4UBNA 3RYCB 3BGOS 1JQDA 3ZJ5A 4AF8A 1PCXA 4JP2A 4AK9A 5EESA 5A5DA 5HDBB 2DXIA 2PTGA 1MV5A 2C9MA 3DMGA 2A7QA 1XVIA 2PDAA 3H1PA 1U0OC 1L5QA 1IUOA 1HDIA 3I9MA 3K4HA 4UQPA 5A3RA 1G5IA 2C5FA 2GARA 5IVDA 2AUNA 1VI5A 3B7PA 5K3AA 1GHTA 2EYUA 2AEJA 1Z82A 5G1PA 1QMPA 5B6PA 3B9PA 5KVQA 3ZLUA 1RPTA 1XROA 1KAQA 2FN7A 2M1XA 3B1FA 3LK6A 3PIDA 4M0UA 3DDUA 2OZLA 3BEOA 2WIKA 4OAQA 1US8B 4J0FA 4HYYA 4XX0B 1KQGA 1U98A 4WNAB 4UZSA 2D1YA 3ROEA 4CKEA 1LW7A 4Q9NA 3H13A 1ECGA 2OG1A 5FKJA 4YWHA 2F48A 3PA8A 2XCUA 1JXMA 2A5LA 2HWXA 3ANNA 3KFVA 2P2NA 4JAVC 4JJ7A 4BLQA 5IRCD 4N39A 3P4XA 2MSWA 4GX5A 4CLEA 2H4WA 3E8MA 4EB3A 3PD1A 1TZBA 4B6RA 3DE2X 4ZCTA 4QBTA 1IWBB 2FQXA 2FR8A 3NBZC 3MXTA 4I1YA 2AKYA 3RVPA 2QU7A 3G0CA 4FILA 4RKRA 3TZHA 4EX7A 3CW8X 1PZMA 5KTPA 5JR3A 4LUCA 4KREA 1H66A 3PUJA 4PXSA 3MZ0A 4MWSA 1LGYA 1TI7A 5CDTA 1VLMA 4CGZA 5FOXA 3JQDA 5G0UA 2GZHA 5A0TA 2LKCA 4G89A 3U3KA 4BS9A 2PE5A 4MQFB 1F0NA 4LOAA 5IJ9A 4E5NA 5FUXA 1E1CB 1AH2A 2XSZA 3JXEA 1MKYA 4UHDA 3QI7A 3UWPA 2DR2A 1U3DA 3Q5DA 3FOZA 1UBLS 2D7DA 1MB0A 4HH1A 3ZGLA 1V1RA 4ZDJA 1O8CA 3IO3A 5B7GA 1NXWA 3OZIA 3ZZ0A 3QSYA 1L0BA 1ML4A 2WB4A 4FNMA 3A6KA 3TNYA 4YMGA 1GZ4A 4ZTBA 3OICA 2G8NA 2W71A 4RIEA 4YCJA 2QRHA 2J3MA 4K9MA 3A1FA 2QAGB 1TU0A 4Y0NA 4INJA 3T54A