1XQXA

Crystal structure of f1-mutant s105a complex with pck
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSAYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 104
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xqxA00
5ALMA 1ORVA 3PUHA 2GBCA 5EGNA 2I78A 5AJHA 2Z5GA 2Z8XA 2XUFA 1YASA 4UBMA 5DNVA 4FTWA 3O4JA 2R11A 1DWPA 4MJ3A 4A23A 1CUUA 3C45A 5AKJA 1J2EA 3ZI7A 5IVKA 3R3YA 1N8SA 2PM8A 4FBLA 4UUQA 5AOBA 3I1IA 1FFEA 1MU0A 3R3VA 3C5VA 2W6CX 3ED1A 1YS1X 1GPNA 3D4LA 4BC1A 2OQVA 3T52A 1XZAA 2CKMA 4OB8A 5A6VA 3V1KA 5JD6A 2GZSA 3IUQA 5ALXA 5AM3A 4C88A 1QLWA 1CVLA 2VATA 1QO7A 2DCMA 1O6FA 1RYYA 2VQ6A 1ZIXA 4U2FA 4I4CA 4UFOA 3WJ1A 1X2BA 3NWOA 1S8OA 2EEPA 4UFPA 1DTEA 4EY7A 4BATA 3G9XA 2PX6A 3F96A 4Q1VA 3BIWA 1P0PA 3H2KA 1ETHA 1H2XA 2WHPB 4ZV7A 1PV1A 4UBOA 1XZFA 4FKBA 4B9EA 3ANTA 3FLEA 2FUKA 4CIAA 1B41A 5K3FB 4N5HX 2WG2A 2HL6A 1CUYA 2QKYA 5K3DA 3WWOA 3VVMA 4AMYA 4X90A 5F4ZA 1J1IA 4ZV9A 4GXNA 1QOZA 5HF5A 4GEGA 4O08A 3DOHA 1KEZA 1XRRA 2VJCA 4DLNA 3WL8A 5C8VA 2Y2VA 1TCBA 4MXDA 1XZHA 7YASA 3WZLA 2AJCA 2OCIA 2ZYIA 4RE6A 1UXOA 5EIAA 1U65A 1W1IA 4ZRDA 3WJ2A 1HBJA 1UOOA 4IH9A 3FNBA 1EVEA 2RHTA 3ZLVA 4MQMA 3QZUA 1WB6A 4B85A 4FLEA 2XMZA 1CRLA 1EB8A 2G4LA 4W63A 4WFJA 4Y2YA 4DM7A 1QTRA 3ZLUA 3V1LA 1H2YA 1R50A 3K9BA 2ZSIA 1EA5A 5IVDA 4OU5A 3A70A 2BUCA 3AIKA 1IZ8A 3IUNA 4DSZA 4K6HA 5KWJA 4IH1A 3R3WA 5LKAA 4AXBA 5AK6A 4CG1A 2J3QA 2Z3WA 3DOIA 6YASA 4BTLA 2XDWA 3B5EA 1TAHA 4G4JA 5AI0A 4JH0A 1XZEA 1E89A 2XB6A 2ZYHA 4JEIA 3WA6A 3G9UA 1YCDA 2V96A 4Y2QA 5K5EA 1LBTA 5ALNA 2D5LA 2QS9A 5FXMA 1RWQA 1H2WA 3UUFA 5ALEA 5AM2A 2HA5A 4XVCA 4HZGA 1UK7A 4UHDA 5SYMA 4Y2PA 1CUIA 2WU3A 5JADA 3D0KA 1EK2A 4CCYB 1HQDA 2XMRA 3AZPA 5AK3A 5ALLA 1E66A 3W04A 1EHYA 2V98A 3BF8A 3MUNA 4H0CA 2WJ6A 3WZMA 2QJWA 3WK7A 3YASA 1SOMA 3H18A 1FFCA 4Q82A 2Y6VA 4J0HA 3F8SA 1DU4A 3S8YA 4GDMA 1WHSA 2CBGA 5I8PA 4HRXA 5AICA 4FFWA 1QTIA 4Q3OA 3TJMA 3STVA 2HDWA 4EUSA 4LXGA 3STXA 4KJXA 4L9AA 4GWLA 3G9TA 5ALJA 4L72A 4Y2RA 2O7VA 1ZI9A 3ICVA 2WUDA 5AKEA 2WIFA 2IIVA 4KE7A 5K3AA 5BV7A 1L7RA 3GFFA 1XLWA 2X8BA 2JF0A 3L1IA 2AJLI 3QMMA 1CLEA 4KEAA 5ALWA 2BGNA 1Z68A 3WL5A 3WWDA 3AFIA 3AINA 4B84A 3OURA 3CCCA 1LPMA 5K3CA 4BZWA 2CUTA 1AUOA 4LKOA 3BE8A 1M33A 1EDBA 3ILSA 4H7EA 1N1MA 1XRQA 4J0CA 4P08A 3B3QA 1ZJ4A 5ALFA 2CEKA 1VE7A 4OYLA 2C0PA 5ALDA 3I2IA 1MNQA 1TQHA 5DLPA 4J7AA 5DNWA 4KR0A 4MQLA 5LYYA 2HA3A 5T4HA 1BCSA 2QRUA 5D7BA 2CZQA 3G9ZA 3ZPXA 3VJMA 2QUAA 2DHDA 4H7FA 3F67A 4K2AA 3G0GA 4U2CA 3RKSA 1AKNA 4PV7A 4X6XA 5JARA 1ZI8A 1LBSA 2H7XA 5ALHA 1UOPA 1HLGA 2DQYA 3KSRA 4DMCA 4RE5A 4LIPD 5AM1A 4G4GA 4V2IA 2ZVDA 1VE6A 3RM3A 5ISMA 1QO9A 2QMQA 2OCLA 1MNAA 3UUEA 5K3FA 2XLBA 4DNQA 2HA2A 2XUGA 2WSLA 1U4NA 3D2BA 3WMRA 5A71A 3QVMA 4EB0A 1XZLA 4U2EA 3HABA 5CXXA 1QJ4A 1C4XA 5A7GA 1I6WA 4AO6A 1F0NA 4B0OA 4KAFA 2ECFA 4I19A 4CI9A 4GBGA 3VJKA 2OXEA 5HF8A 1G66A 3WQHA 1GQSA 3N2ZB 3STYA 4G5XA 3VISA 4CG3A 4S0XA 3WIBA 3G0BA 4Y2XA 4D9JA 4E46A 4OCZA 2XMGA 4KACA 4LXHA 1DX6A 4TGLA 4B0PA 4DSAA 3CN7A 3FYUA 4RNCA 3V48A 4U2DA 5HKBA 3IUJA 4XWGA 1JU3A 1BEEA 2HU5A 2WG1A 1UKCA 5E4JA 4F60A 2XT0A 5A7FA 1BN7A 1UK6A 3EBLA 4W1QA 5HQ3B 5JD5A 3C5WP 1BROA 1CUCA 3D3NA 4AZ3A 1JI3A 3U0VA 3PFBA 1WHTA 4H7HA 5E4TA 1LGYA 1X70A 3AUKA 3DEAA 5ALQA 2YXPX 3UMJA 3D5EA 3R3XA 5JAUA 4ITVA 4C87A 1SC9A 5J3JA 4X6UA 2LIPA 1AMNA 5SYNA 4BE9A 5D3ZA 2PU5A 5EIHA 4X91A 4BRZA 1HDEA 3H04A 2EDAA 1EDDA 5HFNA 4OD0A 5YASA 4WDRA 2QM0A 2J4CA 1UOQA 4EY8A 3MVEA 5JAOA 3I2JA 4UHEA 1WPRA 4HXGA 1A7UA 1GPLA 2JGEA 4F0JA 5IH7A 2ORYA 4J0DA 1GXSA 1CR6A 1ZICA 3WWCA 5FP0A 2FX5A 3ZLTA 4DNOA 4PNZA 3FCYA 2HRRA 2JGKA 4MYDA 3N0TA 1XZGA 1LPNA 3X3HA 5A7HA 1ZD2P 1E5TA 1MN6A 2FJ0A 2DSNA 4C6HA 2VAXA 2BUAA 1VOTA 2DHEA 1UKBA 5CBKA 2VJBA 4LXIA 4BCBA 5LZ8A 3GA7A 3EQ9A 3OG9A 2XMBA 2WQZA 1FJ2A 3GROA 4EY5A 3I6YA 3I1YA 4DGQA 3ICWA 5AKKA 1CUHA 2XUQA 5ALVA 5AI8A 2G5PA 3HACA 5AKGA 4ARBA 1EINA 3QM1A 5JAPA 4INZA 4X6YA 4L0CA 4J3JA 4BVKA 2QXTA 2V97A 5ALUA 4ETWA 4PW0A 1BCRA 3V1NA 1SFRA 2WLSA 1MO2A 1WB5A 3I2FA 1WOMA 4PO3X 1Q83A 3ZV7A 1ACJA 1Y7IA 3DCNA 2WUFA 1LPOA 1JJIA 1C7JA 1FFAA 3D59A 3FYUC 3WKDA 4Y2VA 4XX1A 3O4IA 4QNNA 2WFZA 5I7UA 4M0FA 3VVLA 4KE9A 3IULA 4FLMA 1PFQA 3JWEA 4Z49A 1OXMA 2HIHA 1EH5A 1ODSA 2WM2A 3I2KA 2DQZA 4DMHA 3AZOA 4MWTA 3LP5A 4J0GA 4AQDA 5ALSA 2XQIA 5AOCA 1DINA 5HF6A 3QPCA 3S2ZA 2R8BA 1MPXA 1XZCA 4C01A 3PDCA 3I6ZA 1YAHA 2B20A 2WKWA 4A16A 2BJHA 3CN9A 1W4LA 1YA8A 5CTAA 2XMSA 4PSCA 4LYDA 1QIFA 5JZBA 4BTVA 2OCKA 1CV2A 5CXUA 1K6EA 1U8EA 3HC7A 4UBIA 1JJFA 5FV4A 3BDVA 3PF9A 3KOOA 5C8XA 4BZZA 1WB4A 2B4KA 4G4IA 4PSUA 1EI9A 1F0PA 3MGAA 1QGED 4WY5A 4FMPA 4HXEB 1X2EA 3U1TA 3DS8A 2JBWA 2BAGA 4M0MA 3BL8A 4ZREA 1UKAA 4W1SA 4MEAA 4UBJA 2W22A 3WKCA 4IQ4A 2VT6A 1D07A 1A8UA 2E3JA 1USWA 5LZ9A 4M0EA 4TPKA 2WIKA 1XLVA 4J0JA 4FNGA 4C4ZA 4QEKA 1YB6A 5A62A 2RI6A 2OQIA 1MX9A 2PSFA 5CT5A 2Y6UA 3H19A 3F97A 5FKJA 2O7RA 5CH5A 5LKRA 5CH8A 1UZAA 3E1GA 4X3CA 5A2GA 2ES4A 3FVRA 3NUZA 2OCGA 5LZ7A 4X00A 3RARA 1P0QA 3HRHA 3E4DA 1QIGA 4N8EA 3IIIA 3W9UA 1R9MA 5FUMA 3EQ7A 1W6RA 4F5ZA 4YX9A 5ALIA 2D0DA 2ONCA 2P8SA 3FBWA 4B82A 2BKLA 2C7BA 4PF1A 4YK7A 1XZMA 4BE4A 4H7IA 4Q34A 5FRDA 1ZD5A 3WK6A 5ALRA 5DYWA 2I3DA 3G02A 2G63A 2GBFA 3NOXA 4IO0A 5DWDA 2PKYX 3WKEA 1IVYA 4J0IA 4HXFB 5LP1A 2ZJFA 2V9ZA 3EQ8A 3R3ZA 3C70A 2AJBA 5AKIA 1EX9A 4EHBA 3K6KA 1GKKA 2PL5A 4X93A 4W1RA 5HFAA 2I03A 4OB7A 3AIMA 4WY8A 4RGYA 4HS9A 2G5TA 4C4YA 5HZGA 1VA5A 1CEXA 4XIIA 3DNMA 4BC0A 2RIPA 3VXKA 4UHCA 5JIBA 2PSJA 2WFLB 4QDXA 1Q0ZA 3IUMA 5C81A 3Q8WA 1VXRA 1QIEA 3IURA 1XQYA 4W9RA 3GZJA 2EDCA 4FFVA 5H3HA 3FCXA 5FPQA 1P0IA 5AI6A 3DD5A 3O9MA 3AIOA 5ALOA 2UZ0A 3R41A 4EZIA 3F98A 2JGLA 3IVMA 3DL4A 3H0CA 4HRYA 2WHRA 1DQZA 2HFKA 2QOEA 3IA2A 1VXOA 5JALA 4Y2UA 2VT7A 1BE0A 5T4BA 2H7CA 3TEJA 1CIJA 5AHXA 3CCBA 2WIDA 1F6WA 3OC0A 5AKHA 4E11A 2QR5A 4DMKA 2GYUA 1IUNA 1VJ5A 5D6OA 4G8DA 5AKLA 3C6ZA 4Q3KA 4KYVA 1GT6A 3LS2A 2H7YA 3QMWA 5BWCA 4FNMA 2JEZA 2DR0A 4EY4A 2OGZA 2YYSA 3JYHA 3G8YA 2HHAA 3AILA 1E8NA 1UWCA 3ESAA 4BAUA 2WU4A 3HJUA 4CG2A 5AP9A 4EY6A 5HKAA 4AN0A 1MAAA 3WIOA 2OAGA 4AX4A 1VZ3A 5JASA 3W05A 3C6BA 3WK9A 4H18A 2WHPA 4P92A 5AM5A 4WDQA 5AM4A 2WIGA 3FSGA 2K2QB 2ZYSA 1XQXA 2Y2UA 5BOVA 4UPDA 2XLCA 3SC2A 4F21A 2XMQA 3A2MA 4C4XA 5ALKA 1LZKA 1CUJA 4H7DA 5ALYA 3ZWQA 1LPPA 1P0MA 1R9NA 5AI5A 1ZGBA 2XUHA 1ZI6A 5EHXA 1TIBA 2HA6A 1EXWA 4JYMA 2J4FA 2BGRA 3G7NA 1XZKA 2CMFA 5D3KA 1N5RA 4N8SA 2B9VA 5JANA 3WK4A 1XQVA 1XZBA 2WILA 1AGYA 3HYSA 1YB7A 3VJLA 1XRNA 3PFCA 3DDUA 3O0DA 3W2TA 1CUEA 2HU7A 1TCAA 1XRPA 5LZ4A 1OCEA 2QVBA 4BVLA 5HK8A 3K2IA 3FLBA 1AC5A 1J06A 3M82A 5ALPA 3HXKA 4G8CA 4XJVA 1JFRA 2FJPA 3M83A 2XQFA 1ORWA 3ESDA 4KE6A 5CT9A 4Y9SA 2AXEA 1EDEA 2WHQA 3D7RA 3I6MA 5DYYA 3PF8A 1MX5A 3MUOA 3D2CA 3G0IA 3EIOA 3KDAA 3QH4A 1TK3A 1Y37A 4CFSA 2ROQA 2JIDA 3IB3A 2J3DA 5AK5A 4QZVA 4BAGA 1HL7A 2PUJA 1R88A 5IKXA 4J03A 3GUUA 3M81A 4OU4A 2HU8A 1MT3A 1QIHA 1K4YA 3DL7A 2O2IA 5DTIA 2IX9A 3DJYA 1Y7HA 4UHFA 1DX4A 2PUHA 4GECA 2PVSA 3R3UA 4CCYA 3FLAA 1VLQA 4G9GA 1IZ7A 1QFSA 1H23A 2QT9A 3BDIA 1DT3A 4UHHA 4X92A 3WI7A 1A88A 1NX9A 2WTNA 4QDOA 3WKBA 4LHEA 4CIBA 2PBLA 5FOQA 3QMVA 5FLKA 3DYIA 3FWHA 2RONA 1DQYA 4OYYA 4QA9A 4QWMA 1IUOA 2PSDA 5AI9A 1UFOA 4FDMA 1OILA 3AZQA 5HCUA 1SCIA 2WFLA 4BVJA 2RHWA 3H2IA 3WYDA 2OAEA 1Q84A 4BYMA 1XFDA 4K5QA 1DT5A 4FHZA 2HM7A 4QDTA 5AH0A 1CQZA 4KRXA 2XUIA 4WCVA 1ZJ5A 3GBSA 1ISPA 4H7KA 2C4HA 3IDAA 2OGSA 5IVIA 3BJRA 1HPLA 1CQWA 2QTBA 1YA4A 4IH4A 5EI5A 3C8HA 3W9BA 1R3DA 2HA7A 5KWIA 2PPLA 2QJRA 2GYWA 1CUVA 1O6GA 4G9EA 3KWFA 1YSCA 1F8UA 1KU0A 1BS9A 1QIJA 3WL6A 3F9CA 2VSQA 2BFNA 2XI4A 4Y2TA 1XLUA 1JKMA 2ZJ6A 1KU6A 4BAZA 4WJLA 3WK8A 3ESBA 2WUEA 1W76A 1JMYA 2H9YA 1AURA 4BBZA 5ALGA 4AZ0A 1TRHA 5EIEA 2HFJA 3H1AA 2C58A 4EBBA 5BWBA 3BIXA 4NZZA 4I3FA 4AO8A 3BJMA 3CXUA 4ZI5A 3HEAA 1ZD3A 3QPAA 3HI4A 2GZRA 1NU8A 4N8DA 3OM8A 3EF3A 5EHNA 4JUIA 2VJDA 1XRMA 3L1HA 4MYSA 4ZGBA 4X97A 5T4EA 2O2GA 1T4MA 4J0KA 4Y2JA 4FOLA 1VZ2A 4BB0A 4B80A 5DYTA 3LIIA 4YASA 4G8BA 2WG0A 1A8SA 3BWXA 1HKHA 2H1IA 3C43A 4FLFA 2JGFA 1WPXA 1QFMA 3E3AA 3IBTA 4DYHA 4KRYA 5AIBA 4H35A 2VEOA 5IVHA 1ACLA 3FOBA 1JMKC 2XMCA 2ACEA 2C5FA 3L1JA 4BRSA 4K6GA 1MX1A 2VJAA 2ZJ7A 2RAUA 3RK4A 2ACKA 2VF2A 2X5XA 1BU8A 2OGTA 1TCCA 3WLAA 1BN6A 4YPVA 3A6ZA 3WK5A 4UBKA 2C0QA 4Y2SA 4FBMA 3FYUB 3BF7A 1QIMA 4EA6A 3E0XA 4Q3LA 3QYJA 2PSEA 2X76A 2NW6A 3HSSA 5DJ5A 4ZWNA 3STUA 5HQ3A 3I2GA 1FFDA 3WL7A 4KE8A 3RLIA 4X94A 1ZIYA 2VAVA 2XE4A 2AJDA 3TGLA 4UBNA 3QBJA 1W52X 3C6XA 2QUBA 5LIPA 2GBGA 3R0VA 3FYTA 4GW3A 4RPCA 4QWWA 2WJ3A 4A5SA 1QIDA 5AKZA 5ESRA 2WUGA 5I9IA 2HA4A 4PSDA 1LNSA 5CURA 3WKAA 4DNFA 1XROA 3VKFA 2YASA 1H2ZA 4L3WA 4HAIA 1FFBA 1MTZA 1CFJA 4QDZA 5AOAA 2WFMA 5AKXA 2WIJA 4X85A 3WWEA 2OLEA 1EVQA 4UHBA 1EK1A 2ZSHA 2Z3ZA 2JGIA 4TVKA 3TRDA 4KAAA 1CUWA 2JGJA 3H17A 4QLAA 3PICA 3H1BA 3O4HA 4PQEA 1AZWA 4LYEA 5K3BA 3I28A 4QDUA 1G5FA 5CT6A 3GELA 4BCCA 5CT8A 1NU6A 5LZ2A 3QITA 1L7QA 1SCKA 2WTMA 3R40A 1QIKA 4OPMA 2XUJA 2GYVA 1Q0RA 1CUGA 1K5PA 5EHQA 1K63A 1E8MA 3OPMA 4B81A 3VDXA 1CUSA 2XQJA 2XQGA 3H2GA 2ZYRA 1YR2A 5JAHA 4W1PA 1ODCA 1XZJA 4GI1A 3KD2A 4U2GA 2XUAA 5AM0A 1CUFA 1XQWA 1WM1A 3STWA 1C7IA 3M3DA 1BEZA 4B6GA 4DNPA 1LZLA 1XZIA 1BRTA 2O2HA 3T4UA 1U2EA 4MWSA 1CUXA 1ODTC 3OOSA 3PE6A 4DTCA 4B9AA 3WYNA 5CMLA 3D2AA 5CW2A 2QZPA 5HF9A 2OG1A 3V9AA 1H22A 2HA0A 5AK4A 3I2HA 1ZGCA 1JJBA 3JW8A 3QPDA 4BCDA 4JNCA 5LLSA 4NVRA 1THGA 2VA9A 5ALZA 4HTAA 3STTA 5FPPA 5C8ZA 1R1DA 1YS2X 5EHZA 1PJAA 4FWBA 2JEYA 1G4HA 3FVTA 3P2MA 4GHWA 1A8QA 2Y1KA 3KXPA 4NMWA 3BXPA 1QONA 1GGVA 1JT2A 1LPAB 5AO9A 4Y7DA 1LPSA 2XQKA 3A2NA 5JATA 1DWQA 5AI4A 4BP8A 2BUBA 2YH2A 5E2IA 1XRLA 1G42A 1QIIA 4X71A 5AIAA 3PI6A 3KWJA 4NS4A 3ANSA 4P93A 5JZSA 4UBLA 3FAKA 2GBIA 4BP9A 1UK9A 1W75A 5CT4A 2HADA 1CUBA 3A2LA 4GLBA 3O9VA 3O95A 2C5GA 2JGMA 2QXUA 4KAJA 2OPHA 2PU7A 3W06A 4H77A 3OTQA 5ALTA 3FSGD 1TKRA 3DQZA 4AB1A 3LCRA 1XKTA 4MEBA 5T4FA 3AJAA 2VTVA 1XZDA 2XUKA 3C8DA 1JU4A 4N5IX 3DKRA 4E14A 1SCQA 1ZD4A 2CB9A 3G0CA 1UK8A 2XUPA 1GPKA 4UFNA 4AO7A 3WWPA 1THTA 1CUDA 3LLCA 1J07A 4B83A 2DHCA 4JYPA 4BDSA 3DYVA 5EFZA 4E15A 2IITA 5DNUA 5C7YA 1XKLA 3Q0TA 5K3EA 2RGUA 5HK9A 1R4ZA 3O4GA 1E8DA 3NGMA 3HZOA 1N5MA 4BDTA 4DIUA 4WFKA 1ZOIA 4OUKX 3LIPA 3SWWA 1MJ5A 2XUOA 4QLOA 1WCYA 4AN1A 1AQLA 2Z8ZA 1CPYA 4QE3A 5KREA 5E4YA 4DMFA 1QE3A 1IMJA 5KBYA 1QZ3A 5CH3A 1LPBB 5FDFA 1FSSA 3C6YA 3PUIA 5JYCA 1GZ7A 2I3ZA 4U2BA 3H2HA 3C87A 4X95A 4AMZA 4Q05A 4OB6A 1LLFA 1B6GA 5CRIA 4X7BA 4HVTA 4C89A 1VKHA 5DTJA 2B61A 2Q0XA 4ARAA 2CJPA 4K6KA 1K8QA 1GQRA 4WFIA 2HRQA 2PSHA 5LZ5A 5AKYA 1GKLA 2WJ4A 1T2NA 3SK0A 1IUPA 4OSEA 1L7AA 1EB9A 3SX4A 1DWOA 3HLKA 4P9NA 3ESCA 1CUZA 2BCEA 2XUDA 1UT6A 3G0DA 4IHAA 3WA7A 3V1MA 1VA4A 4B7ZA 1E3QA 4G1FA 4ROTA 1YAJA 4CCWA 2AJ8A 3DLTA 1CUAA 4ZXFA 1AX9A 1MAHA 5JD4A 5JZ9A 3B12A 4H7JA 3H2JA 3DKKA 2DFPA 2XMDA 1RP1A
chains in the Genus database with same CATH superfamily
1KQFA 4E88A 3CPJB 1ORVA 1A2OA 4EB6A 4B2PA 4EJSC 2I4IA 3I61A 4NPCA 1FNMA 1RYNA 2GBCA 3EH2A 1PNTA 1KJYA 2AHRA 4L73A 2OHXA 1GLGA 1K3TA 4GPD1 3EGEA 1RI1A 2AUTA 4CDNA 3HKBA 2C2YA 3BGIA 1E1MA 1T3ZA 5J4YA 4MYCA 1CG6A 1N5JA 2AFIB 3MPOA 1A9XB 5T57A 1JTFA 3O4JA 5ECDA 3CR3C 4GT1A 2ENUA 2YV1A 5JNWA 4REMA 4OAOA 3BORA 2YOHA 1RJDA 3W3AH 5LDDC 3ZI7A 3PX2A 2E37A 1N8SA 4R54A 2PV7A 3WLRA 5DHUA 1Q2UA 2RDMA 2O06A 5DBHX 3NHKA 4FBLA 3GA5A 1WOYA 3FM9A 2ONYA 4UUQA 5AOBA 2CLFB 3I1IA 4IKPA 4OI1A 1QYCA 1TGVA 4G0WA 3UWDA 5D1NA 1MU0A 2YXLA 3Q7IA 4QRDA 2W6CX 2DKNA 5JS1A 1I4TD 2XTJA 1PUIA 3LVBA 3S28A 1HV8A 3CHYA 3CF4G 3ED1A 4YCSA 5KQLA 1YS1X 3FVWA 1GPNA 2BGTA 3CLKA 3LZDA 3PNKA 4MS3B 1D1PA 1M1NA 3A1TA 3L40A 3NV9A 4ZT7A 5I5GA 2O8FB 1SGWA 1K6JA 1XAJA 2Q7DA 1XZAA 5PNTA 2Z0MA 1J49A 3V1KA 2ODEA 1L5YA 3EVAA 1ZJZA 4OGWA 1HTTA 2ZRFA 1SRQA 4BVEA 4C88A 2BCGY 3R3SA 4F9FA 2WSSA 1TT7A 3SC4A 1O6FA 1IJEA 1BA2A 2EBFX 3RYFA 5KVQA 3T4PA 3VSDA 3JY6A 3Q41A 5DASA 4NQZA 3G0HA 1Z7EA 4QEDA 1C8KA 2HNAA 4D45A 1LDMA 2JD0A 4OHYA 2R1ZA 3ZIAA 3RANA 4Y6LA 1A8HA 3U7IA 3KP1A 1LV7A 2JIRA 3G8CA 4FMCB 1RKVA 3WJ1A 1K6XA 1YMQA 4ZO7A 4R9NA 1GADO 3CZPA 4QYXA 1H8ED 2FSHA 4PGAA 1QU2A 1QC5B 4XWWA 1TE2A 4BATA 4B4KA 5FBWB 2H00A 3H6GA 3HCAA 3DUFA 3TE7A 3ZKWB 2OE2A 3HKCB 2E1RA 4BMDA 1UDCA 3HB7A 5DN6A 3GEHA 2I4TA 1QQAA 1P0PA 4CM9A 1ETHA 1H2XA 2C03A 3I1FA 3C24A 3I0MA 4L8VA 4CM8B 1NWCA 1PGPA 5L3ZA 4Q7QA 1XJQA 3HVJA 1TZMA 3OCYA 5ANRB 2JI7A 5DHPA 3RC2A 3FLEA 2ZQZA 4DXDA 2PG3A 4CKWA 4CHTA 1H1TA 2Q27A 3VQTA 4CIAA 1CP2A 4FR2A 3TLYA 2C9ZA 4YRQA 1OBVA 3JRNA 5FF9A 5BSVA 4AZVA 2QBYB 4OATA 1B41A 1F17A 1I3OA 5LUBA 3HY4A 1CZOA 1T3SA 1U0EA 3LFTA 2HL6A 1C7QA 1CFZA 4OHRA 5AVKA 2A0UA 1V96A 5E6RA 3GLFA 3VMMA 4ZQHA 3I5YA 1I32A 1QZXA 3CY6A 4XPZA 3WWOA 5I4IA 4PZDA 2N9UA 2A4MA 1EFKA 5IU6A 1QUEA 1JB9A 3ETDA 4XSHA 4B46A 1R8SA 3OC6A 5TY0A 1N0IA 2VXBA 5FR1A 4HUTA 2GD0A 2APJA 4WZBB 3L06A 3DBIA 4GXNA 2XDQB 2NYAA 3B6KA 1ICEA 3EOAI 1B4DA 2PMDA 4NEHB 4EG3A 2EBUA 4OJQA 4BQFA 1KEZA 1XRRA 1AD2A 2DOKA 4DLNA 1UIMA 5FQNA 2QROA 4BMZA 5GPBA 3WV4A 2BFBA 5BSFA 1HSZA 4CQMA 2WYVA 2OP1A 4IPTA 2EIXA 1ZK4A 1POXA 3DDWA 5IN5A 5CDHA 4D98A 3UT6A 4D0GA 3KPYA 4JLJA 3ZHBA 4I46A 4P22A 1QCZA 2AJCA 3NTOA 1PQPA 1WUKS 3EOBI 1UXOA 3ZH9B 4PR0A 4BQIA 5JROA 3RK0A 2XMPA 4FYXA 4S1WA 3TOVA 2H2HA 1JXOA 3WJ2A 3ZW7A 1TCUA 1HBJA 2AUNA 2K7ZA 2PTGA 3A05A 5FB3A 1EVEA 1JKXA 3GMTA 4JP5A 1DUIA 3O8LA 3NM4A 1QHHB 4MQMA 3IAAA 4CMBA 3QZUA 3FBGA 3IERA 3B2NA 4FLEA 4BLUA 1E7QA 2XMZA 1JR2A 4PZAA 1BKYA 1ZY2A 1MABB 5SZKB 1CRLA 1RLJA 1RXSA 1XCJA 2R5FA 3A14A 2G4LA 1EFDN 1XMVA 2CLHB 2G1UA 3IT1A 3JCZA 3LAWA 1B73A 4G81A 4NY1A 1PT5A 4TQGA 1YDEA 3AVWA 4DM7A 1N3IA 1NA5A 2R3SA 2A1TR 3AY7A 2NO5A 2VHZA 4JI0B 1B8OA 4JLAA 4GPAA 5FLEX 4AJJA 3ZLUA 4HR7A 2B0JA 3QE3A 4KPUA 5D6NA 3FJYA 2PJDA 5H7XA 4N3GA 2B99A 4F2HA 1H2YA 1KEEA 3F5MA 3U4QA 3K9BA 1CQJA 4WCFB 4WLEA 3OFJA 4ETMA 2ZSIA 4RTKA 1JQLB 1EA5A 2WIBA 3H87A 5EG5A 3FWYA 3WYGA 4ZDJA 4MR9B 3X2EA 5HRUA 3D8SA 3A70A 2BUCA 3MLAA 3AIKA 4BKRA 4DEXA 1MH1A 1P1JA 2AG1A 4LZWA 3DG9A 1SUPA 4ZMSA 2NYUA 1VJ0A 4ACAA 4HPWA 4DSZA 4C3VA 2Q3BA 2XB9A 1B3BA 4FC6A 4JWKA 3N8HA 5EEGA 1JG1A 2VNKA 4IH1A 1Z0SA 1Y4SA 4F3NA 5LKAA 1SHUX 1PW7A 4MKZA 2H57A 2ZXEA 2ORIA 3GLSA 3KLNA 2W6IA 3BD9A 5D3QA 5EQJB 3GG9A 2HRDA 3D3JA 2F4NA 3QE2A 1DE0A 5HS4A 3EGVA 5T8KA 4YDQA 3WYFA 3M4NA 3VTZA 1L5QA 2P41A 3HWWA 3MIZA 4GF5A 2ADFA 1F4PA 4WX2B 3PRHA 5AFSA 4WKCA 1EYZA 3FFWA 5IANA 3EJWA 5AI0A 4HZUB 6REQB 3ILVA 4JDUA 4TLEA 2PUDA 2WT4A 1XTKA 3I30X 1E89A 1VKJA 2XB6A 2ZYHA 4IO1A 1ANKA 4JJEA 3ZZTA 1XRJA 3H11B 4JCCA 2F64A 1ZVKA 5E8RA 5IT9A 1RNLA 4HS4A 4JGGA 3RR2A 3P2OA 2C83A 1LVGA 1P1KA 4RPHA 3WDLA 5BR7A 4AJOA 3C3KA 3AO0B 4QVIA 2OG2A 4OP3A 5FXMA 1JLLA 1RQRA 4Q02A 2HPAA 2IYEA 2WZBA 2P1ZA 3UUFA 3VC1A 4WXYB 5ALEA 3X2SA 3AY6A 3OQBA 5TE9A 3ZD8A 1YS4A 4PGGA 5CBPB 2ZYVX 4M76B 1RMQA 4XVCA 2W6QA 5KYUA 5C8YF 1M2VB 3QU5A 3L3BA 1Z0UA 5SYMA 3QSGA 2R7KA 2TECE 3LT0A 4NC9A 3VYUB 4B5KA 4A15A 4NCAA 2P6OA 1N0UA 3K6JA 3R3HA 4IHJA 2ZI3A 3D0KA 1EK2A 1L5GB 1KC3A 4E5NA 1ZK1A 1QG0A 3TOZA 3KQOA 3AZPA 3P9CA 3SZLA 5AJWA 3CIFA 4HNUA 4AS1A 3E9EA 3O4FA 1E66A 2NQTA 3GRUA 3TDKA 3D7SA 4PTLA 5ERYA 2WQ6A 2XAUA 2ZE7A 1UINA 2X9NA 5DKFA 4CMGA 1SA0A 1V3UA 2JFYA 1D1TA 1FUKA 2IS6A 3TECE 4CMEC 2BBOA 2EWMA 3DE7X 1P1IA 2XA1A 1YJ5A 3VAYA 3NWJA 4K9RA 2E4XA 5FPYA 1DQNA 4BLWA 2DFVA 3CZ4A 2LNDA 4GDMA 16PKA 1DO2A 5FHRA 4LJ5A 2NVUB 3PTLA 2B5OA 2Y1DA 3LPLA 5I8PA 1P4SA 4HRXA 2O07A 3GJ3A 3FTCA 4OMCA 3OKAA 4BTEA 1XEWY 3EHDA 1QTIA 2CL0X 1FXSA 3Q6MA 4L74A 4Q3OA 3NO4A 4EHJA 2HDWA 4TYMA 5EJFA 4ZYUA 2JIBA 2QPLA 4P3XA 4NU6A 1ULBA 2GEDA 5E6SA 3NKLA 4EZEA 5J4HA 1Q7BA 3BQ9A 1G6OA 1W36D 2JAPA 4KJXA 4L9AA 4WLNA 2QLNA 4IQ8A 1HM5A 1RCTE 4NH0A 5IZCC 2I1QA 4Y2RA 3CZAA 5I9SA 3EC1A 4ZVQA 3USZA 2JZOA 3BHIA 4M22A 5JHHB 3IDFA 2WUDA 1C1HA 2Q3DA 4EI2A 5HRCA 2VDNB 4H4EA 4NXMB 1AQ6A 2IIVA 2FFBA 3O8BA 1QQTA 5H81A 3NAMA 1QDUA 4KE7A 1XA0A 2CDAA 1GAEO 5TX7A 3TYXA 3MBOA 1W4BA 3JYNA 1K4MA 5HRAA 4RHFA 4WQMA 2QMEA 4KNVA 4BS9A 4RENA 4RY8A 2WLTA 3O83A 1R8QA 3P7MA 5KAMA 2FEXA 4OAPA 4PNEA 2G77B 3CVYA 1Y9ZA 2AH5A 2V7QD 2G4CA 4QJBA 4TV9A 3VSEA 2HDHA 2HB6A 3L1IA 3CKMA 4PBTA 4Z7NB 3RRBA 2C3OA 1VB3A 4QXQA 4FBGA 1DCMA 4R8RA 1NI5A 3H9JA 2NTNA 1KJIA 2G40A 1SY7A 3AUAA 4L85A 5JDCA 4PO1A 3U6KA 1DAGA 5EWMB 2BGNA 1GRCA 2OXIA 2JHFA 2ONKA 5BVHB 1QK3A 1MGOA 3B13B 2VDQB 1JJVA 3BJIC 4YJDA 4WTOA 5MGBA 3OBIA 2ANBA 1YQUA 5FTNA 1KS2A 1O96B 3BZUA 4CV2A 2W4MA 1LPMA 3OHPA 1PJ8A 4IV8A 5K0FA 4KO8A 4BZWA 3ZCXA 2CUTA 3FETA 5CVUA 1KA9H 4Z7JA 1NW8A 3W2GA 4DSOA 2HMSA 3ZHYA 5LU8A 2CXQA 1G41A 3G79A 4G24A 5KAPA 3ZCTA 3LG2A 2HSGA 3NT5A 1N1MA 1XRQA 1ZH6A 3A9SA 4J0CA 3ZEAA 3F49S 1Y8ZA 1YJAA 1ZN2A 3IS3A 4Z1MD 3H7IA 3B3QA 4GKVA 4RIHA 4RMIA 3SDZA 5JZOA 2DPLA 4CR7A 4MS4B 1XHLA 1QP8A 1QVRA 1U0OC 3D6NB 3KAKA 2DT5A 2HV9A 2ZUBA 5EEHA 1JIJA 1U2TA 3QX8A 1VG0B 4YT5A 3U7FB 3I64A 2A1IA 4ZQBA 1ZNZA 4IJWA 1CJUC 4RADA 3RHTA 1VBMA 3RWOA 1E5DA 4A8JB 3AF2A 3U3XA 1GEGA 1APBA 1KDYA 1YD7A 3GI1A 4D9EA 1TLFA 4J7AA 1FX0A 3G68A 1DRWA 4R69A 1A2KC 4YP9A 4V3CA 2WOOA 3W5AA 4DMLA 2BGGA 1Y5RA 4F5EA 1UEIA 3FDJA 3PD7A 2Z57A 1YMVA 4JUDX 4C4SA 4ECAA 2YHIA 2JJMA 2WYWA 2FN4A 2Y0EA 3DP9A 3E8MA 3O4RA 4HO1X 4J7CA 1Y3FE 4MS1B 5F98A 1QWOA 1IBKB 1SHLA 4NENB 5T6BA 2D62A 2GDZA 2W43A 1JIXA 3NUQA 3TVTA 1NKSA 1J99A 3T9FA 1MR3F 5C4MA 1XMIA 2IOFA 5LOVA 3J81k 1JEYA 2HH9A 4IMPA 1Z25A 2DHDA 2XTNA 5JMOA 3Q3GE 1PL0A 1U8XX 3AU8A 2J9ZB 4IDDA 4K2AA 4X5OA 1COZA 1QAOA 1RE1A 2IDMA 2GOYA 2WKQA 3MRTA 1EBFA 4IOJA 2BVNA 4U9IS 4V3BA 4YCLA 5LXTB 1AKNA 3LBIA 4PV7A 5JS8A 5KNDD 2EU8A 4X6XA 5JARA 3PKZA 1KETA 2MSDB 3HXMA 4URWR 1E2IA 5B2EA 5ALHA 3KT8A 3J81A 1HLGA 3ROQA 2H5JA 2DQYA 3ZV4A 3WLMA 4ZU6X 1NONA 4FDTA 4G1CA 3M6XA 3JVEA 2X7JA 2C8VA 4QPPA 4CF5A 2MSNA 2R2GA 4NBNA 1ULUA 5AM1A 3VZPA 1H1LA 2IXFA 3WB9A 5IULC 4EPWA 2GM4A 1DFGA 3HBAA 1QO9A 2HQOA 2QMQA 3NT2A 5CGZA 1EA7A 4Q66C 3I04A 1V39A 1VHTA 1YUBA 4CKYA 3K92A 1P4GA 4PLTA 4AN4A 5K3FA 2FWRA 2CJXA 2XUGA 3WLIA 1N32B 2OBXA 2PT7A 2VDWA 3R7WA 1TT5A 5THQA 4E5MA 3LDAA 1LFDB 2IE0A 2W83A 4U7FA 1Z2AA 1MV8A 2DY0A 3F6CA 2G17A 1I3MA 1GYRA 1KJZA 2FPOA 3QVMA 4D57A 3L6CA 3D81A 4U2EA 4X8LA 5CXXA 1QJ4A 5BSTA 1RD4A 4HQ6A 4UZFA 1F0NA 1E92A 1I1QB 2I67A 3DBHA 5HZKA 2ERCA 2IFTA 2W2LA 4F92B 2FOLA 1IB0A 3WGNA 3E22A 3FPLA 1BWQA 3DWGA 1CYEA 2KB0A 4GBGA 4JLBA 4Q4HA 3ULKA 5JQWA 2EJTA 5BR4A 2XF8A 3IEXA 3LRTA 4YLGA 3S68A 1SK8A 2X6QA 3DKVA 1IUKA 4LV6A 1TM7E 4KVGA 4LE0A 3WQHA 5CK4A 2IKSA 1YH3A 3ZJ4A 5L7TA 1IY8A 2QV0A 4R5HA 2WTUA 4Z7OB 3W1VA 3N0WA 3ECAA 4Y9UA 4G1BA 4LI0A 3ZWPA 3DZHA 2H17A 1PNOA 2HUPA 2V7UA 3OQHA 4QYTA 1H69A 2PDAA 3TZCA 3GLFE 1OLSB 2B5WA 3GF4A 4R0MA 2A94A 3GEEA 3JRXA 4XJXA 1R6VA 1IXYA 2GPJA 1M0SA 4RW0A 2ZI5A 3UO8B 1UZNA 2C5LA 1GKYA 4MV5A 5F1PA 2C92A 3ST7A 4EELA 5CCEA 1T9GS 4E46A 1RJ9B 2VHUA 1W4RA 1XG5A 2RC5A 4OCZA 2XMGA 4KACA 4YJFA 1E0DA 1T9KA 1JBEA 2A3NA 2HU2A 4HTFB 3ZYCA 3K4QA 1O95C 1N6IA 3NYQA 4G01B 5KQMA 3PDWA 4DSAA 4G8JA 4GYJA 1K8YB 5ETJA 4CM4A 3TEMA 2QRVA 3VR6H 5ITZA 2HR1A 5A04A 1E98A 1PHPA 1GFSA 2WOJA 1RKBA 3FYUA 3HCOA 3QHPA 4RNCA 4B17A 3ZVMA 1DUVG 3T7RA 2NSHA 2IEIA 2E82A 1KR2A 3AH8A 2A9PA 4DUZB 4W5WA 3QJ5A 4RD1A 1J2JA 3IAM6 3G2QA 3IOMA 4KXXA 2P2YA 2BT4A 3RBZA 2V58A 3WXMA 1J8QA 5EJ7A 1P39A 2JLQA 3IYLW 4UCXA 2GBLA 3LA6A 4HDNA 1T6XA 5CU7A 2XT0A 4EQZA 3GIWA 5A7FA 5EZ6B 4N65A 3PNVA 4TUYF 3O0TA 4B74A 4EJFA 5AW0A 4MVWA 4CIDA 3FY4A 4BO0A 3OKFA 1FF9A 1SXQA 1Q74A 1JI3A 1H6AA 1GLNA 2AW3A 5G40A 3U0VA 4FMBB 3TXXA 1O5IA 3KLPX 4LX0A 4BLPA 4NQRA 4MR7A 5FTJA 1C0EA 1WEKA 3ORSA 4GMFA 2GR9A 4RA6B 1LGYA 1X70A 2KWIA 3DE3X 3KKZA 5ALQA 4UVGA 5I47A 4M87A 1ML4A 3BXOA 3RO7A 4IUYA 4E2WA 3DMNA 1UAAA 4C87A 1SC9A 2QE6A 2JLCA 3L8MA 2Z4SA 2Q7OE 3HNPA 5LR6A 1MJNA 5J3JA 3CUSA 2XVAA 4QGSA 1UKZA 3NBUA 1PL8A 3KX2A 4MUAA 1Y48E 3PC2A 2J8ZA 1TVCA 3DNPA 4X6UA 3IUSA 5KWEA 5JRZA 1AMNA 1B8PA 1MO4A 1C50A 1F3OA 2CNDA 3NHMA 3OCJA 3OO0A 1XEXB 4NBVA 2XR1A 1CVIA 4MR8B 1NM5C 3HJNA 1A0OA 4NBUA 4E2FA 4U4AA 4F6LA 2BMEA 3KZNA 1GYQA 4ZDKA 1Q95A 2Y1WA 3PX3A 3T1YB 3JAKA 2PU5A 2ACWA 2B7CA 3RUAA 1OXTA 5I7SA 4ZCTA 2F90A 1R0RE 2WT8A 2GB4A 3RYIA 4EHLA 1MAWA 2X0DA 3G1WA 1KYXA 4R2IA 3R8CA 2J09A 1Z0ZA 3ZS8A 4EKYA 4ADSG 1KAHA 1GNQA 1ADJA 4ZTBA 1BXRA 1OXXK 1BQ3A 4JYCA 3COWA 4R3UC 5HFNA 1SG0A 4ICIA 5EOVA 4PC6A 3L82B 2YXBA 1Q1NA 3FUWA 1Y6QA 3JXEA 4IICA 2GNAA 3AJDA 1NXWA 4XPIA 2C7QA 1Y3DE 2C82A 2ZJZA 1OH6A 4FEAA 4QBIA 4B3BA 2ZPAA 3RC1A 2CLLB 2J4CA 3JARB 4DW8A 1VP9A 2OENG 1UOQA 3DDZX 3TIXB 4EY8A 1W48A 4ZDWA 4J1TA 3MUFA 4YAOA 3VJRA 1MD9A 1B8VA 1JHPA 2IPXA 1M73E 1Y1SA 3M9LA 1ZRNA 1L5KA 5LP6A 3S70A 2IEBA 3PK0A 2VZEA 4MITA 2GM9A 5TRTA 4U6QA 4C5CA 1Z38A 1BMQA 2GPWA 4UQOA 1AHIA 4YV1A 1A7UA 2ZT6A 1Q0TA 1GPLA 1BE6A 3LRXA 3KZOA 4IHJF 5C8DA 1X19A 4F0JA 5KX5F 4HWGA 1LTKA 1JUDA 4JQOA 3GDGA 1KSJA 2C3YA 3NHZA 2OQRA 4N1AA 3SXJA 5J4KA 5LQNA 1K6IA 3RT1A 1WR8A 3Q9UA 3ZZNA 3SQWA 3WWCA 1KJNA 2FX5A 1W9HA 3EVTA 2QP3A 2R79A 1ADCA 2HRRA 1RWWA 2MWMA 1I7LA 3IVRA 3N0TA 4I8DA 4CEIB 2J9FA 1W5AA 1GDTA 4WOPA 4DAEA 1DKLA 3THXA 1ZAYA 3KJFA 2TMGA 1WMEA 2IY7A 2VT3A 3G5AA 3L7NA 4KLCA 3TQSA 5K09A 2I7DA 1AUVA 4M1MA 3HQ4O 1FYXA 1DS6A 5L4SA 1EHIA 1T6BY 3L4BA 3UYLA 4INOA 3ZHRA 4ID9A 1V47A 2OZKA 3OPYA 3GMSA 1D1SA 4WL0A 2YQ5A 3KS9A 1SUIA 2GEVA 3KPUA 4XWOA 2LD4A 3EQ9A 4XDYA 3VKWA 2G07A 4ZCSA 3CLHA 1QG2A 2Q2OA 1AQIA 3IC5A 3G3EA 1SD1A 2I2DA 2PXCA 1EDZA 2XMBA 2PRIA 3FPKA 3A1WA 3SFVA 5AVYA 1JVSA 1T9AA 4IX9A 1OF1A 1U2ZA 3LMKA 2QZ4A 1KPGA 5KDDA 3CYFA 3UA4A 4I5IA 4EGCB 2W6PA 4EPRA 3PGVA 3KKOA 2XUQA 2VK4A 2G9VA 2ZYGA 3BK2A 3FGZA 1DBWA 3O4VA 2WIAA 2H4JA 4JAVC 4NFHA 4R7ZA 3A6EA 2X22A 4QYMA 4TS3A 4YMSA 5JSZA 4ECEA 1JHAA 2UUCB 1OJ7A 1IHDA 3RT9A 5IAOA 4LPSA 1J0BA 4XZ3A 2R1TA 4QUEA 1WCV1 3LLMA 3QLUA 4MKRA 1AE1A 4MV8A 2R4TA 3H1FA 3GJ5A 2PFKA 3CE6A 1RKQA 2IRWA 1XTPA 1X7WB 1ECJA 3SYNA 2ETXA 4BX9A 4W5HA 3WB1A 4POOA 1FVFA 1N9ZA 4F5YA 2QXTA 4EHKA 1X87A 3PC4A 3DXYA 3WR5A 4H3VA 4ETWA 4PW0A 3TIFA 1PG5A 5BW5A 3QV2A 3GXBA 3FH0A 4EGQA 5KPJA 1TVKA 2HY7A 2ZYWX 3GWZA 3Q85A 3K0CA 4JJ8A 4JX8A 4CRWB 1MO2A 4ZIRA 2R00A 5EKXA 1AA9A 1N57A 1DZIA 4B47A 2WB4A 3AR9A 3ZKAA 3L1KA 4AJPA 3C3JA 2XXAB 3ZWNA 1QV9A 3EVZA 3GAAA 1N9GB 1NTRA 1U8TA 3GQVA 3U4AA 4F6RA 4KPEC 2O8CB 1WA5A 5GV8A 3TDNA 2QQ5A 4NI5A 1YVUA 4JS0A 4MWZA 3BWBA 2XECA 1QR6A 2R66A 1RM4A 2AOUB 2P9FA 3MXOA 1LPOA 1NLMA 3QGMA 2B1QA 3RVPA 3ZDXB 4CT5A 1WETA 2KYRA 5DXJA 3WKDA 3WHKA 4ZA2A 5HJ5A 3EAGA 1D2CA 4FCVA 2EX4A 2GO1A 4QNNA 1IHUA 2MT9A 2W71A 4P38A 5H9VA 4N5DA 1XAIA 4ZCRA 2G9ZA 2Q8QA 4M7RA 5JSUA 4WCFC 4HH4A 4EUEA 4RA9A 1J7JA 2WJHA 3EGIA 3VVLA 3ZHVA 2C3PA 2BEKA 4KE9A 2ONJA 3TLGA 3SQLA 2ERXA 1EQ2A 3FCCA 3OZ7A 4X44A 5G1NA 3SJZA 3UMSA 2EOAA 1YONA 3F2IA 3JWEA 1I1NA 1Q7TA 4ID3A 1KZHA 1AGPA 1M1ZA 3WL3A 4RS4A 1XYYA 1AF4A 3OZSA 3JQFC 2F9MA 3M1IA 3DM9B 1B1AA 1AXGA 3CTMA 3I2KA 2DQZA 5JNSA 3AZOA 3ER9A 3LP5A 2E5FA 1HE2A 2P9EA 5TGZA 4NDZA 5AVTA 2QIOA 4JODA 2R8BA 3EVEA 1M1YA 2PN1A 1XZCA 3TEFA 2AMFA 1FRZA 4R1OA 4E03A 1OY1A 1PZNA 3CS3A 3F7TA 1EE2A 1L4YA 3IMEA 4KUGA 3T12A 5HTKA 5EQTA 2AOVA 1XZ8A 2JLWA 1HMPA 4JB8A 3IVCA 5I4BA 2P2GA 4A16A 3BB4A 4QO7A 2P2ZA 1KHHA 4NCJA 1NOIA 4TROA 2JFOA 2OHVA 3H5NA 5FX2A 1THZA 3KKKA 5B7QA 2E4WA 4XIGS 4I8IA 5F9MA 1KTVA 3K6SA 3NDPA 2O2XA 1P18A 1QS0A 4BTVA 3MTJA 2XOKA 2EF1A 3ANNA 4EJ0A 1CV2A 1D1QA 2LKDA 2P0YA 2YJZA 4WN9A 1KXZA 3SQXA 1W30A 3IRVA 4I9HA 2D2XA 3T9EA 3TB4A 1KARA 1PTJA 4G65A 4UHKA 4XM0A 1XWWA 4XR9A 3R7DA 3BULA 1Z18A 1YNSA 5HTOA 2X0RA 1FX1A 2VBFA 1X7ZA 3P0IA 4H08A 3RSZA 3OIYA 5J2TB 1FEZA 4KWCA 5D7NA 2WMNB 7REQA 3CXRA 2C2MA 1UBCA 1SBIA 3A0UA 1M2KA 4WY5A 3DAGA 4FMPA 2WU1A 2G72A 4UM9B 3RGWS 4ZYLA 2J0QA 4CF4A 3V7NA 1IIBA 4JR1A 4M0MA 3HH8A 5AQ1A 1L5MA 4QELA 1X7DA 2C94A 3OEWA 1UKAA 4Y9RA 4BMCA 1R0BA 2JBAA 3B1YA 1SBQA 2B2NA 2CGEA 3INGA 3EWNA 3JQ8B 3QUAA 3SX0A 3VX4A 4E3WA 2EATA 5CPBA 3KYCB 4GRAA 4G5OA 5CDFA 5BWNA 4CMIB 1A9PA 2EL9A 3JQCA 2ZYTX 3O93A 3KT0A 1AMOA 2ZQYA 2ZUVA 4EO4A 4JDPA 2VF4X 2JFHA 2DFDA 2YOGA 1XQ6A 1VMIA 2VT6A 1D07A 2QN2A 4P2BA 5DCYA 4BXOB 5A1JA 2E3JA 3HWX1 1JHXA 3C6MA 3ONVA 3QIAA 3TAHA 2XVZA 1BEUB 1R37A 2RH4A 4K88A 4H1VA 4JI6B 2MSKA 2O2JA 4RKFA 5A4JA 4J0JA 3MT0A 3D4OA 3DE1X 3OCWA 2G7ZA 3TDMA 4EVIA 4C4ZA 3K96A 5CA1B 4KR9A 5IF3A 2V9CA 2NU8B 4KKVA 5I8WA 4JI7B 4ZC1A 5F3DA 2FPWA 3EDRA 2VF7A 2JJ2D 1CS0B 5CT5A 1GQFA 5EKTA 3TUJC 4TN5A 1FDOA 3VNBA 4YP5A 3H19A 2ESRA 5BOSA 4G5GA 1RYEA 2C97A 3HB5X 2O7RA 4ZQIA 1CDOA 3AG6A 4TX1A 3SFZA 3DD1A 1UL1X 4NICA 1A5SB 5E3JA 4C0HA 4WIAA 1A9YA 3EZLA 5A2GA 4JXXA 1OC4A 1RHRA 3MAAC 3N07A 1I2DA 3NJ8A 4Y9TA 5LZ7A 3WGOA 4WV3A 2YFQA 1QKJA 5CX1B 4G0YA 1UMDB 1HDIA 1WDLA 4P5PA 5BN5B 5T3YA 4D74A 2HLHA 4UTPA 1HH4A 3E4DA 1QCCA 4K03A 4CFZA 2HHJA 3W9UA 3SBXA 1W46A 5FUMA 3S1AA 3EQ7A 1BGWA 3C6QA 3G17A 1W6RA 2O0MA 2WSYB 3L93A 3VPCA 1TJNA 2F3QA 3BIJA 2HLNA 3IUEA 3NHLA 1KY4A 4F5WA 3W5CA 1FDUA 3BXEA 3NJRA 3QEJA 3QI2A 4YDSA 4GOXA 1V8ZA 1VKRA 2ONCA 2Y3IA 1HY3A 4LSZA 3PXUA 2OGUA 4B82A 4PN7A 1I2CA 1WMDA 4C43A 3P2JA 1PS9A 2OC4A 3BS4A 1FQJA 2OAQ1 4IQFA 4MYTA 4PTYA 4PIVA 4DLAA 4TKMA 5HBGA 5K8LA 2DLCX 1IEWA 4Z5XA 5TMEA 2AD5A 5BWLA 2FSVC 1CJCA 4MGHA 1ZD5A 4XR4A 3LCJA 5DFAA 1RYHA 5EN4A 2J45A 2IX3A 2I3DA 3KJHA 4JROA 2I22A 4V02A 4LF8B 1XBTA 3SE0A 2ZTLA 1RLMA 1T1RA 3PKIA 4HAYA 4OL9A 3TD2A 5GGXA 2PRKA 4IO0A 3X1XA 1V95A 5EJAA 4DR1B 2RIRA 1IVYA 1YCFA 3KZVA 5DYNA 3TSWA 4AVYA 3EAQA 1OTYA 5LP1A 3K30A 3WBFA 1IEVA 5K6AC 1NLFA 1DMSA 4MV4A 5IDVA 5IP5A 1VSVA 1X14A 3DCIA 3OCUA 1TF5A 4EHBA 5EP4A 2G06A 1XYVA 3BE5A 3F71A 2NP7A 1M75A 4P3YA 2AB0A 4LECA 3UWPA 3OLCX 5NULA 4A8JC 4AUMA 1DAKA 3V32A 4OB7A 5ICCA 1ZITA 1J0EA 3GFRA 4XVQA 4C2BA 3H8SA 3HSYA 3KVNA 4MKFA 3RTCA 4LF6B 1M2EA 2ZBQA 4QL3A 2IHUA 9ABPA 1FYDA 5SY9A 4KFSA 4MLPA 4C4YA 3RC8A 2HPHA 4O3FA 3SD7A 1R4NA 3C8UA 3H5WA 3MA0A 4ENRA 1EGHA 1TC2A 2IEDA 2IY9A 3VH3A 3JAWA 4BNDB 3LHSA 5AHWA 3R5JA 2P3OA 4YP6A 3NWEA 5TJ9A 3DCJA 3GGOA 3P2YA 4HDSA 3TJZA 3TZ6A 4UHCA 4HI0E 3UW3A 4NZ9A 4PHGA 4QDXA 4HV4A 1O58A 1Q0ZA 3Q8WA 4V1CB 3N6VA 1Z5NA 4CDRA 1VYUA 5H82A 2C98A 4JXKA 3K2EA 1DRUA 2YYZA 3MJCA 3QF7A 5AMXA 5IUJC 3KQPA 2EZ4A 2R4UA 3GNQA 4KQGA 4CM3A 1YKGA 3TQFA 1U0RA 1XQYA 2D59A 4W9RA 3I23A 1LF0A 2BGMA 3ABQB 2R9VA 3DDNA 5CXSA 5KSWB 1LD3A 1TUBA 2I2AA 3FCXA 1KWGA 4Q0MA 1E1CB 1YFJA 3NU1A 4G67A 1GNSA 4CKEA 2AKEA 3FOCA 3HUFA 4ALMA 2HWUA 4IUBS 5IS2A 1HE8B 4XYEA 1HYQA 2WKPA 5K0BA 3O9MA 4QM6A 4EVRA 8GPBA 1YR7A 2QVZX 2V0CA 2EERA 4J4BA 1O95D 1D7AA 1QZUA 1YR1A 3DWIA 3PYMA 3VOTA 4KVZA 2RB4A 4ARSA 5KTYA 4TYQA 5TMPA 2JGLA 3U09A 1PX2A 3WDSA 1U99A 1H3NA 5BRJA 5GTDA 3IE1A 2CHUA 3B9QA 3DL4A 3K8QA 3W3AA 1E4EA 3BD7A 3K0FB 2Q6OA 3K2BA 4W5NA 3IAHA 2EF0A 3GGCA 4RAOA 1JAYA 2FW0A 1JA0A 2F6RA 2WHRA 4D4MA 1DFIA 1OFVA 1QX3A 1DQZA 3A6KA 2HFKA 4YV7A 3IA2A 1FZTA 1B2RA 4Z6KA 3BPSA 1A9XA 5E8JA 2VWGA 3MMPA 3RSOA 4DMMA 2VT7A 2FHPA 1DBVO 2H7CA 3A4VA 3DC2A 1PLLA 5KNCD 3N86A 2PL1A 4OBEA 1OTXA 4MJXA 1M8PA 4BEBA 1Z6YA 1E94E 4MUMA 2VSNA 3OC0A 5AKHA 3B2QA 1SHZA 2IZ7A 3KPVA 4R01A 2FG5A 3TW4A 3U62A 3UW1A 2IWHA 2F1KA 2VNAA 2QR5A 3ZDZB 2GZ3A 2X58A 2GYUA 5BQPA 2GCOA 4PCUA 1ZISA 1VJ5A 1A5BB 3VO1A 4JFRA 4AF6A 1GTG1 3V7WA 1D4OA 5AHKA 1TYZA 2IF2A 2OM6A 3ZZ1A 3HO1A 1K5HA 1RXIA 2I80A 3C6ZA 3KFVA 4Q3KA 4H3SA 3EF0A 3FDFA 3TH5A 1IN6A 4WASA 4A6XA 1QQBA 1HRKA 3R09A 3TI7A 2AI1A 1TM5E 4MS3A 5JEDA 1G7TA 1O4VA 2B78A 4ZOBA 1U3FA 1Z12A 4BO8A 2GHQA 4TZ6A 1QZTA 4ND7A 4KUHA 3QJYA 4FNMA 1DIOB 1L9XA 2BDUA 2I54A 2JEZA 1G6HA 3DEHA 3F4BA 3OEHA 4JB0A 3AG5A 2DR0A 4EY4A 1IXSB 1ADYA 1DB3A 4E31A 1DCTA 3WLEA 4RJTA 1OAAA 1HDYA 2BZGA 1P0FA 2FPLA 3EISA 5JEEA 3U61B 3OTHA 1V9CA 1SXPA 4MVJD 2NP6A 3R44A 4C21A 2AZ4A 5KOIA 4R0NA 2QY9A 5B7NA 4AJ1A 1EFCA 3PXEA 1E8NA 1UWCA 1JT9A 1XEWX 2AD1A 4H3HB 3VR1A 4C78A 4BAUA 3CV3A 4CXMA 4C1NA 3FGPA 1WKCA 3W4IA 1Y7PA 1Z37A 1P6UA 3FF4A 2EFJA 3ONWA 1CE8B 3WGZA 4YLYA 3DZ8A 5GONA 3EXHB 2DT8A 3CUTA 4OXYA 1MAAA 5AVRA 1AQUA 3WG9A 4AX4A 1VZ3A 5EIOA 5LVAA 1P9RA 1W4ZA 3BMQB 1VDMA 2ZJ2A 4UQPA 1E2GA 4ZT4A 3SSOA 2AV6A 2OUIA 3VR3D 5F52A 2IEAA 1NBHA 1SIOA 1CIPA 1ZRHA 2PV0A 2QXYA 5JFTA 4LWPA 2NX2A 4WDQA 4YP1A 1UPTA 2AVDA 3L0IB 2AR9A 3TRHA 3FSGA 4XXHA 5JH7B 2K2QB 2ZE8A 1KSHA 2YWFA 4CGZA 3Q7PA 1AT1A 5HMLA 2X4GA 1EP1B 3EY9A 2CXTA 1FXWA 1O0CA 3U56A 2BKUA 2AQ8A 3A2MA 4D9KA 4M4SA 2QBYA 1OGYA 1LZKA 3DCYA 4R0VA 3RIXA 1KSFX 4GG1A 1RRFA 4CVNA 2IODA 1YHNA 2FB9A 4MW2A 2IWRA 1JTVA 2D4AA 5JTUA 1S8NA 1ZPDA 4GLJA 3E84A 5G02A 2OV6A 4TLLB 4WN3A 5HFJA 2PYDA 2AQIA 3E9ZA 4RGQA 3R8XA 4PAOA 1RR6A 5FI5A 1GV1A 4DCUA 4DQXA 3LLSA 5HILA 2W2TA 4YRNA 3GEIA 5I8ZA 5C2JB 5I7WA 3FCAA 4YMVA 3IBFA 1EXWA 2I2WA 3M6AA 3RFFA 4X64B 1RKUA 4FQ5A 1U0SY 2W42A 2HZBA 5J59A 2OSVA 1X15A 2CMFA 3ZGXA 3KG2A 2V1XA 4RJIA 2Z5VA 3ITKA 3KXKA 2WTEA 2CYAA 3T7IA 3ZE8A 1JSRA 2XD9A 1M0TA 4B3HA 2X13A 9LDBA 2YNMA 2B9VA 4TTPA 2NGRA 4DA8A 3O38A 1XU7A 5TEWA 3K0KA 1E63A 1M1YE 3FCSB 4GZLA 3QVJA 1Z4PX 3S0JA 3H2ZA 3V4RA 1QGOA 3RC9A 1PZGA 2FW8A 4KXYA 3OE4A 1QO0D 4P81A 4A3SA 3G7UA 5BQFA 3L5OA 5ADHA 3WK4A 2DPGA 1TFUA 3DT8A 3EX7C 3C74A 3KLOA 1G2PA 4TKZA 1E9SA 2HWXA 4IV5A 3ZTWA 4P1ZA 1QHHA 4C0LA 1RP7A 2XW6A 3VJLA 4N47A 1XMPA 4KR3A 3Q0IA 3PFCA 2PEYA 3EVCA 4G41A 3D5TA 1CUEA 4WBSA 4FWTA 1LFAA 1MABA 1YRYE 3F9RA 4HWTA 1G19A 4YCBA 3QI7A 1TCAA 2PFSA 3G5UA 1YR9A 4FOPA 2OZPA 4PWZA 5LZ4A 2RHHA 3PFHA 4TTRA 2C31A 5EJGA 3RBXA 2YY6A 3NT4A 3DP7A 4HDRB 1UBHS 3S1LA 4I3GA 4L08A 3E82A 2MIIA 4DJ5X 1TQ8A 3SYKA 2R5WA 1U7DA 2PBRA 4KH0A 2OBFA 1SVMA 4PXAA 2YJ4A 1E5QA 1U80A 2NZXA 4TV8B 4D3DA 2P2DA 1UCFA 3IQHX 1SZDA 4MR9A 3VPFA 4QGBA 1B93A 2OCBA 4G8CA 4L7QA 3PXCX 4TWJA 4XRGA 1WBDA 2V1UA 4IIJB 3Q3JB 1A69A 2YR0A 4CN8A 3WRVA 1FRVA 3KOWA 3OHSX 3M6FA 5JAQA 5B6IA 2BTEA 2CE2X 2VNSA 2YIVX 2AXEA 4AECA 2I7VA 2EBHX 2CZCA 1DQSA 3BFJA 5IJWA 4XWYA 4WGGA 2I9KA 2WU8A 3P94A 4L0QA 3OZCA 3TTTA 3FN4A 3G5MA 1TIKA 4FD2A 1H4VB 4FONA 1K06A 2CD9A 1QRDA 5DYYA 3OT1A 5CDFE 5D1HA 3D2CA 3TBKA 3ZNOA 3G0IA 2AMJA 3U39A 3AC0A 3O8DA 4ZO6A 1T1SA 3NTRA 2VXCA 4HZUA 4IDAA 1ORHA 1WV1A 2Z1NA 4PS1A 6REQA 1Q3HA 1P80A 3PD1A 2QYSA 1KZYC 1YUMA 5JO0A 3H11A 1C80A 4MIEA 3TW8B 5IYZB 4C2AA 2YXDA 5AK5A 1NMYA 4E0BA 1ESNA 1HL7A 3CX7A 3NNNA 2QT0A 2WV9A 1R0YA 3ODGA 4GKKB 3IP8A 4QPDA 4FDLA 3L2OB 5FJIA 2P8JA 5I9MA 3UG7A 1E4OA 3M81A 2LUOA 4GR4A 3FHCB 121PA 1L4BA 4M60A 4DADA 4XCVA 5B57C 1XZNA 2Q4RA 4C07A 5BSHA 2GAAA 3W90A 3KKMA 4B6EA 2RAFA 3UXYA 1E7SA 3GZNB 3E5HA 3N0VA 4RVCA 3EPJA 3VPDA 4ENTA 3NBZC 2FWBA 3A6JA 4JOCA 2F1RA 2GM5A 2QW0X 1DX4A 4MIKA 4GECA 1RXYA 3GAFA 4EPTA 2DR2A 1KMQA 1A95A 1ZCJA 3DE4X 4YRRA 1IQPA 1K3FA 3FLAA 3BD8A 4GSLA 2UV8A 2DH6A 4R1MA 1W7AA 3KSDO 4IFIA 4H6PA 2JCXA 1E69A 5G0WA 5BWMA 1IBSA 1X92A 1GFIA 2BDEA 3S29A 3WISA 1QQ5A 1JIUA 1XZQA 4O1HA 4FFDA 3TSAA 4YGXB 1M5RA 2FUNB 3SR0A 4BNNA 3WI7A 1NASA 2I6SA 3FPFA 1SELA 3PPVA 1YQEA 5D00A 1PJTA 4CIBA 2VPIA 2GASA 1EFRD 2COKA 3I5MA 4JUFA 4OFXA 4RQTA 4EVQA 5FOQA 4A82A 3U4MA 1U28C 3FPEA 3TK1A 3CJQA 4KKXB 4BGIA 2OZVA 5IBQA 2A8YA 4QA9A 3KHUA 1IUOA 4RMJA 5DBIA 2I2CA 2C9CA 1VMAA 3HB1A 4EB3A 4DWOA 3R23A 5CFMA 5JXJA 3FNEA 1RQ2A 2ZWAA 4XDGA 1Z7BA 3KYIB 1LJ8A 1RC0A 3VH1A 4BBAA 2FPPA 1TUIA 3AZQA 4ZO8A 4DVJA 4FUTA 3K4HA 5FWAA 4DF3A 5IXJA 2YS6A 3T9BA 1G98A 4RFSA 1Z5UA 4Z9FA 2X3FA 2ZJ8A 1HURA 4LN1A 3GCDA 1K88A 5CAEB 2GPTA 4GX1A 4MRVA 1Q6ZA 4L5JA 4DJEC 5TLSA 2FJUA 3VDQA 1K08A 5BSRA 1TCVA 1NKVA 1P1BA 1Q84A 3KELA 2VYND 3PHCA 4G97A 4F5DA 4MYRA 3F90A 3LBHA 3WMGA 4A10A 2DQ4A 1O4WA 1RZRD 3QE0A 4FEYA 1SD5A 1W5TA 3PJEA 4X1IA 4CF6A 2GO7A 2VG8A 2H4YA 1JDBC 2ATVA 4K6CA 2RGRA 4M36A 1CQIB 4BP1A 4LW8A 1JKIA 2C9DA 2QU8A 4CBVA 1NVBA 4A2CA 5KWVA 3VC3A 4DLXA 4IHKA 1W2WB 3SKXA 4ZAFA 2EX1A 1Q77A 3Q98A 3ESZA 2I7TA 1T5SA 4D6YA 1ESEA 1A8IA 2VXOA 3GY0A 3I9FA 2VHWA 2DE0X 3N7AA 4IR7A 4QRHA 2C2GA 3RWMB 1ISPA 5IBCA 2QRQA 3PC7A 3A27A 4I5GA 1JP7A 2G6TA 1GTL1 2W37A 4ARZA 5DIZA 5IXYA 1GL7A 1ADFA 3MCAA 3NIWA 5A3SA 3FXAA 2CCKA 3DZIA 1WCIB 3I52A 3AEUB 3D3QA 5A3RA 1L5RA 4PQFA 5EWMA 2PZAA 5BVHA 1KYIA 1NSYA 2C4MA 2RGEA 3HA3A 4GOLD 2YMMA 1WX1A 1LC0A 1YA4A 4EPYA 1M2HA 3P32A 2ORVA 4UEOA 1O96A 3PFFA 2WFAA 3QVWA 4HRVA 5EI5A 2PZKA 4ZI2A 4BV2A 4N0MA 1QUFA 4O4HB 2JKYA 4PE5B 5LN1A 1JFTA 1DRVA 4ZJPA 1MHTA 1FP1D 2GYWA 1RHUA 1NNSA 4W7SA 5DHFA 4EI8A 1JQEA 1KU0A 4LJ9A 5AHOA 2QGFA 3P97A 2YYYA 1FNBA 4OKIA 5FYQA 1RS0A 1Z28A 8ABPA 1ZGJA 3G89A 3OT5A 4RZ2A 4TXNA 1QIJA 4EMBA 1X74A 3Q8KA 4HNTA 4XVRA 2NTVA 1R2QA 3OLQA 4LGVA 4UEWA 3WL6A 3QXSA 5B64A 1PT7A 2VSQA 2BFNA 4MS4A 3ETGA 2D4HA 2H4FA 4Y2TA 1XLUA 4BEJA 1EUCB 3UHFA 2ZJ6A 2BR5A 3FTDA 1OT3A 1VLVA 2B9EA 2R8RA 2YIMA 3KNZA 3GJSA 3OSUA 4BAZA 4DC9A 5HQTA 5CNJA 4GEKA 5FORA 3WK8A 1R0XA 2H52A 4YAUA 1E2BA 5F1YA 3OE7D 1E6EA 2H9YA 3IOEA 1Z75A 2FF5A 3LBAA 1QMGA 3L8ZA 4BBZA 2V5UA 3D54D 1N7JA 4XSVA 4AKEA 4MVJF 4JI4B 4IQGA 1VGRA 3UHJA 1TLLA 4B6RA 3REFA 1KI7A 1OIXA 1TYCA 3EUAA 4J2OA 3VM6A 4J0QA 4AKIA 2XAAA 4S04A 1GQ2A 5F77A 3SS9X 5P8WA 2C58A 3PB3A 2BEJA 1U2RA 4M0KA 5BWBA 3PDHA 1KAEA 1WXDA 5AW5A 4K87A 5DX0A 5H1YA 1S8AA 2CXNA 2ASVA 2JDIA 2KJQA 1JR3A 5BYKA 3TM4A 4FCCA 4I3FA 2IYAA 4AO8A 4C4PA 4HNVA 2CFTA 4K8OA 2FN7A 5DHSA 2ORWA 3FWPA 3AGQA 4S0ZA 2G0NA 3CXUA 5CA0A 1N4DA 1E1QD 1RHJA 4QDJA 5KJ6A 2J0EA 3K1AB 3CLVA 5LXTA 1WB9A 1ADBA 1SBNE 3VYTB 2JLXA 1P5FA 1P60A 3IJEB 4DC1A 1NU8A 1RWPA 3EAFA 1Z13A 3HJAA 3PRYA 4HZIA 3TVDA 1NSTA 4CM6A 4DCTA 3DMTA 1MOZA 1M10A 2N47A 4UTZA 2JATA 4INJA 4S24A 4V24A 1YC2A 4OLHA 3SJUA 3KKNA 4YUVA 4COOA 3PQFA 5EHNA 1ZN8A 2I1VB 1HC7A 2GK4A 4B3XA 1V3QE 2VJDA 4BV9A 1NVWQ 4FMCF 3VR4H 1EBUA 1T4MA 1VLMA 1AY0A 1G55A 2H59A 2O2GA 2RGYA 3JZIA 4G0ZA 2YWDA 3EG9B 1A72A 4J0KA 4R7TA 3CLRC 1TKCA 4BE7B 5KTSA 1IU9A 4M1ZA 2O8DB 4MA0A 3SZUA 2HNBA 4I50A 4KO1S 3MHTA 3TSYA 1K5GA 5EY5B 4YO8A 1BAPA 2NXNA 2IA5A 2H85A 3Q9NA 4FHEA 1N6LA 2Q8NA 5JPCA 4TZ0A 3Q3EA 4KSCA 1RZ3A 5EAIA 4K8RB 3MTEA 4B45A 2GJAA 2ZRBA 1NIPA 1O0SA 1SIWA 1XVVA 2KS6A 3O7MA 1UMKA 4G8BA 5C7LO 4U7DA 4KBGA 2VTBB 1Z4QA 1F20A 2V3VA 2VVTA 3FHTA 5KQPA 1R4AA 2H1IA 4FPXA 3R7BA 4PX2A 3FF1A 1XVUA 4MRAA 1QRTA 4P0PB 1H2AS 3A37A 1UBKS 5K2OA 3NM6B 5EJ9A 2R87A 2JGFA 1V1MB 1EVYA 2ZATA 1O1YA 2IXTA 1WPXA 2P79A 3AUUA 4F11A 3K3PA 4CEHB 4DYHA 1U0GA 2MMGA 5L95A 3O8QA 4C7JA 1YWGO 2DQSA 4EEXA 1BVRA 4YUWA 2ZT7A 4D8VA 1W5FA 2NO4A 1TTQB 2UUOA 2YWHA 4PYOA 5HJ2A 1YHZA 2A3RA 4TKVB 2IV2X 4UTRA 2PX0A 2A0KA 3OEEA 5KTKA 1A2BA 4EO7A 2Z43A 1TJYA 2UZAA 3R77A 1X1QA 3E58A 2PUTA 4LRQA 5LP6C 1OLSA 3VR6A 4C0BA 4D79A 2J0VA 1QE0A 2K5UA 1C30B 2Q50A 2P3LA 2VJOA 3F46A 3KUXA 4PBRA 4EWLA 1V0JA 2C5FA 4WNIA 4DT1A 3L1JA 4BRSA 4K6GA 5A9TA 2VJAA 4BMOB 2RAUA 5KYXA 2ILVA 1RJ9A 1I3CA 4L8LA 2X5XA 1U1CA 1TRKA 2GZ2A 2B7LA 4HTFA 3UANA 2OGTA 4PLGA 1TCCA 2QTRA 2DUUA 1V9LA 3KVYA 4QOGA 3U1VA 1I1OA 3QG5A 3RF7A 4BC1A 2JLAA 1R6TA 3PNQA 4QREA 4JCOA 1X0VA 2I66A 4PHHA 4P8RA 4RK7A 4JVNA 3ITDA 1Y3IA 4Q1BA 2IBTA 3WFIA 1E3IA 1SPBS 2E89A 4UBKA 2C0QA 1YRAA 2WZCA 5FA5A 4TYYA 3IP7A 3NHPA 4MAAA 3ICQB 2NV2B 1L5LA 3RJ5A 2PJUA 5DI9A 2O5VA 5C31A 4JITA 4NAHA 3K09A 1XMJA 3DFZA 1J20A 1QGYA 3AFHA 3D4NA 3FOAA 3E0XA 4Q3LA 5TPZA 1GU1A 3QYJA 4L4ZA 2PSEA 5M34A 2QRNA 5CM8B 1QFZA 2Q1SA 1DEHA 2VK2A 1QNFA 4H17A 4ZWNA 3BJEA 3STUA 2V6FA 2FP4B 5JQGF 1FFDA 2C3MA 4G5RA 1T0HB 4HGPA 5PGMA 3WL7A 3WMWA 4COKA 2Q8PA 3TG2A 4G26A 1OBHA 1U4OA 3R7FA 2ZPUA 1GZ5A 2VAVA 4C7OB 4URFA 3E9MA 1JDZA 1GZHB 4DLYA 1HG1A 5MN5A 3L4KA 1Z17A 4RA6A 1ZIDA 4JQCA 5FNZA 2O3RA 3B60A 1XPOA 5K0ZA 3RJ9A 4FB5A 2JFBA 2F55A 4EUNA 3N39C 2QTWB 5JR3A 1Q0QA 2OORC 4C20A 5JRJA 2M1XA 1II8B 1XTZA 2GWRA 2DFLA 2P9GA 4NBRA 4DYDA 2QTMA 3NBQA 1WXQA 2WJGA 1WSDA 3JASB 5LD2B 3ZGVA 3SMVA 3IL2A 3BBLA 4MA4A 3T1HB 1W25A 1CXZA 3VUFA 2R96A 2R8OA 3KKLA 4X61A 3KO8A 5KB3A 2J5BA 5COQA 3HP4A 2GBGA 3T9CA 5AXBA 1U5BB 3GGDA 3GUHA 4RACA 3BYZA 3VC7A 1P2BA 4H6XA 4R81A 1OPXA 4RPCA 1RBYA 3ZQ4A 3L07A 2PNJA 2WJ3A 1JJ7A 4YJGB 4LZNA 2B37A 2Z2XA 1UXHA 5F21A 4URVR 1THMA 2WSIA 3LUHA 2CVPA 3R4VA 4P31A 1NLZA 2V8BA 2J7PA 5AKZA 1BXZA 2WTAA 3G0OA 1G5PA 2Z9CA 4YJ3B 4UOQA 3B3GA 4YMHA 3EHEA 5I9IA 1LEHA 1L7EA 2J41A 5DNEA 3WKAA 4P4TA 1PQUA 2E48A 2A9OA 1IYZA 1AZSC 1P77A 2IPNA 1JG3A 2JH8A 2YASA 4QT0A 5IJXA 2ZSUA 5IT5A 4WPGA 3ROGA 2R6CA 1MXFA 3D7KA 1NW4A 4MV1A 3KQUA 2JLUA 4LZPA 2ZWVA 1VMKA 4M9UA 4PLZA 4YMWA 4DV7B 1VBNA 4NZOA 1KTIA 1CFJA 2CBZA 1I6MA 2REBA 4G1VA 4M0LA 4QDZA 3HV0A 4KGXA 5G53C 3SZMA 4EF4A 1SVWA 1YV9A 2WIJA 3COVA 3MXTA 3DDHA 4L5CA 2PJRA 2ZSHA 3P9ZA 1M7GA 1SCAA 1JQJC 2JGIA 4R83A 3UUWA 3MMNA 2FGKA 3I5AA 3BA1A 4DUPA 3KQNA 3GLTA 2OHFA 4MLZA 3H17A 3HCBA 4QYIB 2FN8A 2KE5A 2ZYAA 3RFUA 4YMUA 5BNWA 1UXGA 5EKSA 4PQEA 3WTCA 1CDEA 1HF3A 1GUBA 2F1OA 2HSDA 2IEZA 2OXCA 1ZIPA 4G0QA 4RMNA 2IY8A 5CVJA 3NKVA 3RU2A 4ZZ1A 1J6UA 4IUDS 3HEMA 2AZDA 3IEKA 1EVKA 2PA3A 2X86A 3GELA 4HDCA 4WT7A 3JWHA 2HF8A 2ZDGA 2E9SA 4Y1GA 3UQYS 1W0JD 2ZTUA 4NDAA 3V8NA 4EFDA 3A4MA 3EVGA 3QITA 2F3SA 3AL3A 3V42A 1DAEA 1NQTA 3EIHA 1QIKA 2JCYA 2J3LA 5JCOC 3LL4A 5BW6B 3RS7A 1CUGA 1ZMRA 1JE1A 4FGSA 4HAZA 4MV9A 5KKNB 3G23A 1SXJB 2E4UA 1RXWA 3OPMA 3TGPA 4DDHA 3EIUA 3EFOB 3JYOA 3C3DA 2GVDC 1EIWA 2JZCA 5FBVB 2Q5QA 2XQGA 3WGMA 3H2GA 2ZYRA 1XC7A 4KXLA 5LQJA 3KU1A 2FUG1 4MX8A 1D0SA 4OIFA 5JAHA 1J5EB 4BASA 5IC4A 1FDIA 3W9YA 1HDCA 1DLIA 1QFJA 3FDXA 2CLEB 4OMDA 3ZWMA 3NVMB 6AT1A 2D74A 1ZGAA 2GETA 5GOZA 3ZCUA 3W5BA 4DV5B 2XUAA 1CD5A 2JVJA 3GRKA 3KTOA 1NURA 2XRMA 3GJ6A 3STWA 1JSZA 4Y0NA 4HGRA 1C4OA 1C3EA 4J2HA 1P6XA 3O26A 5TMDA 5ESDA 3KYDB 2IIBA 2R0QC 1WUJS 4B6GA 4DNPA 4OL0A 3KHKA 2XGMA 3L6BA 1WF3A 3K05A 3T4UA 2CW5A 3MJVA 4JBWA 3LY7A 1PD1A 1TA4A 5EXPA 3NDBB 5A9SB 1B42A 1PW5A 2F2TA 5DHAA 5LQCA 4W9MC 1CUXA 1YVEI 3IQDB 1PKXA 4LXQA 2IU3A 4B3FX 2C5SA 3S2SA 4DBLE 1X7WA 2DULA 2BFCA 4ZQFA 3SSNA 4MHTA 4BN5A 4QODA 4PYNA 1CY7A 4HWRA 3AVOA 2OXFA 4HH1A 3P2IA 1MKYA 2CXOA 1XRSB 5DTMA 1DEAA 2WD7B 1K7SN 4G56A 2OLKA 1I3LA 1Y5LA 2IYRA 1JVBA 3QXHA 2HF9A 4GUDA 4DDWA 4MMYB 2BFFA 3D64A 3ETHA 3JW8A 4MK4A 2C04A 4CG0A 2QD3A 3EIFA 2B0CA 3BICA 3BZBA 4LTNA 3R5FA 2VSXA 2WQ7A 2PZMA 4NYIR 1NDQA 2AOUA 2C7GA 2SHKA 3H9UA 3BQNB 3CMMA 4G6ZA 2QP9X 4ME6A 5FPPA 3UOGA 2QRHA 1PJAA 2ODBA 3G82C 2QRJA 3BGSA 1VHDA 3EMVA 3OPVA 4ZOQI 5IJ0B 1KQOA 1SULA 4X63A 4BNTA 4M53A 2NPOA 3KXPA 4OM8A 3LDUA 4QGAA 4H6VA 1ACMA 1JPUA 2FPIA 4AI6A 2ZZKA 3UMBA 1AUPA 2QJOA 3DTYA 5AO9A 5KJFA 4RUKA 4CTMA 4IDPA 4Z51A 2FI1A 1DWQA 2AG8A 4B32A 4PFJA 3MS7A 4R3WA 3OU6A 4PLWA 2XSZA 4OHOA 3CKLA 1G42A 2QUKA 4BNUA 4F4JA 3JZDA 5AIAA 4GNKA 1Z6TA 3OQIB 5HP4A 2O4UX 2CL6X 4U5QA 1G3QA 3PI6A 3WGVA 2GHRA 2RHDA 4FYJA 4RCYA 2YV2A 4NS4A 1QCDA 5HKKA 4GC9A 5LJLA 5JZSA 1R64A 4UBLA 5L53A 2PD4A 1P2VA 4ZVPA 5HIIA 1UK9A 3JZFA 5EZYA 5FO1A 3RE1A 4BP9A 5ICMA 4HQOA 4Q7JB 9ATCA 3F3SA 2GN9A 1J42A 2XOEA 4CV3A 1NBMA 1ZM7A 2HADA 3IXMA 3A2LA 2PO7A 2R47A 3DEYX 1OUMA 1OXBB 2CLKB 4GLBA 4QBGB 3ZUGA 3O2JA 4C3ZA 2FWMX 2QAJA 4S1OA 1JR3E 1O9GA 4TMFA 4B34A 4I0WB 1VPDA 2NO7A 3QLJA 3O9VA 3O95A 1D04A 3GXOA 2OV3A 5LXTF 4QTYA 3ICEA 2Q3HA 1W85B 2QXUA 1M6NA 3P96A 1AIPA 2PU7A 2F48A 3C7TA 4Q1EA 3PGXA 1HYEA 3W06A 2PX5A 4Q9JA 4LCBA 4A0HA 5C52B 5CDSA 3OTQA 4XOIA 2IXAA 3TKLA 1QYDA 2W2XA 1KMHB 3WSVA 2CV2A 3GNSA 5F4BA 2EWWA 1SXHA 2ID7A 2P9BA 3NRCA 3UTCA 4CNBA 2DKFA 1DLJA 1JEQA 3D6UA 3LVRE 3PFIA 3RRFA 2VP5A 2ZRMA 1ZRMA 1E79D 2RK4A 3DDSA 3VMFA 3ZDQA 4BNIA 3FRHA 3CF2A 5ESXA 4D0RA 4DM4A 3A10A 3ITEA 2UYOA 3UCFA 3GP5A 5FLYA 1LS1A 2EFGA 2GTPA 3MC1A 4DABA 3OSZA 3LCRA 2VAWA 5EIXA 2YXNA 4AJNA 3KLBA 5T4FA 1EDOA 1MF7A 2F9LA 1XZDA 4KN6A 2VBIA 5JO9A 1JU4A 1C1XA 1N8NA 3E9CA 3L6UA 3MN1A 3PBKA 1JG2A 1U9YA 3LYUA 4MGIR 4J16A 1EZZA 1Q14A 2X9LA 3KYCA 1M54A 4OQMA 1P9NA 3WBBA 2D7JA 2HW8A 4RF5A 3TZQA 4CMIA 1ZD4A 1JR4A 1P2SA 1CP3A 3NS7A 2QX9A 3EW7A 3G0CA 3MWGA 2OVFA 2F43B 5FUQA 3GLGB 1XLTC 2J07A 2PGXA 4MB6A 3N2EA 2FW6A 4E5PA 3I9JA 2ZKLA 4C14A 1W0KD 4F9TA 1E2NA 1U02A 4FFNA 4F86A 1O8BA 5IFKA 3GUYA 4FFRA 1FQKA 1GU7A 2W11A 4D3SA 5H16A 4B83A 2YHAA 4Q37A 3U44A 1YZLA 2WJPA 1GL3A 3ABOB 4JI3B 5CA1A 3CF4A 1M66A 1RJEA 3B6IA 2IITA 3LGXA 4GIBA 4UM9D 5SICE 2NU8A 4KXNA 2QRKA 5DNUA 4R16A 3DL2A 1FRQA 1NIJA 2OYSA 2XGSA 3W2FA 5D5PA 1CS0A 2JJ1A 4HSEA 4B5LA 5C7YA 4OK5A 3OIGA 5FBKA 1YXMA 3F74A 3VKGA 3ICCA 1ZUD1 1FFSA 2PRSA 1YJCA 1NZFA 4KWIA 3TZEA 4TMKA 1B74A 2EQAA 5HK9A 2SKCA 3LGSA 1Y9DA 2J33A 1E8DA 2TMYA 3N75A 3AHHA 3LX4A 4XDZA 3EMBA 4BKOA 1ZHHA 2Q4EA 4UJ3A 4NSNA 4DDUA 1JRLA 2FZCA 4BDTA 2DERA 4MCJA 1ZL0A 2EFYA 4WFKA 4TYWA 3B1ZA 2WWXA 5CX1A 5BN5A 1UMDA 3UUGA 3SWWA 3BRQA 4MVXA 4NPHA 4E3ZA 4CKCB 3MCWA 1AG9A 1YBVA 2W93A 4QLOA 4B79A 5GADl 1CPYA 2HPZA 1R5NA 3LCMA 2PEZA 5KREA 3N9IA 3ZBPA 4LNUA 2PTHA 1WQ3A 4MDFA 4PYRA 2A7QA 4DV2B 3PGMA 1NW7A 3OI7A 3G49A 4ISCA 4ZYTA 1IMJA 1FDTA 4Z8YA 3ZU5A 1W6UA 2XCOA 4JJAA 5FV7A 5MFZA 4GR5A 2H6EA 5FDFA 2WJAA 4KQ9A 1LDGA 3E3MA 2YY5A 1GZ7A 1UP4A 1VHQA 2ZJ5A 2IW3A 1PNQA 3SJCA 4L16A 2YICA 3IEVA 1ZHFA 2YY7A 2G70A 3KJQA 1DUSA 3C87A 1PDOA 4ER6A 2J6BA 3NQ41 1SD2A 2CVQA 1II0A 2IYFA 3AM5A 4CDMA 5DXAA 1SEVA 3DVQX 4B4VA 3B1F