1XQXA

Crystal structure of f1-mutant s105a complex with pck
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSAYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 104
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xqxA00
2XUQA 3B3QA 1QIGA 2FX5A 3G0DA 4GLBA 3IVMA 2QMQA 2DFPA 4UHBA 3OPMA 5DNWA 3DOIA 4IH4A 2H9YA 3VKFA 3OTQA 1DQZA 3WKCA 2ES4A 2BGRA 3NUZA 5ALFA 1R4ZA 5EFZA 4H7KA 1LLFA 4RPCA 5AI5A 4BC1A 3G02A 4WCVA 4G4GA 1A7UA 1Y37A 3VJLA 4X94A 2WFLB 5A7GA 1N5MA 1LPAB 1VZ2A 1GT6A 5AH0A 3QM1A 1G4HA 1XZKA 4B9AA 2GBCA 1WB6A 3D7RA 2XLBA 1UFOA 3WK9A 3TJMA 2HIHA 3WA7A 1Q84A 1XZMA 5LZ8A 3LIIA 3HC7A 3U0VA 4H7IA 1N1MA 1UK6A 2HM7A 3PE6A 5JALA 4WJLA 2WUGA 4OB6A 4XX1A 1YASA 4DMFA 5HQ3A 5ISMA 1ZI8A 1BEZA 4CCYB 4J0HA 1LPSA 3M82A 4KR0A 3DEAA 1BCSA 1VE7A 3IURA 5A7HA 3RLIA 4KAAA 4S0XA 4BDSA 4NS4A 5I7UA 2OGSA 3A6ZA 2Z8XA 1IVYA 5CRIA 3CCBA 5ALWA 3M3DA 3STUA 3F67A 1CUJA 4Q34A 1Q0ZA 4DMCA 4B83A 4QDUA 3WK8A 4J0GA 3VISA 3H1AA 4ITVA 4DSZA 4RE5A 4DMHA 4BE4A 4QDTA 5H3HA 1EDEA 2GYUA 4I4CA 1GZ7A 1LPMA 3WL8A 2WHPB 4K5QA 4ZREA 2HRRA 3DCNA 1JMKC 3BDIA 4H7DA 2J3DA 4K2AA 2G5PA 2WIFA 1YAHA 3IBTA 4RGYA 4HAIA 4MYDA 5C8ZA 2PPLA 1XLVA 4H0CA 3DD5A 5ALHA 2HDWA 4H7FA 3WWOA 3AJAA 3I6ZA 3VVMA 3G9XA 4FNMA 3EQ7A 3B12A 3IUNA 2QJRA 3R0VA 1O6FA 2QUBA 1AKNA 2JGMA 4Y2JA 2XUJA 2GBIA 2RHWA 3F97A 2HADA 3H2JA 2AJCA 4X7BA 2JGLA 1JU4A 2OQVA 1ZD3A 4FFWA 4MYSA 2HA0A 4I19A 5K3EA 5C8XA 2ZYHA 3H2IA 4W1SA 3G9TA 2FJ0A 4X90A 3CCCA 4Y2XA 5ALMA 2CB9A 3FAKA 4B81A 2VSQA 4NZZA 2I03A 4U2DA 1ZJ5A 1UKAA 1NX9A 4ZGBA 3R3WA 4P92A 5JIBA 4QWWA 2Z3WA 1XRLA 5JAOA 1TIBA 4Y7DA 2HA6A 5C81A 2O7VA 1LPPA 4UBMA 4E11A 4WFKA 2WIJA 3G0CA 2GBGA 1A8SA 1C4XA 1ZGBA 3DDUA 4Z49A 1EX9A 2XMSA 1BCRA 3KXPA 3D2BA 3STVA 2CZQA 4YK7A 3T4UA 3ICWA 1H2ZA 2OLEA 3WI7A 3QMMA 2PX6A 4W1RA 4L72A 4OYYA 4KE9A 2Y6UA 3JW8A 3IUMA 4H18A 4C6HA 3I2FA 1YS2X 4GW3A 1KU0A 5HF8A 3F96A 3QVMA 2HU7A 4AO6A 4AB1A 3IUQA 3X3HA 1ZI6A 3O4GA 4BCBA 1XQVA 2Z3ZA 3TRDA 4BVKA 1QIFA 5LLSA 1UXOA 5CH5A 3ANTA 5AM5A 3CN9A 2IITA 1SC9A 4PV7A 4H7EA 4W9RA 5T4FA 2JGJA 1Y7IA 2H7XA 3WQHA 4EY6A 4PNZA 1YB7A 5IVIA 3QPDA 4J0IA 4K6KA 4DNFA 4W1QA 1QO7A 1CUDA 2CKMA 1Q83A 1EB8A 4C87A 1D07A 3AZOA 3O4IA 1VXRA 5ALDA 1MO2A 2VJBA 2V96A 4X97A 3AZPA 4FLFA 4N5HX 5I9IA 2WJ4A 1DTEA 3S2ZA 1WCYA 5JANA 2H1IA 5ALYA 4LYDA 4QDOA 2EEPA 1FSSA 1MTZA 3DKRA 5AI8A 1F8UA 2V9ZA 4QA9A 4Y2UA 3M81A 2Z5GA 3HYSA 5FV4A 3QBJA 2ACEA 4GWLA 3HSSA 2C0QA 3D3NA 4IH1A 3VJMA 1K63A 4M0MA 1P0PA 1VLQA 1BN7A 5FUMA 2VA9A 1HDEA 4WFJA 3T52A 2ZVDA 3STXA 4XJVA 4JH0A 2IX9A 3FYUA 4BBZA 1G66A 4BDTA 1A8UA 4NMWA 2B61A 2XQFA 2P8SA 2BKLA 4P9NA 4F60A 2VEOA 3KWJA 1MX5A 2DHCA 2YXPX 3AIMA 2QTBA 5CT8A 1CV2A 4LHEA 4ZV7A 3FLBA 4Q82A 1HL7A 4ZV9A 3WWEA 3ESDA 1QIMA 4J0DA 4H7JA 3OC0A 3ZLVA 5AM2A 1HQDA 2C58A 2WILA 1YAJA 4YX9A 5JD4A 5F4ZA 3C6ZA 3ESAA 2RI6A 3FBWA 3DNMA 1DU4A 4Y2TA 5AP9A 4HXFB 3W05A 4C01A 1EA5A 2V97A 3WYNA 1JJFA 1QOZA 1CUEA 1X2BA 2HA3A 1R9MA 2X8BA 1QIKA 2GZRA 4E46A 2C7BA 5SYMA 4G4JA 4B0OA 1IZ7A 4GI1A 2QOEA 2VT6A 1XRPA 3EQ8A 3OG9A 3H1BA 3ZPXA 5EIHA 3B5EA 1CUWA 1N5RA 4U2CA 1XKLA 7YASA 1CUIA 5HCUA 1U8EA 2H7YA 1GGVA 4KJXA 5ALRA 4DNPA 5ESRA 2D0DA 4F0JA 5AOBA 1WB5A 2EDAA 2XUHA 3E3AA 4FBLA 3E1GA 3I2KA 4HXGA 4MWSA 5AHXA 1XKTA 3ESCA 5D7BA 5K3DA 1PV1A 5K3CA 3PUHA 1XZAA 1U2EA 3O9MA 4K6HA 3WYDA 2WU3A 2XMCA 1GQRA 4FKBA 1ZD4A 4EB0A 2RONA 1ORVA 1QTIA 2VAXA 2PSDA 1FFAA 2WTNA 4AX4A 3BL8A 3G0BA 2XMDA 3HRHA 1MX9A 2DSNA 1E3QA 5AK5A 5A71A 1JMYA 3F8SA 4B7ZA 4FBMA 5IVKA 2XMGA 4ZXFA 1FFDA 2DQYA 2B9VA 2DR0A 1B41A 4IHAA 3TGLA 1XQWA 1U4NA 2WIGA 4I3FA 3FYUB 4BC0A 2GBFA 4BP9A 5E4TA 3HJUA 3G7NA 4WDRA 5E4JA 5JD5A 1MX1A 1FFEA 4LIPD 1KEZA 1QO9A 5A6VA 3DQZA 5DWDA 3AUKA 2BUBA 2WQZA 1DQYA 2C4HA 2WKWA 4XIIA 4G8CA 4FMPA 4A16A 1L7AA 5EHNA 4DMKA 1SCQA 3C70A 1CUZA 3OM8A 3ANSA 4B80A 1XRMA 1GQSA 1SCIA 4BCCA 3CXUA 3FCXA 4BVJA 3AIOA 4FOLA 4HZGA 3WJ2A 4DSAA 5AM4A 1HBJA 1NU8A 1UOQA 5FRDA 2QUAA 3WMRA 1EXWA 1BE0A 3MVEA 3FYTA 1QJ4A 3BXPA 2J4FA 4BVLA 1ODCA 4KYVA 4UHCA 4BATA 2E3JA 5IVHA 1W1IA 4Y2RA 1AQLA 1XFDA 4YPVA 1OILA 4E15A 1QFSA 3FOBA 3PFCA 2R11A 1YSCA 4Q05A 4L0CA 1CUGA 4GHWA 3H2GA 4QZVA 5KBYA 1Z68A 4N8DA 1E89A 1EDDA 4J03A 5ALPA 5AM3A 5AIAA 2FUKA 1MNQA 3D4LA 3BWXA 1H2XA 2O2GA 5AO9A 2ZYSA 5ALUA 1X2EA 4BCDA 2JIDA 2YYSA 2WUFA 3DS8A 2HHAA 4X95A 4HXEB 5AIBA 1F0NA 2GZSA 1DWOA 1FFBA 4B0PA 3QITA 4IH9A 3QH4A 3C5WP 3WWCA 2WG2A 3WIBA 1LPNA 1TCBA 5CH8A 3D5EA 3ZLTA 4EUSA 4BRSA 2OCKA 3RK4A 1XZIA 1XLUA 4EY4A 3O9VA 2RAUA 2Y2VA 4ARAA 5AJHA 1CUCA 5AK6A 2VJDA 5CW2A 5EIAA 4JUIA 2NW6A 2X5XA 5K3BA 4FLMA 4OYLA 3LP5A 1UOOA 2ZSHA 2DQZA 4KEAA 2H7CA 3ZV7A 1RP1A 1J2EA 4KE8A 4OD0A 5FPQA 3GA7A 4J0KA 2I3ZA 3SC2A 5AI0A 2WUDA 3QMWA 2Y6VA 1ACJA 4PQEA 3FVTA 1TCAA 3GZJA 4AMZA 3QYJA 4AZ3A 3WWPA 1C7IA 2WIKA 2I3DA 2Y2UA 4K6GA 4RE6A 3MGAA 2J4CA 4FWBA 2CEKA 5ALJA 3D0KA 1IUNA 5HK8A 2XMBA 1W76A 2BJHA 3UMJA 4RNCA 5E4YA 2ACKA 3R3YA 3AFIA 1YB6A 2CMFA 4AZ0A 4P08A 3FLEA 5ALNA 5HQ3B 4Y9SA 4QNNA 1LPBB 3SK0A 2DCMA 1QLWA 2OAEA 4EY7A 3ICVA 4QWMA 4LXIA 3LS2A 5LZ7A 4U2BA 2XI4A 3IB3A 5CURA 2O7RA 3AILA 1J06A 1CUFA 2PKYX 4G9GA 1YR2A 3WK5A 3ED1A 3E0XA 1G5FA 2IIVA 3M83A 1H22A 3DOHA 1CFJA 2CBGA 3BDVA 1MAHA 2DHEA 3V48A 1W52X 4X6UA 3D2AA 5D3KA 1AC5A 3STYA 1AZWA 5CH3A 1VKHA 1K5PA 4U2GA 2HFKA 4TVKA 1VOTA 4EBBA 2Z8ZA 2ZJ7A 4IO0A 2WLSA 1BN6A 1A8QA 3IDAA 5JARA 1YA4A 4UFOA 1P0MA 3WK6A 4GBGA 4OCZA 1WPXA 2HRQA 3AZQA 1CQWA 1EVEA 4DM7A 5IKXA 3Q8WA 1K8QA 4PO3X 4Y2PA 3N0TA 2ROQA 5T4BA 2J3QA 4JYMA 3FCYA 4U2FA 4WDQA 1THGA 1KU6A 1XZEA 3KOOA 3NOXA 4WFIA 3WK7A 5KREA 4KE6A 1TQHA 3BJRA 4X85A 3K9BA 5BOVA 5JZ9A 5BV7A 5AM1A 2ECFA 2ZSIA 1GPNA 4Q3LA 2G4LA 2WJ6A 3H18A 4B6GA 2PSEA 3A2MA 1IUPA 2PSFA 4QLAA 1L7RA 4W1PA 5LZ2A 1Q0RA 4A23A 1H2WA 1C7JA 2DHDA 1A88A 1WHSA 3V1NA 4AO7A 2JGFA 5I8PA 2X76A 1PJAA 4KRYA 2HFJA 1ZD5A 3EBLA 1CLEA 4PF1A 3VJKA 5ALLA 3H0CA 3L1IA 4MXDA 1WB4A 1QIIA 5DLPA 3R3VA 1GKLA 5JZBA 3F98A 4MQLA 5BWBA 4O08A 3ILSA 1TK3A 1TKRA 3C45A 4X00A 1CUAA 3YASA 1P0IA 3HXKA 3QZUA 2PVSA 1F0PA 2K2QB 1MPXA 1QIEA 1UOPA 4MJ3A 5ALZA 2CUTA 3GFFA 4N5IX 4XWGA 1ZICA 4UBIA 4J0CA 5HF5A 3WKEA 2OPHA 3WKDA 1ZIYA 1H2YA 1TCCA 4J0JA 1X70A 4M0FA 1YS1X 3DL7A 4N8EA 4EY5A 1E5TA 2QS9A 4UHFA 3W04A 3GBSA 1RWQA 2OXEA 4DIUA 1ZD2P 5D3ZA 3C8HA 3KSRA 2PUJA 1CUVA 2WUEA 1XQYA 3I1IA 5AKKA 4X6XA 2V98A 4C4YA 2PL5A 1RYYA 5AK4A 4B85A 2R8BA 5EI5A 1XZJA 3D2CA 1K4YA 3HACA 3R41A 1XZCA 3ZLUA 3G0GA 3S8YA 4DLNA 2ONCA 1GKKA 3O4JA 5JADA 1EK2A 2ZYIA 5KWIA 3G0IA 3QPAA 1F6WA 5LYYA 1VZ3A 3STWA 5HK9A 1R88A 1HLGA 2B20A 1OCEA 4HVTA 5EIEA 5AKGA 2HL6A 3U1TA 3WIOA 5CTAA 4OSEA 1CUBA 1CUXA 3RKSA 2OAGA 4BTVA 2QJWA 2VQ6A 1B6GA 4BZWA 5ALQA 2BUAA 3FSGA 4CFSA 3VXKA 5EHZA 1XZDA 5DTIA 2BAGA 3IIIA 3G8YA 4FDMA 2XQGA 4Q3OA 1MT3A 1E8DA 6YASA 1QTRA 2OGZA 4X3CA 1LZLA 3L1HA 1VE6A 2VATA 5JAHA 4J3JA 1FFCA 1O6GA 1DWPA 4WY8A 2XMZA 2XQKA 3WZLA 4LKOA 3FYUC 1BROA 1EB9A 4LYEA 5DYYA 1XZGA 4KRXA 3WJ1A 2HA4A 4NVRA 4EHBA 4DYHA 3HZOA 3H19A 1DINA 4JEIA 2WHPA 3PF8A 1QZ3A 3R3XA 4MEAA 2BUCA 5FKJA 4G1FA 1DT3A 4UBLA 4EA6A 5JATA 2YASA 5K3FA 4GDMA 4INZA 5AOCA 4UHHA 4QE3A 1WOMA 4G4IA 3V1MA 5ALEA 2VT7A 5J3JA 3H17A 4C4XA 5CBKA 1T2NA 4OB7A 1UKBA 3PFBA 1P0QA 5HZGA 3WKBA 2FJPA 5DJ5A 2Q0XA 1BRTA 4DTCA 4BE9A 2CJPA 1EINA 1HPLA 5AKXA 3EIOA 1PFQA 5ALTA 5HKAA 1Y7HA 4ARBA 4BAUA 4MWTA 3KDAA 1QGED 3C6BA 1ZOIA 4FTWA 3FVRA 4UUQA 3ZI7A 4BB0A 3A2LA 2WJ3A 2JEZA 1TAHA 4KAFA 3DL4A 4PSUA 1EK1A 3FWHA 3I2HA 2PSHA 3F9CA 3K6KA 5T4HA 1J07A 2D5LA 3GELA 3SX4A 1JI3A 2UZ0A 3C5VA 3V1LA 3DYVA 3R3ZA 2ORYA 2RGUA 3UUFA 5D6OA 3N2ZB 1UZAA 2PU5A 3LLCA 5ALSA 2ZJ6A 4WY5A 2WSLA 2QT9A 1ZIXA 5JASA 4Y2SA 5HFAA 2C5GA 4H7HA 4Q3KA 1WHTA 2XB6A 1UWCA 3IULA 4FNGA 1TRHA 4ZI5A 5C8VA 1SOMA 1MU0A 1LZKA 2XMRA 4N8SA 1EVQA 2XMQA 1ACLA 1JFRA 3H2KA 4CG1A 3D59A 3OOSA 2WG0A 1QIDA 4H77A 2JGKA 2XUFA 5FLKA 3VDXA 1ETHA 4H35A 5T4EA 4A5SA 5AKZA 3AINA 2OCLA 1CUYA 1JU3A 1AUOA 5AI9A 5AK3A 4TGLA 2WM2A 5JAUA 3V1KA 3DJYA 2VF2A 1BEEA 4G8BA 1AGYA 3RM3A 3G9UA 1L7QA 1XZHA 2AJBA 1WPRA 2W22A 3I2JA 3W2TA 4UBKA 4PSCA 4QEKA 1QIHA 2QKYA 3HABA 3G9ZA 2QXUA 1JJIA 4F5ZA 2XQIA 2OCIA 3WK4A 1CUSA 1AX9A 3PICA 3P2MA 2VJAA 5CT9A 2QRUA 5K3FB 4DNOA 3A2NA 5LKRA 2WG1A 2O2HA 3FSGD 3BJMA 4FFVA 3LIPA 3W06A 4B9EA 4YASA 3K2IA 5IH7A 4AN0A 1H23A 4V2IA 5JAPA 4UFNA 4MQMA 4AN1A 4L3WA 1ORWA 1LBSA 2JEYA 1J1IA 4DNQA 4BYMA 3WZMA 3TEJA 3HEAA 4XVCA 2B4KA 4LXGA 1USWA 1U65A 4UHDA 1VA4A 3V9AA 3EQ9A 3ZWQA 3BE8A 4HRXA 3R40A 5ALVA 1ZGCA 3W9BA 2PUHA 5ALOA 5JZSA 2QM0A 3GROA 1MAAA 4X91A 3BF8A 5JD6A 2I78A 1XZFA 1XZLA 2AJ8A 5ALXA 5E2IA 4F21A 2HA5A 4MEBA 1UK8A 1W75A 1CRLA 2GYVA 4OU5A 3C8DA 1E8NA 4PSDA 2WHRA 1LGYA 1XQXA 1XRRA 2XUOA 5FXMA 5AI6A 1ZJ4A 4KACA 1EH5A 4BAGA 3JYHA 4B84A 4EZIA 4QDXA 3PUIA 2AJDA 4FLEA 4G9EA 3L1JA 1ISPA 5CT4A 4HS9A 1NU6A 2HA7A 2XDWA 2XUGA 3IUJA 5LP1A 2VJCA 5AKYA 2RIPA 3QMVA 5EHXA 3C6YA 2XT0A 5AOAA 2XLCA 5CMLA 3LCRA 5FDFA 2RHTA 3PI6A 2O2IA 1EDBA 4ZRDA 2JBWA 5HF9A 5EGNA 4G5XA 4HRYA 5AI4A 5ALGA 1M33A 1CVLA 3BF7A 2OG1A 1EI9A 2JGIA 5AKIA 3Q0TA 4HTAA 1CR6A 3ESBA 2JF0A 4AQDA 2ZYRA 3O0DA 3I28A 4X6YA 5AM0A 5AKJA 5C7YA 1E8MA 3HI4A 2QR5A 1XROA 2XUKA 4CIAA 5LZ4A 2QXTA 4UFPA 1R9NA 2LIPA 3H2HA 4E14A 2WFZA 1DX6A 1MJ5A 5JYCA 4AXBA 3NWOA 2AXEA 4BRZA 1CUHA 3H04A 3OURA 1R3DA 4TPKA 1VJ5A 5AICA 1GPKA 3EF3A 4OU4A 5FOQA 5AKEA 4M0EA 3WL5A 2WHQA 1QIJA 2XUIA 1DT5A 4ETWA 2G5TA 3I6YA 3I6MA 3C87A 5AKHA 5DNUA 3IA2A 5IVDA 3WWDA 4Y2YA 4X92A 4KAJA 1I6WA 4DGQA 5DYTA 2JGEA 2VTVA 3WA6A 1S8OA 3PDCA 5ALIA 4Y2QA 4C88A 4UBJA 3HLKA 4IQ4A 1W4LA 1XRQA 4LXHA 4CG2A 3AIKA 4JNCA 4GECA 5FP0A 4OUKX 1MN6A 3WKAA 2XQJA 2QVBA 1OXMA 1GXSA 2BCEA 2WTMA 3CN7A 4UBOA 4UBNA 1WM1A 3DLTA 3FLAA 4EY8A 2WU4A 1AURA 3JWEA 4Y2VA 4UPDA 3WL6A 4U2EA 2YH2A 4P93A 5DTJA 1QE3A 1YA8A 5CXUA 3UUEA 1E66A 5YASA 1ZI9A 5K3AA 3C6XA 4L9AA 4BP8A 1FJ2A 3E4DA 2Y1KA 5CXXA 2AJLI 1BS9A 3I2IA 2VAVA 1DX4A 1UK9A 2PBLA 5DYWA 4GXNA 4C4ZA 1UKCA 4KE7A 1SCKA 2PM8A 4ZWNA 2BFNA 1JJBA 4G8DA 2EDCA 4CCWA 1IUOA 3C43A 5LZ5A 2OGTA 2PU7A 3MUOA 5SYNA 2XUDA 3FNBA 2ZJFA 2HA2A 1UK7A 2WIDA 1LNSA 4OPMA 4D9JA 2QZPA 5LKAA 1XZBA 2OQIA 1K6EA 5BWCA 3KWFA 1AMNA 1SFRA 4UHEA 4BTLA 2C0PA 5AKLA 2HU5A 2WFLA 3KD2A 5LZ9A 1ODSA 1W6RA 3W9UA 2HU8A 1BU8A 1VXOA 5DNVA 1CEXA 2W6CX 1HKHA 2PSJA 5HFNA 1R1DA 3NGMA 4FHZA 2WFMA 4W63A 3MUNA 1ODTC 4BZZA 3DYIA 1UT6A 4OB8A 3PF9A 1XRNA 5CT6A 1EHYA 1G42A 4BAZA 3GUUA 4Q1VA 5EHQA 3A70A 1IMJA 2XUPA 3BIWA 5A7FA 4CCYA 4CG3A 5A62A 3RARA 5K5EA 3I2GA 1MNAA 4JYPA 3I1YA 1QONA 4PW0A 3SWWA 1LBTA 4ROTA 5ALKA 1T4MA 1CPYA 3R3UA 4X93A 5A2GA 3BIXA 1CUUA 5CT5A 4CIBA 4GEGA 4C89A 4B82A 4CI9A 2G63A 1CIJA 1GPLA 3WL7A 1JKMA 1N8SA 2OCGA 4AO8A 4QDZA 5LIPA 2BGNA 4X71A 1R50A 3DKKA 1DWQA 4AMYA 1QFMA 2XUAA 5HF6A 5FPPA 1JT2A 4QLOA 3WLAA 1YCDA 3VVLA 2GYWA 1XLWA 5KWJA 3STTA 1VA5A 1LPOA 1THTA 4J7AA 3QPCA 1IZ8A 2C5FA 1CQZA 3O95A 2XE4A 3O4HA 5HKBA
chains in the Genus database with same CATH superfamily
4WK4B 3PEVA 3T3IA 1PTJC 2HQOA 4CEHB 4RVDA 2SCUA 3CKKA 2NXCA 4NV0A 1W5AA 3D0RA 4QUBA 2BFCB 2OHXA 3KUDA 1GU0A 1KEUA 3DOIA 5FPHA 3GIDA 4LPKA 2W6ID 2O3UA 4CLDA 3QYFA 1M1ZA 1IEQA 4K3VA 3ONVA 2JJYA 5EKTA 3I9JA 4GP6A 5IC5A 4HWRA 3RFVA 5C5EA 4C6TB 4IXTA 3VI3B 2V9CA 5GZ3A 1DQZA 4MCIA 3ZK7A 3I8SA 2VQDA 2ES4A 1KI7A 2YVKA 3HNOA 5JROA 3OF3A 1APBA 3BOSA 1V2GA 1YQUA 4HN4B 4QJ3A 2EZ4A 3HJAA 1R4ZA 1TJ4A 4OHPA 2H0AA 2PUTA 3D0OA 5KQGA 4N3GA 3VZDA 3ESYA 3KOUA 4Z3KA 1QFYA 2QP9X 1P9LA 2QTVB 2TRSB 3IVRA 3TWOA 2YWXA 4NX2A 3BGVA 3ITEA 5E38A 1H3EA 4BIIA 3A58B 1JIVA 4D3XA 1ATIA 2E2WA 3I0NA 3RTDA 3VJLA 2DQ4A 1QOQB 2ZATA 3ECSA 4IDQA 4X5OA 1XCPA 5T67A 4JP5A 1H6DA 4JXKA 1T2FA 4TKUA 4CIYA 5LP6B 5BT9A 5JT1A 3T5PA 4UM5A 5JJCA 4AX8A 4C5CA 5CJJA 1GT6A 1VIAA 4KV9A 5JJ5A 2X0EA 1HNWB 4FDLA 4IGAA 2W43A 4CV1A 3K70D 1YL5A 4B9AA 2J6CA 4R1LA 5KQLA 5EZYA 4W4TA 3SF8B 4ZDIA 1C9DB 2V5AA 3TH5A 1XEXB 3QY9A 2HPAA 2MTBA 3HA2A 2R2AA 1WY7A 1MXFA 3D7RA 1YDHA 2F55A 1A4XA 1UFOA 1EE9A 1L5FA 2I2AA 1L5ZA 1DZ3A 5DV9A 1XMXA 3TJMA 3ECCA 3WK9A 2X1VA 3AESB 1SZJG 1YB5A 4FE7A 1Q84A 3NEJA 4MW9A 4UREA 3RFXA 4M8KA 2H8KA 3CVYA 3JV7A 3L7DA 1BXRB 3VFDA 5IZCC 5J2UB 4XUCA 4JK3A 4K9SA 1E9DA 3SYTA 1OASA 3PE6A 1C50A 4NWIA 5IAGA 3H1TA 3K71B 3X43A 2YC4C 5E6SA 1YASA 1BOOA 1BEZA 4IDEA 4CCYB 1Y3IA 2G1AA 4KMSA 3GD5A 2FLVA 2Q3FA 2R6GA 1TZCA 3O93A 4LQ4A 2SHKA 3K5IA 1GQQA 2W6JD 4JQSA 4A8JA 3BCHA 1QRDA 1FYDA 4KR0A 2QMHA 3MRVA 3WDMA 3G82C 1GAEO 2OCAA 2GRUA 1C8VB 4BFXA 1JDNA 1M7BA 1NVFA 3RLIA 4F6RB 4S0XA 2FQWA 4I9NA 4GX5A 2BBOA 1A27A 5L3RA 3SZUA 1LH0A 3THWB 2G70A 4DRZA 1CXZA 1NUQA 2Z8XA 1A9SA 2Z2XA 1IVYA 1AKEA 2WWTA 1ZN7A 4LZPA 4Q03A 2F1JA 3NHMA 3AV3A 3OCWA 4ASUD 1VJRA 3DFKA 3I5MA 5JDCC 3DF7A 2HKIA 1W4CA 4PYOA 3F67A 4KDFA 4X41A 1TM4E 4BN5A 3DEIA 4DABA 5CXQA 3TZKA 4B83A 1E6KA 1YZQA 4QDUA 4B4VA 5HM8A 4PCUA 5FAXA 4J0GA 5COAA 3HZHA 3VJRA 1R8QA 1GVHA 2XMPA 2P2GA 5FNZA 5GVRA 3BBPA 1Z56C 5I8WA 1IB6A 3DTVA 2AFIE 1QGZA 3NVMB 1KQPA 4G5OA 1Q91A 1G64A 2C54A 3DHEA 4HMPA 4YT8A 1W6UA 3DVAA 3RS0A 4B87A 5CFOA 2OE2A 4ITVA 4XDGA 3MEQA 3B1YA 4GM1A 2YN0A 3AERA 3M2PA 2ZJZA 3RT9A 5H3HA 1C1XB 4ZKDA 4ZMRA 2BCGY 3KYCB 3RUAA 4LX0A 3N7AA 3WL8A 1WD5A 2WHPB 2CNWD 4RKQA 4KXNA 4ZREA 4ZC1A 4KQKA 3A2KA 4PPGA 1F3OA 1N4AA 4CV3A 1P62B 3FTQA 3B8EA 5HBRA 4H7DA 2FPKA 4DCCA 3D1JA 1HT0A 1CQIB 2O2YA 1ZEJA 3AO0B 4HGPA 1A9QA 2RJNA 4YJDA 3DUWA 2XNDA 1G5TA 4D4KA 4MYDA 1X7ZA 2IHYA 1SXHA 4QG7A 1A9PA 1KI6A 1R8SA 2F64A 2WDZA 3K7EA 3M6WA 4ERXA 5C8ZA 1D1QA 5LOVB 3TJZA 1YOVB 3L84A 3DEZA 3ZD7A 4HZUB 2HY7A 3UXMA 3EXFA 3HWWA 2HDWA 2F9MA 4H7FA 2XNCA 1KWKA 2V6JA 4ZQFA 4EI2A 3WWOA 2CMKA 1FF9A 1U1DA 4BPBA 1SCAA 3HJFA 1BMTA 3I6ZA 1JLKA 1NOIA 4I8XA 1W1UA 4OKNA 4FNMA 4HD8A 2WAXA 4MVJM 3RC8A 2ZYAA 4IFBA 5HCNA 4KPYA 4YRSA 3EQ7A 5B7GA 3IB6A 2I2FA 3R6GA 3G1WA 3VPAA 3FMOB 1Q1BA 3CZ5A 4XB1A 1AK2A 3N74A 3CGGA 1TM5E 3JAWA 4KQ6A 3MSXA 3OEED 2ORED 2EYQA 1AKNA 4BFYA 3WWYA 4EPXA 3B38A 1ND5A 2JGMA 4GR5A 4UDNA 1U2SA 4H9GA 3COPA 3BXOA 3L8YA 2XUJA 2C5SA 1BFKA 2GBIA 2QTAA 4TVSA 3CLRD 3O21A 2CHFA 2FEPA 4FC7A 5DLEA 2HADA 4Q4AA 3AQ4A 3TG8A 1DEKA 3R7FA 2GKSA 2QQGA 4ND6A 1DRKA 3EHDA 1JHZA 3HDGA 1DO2A 2PWBA 5EUCA 3ZJ5A 4EPRA 2C7QA 1ZD3A 1XPOA 2BFDA 1E7WA 1YBFA 1YVPA 2LWIA 1LDMA 1NQUA 3BWCA 3CE6A 3VO9A 3NOQA 4GOJA 2OD2A 1N8NA 2FN8A 2QGFA 1U0BB 3D5TA 1MJGM 1UINA 2J6HA 1JDTA 4MR8A 4W1SA 2BHTA 5IUKC 4CYMA 1PKXA 1XVTA 4BNYA 3SCZA 4QVKA 3UH1A 2ETVA 3AF4A 3ZZ0A 1RPZA 2WF7A 4U2DA 3NDBB 3FGNA 4RLQA 4W82A 4JB2A 1ZO8A 4JBIA 3LD9A 2FRDC 3NHYA 1OFTA 2Q4BA 1NX9A 3CNOA 5DCUA 2H4JA 4QASA 4IEIA 4II7A 4CL0A 2GJSA 3LBIA 2J7PD 1KK3A 3K96A 4I66A 3GCWA 4P92A 5L4NA 2BMDA 2ZJAA 2RBKA 3H9JA 5ESWA 4G37A 4QWWA 1U2QA 3K6SB 2AFRA 3M1AA 1M3SA 3PRKE 4U7HA 5T7BA 5JJIA 4OQLA 4LF6B 1QCYA 5KVAA 4KGZA 1X8LA 1RRFA 2Z1DA 3GFTA 4R2IA 3WRXC 4JJ4A 3E9RA 3I5YA 2KMLA 4HADA 2TYSB 3HCRA 2VXCA 3NWJA 5J58A 1RW4A 4G0XA 3NYRA 2P1ZA 3V8RA 4M98A 4H0NA 1YDEA 3GP5A 3I04A 3WLSA 2BP7B 5C1OA 1M7HA 2GBGA 4BO0A 4OQEA 5BSVA 1Z39A 1A8SA 5TSDA 1K6JA 2FFBA 2ERYA 5AJXA 4XR4A 3VR5D 3EZ2A 1KQ3A 3GR6A 1GZSA 2RHBA 2W5UA 4DWJA 5L53A 2G5CA 1ZK2A 1C4KA 3T9CA 4QTZA 3ETCA 4GPEA 1T5SA 2E6UX 4HY3A 2E82A 1Z37A 4PIVA 1BCRA 2FAXA 3AU8A 2C0CA 4D4IA 6REQB 3A0RB 2IHNA 4LDPA 1MEJA 4CRWB 4UD6A 4WBNF 4YK7A 1UEJA 3O0TA 4BKRA 1L5OA 4YRZA 2WSSA 3O1LA 4HLNA 2OK8A 2ZRLA 3NNSA 1SG6A 1KZ4A 2HV9A 2OLEA 3B5JA 3BB1A 2GEDA 2J7KA 3KB2A 4LC9A 3WI7A 5TIIA 4L72A 1M9NA 3DNFA 1SQFA 2V5UA 3I6IA 4KE9A 2CB0A 4ZTZB 1QO0A 2Y6UA 3E4CA 3FZNA 3T15A 2BEVA 3N53A 2JK1A 2JLZA 1XFAA 1RJ9A 2LCIA 2B5VA 2CXRA 5JMTA 1FDIA 3JW8A 1T6ZA 4RF5A 1SKMA 4ZHQB 4QDJA 3VHXB 2VNSA 3VPSA 4A73A 5CA0B 1Z0DA 3FMFA 1VDMA 4PFKA 3BFVA 4XDHA 4C6HA 3DWEX 1FYVA 2FEAA 5ABPA 3O7MA 3UAOA 4JZYA 4LHXA 4DCUA 1RYBA 2ZUWA 5BWOA 2MR6A 1RBZA 4HN9A 4B32A 1SCBA 3LI2A 4Z9YA 5CEEA 1DIRA 3QENA 3JVUA 5EIOA 3ZGOA 1U0SY 4HDRB 4JEMA 4WTOA 1TKBA 3L06A 4EHKA 1AV6A 4UASA 2H5IA 2I3GA 3AP3A 3UHAA 2P4HX 2Y0PA 3P9QA 1TW3A 3IUQA 1QRAA 1ZI6A 3PKIA 4M7WA 3UAGA 4NEHB 2WM3A 3X3HA 3ACDA 4OJNA 1DOAA 4BCBA 5A02A 5I45A 4TWBA 4XD7D 4ND4A 1AN9A 3PIDA 3L1KA 3D8NA 1Q11A 4YNBA 4C5AA 1U3CA 2P9ZA 4YP6A 2IH4A 1G7SA 2IITA 1TCVA 1NX6A 3SM3A 3WVNA 2PEZA 5C18A 2CUKA 3JASB 4PYKA 1JIKA 3A6PC 10MHA 1Q20A 3VAYA 4RK5A 2QTFA 3DLPX 2REQA 1NP6A 3R44A 4PV7A 1QH8A 4HGRA 4R2JA 2GM4A 3FBGA 4W9RA 1VRWA 3FIJA 4HQRA 4WXHA 1VHDA 2RCYA 2X2PA 1YZUA 4FFMA 2VS1A 4C0BA 1H2FA 3DT8A 3CRMA 1Z2OX 2H7XA 5ITVA 5JAIA 4H31A 3HP7A 3DDOA 3UENA 3UATA 4Z3DA 3JQFA 1UMBB 1SH7A 2P0EA 2PKQP 3CH6A 4IMPA 4QFBA 1K7SN 4R0NA 4EY6A 2H0RA 1IBRA 1SXJA 3OFSA 4FHCA 4KNYA 3P7MA 4LV6A 1JAIA 3P9CA 1YB7A 2QDXA 2WK1A 1ODJA 1P1JA 4JN6B 2JEOA 4K6KA 1A7AA 1ADJA 4FS8A 3DDHA 2HYDA 3BGWA 1QV6A 1SXIA 3D7LA 5JPCA 2Q2WA 2JGDA 1XVVA 1J9ZA 2BISA 5C46F 3ZDEA 1U04A 4OX9Y 1CT9A 1CUDA 4Z4FA 3UGKA 2E4ZA 3WP1B 4AWAA 4AUMA 5IJ9A 1RYDA 1QS0A 2AUNA 3NKVA 4HX5A 4C87A 4ZK6A 4D74A 1VP9A 1ZH8A 4BP3A 3MRTA 1Z18A 3PQ7A 3DOJA 2BF4A 4IV8A 1K97A 1VIDA 2AXNA 1EZ1A 2VJBA 3HUUA 3KT3A 3DC7A 2O2ZA 3C24A 3DV2A 1ST3A 2B3TA 3JPYA 3CBGA 2WINI 1RHMA 4E4RA 4K6MA 5JI3E 4R83A 5I9IA 2DLCX 1I3NA 1DTEA 3S2ZA 3VR2A 4AFNA 3L8GA 5BR8B 4DR1B 3A9TA 5ALYA 1AA9A 1ONOA 1P7CA 4QL3A 5IFLA 4QYWA 3DKRA 3AM4A 2I2DA 2Z43A 1DBVO 2BJVA 2DGDA 4YUYA 4B8WA 5D1HA 4Y2UA 4Q15A 1Z5VA 2YXDA 5FPKA 2JI8A 2FW8A 1C9YA 3E53A 3TYXA 2HZ7A 1Z6ZA 4MUGA 4ITRC 4OHMA 4HUJA 3HYSA 4ZAFA 3SHWA 3QBJA 5JJBA 3TX6A 2JD2A 3LRXA 1JIXA 2ACEA 3KSDO 4M99A 4QATA 3GHYA 2WR8A 1CS0B 5CFMA 2DERA 4KXLA 5ANRB 3D3NA 3H05A 1E2PA 1JSLA 2HMVA 1A2OA 4IH1A 3TR0A 3ZE9A 5JNSA 1AF7A 1SQ6A 2GO7A 2XCIA 2IK8A 1P0PA 1VLQA 1RKVA 1NMYA 1T0BA 3D4OA 2JVIA 3MWEB 3N0XA 4NJMB 5FUMA 1J8MF 4MITA 4X44A 3STXA 3FFXA 2J07A 3WGLA 2QUJA 1N2GA 3MXTA 3V8NA 4Q4DA 5JAZA 1DADA 1CB0A 3FF1A 5CGZA 2JI7A 1R15A 1EM8A 4BBZA 1DLJA 3OKFA 1G20A 1OA1A 1I2DA 2VJKA 2N46A 5LYJB 2Z2YA 3SS7X 3EAQA 2BKLA 4F9GA 2SBTA 1FQWA 1JU9A 2DBZA 3KWJA 4WN9B 5DI9A 5GGXA 1KQFA 2I2WA 1MX5A 2JBHA 2XWSA 2CF6A 2P9QA 2DHCA 3GC6A 4E1AA 1XQ6A 2K87A 2FWMX 1DDIA 1ANKA 4LHEA 4ZV7A 2I3AA 2PT5A 1KZYC 3FLBA 1KJYA 2GTIA 3FPCA 4X3PA 2NU7A 1TF2A 4GMKA 4IJKA 1IQUA 1T9HA 1X0VA 4R9UC 4RY0A 4ZV9A 1KETA 2PTHA 5HMLA 3UG7A 4W9NC 3WWEA 4EA8A 1ADYA 1KVQA 4ILEA 1OBCA 4JLSA 4KH1A 2FEKA 3B70A 1VBFA 2YUTA 4P2GA 5I01A 4N01A 4C0JA 3BFKA 1IHYA 4MVCA 4G63A 1EUDB 1OBVA 3BPSA 3MTJA 4I5IA 1GGJA 4YX9A 1HO3A 1J24A 1Y3CE 1PSDA 4TYQA 1KSHA 1OWOA 1ZINA 1P60A 4TXJA 1ORDA 2G28A 1YB2A 4GEKA 4YALA 3JYPA 3CLUD 2QF7A 1O8CA 1T10A 5TPZA 3KBOA 1U7TA 5MF6A 2IXGA 2H29A 4Y2TA 5J5AA 4IX9A 1FVHA 2CYCA 3RBAA 1YACA 4N9QA 4HXFB 1W9MA 4R2WA 3TPCA 2KS6A 1GNSA 2I80A 3BMQA 1EA5A 2V97A 3F49S 4C01A 1CYEA 4L08A 3L0OA 4M21A 3R7NA 1QOZA 3ULKA 2WJJA 4JOBA 2IELA 3V4ZA 1ZNZA 4M2LA 5IAJA 1LUAA 2RAVA 3L7BA 3H6KA 2C7BA 1SHUX 2XPCA 1IZ7A 1J7KA 2P40A 2X13A 3AOEC 3S4YA 3EQ8A 4B0OA 2X58A 2BMVA 2P78A 3OG9A 1JB9A 3G3EA 5IP5A 2QLTA 3W5JA 1KERA 3B5EA 4KN9S 2QAGA 3IMGA 5EE9A 3VNRA 2AR9A 3PBKA 5KQMA 4RBNA 1JTEA 4U2CA 5BOSB 1EDZA 1XKLA 1ONNA 3HG7A 1Y98A 4ISCA 3AB3A 3GVIA 4YQFA 7YASA 1HQKA 1CUIA 5J5VA 3X1JA 4XWYA 2XRZA 3BN3A 3KYIB 5LQAA 4DVJA 3VOSA 1VPWA 4P38A 3IPLA 4PQRA 1MIOB 3ZY4A 1ATZA 3ZDZB 4NJEA 1EJ6A 3NIFB 2D0DA 1ZM7A 1NBWB 2W2NA 3UJ6A 1OF1A 4QRIA 2EDAA 5IHXA 4YUZA 4G36A 4Q7EA 4EHJA 5HUQA 4F2HA 1JSRA 3EA4A 4RJTA 5JDIA 1T9BA 1KFEB 3AKDA 1ZU4A 2I4OA 3CM0A 2EJVA 4Y6QA 3R0ZA 3N28A 3PEYA 2HDOA 5LLDA 2IH2A 1VJCA 5ITZA 2F62A 4HPJB 2Y67A 4U3JA 1WQ3A 4KFUA 4WQMA 3KQLA 3OIGA 1M2WA 2EGUA 2MMCA 3O9MA 2A0XA 3VDQA 2XCLA 4C06A 1HORA 3NNDA 1GQRA 5CDHA 5IHPA 3EZGA 1WUYA 2G80A 3COVA 3JALB 1IPEA 4CLHA 5JYDA 5DBFA 1T35A 2VAMA 2VAXA 1ULBA 3ZDCA 2PSDA 1FFAA 4QJ5A 2FRXA 3ZWYA 3EFBA 1IXYA 4BMOB 3ET5A 1V5FA 3OQVA 3P20A 3ZXSA 3FJ1A 2WWRA 3RUIA 4E6EA 4YMTA 3W5BA 3Q7IA 3QX9A 3DO6A 2LD4A 4Q9KA 3T1NA 3Q8KA 1HUQA 1EHIA 1EFCA 3HRHA 2W98A 3H83A 1X19A 4YXWD 2PUAA 1OYYA 4M8IA 4ZQIA 1MX9A 3MTGA 4NH0A 4WASA 3WLJA 4BO5A 1ITZA 2VUUA 5C32A 2CFOA 2JLBA 1KVRA 3A1SA 3DTTA 5LDDC 2WD8A 5L3SB 4X63A 4G0ZA 1FFDA 4YRQA 3LT2A 4ZI7B 1GXSB 3LX5A 5ADVA 1ZGGA 1SEPA 3SBXA 2OZKA 2H8GA 3PSAA 3TGLA 1AKVA 1XQWA 3K9CA 3PWZA 4ZZ2A 1NKVA 1U81A 4XRGA 5IPFA 3QELA 5AQ1A 2ZWOA 3ILVA 3PTAA 3HU2A 3JQPA 2JVJA 3PNKA 2WVJA 2BYTA 5I4KA 1Z7EA 2Y4OA 4WVLA 1SRQA 2XTJA 3D8BA 4OXKA 5E8RA 3U3JA 4IWNA 1CEYA 2GD0A 2YJZA 3A1CA 4WDRA 5IXJA 1YRLA 4YS6A 1YZTA 4EB6B 1I4EB 4FI3C 4WZAB 2FUCA 2ZBPA 3I8OA 1Y6JA 4GI3A 3SBOA 5JD5A 2ZUFA 2ATIA 3RRBA 3LRTA 2YHAA 2IYRA 2QUHA 1DO0A 4MV9A 1MZVA 2MYNA 3HYLA 5DZSA 1OZHA 1P44A 2P9JA 1F14A 1FRQA 1JVNA 5DWDA 4KR9A 1P1FA 3BGSA 3IJRA 3JTMA 2ZLBA 3GEDA 4P7FA 4NBKA 4G2NA 4GBJA 1S3IA 1RPNA 1T6BY 1T2CA 3A14A 1SUFA 3QV1A 3M89A 2OO5C 1J7JA 1SCNE 3HU1A 3ROTA 3ZTYA 2WP0A 4BVKA 3BGOS 2QE6A 1DNPA 1WDMA 1R0KA 4C5BA 1OPRA 3BRWD 4ZJPA 2ZKIA 4DDWA 1EFAA 1DTWB 1NJ5A 1MH1A 2VJPA 4YJFB 3REQB 1IOZA 3RWOA 3NH6A 1DEXA 3AEQB 1K5DA 1E1RD 1XMIA 4O4IA 1VHLA 2A0YA 2GVZC 3IE1A 4BX8A 3ANSA 4B80A 4KUGA 1J23A 4FQ5A 1KOLA 2FETA 3O38A 3ASUA 3CXUA 1UPAA 3FCXA 4LZOA 1N1GA 1ZFNA 1SA0B 3CH4B 1V6SA 2GQ0A 3K9HA 4FOLA 3WJ2A 2OILA 3R20A 4DSAA 4CM8A 1EFRD 1F20A 3KZKA 4DLYA 1NXPA 4L7VA 5H5JA 3B51X 3R6TA 4I1IA 2AFIA 1ZM2A 3KZOA 5DEIA 1EXWA 1PGPA 1EX7A 2Y92A 3CPEA 3FHJA 3HUEA 4HPWA 3AL2A 1E5DA 1PK8A 2ID4A 3FYTA 4J43A 1QJ4A 2OCDA 3LQRA 5FR1A 4JOQA 3CVJA 5KDLA 2CXOA 1A4IA 2IYNA 3T1VA 5BW6B 5L3QB 1BHQ1 2PV0A 3P1JA 3TK1A 4WERA 3UFBA 1J20A 3B60A 3SFVA 2I2XB 1C7EA 3AFHA 5REQA 1JFSA 4GX2A 3ZX4A 3QFFA 5A4KA 2W6OA 1RPTA 5I7SA 4A0FA 4XLZA 5E6UA 5IVHA 1B7GO 3OPYB 4C3OB 5FNVF 4ZU6X 2A30A 1P80A 3AC0A 1OBFO 1MLDA 4YP9A 1LB1B 1R4AA 5L6LB 1G8JA 3CWQA 1XCOA 1JDPA 2VQFB 5F5NA 3QKUA 3QVSA 3D8TA 4YDSA 4P4SB 4PAQA 4XR9A 1TTHA 1TYDE 1WIWA 1SK8A 1EGAA 3T8YA 5CVEA 3UFXA 2J3HA 2QTTA 4QFDA 3SYLA 4ETMA 1RXSA 3FAZA 3GO4A 3LF1A 4RHFA 4Z6KA 3KQTA 4LE1A 4AKEA 1F8XA 3AT1A 1CUGA 3DMHA 4MRNA 1WCIB 2HK6A 4Z0PA 3INNA 4NZNA 4LDAA 3WRWA 5BW4A 4QG3A 2AEJA 2HJ9A 3SI7A 3T4EA 3K8YA 1PW7A 4FYPA 1J8YF 1P4JA 1VI2A 3GH1A 5F3WB 3BCSA 3L8DA 3TOZA 2D1SA 5DNEA 1M2OA 2X2FA 3S1AB 4KBGA 3OEHA 5EIBC 2FGKA 3FTPA 3ZQ4A 1QQ5A 2GCIA 2H1RA 2I65A 2P9GA 2HQBA 3W4JA 4QXMA 4ZGGA 2FF5A 2FNAA 1VL0A 4B3RB 4HPXB 2O2CA 2EL7A 4P7JA 4XVRA 2JAOA 5ALPA 3O94A 4JELA 2VJLA 3RS9A 3VZSA 2WICA 1VSVA 3AW8A 4NE7A 1BA2A 5ENVA 4D3ZA 2FUKA 1MNQA 1ULSA 5GONB 5A9SA 5HG0A 1X6VA 4TT3A 3UCXA 5JHGB 1Q17A 1NG1A 4G1CA 2X0KA 3FNFA 3KU4A 1AXGA 1DC4A 1TGYA 3BXXA 5JXIA 2OOSA 2RHGB 5DBOA 1LS6A 1C9NA 4JVSB 3U3MA 2R8XA 4G84A 4PAOA 4OKIA 5ALUA 1WP4A 2H11A 4RXUA 2R47A 4G0YA 4BCDA 1OW3B 3EG5A 4ZJYA 2WJWA 2FWRA 5JXJA 1O94A 1RSZA 2C3UA 1Z5OA 2FFAA 3PRYA 1H8ED 1MJFA 3EGWA 1TW2A 5FEMA 1IIRA 4EW6A 5LMCA 2GB4A 4F9TA 1PS8A 3SR4A 4GOLD 5BSMA 3TEMA 2OLKA 4IDNA 3IQXA 5B7QA 1NGSA 2Y3IA 5A3VA 1C7ZA 1FP1D 4B0PA 1USGA 3QITA 3IHKA 3MINB 3QWAA 1S1MA 4HX2A 4YP1A 2IV2X 2JIZA 4EF5A 3M6XA 3W1WA 4C7MA 2FP4A 5JD4A 4DJ5X 1IBLB 4UU0A 3Q5GA 3WG9A 3KQPA 4F11A 3QH4A 2V6MA 3C5WP 1FRZA 4KZPA 4OI1A 1PKEA 4HSGA 3DAOA 3BYZA 5TQJA 4X20A 1GTRA 2OWDA 4IHKA 2VHEA 3UJCA 2VT2A 1GRVA 3D6HA 4CDMA 5IJAA 1K5HA 1PGNA 4EGCB 2PVCA 3ENKA 4MW4A 1DRWA 3PNYA 3THOA 3OH8A 4FNOA 3N86A 3WGVA 1OC2A 1PNVA 2YWFA 4PNEA 1G8HA 2W11A 3ANYB 4FHFA 1L4UA 3G23A 1PR3A 1U7XA 4ZO6A 1U90A 1E1YA 1Q44A 2LGJA 2LXNA 2PHZA 3A31A 4LRSB 4M89A 4NEGA 1JR6A 2XEDA 4FNAA 3R9XB 1W1WA 1VSBA 2HXYA 4ZVUA 4QPPA 1PFGA 2H17A 2RAUA 1L8OA 2OORA 2ZJ8A 2GZDA 4I81A 1RCUA 4JYBA 5FQOA 1MABA 1OFVA 3OTGA 4BVGA 1CUCA 2R96A 3HVHA 1XNHA 1INLA 3MIZA 4HB4A 1L5LA 4B2PA 1JG3A 2PA3A 4JUIA 4V0RA 5HOEA 4AQ7A 1Z0UA 4HFJA 1JSZA 2E89A 1H8HD 5CVTA 1QHFA 1MPTA 3ANXA 1U7WA 2XUZA 4OJQA 3T5TA 3GJTA 1D8TA 1PJBA 2ECPA 2N1BA 1H4VB 2EWVA 2FEOA 3FPAA 3GBPA 1UOOA 2IOFK 2ZSHA 3MMZA 3NONA 4V24A 2UXDB 4GL4A 2CJXA 3SZRA 3G8DA 3ZV7A 3QVUA 2EF0A 1GDDA 1Q7BA 4I14A 1Z4PX 3S40A 4V0LA 2G17A 4Q9DA 4DCVA 2W58A 2BSAA 1R2QA 1JYEA 4GXRA 1NZFA 4TQ9A 2XWPA 1N0WA 2I3ZA 2UYYA 2X3UA 4KW7A 1Y1SA 2Z2ZA 3SC2A 1W5SA 4TKLA 1KI9A 1Z4QA 2DFVA 3DH0A 3ETNA 3QMWA 1UBMS 3L8ZA 2AG6A 3ZV6A 4PQEA 2CLMB 1PZMA 4OMDA 1W581 4AMZA 4BKUA 1BVHA 4DSUA 3F3SA 4UVHA 2XZTA 3ZDRA 1LRKA 1MEEA 2Y2UA 1CYDA 4CXMA 1TE2A 3KDPA 2R25B 1G8FA 2OAQ1 3ANLA 2FWNA 2CEKA 4P58A 3P8ZA 1IUNA 1SK9A 5EUBA 3USZA 3ZJUA 1E79A 1SC3A 1YCFA 2FR8A 3LGAA 3K0AA 2CXPA 5KU7A 2A4KA 5CBPA 1RWXA 3MM4A 1K8XB 4NU0A 4RNCA 5KNBD 4IF4A 4HEJA 1J0EA 3NBQA 3FRHA 1OU0A 1JIQA 1F6BA 1RRMA 2ACKA 3R3YA 5K0ZA 1Z26A 1LWNA 4R8RA 2VDUE 3N05A 1WVGA 2QJOA 2QMEA 2AR7A 4HCJA 3FLEA 2EQ5A 5E6SB 1JA0A 1W0CA 5JO9A 1THMA 1IH8A 4QNNA 4Y9SA 1LVGA 3FLMA 3O03A 4YGYA 5G1NA 1VL1A 2PK3A 1PLJA 1IFXA 3MIIA 3Q5DA 1C7FA 2WQ7A 2JJ2D 5KWEA 2GCOB 3R5FA 1ZK0A 4MULA 4EPTA 1GADO 3ICVA 3QE0A 4QWMA 3LA6A 3UKOA 4R1QA 4YDQA 3PJGA 1L4YA 2R8RA 5LZ7A 4U2BA 3F5SA 4HT3B 1K86A 2PGLA 5CURA 1Z82A 2O7RA 1IN5A 4FUTA 2WT9A 1KI1A 4JP1A 1GY8A 1ZGZA 4G9GA 3UANA 2PUVA 2QMOA 1I4OA 4R2KA 3WGKA 1GT91 1OFHA 4A8JC 3DULA 3Q1LA 5B12A 3W7BA 1J2JA 1A5TA 2C96A 4EJ2A 1YS4A 5FTLA 1MC1A 4GE3A 1M2FA 1NBAA 5D6NA 4KB5A 3VR5H 1G5FA 2GN6A 2ZUBA 2Z6QA 2IIVA 3D8UA 3M83A 3LX8A 1ODLA 3KJZA 2NPIA 2HXSA 2FCAA 3TOCA 1VMDA 2DHEA 3URKA 2YV3A 4X6UA 4Q0MA 1NI4B 1V8ZA 1UXHA 3WFZA 1Y42X 3EQZA 3AVTA 3UC5A 3ZWKA 1AZWA 3QKWA 1CP2A 2QD2A 1T9CA 1VKHA 2CFIA 4AROA 2DPMA 2HPHA 2PLWA 3DVAB 4UCFA 1MTOA 2YBEA 2MWMA 3K1AA 4I55B 2O14A 4UUOA 4B7AA 1LBQA 3WLHA 3QKSA 3ASYA 4ND1A 2DLDA 1R0YA 3RVKA 2GEJA 5EESA 4KX3A 2ZJ7A 1KO8A 2AI1A 2PO7A 3RAGA 2WLSA 1BN6A 1M8GA 3B1KA 4H17A 4MV3A 4IX1A 1A8QA 421PA 3QEKA 2FX2A 5BURA 4JLMA 3RJZA 1YA4A 1EGHA 3IAFA 3ETJA 2C1XA 3BBLA 5JC1A 2VHXA 4MUAA 4PSVA 1NPDA 3H2ZA 4UFOA 4HNSA 1Y5RA 5AW6A 4MVJP 1RJGA 1ES9A 3B9BA 4GBGA 2WIAA 5KYUA 1E9CA 2IF2A 4IDOA 4CM5A 4F4DA 3IQDB 1AD2A 2UVPA 4OIFA 1RJEA 4CEIA 3QVJA 1CQWA 5H80A 4FDTA 3EGDA 2UYCA 2C83A 2WABA 3QEOA 3OMLA 3NTRA 3TVYA 3LUKA 2AH5A 4B7CA 1KYWA 1HOXA 1O6CA 1SBNE 1HLDA 3Q8WA 3OLCX 5B58T 4PO3X 2V03A 4CF6A 1PEAA 2QBYA 4IKOA 1ZL2A 4OK5A 4Z54A 2G40A 4MX8A 4Y1EA 3LYHA 1FFXB 3M4XA 5E7MA 3GCZA 4RC9A 1JR3E 3UJBA 3IP8A 3W2IA 3K53A 3HLTA 1BHO1 1KEVA 1QR2A 1ODFA 2FZWA 3BK7A 3ITDA 1E2GA 1SHLA 1PUIA 1U5BA 4CMKA 2WKSA 2GF0A 4KCGA 5FUQA 1KU6A 4WFIA 1FZQA 3WB1A 4UQLA 3V7YA 2C57A 5FO0A 4KE6A 4LRTB 1HQCA 3BJRA 3BGDA 3D4BA 3MRXA 3PNOA 4X85A 3UWKA 5TVGA 3JAWB 5IXSA 3N8DA 1SU4A 1ZJJA 3GG2A 2IEAA 3D54D 2CL7X 4PPFA 5JJKA 2WJ6A 1B6TA 4JASB 3D4PA 1JXOA 4B6GA 1EWRA 1TTPB 3KZ1E 3UHFA 1ENYA 4QLAA 1L7RA 1NVTA 3LJKA 3VZBA 4BU0A 4W1PA 3VZCA 4HNVA 1N32B 1Q0RA 4PO9A 4FW9A 3UQYS 4U9HS 4PTLA 2X4IA 3CUSA 4MCJA 3K30A 4URFA 5KJ1A 3GRCA 5AOVA 5FWAA 1ZQ9A 2DECA 3URMA 3DWGA 2QPLA 4PLGA 1L1EA 3D6VA 4NNOA 5IT4A 4EUNA 3OHPA 3V1NA 1VTKA 1WBDA 4RA6A 1U8XX 4WVFA 2WJHA 1NATA 1BXKA 2HF2A 4PZEA 1GQ2A 4UVIA 1JDSA 4LSGA 5MGNA 5EXEA 3ZD6A 2PX2A 2X76A 5K8LA 4OQMA 2FKAA 1CSEE 3K15A 3ND8A 4JOSA 3FNQA 4URZR 2GHRA 2GBLA 1X13A 2EU8A 3DP7A 2E55A 4AZ0B 2WE8A 4O8CA 1Z15A 1YZ3A 4H15A 2C3OA 5DBIA 3HYCA 4HFNA 1Z63A 1I32A 1VKJA 3QXXA 5GJWC 3EMDA 3TX2A 1QIIA 2IYZA 2ZZKA 4FFRA 1WNFA 4RHEA 3V00A 4BUJA 3OQMA 1JZTA 4OI2A 4RFSA 1EVYA 2R5WA 5EKXA 5JZBA 4LYJA 1H9AA 2P2NA 4MQLA 3KTOA 3UAYA 1AQJA 1FDVA 2X5JO 3SQXA 1T1JA 2CFTA 2QRJA 3F5FA 2J3MA 2D1QA 1OR8A 2YWGA 3D6UA 3A05A 3OTHA 3DYBA 3LCVB 2ODQA 2CNBA 4WBNA 2YZKA 1G6OA 3DO8A 3PEEA 4IVPA 4ND7A 4MB2A 2ZS7A 3HXKA 1BW9B 1WEKA 3ABIA 2ZRHA 2KWIA 2PVSA 3TBFA 5EMNA 4PICA 3VYSB 3WOVA 3F7MA 3GJ0A 4YRDA 4CU5A 5IBRA 1NNSA 2GMWA 4MJ3A 1O0BA 1DL5A 1J00A 1IN1A 4FMDB 2GK4A 3X1WA 3PU6A 3QHQA 1NF3A 3X1XA 3DKVA 4IQFA 2YWHA 1XAGA 3C4QA 1IC6A 4HUQA 2RDMA 4IHJF 4PLHA 4XIYA 1GZHB 4CT5A 4YDHB 2Q9CA 3R77A 4XWGA 4UAGA 3BSSA 2P0AA 1JLLA 1M34B 1ZICA 1EP9A 2BEVB 4XQCA 2P3QA 2BKVA 5DN6D 3U7FB 3G7UA 4X1IA 1YQEA 3AUJB 2F1HA 4LG1A 5T64A 5L40A 5MFPA 1RM4A 4RTMA 4OQFA 4M60A 3EF0A 4RK0A 2ZAYA 3BTOA 4PXSA 2OPHA 3WKDA 1NXVA 3O91A 1H2YA 4I8IA 5B53A 2DFTA 2I1LA 2I8AA 3TLGA 4EMSA 3EC2A 2NSHA 1PHRA 4M55A 3EIEA 4ALMA 2Q5QA 3IKVA 1X70A 3ONNA 2GUWA 4RZIA 2ZM6B 2HQSA 2P77A 1K75A 3EPKA 1GGMA 1ZRMA 6Q21A 4DHWA 4IV5A 1UBLS 3OIUA 1NPTO 4BYGA 1E98A 2ZIAA 2XCRB 2P91A 3EG9A 3WDLA 3Q7RA 4BV3A 4QXPA 3W04A 2AF3C 1KS9A 2AFHB 1RWQA 2OXEA 4DIUA 2GEFA 2ZSAA 3QX8A 3PXDA 3ZVKA 1KR5A 3GA5A 5BN4A 2OKCA 1V71A 3S2UA 4D92A 5EJGA 2HREA 2C2OA 1JEQA 1GWNA 1MEOA 3H11B 1JYSA 1U8FO 1Q77A 2P2DA 4JBWA 1N3BA 1R6XA 3E2PA 2I55A 1KTVA 2PL5A 4KFSA 3V34A 2HHCA 3WB9A 1B0AA 1EVKA 1CCWA 2F43A 1XKXA 2J9YB 1GAQA 3OZEA 3RSHA 3U7GA 1DCMA 1ENPA 4HYEA 1MVNA 5EZ6B 2IOYA 2R8BA 3W8DA 2X9QA 1YFZA 3ZW8A 4B85A 3MCZA 5KKNB 3D2CA 4UULA 1AHNA 3EH2A 2ZVQX 1E9RA 1K4YA 2N0SA 4NK5A 1PV4A 1OI4A 1EGMB 1XZCA 1CULC 1U7HA 5C1IA 3ZLUA 5BSEA 5EEGA 3DC2A 4PC6A 4RMGA 1E2MA 5C31A 2Z98A 3WGHA 2AQKA 4U5XA 5A5EA 4DDUA 3AP1A 2A0FA 4FT4A 4MPDA 2B34A 5ENZA 4DLBA 1FMTA 3P52A 3OJOA 4GRDA 4WZAA 3O4JA 4EKYA 1KYXA 1A5BB 2ZYIA 5KWIA 6GPBA 5KTRA 3QPAA 1F6WA 2NVWA 4YYEA 1JG4A 1PJ8A 1AQNA 4P0TA 3SNHA 5HK9A 2G04A 2JGDB 3E5RA 3HVJA 1QK5A 4GZ3A 1Z0IA 4IJVA 5IAEA 3RNLA 1E1MA 1FSFA 1HLGA 4X61A 5BNZA 1A97A 2EL9A 5CDTA 1BZYA 3SDBA 1OCEA 4HVTA 1SXJC 2KI5A 3P4UA 3RUDA 5AKGA 5IJ9B 4NBSA 2Y66A 2GVDC 2CN1A 4KAXA 4BJHB 2F4VB 3AUTA 4D6XA 1FPMA 1TM1E 4GI5A 2QX4A 1S2MA 2J9RA 4TM7A 3WIOA 2P67A 5TGDA 4ENSA 2PQ2A 1FUUA 5DBGA 1AGNA 1CUBA 1CUXA 4UEQA 5E1BA 2ZRMA 1ML4A 2YX1A 3OU7A 3WX0A 2BDEA 5I3CA 2NO0A 5FOUA 2PGIA 3R5KA 2C9YA 2QJWA 4MKHA 3ENVA 3H13A 4URWR 3TBHA 1Y4ZA 2QQ5A 1CRQA 1RBYA 1B6GA 3E1SA 3QBEA 1Q16A 4BZWA 1ABEA 4BKQA 4LY6A 4D42A 1J0BA 3ZV5A 3FSGA 1E3JA 4MI6A 3TLEA 1Z6TA 1KOGA 2OV4A 2K4MA 3SIPA 2NO7A 4L5BA 1RP7A 2UYOA 5DTIA 4OL0A 3RTEA 2OZLA 2Y1FA 1BC5A 2GASA 4PYQA 4B5KA 4EGJA 2JI4A 2XIJA 4EMBA 4RVSA 1JDZA 4QXAA 1GCOA 1UBGA 1I4WA 2Z9BA 3GMTA 3KC2A 3NETA 2OUKA 2D5IA 1MB3A 1T3ZA 3JQEA 5J1TB 5F76A 3WMXA 4IV0A 5DGTA 5HXAA 4FDMA 2XQGA 1S89A 1M76A 1MT3A 1GPDG 3I3OA 4B3XA 3MILA 3W9SA 3L6RA 1QTRA 3PFNA 4F1JA 1FJGB 2OGZA 1EAYA 2BN4A 2VI5A 4X3CA 4D3YA 1ZC3A 4YJ2B 3GN1A 5PGMA 4KR7A 3SICE 1DAIA 2LKDA 3WMFA 1E5LA 4N6NA 3L1HA 3FFWA 2B6HA 5EKUA 5B2FA 1B6RA 1P7PA 2RB5A 3WHKA 1RXUA 2LNDA 4PTYA 4ZEXA 1EM8B 1I7LA 1MVLA 1X42A 1UJ4A 1J8VA 3QG1A 3TLXA 4D6YA 3ZBQA 2HTEA 1G20B 1DS6A 3HNPA 1BDIA 1NWCA 3NEPX 1FFCA 2WC1A 1FE8A 3LT0A 1Q1NA 1O6GA 2YJ5A 4G6ZA 1DWPA 4DLXA 3KSAC 4I1OA 1ULZA 1WL8A 4EPWA 5K8IA 5H70A 1V39A 1S9DA 2XMZA 1O1YA 1NJSA 4LKOA 3ZS8A 3H7IA 3MOIA 1BROA 5H3CA 4I4TF 3HJBA 4RTJA 3GLGB 3N2KA 2RGAA 2HIAA 4DMLA 3IQZA 1YNSA 3M6IA 4IHQA 4I4IA 1ULHA 4KRXA 1XNJA 1V9CA 1C1DB 1BYIA 3P5BA 4G81A 3FNHA 1N6HA 2VHQA 4CW7A 4E4YA 3D7SA 4K86A 3WJ1A 4KMMA 3DCJA 4RH0A 1LKZA 3CRNA 4EEKA 1W73A 1Q1EA 1W5BA 3ZU6A 2JHCA 5FOSA 3A1UA 4HQ6A 2VNHA 3L0CA 4KPEC 1OZAA 1XHEA 3GZ4A 1VECA 2Z8YM 3RYIB 4B40A 1DINA 4JEIA 3WNZA 2QR3A 4NBRA 4YBRA 5AW7A 3PF8A 3WDSA 4TLBA 4Z0NA 4EDHA 4MEAA 2P6RA 4C2UA 1SZDA 3OBBA 1W36B 3Q41A 3MPUA 1I24A 4PHCA 1XR3A 4GYWA 5ETJA 1HZJA 3VR2D 5AXDA 3KJIA 4F3NA 3ZNPA 2KLBA 1J97A 4OLJA 5FH9A 1L5MA 1PT5A 3KUUA 1X0XA 2ZBVA 3T95A 2IPXA 5JEEA 1YI1A 1C0EA 4AWBA 4UNQA 3I4CA 1YVEI 4QJBA 3EGIA 2VP2A 5H4GA 1QP7A 1M6VA 4UHHA 5EIFA 2I6GA 2OXIA 1II0A 1WOMA 2P7HA 1PQYA 3K72B 3NTOA 3DLHA 1M2VB 4F5YA 2JHAA 3MW8A 1NFRA 4LWQA 3TNDA 1JN0A 3CZQA 2ZPTX 4A8PA 4IYRA 1K7FB 4LY0A 4MKIA 2GF9A 5EXXA 1EBBA 4NFHA 5F3RA 1W85B 1U9IC 2HCFA 4US2R 5BMVB 1KEPA 3HFRA 3U3ZA 2WD9A 1T2NA 2UVDA 2ZGVA 3MD0A 4O6VA 4OB7A 5C1DA 4JUBA 1JE0A 1TADA 4JLBA 4YRCA 5BR4A 1TYZA 4HNGA 1G59A 1L3BA 3D2LA 5K8UA 5DOZA 4PANA 5HZGA 4YP0A 4WJZA 3MNFA 4QUDA 2RFLA 2Q0XA 1V1JA 4OA5A 3AM1A 5CDFA 3VDMA 3G5TA 4E6PA 1TQ2A 2QAGC 2CY0A 2ZI3A 4JS0A 1ZHFA 2G1PA 3LHKA 4LV8B 5K3SA 1QSGA 4TYWA 4RMJA 1VC2A 2XEXA 2AN4A 4LMPA 2V4ZA 1SBQA 2O6LA 2VYND 4BAUA 3NVDA 1P6UA 4PRKA 2BGIA 1U0OC 1NXTA 4RF2A 5P21A 4ESOA 1N2CE 2SKEA 5A6SB 5GP1A 5LQJA 2ZEJA 3CLSD 4EHDA 3A2LA 2WJ3A 3Q3EA 1NG9A 3SSAA 5CTJA 2M32A 2VEDA 2Z2KA 2WJPA 5K4AA 3C3WA 4LJ5A 1E2BA 1RWVA 1CR4A 1US8A 2GJ9A 1COWA 3DL4A 1EK1A 3FWHA 3OZSA 1E0KA 4M4SA 4B31A 3ERCA 1EP3B 2Q5LA 3CEHA 3E7PA 4DOMA 1OKKD 5FWXA 3HXOA 1L4NA 1QQ7A 1N7JA 3F6EX 3OU2A 1Y8RB 1J07A 5DBEX 5DHTA 4YWHA 1IBSA 5T4HA 3WNDA 3OQPA 2DETA 3UMGA 4HDKA 1GRCA 3OF5A 1U8CB 1GSOA 1A96A 2BFEB 2C88A 2RGUA 4TKVB 2BTQB 1OFUA 1XZQA 3UUFA 1JPNA 3JQ8B 4GPBA 2NSYA 4PBTA 5B30A 4I6JA 3N2ZB 3L8FA 2WMYA 3SGLA 4DIMA 4DR7B 1JEEA 2AHRA 5TEVA 5DGCA 1V8DA 5BQPA 1PZNA 1NI3A 2VP4A 5TPZD 1Y48E 2R5FA 5THQA 3CJQA 1NAHA 3IUYA 4V2UA 4KR6A 721PA 3OOEA 2PZMA 3R4CA 1KFJB 1SUWA 1ZIXA 3WYAA 1G55A 1MMFB 3GJ5A 3KYDA 2Z6VA 4PQGA 4QYXA 2ZANA 1JECA 2H52A 4XUEA 4H7HA 4QNRA 4R98A 2EGGA 4UMVA 1L7XA 5JSHA 4WLNA 3VR6A 3A4LA 1UWCA 1M6HA 5KUTA 2YVQA 2FH5B 4PAMA 1IY2A 1V1RA 1ZNWA 3FYHA 3GA0A 3IULA 3GGGA 3MCVA 5I4CA 2P30A 2HQ1A 4IVRA 4E12A 4EB8A 2YRFA 2O8NA 4RSRA 1SOMA 5CUQA 3NRJA 4KV7A 2G9ZA 1KOFA 3WWZA 2FMKA 2PGXA 4GQIA 4N8SA 4B3IA 1E2HA 1A0OA 4RK1A 1DUIA 2GWRA 2IZ0A 3H2KA 1NQWA 3IT2A 3D59A 2WG0A 4LFAB 4ALNA 4C08A 4RXMA 2O59A 1DX9A 2FPUA 5DTEA 2XUFA 2CD7A 3PD7A 3LKVA 5T4EA 4AMUA 1KEEB 2F8LA 1O97D 1P77A 1N0IA 1XA0A 1RZRD 2UYHA 3MJ4A 4JXZA 3PFGA 2B4QA 1AUOA 3HJRA 2IXTA 3OZFA 4FZVA 4XASA 4YLEA 5AI9A 5AK3A 3O4VA 5IKEA 5KMGA 3NAMA 3N2EA 4QUKA 1TEVA 3B6KA 4MKRA 4NESA 1W2GA 2GX6A 2OAP1 1QKJA 2WM2A 4NNPA 3EA5A 5E6RA 3N8GA 4B6OA 1U3TA 4H6VA 1K1EA 1W88A 3DJYA 3W4KA 1W49A 1HTWA 3AL0C 5H1YA 2I6QA 1AGYA 1TK2A 4O4JF 3T61A 3SS8A 1UBJS 5AR1A 2B30A 3ENQA 2JASA 3LK7A 2AJBA 1WPRA 3I2JA 5TR9A 3W2TA 2AJTA 4PSCA 3DMPA 2GH1A 4QEKA 4ZVOA 5MDHA 3ADPA 4M54A 4YRIA 1JAXA 3G9ZA 4AUNA 1YJ5A 4FFBA 4NL4H 2EFHB 5F7JA 2XQIA 1K7XB 4JAVC 3WK4A 4P3XA 4Q02A 4EGQA 3CF6R 5LCXA 3OICA 1U3UA 3UUWA 1VKZA 1V3UA 3D31A 1RD4A 1KKMA 3P2MA 5FOVA 4Q6WA 2QRUA 5JTUA 3HMKA 1KYIA 4QSMA 4Z0HO 3V9PA 4CM8B 1XU7A 5LKRA 1KEWA 2X6QA 4L74A 4FFVA 2I1VB 1WMFA 1VFPA 1I2MA 5E1DA 1HK7A 3AW9A 2XCOA 3EIHA 3IVXA 1VBKA 3KYJB 3UJ7A 3EWIA 4AN0A 2RK3A 4A15A 1YIAA 2O0MA 1O57A 1HF3A 3TNYA 4CMJA 3H1PA 3PG5A 1WA5A 1TCUA 4H4CA 1FY2A 5FA5A 3F7OA 1Y34E 2C2ZA 1YZKA 2P6UA 3P9IA 2JAPA 1Z5PA 1CDZA 4HAYA 4PLCA 1E63A 3EGOA 4ZT4A 1L1QA 1ONBA 1Y1LA 3A4IA 4Q24A 1YNOA 4L3WA 4AN1A 2DPHA 3LXMA 1OBOA 2XYHA 1H69A 2GAIA 3CMMA 3GGDA 1SC1A 4L8YA 2M9MA 4EFLA 4F93B 4DMUB 3WZMA 3W77A 4DCSA 1GPUA 4L02A 1JEAA 5E6UB 1PN3A 1F4LA 4W99A 1TQ6A 1XNGA 5AVQA 1B3RA 5KSPA 4F3YA 5FYDA 5AJTA 3FDXA 4HQLA 1MC4A 2C97A 1VA4A 2PAAA 4I9HA 2YBDA 1RWOA 3EQ9A 1Z35A 2ATXA 2D2FA 2ZS8A 4HS4A 5C4IA 3NC4A 3PP8A 2FG6C 1F12A 2QGZA 3JQDA 1MW8X 2HUPA 5JXWA 3UFXB 1TVKA 2A1IA 4ZT2A 3WNCA 4B6SA 4J0FA 4UMEA 3C0KA 2ZRIA 4A91A 1T3HA 2PTGA 5AHRA 1H42A 2C3MA 2QM0A 1X1AA 2R1UA 3DZCA 4KXXA 1U8TA 1JQLB 4N40A 3GROA 4CM7A 4II3A 4V0NA 2QMUA 1K7EB 1NF2A 4BQEA 1BDHA 5KNBH 2BFBA 3E3NA 2H51A 4P8RA 3HBLA 1RR6A 1H5UA 4LXTA 2WKRA 5ALXA 1CR1A 1PVDA 2BEUA 3LNCA 5JMWA 4UEJA 4GUAA 5INTA 3JQAA 4QHSA 1HDIA 4YO7A 2A9KA 4HB3A 521PA 2HA5A 3D8RA 5KOYA 2CJFA 1U63A 3IIEA 3GPCA 1SIOA 2AN9A 3MFYA 2GYVA 3FDZB 1L8QA 2HK8A 4LVUA 3A26A 3F5QA 1XWFA 4RD6A 1TZKA 5JQGB 2PN1A 1TTTA 1E8NA 4RPIA 4MGYR 1LGYA 2O57A 1IXSB 4LS3A 4NDZA 3UWDA 4BNZA 4Z3OA 1BH2A 2OV6A 4KIGA 1EYZA 1KQNA 5CLJA 1HNZB 1P1BA 5AI6A 3CKYA 4LE0A 2NP7A 2Q9BA 4NONA 2J3IA 2GUGA 4RQTA 3WLIA 3EFHA 4B84A 2QTHA 1X9GA 4ZT6A 3PUIA 2NZJA 2WSBA 5JJLA 4WKBA 5HPYB 2INGX 1PWZA 1GJRA 1E1QD 2ZIXA 4IIJF 3FFTA 1E7RA 1G3UA 2UKDA 2XBUA 5JISA 4R7ZA 5M5BA 1NU6A 2B98A 2HA7A 2XUGA 4TMWA 4UE2A 2OECA 3S1SA 5AVYA 1PR9A 1LS1A 1ZXLA 1MB2A 4M9CA 3IERA 5AKYA 2Y0DA 3D6JA 3SIXA 4NYMR 4EJFA 1LJUA 1AUXA 1T0HB 2VYCA 4EJMA 4GOND 2O2DA 5EZQA 1ISHA 4J1TC 3FETA 1XYGA 1G8SA 3LTEA 5BV1A 3HBFA 1P3DA 2LKCA 1ST2A 4MJ7A 1OI3A 4F2GA 1L7VC 4FZRA 4F6LA 2AQHA 2Y76A 4M86A 1X9IA 4X20B 4YJKA 1EHCA 1R0XA 3BEOA 2VZ9A 3MTBA 4MVJF 4Y8VA 5IDYA 3O4FA 5CVVA 5AOAA 4BZQA 4YJGA 3WGMA 4ZQGA 1H6BA 2EKPA 2NTNA 2RHTA 2PUFA 3INTA 1G21E 5BVGA 1DGQA 2KYRA 2V0GA 3FZEA 1VP3A 4QOEA 4PZZA 3ZVNA 5HF9A 4HH3C 4C2AA 1EQUA 3G68A 2RHCA 5AW0A 4G5XA 1CQJB 2EKQA 5AI4A 1UR5A 1YB4A 1QWOA 2HWKA 4FGSA 4PYMA 5D7NA 3BWMA 5ALGA 1ECPA 1ICIA 4LDNA 4DAEA 1T1SA 4JKYA 2AMFA 1X8JA 4ZYVA 3BF7A 3KPWA 5DT2A 2G07A 1OXSC 3FIUA 4GVLA 4QUIA 1ZM9A 1QQTA 3OKAA 5FLYA 2JGIA 2F7SA 5D00A 4R1OA 2EKLA 4P33A 5BWNA 3IPRA 1ZZGA 5K6RA 1QQ6A 4RWZA 3DGFC 3HHPA 4HTAA 2GN8A 3TSCA 4UTXA 4F86A 3AF6A 4F8YA 1KPHA 1MOZA 1AE1A 1JQAA 1XT6A 3ESBA 5KVVA 5EJ9A 3IT1A 3OEHD 2HJHA 3KHUA 2AW3A 4X6YA 1A8IA 2JG3A 3WBKA 4R7GA 1E4OA 1U5AA 2WTAA 3MT0A 3EWNA 4Z1MA 3W2FA 4UM9B 2QSJA 1EWVA 1UMCA 4KPUA 4M6WB 5C80A 4J2HA 2MSLA 2YIMA 4Q1DA 5FPTA 4DQVA 2LBPA 4UQPA 4QTYA 1JBEA 1U31A 1NVXQ 3KFLA 3RNOA 2D1FA 2XWQA 2X4DA 3A3YA 4O4LB 5GIOE 5BW8A 2TSYB 4ND8A 2QR5A 1XROA 3SC2B 3BERA 1DG3A 1DIBA 4LJLA 3IBYA 4AP6A 4CIAA 3SVTA 4N1AA 5UKDA 1JLRA 3PJEA 4KREA 2DZDA 3AEYA 5IKPA 4DPKA 4E0BA 2DFNA 4JC0A 4DKXA 4B09A 4B71A 2HAEA 1O77A 1K8RA 1Z2AA 5DSZA 4U9IS 1K7CA 1R9NA 2HJSA 2M6RA 4JT8A 4NH4A 3RGWS 4C78A 1TJPB 4HLDA 1FLDA 4LHSA 3FYDA 3T7CA 3PQCA 1MJ5A 1Q0TA 1M10A 1LTQA 1M2NA 4Z9BA 3ZE8A 5EG5A 4E09A 1NJGA 2K5UA 2ZDQA 5FL7A 5THKA 3R7WB 1V6CA 4REQB 2UUBB 1FZTA 4PAWA 3CJRA 3GLHB 3CV3A 2VZLA 1NVGA 3CF4G 3ZXXA 1R3DA 4QHTA 1VJ5A 4TPKA 5CBPB 1EX6A 1MB0A 2NVOA 1C0IA 1E4EB 1SKYE 2ISQA 1EFPA 1JJAA 1NVDA 2Q6TA 5KJEA 4ZIRA 4OMUA 4HX9A 4DLSA 1U0NA 3CLUC 1SULA 3IEUA 2C5HA 4FOPA 1Z4LA 1ZK4A 3ZHRA 5JLJA 1Z7GA 2JLAA 3DEKA 3RSCA 5BORA 3VZPA 2VRCA 4OQ4A 1H93A 1Z34A 1Z6AA 2ERCA 2TMYA 3PD1A 4G5FA 2JS7A 2Y71A 4L8VA 4OHBA 4A0QA 4V1CB 4BO1A 4P4GA 3GBVA 2BDUA 4KSYA 4E5MA 3VR4A 1B0ZA 1PLKA 4AJEA 1I6WA 4AT1A 4J8PA 4HNTA 4HFMA 2R1TA 4PO1A 3UQZA 4Z4CA 5FYQA 4J1NA 2JGEA 3KPVA 4QELA 4D82A 4YV2A 1I4DD 1JXQA 1G9SA 1ZN9A 2VTVA 3DBVO 3T38A 2AOWA 3UMVA 2F8SA 1QCDA 3PDCA 4H2DA 1CU1A 5F9FA 1MB9A 1MIHA 3E48A 1OJ7A 1ZNQO 3R2JA 4UBJA 3WIEA 1MO3A 1K0UA 4IQ4A 1X1DA 3KL4A 3LKBA 1W4LA 1XRQA 2R62A 4K9KA 4OG2A 4U7JA 3ZWPA 4YCSA 5IT5A 5J4LA 3DD1A 3X2SA 3UXHA 7GPBA 1G19A 1JHPA 2DRIA 1J2UA 1U1CA 4ZFNA 4CQLA 1F2TA 4EQZA 3IO5A 4P80A 2VHZA 2ZUDA 2V7WA 3P2YA 4GSKA 4JNCA 2W8BB 1XF9A 3WQQA 3ZWXA 2ZE6A 1JHMA 4K26A 3WKAA 4RVOA 1XAIA 1Y6FA 1WB9A 1MG0A 4UM9D 2XHZA 3HKBB 1OXMA 3RTBA 2BCEA 2WTMA 3W1EA 3CN7A 2PXXA 4QC2A 4NAVA 3NANA 4UBNA 2X9LA 3R0JA 3TL6A 3VUEA 2V4MA 4U0KA 3LFUA 4C7VA 3DVRX 2WNIA 3FLAA 3JWIA 4P32A 2IP2A 2ANCA 4N0QA 4EY8A 1EFUA 5KCZA 4OVKA 4RIIA 1O3YA 1TM7E 2GFIA 1B8VA 3HKEB 4Y2VA 1AY0A 4BPRA 4ZI7F 3CTMA 3OLWA 3RHFA 1ABBA 3QKSB 1AIPA 1NR1A 1OPXA 1SVKA 1U2RA 3D6FA 4YRTA 1X7XB 2FK8A 2OP1A 4BMZA 5IASA 2D1YA 5LBUA 1QFZA 3C14C 5CXUA 3L4EA 4GO1A 4Z99A 3NJ8A 4OIMA 2DLNA 2CF5A 5YASA 4RK4A 4J4BA 1SHJA 4P31A 3K5PA 5DF1A 4BP8A 1C41A 1UKZA 5FBQB 3V80A 4GLFA 5CXXA 2R68A 1WZUA 4HN2A 1Z2NX 1FSPA 3T1OA 2J8ZA 1UK9A 2PBLA 1SG9A 3NVAA 5HIKA 4CEIB 3VGPA 3N2LA 4DIOA 1TT5A 1G6KA 1SCKA 1T4CA 2GHQA 3FROA 3QYAA 4MYRA 3F3YA 4NI5A 1JL3A 1TMOA 2NVBA 3U37A 3OY7A 1Y4AE 2QBYB 3CEPB 1E2KA 4Q3CA 3SBDA 3LXRA 1BX1A 1HSZA 5A3QA 5A5DA 3RYCB 1IUOA 4YRMA 3OHMA 2QWXA 3JRNA 1JH8A 2XNHA 2R6JA 4NDNE 3NDRA 5ER6A 1KE2A 4FDVA 5B1EA 5DNYB 1X7YB 1HMYA 4H6PA 2QLMA 4L4UA 1SB8A 1FA9A 2HLDD 1JHXA 2XKJE 4WLEA 2ZJFA 2HA2A 5L3VA 3LQYA 1GG5A 4G9BA 2WB2A 1PEKE 3ILHA 4KWCA 4P3KA 4QYSA 2QXYA 3OLQA 1XZBA 3BMCA 3AFNA 2QROA 1PR6A 4MQUA 4OQDA 4UZSA 4I5EA 5BWCA 2EWMA 3EIQA 1AMNA 3FHTA 1F0KA 3GUYA 4XIFA 5AW8A 1U8YA 3V2GA 2GILA 4ALKA 2WAMA 1G9TA 3EZXA 3PHIA 1FNMA 4BTLA 1EEHA 2C0PA 3RS3A 3G2NA 5AKLA 1LTHR 4MP8A 1RBMA 1XCJA 5IYZB 2G08A 3O2QB 5AHOA 4EG1A 2PL9A 1IEVA 1AOXA 3A9UA 1LDEA 3I92A 2WFLA 5CVUA 3KD2A 2JFOA 3B3GA 2A0WA 4CF7A 3OU6A 3DDZX 3H1GA 4D7AA 3D43A 4QGBA 2CLOB 3UK2A 3HO6A 1XTIA 3E9DA 3OT1A 5FADA 4HR7A 2H2IA 2FV8A 3UM9A 5CX4A 1PDWA 5DNVA 3DFFA 3RAEC 2QQEA 4ITUA 1MGOA 3CNLA 1R0RE 2ECQA 1J0XO 1SBIA 5T57A 4KPFC 1L5YA 2VJYA 2FN3A 4KO2S 2IW1A 1Z5UA 4YLYA 3HJCA 1MG5A 2HIMA 2JFXA 2JL1A 2WDPA 3S29A 4BZZA 4PFQA 4AZVA 4BOYA 5KYWA 1G8PA 1QF9A 4ZPXA 1Y81A 2ATEA 3ROGA 1HWYA 3RFFA 3PITA 4PPQA 4ETIA 4IZIA 4OGGA 3UWMA 1GAJA 1M1NB 1RIFA 1Q7CA 5CT6A 1NNEA 1HEYA 1QAMA 4JJGA 4BAZA 5CDUA 3DV0A 1GGEA 2P35A 1F2VA 4BJ6A 4Q1VA 1KJNA 3PUJA 1J4AA 5EHQA 3EAFA 4RH3A 4D44A 4JCCA 3U17A 4YONB 3TINA 4RFVA 2XUPA 2V7PA 2X5NA 4F85A 1MORA 5A7FA 2VTEA 1QYDA 5ES3A 5EJ5A 3TL3A 2QVCA 3ASZA 1MENA 3KE9A 3V3TA 4DG9A 4DCGA 4HDMB 5TMEA 1MNAA 5CG2A 2XCTB 3ZJTA 2TMDA 3HM9A 1GQOA 1HEUA 1ZOLA 4HQ0A 5AESA 1RVDA 3CSSA 1QONA 1AQIA 2CHGA 2YJTD 4IVQA 4D56A 1GPJA 4PRZA 1PR5A 2H2HA 1AZSC 2HLNA 1WKBA 3EZNA 1T3LA 3VH2A 4BB6A 4WOKA 5CT5A 3E61A 4MTLA 3N87A 3LQQA 4GEGA 4CIBA 2JDIA 5HNKA 2Q5OA 5HUHA 1N2CA 3WGGA 5IXYA 4FN4A 2FCRA 4G0VA 1MOQA 1NJ8A 2FPRA 3I76A 4IHJA 1HZZC 3UNXA 1VPEA 3SPXA 5A3RA 3Q7QA 4K0KB 1WZCA 1S3FA 4B17A 4DZTA 2Z1MA 3ZDAA 5A06A 3IOYA 1F2UA 3WL7A 4AS2A 2B36A 4TQAA 1JS1X 3GUHA 4YJ3F 5CHEA 3WDKA 2ZXUA 3ZJYA 1R50A 4CHGA 3I61A 1QG0A 3JR7A 4ZQEA 4D9EA 5I5GA 2QNBA 3PQ4A 4AMYA 3QXGA 3O26A 5DW3A 1WZEA 5FFMA 1CDEA 4FDUA 3MAJA 3GJZA 5LC1