2GN4A

Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadph and udp-glcnac
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
329
Chain Sequence
QNMLDNQTILITGGTGSFGKCFVRKVLDTTNAKKIIVYSRDELKQSEMAMEFNDPRMRFFIGDVRDLERLNYALEGVDICIHAAALKHVPIAEYNPLECIKTNIMGASNVINACLKNAISQVIALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQFSVVRYGNVVGSRGSVVPFFKKLVQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRMHGGEIFVPKIPSMKMTDLAKALAPNTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLTKLHEKGQKVAPDFEYSSHNNNQWLEPDDLLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords UDP-GlcNAc C6 dehydratase
publication title Structural Studies of FlaA1 from Helicobacter pylori Reveal the Mechanism for Inverting 4,6-Dehydratase Activity.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 111
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 4.2.1.115: UDP-N-acetylglucosamine 4,6-dehydratase (inverting).
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gn4A01
3.90.25.30 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase; domain 1 2gn4A02
4BHTA 5EINA 4J2OA 4A7PA 3PJEA 2Q1TA 2NVUB 3RSHA 4PLFA 3OETA 1DFIA 3M2TA 4Z0HO 3UHAA 4LVUA 3PZBA 3CXRA 2Q2VA 1CEQA 4B4UA 1N7HA 3ZH2A 1PS9A 3GHHA 3EW7A 1Y8RB 1OZAA 3CZMA 1E6EA 1PR3A 5TJ9A 2WSBA 4JXKA 4YRAA 1DOHA 4BO3A 2GZ2A 2X23A 2W4QA 1GTMA 1YDWA 3BHMA 1JDJA 4YDRA 3WGZA 3SEFA 4MIEA 3ROPA 3FCOA 5LCXA 4XQGA 3RFXA 4GKVA 3DMTA 3MJSA 4IY1A 4CLRA 2WE8A 1I32A 4NU5A 4IXWA 2EV9A 1RM0A 1EUZA 4XYMA 4NR0A 4DBZA 3I4CA 3ROKA 2GO1A 2P2SA 1SNYA 1EK6A 1N9GB 3I6QA 4IDGA 3GMDA 2OL4A 1ONNA 4OHUA 1YJ8A 1DFGA 2BFPA 4UAGA 1GCUA 3GH3A 3P19A 4NFHA 1LSOA 1F8FA 4OOEA 4Y6SA 4HY3A 2P9CA 3LF2A 3BTUA 4HP8A 1GQ2A 1U9JA 2VUTA 4WCDA 1UUFA 1AUPA 1BVRA 3WNQA 3KTDA 3DMTC 4MDHA 5A5EA 3WIDA 3SJUA 5CAEA 4BUCA 5L4SA 1YL5A 4H3VA 5G2OA 3DZFA 1C3VA 4L76A 5CDYA 3Q9NA 4C7KA 4RDIA 3E9QA 3LZ6A 4FPXA 3Q2KA 3HDYA 3CTMA 4YCAA 2D59A 4J7CA 1J6UA 1ENYA 4YT4A 1U3UA 3AUSA 3FWNA 4EJ0A 3NV9A 3PK0A 4CQLA 1H2HA 3RC2A 1PGPA 4O63O 4PG6A 4E32A 1LSUA 1SO8A 4NBWA 2DVMA 4ALJA 3RUHA 1P1FA 3OHSX 1VLLA 3GDGA 5I7SA 4PLGA 5JE8A 5JYDA 4GSKA 4DWVA 2VHVA 3JQ8B 1AXGA 2VYNA 3M2PA 3OEYA 1V9LA 1UXHA 3DBHA 4J7UA 4BKUA 2DTEA 4E5YA 3UICA 3MJVA 4DPMA 3GGGA 1NR7A 5G4LA 3VHRA 3WGGA 2Y1EA 5IZ4A 1JA9A 1KEWA 1BW9B 4GWGA 1XGKA 2EW2A 3UOGA 3ZZNA 4B3IA 2GGSA 4DYVA 4E5PA 1K89A 1C0IA 1XEAA 2FPPA 2AXQA 2FN7A 1QP8A 4OL9A 5IXYA 1FK8A 4FB5A 1A4IA 4WNCA 1K2WA 3N58A 2YUTA 4I08A 3RASA 2DBZA 2DFVA 4EEZA 3AY3A 2VYND 1EVIA 2Y67A 3F3SA 1XQ1A 5JY6A 1PJTA 2B5WA 4CLRB 1HT0A 4HV4A 3WBFA 5EMHA 1GFSA 2BD0A 1TA4A 1MGOA 4J7XA 5MGBA 2Y0DA 4RDHA 4CLHA 1S6YA 1LU9A 2EP5A 3K96A 1HYHA 3HSKA 1NHGA 5BNTA 1ULSA 4RVFA 1PTJA 3JQDA 2PWZA 1AE1A 2Y93A 3B1JA 1U3WA 3EGOA 3V8BA 3ZW8A 4FFRA 4DRYA 2GPTA 1PX0A 1VL8A 4BV8A 1QR6A 2QW8A 5CPBA 4R3WA 1Y1PA 4ILKA 3IMFA 1DIBA 4W7HA 1OBFO 3U9LA 2C29D 3ZV4A 2WDZA 4KZPA 3JD1A 2VZ9A 4Q9NA 2UDPA 1YBVA 4QFDA 1ADCA 3EAGA 4YRBA 1FXSA 3KSUA 1VC2A 1TT5A 2P68A 1AHIA 2O3QA 2EP7A 3GUCA 3JQAD 4GVLA 4CQLB 2DTDA 2ZCVA 1NPDA 2CVOA 4XGKA 2FMUA 2LDBA 1GY8A 2DUUA 1OOEA 2G0TA 4N7RA 4RPJA 3PJFA 1PSDA 1DRVA 2P4QA 4ALIA 1VJTA 2ZYAA 3A28A 3GVIA 3ONFA 3O4RA 1PJ4A 2ZATA 1I5RA 3PDUA 4J90A 1D1SA 3ON5A 5H83A 1F14A 3DBHB 4CM4A 1IHYA 2RIRA 4AL4A 4ND5A 5KIAA 1ZH8A 1O9BA 2SCUA 3R0IA 2P5UA 5TQVA 4R3NA 3V1UA 1V3TA 4WLUA 4HWKA 3DZHA 2NU7A 2DPHA 4TRMA 1KEPA 2ZTMA 4B4WA 1IOLA 4CMCA 2PLAA 3RVDA 2VN8A 1MP0A 3NTQA 4FFPA 4RJTA 1AHHA 3PHLA 5KWEA 1PGNA 1GPDG 1T1SA 3PWZA 4DPKA 5F1PA 1CYDA 3EMKA 4TROA 4F3YA 5IF3A 2DBQA 3WFIA 1QYVA 1DEHA 2OFPA 3QVXA 3DWFA 4UEOA 1R4MA 1N7GA 4E2XA 1EDOA 3HDHA 2HLPA 2CDAA 5TGDA 2FOIA 1C1DA 4LSMA 1QXSA 5ICMA 3IAHA 1PGQA 5C3MA 1PQUA 1RJWA 2AMFA 4IINA 3GUYA 1H6DA 2QG4A 3WGTA 4AFNA 3DZKA 4WKGA 3PRJA 5F3RA 1HSOA 4MO2A 3U4IA 1JVSA 1MXHA 3I4FA 2Z1MA 1BDMA 1GL3A 4L8VA 1QYXA 5CFZA 4EGFA 5IG2A 1WWKA 4RZIA 1LDEA 1W73A 1E6WA 1L7EA 1PJ3A 4U8GA 3N7UA 5U1PA 4E30A 3HE3A 5DT9A 3A06A 4GX5A 4QEDA 3IC5A 3IL2A 3QRWA 4XDYA 4CMEA 5IDXA 2I9PA 1RKXA 3H9UA 3LU1A 4Q3EA 2EKLA 3DTYA 1WMBA 2HKIA 3QWFA 4ZA2A 5TC4A 3RFVA 1XYGA 3FNEA 4PGFA 1F17A 2Y99A 1JLLA 4NBVA 4UUOA 3ICPA 5HS4A 1YXMA 4EZBA 4PN3A 4UEJA 1DC6A 4CM4B 1YJQA 1W6UA 2B35A 3PJDA 3VPSA 2P5YA 2R2GA 3U4HA 1B3RA 3P5SA 4NJMA 4K6CA 2AA3A 2DTXA 4FBGA 4XB1A 1B2LA 1JTVA 3GK3A 1N2SA 5COBA 4DBVO 4KTTE 1I3NA 1EQ2A 1BTOA 4GKBA 4IJVA 1PJQA 4AICA 3K6JA 3KEQA 3W4KA 4AJPA 4LK3A 3WFJA 1DRUA 1Y8QA 1BHSA 4EUEA 4DIFA 3F1LA 2I66A 3GEGA 5F1KA 4M54A 3JD2A 4UVDA 1T26A 4MINA 3ITKA 1YQDA 3VOSA 2HO5A 4E5NA 2C54A 2Y0EA 4JROA 1DIHA 1MFPA 5HBRA 2OMEA 3NTOA 3JYQA 4J91A 1KEUA 1R4MB 1DIGA 3M6IA 4IXTA 1B8PA 5A9SA 3STHA 4CLEA 1C1DB 4E2YA 2AE1A 1WZIA 2DLDA 1FDWA 4WLEA 3QV1A 3MWEB 5KJ6A 3D3EA 4IJWA 2Q50A 3AOEA 1NASA 5IZCA 1R4NA 4JJGA 2BI8A 5B37A 3O38A 3OJEA 4N18A 5IAAA 2ZB3A 1KBZA 3DOJA 3IKVA 2A4KA 1GYPA 3QVWA 1CF2O 3ZWXA 1GYQA 4TRNA 1GZ3A 3I9JA 1E3IA 3JTMA 4NI5A 2HMSA 4B8ZA 5A05A 1WVGA 4FIZA 4Y8VA 1Z74A 4DLLA 2NADA 2WJPA 1I8TA 2UV8A 4BKOA 5GZ6A 3AOEC 3F6YA 5IZCC 4WASA 3WGIA 1ONPA 2J3JA 3JQBC 4GL4A 4NG5A 2J3HA 5TT1A 3ZCXA 4KQWA 4DUPA 3F5SA 3BTSA 4LISA 2VCYA 4JQCA 1TEHA 2NU6A 1LDYA 5A03A 1GPJA 4RVUA 1HE4A 2HK9A 4CPDA 4YXFA 3QVOA 4BO5A 2PD4A 1DHTA 2BI7A 3CH6A 5G0UA 4NJMB 2X5KO 2YY7A 3PDJA 1BXGA 2XXBA 3FBTA 5EIOA 4Z9XA 5CDUA 1U5CA 3WWZA 3ZHZA 3OF2A 4DPLA 2JFGA 1SEPA 2PKQO 3PGXA 2D3TA 3EDMA 4OXYA 5KVVA 2BMAA 3H7AA 4AJNA 3WGYA 2W2KA 2ZTUA 4XRRA 5AVOA 3RU9A 3K9QO 2YQ4A 2AEMA 4PG4A 4BNJA 3I52A 2ZQYA 4E2ZA 1ZXBA 3AI3A 4CMIA 1Z7EA 1A5ZA 1E7SA 4IDBA 1DAOA 3VZRA 1ZW1A 2BF7A 4Z0PA 2YDYA 1BWSA 3DC2A 4BO8A 4TKLA 1ZK4A 4ZQGA 3KOUA 1O89A 3G79A 1NPYA 2I5PO 4DC0A 2QZZA 1DIRA 4DA9A 4IGEA 2VHYA 4FFMA 1SB9A 3OJFA 5A9SB 2NVBA 1N1EA 2ZTVA 4ONEA 4AVYA 1ULUA 5THQA 4M49A 2O7QA 2AG5A 2GN4A 3RJ5A 4H7PA 3ZU4A 2B37A 2GN8A 1UJMA 2EF1A 2ZYDA 1I3MA 1DC3A 4CMHA 4AJ1A 3ADPA 1ISFA 5KOIA 2WD8A 5BSEA 1ADGA 1R4NB 2H1SA 2A92A 4ITUA 1NNUA 4ND1A 3X2EA 3JYOA 3QA9A 5KTKA 1HEUA 3GDOA 1ZO8A 1NP3A 4E6PA 2P9EA 1H6AA 3RAJA 1BDBA 5A06A 3BMCA 4NQZA 3WYCA 4IM7A 2X8LA 3PVZA 2B4TO 2V6GA 1Y5RA 4AJHA 4I1IA 1BRMA 2OHXA 3H8VA 3P2OA 1P0CA 4CMKA 4FR5A 2DUWA 3CE6A 1JN0A 3NTRA 5IFLA 2FR8A 3VH1A 3JQFA 4WLNA 1LQTA 2RCYA 2PA3A 3LQFA 1IE3A 2E4AA 4Q3NA 2J8ZA 1YB1A 3KYDA 4IQ0A 4KP7A 3LDHA 1X7DA 4NK5A 1A7KA 1C0PA 5F21A 3SBOA 4EI2A 4Z9FA 5L7WA 3RROA 4A73A 1PGOA 3QSGA 3D7LA 1HSZA 3W6UA 3DBRA 3L6DA 3S2EA 3G1TA 1KVQA 3U62A 3SLGA 4W4TA 1BXGB 3FD8A 1I3KA 2NTJA 1LDGA 4BNKA 3GOHA 4K6FA 3GHYA 3RWBA 5IJZA 1HF3A 2AQHA 3DZBA 1DDOA 3K2BA 4FCCA 4RVGA 2J5KA 2Q2WA 4R51A 3JD0A 4I5FA 4MP3A 2EGGA 4OH1A 3FNFA 1GUZA 3JCZA 5DOVA 3PLNA 2BFAA 4GSLA 2W2KB 3FSRA 3VPXA 4XZ3A 4L9RA 4MVJF 3RC9A 3WMXA 2WTBA 4TVBA 4OOFA 4YJDA 3V5NA 4MVJA 4CMIB 1E7RA 2Z95A 3VAZA 1PL6A 1QLHA 2B4QA 1E1MA 4BNMA 2EIHA 2HJRA 3DMYA 2I6TA 1EVYA 5BNFA 3SVTA 2E49A 2C2YA 1SOVA 1YKFA 4J2HA 4Y6RA 1PJ2A 4FGWA 3DTTA 1HETA 4PLPA 1I0ZA 4R4JA 1L7DA 4E12A 3MOGA 2NM0A 3IUPA 4Y67A 2H63A 4ZD6A 3ZWVA 1Q7CA 4MVJD 2I3AA 4Z3KA 1EBFA 5JO0A 3U5TA 4XEHA 2C82A 2C59A 1QMGA 1PJSA 4JBHA 1HYEA 2IEDA 1H5QA 3BMCB 5BQFA 3PHGA 2X0JA 4FGSA 4YA6A 5DCYA 5TS3A 2WEKA 3UVEA 2E6UX 4R5MA 1R0LA 3AI2A 2C07A 1YL6A 4I9UA 4LCJA 3GVHA 3VVCA 3ZU2A 4EBFA 4BL5A 1ZCJA 1KY4A 2PZJA 2VWGA 1U8XX 3TFOA 1ENPA 4YJFA 3OSUA 4WLFA 2A94A 3KYDB 3UH1A 5HA5A 5H82A 1GV1A 1KVRA 1NBOA 3TZ6A 2RH8A 4DQVA 4WCFA 1WAMA 2C7VA 1U5AA 1B16A 4KUGA 5G0TA 1IZ9A 5L40A 3IS3A 3DBRB 1Z75A 1NWHA 4GBJA 2JD2A 1I01A 3EZYA 3WTCA 4CUZA 5JAZA 2Y1GA 3NT5A 1KVTA 5AYVA 4H15A 2Y68A 2E37A 2X5JO 4XJTA 3FTNA 3R3JA 2IDZA 3GVXA 4WLOA 1GAEO 3ANLA 3D3WA 1JAXA 4W6ZA 3RUFA 3NX4A 5EQFA 5DF1A 1H9AA 5DP1A 2G82A 2HUNA 3HADA 1T2DA 3SC4A 3HB4X 3TSCA 3WR5A 3TQHA 1LBEA 4I8XA 4AJKA 1YONA 2DT5A 4LSWA 4OSPA 5C5IA 3TPCA 4KQXA 1ZSYA 3H9QA 5B4UA 4BNNA 4J4HA 4TRRA 4J16A 3H9JA 4N5LA 3TN7A 3ZWWA 2O3RA 3GGPA 1V8BA 5BT9A 2EJVA 3GRPA 3LVFO 3NGXA 1R6DA 3BTVA 4A0SA 2CVQA 4X54A 3KSZO 3DHNA 1ZBQA 4E3ZA 2OP1A 5DBGA 3TJRA 4ALLA 5A9RA 1ISGA 4UUPA 4YQZA 3RBVA 1V3VA 3JQGA 4D46A 5I7VA 5ENDA 5T64A 4UUNA 4IJKA 2C7GA 5EN4A 3AUUA 4W9NA 5EPOA 3TF5A 3W4JA 1KVSA 2HAEA 5FI3A 4RF4A 1UZLA 4HNGA 4PRKA 3KVOA 1ENOA 1EUCA 1VSVA 3GQVA 3RUEA 4S3MA 1YQXA 4R5HA 1GCOA 3L4BC 4E0BA 1D7OA 1XCBA 5K6AA 4KDFA 5JNLA 2XXJA 3RUDA 1XU9A 2EKQA 3GDFA 4RQUA 3ZWNA 1ZK3A 2FP4A 4O6VA 1PGJA 2YW9A 2OO5A 4YJFB 3ZWPA 1O6ZA 1OAAA 2DKNA 4WCFB 3DFUA 4YYZA 1ZSNA 4KUEA 1T2FA 3R6DA 1UP4A 1Q1NA 4NNJA 3IOYA 3RD5A 3F1KA 2NQTA 1YBMA 3WXBA 1CQJA 4FD3A 4B4OA 1P33A 2C20A 5K6AC 2ZK7A 5JPIA 3R1IA 4JK3A 2O7SA 5K0ZA 2CNBA 3HG7A 4NMHA 3D3WB 4D44A 3OFSA 3RUAA 3NGLA 1NAIA 3VH2A 3PWKA 2H9IA 6ADHA 3ZWBA 3ZDFA 5AXCA 3WB9A 4FFLA 1Z6ZA 3VZQA 4BNHA 5A5FA 4EW6A 3PFWO 4WEQA 1PEDA 5JW6A 3RUCA 4MKRA 2NACA 3LF1A 3QWAA 4RPLA 4GQAA 2PH3A 4CQMD 4CR7A 2Y0CA 1ID1A 3WLEA 3GEDA 3G3EA 2FSVA 2O4UX 2CZCA 2YFQA 3LK7A 4GMGA 2G76A 3JQGB 2P4HX 3NRCA 1T2CA 3RQSA 1V3UA 2VZ8A 1M76A 3OJOA 4QO8A 4RF3A 3C1TA 1TT7A 3FRJA 3VVBA 2D0IA 4WUVA 2O2YA 1QYDA 3CUKA 4JLWA 3T4XA 4OSOA 5HS6A 5ILGA 3KO8A 4WPGA 5FYDA 3GA0A 2HRBA 3PHIA 4PLCA 4OQYA 2PGLA 4WLVA 1XSEA 1I24A 4PLWA 5FF9A 1OI7A 2V6FA 1EVZA 1GUYA 1ZJYA 2WD7A 3DL2A 4FN4A 4C7JA 4DGSA 1E3LA 3L07A 1VPDA 3WX0A 3ORFA 2ZB8A 1R16A 4EITA 1AN9A 2VOEA 2XOXA 2Y66A 4GLLA 4FS3A 3INTA 3F46A 3O26A 4YB8A 1I33A 2AQKA 4TMFA 4BOYA 3HWRA 3TZCA 5JBIA 1G0NA 1HDCA 4HADA 5KCZA 4TQGA 3ENKA 2WMDA 3TZQA 3QVTA 1BXKA 2X9NA 4AJ4A 4NDNE 5ITWA 1HZZA 3DQPA 2RH4A 1WNTA 2UUPA 4YACA 2J5RA 1U8FO 5CP8A 2UVDA 4P38A 1ZIDA 4AG3A 1OC2A 3BHIA 1MUUA 3AI1A 1E77A 1QYCA 2EEZA 1WDLA 5I9LA 2BHLA 3F4LA 4A03A 4DTIA 4BKPA 4CV1A 3H5NA 4IZIA 4TRJA 1LQUA 3JQAA 3PHHA 2O48X 3KV3O 3UW3A 4JBIA 1IZ0A 4IMPA 2IZZA 4NIMA 1ISJA 2ZJ0A 3L0DA 3V2GA 4MP6A 4GPD1 2BKAA 2Y1CA 3GF4A 4DL9A 1DC5A 2FWMX 1Z7BA 3IKTA 4U7WA 2X5OA 3FPCA 1LRJA 2FPIA 4XGNA 3LT2A 4CR6A 4RGBA 2CFCA 3PYMA 4PLVA 1XWFA 4F46A 2IEBA 2Q99A 4D3FA 2H6EA 2R00A 3ANNA 1EMDA 1ZMOA 3I6IA 4L75A 3S2FA 2DU8A 1I2BA 2IE0A 5L7YA 1E1LA 3FR8A 3TL3A 1QRRA 4L4SA 4BNVA 2BGMA 4CMGA 4R9RA 4DQXA 4RLHA 3GLQA 3QP9A 3QLJA 4II3A 1XELA 3WMWA 4HKTA 4DMLA 3ZWAA 3RUIA 4J43A 4YJGA 3VDRA 2NTNA 4D41A 3AUTA 1O0SA 3B70A 3VKVA 2GDZA 3QIVA 4D0RA 2IRWA 3GT0A 4HFNA 3AJRA 1P3DA 4OMUA 1XA0A 4BQRA 4PRLA 5ES3A 2R00C 2O3TA 1WMAA 5IN5A 3G0OA 3RJ9A 3U09A 4ZQEA 4FJ1A 4BGIA 4XRGA 5KJCA 4O59O 5COAA 4XKJA 1L1FA 4RF5A 4CM5A 2J3IA 3ZV3A 7MDHA 3VKUA 4NJOA 2F00A 3JSAA 1DJQA 2CF6A 2FR0A 2FZWA 4G81A 1FF9A 4J6FA 5G4KA 5TT0A 1RYDA 5DZSA 4YRDA 1ZEJA 4FJ2A 4CV3A 2RHRA 4J0FA 1Q7GA 3ASUA 4WK6A 1P1KA 2QYSA 1O5IA 1MG5A 3GPDG 1YO6A 3I5MA 3OQBA 3JQAB 1D4FA 4J49A 3LT4A 4FQ8A 4FC6A 1DHRA 3M1LA 5ICSA 5G0SA 3E18A 3IP1A 3E48A 5A02A 5DBIA 2CMDA 5L3ZA 4YAEA 3WDSA 4FJ0A 2IODA 3WIEA 1JWAB 4IDFA 1OMOA 2X0RA 3FHLA 1BGVA 3F5QA 4KTVE 2BGKA 2VRBA 3RI3A 3WJ7A 4J0EA 4B3JA 4CL3A 1LI4A 5A3VA 3ETGA 2PH5A 4MIYA 1U3TA 4UVEA 3NT2A 4D3SA 3HFSA 3EVNA 4MPDA 4OXNA 4LGVA 1LEHA 1TT5B 3OM9A 2BRUA 2X58A 3BMQA 1PWZA 1QV6A 4R68A 4WJZA 4XQEA 2POQX 3IQDB 1RWBA 3L6EA 3TFQA 5I9NA 1LLQA 2FHSA 2HK8A 4MOWA 1XIVA 3D0OA 3BMNA 4FSHA 1YVEI 4PVDA 1HDRA 1T4DA 4DQUA 3MOIA 4CV0A 3LSYA 1H9BA 3H9GA 3KXDA 1A72A 5JFOA 3OQ6A 5DP2A 4EJ6A 1KS9A 3INGA 5AXAA 4YT2A 2QX7A 1YB5A 4Z3DA 3PHJA 4YJGB 3VPGA 2CVZA 2HU2A 3EK2A 4XJSA 2JAHA 4P22A 3VH4A 3D5QA 4E21A 1D1TA 3X2FA 2OBYA 1WLYA 3TZKA 4B8WA 4CMAA 2Z1NA 4CMEC 5B12A 3Q3CA 3ZGYA 2GASA 5LDGA 3W8DA 3NEPX 1IUKA 4B7XA 4DYDA 2WE7A 3DONA 3PGJA 5F1OA 1ZK1A 2PD6A 4WOJA 5B1YA 3GPIA 5LC1A 1G0OA 3JQ7A 3C24A 3NJ4A 3JQCA 2GSDA 2EWMA 4BNFA 2V6MA 3GAFA 4BO6A 2V65A 4ZJUA 2C0CA 9LDBA 2ZYGA 4FOOA 1IB6A 1N5DA 3K92A 1U4SA 4JIGA 3H6KA 4DXHA 3VTFA 4Y6PA 5DBFA 1PL7A 3GNSA 2OXIA 1QSGA 2GZ3A 3Q1LA 5JC8A 3EY4A 3LLVA 5KVCA 4UVGA 4IGFA 4D79A 1BG6A 3K2EA 4R54A 3F47A 1DXYA 1ENZA 3RFTA 2O50A 1VL6A 1E7QA 1HRDA 4MVJE 3WSVA 4OKIA 2Y05A 4CMJA 5CDGA 1PQWA 3VDQA 4JBGA 1ZFNA 3LT0A 3AM5A 3MZ0A 4L73A 3S2GA 1E3EA 1PU2A 1HDXA 4RO0A 2JKVA 1TVEA 1P74A 3KB6A 4G5HA 4J1TA 3GGOA 5JDIA 3E6AA 2YYYA 3BMNB 2X9GA 2NU8A 3RC1A 1R0SA 2C5EA 3UN1A 4B7UA 1UDBA 1VKOA 3P7MA 3T7CA 4E31A 3O03A 3L77A 4AJIA 3BMOA 2ZCUA 3HQ4O 3QWBA 3ASVA 3JYLA 4BO7A 5JAIA 1E5LA 1X1EA 2BH9A 1UH5A 3UCFA 1HLDA 3U4DA 5FFFA 3RCBA 1JWBB 2YV1A 1ARZA 4Q3AA 4A26A 3PQFA 1SZJG 4CL8A 1O95A 1M66A 1YDEA 1BXZA 1X13A 1NFFA 1I2CA 1KETA 1Y8QB 3OECA 5GZ1A 4XYLA 1UAGA 3QHAA 3GEMA 4FOSA 3Q9UA 3PI7A 4M1QA 4ZQHA 2HSDA 5DNAA 5DCUA 4E5MA 4II2A 1X7HA 1JVBA 2VUSA 4YTEA 3SLKA 4BNUA 2D5CA 2V6BA 2J3KA 1Q0LA 2GERA 3CINA 4TZTA 3ZV6A 2PKRA 2VNSA 1YS4A 3UAGA 2HCTA 5I7EA 5T57A 2TMGA 1LA2A 4U5QA 1EBUA 1HE2A 3E8XA 3AK4A 2Q2QA 2QRKA 4KMSA 1NXQA 4JX8A 2B69A 1E3WA 4ZQBA 2A35A 3H3JA 4RVHA 3GFBA 3W4IA 4J1SA 3NT4A 1ZK2A 2ZQZA 4AJ2A 4RV9A 1SPXA 1UZMA 4Q3CA 5U9CA 4XR4A 2EJWA 2X22A 2VWPA 3MEQA 4PLYA 5KNLA 2OOSA 4WOKA 1B8UA 3KLMX 4GMFA 2GLXA 3WNVA 3OP4A 5F5LA 4ZICA 3FR7A 5L45A 1XQ6A 1SMKA 3K31A 3KEOA 4BV9A 4QX6A 3LC2O 4FDAA 1DSSG 3C85A 3TL2A 2WYUA 2X86A 2XAAA 2JD0A 5IDYA 3GNTA 3WGHA 4XIYA 1LLUA 4U6SA 5GY7A 3ZW9A 3K73O 1UDAA 1GQYA 2NUAA 2VTDA 4KWHA 1KOLA 4JP3A 4QFCA 4UEKA 2GD1O 1M6HA 1WZEA 4NH4A 2NV6A 3ITDA 4XYGA 1GEEA 4F6LA 2FZEA 1PZEA 3E9MA 5JCXA 3H9EO 3VPHA 4NPCA 2VHZA 4URFA 3BMOB 4PG5A 1N8KA 3KZVA 2OZPA 1Y6JA 4Y98A 3FWZA 2W2LA 2FY8A 4ZU3A 3QWIA 2ZTLA 3JYNA 4D3DA 4OXKA 3PEFA 4IBOA 1YWGO 2EG9A 2FPGA 3RIHA 5I7FA 5DOZA 1XU7A 1H93A 4I9NA 4ZN6A 4R41A 1M2WA 3JQFC 4DIBA 3ROMA 5MDHA 3N74A 2Q1SA 3LC7O 2YV3A 2RAFA 4DMMA 4JGBA 2GRAA 3UXYA 3JQ9A 3HNPA 1Q2XA 1U7HA 1VJ0A 3CIFA 3H3FA 3ZWYA 3OEWA 3BZUA 1JAYA 4P8RA 1LSJA 4TWRA 3JYPA 1K5HA 1CETA 4KUHA 2W2LD 5TSDA 5A9TA 1P1HA 1IULA 4HUJA 5FWNA 4MKZA 4IPTA 1CJCA 2B4RO 3TRIA 4Q3BA 5FEUA 3KYCA 3NJ8A 3C8MA 1NYTA 2CF5A 1E3WB 3QQPA 3TNLA 4M86A 1C0KA 3WGOA 4IQ8A 2DBRA 3COSA 3DHEA 3C1AA 3OA0A 4YBZA 1C14A 4R9SA 3FNHA 3DZJA 3HN7A 1WW8A 1EEHA 1G1AA 3FI9A 1UZNA 2VNAA 1BMDA 2HMUA 4IDAA 3I9MA 3KETA 3H2ZA 1NQOA 8LDHA 1H6CA 1CWUA 3S8MA 3ZWMA 1JKIA 2GYYA 4QXMA 5ILOA 2VZ0A 2Q1WA 3CEAA 1O8CA 4OO3A 1JW9B 3OICA 3OMLA 1B26A 1HDZA 3BHJA 4NHEA 5L9AA 5ITVA 1MB4A 4RLSA 4MJLA 3KYBA 3L9XA 4G2NA 1CERA 3ZNQA 4D0SA 1BVUA 2I3GA 1FDSA 3E5RA 3P2YA 1X14A 2YHUA 1UXKA 1XKQA 4XR9A 3TDKA 2EERA 3ABIA 1J0XO 3BXXA 4U0JA 1VSUA 2X1HA 3E1KA 4D7AA 2YJZA 4Z6KA 4NZ9A 3OJ0A 3M1AA 3ZHBA 1IPFA 3TZHA 4UREA 2OP0A 2DAPA 4BNZA 2CD9A 1YB4A 2D8AA 2A9FA 3HZZA 1NQAO 3SC6A 1JQBA 2PFGA 4FC7A 4BNWA 1KVUA 3E9NA 3NAQA 2VHWA 4YAJA 4I5GA 4ZRMA 2HK7A 1UXGA 2EHDA 1LRLA 1R15A 4PG8A 2IZ1A 3DOCA 1MXFA 1S7CA 1I3LA 1ZUD1 1LX6A 3MTJA 4PZEA 4YVFA 3WQQA 1KERA 4YJHA 2B83A 1ONOA 4ND3A 5K9ZA 4IDEA 4WCFC 4XQCA 4BO4A 2NU9A 1B14A 4LVCA 1E1NA 4ROSA 1FDVA 3PPIA 4OGWA 1Z45A 4TVOA 1P0FA 1I30A 5A4DA 3A9WA 3C7AA 1ADBA 4QSMA 1LC0A 2GF2A 4ESOA 4CM9A 1PZFA 4EUFA 3DB2A 1B0AA 1FJHA 2PTGA 3GZNA 5AXDA 2D4AA 1N9GA 4R01A 1WDMA 4PLHA 1ZZEA 2VT2A 4OIMA 4RZHA 1DLJA 4BO2A 1R37A 1NM5A 4LMPA 1TI7A 3GAZA 3DR3A 3GVCA 1EK5A 4NBUA 3PTZA 1J4AA 4CR8A 4HX5A 2B36A 1WXDA 5JSFA 1QKIA 3IJPA 2CY0A 3HHPA 5J23A 3AM3A 2IYPA 1ISIA 4XCVA 3DBLA 3JD3A 3FPLA 4K26A 2Q4EA 2DFDA 1KY5A 4QECA 4CM9D 2AW5A 1GV0A 4GGOA 1AXEA 4O0LA 1CIVA 4BB6A 3AY6A 4BNYA 2D5AA 3ZI0A 4RVSA 4BO1A 4MP8A 2QRLA 4BMSA 5A3JA 3ST7A 5AOVA 3PYXA 3ROQA 2PV7A 3IIEA 5L53A 4A5OA 1PZGA 4E13A 1IL0A 5G0WA 4OKNA 2O4CA 4DIOA 3OQ1A 1GR0A 3WBBA 2UAGA 1SOWA 1D8AA 1H2BA 2PGJA 3FTPA 2UUOA 4L4RA 1N1GA 3PIIA 4W9NC 1E3SA 3UFXA 4INAA 3JQ8A 3CSDA 1X1TA 2DQ4A 4GX1A 1YBAA 1GEGA 4CQMA 3V1TC 1B7GO 1Y81A 2ZJ1A 5CG2A 4B7CA 1BW9A 1UP7A 3GRKA 4D42A 2NSDA 2YQ5A 3NDRA 1U1IA 3I9OA 2VUUA 4LRSB 4KWIA 1RM5A 4EEXA 4BB5A 1PWXA 1DPGA 3R3SA 3NDJA 1UXJA 3H5AA 4YJHB 4OJNA 4AJOA 3AY7A 4EDFA 1CRWG 1Y9AA 4CMBA 1MC5A 2FR1A 2X0IA 1PL8A 3EUWA 4TKMA 4NFSA 1IPEA 1M6WA 3C7CB 2AE2A 4J3FA 3U0BA 4WEOA 2BGLA 2H5LA 3ZHXA 1NPTO 3B1FA 3H4VA 3IJRA 4WNIA 1LLCA 2PZLA 1UXIA 2X6TA 3GZNB 3ONEA 4D45A 1VE9A 5IN4A 4RL6A 3T4EA 1QG6A 4TSKA 1MFZA 3PJGA 4K28A 4NFYA 5TLSA 1XHLA 5JS6A 3I83A 5LDHA 4GX2A 2O3JA 5EQDA 1A7AA 1U3VA 4EYEA 3I3OA 1ORRA 1ADFA 4IDDA 5L7TA 4LCEA 1LUAA 1F12A 3HDJA 4LW8A 4WECA 4MVJM 4R16A 3U49A 2JCVA 4XYEA 4YAGA 3DBLB 2OUIA 3EC7A 3MJTA 1M75A 2HMWA 2YDXA 4R69A 2DPGA 4BMNA 3RBXA 2HDHA 5COQA 3OIFA 4OAQA 1YE3A 2O2SA 4B4VA 4GLOA 2YZ7A 3K30A 3VH3A 4ALMA 4HFRA 3C7DB 4XGIA 1FDUA 3Q6IA 4HFJA 4IS2A 4NBRA 4A2CA 2AHRA 1E7WA 3AM4A 4UVIA 1JU9A 1MV8A 3HFGA 4JJIA 2CDCA 4K9DA 5DN9A 3U4CA 2BFMA 3I9NA 3OA2A 3KSDO 4JJFA 4CQMB 5JXWA 1MC4A 1ZVMA 1E0DA 1GDHA 1HE3A 1DC4A 4C4OA 5C7LO 2YFHA 2D1YA 3PYLA 2VWQA 1VL0A 2ZIZA 4RCVA 4ALNA 1Q0QA 4YT8A 2I67A 5TNXA 4XA8A 4E5KA 3WGQA 2OGUA 2Q3EA 1HXHA 1CDOA 4BNIA 1P77A 3D4OA 3DOOA 1IY8A 2EXXA 1PS8A 3L6OO 2JAPA 4AJLA 5U4QA 1MA0A 2BELA 4PLTA 3QE3A 2UYYA 5L51A 3V1YA 4GH5A 4J4TA 1YQGA 4GI2A 1OFGA 1E5QA 3WQRA 1LSSA 5C37A 1P1IA 1K6JA 3G17A 1LDNA 1T25A 3ZV5A 1UR5A 3ZWOA 1Q7BA 1D3AA 4BGUA 1W8DA 3F4BA 3ADOA 1OC4A 5H81A 2X4GA 3DZIA 3WTBA 1EDZA 4JNKA 1GUFA 3AFMA 1A9YA 1YRLA 4A27A 5TIIA 3PWSA 3ZWCA 4Z0TA 4L4XA 5THKA 5BNIA 4RF2A 5CHEA 1R0KA 2WD7B 3QJ5A 2NTVA 3AW9A 3MJEA 3QY9A 3MJCA 3HN2A 3G49A 5FI5A 5B4TA 3MJ4A 3HB5X 1LTHR 4J1NA 3RKUA 3INRA 3GN2A 5IDWA 4LRTB 4IDCA 4BNGA 4LN1A 4RORA 3IP3A 3PQDA 1RYEA 5CDTA 1DIAA 4IS3A 2OORA 4BMVA 5CEFA 2I76A 4OQZA 3HDQA 1C1XA 2W90A 4Q39A 1AGNA 4EJMA 3S2IA 1VKNA 4XWYA 5BSFA 5CPFA 3ENNA 5AXBA 1YH3A 1LRKA 1TB4A 3UCEA 4ND4A 3UKOA 2JL1A 2PZMA 2Q49A 4CLOA 1SEVA 5JAQA 3DFZA 3SXPA 1ISMA 1VI2A 6LDHA 4W7IA 5HWSA 2I65A 5DCWA 4TZKA 3AUAA 5ENVA 2PD3A 2Q1UA 2ZKLA 2QZ9A 4ZQFA 4ALKA 5L4NA 1F06A 3WICA 1P1JA 2XPCA 4G65A 1SB8A 3WWYA 5AQ1A 1ZK0A 1PJCA 1DJNA 3SX2A 9LDTA 2G17A 4OM8A 1DAPA 4PZCA 2VT3A 4H16A 5JCJA 4XX0A 1ZKMA 2GR9A 1X0XA 1W0CA 1JKJA 4PFJA 1F8GA 4YAKA 4JP2A 1KYQA 3D4PA 4NU6A 3T7EA 4QUKA 2B5VA 3GZ4A 1YGYA 4GVXA 4XDZA 3EHEA 4UVHA 4BGVA 4R1UA 1P9LA 2EKPA 1E7YA 1U4OA 5KVSA 4E33A 1U2DA 1T1RA 2PGDA 2Y1DA 3DXFA 2QHXA 4BKRA 4YT5A 3KLPX 3CKYA 3EVTA 4R1NA 1K6IA 3DAGA 3K5PA 2HMTA 3NKLA 1TLTA 2PNFA 4ZVVA 5JCJD 4MIOA 1T2AA 1EQUA 1LXCA 4ZHSA 4DREA 1ISHA 3ZU3A 1YL7A 4XIJA 3SJ7A 3KM0A 1EFLA 1MX3A 5EESA 3S1LA 2ZB7A 2JFFA 2R6JA 2VRCA 3O8QA 4CM8A 3NDIA 2WWRA 1R12A 3ZNOA 2P91A 3DZGA 3A1NA 1T4BA 1W4ZA 1ZSVA 1I10A 5TX7A 1F0YA 2DC1A 2VTEA 3C3XA 5T5QA 1V35A 2X7HA 3EZLA 2O3SA 3B6ZA 3KHUA 3QW2A 5BSHA 1NFRA 1C1XB 3OJLA 3ZN2A 4AJEA 3W6ZA 1Y7TA 3H65A 1HTBA 2PZKA 1GD1O 4CLOB 4UULA 4U0KA 2O23A 3AOGA 1KC3A 3GNQA 1Y9EA 4CM3A 5HTOA 3B1KA 4BO0A 3IUSA 4CJXA 1HDYA 1PJLA 2VRCD 5G4KB 3JV7A 3LT1A 4J9UE 3D64A 5CEJA 1DRWA 1WDKA 3BYZA 3HUDA 5T67A 3I9KA 2X9VA 4CUKA 4DC1A 1GYRA 5HRUA 2I99A 4IMRA 3MWDB 4I5DA 4BS9A 4M89A 1I36A 1PZHA 1HLPA 1WPQA 3A14A 3WOHA 3VTZA 3WYBA 1EZ4A 3ZNNA 4HNHA 1HYGA 3ICCA 4YWJA 3I9LA 5KKCA 2HRZA 2V7PA 2Q4BA 2CSUA 2ET6A 5JO9A 3C1OA 3UCXA 4B3HA 1R66A 2JCXA 3DAFA 3ZHYA 3RC7A 3OBBA 2OBNA 4W99A 3QWHA 4MVJI 1HDGO 4Q3DA 2G5CA 2C2XA 4AJJA 4CLDA 4D43A 2VQ3A 3G1UA 3BMQB 4YEDA 1LC3A 1NAHA 1Z82A 3BAZA 3V2HA 1PS0A 3JQBA 5I9MA 5JDCA 1QORA 4BKQA 4CV2A 1XR3A 1EE9A 3FBGA 1E7MA 3VZSA 3HJAA 4ZGWA 1HDOA 4RVDA 2RBEA 1P31A 2YHIA 3PLRA 4F6CA 2TMDA 3O8QB 1SC6A 2VHXA 4CM8B 2AQIA 4IZHA 2NNLD 4Z9YA 1LNQA 5KJFA 5KKAA 4J1QA 2AQ8A 4K1LA 1EE2A 2RHCA 3W8FA 2WYVA 4PLZA 2D2IA 4RPKA 3B20A 5BSGA 4UUMA 3GVPA 4QT0A 4WGGA 5EL0A 5JC1A 2GN6A 5JDIC 2B0JA 1E6UA 3CMCO 4WE3A 1DFHA 4CM1A 5JDCC 5F5NA 4KDEA 3D5TA 1V0JA 3Q2IA 1NQ5A 1GQQA 5GMOA 2JFHA 1LDMA 2NWQA 4MVJG 3UUWA 2Q45A 5CG1A 2EW8A 4LMRA 3JQ7B 2E48A 2P9GA 1P1RA 3A4VA 3LLSA 1SAYA 5C7IO 4M8SA 5TJHA 1UAYA 2Q46A 4M87A 4RPGA 2PR2A 2IXAA 2NQ8A 1VJ1A 5ER9A 4IUYA 3FN4A 3O9ZA 3K8ZA 4Y9DA 1C0LA 3I23A 4F45A 2IYOA 1GZ6A 2WM3A 4PG7A 1M67A 2JJYA 3DEYX 3MCVA 1HKUA 4ID9A 4KOAA 4PCVA 2VOJA 5G0VA 3DHYA 4RQTA 1A71A 1TXGA 5TRTA 2W98A 1EFKA 4QQRA 4XB2A 5CDSA 2AEJA 2BFOA 1A27A 1MLDA 4MVJH 4R1SA 3PXXA 3VC7A 3KBOA 1UP6A 3UGKA 2QIOA 3BA1A 3WSWA 1XG5A 4R1TA 3L9WA 3PFFA 2GNAA 5DULA 4CM6A 2J6IA 5T6BA 1UDCA 1E3JA 2NVWA 2GN9A 2PK3A 5EERA 3AFNA 4P4NA 5IXSA 1DLIA 3MTGA 1BSVA 1U2GA 1HWYA 1ML3A 2HMVA 3Q0EA 4DVJA 4MVJP 3WG9A 5I8ZA 4A10A 3TWOA 4YQYA 5DDIP 4EUHA 4GX0A 3E5MA 3PQEA 3WLFA 2ZB4A 1PR9A 4GAEA 4PVCA 4O1MA 3OIGA 5JLAA 4YAIA 3V2UA 5HM8A 1HL3A 1ZEMA 3S55A 1B3BA 2YHIB 2QYTA 2X0NA 3GN1A 4FW8A 1KIFA 5ADHA 4IIUA 4CLXA 1LDBA 1E1KA 7ADHA 1ZJZA 3GY0A 2BLLA 1GZ4A 3PIDA 1GADO 3JQEA 2AG8A 2GUGA 3VZPA 5B4VA 4I9HA 1FMCA 1NQTA 4DLAA 2JCYA 3E82A 3ULKA 3PZRA 3RBZA 1P45A 4N54A 5L95A 3AU9A 1LLDA 1LJ8A 5KJEA 3AU8A 3UF0A 3BTOA 1MG0A 5GZ3A 4S1VA 2Y1FA 1KEVA 2ILTA 1H6BA 2C5AA 4BIIA 4YPOA 1SCUA 4MKXA 3TOXA 1J5PA 1K0UA 2EGHA 8ADHA 2YV2A 3ANMA 3F9IA 4BQPA 1G6KA 4BNXA 1QLJA 4XD2A 1HZJA 1DO8A 1VM6A 2PY6A 3ETDA 3LC1O 3ETEA 5T8KA 1DB3A 3NYWA 4I5EA 3CMMA 2J5QA 1X15A 1QYWA 1EVJA 1YOVA 3OIDA 3DO5A 4GGPA 1T24A 1KC1A 3JQ9C 1PJBA 4CM7A 5JMPA 4NBTA 3FNGA 2DBVO 1DBVO 4JCOA 1XLTA 2QRJA 3D4NA 4JN6B 3JQ6A 1NFQA 5JMWA 1XDWA 1N92A 4IIVA 2Y1OA 3OH8A 4P4LA 4QO7A 4CODB 1A4UA 1K6XA 2IZ0A 4PZDA 1NVGA 4W82A 3CPSA 3DBVO 2IXBA 2O3UA 1RPNA 5T8KC 5KJ1A 3GFGA 1RM3A 3KRTA 4OYRA 2Z5LA 1NTOA 4N5MA 3ZNPA 3W1VA 1U28A 1WP4A 4NK4A 2FSSA 3RKRA 5BR7A 5C7OO 1H0KA 1NR1A 3JD4A 1J49A 1CQIA 1Y5MA 3RU7A 3L4SO 4BNTA 2NVUA 3WJAA 3VPFA 4HBGA 1NVMB 4J4BA 1RM4A 2E82A 4FFNA 4YR9A 3WQSB 5IDQA 4E4YA 1Y8RA 3BIOA 4XQ9A 1ZNQO 3H5RA 1P44A 4P4GA 4XYBA 3GC6A 4GWKA 3DAPA 2JHGA 4PIVA 1E92A 3CZRA 4HFMA 3WYEA 4BO9A 1V6AA 5JY1A 2JD1A 3WS7A 1NWCA 2VWHA 2CUKA 3Q11A 5I8WA 5L4LA 1X0VA 2DM6A 3FF4A 1B8VA 2GZ1A 1QV7A 1IYZA 1X7GA 2CDBA 1NX6A 1Q0HA 5A1TA 5JYEA 3D1LA 5ER6A 3GG9A 1ZMTA 1H94A 2WYWA 3I1JA 1IHXA 3IDSA 2FRDA 2GCGA 2QQ5A 4BGEA 4ZRNA 2AEFA 5CEEA 3KYCB 3KUXA 1SBYA 1EUDA 3TOZA 1K3TA 3E03A 4BNLA 2HQ1A 1NVTA 2F1KA 3QVSA 2VYVA 4FFOA 3W8EA 3ONDA 2PKQP 1JKFA 3GMSA 4BVAA 1YOVB 2LDXA 3ZU5A 3DDNA 5A04A 4U6QA 3PP8A 1T2EA 4HXYA 4B79A 3GG2A 3GR6A 2XF8A 1VRWA 2G1UA 1FDTA 4QTZA 1B15A 4L0QA 5KVQA 4ND2A 4E2WA 3LYLA 1HE5A 2JHFA 3L4BA 4J9VA 3H2SA 5EJ2A 4O5OA 1ZXLA 4RPHA 5TF4A 1A9ZA 1O94A 5JAMA 2NLOA 3AWDA 2W8ZA 4DLBA 4IQGA 1I2ZA 4N5NA 1U7TA 3NUGA 4M55A 3U3XA 1PIWA 2VYVD 1Z73A 4CUJA 1NHWA 3EYWA 1GU7A 4L74A 1PQPA 2HJSA 4IJUA
chains in the Genus database with same CATH superfamily
1CQIB 2WJGA 1BXRB 1XPUA 4RM3A 1GXSB 3TI9A 3H2JA 5TY0A 2QR3A 3UHAA 1U9IA 3F5MA 4HH4A 1A9RA 3T9DA 1J39A 1MX5A 1C30B 3DR5A 5CT8A 1TVMA 2JANA 2O7NA 4G1EB 4WNAA 3UC5A 3ZTWA 2FQYA 5FLYA 4N3NA 1SQSA 1ZD2P 2H48A 4EOGA 4Z1MD 1V96A 2IIBA 3GHHA 2P2DA 3H8SA 2Q4TA 1OZAA 1V95A 1QFYA 3CZMA 4G1FA 5MGNA 5TJ9A 2MSNA 1JFVA 1W49A 4JXKA 4DDWA 4YRAA 4HGNA 2ZR9A 1JE0A 2XBLA 4PPNA 5C5EA 5DWVA 2ECPA 1OBCA 4YUWA 3DEKA 4NARA 1HURA 2FWBA 4C6SA 4GU5A 5HDQA 4RXTA 5MFZA 4C7OB 3E35A 4JYAB 4LHWA 1WUYA 3MK31 1UOOA 2UXCB 4YDRA 4JJZA 4D4IA 4C3UA 2IH2A 3WGZA 2P1DA 2W2OA 3I39X 5FPKA 1U0BB 4ME6A 5K7SA 4L9WA 3THOA 3WRXA 1IWPB 4EGQA 1I2AA 2RI0A 2VH1A 1ECBA 3LUHA 2ADMA 4FOPA 2G25A 1G20E 2ZWOA 4XYMA 1BMFD 3IEVA 4NR0A 1VKJA 4DBZA 3X1XA 3CR3C 5B2EA 3ZIDA 3PNYA 4ZZ1A 2F1IA 2GO1A 2TSYB 1WP9A 1OREA 2HWKA 1ML4A 3RK4A 2IX3A 1WCV1 4C4ZA 1KFEB 1ONNA 3NHWA 1S8OA 1YJ8A 2OFWA 3GH3A 4AO8A 4TTIA 2I3DA 3QU7A 1QKKA 5C1DA 1APBA 1F8FA 3GGSA 2ZPAA 4R2HA 2VPZA 3ZUGA 1U7OA 4HY3A 2P9CA 2ZRNA 1GQ2A 2VUTA 1CUDA 4AMVA 4JNCA 4WCDA 4QJ5A 1AUPA 1BVRA 1F0NA 3KTDA 4FR0A 4KQKA 2DB3A 1G41A 1YL5A 4LYAA 3DZFA 2GK6A 3T5PA 5CDYA 1Z2CA 4ZJYA 1J9EA 2AD5A 4FPXA 1I2MA 2IHYA 3HDYA 3Q2KA 5E1MA 3IBSA 1V25A 2D59A 2VLBA 3JWGA 4J7CA 5BN4A 3B2EA 2NPIA 3T8YA 3K9WA 1ENYA 2PUFA 5HQTA 1QRAA 2EKZA 3AUSA 5J4LA 5THXA 1OZ0A 1RS0A 3IMKA 3EQ9A 1CJSA 3NV9A 4HNSA 3CBQA 3LP8A 1BHQ1 1GUAA 3IEUA 2M6KA 2H85A 4PG6A 4E32A 1SGWA 3FMPB 10MHA 4MCAA 2DVMA 4NBWA 2ZI6A 1L4EA 2JFBA 2J6HA 2VF7A 5IU6A 1VB3A 4JUCA 5JE8A 4D6XA 1NMSA 4DWVA 1FLAA 2VYNA 4KVAA 2OAEA 3TXYA 3UMBA 1X1DA 3DBHA 3HUUA 4BKUA 4IIXA 4E5YA 3UICA 4ECAA 4Q1EA 5F52A 3UB2A 2XJ9A 4P34A 5BSUA 3GGGA 5BYJA 3VHRA 3WGGA 3SF8B 5REQA 3C6KA 3AG5A 5E4FA 2UZ1A 2RB5A 3NHLA 4XOIA 2NIPA 1YCGA 3ZZNA 4B3IA 2GGSA 2B8TA 1C0IA 1XEAA 2FPPA 3V9PA 2VBIA 1FS6A 2RGUA 2YRFA 1BN6A 3N5CA 4RY8A 4GRIA 1G21B 5IXYA 4FYJA 2RGYA 1GQSA 4WNCA 2VRWA 2OC4A 4NEGA 4CDMA 1TD1A 4CTJA 3E8MA 1P7VA 3N58A 4EW2A 1RE1A 4H1WA 1XNRB 1H22A 3TRFA 1K7SN 2NSLA 3HU5A 3I30X 3G0GA 4EEZA 2IYFA 4FYIA 4PSKA 1C3JA 3ZW7A 2C8JA 3W8RA 1EVIA 1IEWA 3BWEA 4UHFA 3UB4A 3VZCA 1SUDA 5DLQC 4BCCA 5C8YB 2JFOA 1XQ1A 1PJTA 4CLRB 1HT0A 5EMHA 3RS2A 1VPLA 1GFSA 3DOUA 4JJEA 1ODLA 2FUG1 3U31A 2HWWA 3F7NA 2ATCA 3IO3A 3QYAA 5T3YA 3ZY4A 1KI7A 1L7RA 2LV8A 3Q98A 1MGOA 2VDKB 1GGFA 1T9BA 4J8PA 4EVRA 4JFRA 1AU9A 5A4JA 5LQDA 3HP7A 1S4QA 4LC1A 4RY9A 4EG1A 2PKCA 3GRYA 2E4UA 3K96A 4UU7A 2SKDA 4IVQA 4R8VA 4AXXA 2ZYHA 1FA9A 3ZHQA 2VJQA 1ULSA 3JQDA 3FPGA 4F71A 5JFGA 1S2IA 3E23A 2XUZA 1R6BX 2Y93A 1U6IA 1X92A 2P3QA 1IAVA 2WVJA 4NV3A 3VR3A 4FFRA 3PCTA 3ZW8A 5LKRA 1F3LA 5HDBB 1GLNA 3ZDBA 2OY0A 5CPBA 2XT9A 3OIVA 1HPLA 4R3WA 1YE5A 3IMFA 3LXMA 1XRRA 2HJGA 1OBFO 4FYKA 2EQBA 4C6TA 1KDPA 3BB3A 4PHGA 3H87A 2W6QA 4DR4B 4PZ9A 2L69A 2R68A 3O8OB 1WB5A 1K66A 3G2JA 4IHJB 1H5NA 4F5EA 3MYYA 1MNAA 3UWOA 1FFHA 4AN0A 3HXTA 3KSUA 3L0CA 4J0DA 2FI1A 1ULTA 2V7TA 1MJNA 1QVVA 2O3QA 2EP7A 4GVLA 1LFAA 3ZKWA 4DKJA 4EYGA 2NO0A 3GX1A 3O75A 4Y2TA 2CVOA 4K1XA 2VP6A 5LYJA 1OOEA 3ZLBA 4Z51A 3CJRA 2P4QA 3P45A 1JSZA 2HF2A 2J7PA 3PJFA 4HH1A 5IG2A 1T8UA 3MGKA 2QN2A 4PEVA 3GRVA 3SHVA 4MVWA 2VNIA 1VE1A 3O4RA 3GIDA 5AK6A 5DN6A 3ABOB 3CVOA 1Z3CA 2Z9CA 1DARA 1GN8A 3E58A 3JASB 3L8FA 3AR9A 3ZIAA 4CM4A 1LV8A 5A4IS 1QM5A 5KX5A 1IHYA 5CURA 2ZE7A 4X6YA 4AL4A 5HJ7A 4B3CA 1O9BA 4ITVA 5B58C 2DECA 4HXFB 4HDAA 4O4LA 3E7FA 4HWKA 1CNEA 1XZFA 2NZYA 2MWMA 2OSVA 3DZHA 3EW9A 3L1IA 3QEKA 4L8GA 1ATIA 3KB2A 2NN3C 1KEPA 2CXRA 1D03A 2HV8A 4DJFC 4GZLA 4P81A 5A7GA 1XMVA 4KYIB 1V8ZA 1SXJA 2VN8A 3VU9A 3U7FB 2OORC 1KA9H 4BBJA 5KWEA 1EIWA 4QOFA 1YZLA 1G42A 3H0CA 2Z08A 2H57A 4WV3A 4YDHB 3PWZA 4N65A 1JI0A 4J0HA 2H2GA 4O33A 2D4HA 2VDMB 3IAFA 5HM6A 2HEGA 1ILEA 3LQ2A 3EPJA 1CP3A 3VR6A 3L1HA 4HDSA 3WFIA 3PX2A 1DEHA 5E6RB 1EWTA 1I1QB 2X8JB 3DWFA 1FCJA 1YQTA 4UEOA 1DAEA 5IM5A 3RFCA 2QEQA 4PYNA 3TLMA 4BFVA 2AG0A 2CUTA 4MGYR 3CN9A 1TJPB 3SM9A 1QXSA 2PSEA 3ESYA 2M6LA 3T06B 1KJIA 2EC5A 3KT8A 5B64A 4JIMA 4JVOA 1R1DA 4JELA 3GUYA 1H6DA 4M9SA 4YREA 2WFLA 3UC9A 2KLHA 5EKUA 4AFNA 2UUBB 1RAFA 1ZOIA 3DZKA 4YPFA 1POXA 3PRJA 3UJ9A 4W7SA 5K0SA 3G9TA 4NF2A 1EZ1A 1KKUA 3A4TA 1W1IA 4F4FA 3UT5A 2Z1MA 1GL3A 1SBQA 1SOAA 3LBYA 4WX2B 4WQMA 3FPSA 4LV8B 4GXTA 1R50A 4CGZA 4CU2A 3MAAC 1Q14A 5AVWA 4ZREA 5EJGA 3R76A 4CN8A 3HA2A 3KU1A 4X00A 4YCNA 1PJ3A 2Y1WA 2RAUA 4WA8A 2JASA 5LNK1 1XE3A 5DT9A 3A06A 4GX5A 2ZVQX 3IC5A 3G2NA 2WY2D 3SC2B 3SF0A 2VJOA 4OX9Y 4M9QA 1U04A 2NZ8A 1NUUA 3UHOA 3BGIA 2I9PA 3V8VA 1RKXA 1JEQA 3KQMA 4MRSA 1SUFA 1H1TA 4Q3EA 3S2YA 4HQKA 4BMXA 4QEKA 1PD0A 3VNBA 3OFKA 3RFVA 3NP7A 3MPUA 2VDOB 5GGYA 4URYR 4HGQA 3ICPA 5HS4A 1YXMA 3EZNA 3DCIA 3C15C 3W1EA 5JISA 1QE5A 2N0SA 1DC6A 1W5BA 2EKDA 3NV7A 4OQEA 1ZKDA 3NBKA 1B43A 2GH1A 4KXVA 2P5YA 3NHUA 1FE8A 3FF1A 1QGUB 5EIHA 1G9TA 3P5SA 4X8MA 5ALSA 1TTHA 1NVVR 5ADHA 1VPVA 2QN3A 4HXGA 2P3LA 4XB1A 1B2LA 1JLRA 3BB4A 3GK3A 5AK0A 4DBVO 2V74B 3EMDA 3IP7A 2XUPA 4G9GA 4ODIA 4AICA 1RW4A 5CB4A 2VO1A 4UDNA 2GLTA 2PL9A 1R0RE 2YS6A 1W29A 2DFPA 4DDKA 1ODKA 3AERA 3D6UA 4BMCA 1DRUA 2QMQA 3F1LA 5F1KA 1A96A 4IIDA 1SVMA 1T26A 4KMOA 1FNDA 4IDPA 1YQDA 2HO5A 5KYTA 3LLCA 4E5NA 5GJBA 3OLZA 1DIHA 5HBRA 2WT4A 5LZ9A 3B3GA 5B3LA 1A0OA 3JYQA 3BSFA 4J91A 3T3IA 4YX9A 2ZSKA 2KW5A 1FRFS 2ZM5A 4ZYZA 1ZLYA 3HR4A 1DIGA 4R0MA 5E4JA 4Q24A 5INTA 4IXTA 1TF2A 5A9SA 3STHA 2WVGA 1C1DB 3FLMA 3OMWA 4CLEA 2AE1A 2A0UA 1KMNA 1J2EA 2BBTA 1FDWA 1FPMA 1U7UA 3WL4A 5KJ6A 4BVEA 3N2EA 1GZUA 2YY6A 2FSPA 5E7QA 2L2QA 3AOEA 4J6EA 1EFRD 5IZCA 2J32A 3D2BA 3PCRB 1ULBA 1JG7A 1NONA 2XNDD 1R4NA 2JLCA 4JJGA 2BI8A 4NCJA 3O38A 4N18A 2YWHA 4BECA 5K0TA 5L6MB 1IM2A 4Q48A 5DGHA 2GN2A 3T9BA 3L8DA 3LUBA 3TEJA 4M0KA 5DVZA 3CEPB 3CW2A 3OCXA 4MCJA 1UBLS 3L7JA 1E3IA 3JTMA 1JFSA 4KNWA 4G5XA 2IZOA 2WYHA 2HMSA 3IHLA 1HV8A 1OYYA 3I0ZA 1OHHA 5A05A 1WVGA 3I0MA 3SI7A 2KJQA 4ENTA 4E51A 4Y8VA 3NORA 3ACCA 3EA5A 5BURA 1YB2A 2YBDA 2UV8A 4BKOA 4BQNA 4ZVRA 3OQNA 3EQ6A 1O6FA 2VAWA 1OH5A 4X95A 2GPBA 2J3JA 1T2VA 2IQIA 2RK3A 4KQWA 3UUGA 4C4RA 4DUPA 2PV0A 1SZPA 2FUG6 3TTSA 4ZJPA 3TJZA 1TEHA 3QKSA 5L3SB 3FLBA 1SHZA 1KRXA 3P0EA 1HE4A 1XEXA 1QH0A 3OOWA 5CK4A 4CPDA 5EC8A 2PD4A 3CH6A 3NGMA 1E8DA 1BOFA 1U31A 2B78A 4MARA 5DEOA 2A1IA 4HGYA 1KI4A 3WGNA 3CF2A 5G40A 4IIYA 1IEXA 1TU4A 2XXBA 1OX4B 1UQRA 4HQRA 5KEIA 4Z9XA 3LUJA 2H0QA 2P7HA 2BM0A 2WOOA 1SM4A 2ZU0C 4GZ5A 3PGXA 4RK4A 1RBMA 7GPBA 4AT1A 2AFRA 5KYUA 3AQ4A 4Z0NA 4FZ3A 4B3DA 2BMAA 4OBBA 4EPYA 1LPAB 3CXUA 2ZTUA 2H5IA 4XRRA 3NG1A 4YROA 3S2UA 3WGYA 3LTEA 2HU8A 3MIIA 4YAWA 4AYTA 1EJ2A 2I3ZA 3DOHA 3HRIA 4CMIA 1ZW1A 2R66A 2IDJA 3DC2A 1YR8A 4XM0A 3OOEA 1ZK4A 1NUTA 3EGEA 4NBSA 4BFCA 1O89A 1FVFA 1NPYA 4KYTA 3HFJA 1DIRA 5DNWA 3WMFA 4DA9A 1G8JA 1Y5LA 4FFMA 3NM5A 4QLAA 2JKZA 4AVYA 3G13A 1ZN2A 2Y77A 2Q29A 1ULUA 2C95A 2BFCB 1O95D 2GN4A 2O7QA 3HKDA 3IHKA 4XUEA 2QM7A 3AHIA 1YZKA 3RJ5A 1UKEA 2GN8A 1VJCA 3TNDA 4TUYF 3T5AA 1I3MA 5F98A 4WY8A 3HJBA 1G8KA 4HX9A 4B6GA 2CVHA 2WD8A 1Q74A 3G0CA 3WIUA 1ADGA 4CHGA 4TZ6A 3EDYA 1XMPA 4ATNA 3ICWA 2H1SA 1M34A 4ITUA 1A9SA 2HPHA 4YUYA 4ND1A 1INLA 5ICFA 2ZT8A 3N7AA 1B73A 2X15A 5CLIA 1PNQA 2O52A 3CUVA 1T3HA 5A0FA 1QRSA 2BL4A 4E6PA 1H6AA 1P4HA 2RG7A 4OHMA 1IG3A 4S1OA 3BMCA 4GPEA 4BQIA 3SXJA 2WHEA 1XOIA 4G1VA 4TSRA 3O7MA 1Y5RA 2JG3A 1JB9A 3DL4A 4US0R 3PL5A 4D9IA 2QV7A 5EWMA 3K1AA 4M1ZA 2QPAA 4G5YA 1ESZA 3A6ZA 1NXOA 3B5IA 5DNVA 3R9KA 2XMGA 4EG3A 3AP1A 1JIVA 2JFXA 3JQFA 3T34A 1LQTA 2GYUA 2RCYA 2WF5A 3LQFA 4FLMA 4L08A 1R3DA 6CHYA 5KSWB 2PS0A 4Q3NA 2J8ZA 1YB1A 2OVBA 3AG6A 4KK4A 4KP7A 1X7DA 4BV2A 1O96A 2BTOA 3RVSA 4IILA 1TZCA 2XQFA 3VR4D 1VHWA 2VNHA 4EI2A 1U0EA 1VYHA 3O92A 2PAFA 2PKXA 3U37A 3H0KA 3L6DA 4NMMA 4C78A 5A4MS 3C2QA 1POWA 1C29B 1GFZA 1KVQA 1OXUA 4LYGA 4YASA 2Z5GA 3QVMA 3B52X 4YJ2B 4W4TA 3U62A 3FD8A 2O2EA 2FWAA 3W34A 3HVJA 3GHYA 3RWBA 4UDOA 1Y5NA 2AQHA 1MJGM 2AZMA 3GJXC 3I34X 3GLVA 1HGXA 2J5KA 4FCCA 1H5UA 1OASA 4YCCA 4OH1A 1GUZA 1NBIA 2A86A 2QGNA 1KO5A 1WXHA 2IS4A 1PWEA 4V2UA 3FSRA 5ALUA 3DDOA 4DHWA 1ZM3A 2PSJA 4PNEA 2WTBA 4Y9UA 1QO0A 2GF0A 3BD6A 3G02A 1ZCZA 3H5VA 3KJGA 4MUXA 4TVBA 1XZHA 4XJVA 3WAKA 2J0UA 1G21E 4A2WA 3T3NA 9MHTA 2ZWMA 3D7MA 4Q34A 1QLHA 2B4QA 1GPH1 1LK0A 4LWOA 5FPQA 2VQFB 1IDOA 1OZGA 4DV3B 1KP2A 4MR7A 4IQFA 5BNFA 1LD3A 1RPAA 2GEVA 3WWOA 1T35A 3SVTA 2E49A 2C2YA 1I80A 3FPHA 2WJHA 5IARA 4Y6RA 4F04A 1PJ2A 1ZS9A 3PQ2A 4FGWA 5FL7D 4H7FA 2GJ4A 1XZDA 2C9OA 3S99A 4FYWA 4KQCA 2F1HA 1I0ZA 3IB6A 1T91A 3FVRA 2GXUA 1YRHA 3MOGA 2NM0A 4JGGA 4KHZA 3Q8LA 2CLHB 3GMIA 3T7KA 3ZWVA 821PA 4GDFA 2XWQA 4UJ3A 2OHFA 2ZU6A 4X8LA 2JI9A 2FQ1A 2ZI4A 3L84A 3Q3IA 2JH3A 4N76A 1LK5A 2XF2A 3KZXA 4M7OA 4ARCA 3VSCA 4L95C 1H5QA 5BQFA 1YKGA 2CLDX 4FGSA 2V7EA 4EHIA 4YA6A 3I5XA 5JASA 1NMXA 4RLQA 1PFUA 1P61B 3NCTA 4H1VA 3AI2A 1MIHA 2C07A 4QM7A 2IEAA 4LCJA 3GVHA 3ITEA 3R0XA 4ZMSA 3T3HA 2AYYA 3PC8C 2DHCA 3MMNA 2YJNA 5H80A 3WKCA 1THGA 4HWSA 1U8XX 2IV2X 4E1VA 4TMTA 5BWLA 4WLFA 2OCYC 2A94A 4OHVA 2BGGA 4KW7A 5HA5A 4P2BA 2CHEA 4P54A 3HYRA 2ZBRA 5GJCA 4I4CA 3GRUA 3TZ6A 3N8DA 3WISA 1OGJA 2PCLA 4DJJA 4PBSA 1G8SA 3IS3A 3DBRB 3ENQA 1TM7E 3R9XA 1F48A 1M2KA 3RANA 1M7BA 3BJRA 1NWHA 2FSHA 4C05A 1GZ7A 4CEHA 1PWHA 4GBJA 2JD2A 3TDMA 3EZYA 1U2EA 1G8HA 4C4XA 3QGMA 3LRXA 3NT5A 4RHFA 1KVTA 5ILQA 4XSHA 3SHFA 4Z4GA 2X5JO 3KDAA 4ZT6A 3PD1A 3R3JA 4QARA 1QK3A 3UV3A 3Q7IA 2CL7X 4B3XA 1WTCA 5DTRA 1G2PA 1NIPA 1TIKA 4GGMX 4ZRDA 1JFFB 4D81A 4DAEA 2QR5A 4I9FA 4K3UA 4P3KA 1H9AA 2IPMA 2VCEA 3ZQUA 1KYVA 1GPLA 1X8LA 5EZ5A 3SC4A 2MYUA 3TSCA 4DLZA 2CXUA 2XMQA 1FP4A 4AJKA 4XWWA 3QX8A 1E62A 3JZDA 4ROTA 4BP1A 4DRXB 3RJMA 5C5IA 1ZSYA 3GARA 4BX9A 3EEBA 5B4UA 4MDYA 4EQ6A 2ISQA 1J0BA 5D00A 1W25A 2DHRA 1XC7A 4PHTA 2PDAA 4MQFA 2NQ2C 3TN7A 1EHIA 1EFVA 1U7ZA 2O3RA 2EJVA 3GRPA 1H8EA 1R6DA 4P9NA 3BTVA 4ZT5A 1X7XA 4A0SA 4FVTA 5CYPA 1X77A 1GTSA 1I3CA 4MV3A 1P75A 4ND7A 3BC1A 5DBGA 1AKQA 5A9RA 1ISGA 2VH2A 3OOSA 4JJ8A 4JOSA 4UUPA 3P0RA 2VJDA 1V3VA 4YQZA 2H7YA 4Q4CA 2XQJA 3AI7A 3D59A 4RTPA 2JLQA 5I7VA 4BPBA 2XHEA 1DBPA 1L5FA 4LYYA 4DSTA 2WKPA 4IJKA 2M98A 5EZYA 2C7GA 3C48A 4MS1A 5DI3B 2C3PA 4OFZA 4C0WA 3X1JA 5ADUS 3HJFA 1P7PA 4FQ5A 4RVCA 4AXBA 4MQUA 3NS7A 1K5PA 4K9NA 3TRJA 1UZLA 3OPYA 1ENOA 1EUCA 4LS3A 3KT0A 4FE4A 4NS1A 1V5IA 1JNYA 4R5HA 3VQTA 4AZVA 3IRUA 4UATA 2ZR8A 3UENA 3QY0A 5JNLA 3OD1A 5EAIA 3RUDA 3RQIA 3MCWA 4PTZA 3GDFA 4IDUA 1ZK3A 3DTVA 3AEUA 3RRXA 4ZV9A 1PGJA 2WIJA 3AIOA 1L4KA 2H0AA 3Q5EA 2VIIA 2DWOA 3FSGA 4GMXA 2CNNA 4N0DA 5HKKA 4HC4A 5DHTA 5A6VA 1OAAA 4WCFB 3BD7A 1ZSNA 4KUEA 2P69A 3PE3A 3C14C 3R6DA 4HDNA 3TBFA 5JD5A 3KB1A 3F1KA 1OFUX 1U9IC 2J9RA 2NQTA 1G8YA 1IB0A 3WXBA 1DQNA 2X77A 2GNOA 3K53A 1ODFA 3GFOA 1EX9A 2WSMA 1HORA 1NE7A 4QVGA 5JPIA 2GAOA 2PS1A 3SZUA 5K6AC 1V8OA 5C8ZA 2YJTD 5ELXA 5LMCA 4PQFA 4GOXA 4V39A 4FHFA 3OTGA 5ESRA 4D44A 3OFSA 3THSA 1TZJA 5JRJA 2OHHA 2O0JA 4O4JA 1F2DA 1SIUA 3ZDFA 2RHDA 4JSRA 3NPMA 4FFLA 4FFWA 4ZEWA 4RVOA 1KZ1A 5C53B 1W2WB 3EFEA 3TLGA 1W0JA 2HY7A 3V8PA 4LJAA 1H2EA 1FTYA 1TTQB 2CWDA 1P2FA 2OG2A 3IODA 4OJMX 1IQPA 4QYIA 4KV7A 4RPLA 4GQAA 5AI4A 4IDQA 4XGQA 5ALHA 1L5KA 3WRXC 2PZBA 2QZPA 4M53A 4CR7A 4RZSA 2QRVA 3JW8A 4C4SA 1LPSA 2ID8A 4TS4A 3G3EA 4DV0B 2O4UX 1ODCA 4MHSA 1OGYA 1V1MB 4RTQA 4BFYA 7ABPA 4LBVA 1U8ZA 3RW9A 4GMGA 2B3TA 4EMBA 4JDUA 4J3NA 4EVIA 3JQGB 4X92A 4QUIA 4QVIA 1NSTA 1FTGA 4WN9A 1M76A 3MYRA 5ICCA 1J2RA 4LMBA 2VDNB 3C1TA 4N8EA 1UK8A 4J3JA 2AUMA 2IPOA 3BN3A 5TS2A 2WUEA 2R4UA 1UPFA 4I4TB 4OSOA 1G5HA 3GA0A 3I8XA 3PHIA 2XNJA 4DARA 2A5DA 2WPNA 3FNBA 3OZXA 4CVNA 4WLVA 1BN7A 3FZEA 2EFHB 2V6FA 1EVZA 4FSXA 1EYZA 1VMDA 1YZGA 3HY4A 1VPDA 3L07A 3R6TA 1J09A 1AKMA 1Q0PA 2ZB8A 1E2DA 3PIRA 5H5JA 4F2PA 1AN9A 2NZWA 1QIHA 4GLLA 1PR4A 3LL7A 3OWOA 2J9FA 4LECA 2HSWA 3NUZA 2QD2A 4AMUA 2AQKA 4HGPA 4BOYA 3RS9A 5I5GA 6REQA 1U8UA 3KJEA 4I1VA 1PJAA 3GFTA 4QBIA 3O8CA 1OZHA 4HADA 1HDCA 4O02B 5LJLA 4LHSA 1QGAA 1UINA 2AH5A 2IP4A 3DZ8A 1AKWA 4TMVA 3TZQA 2W2NA 3SQDA 1BXKA 4F1JA 1WBBA 4B6EA 4F92B 1F2TB 1SH7A 2O2HA 2I6SA 2ZSEA 4AJ4A 3KPVA 4XM2A 5FA8A 1L9XA 2CKMA 3DQPA 2QQ0A 4RX1A 4O1HA 4GE0A 4BFWA 3W5BA 2BKUA 1U8FO 5E0KB 3TQOA 5CP8A 1DKQA 1JPUA 1T5DX 1CFZA 2QQEA 2P3SA 2QTTA 2JBWA 3IGFA 4P38A 3CEJA 1DCKA 1X1AA 2DH5A 4R8RA 2EEZA 4DAOA 3WYGA 3FVTA 5BR4A 1IFXA 3CONA 4NSNA 4A03A 4BKPA 4DTIA 4UNRA 1P4JA 3NBAA 1IBMB 4FMBB 2YV4A 5SY4A 3DE7X 1TYDE 4IR7A 3CJQA 3E05A 3W3AA 1ECGA 4IZIA 1OXXK 3RFFA 3RR2A 3PHHA 3HXOA 5GV7A 4HB0A 2X4LA 1T6NA 3KALA 4KN6A 1IY2A 1BX3A 1IZ0A 1I6MA 4N12A 1R4AA 3HPQA 2IZZA 4MR8B 1ISJA 5EJ5A 5KU7A 2ZJ0A 3L0DA 4LZPA 5AD1A 3ZD6A 1PL0A 1KY3A 3G9XA 4BAZA 5KYWB 2HO4A 2ID9A 2V54A 2BKAA 2VDPB 1I4TD 3AL2A 4M0EA 1J8QA 2Y1CA 3GF4A 3JRWA 4QGAA 4DL9A 2FWMX 5KREA 3FPCA 2HTEA 5CLFA 1LRJA 4AY5A 1SVUA 3TL6A 3EDRA 1H1DA 3TBHA 2DX7A 5BN4B 2XEDA 1Z5VA 3N0VA 1ZJ5A 3MGBA 1V7QA 4RGBA 3LO8A 3AF0A 3OZUA 4CKCA 3O91A 3LFTA 4E3WA 2RHOA 3BKWA 1CQXA 2X40A 3R5SA 2IEBA 3Q3GE 4JJKA 3ROTA 2GKSA 2I6XA 4MULA 5K8IA 2DU8A 1U7PA 1E0SA 3VJMA 5L7YA 4LFAB 2F9FA 1EBBA 3FR8A 3ND8A 1QRRA 1US8B 2C2MA 4JLKA 4KITB 4R9RA 5KNCA 3PA8A 3UG6A 4QNNA 2QUAA 2J07A 3GA5A 4K3VA 3WMWA 3B82A 2IGTA 4FB4A 5CYOA 2UUCB 3BH6A 1E89A 4B3GA 3OE4A 3ZWAA 3FZYA 1JBEA 4MUEA 4QTUB 4YJGA 4MHOA 1U1GA 3QPBA 3B7PA 1LW7A 3CR7A 3HCDA 3ZG6A 4BWVA 4TXJA 5EJAA 2UU9B 2OB2A 5JS1A 4D0RA 2UZ1B 4PNPA 2IT1A 4F4JA 3FLEA 1F5NA 1XTPA 1EB8A 3WVNA 3J80A 4TS1A 1JXMA 5IANA 4BQRA 3ZU6A 5EZ6B 3MWLA 1YVPA 1Q1BA 3HYSA 2D8MA 3TG2A 2O3TA 4R71A 1N8SA 2QN1A 3U09A 2WJJA 4RS3A 1K92A 5CD1A 3NI2A 2PFKA 1LQ2A 3BSWA 1N3LA 4MZXA 3LH5A 1EFTA 5H02A 3KSRA 3NXKA 5COAA 1J1UA 1P8AA 2OLEA 4CM5A 2JFVA 2J3IA 3ABRB 2C1XA 3H16A 2ZJ3A 4WOBA 5EYPB 4NJOA 3VKUA 4EG4A 4BU0A 4ITRC 2FR0A 1DINA 2DRIA 4TT3A 3M89A 3MGGA 3M8KA 2A2ZA 5TEVA 2Y1KA 3BJZA 2H2FA 1X7ZA 1TO2E 2HHLA 4CV3A 4CIXA 4CKWB 4TMYA 4UNNA 5CRIA 1Q7GA 1N0VC 2VAVA 3KQNA 1AVTA 4BUJA 4YMLA 1JQLB 3H9BA 4WMLA 2OCKA 1WF3A 2C7OA 1Y6ZA 2I6FA 1CY7A 3JQAB 3Q9LA 1SXJC 4K5QA 4LV6A 4MB0A 3RS8A 2XCSB 4FC6A 1Z0FA 5JZOA 1EESA 1RAHA 2HDOA 3T99A 4HNVA 5A02A 1ZGGA 3NPAA 1JLKA 5F9MA 4WJLA 4YAEA 4Z5XA 4DJEC 1PVOA 5K0EA 4OMDA 3KL4A 4ZYWA 3FHLA 3HCPA 2BGKA 5I7WA 1KH2A 4B3JA 4E5UA 3AEXA 5LP6B 2VP3A 1YFLA 4OTZA 1AHPA 2P4SA 2ONCA 1ES9A 4ARUA 1XX6A 3BE8A 4UVEA 5C1IA 3DLHA 2HHJA 3NT2A 4D3SA 1C9EA 4X24A 5HEKA 2Z5VA 3KKPA 4QE3A 4BC0A 1HO3A 1ZM9A 2POCA 3D1VA 3JU3A 4CI9A 4X62B 4NABA 4WBSA 4OXNA 1LEHA 1UOQA 2I7VA 1ZD8A 1X87A 4Q9AA 4MRMB 5L3QA 3ERCA 3GJ6A 3IQDB 1RWBA 3LP6A 4ZVQA 3W2FA 3RADC 3L6EA 2ZRJA 1KE2A 3AKZA 4NCAA 3LHSA 3QUTA 4IHQA 1P39A 4ZT2A 5JRZA 1XTQA 4TKUA 1XIVA 2QL7A 3L79A 3R2JA 3GGCA 4FSHA 4FWIB 4D0LB 4MB2A 1W93A 1VB5A 3PHCA 4LHEA 3SHOA 1F8XA 1ZW6A 1KEEB 2X76A 2YWFA 5LIRA 3H9GA 4L8FA 3LGAA 1JQEA 1RQLA 4S1NA 4ZARA 2PTHA 4EJ6A 1AUOA 3LHIA 3FNRA 1UPUA 2FAXA 2HU2A 3EK2A 2HIMA 1FYDA 3NEAA 4GMHA 3G85A 3T3EA 2IOQA 4JKOA 3X2FA 3I2JA 2BT4A 3HKEA 1WVMA 5IBCA 1WLYA 1J9ZA 1NJ2A 1EDEA 4R9VA 2VK4A 1FYXA 1QP7A 4KFCA 3LRPA 4HDMA 4ZAYA 1OI2A 1CDZA 4NPAA 3KQUA 1ECJA 4ZALA 3OEHD 2ZRKA 1NC3A 2OMKA 4ZYTA 5IT9A 1Z36A 3PGKA 4DYDA 4UAJA 4X20A 3NWOA 1DJMA 3HYLA 3EBLA 3SJAA 1YRWA 1OV6A 5IK2A 5KPJA 5DW0A 2RHJA 4GZMA 2JDIA 2I2DA 1WS6A 2ZIUB 1G0OA 3FFTA 3IHWA 3OIWA 1UBHS 4ZOLF 2QPOA 4UCFA 4B6RA 2GSDA 2YR0A 2GZSA 2V6MA 1YDMA 3GAFA 4ZOLA 2V65A 3SP1A 4IAOA 1CLUA 2ZYGA 4FDTA 1UBOS 1BWPA 4FOOA 1IAQA 3BL5A 1N5DA 3EAFA 4TLCA 1C41A 3K92A 3KB8A 1MZVA 3RE1A 4ZTUB 1U4SA 1MVNA 2YBEA 1YZQA 1OT3A 1BHJA 3H6KA 1L7AA 2PU5A 3QUQA 4Y6PA 2OXIA 2FB9A 1N5KA 1YC5A 4GM4A 3CF0A 3EY4A 1JHPA 2Q27A 3HCWA 3LLVA 4P08A 4UVGA 4UCXA 3QX3A 2CW5A 5D1NA 2DZDA 2CNOA 4KSYA 1P2SA 2HQSA 2C83A 2HNAA 2YYAA 2Z4RA 3L04A 2EZTA 1ENZA 1W48A 3F2VA 4GXRA 4X64B 2ZDHA 3UT5B 1TOAA 4EH1A 1FZTA 4X7RA 3U4AA 3DUWA 1VL6A 4S1WA 1HRDA 4M8KA 3MB5A 3ZGVA 4MAAA 5CDGA 2O5CA 4FN5A 1RU3A 5I7RA 1QK5A 4TYNA 5HIAA 2YWCA 3MFYA 3PNLA 2LGJA 1YD7A 4E15A 5LOVA 3O8RA 3A25A 1N3YA 1OXKB 2XQKA 4L73A 3S2GA 1YMUA 4TTTS 1E3EA 5UKDA 4C7BA 3EQ7A 2Z83A 1TVEA 5F4BA 3RC8A 1J22A 2PZAA 5AKZA 3GGOA 5K3DA 2CT8A 2ZSIA 4J07A 5C51B 1TD9A 3HCBA 2M32A 1XJQA 1YGPA 4EO9A 5AUNB 5CB0A 5ALRA 4DLKA 1BU8A 1NR5A 1XB2A 3HP4A 3RC1A 3PQ7A 2CEKA 2PMWB 2FPLA 1Z5UA 2JNWA 2E2WA 5E6SA 1UDBA 2ZT7A 4BX0A 1AJEA 5KDLA 1K8QA 3ASVA 2W8BA 3L92A 4J29A 4KPGA 1YMQA 4MRNA 2QUHA 2H11A 5JAIA 3FCXA 4DUZB 2JIQA 4KFTA 1HLDA 2FV8A 1D0SA 1S2NA 4BLQA 1HH4A 1Q50A 1T0JB 1UBCA 1E6CA 1MVLA 2IUEA 4G8BA 1OBHA 3PQFA 5M29A 1A8UA 2WVHA 2QROA 3A3NA 1FSGA 3G0BA 4J1TC 4CL8A 5BUCA 3CO5A 2XUIA 3ZV7A 4BDTA 3IERA 2WM8A 4RK1A 5FBZA 3RTGA 1ZJ4A 4GT1A 4EX6A 5B7QA 2IYTA 5B3JC 4B3RB 4YJKA 2QTAA 2H7VA 2V7UA 3G9ZA 5GZ1A 3OHMA 4QUEA 1OUMA 2ZYRA 2JLYA 1H3FA 3ANYB 1OWOA 3PI7A 4M1QA 2HSDA 1TAQA 2RGWA 1PE0A 2R6FA 5EJ4A 2AI3A 2H2AA 4BNUA 2ZS7A 1PD1A 3EZ2A 5CX1A 5J9FA 2DHQA 2J3KA 5FUWA 3SZRA 5TMEA 1CHDA 3CINA 2BISA 5J2UF 1M83A 5I7EA 5T57A 2DBYA 5LQNA 1DTWA 5LFAA 2EEPA 3LPLA 2QRKA 4BIMA 1NXQA 1E8MA 1TPYA 2HXGA 2PPLA 3VM6A 4YIKA 3EUEA 3OZEA 2RHGB 4MWEA 1SU8A 4RVHA 3WRYA 3WJ1A 1E69A 3D3NA 1CUGA 2EW1A 1NMQA 1VQ1A 2RJOA 1UJNA 3D2AA 3M4NA 3RF7A 1U2RA 3EGDA 3KNZA 1D2GA 2A8YA 1G19A 1NY6A 3JAWB 3PUHA 1A5SB 4JB3A 2P30A 3ZX5A 1ACJA 2L42A 3PCXA 2EJWA 3WKBA 8MHTA 3NNDA 3PDIB 4PLYA 3TDNA 2QUKA 3C4QA 4WOKA 3H17A 3JVIA 2Q07A 5EUBA 3SNHA 3P9RA 3OP4A 5F5LA 3UAXA 3WLTA 3WZ2A 1SBZA 3FGPA 3KEOA 3OOJA 4BV9A 2WTNA 2X1LA 4MKIA 5CFLA 4DQLA 2J7KA 4PWZA 1Z88A 2X86A 3K72B 3TSYA 3ZHTA 1GP2A 1TJ4A 1USUA 4WUTA 4ZKDA 3T0FA 3GP8A 4DA0A 1LLUA 3QU5A 9GPBA 1J42A 3B7GA 4KWHA 3SNKA 4MUYA 3FOEC 4HYQA 4UEKA 2GD1O 5IJ9B 2H17A 4NH4A 4RXMA 4XYGA 1ZX1A 3GB9A 1GEEA 2XB4A 1WCWA 1PZEA 2DMRA 3E9MA 1HEIA 2ZRPA 2TS1A 3OQIB 4Y2VA 1DDGA 1N0UA 4H0CA 2VHZA 3RFUA 4ZP1A 2QT0A 4URFA 1Z6XA 2O06A 5A4AA 3BMOB 1N8KA 2GZDA 4LSZA 4OLFA 1BYUA 1ILWA 2WJIA 2H59A 4Q1CA 2HF8A 3FWZA 3OZCA 4R2MA 2ZTLA 2GXQA 3KK0A 2XWBF 1II0A 3ND6A 3PEFA 4LF8B 4BHHB 2QUBA 2PX2A 4K9QA 1M2NA 1GSHA 1YWGO 5I9BA 3MS2A 4Y18A 2ZJZA 2B1RA 1QPGA 3B1ZA 3RIHA 5C35A 1G4AE 1HOXA 2P9YA 3KOYA 3U4GA 2BHNA 1ZRHA 2PMEA 2RGXA 1M2WA 1YU9A 3JQFC 4KH1A 4DIBA 2XV1A 3N0WA 5TR9A 1CUBA 5MDHA 4CW7A 4CFYA 4M88A 4TTQA 2GRAA 5EIFA 4QASA 1VJ0A 1QLWA 4KJZA 3SWWA 3WNZA 3ZBQA 1TECE 2WR8A 4DJDC 2P5TB 1EE1A 4F5WA 1JAYA 1R0CA 5CIWA 1VG8A 1LSJA 4ES6A 4F4IA 1BU5A 5I01A 1CETA 1PR5A 2OCGA 3AHHA 1R0YA 1Y98A 1CZOA 1FVXA 2B20A 3C39A 3Q40A 3TOSA 1EA7A 1KJ8A 3O95A 1P1HA 1IOZA 3CPJB 1P2BA 1FOEB 1W4BA 1Z37A 1FIUA 1CJCA 2B4RO 1Q20A 3IAEA 4OREX 3KYCA 3TRIA 2KS6A 2WSIA 3ZXYA 4EKDA 1Z8HA 3QQPA 2VEDA 3DF7A 4DM3A 4ETNA 4QG3A 1C0KA 3WGOA 1LZKA 4RTSA 4KPEC 2DBRA 3COSA 3DHEA 1CP2A 3SQOA 3C1AA 1Y48E 4HPJB 3G5AA 3O74A 1M2HA 1PYDA 1C14A 1RMTA 4R9SA 3PPXA 4TUYB 1MDBA 4MITA 1Y89A 1WW8A 3L5OA 3ZX4A 1M34B 1UZNA 2AT1A 2GLUA 1BMDA 1NJ8A 2HMUA 3LV8A 4IDAA 2R4TA 4YRCA 3GJYA 4BVGA 5CFQA 4DR3B 2O8DB 5C4IA 2VXOA 2EZUA 2M2IA 2AFIA 2PM8A 2GNPA 3S8MA 1OLSA 4QXMA 5ILOA 4IV5A 3OZBA 3OICA 2IC5A 4KNYA 4BFXA 3W5JA 1B26A 4N0QA 4OQDA 3BAFA 5ITVA 4AYXA 4D8WA 4IFBA 3PXDA 1F9EA 3TZBA 4RSHA 1IXZA 3L9XA 2X6RA 4GOND 4ICIA 4MJLA 3B60A 4WAUA 2I3GA 1BE0A 3M6FA 4LZLA 4ZVNA 4C3VA 3P2YA 2G8NA 1MGPA 1SU7A 2H31A 2O2CA 2ZBPA 4MS4B 1TM4E 1II8B 1L9KA 2XR1A 2YHUA 5M3BA 4RD4A 3OPVA 4J0GA 4JI5B 1QC5A 2O1WA 2HR1A 1BMQA 1VG0B 1ZOSA 2YJZA 3V4OA 4XAQA 2JGLA 1Z6GA 3OJ0A 4RS4A 3M1AA 3ZHBA 4EFMA 1IPFA 1TK9A 4UREA 2OP0A 2UXBB 4CV1A 4E4RA 3M82A 4F1KA 2UVPB 3E9NA 3H11A 4MJ7A 3NAQA 1EVEA 2NUTA 1Y7IA 2HLDD 3Q12A