2GN4A

Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadph and udp-glcnac
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
329
Chain Sequence
QNMLDNQTILITGGTGSFGKCFVRKVLDTTNAKKIIVYSRDELKQSEMAMEFNDPRMRFFIGDVRDLERLNYALEGVDICIHAAALKHVPIAEYNPLECIKTNIMGASNVINACLKNAISQVIALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQFSVVRYGNVVGSRGSVVPFFKKLVQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRMHGGEIFVPKIPSMKMTDLAKALAPNTPTKIIGIRPGEKLHEVMIPKDESHLALEFEDFFIIQPTISFQTPKDYTLTKLHEKGQKVAPDFEYSSHNNNQWLEPDDLLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of FlaA1 from Helicobacter pylori Reveal the Mechanism for Inverting 4,6-Dehydratase Activity.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords UDP-GlcNAc C6 dehydratase
total genus 111
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 4.2.1.115: UDP-N-acetylglucosamine 4,6-dehydratase (inverting).
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gn4A01
3.90.25.30 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase; domain 1 2gn4A02
1IL0A 3F6YA 1M76A 2DBRA 4EW6A 1MB4A 1WPQA 2O3TA 3WOHA 3BTUA 3HE3A 2YQ5A 1UP7A 3R0IA 4NHEA 4PG4A 1LI4A 4BKUA 4PLZA 1ZEJA 1NM5A 1ZJYA 3EUWA 4RGBA 4E30A 3NT4A 5A5FA 4GBJA 3NTOA 4FJ0A 1PL7A 4JP2A 2WSBA 4A10A 1K6JA 2AEFA 1C0IA 1YE3A 4XQEA 3GGPA 4DQXA 1XELA 5DCWA 2PGLA 1U28A 5JBIA 3RC9A 1CJCA 4L8VA 2EGGA 2EJVA 4FGWA 3W8EA 1E7YA 1EQUA 3E9MA 4OJNA 2GN8A 3ADPA 3W8FA 4RORA 1PL8A 5DNAA 1YS4A 3KEOA 2IODA 4JCOA 1KETA 3GUCA 1G1AA 3PXXA 2JCYA 3E8XA 5AXBA 3VHRA 1YJ8A 3OJLA 1DRUA 2QRJA 2J3KA 3BTSA 2PLAA 3KRTA 1QG6A 4OIMA 2VRCD 3GPIA 5DCYA 4M49A 3JQFC 3FHLA 5FF9A 3AUAA 3PFWO 4EUFA 1E5LA 4J7UA 3GDFA 1NAIA 4NU6A 1LRJA 2VTDA 3GVIA 4EBFA 1E6UA 4NJMA 3HQ4O 3DWFA 2X8LA 3G17A 3TPCA 1YBVA 3TWOA 4YAIA 4EDFA 2VQ3A 3SC6A 4CQMA 4RZIA 2YYYA 3BXXA 4GH5A 4PG7A 4WCDA 2Q2WA 4PCVA 4Y6RA 1FDSA 4CUJA 3PJEA 4O59O 5IDQA 3V5NA 2XOXA 1JAXA 4ZQFA 1HTBA 4J1TA 1A27A 5TC4A 3MOGA 4MKZA 2RBEA 6ADHA 2I76A 1ADBA 3BMOB 3TQHA 3UH1A 3W4JA 3JQ7A 4Q3DA 3BMCB 5IZCC 1Z7BA 3HN7A 4KDEA 5ITWA 1U4SA 2X5OA 1H9AA 5BSFA 4O5OA 5CDTA 1T1RA 2E82A 4U6SA 3SX2A 3JQ9C 4L74A 4EUEA 1VI2A 1NPTO 3ZZNA 5G4KB 4ZQGA 4BNGA 4ITUA 2BGMA 1ZK4A 4YJHA 1WMBA 2YV3A 1XSEA 4UVEA 5L4SA 3GT0A 4OMUA 4RVSA 1GV1A 4LCJA 3GH3A 3NAQA 1QYWA 5TT1A 4FB5A 3D0OA 2ZTUA 2RCYA 3WGZA 1UJMA 2QRKA 1J4AA 4OL9A 3ETEA 2I65A 4XYMA 1FXSA 3U9LA 5FFFA 5JY6A 1YQDA 3AI1A 1TI7A 3DHNA 3HB4X 2Z1NA 5ICSA 5FI3A 2HKIA 3FNGA 4WPGA 1F8FA 3OICA 2HJRA 4PLVA 2VHZA 1GL3A 2BF7A 3U4IA 3KUXA 3SLGA 3MZ0A 1H2BA 3K92A 1OZAA 1SEVA 3HWRA 3ZWMA 1Q0HA 3ROKA 2HMTA 1D1TA 3OF2A 3L77A 1B8PA 3DMTC 1ZSVA 4R41A 3WGTA 1Q7GA 3PZBA 2C7VA 3JQ8A 3ZV3A 4GX1A 2BLLA 4BQPA 3ZNNA 1TT7A 2ZTLA 4Q3CA 2C7GA 4PGFA 2NSDA 2F1KA 3GZNA 3ASVA 4GLOA 3RU7A 3IUPA 4II2A 1WLYA 9LDTA 4IMPA 5GMOA 1WAMA 1ZXLA 5CDYA 1NFFA 1YH3A 1CQIA 3ZNPA 2X6TA 4TWRA 4CODB 3ZHYA 2D4AA 4YCAA 1GPDG 1GZ3A 3IMFA 2ZB3A 3JQGA 4L0QA 4OKNA 1EE9A 2NTVA 3LC1O 4BVAA 3I52A 2HCTA 2VHXA 1K6IA 2TMDA 4JBHA 3N58A 4MOWA 2JCXA 1NFRA 4UVHA 4IPTA 4OXYA 1L7EA 1TT5B 3U3XA 5KVCA 1M67A 5A9RA 1HYHA 1RYEA 3NKLA 4CR6A 1R12A 4G2NA 3OQ1A 4BO6A 8LDHA 2J3HA 3UW3A 3BMCA 3MCVA 3AI2A 4GQAA 2AEMA 3IDSA 3OEYA 4IIVA 4XB1A 2Y0DA 1H94A 2Q45A 2SCUA 3LSYA 4D3SA 3L0DA 1F17A 3GEMA 1GUYA 2C5AA 2CDCA 1D3AA 2A92A 3Q2KA 3O9ZA 1NHWA 1ENZA 3S8MA 2VOEA 4M86A 3WS7A 2AHRA 5DT9A 5KNLA 1KY4A 1X7DA 3JD1A 3K2BA 3N7UA 1Q0LA 2YZ7A 3IP3A 3I6IA 5KJ6A 2O3RA 1NP3A 1T2DA 1QYDA 3ICPA 1R4NB 3DOCA 4JJIA 4RO0A 2XAAA 2JHFA 4XYBA 5K9ZA 3M1AA 1PJ2A 4A7PA 3IIEA 4ZA2A 2JAPA 4IS3A 1EFLA 2H63A 3BTOA 5IXYA 2BRUA 4YPOA 2CVOA 1XYGA 3JD3A 1E3JA 3CUKA 4YT5A 3OSUA 5ENDA 3JQ6A 5L3ZA 2CY0A 2IZZA 4C7JA 1H93A 4XWYA 2UAGA 4M87A 4FDAA 1ENPA 4MIOA 5TLSA 1HDGO 1YBMA 4FC6A 1I3NA 3PLRA 1XA0A 3OM9A 4LRTB 3U0BA 1SMKA 4MKXA 4DBVO 5IDYA 1GTMA 1HE4A 1NVGA 3F5SA 2H5LA 3M2PA 1HKUA 5B37A 4XGIA 4ZICA 3TDKA 1EK6A 1DJQA 3OETA 3RKUA 3EHEA 3L4SO 4TZKA 3AY6A 3C7CB 4BNWA 3OBBA 4CMJA 5I8WA 1BSVA 4XGNA 4AJ4A 1XU9A 2DC1A 5IF3A 4Q9NA 4WGGA 3LT1A 3TZQA 3WYBA 4BHTA 4JXKA 3DBHB 3BYZA 3NJ8A 2O3SA 4MVJF 1KEWA 5FEUA 1ZZEA 1MP0A 3DZHA 3IS3A 3ZWXA 1AUPA 2VZ8A 1GPJA 3R3SA 2JCVA 5CAEA 3M1LA 3PPIA 4Z9YA 2IYOA 3H3FA 4IY1A 1N1GA 2X86A 2OBNA 2G17A 2TMGA 1EFKA 4CMEA 5G0TA 3RBVA 1K0UA 2GO1A 1ZW1A 3WSWA 4EEZA 4NPCA 1E6WA 3ZU3A 3AFMA 3AY3A 1OC2A 2IXAA 4S3MA 1KYQA 1NWHA 3AUSA 4PVDA 3AOEC 3JQAA 3C1OA 1EVIA 2Z1MA 1BW9B 3N74A 1JQBA 2C2XA 1X13A 4K28A 1OBFO 1P1FA 1LLDA 4L4SA 4UEJA 1DC5A 3ENNA 5ES3A 3AJRA 4QECA 5KJCA 1V35A 2Q99A 2QIOA 4E32A 1HSZA 3HDJA 5CEJA 2VTEA 3MJ4A 3PHJA 4U0JA 4C7KA 5AXDA 3HDHA 3HNPA 3GEDA 3D4NA 2Y0CA 5I9LA 2FSSA 4CV1A 4YEDA 1I30A 2JAHA 3U49A 3LU1A 4PZCA 3GDGA 4RPHA 4J43A 2E6UX 3ZCXA 3H9QA 2UUOA 1H5QA 5T6BA 4PLPA 2OMEA 1F8GA 2C59A 2A35A 3CMCO 3UAGA 2V6BA 3VVBA 3Q11A 4BKQA 1EUCA 1GUFA 3JQGB 3MWDB 4U5QA 3GNSA 3V1YA 4F6CA 1Y8RA 1IE3A 1PWZA 1DJNA 1Q7BA 2DKNA 2HRBA 1HLDA 4D0RA 1QYVA 3RJ5A 1SOVA 3GFGA 2E48A 1ONNA 2Q46A 4J1QA 2FMUA 4XIJA 4R1SA 1T2AA 4B4VA 4CM7A 3IJPA 4M55A 2ZK7A 1X7GA 3BHJA 1W73A 1BGVA 3RC1A 2AMFA 1U8XX 4U7WA 4Y9DA 4Z9XA 2Y93A 4DPMA 4TVBA 1A5ZA 2J5KA 4WOKA 2Z95A 4KZPA 4TSKA 1RJWA 1PJBA 4ND1A 2A9FA 4CLEA 3QY9A 4IQ8A 3GZ4A 1VSUA 5L9AA 1V9LA 4JJGA 4D41A 3EY4A 5IZCA 2DBVO 5EPOA 1R37A 3JQDA 5EESA 3L9WA 4CQLA 4PLHA 5IZ4A 1O5IA 5I9MA 4ONEA 4D3DA 4ALJA 1P1RA 3B1KA 4HUJA 3WLFA 1PQPA 1PJTA 4U8GA 4F3YA 5I7EA 3WIDA 3X2EA 1V3TA 3L07A 2A94A 3A28A 4BV9A 2UYYA 4DUPA 3GVHA 3TFQA 1SOWA 2CVZA 2PZLA 2AQHA 3HSKA 5EN4A 3ZWAA 1CYDA 2BD0A 5DOVA 2GZ1A 2HMSA 1N7GA 1T2FA 2EF1A 4KQXA 4D43A 3BA1A 1UXHA 4J7CA 2QZZA 4L75A 2CFCA 2PNFA 2Y67A 1I3LA 4PFJA 4RF3A 5JDIC 1EUDA 3HDYA 3WB9A 4P4GA 4YT8A 1T24A 4CM8A 3P19A 3F4LA 4FW8A 2W8ZA 1IY8A 4AVYA 3EAGA 1SB8A 3U4CA 1UDBA 4NZ9A 3RQSA 2DUWA 5GZ3A 3A4VA 2QYTA 1B3BA 4B3HA 3VPXA 1E1MA 4Y6PA 1PR3A 3JTMA 4YRBA 5A06A 2VT2A 1N5DA 1IULA 5JCXA 1BXZA 1GZ4A 2BGKA 2NU6A 2I9PA 4FOSA 4WLOA 3DBRB 1T26A 3DONA 1E3SA 1N2SA 3FNEA 4CL3A 3D64A 1V3UA 2E37A 2UUPA 2CNBA 3KVOA 4JIGA 3VPGA 1UZLA 1GYRA 1KVSA 3LQFA 2NU7A 1I2CA 5AYVA 1C14A 4OXKA 2WYUA 4DQUA 3S2GA 2HMUA 2PWZA 1AHIA 2RHRA 3IKVA 4R69A 4MVJA 1NQTA 4M8SA 3ZWNA 2G0TA 3INTA 4IXTA 1QLJA 3HUDA 2W90A 4JNKA 4A03A 4CLOB 1P74A 4L76A 5U4QA 4D3FA 2NTJA 4O63O 3A06A 1E1LA 3VZRA 1R16A 2Q2VA 1IUKA 3BTVA 3OA0A 1K3TA 3K31A 1HDOA 3WSVA 1NBOA 2FZWA 4IDEA 1HZZA 1PZEA 2IEDA 1DEHA 3GAFA 2JFHA 2FSVA 3E9QA 5JE8A 2BKAA 2PZKA 4D45A 4YJGA 4B3IA 4I08A 1EEHA 4Q3AA 4BNHA 1JLLA 1GQQA 2DTDA 4WLFA 1EUZA 3V2UA 3KSDO 5JO0A 5LC1A 3WMWA 2NVBA 3DO5A 4XR9A 4Y6SA 4E4YA 2BGLA 3F1LA 5JDCC 3WBBA 1N9GA 5L4NA 5JLAA 4YJFA 1PJSA 2B35A 1P45A 1ADFA 2GLXA 1ZCJA 4FFLA 3ZU5A 2GN6A 2C2YA 4XCVA 4CV3A 1O9BA 2EHDA 2EXXA 3TZCA 4OYRA 4AJJA 3C7AA 1PJLA 2Z5LA 3CE6A 3QVSA 3PJDA 4WEQA 5ER6A 4FD3A 5T8KA 2DFDA 3W1VA 1R15A 3PDJA 1NPYA 1SBYA 5TS3A 1N1EA 4J4HA 3RC2A 1TLTA 4LVCA 2EJWA 3QWAA 4P4NA 1ZMTA 1HYEA 1Y6JA 3F47A 4ESOA 3JQ7B 1KEUA 1U7TA 1R4MA 1DOHA 3RJ9A 3PIDA 1YKFA 4N5MA 1DIGA 2PFGA 4NK4A 3QVXA 1KOLA 5A1TA 4E13A 5JCJA 4AICA 1MC4A 2X9VA 4UUPA 2C82A 5LDGA 2O3JA 2PD4A 4WJZA 4FPXA 2O23A 3U62A 3UXYA 3KYCB 1J0XO 3G1UA 3JQCA 3MTJA 4ZD6A 3HJAA 2R00C 3LYLA 1R6DA 1KVUA 1GQYA 2GERA 2YHIA 1B15A 2QG4A 3GN1A 1WZEA 3M2TA 1YB5A 3DBRA 4I5DA 4RPLA 3K2EA 1M75A 3WBFA 3H2ZA 3LC2O 3GDOA 4C4OA 4ID9A 4BQRA 4AJOA 2AE2A 3MWEB 1YWGO 3UUWA 2FN7A 3E1KA 3F3SA 4P22A 5KIAA 2PH3A 3GHYA 5FI5A 3L6OO 3LVFO 1HXHA 4JGBA 1K89A 4GX2A 4TRMA 4WKGA 1LDEA 4IJWA 2PZMA 4JP3A 5DBGA 3V1UA 5IG2A 3JQBC 5JS6A 1MXFA 5EIOA 3IKTA 2VWQA 3PYLA 1MG5A 4K6CA 3H4VA 2OP1A 1IYZA 3U4HA 4BNLA 3D4PA 3C85A 3ZN2A 4IUYA 4E5KA 1H0KA 3RCBA 3RSHA 4YA6A 1LBEA 5JAQA 3KLMX 2NVUB 1ZK1A 4CM3A 3A9WA 2X22A 5A4DA 5A9SA 1KS9A 3ZW8A 4BIIA 2C29D 4PRKA 5IDWA 4XZ3A 1MLDA 5I7SA 3OP4A 3SJUA 4L4XA 3ZNOA 2Q1UA 3D3EA 4JQCA 2I6TA 3VZQA 1ARZA 3O03A 2Y68A 3S2FA 3NV9A 4B8ZA 1SAYA 2P91A 3STHA 5A3VA 1LSSA 3HN2A 3T4EA 4HFNA 3WTCA 4B7XA 5KTKA 4FIZA 1UAGA 4RZHA 3WWYA 1RM4A 4D7AA 4TKLA 3PWZA 3CINA 5C7IO 1U3VA 3ONEA 1VJ1A 4N5LA 3W4KA 1OI7A 1R4NA 4YRDA 3GOHA 2V65A 4NU5A 1ULSA 1B16A 4B4UA 5KJFA 1WWKA 3MJCA 2HAEA 1E0DA 2FWMX 2RH4A 1AXGA 3FWZA 3KYBA 5CFZA 1N8KA 2WE8A 4L9RA 1NAHA 3WMXA 3C3XA 4DC0A 1QORA 3PJGA 3DB2A 4R5HA 4J1NA 2YY7A 2UVDA 3P7MA 4YAKA 3WQRA 3JSAA 1JW9B 5BSEA 1GR0A 4AJKA 2WTBA 4CMIB 1E7WA 2VWHA 1MXHA 3H6KA 3WGHA 4ALLA 5BNIA 2VUUA 5KVSA 3CXRA 1Z82A 8ADHA 3GFBA 4B3JA 4A2CA 4XR4A 4XQGA 2YJZA 1ZMOA 5T57A 2PY6A 3DOJA 3LT4A 1I2BA 3E6AA 4MINA 1X0VA 1YB4A 3PIIA 1X14A 4CMIA 4BNFA 2W2KA 4CPDA 4E2YA 4MP6A 1Z7EA 1NPDA 4KUHA 4IINA 1O95A 3AM4A 1F0YA 3DZIA 4CLRA 2BI8A 2YV1A 3MJEA 1A71A 1ZBQA 1CQJA 1LLCA 3KYCA 1AGNA 4YT2A 3PTZA 3V2GA 3ZWBA 4BGEA 1HEUA 4LSMA 4OOFA 5IJZA 1U3TA 1I24A 1I32A 4YB8A 3DAFA 1DIHA 1L7DA 1TXGA 4TMFA 3ZWCA 1HDCA 5TNXA 3FPLA 1IOLA 1C1DA 1V8BA 1GEEA 3UFXA 1EVZA 2IZ0A 4FFPA 3GMDA 4CQLB 4R1NA 3TFOA 2GGSA 1WNTA 3B1JA 4QFDA 3RROA 2D3TA 1NR1A 5COQA 3ON5A 1PEDA 2EG9A 2V7PA 2VUSA 1UP4A 2DM6A 4CR8A 2GN9A 4HV4A 4PLYA 1LNQA 4MKRA 4WASA 2X0RA 4KWHA 1YL5A 1QKIA 4KWIA 2E49A 2ZYGA 4J3FA 4AG3A 2AQKA 4J91A 3E82A 5GY7A 1PS8A 4H15A 1I36A 3RFVA 4MVJM 2FR1A 5DN9A 1KC3A 4RF4A 1CRWG 5KJEA 1A4UA 4NG5A 4NH4A 4UUOA 3JD2A 4I8XA 4TQGA 2ZYDA 3TL2A 2WYVA 1DFGA 4J49A 4ND2A 1T25A 5AXCA 2HU2A 4HX5A 1DIBA 2VWPA 1LUAA 3HZZA 4GL4A 2BH9A 2WMDA 5A3JA 5U9CA 3HADA 3NEPX 4B4OA 1MFZA 2V6FA 4XJTA 3ZV4A 3QWIA 4JROA 3LT0A 3MOIA 1ZJZA 4EI2A 2X7HA 3GVCA 4CV2A 1LDMA 4W9NC 1LJ8A 3ZDFA 2JFFA 2V6GA 4OH1A 2W4QA 1IHXA 4L73A 2EKLA 3VH2A 4HWKA 4DA9A 2ZCVA 1LQUA 3RFXA 1NHGA 5IXSA 2DPHA 3RASA 4WCFA 1LC3A 3D4OA 4IBOA 2GYYA 2LDXA 4XGKA 4J0EA 3UCFA 1T4DA 3R1IA 2R2GA 3GVXA 1ISHA 1Y81A 1A9ZA 3NDIA 4ZVVA 3SBOA 4AJ1A 1PU2A 1UZMA 3QVTA 1DHRA 1HRDA 4JJFA 4QT0A 3AK4A 3C7DB 3VPFA 4E3ZA 3BMNA 3TOZA 4GGOA 3H9EO 1FDVA 5THQA 3AU8A 4HFJA 3D5QA 2WWRA 4YVFA 3GNQA 1KBZA 1GAEO 1K2WA 2B83A 3I9MA 4MIYA 3WYCA 1MV8A 1GDHA 1RWBA 1XEAA 3CSDA 3KSZO 1GYQA 3AY7A 1GYPA 1ZSNA 2BFOA 2J5QA 4IMRA 3TNLA 4NBTA 3WICA 2X5JO 2JL1A 1UR5A 5TF4A 1ZXBA 3PGXA 3MTGA 3PDUA 1ORRA 3BHMA 3DOOA 1O94A 2DLDA 1A4IA 1P1HA 3FRJA 2NUAA 1YL6A 5EL0A 1DC6A 2PV7A 4UAGA 1KEPA 4IIUA 2Y1GA 4J7XA 4CMKA 2J3IA 2YQ4A 3I9LA 5F5NA 2BFPA 3GF4A 1EDZA 3RUCA 1PZFA 4QTZA 4DWVA 4J0FA 1VKOA 1CEQA 2B4QA 4FSHA 1LC0A 1TVEA 1UXJA 4BB6A 5K6AA 3IC5A 2ZATA 3OJOA 3ST7A 4FOOA 4XEHA 3HDQA 3RC7A 3DHEA 2F00A 4Y98A 5HM8A 2GNAA 1GV0A 5JYEA 3DDNA 1FDTA 3PHLA 1ISMA 3NTRA 1DXYA 1LDBA 4PG5A 4GX5A 4A0SA 1HZJA 1UXKA 1OOEA 3VAZA 3KO8A 4OO3A 4BS9A 4MPDA 2XXJA 2VHWA 4AJEA 3HFGA 3FNHA 2ZQZA 4CUZA 1GZ6A 1C3VA 3VDQA 2G76A 1XQ1A 4BV8A 3S2EA 5DCUA 1E6EA 1HSOA 1PGNA 1PGOA 5JAIA 4IDFA 2WEKA 3AOGA 2DTXA 5AVOA 4PVCA 5KKCA 2Q1TA 1ZIDA 3VZPA 1VE9A 4R01A 3RUEA 1FDWA 2AW5A 3WFJA 4ROSA 1NQ5A 1XGKA 4IXWA 3VTFA 1B0AA 3QVWA 1RPNA 4CM5A 3K9QO 1KERA 2P5YA 4IJVA 4ZRNA 2EW2A 2JHGA 3DHYA 1W0CA 3ABIA 3ZWVA 3GVPA 1ADGA 4B7CA 4EJ6A 1HE3A 2YV2A 5T67A 3WJAA 4KQWA 4NBVA 1EE2A 3ZU4A 3MEQA 2WD8A 4TROA 2ZTMA 1BTOA 3E9NA 1LLQA 1UH5A 4Q3BA 4WLVA 3RUHA 4CLDA 3H65A 2QHXA 3T7CA 3TZKA 4WOJA 4BNKA 4FCCA 2AQ8A 3FI9A 4W99A 3UICA 2IE0A 3G79A 1VM6A 3KB6A 3CZMA 2A4KA 2JD2A 4RDIA 3TN7A 4W82A 5KCZA 2O2YA 1HYGA 1QR6A 3A1NA 4GI2A 1F14A 4PZEA 4RV9A 2D5AA 4XKJA 1WMAA 3GUYA 1CERA 2VOJA 3L6DA 1IHYA 1RM5A 2PK3A 1IB6A 2EWMA 3QWBA 4WCFB 3GRKA 5BSGA 3HG7A 4DIFA 2B5VA 3TF5A 4J9UE 4BNZA 4KTVE 2FPPA 2I3GA 2NU9A 3WGIA 3RUDA 4OHUA 4LGVA 4J4BA 4CUKA 1JN0A 1ONPA 2Y1DA 4R54A 1PX0A 4WCFC 5H83A 5L7WA 2D59A 2O3QA 4M1QA 5JMPA 4W7HA 1ZSYA 9LDBA 3I4CA 3ZW9A 4ZQHA 2H1SA 3DBHA 3PI7A 1LDYA 1I01A 1LTHR 1T2EA 1MFPA 2W2LD 5BSHA 2ZYAA 4YWJA 2YDYA 3JQBA 2AEJA 1JTVA 4ALMA 2ZJ1A 5TX7A 1BG6A 1DFHA 1R0SA 2C20A 1VL6A 3AUUA 4U6QA 1VLLA 1UP6A 2NVUA 4RPKA 1HDYA 1XLTA 4II3A 3INGA 3KZVA 3IL2A 4MVJG 4Q39A 1AXEA 2VRBA 4MDHA 1PQWA 2X1HA 2NV6A 1DFIA 3FF4A 4R9RA 4YACA 1J49A 3H5NA 1G6KA 4UEOA 3LK7A 5G0VA 4M54A 2WM3A 1DAOA 1TA4A 5L95A 4CM9D 5L53A 1YJQA 5IDXA 5A9TA 4YQZA 3FBTA 2D1YA 3Q9UA 4R3WA 1BXGB 3EZLA 1MC5A 1Y5RA 1HF3A 1YQGA 2RIRA 1PWXA 3BMOA 3AUTA 5EQFA 1WW8A 1E7SA 2CF5A 3RWBA 5BNFA 4BO2A 4S1VA 4BGIA 3Q1LA 3H3JA 5KVVA 3TJRA 3TZHA 5MGBA 4OKIA 3CKYA 2VNSA 1LSJA 1LDNA 1XR3A 3SVTA 2CVQA 2GSDA 5C5IA 2GZ2A 4URFA 2Y1FA 1PZHA 4DGSA 2NNLD 1RM3A 1PQUA 5KKAA 5ILOA 3RAJA 3OJEA 4I5FA 4NJMB 5GZ1A 3NGXA 4JK3A 4E33A 2FR0A 4CLHA 3VPSA 4I9NA 3GHHA 3KETA 2D0IA 1SC6A 2DUUA 5DF1A 1AN9A 2O3UA 5G2OA 5CDGA 4RJTA 4WNIA 1XIVA 1B7GO 5CDUA 1BDBA 2B37A 2IZ1A 1BMDA 2P9EA 3SJ7A 5L7YA 5TGDA 3RIHA 2OOSA 1MGOA 1U3WA 2HK7A 2OXIA 4J2HA 2CMDA 3D1LA 1KC1A 1RM0A 1YDWA 4NIMA 4PRLA 5I8ZA 4D46A 1FDUA 4HKTA 4FQ8A 3B6ZA 3ENKA 5DBFA 3C1AA 3RVDA 1U8FO 1P3DA 1XU7A 4CR7A 2DAPA 4B8WA 7MDHA 2ILTA 4OQZA 3T4XA 1C0KA 4RQUA 1E3WA 3E18A 4E2ZA 4G65A 4LMPA 1KIFA 2QZ9A 1M66A 4IDCA 4DL9A 1CDOA 3C8MA 3C1TA 1I33A 4K6FA 2AA3A 3GZNB 3PJFA 1ULUA 4H3VA 3VH4A 1LLUA 2ZB8A 3ITDA 5H81A 1M6WA 1QLHA 1VKNA 4AJIA 1T4BA 2HUNA 4F45A 5HRUA 3WR5A 4MP8A 1EBFA 1GCOA 2QX7A 1IPFA 4I1IA 1X1TA 5ER9A 3JYOA 1M2WA 3IOYA 4EITA 4EJ0A 3DZBA 5KVQA 4ALNA 1H9BA 1PJ4A 3AI3A 2Q50A 3BAZA 2PTGA 2VYVA 4CLOA 4FN4A 1PZGA 4UEKA 2GF2A 2OBYA 5DBIA 1NQAO 4XYLA 2AE1A 4MVJE 3UGKA 1XQ6A 3AM3A 4JLWA 4RPJA 3CH6A 1BRMA 1C1DB 3NTQA 2B36A 3P2OA 3RFTA 2C0CA 5L45A 4ZN6A 1GQ2A 3BMQB 5ICMA 3I4FA 3WYEA 3IUSA 3K96A 3PZRA 1E3EA 3PQFA 4A27A 5HS6A 2YHUA 1SCUA 2BFAA 4XYGA 1ZH8A 3W4IA 4BNUA 1B8UA 5A04A 1HLPA 4BNYA 3GC6A 3U09A 4LSWA 1Y8RB 4I9UA 4ND4A 1FMCA 2CF6A 2ZB4A 2P4HX 3EC7A 3FR7A 4D44A 1ADCA 1VL0A 4CMCA 3BHIA 3AFNA 1V6AA 1D8AA 5B12A 4ZHSA 4BKPA 3WGOA 5TT0A 1M6HA 2EEZA 5DP2A 2DU8A 1V0JA 1UDCA 1T2CA 1EDOA 2BELA 3BZUA 3JQFA 1K6XA 1P44A 4CM8B 4DMLA 1WXDA 4INAA 5CPFA 5I7FA 1KVQA 3H5AA 4CQMD 4NFHA 4BGVA 2Y99A 1EZ4A 3PLNA 4YDRA 4R3NA 1ZK2A 3I9OA 5BT9A 1YDEA 5HWSA 1ML3A 2W98A 3WGQA 1Y8QA 1MA0A 3I9NA 4TRRA 4QUKA 1X1EA 4N7RA 4W9NA 5JNLA 3OIFA 4GKBA 4E12A 3KLPX 3NGLA 1R0KA 1S7CA 1UZNA 1ZVMA 3KXDA 2GDZA 4YTEA 1I3MA 3DXFA 1VJTA 4CQMB 4EGFA 3BMQA 3FBGA 5EERA 2G5CA 4IZIA 2HQ1A 1LSUA 3UVEA 2B69A 3JYQA 3FD8A 2YFQA 2R6JA 5L51A 4GMGA 1U2GA 2YW9A 2VZ9A 1FK8A 4M89A 4I9HA 4RQTA 2V6MA 2FR8A 2VYNA 1IPEA 4OM8A 4CMBA 4CMGA 1YOVB 4H16A 1P0CA 4N54A 4E31A 1LDGA 5B4TA 3K6JA 1U5CA 3QE3A 3ZI0A 4D79A 5I7VA 4OGWA 5JC8A 2PA3A 4DC1A 3JYLA 1HDXA 4FC7A 2IEBA 1ZUD1 2PZJA 2WD7B 2RH8A 4LMRA 1ISJA 5TRTA 4E6PA 1PS9A 4AJLA 4H7PA 1DHTA 4NK5A 1OFGA 3M6IA 2ZTVA 4FFOA 4Z0TA 5A9SB 3GG2A 5ILGA 4WLNA 1DO8A 1XKQA 3PVZA 4HXYA 4IDAA 3UCXA 3JQAD 3I6QA 2P2SA 4NFYA 5AXAA 1E3WB 4WLUA 1YXMA 2Y1OA 1W8DA 1XHLA 1E77A 1JWBB 1NNUA 4FFNA 3ZHBA 3RKRA 2FP4A 2YFHA 2ZB7A 5G4LA 1U7HA 1QSGA 4EUHA 5C7OO 4GMFA 3O38A 1E1NA 1DC3A 4KUGA 1PJQA 3B20A 4DYVA 3FTNA 3GLQA 3L4BC 5J23A 5G0UA 1XDWA 3OQBA 3ZHZA 5JAZA 5MDHA 2E4AA 4DTIA 5COBA 5A02A 1A7AA 3PRJA 5BR7A 3PWSA 3OFSA 4YT4A 4CL8A 4G81A 1B2LA 2OZPA 2B4RO 4MP3A 1YOVA 2B0JA 5JYDA 3DBVO 1LRLA 2IYPA 3G0OA 3RU9A 4GAEA 4BNTA 5K6AC 4CJXA 3RUIA 1DIRA 1DC4A 1EMDA 1TEHA 3I5MA 3JD0A 4HFMA 5U1PA 2GCGA 3SEFA 2D8AA 4FR5A 5BNTA 1G0OA 3L9XA 1SB9A 3FSRA 5ADHA 1Q0QA 1Z45A 1CETA 6LDHA 2D5CA 3DTYA 4IJUA 3UKOA 4F6LA 3ZU2A 3DFUA 3OHSX 5T5QA 3FTPA 2J5RA 3IP1A 3S55A 1QV7A 3V8BA 4I5GA 3DZGA 4RLHA 3JQ9A 4KUEA 3VDRA 3TZ6A 2WYWA 3D5TA 2Q1SA 4DVJA 3DQPA 3S1LA 1BVRA 2NADA 4RVHA 3EVTA 3FR8A 4WUVA 3P5SA 3WNQA 4TVOA 3CZRA 2GUGA 4E2XA 3OEWA 4OAQA 2JJYA 5JMWA 2BHLA 1VRWA 5TJ9A 4YJFB 5IN5A 2WDZA 4BO8A 2OGUA 2CUKA 4NBRA 1EVYA 3AU9A 3EMKA 2CDBA 5CHEA 4EZBA 1OMOA 5B1YA 5F3RA 3HFSA 4O1MA 5GZ6A 3RBZA 5A05A 3VTZA 4NR0A 4L4RA 3ZHXA 3QQPA 5KOIA 1ZK0A 4NQZA 1BWSA 1VJ0A 2QQ5A 1QYCA 4J2OA 5EQDA 4UVIA 5HBRA 5LCXA 1JU9A 3DC2A 1O8CA 5T8KC 3I9KA 3ASUA 3CMMA 1OAAA 2EV9A 2O4UX 2NWQA 2EGHA 3EYWA 3WQQA 3WWZA 4HNGA 3GEGA 4GSKA 1F12A 1P31A 3QW2A 4WEOA 5F1KA 3H9GA 4XDYA 5TQVA 3WX0A 4AJNA 3GPDG 1Y5MA 3JCZA 4BO9A 3INRA 4ZRMA 4R68A 4BO7A 1RKXA 3DMTA 3GGOA 1KVTA 1HE5A 2P9CA 3NUGA 1F06A 1P1KA 2DFVA 4GSLA 4Q3EA 2CDAA 3O26A 3QA9A 4XRRA 5B4UA 1GADO 2PKQP 3GAZA 1PJ3A 2FY8A 1ENYA 3O8QA 1XG5A 2VT3A 1W4ZA 4HFRA 3ROMA 4CV0A 2EP7A 5A03A 2EKPA 4BOYA 1EK5A 2AXQA 4BO5A 1SEPA 3FN4A 3CPSA 4CLRB 4DPKA 2VNAA 3WXBA 3WGGA 1Y8QB 3S2IA 2X0IA 1LX6A 4J16A 5CPBA 2ZIZA 3IJRA 4YJHB 2GN4A 2O7QA 1H2HA 2W2KB 2EIHA 1AE1A 1QMGA 3GA0A 2P9GA 3I9JA 3NYWA 3PQEA 5G4KA 3T7EA 3D3WB 4YJDA 4E5MA 4UVGA 3WDSA 1UAYA 3WFIA 3EZYA 5CEEA 3GR6A 4BO0A 1NVTA 3RUFA 2NACA 4I5EA 4B7UA 3H5RA 1A72A 2PH5A 4E21A 4QQRA 2DQ4A 4RVGA 4AJ2A 5EMHA 4RDHA 2G1UA 4TZTA 7ADHA 1E1KA 2CSUA 2GZ3A 1I8TA 4QX6A 4B79A 4EEXA 3NT5A 3WIEA 2B4TO 3WNVA 2OORA 3L4BA 5IN4A 2NLOA 3LC7O 2HLPA 4PG8A 4CM9A 1C0LA 1TB4A 5TIIA 2NU8A 1X15A 1NX6A 3ANLA 4LK3A 4YR9A 4LRSB 5EINA 1YO6A 3B1FA 1N7HA 3F4BA 3ITKA 1HETA 5KJ1A 2NVWA 3KEQA 1XCBA 2RHCA 5AOVA 3QRWA 1C1XB 1Z73A 3JQEA 2JD0A 3NRCA 2YUTA 5CG2A 3ORFA 3QHAA 1JVBA 3B70A 4PG6A 4NBWA 1QYXA 4GVLA 3GRPA 1SNYA 2X58A 3F1KA 1CIVA 1UUFA 3L6EA 1GCUA 1JAYA 3MJTA 3DAPA 1B26A 1I10A 3DZJA 4NJOA 3ONDA 4QEDA 1W6UA 4ILKA 4GLLA 2HSDA 1X7HA 3SC4A 2VHVA 5EJ2A 4TKMA 4IQ0A 2QYSA 3CTMA 1DLJA 2WJPA 2X0NA 4RCVA 3ROQA 4Z6KA 1ZFNA 3DEYX 4LCEA 2OFPA 3LDHA 4WECA 1LA2A 4BNIA 4KDFA 4XA8A 2HDHA 5F1PA 4AJHA 3F5QA 4WK6A 4W6ZA 4KOAA 2BI7A 4BNJA 2D2IA 3V2HA 4IDBA 4XIYA 2RAFA 1DRVA 1JKJA 1EQ2A 2O50A 4RVUA 1DBVO 4MVJH 4ND3A 2FHSA 2IDZA 1D4FA 4YXFA 2FPIA 1SO8A 5JAMA 1I3KA 2Q2QA 4PLFA 2I66A 4XQCA 4PN3A 2EW8A 1VPDA 3PK0A 3PP8A 3PYMA 4PIVA 4R5MA 3O4RA 4CLXA 4J1SA 3I3OA 3EK2A 4OQYA 2R00A 5ITVA 4NNJA 1J5PA 1MG0A 1C0PA 3WTBA 4DIOA 1B3RA 3H7AA 1VL8A 4DQVA 2GRAA 4AFNA 2I67A 4R4JA 5H82A 1CWUA 3PWKA 4DMMA 3EVNA 3FWNA 2PGJA 3VPHA 2VYVD 3E03A 1JVSA 1NTOA 2DT5A 3QVOA 1E7RA 2ZQYA 4NFSA 4A73A 1JA9A 1HT0A 2PD6A 4AL4A 2HMVA 2BFMA 4JN6B 1J6UA 1H6BA 1U9JA 2X9GA 4Y8VA 2HJSA 1L1FA 4CM4A 2Y1CA 1ISIA 3RI3A 2FZEA 3WJ7A 3JYNA 3QJ5A 3ZGYA 4J6FA 3ETDA 4BGUA 1N92A 4NI5A 4TRJA 3KYDB 1Z75A 1BXGA 3VOSA 4Z3KA 1GD1O 3E5RA 2X0JA 3Q9NA 1OC4A 5KWEA 2JKVA 3PFFA 5IAAA 4BO1A 4F46A 4P4LA 4BB5A 1SPXA 1GUZA 2NM0A 1P1IA 4E0BA 2UV8A 4DYDA 3H9UA 2I99A 1Y7TA 1GU7A 4PZDA 4BO3A 4MVJP 4DLBA 3KSUA 1E7QA 3ZWYA 1GEGA 3PHIA 3QSGA 1Q7CA 1XWFA 5G0SA 4UREA 5HA5A 1X0XA 3ZWOA 2I5PO 4CMEC 5TJHA 5L40A 3EGOA 4DRYA 5C37A 4WNCA 5T64A 5JY1A 3GGGA 4R51A 4LVUA 2OP0A 2POQX 2J6IA 3NDJA 3A14A 4UUMA 4O0LA 3K8ZA 2P5UA 1U2DA 1PL6A 1YBAA 4BNXA 1WP4A 1DPGA 1QV6A 3DBLB 3DBLA 3JV7A 1O0SA 4KMSA 4LW8A 2PR2A 4BO4A 1HDZA 4J90A 2PKQO 2AQIA 2CZCA 4BMVA 4WE3A 3ZWPA 1DSSG 4BNVA 5G0WA 2O2SA 4MJLA 4Y67A 1UDAA 3RUAA 1Y9AA 3FNFA 4Q3NA 1EVJA 5A5EA 2HRZA 4FFRA 2G82A 3ADOA 4K9DA 1D1SA 4IS2A 5HS4A 4MIEA 4XYEA 1YGYA 3ETGA 4DXHA 3OIDA 3OMLA 3TL3A 1LRKA 4DLLA 3K30A 2OUIA 1B14A 1JWAB 1I0ZA 2IRWA 2VUTA 1TT5A 3MJSA 5TSDA 1WZIA 4OOEA 4BUCA 4YAGA 3ANNA 5JCJD 1H6CA 1YB1A 3D3WA 4ZGWA 5CEFA 1S6YA 1G0NA 3KYDA 1NXQA 3DMYA 4WLEA 5DOZA 4J4TA 2VCYA 1B8VA 4RVFA 3ONFA 5F1OA 3LLSA 4K26A 4ND5A 1HL3A 3FCOA 1O89A 4RF2A 2YHIB 4Z3DA 4CM4B 2C07A 3OQ6A 2OO5A 4YBZA 4DPLA 4LN1A 3BMNB 4YRAA 3OH8A 2VHYA 4RVDA 1Q2XA 1FF9A 2LDBA 4YAJA 1KEVA 1NQOA 5L7TA 1PR9A 2HK8A 1ZEMA 1WDMA 2X23A 3AW9A 4XB2A 1I2ZA 4RPGA 2UDPA 1P9LA 3JQ8B 3Q0EA 2Q1WA 2DVMA 3ZNQA 1PGJA 4QSMA 4BMSA 3H2SA 2P68A 1UXIA 3H8VA 1MX3A 4EJMA 4GVXA 3UOGA 2XXBA 3KV3O 4YAEA 5COAA 1ZKMA 4NBUA 1IZ9A 3G49A 2OHXA 1YL7A 4DIBA 2GASA 3X2FA 4UUNA 1A9YA 4IM7A 4X54A 1YQXA 1YRLA 4P8RA 4MO2A 5B4VA 1LQTA 2H9IA 4IGEA 4PLGA 3DTTA 5DDIP 3OA2A 3LF2A 4YYZA 1NYTA 1Q1NA 2Q3EA 3BIOA 4JBGA 4BKRA 3WLEA 1DDOA 1WVGA 1H6DA 3HB5X 2GPTA 4FS3A 1GY8A 2PKRA 4BNNA 3QWHA 1Z74A 1U4OA 5IFLA 1CF2O 4YJGB 5BQFA 1K5HA 4MVJI 1NASA 3GNTA 1LXCA 1WDKA 4GX0A 4GWGA 4KTTE 1P1JA 3DAGA 2J8ZA 5F5LA 3KTDA 3VH1A 3OECA 2VYND 3QP9A 3WQSB 4E5PA 2HMWA 5CDSA 4QFCA 2X4GA 3DL2A 3I83A 3C24A 2O48X 3VZSA 1PGPA 3WG9A 5JC1A 1JKIA 2FOIA 4XX0A 4JBIA 5DP1A 4A5OA 4CMAA 4ZQEA 3GK3A 3TOXA 5CG1A 1E3LA 3Q2IA 1NWCA 1UXGA 2FPGA 4R1UA 3R6DA 3QWFA 2DPGA 4ALIA 1D7OA 4Z0PA 1BXKA 2DBZA 4RF5A 3ZH2A 4HBGA 5C7LO 1C1XA 3QIVA 4GGPA 3RBXA 4R16A 4HADA 4E5YA 3GG9A 2NTNA 3ANMA 1DRWA 3P2YA 1U5AA 1KY5A 3W8DA 4BMNA 1PS0A 1EBUA 1P0FA 1LSOA 1ZO8A 3ICCA 1BW9A 1BHSA 1YVEI 1U1IA 1PIWA 3UF0A 3QV1A 3PEFA 2YDXA 2NQTA 4OXNA 5THKA 2XF8A 4Z0HO 3GY0A 1V3VA 4EYEA 3COSA 4K1LA 3GMSA 2O4CA 2ZCUA 4LISA 1PJCA 3NJ4A 1R4MB 2VWGA 4R1TA 4A26A 3DFZA 3W6ZA 1VSVA 4JX8A 1R66A 1HDRA 1PTJA 4QO7A 3VH3A 4E2WA 3UCEA 4NMHA 4XD2A 5JDCA 1MUUA 2H6EA 4NDNE 2Y66A 3F46A 4ZJUA 3IAHA 1FJHA 4FGSA 2HK9A 1KVRA 3PHHA 3SLKA 5LDHA 3ULKA 4IQGA 3EDMA 3U4DA 4ZQBA 4O6VA 3Q3CA 5DULA 4CM1A 5F21A 3SXPA 3NT2A 5FYDA 5JXWA 5CP8A 1N9GB 3KM0A 2IXBA 3VKUA 5JDIA 2Y1EA 4IZHA 4QO8A 1ISGA 4N18A 4XDZA 5DZSA 4HNHA 3VC7A 1HWYA 3VVCA 1ONOA 1Y9EA 3TSCA 3ROPA 2CD9A 4MVJD 4D0SA 2O7SA 1GFSA 5JW6A 3FPCA 2W2LA 1Z6ZA 1YONA 2Q49A 4FJ1A 2I3AA 3O8QB 3UHAA 2Q4EA 2WD7A 4BNMA 4PLTA 5FWNA 4BKOA 1ZNQO 1ZK3A 5L4LA 2VZ0A 4FFMA 4QXMA 4Z9FA 3EW7A 3KBOA 2AG5A 4GPD1 1A7KA 1DLIA 4E5NA 4ZU3A 3ZWWA 1JKFA 3GN2A 4J9VA 3OJFA 3W6UA 3LT2A 3G1TA 3ZV5A 4CM6A 1DB3A 2JFGA 5JFOA 2JD1A 3VKVA 1NR7A 4DREA 4ALKA 4FBGA 3I23A 4PLWA 4D42A 3TRIA 4DLAA 4XJSA 4GWKA 3NX4A 2VRCA 2EERA 3JYPA 5HTOA 3LLVA 2OL4A 3U5TA 5JPIA 1P77A 2C54A 3DZKA 2X9NA 4HY3A 4B4WA 5JO9A 3F9IA 1DIAA 4CMHA 2DTEA 1ISFA 1E3IA 1T1SA 4FJ2A 4RL6A 3K5PA 3RD5A 2B5WA 1QP8A 2WE7A 2QRLA 3GQVA 5K0ZA 3CEAA 2X5KO 2ZJ0A 4XRGA 3PYXA 2EP5A 1E92A 2Q4BA 2ET6A 4YQYA 2EKQA 2P4QA 1BVUA 1QRRA 4OSOA 1PGQA 3PQDA 1ENOA 3LF1A 5I9NA 3D7LA 4IGFA 2DBQA 4OSPA 3PHGA 1JDJA 2J3JA 2XPCA 3UN1A 3QLJA 3CIFA 4UVDA 4IDGA 4G5HA 4W4TA 2BMAA 1P33A 3IQDB 4AJPA 3K73O 3R3JA 4DBZA 5AQ1A 1AHHA 3V1TC 1E7MA 1SZJG 3I1JA 1LU9A 4RLSA 3KOUA 1IZ0A 2QW8A 2C5EA 2Y05A 4W7IA 4XQ9A 2Y0EA 3MJVA 3Q6IA 2HO5A 4P38A 4IJKA 1I5RA 1ID1A 3HHPA 3G3EA 1WDLA 4BL5A 1Y1PA 1U3UA 2PGDA 3E5MA 2VN8A 3JQAB 1H6AA 4HP8A 1NFQA 2GD1O 5JSFA 4R9SA 1E5QA 4GKVA 3E48A 1LEHA 4TRNA 3AWDA 1HE2A 3AOEA 3WGYA 3KHUA 5ENVA 2ZKLA 5C3MA 3ZV6A 3OJ0A 3LZ6A 1QXSA 3H9JA 4U0KA 1PSDA 2NQ8A 1VC2A 2GR9A 1R0LA 4N5NA 3PGJA 4IDDA 3DR3A 2PD3A 3OIGA 3NDRA 3DZFA 1RYDA 1BDMA 3JD4A 4UULA 4PLCA 1DAPA 1O6ZA 2AG8A 2FRDA 3AM5A 4KP7A 1NVMB
chains in the Genus database with same CATH superfamily
4WTOA 4OQLA 1IL0A 5D84A 2DBRA 1N3BA 4MA4A 1S2MA 5HJ2A 3ZGNA 1KBQA 3C3BA 2O3TA 1ACJA 3WOHA 3GRUA 5IH7A 1GSOA 2RHOA 5JANA 4QEKA 1UP7A 2CGEA 1SBQA 2FUG1 5A4KA 1P19A 3WO0A 1DL5A 4EM6A 5JI3E 3NETA 4X1KA 2HEGA 3KPVA 4NQRA 4X85A 3RC3A 3U9TA 4CG0A 2IVZA 5A5FA 1V5WA 2DUNA 4XCQA 1JMKC 4DANA 4JP2A 2WSBA 4JC8A 3SSMA 4DQDA 1K6JA 1Z4LA 3D7RA 5DISB 3LQRA 4MS3B 4N12A 3ND8A 4ZOEA 5NLLA 3DV0A 5B57C 2PGLA 4TS1A 2YIJA 4IDNA 3DJYA 3QTBA 4YO8A 3MUFA 3RC9A 2D6FA 2EGGA 3CPHA 2J3QA 2OQIA 3W8EA 1X1DA 2CE2X 3BRWA 1QLWA 2YCLA 3FY4A 5EE5B 5EUMA 1G42A 3T3EA 1NE7A 1J0DA 4RIHA 2IEYA 4B09A 2H51A 2GN8A 3ADPA 3SM9A 3BWVA 1UXOA 1XFAA 2W6JD 3CNLA 3V3KA 3I0NA 4YWHA 2ZYUX 1Y9ZA 2GYWA 3I1FA 1GG8A 1KETA 1UDXA 1NDUA 3GUCA 1MVLA 2B82A 2GBIA 2ZYHA 3KALA 1YJ8A 3W0LB 1LPBB 1Y1SA 3KCNA 2QRJA 4BLUA 5B3LA 5TLSA 4YPVA 2VRCD 5DCYA 3X1YA 4AY3A 3CT4A 3JQFC 5FF9A 3AUAA 4HWTA 4EF6A 2GCPA 4OI1A 2ZRMA 2ZZNA 1E2MA 4J7UA 3GDFA 5TGZA 1LRJA 2VTDA 4EARA 3T3MB 5ECGC 4NJMA 2OYSA 4DSTA 1MC1A 3AHJA 3COZA 3DWFA 3G17A 1IUPA 4L7QA 4UTXA 3TPCA 1WX1A 2XECA 2IXEA 3SC6A 4AYXA 4RZIA 3RADC 4GH5A 5LMUB 2ZSJA 2Q2WA 2Q6OA 1GZ5A 2HQRA 1RCUA 2WP0A 4YO7A 4ZWNA 4P2BA 3LGAA 2K7FA 1FDSA 3DNPA 4Z4HA 4O59O 4MUXA 3X1KA 3V5NA 4ZT4A 4BVBA 1IU9A 4LNHA 2WKQA 3CHYA 1JAXA 4PAOA 2CVPA 2QP9X 4Q7KA 4J1TA 1ZUIA 3WV5A 4MUNA 1A27A 2W6CX 4OHVA 2QDXA 4MKZA 2RBEA 3T5DA 5IHPA 4ZCMA 3BMOB 3UH1A 1OW3B 3HSSA 3KVVA 2F55A 3U16A 5FOXA 5ITWA 1U4SA 4LNAA 2QI9F 4MUYA 3IBGA 4O5OA 4UMFA 1AKNA 4DSNA 1T4GA 3EWAA 5FWYA 3JQ9C 1GTG1 1OWLA 4RQBA 3M49A 4EUEA 3IQIX 2Q4TA 4TVSA 2IBSA 1VI2A 2QLBA 3WQHA 3DL0A 4G1UC 3DOUA 4IUCS 1TJ5A 4R98A 5G4KB 1HRKA 1OKKA 1MC8A 2YOGA 1NKSA 2WINI 5BWCA 1FU8A 3P94A 5HUHA 5JQGA 1ZR4A 1ZK4A 4MZDA 3NHSA 1WMBA 2FOXA 2YV3A 1N32B 3GT0A 5JPDA 1YFJA 1XLTC 2I22A 4LCJA 4P32A 2B6HA 3M5WA 3U3MA 3F97A 4EG4A 5TT1A 5JOQA 1IWPB 1EDBA 1Z5UA 2AUNA 2R6ZA 3D0OA 3IEIA 3RT9A 5B53A 3ZQUA 3IESA 5JTUA 3OE4A 5LN1A 4S35A 2F3TA 3PDIA 2E5WA 2I65A 4FDTA 2IHYA 2ZJ2A 1NVWQ 4DIKA 4K6MA 3PUIA 4XYMA 1UC5B 3LVQE 3TLGA 3U44B 2B9EA 4PU0A 1IATA 3S1SA 3PJRA 1TI7A 1YQTA 1S89A 2EQBA 4Q82A 3PNMA 4OP3A 5IVPA 2VHZA 3AESA 1DUSA 3QPAA 2BF7A 1A8QA 4Q15A 3KUXA 3LP8A 4KV9A 1I6MA 2BZ0A 2P3SA 3MZ0A 4MICA 4UDYX 2Y0PA 5LLSA 1L5HB 5HIAA 1SEVA 2WIBA 3ZWMA 4DJEC 2OE2A 3OFND 1DAHA 3E61A 2V9CA 1ORIA 2ZRGA 3BRSA 4EUSA 1VXOA 3SC3A 1D1TA 2DGDA 4MRMA 3L77A 5I45A 3KKKA 5K1ZA 2Q29A 4DDHA 2DPXA 5A1JA 2HJHA 1GKYA 3OZDA 2YVQA 2V0CA 1Q7GA 4JWTA 2PO7A 4OHZA 2AGVA 1YQQA 3QU5A 3LUJA 1N1DA 4QPDA 4ZOLA 2H2IA 4GX1A 2W8BB 2ZTLA 1U2DC 2X77A 2YN0A 4DJTA 2PBZA 3KR1A 2F1KA 3GZNA 4I5IA 4CIVA 2FUNB 3FROA 2BDUA 3OKFA 2PFSA 1QP0A 4RLQA 3CLSC 3UAYA 5DGIA 1COWD 4MV4A 3ZX4A 3KQUA 1WAMA 4NCHA 4QGBA 1EP1B 1NVBA 1S3SA 2GF0A 2BFFA 3DVRX 3NVAA 5CFQA 2X6TA 4KLRA 1E2HA 4OXIA 2HCRA 5TPZD 4ANFA 1CUGA 4JQZA 1BU8A 4GD3Q 4ZVQA 3QLVC 3WL8A 1GZ3A 1X7WB 3IMFA 3QYJA 1A1VA 1L1QA 1EE9A 1L5OA 2A9JA 2NTVA 3BE4A 3ECCA 4LWZA 4BVAA 3I52A 3AIMA 3QOYA 5H4GA 2HCTA 2Z08A 4KH0A 2V5VA 1YB7A 1E1QD 1E58A 2QJOA 3Q10A 4HGPA 4JBHA 4BRZA 2OPBA 2XCOA 1TUIA 4O8CA 5BR4A 1P91A 2BWJA 5F3WB 1V9SA 4HVTA 5KVCA 1M67A 3QX3A 3UJ8A 3LX8A 3N8GA 4HATA 1XFDA 2O8BA 3X1WA 2W71A 3NO4A 1N6OA 3RRYA 1EBBA 2XZLA 1XRNA 2FQQA 4GQAA 2ZJFA 3IDSA 2X8JA 3OEYA 4IIVA 4JR0A 3NKFA 3K1JA 3L0DA 1RAGA 4X94A 2C5AA 3IAFA 4Q34A 2VDKB 4PZYA 3Q2KA 3O9ZA 5AI9A 1DTWA 3FNQA 1UBMS 1ENZA 3S8MA 3LHDA 4MW1A 5DT9A 3WS7A 5FPSA 1YI1A 2J87A 3W05A 5KTPA 4CEJB 4C0BA 2QDKA 3BMXA 2YZ7A 3JQPA 1E20A 3GAAA 5IF9A 3WBKA 1TDJA 3ZD9A 3I6IA 3AQ4A 1R4NB 3DOCA 3H1TA 4U7FA 2IXTA 3ROFA 3ZHCA 1MB0A 3EVFA 4IFBA 4O2RA 1RXEA 2YC2C 5K9ZA 4ZZIA 1YUNA 4C4ZA 4A7PA 1Z0SA 4ZA2A 4G0UA 4A8JB 1CB7A 3FMPB 1SBTA 1SBNE 4LY9A 2H63A 1LH0A 4AF8A 3BSSA 3R7SA 3UT5A 4K0KB 4WDRA 3VSBA 1Q14A 4M9UA 3JD3A 2HIMA 2NMVA 1JG7A 2R87A 2X8AA 5DYYA 2XMCA 1C41A 1JTEA 2VDWA 2WILA 3CCCA 4U6NA 5FOSA 1QRTA 2V54A 5L3ZA 5C1BA 1KDOA 2IZZA 3O4JA 1GLGA 2EJTA 1HNZB 2C7QA 2JEZA 4OHOA 4UNSA 1G7RA 4D5GA 1H2FA 1HDGO 5FBHA 3N8HA 3DO8A 4UASA 1XO1A 2Q4RA 1XCJA 1I3NA 1I4OA 2J3MA 2QYOA 3PLRA 4LPKA 3EMDA 1PCXA 1TZ2A 2PR7A 2GARA 4LRTB 5EA2A 2UKDA 4MKXA 5BP7A 1FYFA 4M1MA 4WZ6A 1U9IA 1GTMA 1HE4A 1JSLA 1WXEA 2VP6A 3H13A 5CTJA 3AWIA 4OBBA 3LPAA 1XKTA 1KAQA 5FPPA 1XTRA 4C05A 4ZICA 4QKQA 5FTLA 1WBJB 4IUBS 5BOSA 3Q5GA 5HXAA 3C7CB 3JRXA 5K3EA 5I8WA 2BGTA 4AJ4A 4M1EA 5JQGB 4ILEA 5F51A 2VTBA 4OQPA 1DWQA 3IPCA 3MHTA 4BMZA 4RMJA 3WYBA 3DBHB 3RANA 4II7A 3D6VA 1KI3A 3ZJTA 5FAXA 4JLSA 4RU1A 4CKEA 4YFYA 3ZTYA 1SD1A 1YI8A 3LLCA 2H4ZA 2JCVA 1NOJA 3PQ2A 2ECPA 2C0QA 3D8BA 5ALNA 1C4XA 1OFTA 3K6RA 5CYFA 3VI4B 4C87A 1DKPA 2B8WA 5KC8A 1N1GA 2BE7A 2TMGA 4LGCA 5EIEA 3NWEA 4CMEA 5G0TA 5LQRA 4HZGA 4KN9S 4RS4A 4Q1EA 4BWYA 1YZTA 4AKIA 3NQ41 1E3DA 4QE3A 4URHA 4P4UA 4WD3A 5E8RA 4KR2A 1UM8A 5CM8B 3ZXXA 2I6UA 1Z0ZA 2ADOA 3LUDA 1I3CA 1WO8A 2BM8A 1GAXA 4S3MA 1KYQA 1Z18A 4GEGA 5AVKA 2OT3B 1JSZA 2AN4A 2PCJA 3AOEC 4M1YA 3RS0A 3C1OA 1IN5A 1V4BA 2O5CA 2Z1MA 1H2AS 3MLEA 3PXBA 3N74A 5I7HA 5JU6A 4C06A 1JQBA 4YLGA 2JS7A 4TS9A 1N3IA 2ZI6A 4M99A 4JZKA 3H9CA 3OQOA 1LLDA 2CBZA 1KARA 4LYYA 4YGYA 3ENNA 3VTKA 3AJRA 1KYWA 4QECA 4HWPA 1ZM7A 3H8WA 2QIOA 4PY2A 3KAPA 3V80A 2AFVA 4E32A 1NKTA 2VTEA 5FUMA 4BDTA 1V37A 3UKDA 4IHKA 3GEHA 4YEDA 1I30A 2NUTB 4J6EA 3LU1A 4QAQA 3GDGA 3V8VA 1RABA 3A1DA 4J43A 1FJXA 4JQOA 1JI0A 1JWLA 2OBMA 5EKUA 3CGGA 1X1CA 3EXHC 4TTQA 1KH2A 3PNPA 4MUEA 3AEKA 2PQ6A 2C59A 4H3KB 2A35A 3VO1A 2IHUA 2WZCA 3FX2A 1PRYA 1CIJA 4BKQA 4EJFA 3G5UA 5CCDA 4R40A 2GN0A 3V1YA 5TQJA 1Y8RA 1T4CB 2EEPA 3ID6C 4BEBA 2WKSA 2F8MA 1U11A 4CDMA 1DELA 2H1CA 1Z2CA 2CHQA 2ZQ5A 1P9OA 5AVVA 1HLDA 2IV7A 4RM3A 1JLLB 1QYVA 2IHVA 3V33A 2GPJA 4D0RA 2UUCB 1JB1A 1F20A 3H16A 3S0JA 4R1SA 4X20B 2ZRCA 1WIWA 1M1NA 4HDOB 1O5TA 4M55A 1X7GA 4CM7A 3P52A 3FPFA 4CEHA 3E7PA 3HR8A 1M54A 1Q0TA 3RC1A 1HX7A 1U8XX 2GWRA 4DMGA 3HB9A 1TCAA 1MQ8B 3K3PA 4OHWA 5A4JA 1H4SA 2PZAA 4TN1A 2J5KA 2AR9A 4KZPA 4ESVA 1P17A 2BE9A 3G23A 2ECFA 1AKWA 3HSYA 3P2MA 3GZ4A 3ILSA 1Q7RA 3PT5A 4I8DA 4FKMA 1V9LA 4JJGA 3D6AA 5IAJA 2ZEJA 3CZ9A 1SCQA 5IZCA 2DBVO 5B1HA 1TEXA 3KQNA 1GITA 2GVNA 3L9WA 5HQTA 2EFJA 1K7XB 1KI4A 1W6RA 3K09C 4Z7QB 4ONEA 2JH8A 2ODPA 4CG2A 3UMSA 1XF9A 3ADCA 1P1RA 3B1KA 5C34B 4UATA 3EIUA 3NLLA 5TMPA 3L07A 2QVBA 3H8JA 4M53A 4YMHA 4R2KA 1T91A 4DUPA 2OG2A 3GVHA 4OBWA 1AS2A 3D2AA 2AQHA 4FONA 5H70A 2DX7A 4FT4A 2AFIE 5ALRA 3ZWAA 4OK3A 4MWCA 4PRYA 3IPAA 3TGLA 3LCVB 2GZ1A 2ZI3A 4EFMA 1P5JA 1JMVA 1T4CA 4TVKA 3BA1A 1KK0A 1TU0A 4US1R 4J7CA 3H8SA 3LWDA 1R4ZA 1DKLA 2PNFA 3O82A 4KGZA 4B0OA 2WTNA 4H7IA 3GLIE 1KJ8A 4EVQA 2CFSA 3MGCA 3F6CA 4KQFA 3VA7A 4QQ8A 3I2FA 3U3DA 3TTTA 4P4GA 3IPXA 4YT8A 4G5SA 3ONVA 4ABYA 3P19A 1GNTA 1A9XA 3GRFA 5JNVA 2GEFA 4KIUA 2FUCA 3RQSA 3A4VA 4N01A 5AM1A 4B3HA 4K03A 3ZVNA 1T5HX 1GGMA 1J90A 4U2FA 4YRBA 5LL6P 1IULA 4XVUA 5JCXA 5JNSA 1GTSA 3UMGA 2I9PA 3AERB 1E1CA 2JDIA 4X0EA 5FADA 4CL3A 4YMUA 3ZXIA 1E3SA 2BHSA 2DHDA 1V3UA 3AILA 4TOIA 4ZAYA 3KVOA 1VSQA 1Q17A 3H0CA 1XVVA 1COWA 2HT6A 1UC8A 2IYXA 3TTUA 1GA6A 1VPEA 3L02A 4OJMX 2ST1A 5H59A 4AU1A 5EKSA 2IYWA 4EUKA 4DQUA 5GINE 4J0QA 3WKAA 4I1PA 3O1IC 2HMUA 2PKWA 4CFYA 2J5XA 5D6OA 2WHYA 5JHGB 4I8IA 4QYIA 3T8YA 2PWZA 1AHIA 1AK2A 1Y37A 1W29A 2FFQA 1NMZA 1WXWA 2RHRA 1NQTA 2XA1A 3CY6A 4M8SA 4QNNA 4F1JA 3C8ZA 3L8EA 1U0SY 4HPJB 1G16A 2A9KA 3SR4A 3TMKA 2ZR7A 4EHDA 1G4UR 1X39A 3OOHA 4A03A 1U7WA 2HA7A 1I9CA 221PA 3BF7A 3EWIA 5ALPA 4BWVA 3G6WA 3HJUA 3IAAA 4BYMA 4CLOB 5JD6A 4BECA 4DF3A 4GRIA 2H59A 5BVHB 3H2GA 3VZRA 3QXXA 10MHA 1DRKA 2ATIA 2AYXA 3EODA 2XA2A 1IUKA 3C3WA 1JLSA 4GPZA 5JZBA 3OFKA 1NBOA 2FZWA 5J4VA 3O94A 3AH8A 2EKZA 3B3JA 3PWTA 1FOEB 4KK3A 5D3QA 4NJEB 2XOKA 5JS1A 2JFHA 2RB5A 3DVAB 3OZFA 2BKAA 1VQ1A 5IAKA 4D45A 2HFJA 5EHNA 5BOSB 4KQ9A 1EEHA 2I7TA 4MQBA 4O08A 1JLLA 1MNAA 1W48A 1EUZA 4LDNA 2BR4A 4FFBB 1LGYA 4REQA 3GXOA 3KSDO 4GSYA 1JEAA 4FX2A 1OHHD 2I4OA 1KMQA 1WHTB 3ESDA 5LC1A 2WY2D 2GAFA 2MIIA 2G40A 4QASA 4IJSA 3WK5A 4G3XA 2YIDA 4B31A 5L4NA 5BPFA 1PJSA 2IX9A 4PBRA 3G8BA 1P45A 1ADFA 3MXOA 2GLXA 4X00A 2IQIA 1CR6A 3ZU5A 1M9NA 1OAKA 2C2YA 4HAXA 1NKVA 4XCVA 2EHDA 4V1CA 1R2QA 1QHSA 4X3OA 2XJ9A 4HDKB 3TAXA 3TZCA 1H69A 4AJJA 4HWOA 1JL3A 1ML4A 4F1WA 3LJKA 4FD3A 5T8KA 5TMDA 3T7KA 2KSQA 1NPYA 1U0GA 4J4HA 3IDOA 4EKGA 1TLTA 5DM0A 4JMLA 1IBMB 4OHKA 1KYTA 3UJNA 2XYPA 4H27A 3I01M 2D0OB 5CK4A 4EMUA 4ESOA 2X3YA 1QS0B 2WJZB 1MTOA 1BE8A 3CNOA 2G63A 4FWBA 3HH8A 3R6TA 1FX0A 3ZBTA 2VHQA 4WADA 3IXLA 4IR7A 4LX0A 1D03A 1RJ9A 2B4AA 3P4UA 3VSDA 3B51X 2X9VA 1N6KA 4MGEA 2IOHA 2PGAA 3LYUA 2PX8A 3D2BA 2GD0A 4FPXA 2Q41A 2ZR0A 4IEFB 4WJZA 1CQJB 3H7IA 3UMFA 1KMCA 3MTJA 2WTAA 4YV0A 1JHMA 3AETB 3LBHA 1YZVA 2MTBA 1KE2A 1Z5WA 5FTJA 2LKDA 3GN1A 1QZ3A 5CLJA 4RPLA 3CRQA 5EQTA 2C4HA 4HDMA 1W5FA 4RMHA 5H5JA 3VJKA 4CFSA 4COOA 5IVDA 3RT7A 2BEJA 2XE7A 2V7QD 4L85A 5DM2A 4EELA 1CE8B 1WUKS 2FN7A 3E1KA 3F3SA 3IQWA 2C2ZA 2BEWA 1SVOA 2MDTA 1IXKA 2PH3A 4JOCA 1MT3A 3UEOA 3CLVA 5J43A 4LOJA 1L3CA 1W35A 3GPBA 4TRMA 3I53A 1T3GA 4YJ3B 5DBGA 3JZMA 3RYIA 5JS6A 2COEA 3PFGA 3ISTA 1W59A 3QFHA 4V0KA 3E81A 2VWQA 4AI6A 3TSYA 3SLRA 1U8CB 4DLXA 2F1RA 2X5XA 3TM4A 1YVPA 3B1XA 1UWCA 3C85A 2VA9A 1Q91A 3MG9A 3ZN2A 3CEPB 2EX4A 3NBXX 3RCBA 4EA6A 1MEOA 1NA5A 3KLMX 2QE7D 4IWXA 1W85B 4TL6A 2NVUB 1UJ2A 3A9WA 3BE5A 4JJKA 1KS9A 1EP9A 3ZW8A 4COKA 2C29D 1J2YA 4ZEVA 4AMGA 1G2OA 3TCNA 5FIUA 1JBQA 5FBRB 4YUAA 4JP5A 4LWQA 3G0GA 2OPHA 1V16A 3E70C 821PA 3O03A 2Y68A 2ZUWA 3S2FA 1KRHA 3NV9A 4BMPB 1DJOA 2FW0A 1QO0A 1E4EB 1SAYA 1T1IA 5DTRA 5H80A 2G1AA 1LSSA 1QHNA 1N0HA 1UJ4A 2AF4C 3HN2A 3GGJA 4HFNA 4UBOA 4GUDA 1NUPA 1E94E 2HADA 1YR6A 4RZHA 4J1GA 1RM4A 2OZVA 2XWQA 4D7AA 5M2QA 4D9BA 1Z0IA 4NY1A 4JL6A 2ZSAA 3R3UA 4IHJB 4YMIA 5B2ZA 4QNMA 1ZM2A 2FQ1A 4PYNA 5HCNA 4V02A 4KIGA 3W4KA 3R7BA 5CLHA 3IAXA 4M4SA 3E9DA 4N7MA 1N2JA 3K09A 5T3UA 3AF6A 5HQJA 5EJ7A 1EAYA 2AZXA 3STTA 2VF2A 3SK0A 2TRSB 3BFKA 2P65A 2ZPAA 5A2QA 3KSBC 4UQPA 3WRWA 4BP3A 1RYHA 5DHAA 5IAOA 4XUEA 2OFFA 5J4KA 1PFUA 3IBSA 3IXMA 3KYBA 2WE8A 2OXCA 2OHJA 4OUDA 1C7EA 5J1SB 1M2FA 1M1YB 4JYMA 1U2ZA 2WJIA 2XUAA 4DT1B 3DB2A 2YRFA 1LBQA 2I3DA 3UUFA 1V8ZA 4R5HA 4J1NA 4OFBA 3FDXA 3MFQA 4P7BA 4RHYA 1WSAA 1JJ7A 2UVDA 1P6UA 3L01A 2CLDX 4YAKA 4EW2A 2JEYA 3GRYA 5BSEA 1JR4A 5TF0A 4YP5A 5KNDH 4WKPA 4WSOA 2WTBA 4H7FA 1E7WA 4KO4S 1MXHA 4HDQB 3UWPA 2HA0A 5BNIA 2P2DA 3CXRA 3M5PA 3GWGA 3RVOA 4B3JA 4XR4A 5D85A 4B5LA 3H1FA 3K6SB 5JBNA 1OE0A 3LT4A 4QIHA 1U9ZA 4LJSA 4NZPA 5AMXA 5BUCA 1K06A 1L7NA 4IIJA 2GEDA 3QI2A 3X1MA 4J8PA 3H2HA 3QBTA 1X14A 3UMYA 4EO7A 4QUBA 3AJEA 2ERXA 2QR5A 2PM8A 4RA6B 4TSRA 4ENPA 5A3RA 1WOMA 4IILA 721PA 1H0RA 2NIPA 1UFVA 2WWFA 5DM70 2IKQA 2N42A 5EHZA 3K0EA 3UA4A 2V6JA 1O95A 2PX3A 1F0YA 2LTAA 3AM4A 2FFAA 4MEJA 4YPFA 1QHHB 5HF9A 3MD0A 2IS4A 1ZBQA 1CQJA 1LLCA 4YT2A 4HZUB 3PL1A 4OOFA 5MN4A 1M2GA 3IE2A 3OZVA 4KIWA 1I24A 1OSNA 4AYTA 1E2BA 3DAFA 3KLOA 1TXGA 5CB4F 1VGRA 3NJRA 5TNXA 4BAUA 5DYGA 1IOLA 1W44A 4ZZ3A 1GEEA 3SXJA 2QTZA 1OAOA 5HZMA 1EVZA 4KAJA 3U1BA 1NVAA 4IDUA 1BN7A 3FDJA 4CQLB 4R1NA 4I9GA 4X7RA 2GGSA 1C2TA 3EVBA 5FI0B 1OJ7A 2GXAA 3RROA 2CMFA 2DWOA 3HEBA 4JLVA 1NDHA 4L27A 1KY2A 2B4YA 3AFOA 5F98A 2EG9A 2V7PA 4BP8A 2DM6A 4L5YA 4JI4B 1LNQA 4A0HA 2DFNA 5A7HA 1NJSA 3WRXA 4KWIA 5BN1A 3AF5A 1Q3HA 2E49A 2ZYGA 3LHSA 2AQKA 3CUEF 3K70C 2F9MA 4J91A 2KB0A 4X92A 3HCAA 5GY7A 3HYLA 4Q4HB 1OZGA 1PS8A 2WHRA 1DI0A 5JD3A 3DWEX 4MVJM 1BKDR 2CJFA 1KC3A 5KX5B 2DH6A 1YFZA 4RF4A 1CRWG 3HZRA 4KW7A 3SHOA 2VQ6A 4UUOA 5A3SA 1JQLB 1KIAA 2R97A 2WU1A 3UWOA 5GJBA 2ZYDA 3TL2A 1CHDA 1VZ3A 2WYVA 3CRVA 4RKRA 3V4FA 3WLEA 4GF5A 3G85A 2Q07A 4E7OA 4HX5A 2VWPA 4MV9A 4PYMA 4C0LA 4BX3A 4HTAA 3TNDA 1N6PA 2XCRB 3D4IA 1IQPA 4E5DA 1IMOA 1OILA 1C7IA 3WLRA 1LVUA 1QFYA 1CG6A 2PL5A 3HADA 3HKEA 4B4OA 1RPAA 5CX4A 1P5RA 1MFZA 3S8YA 4F0JA 4MGHA 1GQOA 4Y18A 3PGMA 3R8XA 3GJTA 3WGNA 2HRQA 4EI2A 4JT9A 2PWBA 1T0BA 1TO1E 4ZPJA 5LQMA 3KHKA 1EFAA 1G21B 3SDSA 3THWA 2JFFA 3PVSA 4FYMA 2JAWA 2V6GA 4OH1A 5F76A 2F67A 2W4QA 4UNNA 1N7JA 4HN2A 2JLYA 4F72A 4LFAB 2QMEA 2FZGA 1IHXA 2EKLA 1TQ2A 2WYHA 1NRXA 2IY9A 3VH2A 1TCVA 5BSKA 2GI4A 1AGPA 2YS7A 2ZCVA 5IXSA 1SUPA 4RTSA 2RH5A 4IEEA 1G18A 2JJ2A 3CH7A 3VM6A 2VQDA 5A0VA 4IBOA 2JGMA 2R62A 3AFGA 3JZIA 4GOXA 2KHZA 3FCYA 1H3EA 3UCFA 1H2YA 1MV5A 1XTZA 2IYSA 3SBOA 1FTNA 3PI6A 1G19A 1YQEA 3W8NA 2MMCA 4ZDWA 5TMBA 2QRQA 3D5EA 4BNDA 4JI8B 4KRYA 4LYFA 4PHFA 4C04A 1XD2B 4RKEA 3C7DB 5B6PA 3VPFA 2X41A 5EZSA 3PD0A 2ECOA 2IW1A 3ZCVA 4A36A 4O4HF 1MIOB 1N2GA 2NU7B 2JNWA 1SC9A 1AMNA 4XWGA 3AU8A 4HFJA 1NW6A 3HJRA 3NWPA 4QGSA 4Q16A 1N5OX 1T43A 3HYCA 1Y6RA 4ZJZA 3KWMA 1YR8A 4DWJA 2JF0A 2QXTA 1RWBA 4BMXA 1T0IA 1R00A 3CSDA 3KSZO 2CNNA 1QCYA 2SNIE 3LXXA 1GYPA 1KPGA 3P8ZA 4H08A 2J5QA 4IMRA 4NE9A 3R3WA 4JUFA 2Q5EA 1V8FA 4Q01A 2QLTA 1ZC3A 5AM3A 5KMGA 1WS6A 2OHVA 2Z0MA 5FDFA 3TDMA 3WICA 3P9QA 1UMCB 1MU0A 1WXIA 3B2EA 2FP3A 3G8CA 3HYSA 3QF7A 3LY9A 3ZYZA 1F8YA 3PDUA 2H92A 3LK6A 3BHMA 3DOOA 5KYKA 1QFZA 1O94A 2ID9A 2E3JA 3QE9Y 3FYUA 4C20A 4LHWA 1THZA 3FRJA 2G71A 4IVQA 5AI6A 5EJGA 4BC0A 5F7OA 2UZ4A 2PV7A 4UAGA 1WL8A 2VPYA 2Y1GA 1K7SN 5FPKA 2YQ4A 1TNDA 4ZMRA 1UBTS 1C1HA 5F5NA 5D5QA 2KYRA 4TT3A 1U1DA 2JVJA 1KE1A 3ZCQA 2XCIA 1MNQA 3TLCA 1EDZA 1PZFA 4P3NA 1V43A 4C3UA 4FSHA 2Z98A 3PRYA 3USES 5J4LA 3AR5A 4MQMA 1L3BA 1QTIA 4MW0A 3WK4A 2QORA 2WG1A 1HNNA 4F93B 5EZQA 2ORYA 4MMZB 3DJFA 4P36A 3MHPA 3RVMA 3ZHRA 3IC5A 1LK5A 2ZR9A 5DIFA 2VAPA 4C2UA 3OJOA 3NWJA 4Y2JA 1TQ4A 2OQVA 1SXJA 1ZVKA 4RSHA 3ST7A 1YMQA 5JQWA 4Y98A 2BZSA 2F00A 2FK7A 4I1VA 4BFWA 4H4EA 4GMKA 5FNVF 1RSZA 2Z2XA 4Y9SA 3ZS8A 2GNAA 1EA5A 2K7ZA 2ZPTX 4LE0A 4RJLA 4WH0A 2QAJA 1FDTA 3ORSA 3NTRA 5GPBA 3ZK9A 1DXYA 1LDBA 2H8KA 1EYZA 3M33A 4GX5A 1YU9A 3T4UA 1UXKA 5KBYA 1WW2A 1JU3A 1OOEA 2WPNA 3ENZA 5EAIA 1ZC4A 2JGAA 1NXWA 3F71A 4QFMA 1KI6B 4MPDA 4RXTA 2XXJA 1O8BA 3CA8A 2V97A 3HFGA 5FUBA 2ZQZA 1KNXA 1EE1A 1TAHA 2H2FA 2W6JA 4J76A 2GEBA 2GMWA 1D1QA 2C2BA 2YMMA 3B5EA 4UHDA 3R7WA 4DCOA 4D9CA 5IABA 4MYTA 1ZH2A 5DCUA 2CDNA 4Y2QA 1DG9A 1E32A 1E6EA 1YNSA 1PGNA 2VXCA 1ES9A 1LCIA 2QMYA 3CM0A 3PQ6A 3QX9A 4GW3A 1DCFA 1N8NA 1JX6A 2C4UA 2C0PA 2KM1A 4PVCA 2A1TR 5AVOA 2Q8PA 3R3ZA 1GSIA 4B2PA 3WFJA 1FDWA 5FAKA 1APBA 3WZLA 3ZY3A 1T8PA 5GGYA 2PMDA 4IH9A 4MDFA 4XIFA 3C3CA 3OF5A 3SQLA 2QEQA 3VTFA 1H8HD 5KINB 3M83A 1GKLA 1KERA 2VPZA 2ZM6B 2F8SA 3LRPA 4ZRNA 1AA9A 3IT3A 2JHGA 3ZY5A 1W0CA 3ABIA 2IA5A 3WMGA 1GXSA 1EM6A 1RXUA 2FI1A 3U9SA 4EJ6A 3IDZA 2K2WA 1TKBA 3IEUA 3EQ9A 3F5FA 3R3VA 4MWDA 3WJAA 1VJ5A 1CIPA 1W46A 3HJNA 2XEXA 4KQWA 4NBVA 3ZU4A 1NNEA 2AVDA 2ZBGA 3HI6A 1WCYA 3E9NA 1BTOA 5E7IA 3TFWA 2XBMA 2AC7A 2AC4A 1Y3DE 1UH5A 2KQUA 2C4MA 2YYAA 3EVZA 4GR9A 1RWPA 5AICA 3RUHA 2O2IA 2O1EA 3M4YA 1BHQ1 3T6KA 1ESDA 3FI9A 1DOZA 2IE0A 3UICA 2O5VA 2NSLA 1AHPA 3D9QX 4X64B 3PLAE 1G8MA 1J21A 5DLEA 2A4KA 2JD2A 4C3OB 3Q98A 3TN7A 1G8AA 3J7TA 2OD2A 1WZ2A 5C4IA 2N1MA 1W8IA 3E5NA 4GI2A 3UUEA 3IELA 4RV9A 4UBJA 2XUFA 3JS5A 1WMAA 2Q3BA 3FTEA 1CERA 2J33A 5DMXA 1IHYA 1XDUA 2PK3A 3MUEA 1JE1A 1UQRA 1RVDA 4WT7A 1AN0A 3L05A 2YNMC 4BE7B 3PU6A 4EA7A 1XZIA 1TO2E 3IQFA 5MGNA 1W7AA 2AX4A 4KTVE 3WP1B 2FPPA 2VSFA 5FRDA 3RUDA 1JB9A 3CN9A 2BM0A 4Q18A 3V00A 1UBJS 5CHYA 2Y1DA 1PX0A 4L9AA 4QBIA 2Q5HA 1ZSYA 3LDUA 1C0EA 3FPJA 2Z9DA 2H1SA 2A5FA 3LQ2A 3PI7A 5C18A 3AF0A 4JJEA 2HF2A 1LTHR 1HEYA 2XWSA 2BAGA 5EP1A 1LB1B 2NQ2C 1HKHA 3VR1A 3F5DA 3JAWA 3JQBA 3ZIUA 4AMBA 1XD8A 2HR1A 3SIRA 2WTUA 1DFHA 2XWBF 2QW0X 4CCSA 3IB3A 3EIOA 5K8LA 1QTQA 1THMA 1UBKS 1UP6A 5GAJA 2I33A 2I62A 1G64A 3INGA 3N28A 421PA 2FE1A 3Q72A 1UZUA 2QV0A 3FMFA 2X1HA 2NV6A 4OP1A 4R9RA 1M2VB 2C04A 4MW4A 2WSLA 1W5BA 2QRPA 2QT1A 3H5TA 4F71A 1JZSA 3N0VA 1BX1A 4LIPD 1BYIA 3LK7A 4HGQA 5G0VA 5BSWA 3SBEA 1JQ3A 2WM3A 1S7GA 5IBPA 1CUFA 1DAOA 5I4KA 1JG1A 1TK2A 3P96A 5EJMA 2REOA 1OZHA 3C6BA 5A9TA 3A6DA 4N5DA 4DSUA 5IDXA 1VBNA 4WNAA 5FQOA 1GUAA 1X86B 3VNRA 3IEMA 5AKZA 4JIMA 1U7UA 2HSEA 2X2FA 4JL5A 1VMEA 4PS0A 4KYIB 1W4LA 2FKNA 4I46A 5DHUA 3V7YA 1RRCA 5F9HA 1FA9A 1E2IA 1JJIA 1L5MA 3PR2B 4MAMA 4ZPXA 1RMYA 2J07A 3B60A 1P2BA 1L6IA 3AXSA 4MUKA 4KPEC 4M6WB 1WW8A 3KXKA 5BNFA 4BO2A 1IK4A 4AZTA 4BN5A 3QY0A 3MMPA 1T3HA 3JRNA 3MWKA 4MI9A 1ZGHA 5C4GB 2PWYA 4ZTBA 5TARA 3TJRA 1N34B 5BQ5A 1WPGA 4OKIA 5CUQA 1U3DA 3CKYA 4MWSA 4A2WA 3ND6A 1LSJA 3RAPR 1G9TA 1XR3A 3DNFA 3OU2A 4RTRA 5HP4A 2WI8A 1E1QA 4LXHA 2QD1A 4WXRA 3RRJA 2GZ2A 4URFA 5ICCA 1W96A 1PQUA 3DDCA 2GUWA 5ARCA 5GWXA 1SBIA 4BQEA 3JR3A 1Z0KA 3OJEA 5GOZA 4D02A 4UXIA 3NGXA 1YCDA 3RKSA 5BWOA 5D1NA 3JAMA 2H48A 3MCUA 4JK3A 1XJCA 2AN9A 4OHRA 1PJAA 5BSMA 3TMYA 4UAUA 4E33A 4NOMA 4JXXA 4R2JA 3VPSA 4LY0A 3GHHA 4Y2YA 3T7IA 4DLKA 5C5EA 4N5IX 4LJRA 5JSYA 3MW8A 4E07A 3D6NB 1CUSA 1B7GO 5CDUA 1AQNA 3L1UA 1ETHA 1GGKA 3IXQA 4F2DA 2BM9A 1C7QA 1I2DA 1MGOA 1OX5A 2HK7A 4U2GA 2OXIA 5FB3A 4B8YA 3HV0A 1KC1A 1KI1A 2DFKB 3A6LA 2ASVA 4PRLA 5I8ZA 3USZA 1Z17A 2DJ5A 3B6ZA 4ZHQF 3C1AA 3RVDA 3OPMA 1KTIA 1XU7A 3L7CA 3R5FA 3PNSA 4A8JC 1GL7A 3LUKA 2G1JA 4JKOA 3LTEA 4RQUA 1IPHA 3IIIA 4AY4A 2QPOA 1FXWA 4KKVA 2VCEA 4IFTA 3VR6D 3OVMA 3HLYA 2YV4A 2R1UA 1KJJA 2BSAA 1XP5A 5GVRA 1M66A 4IDCA 2OK7A 1Z5NA 2B1IA 1S2NA 3RU2A 2PXCA 1CDOA 3JWGA 1WUTA 4OA5A 1VE1A 1RZRA 1AV6A 2D2VA 1FRVA 1Q74A 2AA3A 1TUEA 2MYTA 2WLTA 3GZNB 3T5MA 3ZD7A 2JLSA 1J5XA 2HA2A 3SFVA 1T5TA 1X74A 1QLHA 3M8KA 1FMTA 1NRWA 1JQDA 5HRUA 3H4TA 3GLSA 3L5OA 4P7GA 2GYVA 2ZYVX 5REQA 4ZYZA 2K5UA 3GLFA 4TYWA 3G0DA 3BXFA 4I4CA 1K27A 2X42A 1M2WA 2G9QA 2Q9BA 1CP2A 2W58A 1UOPA 1T6NA 4ZI7A 1KYIA 5BMVB 3DCIA 3TVTA 1PNTA 1V7QA 4EG0A 3Q3GE 3ZVRA 1UBGA 3CO0S 4U7HA 4BJ3A 3T9DA 1C9KA 2OBYA 5ALWA 2PQ0A 5DBIA 5FL3A 3ABSB 5DV9A 1K3UB 1O5OA 4FNAA 4MVJE 4Q9IA 1XQ6A 4QM6A 3ZE8A 1G60A 3L41A 3NTQA 4ZVOA 3T7TA 2RGRA 3IVGA 5L45A 4Q7LA 3BMQB 4HDNB 1M1NB 1CS0B 3IUSA 1L5KA 1UFOA 4HT3B 1VDZA 1Z8NA 1P73A 1R9MA 2R11A 5ALUA 5LOVA 1IIBA 2YHUA 2QJTA 1QFSA 3K9NA 3WRYC 1VFNA 4OBXA 1OR8A 4R81A 2Q9UA 1YAJA 3D8UA 2CWDA 1PWHA 3H0EA 2IIVA 4L0MA 3GC6A 3QJGA 1BU5A 4XM2A 1FFCA 1Y8RB 2ARKA 3AGPA 4TQAA 4JLAA 5CJPA 4ND4A 1GO2A 3FF1A 4V0QA 2GRUA 3N7AA 5EYPA 5DM1A 3EC7A 3NBQA 4K7JA 1GQSA 1F3LA 5JV5A 2SECE 2ANBA 4ITRC 4CMCA 5KOHB 1P2FA 2PIAA 4D5EA 1J7KA 4QLOA 3CNEA 4OD0A 3ROGA 1M6HA 1JYSA 2EEZA 3KPYA 1TVMA 1HYBA 3ER9A 1V0JA 2ZULA 3JQFA 1MR3F 4MCAA 2UVPB 2XKAA 2NUTA 1W4CA 3K5HA 1PZNA 2DB3A 2Q3DA 2DFLA 1P44A 1VLJA 2O57A 1DQRA 5IK2A 3A3OA 3SJAA 4WNYA 3FUXA 1W88B 3E2MA 1PHPA 2FEXA 2V7GA 4CQMD 4CKWB 4BGVA 2X6QA 3PLNA 4R3NA 1K2VN 1J2EA 1ZK2A 1K4KA 4TSFD 5BT9A 4QPNA 5K8UA 3AKZA 3M5DA 3RFCA 3SEAA 2IX3A 3EGIA 1DX4A 2F3RA 4TRRA 3VKFA 2KLHA 4ZJPA 1QQBA 1RYZA 1X1EA 4N7RA 3A25A 4W9MC 1IOWA 2FYTA 3MGBA 1L5VA 4ZKDA 5JNLA 5LIRA 3OIFA 3BSFA 4GKBA 4R1PA 1JEDA 4PFKA 4DNOA 1QHEA 2BJWA 1ZVMA 2ZS7A 4OYHA 3IAS1 2WWVD 3DXFA 1VJRA 1VJTA 3THXB 1S02A 3QENA 1VG8A 3BMQA 5M29A 1BFUA 4URWR 3OLCX 2QI9C 2G5CA 5EERA 4IZIA 2HQ1A 4BLVA 1LSUA 4PO9A 2IBMA 3UVEA 3JYQA 1CDZA 3AFHA 4RKYA 4W9RA 5AT1A 2HO4A 2R6JA 5L51A 1P2VA 5F2OA 1U2GA 2ZBVA 3KQOA 4RQTA 5E2AA 4GEKA 1AMOA 2QN3A 2V6MA 3D8NA 2VYNA 4X6XA 1WSWA 4E31A 1FL9A 4KSBA 1FS5A 1G5FA 5GJCA 1P8AA 3BH6A 5C8VA 1G8HA 4BFVA 4B6RA 4YP0A 4WKOA 3QE3A 3NC1C 3ZI0A 1O96A 3GLGE 3CV3A 3HKDB 3KX2A 4ZVKA 4DLRA 2PA3A 2DETA 5IDVA 1HO3A 1URPA 1YIDA 3IKMB 1JEJA 2EBFX 2O2HA 1L7QA 3JYLA 3HP4A 4KIJA 2JKZA 2F4VB 3ENWA 3E4DA 3S7ZA 2XW6A 2WD7B 3OT5A 2DRIA 2IKSA 2RH8A 2QTTA 4LMRA 4NRDA 1I6KA 1I5EA 1OLSB 4CEHB 4ETNA 3QGMA 2MU1A