1PX0A

Crystal structure of the haloalcohol dehalogenase hhec complexed with the haloalcohol mimic (r)-1-para-nitro-phenyl-2-azido-ethanol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 88
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1px0A00
3OIGA 5BR7A 2JFGA 2I6TA 5IDXA 3Q6IA 3BMCA 2HMSA 4G2NA 5DF1A 9LDBA 5ER6A 2E37A 4J0EA 4WNCA 2HUNA 3L9XA 3W4KA 4RPHA 5IF3A 5CEEA 4Q3BA 2J6IA 4WK6A 1F8GA 3FSRA 3BMNB 4BO0A 3QWFA 4M1QA 4BO1A 2AQHA 3GHHA 4J6FA 4XRGA 3ZV3A 3L4SO 2RAFA 1PGNA 2PGDA 5IXYA 1IPFA 1HSOA 2PR2A 3UCFA 3HHPA 3L4BA 5A9SA 3ANMA 4Z9YA 1LQUA 4MVJF 4BVAA 2R00C 4DC1A 2O3UA 5JBIA 1H6BA 2GR9A 3RKRA 4P4GA 5F5LA 5MDHA 2W4QA 5C5IA 4FJ1A 1XDWA 4FC7A 1PGQA 4LMRA 4ZD6A 1GZ6A 5CG2A 3KYDA 4CLHA 4N5NA 5G0WA 4R16A 1Q0HA 3OA2A 3OJOA 3I23A 3ITKA 4XJTA 4EI2A 3PHGA 4OKIA 4AVYA 3JD0A 1WDMA 3A28A 3GDGA 1ZMOA 3LT4A 2IEDA 3KBOA 3JQAA 5IG2A 4YJGB 4E2YA 3S8MA 4WLUA 2GCGA 1I2CA 1Z6ZA 3IUSA 1UXHA 3FNEA 2DPHA 3VPFA 4ZU3A 4B8WA 3DOJA 5T8KC 2XOXA 2C2XA 2GN6A 1EUDA 2AG5A 2VRCD 1PR9A 1Q1NA 3BXXA 3VDQA 5C3MA 5K6AA 1CJCA 3RASA 4JROA 1YQDA 3CKYA 1YQXA 2HK9A 1U3VA 1E7RA 1GL3A 5FWNA 2JKVA 4DMLA 4W7IA 3CMCO 4MVJI 4PG5A 4TROA 5LDGA 5F5NA 4Q39A 2WTBA 5G0TA 4HNHA 3X2EA 3DBVO 1LNQA 3EC7A 3ZNNA 1UP4A 3SJ7A 4IJVA 4HV4A 2XPCA 3I6QA 4TRMA 4MVJG 3KB6A 4CV0A 1B3BA 1N5DA 4NK4A 3RUCA 1I3LA 2I3GA 2Z5LA 2OP1A 4IPTA 3G3EA 1OFGA 2FPGA 4BKOA 1KVUA 2BFOA 3DC2A 1P3DA 3WB9A 3FPCA 3PYXA 2DAPA 1QORA 1BRMA 2ZCVA 2WD7A 1QYDA 1TVEA 2D2IA 4BKPA 2CFCA 2ZTMA 3GVIA 1BGVA 1I2BA 1N9GA 3DOOA 1A9ZA 1GYPA 1WNTA 3QV1A 3BMOA 3ETDA 4PLYA 4RZHA 3TOZA 3R6DA 2H1SA 1KEVA 4L4XA 1PQPA 1PZGA 1UDAA 2GD1O 5COBA 4BNUA 1U3WA 1PZHA 4XYBA 2EW8A 5JMWA 1YQGA 2NLOA 3INGA 4PFJA 2Q2QA 2X7HA 1NAHA 1LLCA 3DB2A 2X9VA 1ULUA 3D7LA 3GG9A 1ZSVA 5TGDA 2X0NA 4IUYA 4L4RA 3TZKA 1R16A 3U4HA 3VC7A 3PFFA 2X1HA 5G0UA 5KJFA 1D1TA 3BYZA 4I5GA 1NPYA 1TI7A 3B70A 4YACA 6ADHA 2BHLA 1T26A 1Z7BA 1HL3A 1KS9A 2WDZA 3H3JA 3ZWAA 3QWIA 5EINA 4EW6A 2B4TO 3A14A 3NTQA 2Q46A 1DLIA 3BMNA 3KSUA 4NBRA 4DXHA 3DHYA 3BMQA 3HB5X 1P45A 2YV2A 3ZHYA 1BVRA 5CPBA 2W2KB 1NHWA 1W73A 2W2LD 5L4NA 4J4TA 1E92A 5JE8A 3A1NA 3TZQA 4QT0A 1NQ5A 4E4YA 4UUOA 4E12A 3JYNA 3VZPA 1IZ0A 2WEKA 5EIOA 4XGNA 1YS4A 2VZ8A 1HEUA 1DBVO 4OJNA 2GASA 3MWDB 2V7PA 2Y05A 1AN9A 1TXGA 4NMHA 3S1LA 3WDSA 4NR0A 1K6IA 4HBGA 3T4EA 2PFGA 4XQEA 4BUCA 1N2SA 4EEZA 3GAZA 4EJ0A 2ZATA 1KVQA 2FR1A 2VHXA 4ONEA 1P1KA 1QRRA 3JD3A 4YJGA 1X0VA 4IDAA 4RORA 4IINA 3RUAA 1MXFA 3C7DB 4OOEA 4OSOA 4D7AA 2IODA 3FCOA 5A04A 2C2YA 4D3FA 4YDRA 2PD6A 1B0AA 4BNFA 3NX4A 3AUUA 1PS8A 3JD2A 1KVTA 2BFPA 3JQFC 2B5VA 5CG1A 4GX5A 4DA9A 5EESA 4JJIA 3ZW9A 4MPDA 5JSFA 4UVDA 3ROKA 1CQIA 4Z3KA 1NQAO 4IQ8A 2ZYAA 4TRJA 1HDZA 5I9MA 1Y6JA 5KJ6A 3VZSA 3DFUA 3QRWA 1ORRA 4GH5A 4IM7A 3WS7A 4CMEA 4BGUA 3JQ8B 1V9LA 3AOEA 3L4BC 4GKBA 3C8MA 3ST7A 2DQ4A 1OI7A 3ENNA 1ADCA 2GDZA 3OP4A 3RBXA 2LDBA 2IYOA 5JY6A 4J2OA 1FDUA 2CUKA 2VTDA 2YW9A 3I9OA 1W4ZA 3QVWA 4EEXA 3O38A 3H9EO 3RVDA 3C1OA 3NDIA 4HX5A 1E3SA 1FDVA 3PWKA 3E03A 2WWRA 1X13A 1X7DA 2PV7A 3TRIA 3BHIA 1K6XA 4KUHA 1ULSA 5DBGA 2C07A 1HDOA 4IDFA 4CLOB 3WNVA 1BG6A 1ARZA 4OKNA 4H3VA 1RM0A 2GN8A 4Y67A 5CDUA 4R9SA 4E5NA 3KSDO 3AK4A 2VWHA 1MC5A 1AXEA 3EY4A 3FHLA 4FFNA 4PG7A 3F1KA 1OBFO 2J5QA 1NYTA 3WGHA 1DPGA 2O23A 2VWGA 3JD4A 3EW7A 5DBIA 4MVJH 4RVHA 1PJQA 1P9LA 3AY6A 4BNJA 1ZK4A 2QQ5A 5FI5A 1PQUA 1MG0A 1EBUA 1JWAB 4GI2A 4RPJA 1ISFA 1VL6A 5HA5A 2I99A 5JAIA 3FTPA 2X0JA 3OMLA 4YA6A 1GR0A 3ZN2A 3OIDA 3HUDA 4FW8A 4QECA 1P31A 1PS0A 2IZ0A 3LK7A 2W2KA 1CRWG 3EUWA 2D4AA 4IQ0A 4QEDA 1VI2A 5JLAA 1P1FA 5FFFA 5TT1A 5ILOA 1H5QA 2FPPA 3ITDA 4PLWA 5JAQA 3VH4A 2H9IA 5DULA 4LVUA 4D0SA 1CEQA 4XYMA 4A73A 3QQPA 1E3WB 3IDSA 1ZMTA 1SB9A 4I9UA 3WX0A 3AFNA 1X14A 3B1KA 3HN2A 1HDGO 3JYPA 3PVZA 1BDMA 4WCFB 4CV1A 1QYWA 1NWCA 2D5CA 3PP8A 4BGEA 1Q7BA 1KC3A 2JD2A 3PFWO 4J4HA 5HS6A 4A2CA 1H2HA 4OQYA 5H83A 4IMPA 3RU9A 2EP5A 3DBRB 4AJKA 3ENKA 2P4QA 4KWIA 1R4MB 4L4SA 5G4LA 4IY1A 1NVTA 4O63O 1A5ZA 4YAGA 3QY9A 3C1AA 2EKLA 2X58A 4BO2A 1B14A 4DPLA 1HWYA 1HTBA 5L7YA 2OORA 2OBYA 5JDCA 1H6AA 4BB5A 2QRKA 3IKVA 1PQWA 4PLPA 4RVDA 3JQGB 3K9QO 2RHRA 4KTTE 2C5AA 3QWHA 2PGLA 2HAEA 2ZB4A 3ZH2A 2CDCA 1CIVA 2GZ2A 2PK3A 3CZMA 1T1RA 2JCVA 2AEJA 2EHDA 1Q0QA 3PJDA 4JGBA 3PTZA 1JKJA 2O50A 5IZCC 1E5QA 1LI4A 3P19A 4YAJA 2VHVA 3DZIA 1WLYA 1IHXA 3P2YA 3P7MA 3RI3A 4HFJA 5G4KB 3V2GA 1Z73A 3IS3A 3JQ8A 4WKGA 3ZU4A 5CEFA 1IB6A 3TZHA 1I3NA 4ZQBA 1LSOA 2AXQA 2NVUB 3IUPA 3K31A 5DBFA 5KVVA 2QW8A 1I5RA 1T2DA 2X8LA 1AUPA 4GVXA 3WFIA 1HZJA 1C0PA 5ER9A 3GC6A 1VPDA 1RM4A 3TL3A 4L76A 4BHTA 5L4LA 1JKFA 2ZKLA 4LCEA 4R9RA 1KETA 1ZCJA 4EUEA 3WJ7A 2GN9A 3WIEA 3TN7A 5FEUA 4DVJA 1TA4A 3Q9NA 5CDGA 5L4SA 1PWXA 3NDRA 1EVYA 3PK0A 1SB8A 1YL7A 4O6VA 3AUTA 1VKNA 3QVOA 3S2FA 2ZYDA 4CLOA 4CQMB 1K5HA 2HQ1A 1GZ4A 1N7GA 1H2BA 4CMAA 2VOJA 2F00A 1MV8A 3E18A 1A9YA 1GPJA 2X9NA 4OIMA 2IXAA 4RLSA 4Y9DA 4EJMA 2CDBA 3S2EA 3NUGA 1D7OA 1X15A 4BNYA 1ONNA 1XCBA 1T4DA 4O1MA 1R37A 1Z82A 2Q1TA 3PLNA 4JCOA 4P22A 4RF5A 4WNIA 4XEHA 5ICMA 4TRRA 2VCYA 5ITWA 4DPMA 2DFVA 3ASUA 2BH9A 1E5LA 4PZCA 3IL2A 4RVUA 1VKOA 1ID1A 2Q4BA 3GK3A 2DFDA 3ZHBA 3D3WB 4BNMA 4WLEA 1HYGA 4RVFA 2BGMA 1RYEA 3AFMA 3GH3A 4IDCA 1UDBA 4RVSA 1U8FO 3E9NA 3VZRA 4EDFA 1I24A 3T4XA 3AOEC 4R1TA 4PLZA 3R1IA 4BNVA 2P68A 2GN4A 3MEQA 3DHEA 1PGPA 1DDOA 3K5PA 1QG6A 5B4UA 3I9LA 4QFCA 5F1OA 1LLQA 2ZTLA 2ZQYA 3ZWVA 1F12A 1B8VA 3TJRA 5EERA 1SPXA 4INAA 1B8PA 4N54A 4ALJA 1E3WA 1U8XX 4M86A 4UUNA 4FJ0A 5C7IO 4WCFA 4Z0PA 1PJBA 5JW6A 2J5KA 1W0CA 3MJTA 1MFZA 5JFOA 4Y6PA 2PLAA 5FF9A 4CR7A 1ZUD1 3FR7A 3DBRA 4NJOA 1C0IA 4CM9D 4PLVA 2BFAA 5GZ3A 1T4BA 4FFPA 3PXXA 1EDZA 4Z3DA 2NU7A 3QVSA 4E0BA 1XU9A 3GAFA 5I9LA 3H9JA 3WLFA 1T24A 3OICA 4J16A 2FWMX 3U3XA 3WGGA 5KNLA 6LDHA 4YXFA 1WW8A 3E82A 3RBVA 2NU6A 5IFLA 3JQGA 5DCYA 1EE2A 2JFFA 3RCBA 1G0NA 2H6EA 1ISMA 1D4FA 3CSDA 4IJKA 3AM4A 2AHRA 1JDJA 5U4QA 1LEHA 4YJDA 3KV3O 3PGJA 4LSMA 4D0RA 4U6QA 1GCOA 5G0SA 2DM6A 4B7UA 1LQTA 4IDGA 3VPGA 4DLBA 1DIGA 3RC7A 5G4KA 3HDHA 4YRAA 4IBOA 1TLTA 1DXYA 4R54A 4R1NA 1I01A 3ASVA 5L9AA 2NVUA 4FD3A 3NJ4A 1MXHA 2TMGA 3RBZA 4MP6A 4XQCA 1ONPA 2VOEA 3NDJA 3JYQA 2EV9A 3DHNA 3GT0A 3TL2A 3EZLA 4P4LA 2JJYA 5EQDA 3TDKA 3LDHA 4CQLB 1HDXA 5EQFA 2I65A 5H81A 1EFKA 4KQXA 1SOVA 2G0TA 5FYDA 2Q45A 2G17A 4OXYA 1WMAA 2ZTUA 2VZ9A 3RFVA 3L6DA 3WWZA 7MDHA 3AI1A 1E3EA 4TVOA 2B35A 2JHGA 1K2WA 3I83A 3VVCA 1O94A 1YL5A 3W8FA 2Q3EA 3K73O 4J43A 1BWSA 4XRRA 4DYDA 2DKNA 4CQMA 4E31A 3H6KA 1KYQA 4L9RA 4MKZA 1DC3A 1X1EA 3FR8A 1ZK3A 2YV1A 3JQBA 3EZYA 4KTVE 4ND1A 4U0JA 3ADPA 5ENDA 4R3NA 2RHCA 2G1UA 3KRTA 3PDUA 5JDCC 4BKQA 5A1TA 1NM5A 4NJMB 4Y6SA 1M76A 1VJTA 4FBGA 5KVSA 4JBIA 1T2EA 2VT3A 3IP3A 3SBOA 3UAGA 4AJ1A 1RPNA 4DRYA 4OL9A 2CSUA 3S2IA 1KIFA 3WQSB 3D3WA 1DC4A 2W98A 4NZ9A 5DCWA 1JTVA 4PG8A 1UDCA 3UUWA 3JQAD 2FMUA 4BO3A 1XEAA 4IXTA 3ULKA 3ZV5A 2QHXA 4CMGA 5G0VA 3DEYX 2CZCA 2W8ZA 3MWEB 4ALMA 4MKRA 4ZGWA 4ALIA 3D64A 4XGIA 5COQA 1DLJA 2RH4A 1KVSA 1H6DA 2HRZA 4PLFA 5T57A 3ZV4A 4OXNA 4NK5A 5A02A 4YPOA 3U4CA 4E30A 3WQRA 4GGPA 1QP8A 1A4UA 1Z74A 2IYPA 3H2SA 3ANNA 3NKLA 4DLLA 4CM6A 1B15A 1DIAA 1VC2A 1K0UA 1LDGA 5I8ZA 1LDMA 3DZKA 4X54A 9LDTA 1YB4A 3K6JA 1FMCA 5BNFA 2GZ3A 4BB6A 4LGVA 1HE4A 2Y68A 1UP6A 3CXRA 3I1JA 3SJUA 1BXKA 3W6ZA 3IP1A 4W9NA 2A35A 1ADBA 2YUTA 1IL0A 1F0YA 3M1AA 4E5MA 4GMFA 4GX1A 1ISIA 4LVCA 1DFGA 3RJ9A 1I33A 3DONA 3JV7A 1QSGA 3OIFA 2AG8A 4FGSA 4ND5A 1XA0A 4P4NA 3ZWBA 3AOGA 5JO9A 3RQSA 2UYYA 4LRTB 3WOHA 1B16A 3PHLA 1E6WA 4GL4A 5BSFA 4NBUA 2FP4A 4U6SA 3K30A 1UXIA 1NNUA 4DBZA 3FNGA 5IZ4A 2B5WA 2VT2A 3H5AA 5BT9A 5A3JA 5JC1A 5KCZA 2YFQA 1MLDA 2OMEA 3H3FA 3BHMA 4UUPA 4KOAA 1MC4A 2JD0A 4NBTA 2WYVA 1L1FA 4L0QA 2I67A 4YR9A 1GQQA 4E2WA 1LC3A 3KUXA 2G5CA 1JLLA 1GV0A 1HXHA 3GDFA 1EVZA 1I30A 3RC2A 3ZNQA 2GRAA 1BDBA 4OOFA 3MJEA 3F5QA 1MX3A 4J1SA 3PZBA 2Y0DA 4QO8A 2NU8A 3V1YA 2YQ5A 1VJ1A 2R6JA 2WD8A 3BHJA 3UH1A 4CQLA 4QFDA 3LU1A 2OOSA 4YJFB 1VM6A 2NACA 4RPLA 3QE3A 4QX6A 1AHHA 4IIUA 3V2HA 4ESOA 2B37A 4WCFC 3FWZA 3LLSA 5BQFA 4XJSA 2EJVA 2HK7A 1TT7A 1V0JA 5GMOA 1PJTA 2ZCUA 2O3RA 5KJ1A 4HFNA 5KVQA 2CVQA 3DBHB 3ONFA 1PJCA 1X7GA 2V6MA 1NQTA 5AOVA 3ZU5A 3I9JA 1B7GO 4TKLA 4II2A 1B2LA 3PHIA 1NAIA 4ZJUA 2X22A 3EYWA 1G1AA 1YGYA 1JN0A 2VUTA 4DC0A 2AEMA 4WGGA 3LVFO 4OQZA 1HYEA 2NU9A 4NJMA 3FI9A 3PDJA 2P4HX 4RDIA 5FI3A 3EVTA 5G2OA 1UZNA 5TNXA 3FF4A 2FSVA 2Z1NA 4JK3A 3G0OA 1YDEA 1WDLA 2UVDA 4Q3CA 4FN4A 5F21A 1ZK1A 2IE0A 3ZZNA 4BV9A 1GPDG 3KOUA 2HDHA 1XIVA 4RZIA 3UOGA 4QO7A 1KEUA 3EK2A 4ILKA 2CF6A 3DTTA 1E0DA 1YWGO 2D1YA 1XQ6A 4BGIA 1Y8QB 4JJGA 2BMAA 2X5JO 2H5LA 4RO0A 5THKA 3UKOA 3BTVA 4ZQFA 1GV1A 1ZZEA 1ZXLA 3BIOA 3MCVA 2V6GA 4A7PA 1NR1A 3OEWA 3RUFA 4OXKA 1NXQA 2OUIA 3F6YA 2OBNA 4R5MA 3LC2O 2QRJA 2Q50A 1U5AA 3INRA 4EBFA 1WMBA 2HLPA 3DR3A 3IJPA 3GPDG 1CDOA 5JAZA 1OZAA 3H8VA 4TVBA 4S1VA 1R6DA 2EEZA 3UN1A 2WE7A 3HZZA 3GF4A 3TQHA 3ZHZA 4CM1A 5KJEA 1UXKA 4DQXA 1UZLA 4Y6RA 1SO8A 1GUFA 5IDQA 4FPXA 1J0XO 5ILGA 1GZ3A 5T5QA 4CM8B 3QLJA 1C1XB 1E7YA 4M55A 4MKXA 4R69A 5IXSA 3VVBA 4BO6A 2AE1A 4FB5A 3L6EA 1DB3A 3CTMA 4GLOA 3JQBC 4E2XA 3PWZA 4DTIA 2Y99A 5MGBA 4K28A 4FFLA 5JAMA 1ENOA 3TPCA 2FR0A 4DMMA 1HDRA 3PQFA 2FOIA 2P5YA 4HFRA 1DHTA 3WQQA 2HO5A 3LT2A 3TOXA 2XXBA 1HETA 4IS3A 3HQ4O 4HWKA 4U5QA 3HWRA 3GRPA 4AJIA 3GFGA 2C29D 4U8GA 4HKTA 5TSDA 1DRWA 2DTEA 3C85A 4C4OA 4CUJA 3NV9A 4I5EA 2G76A 2NTNA 3O26A 4EZBA 4WLNA 5LC1A 3I4CA 4GKVA 4I5FA 3UVEA 3X2FA 5BSHA 2YFHA 3C7CB 3JQ9A 3MJVA 2NVWA 1PGOA 4MVJM 5IDYA 2A9FA 3P2OA 1Y9AA 1MA0A 4YCAA 1ZK2A 1P1HA 4EGFA 1E1LA 4CMJA 1RWBA 4P38A 4WUVA 1SMKA 4TZTA 1H6CA 2IRWA 3CH6A 2CVOA 1IULA 2O7QA 4YVFA 2NSDA 2I66A 5CEJA 3WYBA 4I8XA 1I3MA 1PX0A 1SZJG 5I9NA 4J9VA 2YYYA 4YJFA 4YEDA 1A72A 2IEBA 4FCCA 2ZIZA 2EJWA 2J3KA 5HWSA 2J8ZA 4LRSB 3G49A 3CUKA 3NGXA 1O8CA 1ZK0A 3GFBA 3IJRA 3KO8A 4YB8A 2BKAA 4XD2A 4IQGA 4WE3A 4AJHA 4R68A 1SAYA 5HBRA 4KWHA 3WGZA 3DBHA 2GZ1A 1UUFA 4IS2A 4K26A 4Q3AA 4W9NC 1MG5A 1CETA 2HU2A 4ZVVA 4D46A 1S6YA 3ONDA 1PIWA 2HMTA 3O9ZA 3U62A 3GHYA 1HKUA 4ROSA 4NPCA 1EEHA 3LZ6A 5JDIA 1BXZA 3ZWPA 3HFGA 1DIRA 4F45A 2DUUA 3RD5A 3AI2A 1PU2A 1A7AA 1M67A 4MIOA 1ADFA 4FFRA 1G0OA 1NR7A 4G65A 3ZNPA 4LSWA 1V3TA 3AWDA 2BELA 5CPFA 4I5DA 4RDHA 1P1RA 2J3JA 4LISA 3LF1A 1EMDA 4A5OA 5DP2A 3RROA 1DC5A 1Y8QA 1YO6A 2Q4EA 2YZ7A 3K8ZA 4CUKA 4ZN6A 3CE6A 4KDFA 2I3AA 3KYBA 4D79A 1J49A 2CMDA 4DQVA 2ZB7A 4JP2A 3FRJA 1YJ8A 2PNFA 2H63A 1GCUA 3HFSA 1CERA 1EE9A 5DDIP 1Y1PA 1LDBA 2BGKA 1R15A 4J91A 3TFQA 3W4IA 3WJAA 2DPGA 2UDPA 1QYXA 2E4AA 2EGGA 2NQ8A 3H9QA 3ZDFA 1ZJZA 4CM3A 1R0KA 4XR9A 4E5PA 4QTZA 1V3VA 5ES3A 3DZFA 3RC1A 1M2WA 1T25A 3O03A 1K89A 2NQTA 2R2GA 4NBVA 4YRBA 5KIAA 5TJHA 3Q1LA 1ZXBA 4CV2A 2Z95A 4CM8A 4OAQA 1C1XA 4FGWA 2AMFA 4PVCA 4AJLA 4IJUA 2D59A 3VZQA 4AJ2A 4IGFA 5K6AC 3WGOA 3QVXA 4IIVA 4J3FA 1JU9A 3LSYA 4F46A 3GGGA 3SLGA 1PWZA 1O5IA 3U5TA 1TB4A 1KOLA 4AJNA 4BL5A 1IPEA 1NPDA 2GF2A 3GN2A 4FFOA 4N5MA 2VRBA 1QKIA 4F3YA 4RGBA 5BNTA 4EITA 4PZDA 2DBRA 1E1KA 2Q2VA 3DTYA 3GVHA 4XX0A 3DZJA 1Q2XA 1KBZA 3KYCB 2NNLD 4PRKA 1ENYA 2VUSA 1C14A 2XXJA 2NADA 5JC8A 4HFMA 2J3IA 3ZWWA 4KUEA 1KEWA 5DNAA 2IZZA 4CLRB 2V6BA 3IIEA 4BO9A 5JCXA 2QYTA 1NASA 3UFXA 4J0FA 5HM8A 1NP3A 2Y1EA 3WYEA 1CWUA 1DJNA 4BS9A 3SLKA 1C1DB 2G82A 1EUZA 4MINA 3JQEA 4MJLA 5A03A 3DZGA 3VH2A 3SXPA 4B4UA 1B8UA 1LDEA 1FDSA 1NFFA 1DHRA 3R0IA 2OXIA 5HTOA 5U1PA 2BF7A 2I76A 5DOVA 4OMUA 5I7SA 5DN9A 1D1SA 1HE5A 2A92A 2AQ8A 3T7EA 1E6UA 1HLPA 1P44A 2ZJ0A 4JXKA 3BTSA 2AA3A 1BXGB 1P1JA 3GY0A 3A4VA 5L3ZA 1U3TA 2PGJA 4CL3A 1IOLA 3H9GA 2YHUA 3LYLA 5ICSA 3DMTA 2IZ1A 3QVTA 4BNGA 2FZEA 2ZJ1A 3WSWA 3JQCA 3NEPX 4L74A 4BNIA 2QX7A 2Q1WA 3UHAA 3ZCXA 4K6CA 1A7KA 2OHXA 2VWPA 4E5YA 4B3IA 3RJ5A 4PLGA 1YBAA 3IQDB 1A71A 1O0SA 2Y67A 4D3DA 1V8BA 1YB5A 2TMDA 1FDTA 3DAFA 3KVOA 3KXDA 1DAPA 4XYEA 1LX6A 3HB4X 3OM9A 1C0KA 2QZ9A 2X23A 2GO1A 4DL9A 4N5LA 1N8KA 4U0KA 4YT2A 2C0CA 5JCJA 4PLHA 1HLDA 2HSDA 5I7EA 1XHLA 1GFSA 4MO2A 4FJ2A 3VKVA 1V6AA 1EZ4A 4GX0A 4IDBA 3GZ4A 3NT2A 4A10A 2PZLA 1P0CA 3B1FA 4KDEA 4QUKA 4BMSA 4ZHSA 3NJ8A 4BNWA 1ZFNA 4XWYA 3D3EA 5HS4A 4FC6A 1SEVA 3HE3A 4TRNA 5KWEA 1XU7A 3P5SA 1FJHA 3ONEA 4MIYA 3PPIA 3GMSA 1JQBA 4K6FA 4K9DA 4UUMA 3VPHA 3QSGA 1SNYA 3COSA 2POQX 4XKJA 4BO7A 3L77A 3OJ0A 3BZUA 4A26A 2C7VA 5JDIC 3BTOA 2J5RA 3MZ0A 1R0SA 4MVJE 3TZ6A 4IZHA 4J7CA 5C37A 3AUAA 2VHYA 3M2TA 4CMEC 3ZWMA 1NVGA 3K2BA 3GEMA 3N7UA 4F6CA 4GSKA 3KYCA 3WLEA 1U7TA 2UV8A 5T64A 1C0LA 1HT0A 4FOSA 3WG9A 4R51A 4CQMD 4UVEA 4YWJA 4NHEA 3JQ7B 1WWKA 3WGTA 3F4BA 1HRDA 1ZIDA 3MOGA 3PWSA 3PJEA 1WXDA 4CLRA 3AM5A 4M89A 1J6UA 1M66A 2EERA 4HADA 3UGKA 3F1LA 3V1UA 3W6UA 5JPIA 2EP7A 5CDTA 5KKCA 1ISJA 1I36A 2RCYA 3ADOA 2D5AA 3CINA 3IC5A 3JQDA 3JYLA 5IN5A 4R5HA 3A9WA 2WYWA 4XQ9A 3H2ZA 2DTXA 1ADGA 1O9BA 1DFHA 4XIJA 1C1DA 3WBBA 3E8XA 4IGEA 3L9WA 1U2GA 1R4MA 4CR8A 3UF0A 3MJ4A 1NX6A 1JAXA 3C7AA 1YH3A 2VNAA 2BI8A 2PZMA 4IDEA 3WMXA 1X7HA 3RIHA 5JMPA 3DAGA 4N7RA 3SVTA 1IE3A 1ZJYA 1EK5A 3NTOA 4NH4A 4I9NA 1O95A 2OO5A 2YHIB 4J9UE 5L7TA 2Y1DA 3IKTA 3KHUA 1JW9B 3OQ6A 1PZEA 3RC9A 2ET6A 4YAEA 4BGVA 4CR6A 3OF2A 1BXGA 1YKFA 2DLDA 4J4BA 3RAJA 1AXGA 1FF9A 4CPDA 1YJQA 4YRDA 2O3TA 3CIFA 3IOYA 3WWYA 3OQ1A 2QG4A 2W90A 1N1EA 5BNIA 2O4CA 3VTFA 4Q3NA 3U4DA 1PSDA 5T6BA 4J1QA 2LDXA 4WLOA 3ON5A 4ZQEA 4CUZA 4E2ZA 4II3A 4BO5A 4A0SA 5JS6A 3WR5A 4H7PA 4DIFA 1OC2A 2GLXA 5B12A 1Z75A 2EWMA 3AI3A 3VH1A 3WGQA 4OGWA 3GVXA 2E48A 2YDYA 4JJFA 1KC1A 1F8FA 1ISGA 4TWRA 1FDWA 1QLJA 3NRCA 3BA1A 3H5RA 4XA8A 5AYVA 1NQOA 2NUAA 3KYDB 1YDWA 1PJSA 3KEOA 3ZU2A 1RM5A 3FNHA 2XF8A 2PZKA 3WGIA 3UCEA 3AU8A 4Z0TA 2PY6A 1V3UA 4MVJA 5CFZA 3HADA 1ENPA 3H9UA 4HXYA 2O48X 1Y7TA 1YOVB 1WAMA 2Y1CA 3PJFA 4B8ZA 5AXAA 5B1YA 5A9TA 4GSLA 1P0FA 4ALLA 1GYRA 3LC1O 3VPXA 1UJMA 3AY3A 4IZIA 3WNQA 1HZZA 2B69A 3PYMA 2VUUA 2E82A 1UAGA 3GG2A 4W6ZA 1W8DA 3RWBA 3IMFA 3ZU3A 4YYZA 2VYVA 1K3TA 3M2PA 4J7UA 2EIHA 4J90A 5CP8A 1E7SA 2DBVO 2O7SA 4YAKA 2GNAA 1VSUA 3PIDA 3GEDA 2IDZA 5J23A 3D4PA 2NV6A 4Q3EA 4H16A 4XQGA 2PH3A 2QIOA 4OYRA 1ML3A 3DDNA 4MDHA 4J1TA 3HSKA 3JCZA 5TT0A 2UUPA 3PLRA 1LDYA 2E49A 2B4QA 3JQ7A 3I9KA 1EQ2A 1Q7GA 5KKAA 1EFLA 3MTJA 2WE8A 2ZQZA 3VHRA 5CDSA 2Y0CA 4AG3A 4GGOA 3L07A 3RKUA 1TT5B 2GUGA 2JHFA 2ZTVA 1UR5A 2Y0EA 1YRLA 1XR3A 1HDCA 2JL1A 3WGYA 1XYGA 4CMIB 3GOHA 3GA0A 3F5SA 1QMGA 3E9QA 5IDWA 4CJXA 1ZO8A 3DBLB 4WJZA 3NT4A 4LN1A 2DT5A 5EN4A 3H7AA 1DAOA 1LJ8A 4S3MA 1ZSNA 2YHIA 4JNKA 4XYLA 1J5PA 4XCVA 5TX7A 5A05A 4Q9NA 2HRBA 4WPGA 3WSVA 4CL8A 4YQYA 4LCJA 3E48A 3JQFA 1GY8A 2OL4A 2CY0A 2GGSA 1NBOA 1GEEA 3G1UA 5IAAA 3V5NA 5EMHA 5CHEA 3K92A 3GNTA 4M54A 4CM4B 2YV3A 2DUWA 4O59O 1PJ2A 5GY7A 1KY4A 3K96A 5TF4A 1GAEO 3BMQB 1MB4A 1JA9A 5ITVA 1VJ0A 3HG7A 4FQ8A 3ROQA 1VRWA 3DQPA 3PQEA 3VOSA 4RLHA 5A9RA 2Q49A 5BSGA 3PRJA 4WEOA 1AGNA 4CMBA 4PVDA 4BNLA 3AU9A 3WXBA 5DZSA 2V65A 1KERA 3TF5A 2EF1A 3OQBA 1E77A 3U49A 2VHWA 4YTEA 3M6IA 4ND4A 4D41A 4JX8A 1NFRA 4HUJA 2FRDA 2HJSA 3PIIA 2GPTA 3GDOA 3NGLA 4NFHA 4UEJA 5L95A 1EVIA 4W99A 4XB1A 2XAAA 4NQZA 3F9IA 4J2HA 3W8DA 4AICA 1JKIA 1U1IA 5EJ2A 2AQIA 4RJTA 1YOVA 1JVBA 2FHSA 4GPD1 4PZEA 5U9CA 4R41A 3S2GA 1LRJA 3PZRA 4E21A 1GEGA 5TS3A 2OGUA 4YBZA 3ROPA 4C7JA 3GMDA 4LMPA 1ZSYA 1NTOA 5F1KA 1VL0A 1N1GA 3C1TA 1CYDA 2WMDA 4EYEA 1UH5A 4XYGA 1LRKA 2B36A 4B79A 3WYCA 1Z7EA 3UXYA 4NFSA 4OO3A 1BMDA 4AL4A 3HDQA 1LUAA 3FWNA 3D5QA 3O8QB 3ZV6A 1R4NB 1EK6A 4TSKA 3N58A 1U3UA 3CPSA 2HMUA 4UEOA 5JYEA 1WVGA 5AVOA 1XG5A 2YY7A 1IUKA 2EW2A 3ABIA 2HMWA 3I52A 4URFA 4KMSA 5ADHA 2RIRA 1T2FA 3LF2A 3EDMA 1GQYA 1I0ZA 3EGOA 4A27A 4KQWA 4GWGA 4Z9XA 1Z45A 5KJCA 3WMWA 4XDZA 4E6PA 2NWQA 3AJRA 3BAZA 3D4OA 5A06A 3LC7O 1TT5A 4NI5A 3WIDA 2IXBA 1DIHA 2BFMA 1DOHA 4B7XA 2DVMA 1DJQA 2WYUA 3GQVA 4JBHA 3RUDA 3ZWXA 2VZ0A 3C24A 1L7EA 1ZH8A 4ITUA 3WBFA 1WZEA 1XELA 2Y93A 4CMIA 1LC0A 1XQ1A 3H4VA 1ENZA 1DC6A 1PJ3A 1GDHA 3DBLA 1ONOA 4G81A 4BMVA 1AE1A 4MP8A 2QRLA 3OHSX 4OH1A 4OM8A 1M6HA 5A5FA 3CZRA 4RF4A 4OSPA 4WASA 1LU9A 2QZZA 3DMYA 1ZEMA 5K9ZA 2Q2WA 3FTNA 3MJCA 4CV3A 5AXDA 4QSMA 3ANLA 4MP3A 1S7CA 1MGOA 2HKIA 1YONA 1R12A 3T7CA 5T67A 3SC4A 5JO0A 4B7CA 4FOOA 2PWZA 5ENVA 4Z6KA 3LT1A 2I9PA 4FSHA 2X4GA 3L0DA 3RFXA 4CM4A 4GBJA 1EBFA 5IZCA 3GEGA 2C59A 4BNZA 2HMVA 3F3SA 1F17A 3KSZO 2X6TA 4JIGA 3NAQA 1T1SA 4ZQHA 4DBVO 2VRCA 3OA0A 3QP9A 1PTJA 1CF2O 1P1IA 3QJ5A 3VPSA 3NTRA 5JYDA 2X0RA 2Q1UA 3BTUA 1SOWA 4PRLA 4EJ6A 5L7WA 3WICA 3ICPA 4ZA2A 2P2SA 4MVJP 3ROMA 4IDDA 4WLVA 1WDKA 4ZQGA 1HF3A 2VQ3A 4Y8VA 2A4KA 4DGSA 4B4VA 1X0XA 1G6KA 1HSZA 4PLTA 5AQ1A 4RPGA 3QW2A 3INTA 3E1KA 1K6JA 2GYYA 1LDNA 4J49A 5C7OO 3ZWCA 3ZWOA 4ND3A 1DRUA 1MFPA 4UAGA 3Q2IA 3S55A 2HJRA 1OMOA 1UP7A 4FIZA 2DBQA 4UVGA 2F1KA 1GQ2A 1U2DA 3AY7A 4NDNE 2NVBA 3CEAA 2FN7A 1SCUA 4KP7A 3FBTA 2DU8A 1T2CA 4XIYA 2E6UX 3JQ6A 4D44A 2FSSA 4AJEA 1I10A 4W7HA 3PEFA 4WECA 5LCXA 3ZW8A 3DXFA 1PR3A 3AUSA 4W4TA 1WZIA 3D0OA 1E3IA 4FFMA 3VAZA 1E7QA 1UXJA 1XSEA 3R3SA 4BNXA 3GUYA 4IMRA 3O8QA 1R4NA 1KVRA 4E3ZA 2DBZA 4G5HA 3DO5A 1EDOA 4M8SA 4WLFA 5B37A 2OP0A 3V1TC 4WEQA 3GN1A 4I08A 1PL7A 1B3RA 4FDAA 4AFNA 2D3TA 3RUIA 1LXCA 3OEYA 3H65A 3TSCA 1F14A 2BRUA 3KZVA 3A06A 4QQRA 4E33A 3I9MA 1FXSA 1E7MA 1M6WA 2GERA 3E5MA 3I5MA 5CAEA 5TLSA 1UAYA 2JCXA 3DZBA 3QA9A 5JXWA 5I7FA 3DZHA 2PKQP 2JD1A 4ND2A 5IJZA 2Y1GA 2OZPA 2VHZA 4KZPA 1QXSA 1GUZA 3DWFA 3PYLA 5A3VA 3PHJA 4R3WA 3AM3A 1EQUA 1CQJA 3Q3CA 4FS3A 3VKUA 1DRVA 4CM7A 4HY3A 2W2LA 3OH8A 1JAYA 2X86A 4ZICA 1SEPA 1DSSG 5TRTA 3ZI0A 4BNNA 4DQUA 1PJ4A 1I3KA 5AXCA 2PD3A 4CMKA 4YT8A 3C3XA 3DAPA 4KUGA 1F06A 5EL0A 4BQRA 1ZBQA 4L73A 4ZRNA 4GLLA 4TZKA 3WFJA 4B4WA 5KTKA 3LQFA 2Z1MA 3W4JA 1PJLA 2PZJA 2UUOA 2NTJA 5JCJD 3B1JA 4BOYA 3HJAA 3OECA 1E1NA 3GZNB 1VE9A 3GR6A 1O89A 3STHA 3CMMA 2P9CA 3F4LA 2HCTA 4UVIA 4OHUA 5DCUA 4RV9A 4IXWA 1LSUA 4PG4A 2CF5A 1BTOA 4EUFA 1H0KA 3MJSA 1HE3A 1YVEI 1UZMA 3K2EA 4PLCA 2FY8A 2BD0A 1UXGA 3OBBA 3RUEA 5KVCA 5B4VA 3FPLA 3QWAA 1PZFA 5BSEA 1NWHA 1IYZA 1XWFA 2BGLA 1D8AA 1RYDA 3GNSA 4BNKA 1RM3A 2CNBA 4C7KA 2CDAA 1NPTO 3GUCA 2Y1FA 4NFYA 3RUHA 4CMHA 1E7WA 2P9GA 4QXMA 2I5PO 4CLEA 8LDHA 1OC4A 4M49A 4BKRA 4DWVA 2AQKA 1JWBB 3QWBA 3HDYA 4Z0HO 5L45A 1B26A 4UEKA 5F3RA 3I6IA 4RCVA 2WM3A 2O3QA 3LLVA 2ZK7A 3WTCA 3HN7A 2P5UA 2D0IA 4B3HA 1VL8A 2PKQO 2GSDA 4D43A 5COAA 1QYCA 5JY1A 3I4FA 4A03A 4UREA 2CVZA 1LLDA 3GVPA 2JCYA 5TQVA 1NVMB 3AW9A 5L40A 5LDHA 1DFIA 2WJPA 3EHEA 3DFZA 3U09A 1DIBA 2C82A 4W82A 4RQTA 4R01A 5L51A 1TEHA 3PI7A 3ZGYA 2UAGA 3HNPA 3V8BA 3N74A 4RPKA 4DREA 2RBEA 5GZ1A 1KY5A 3EAGA 4NU6A 2JAHA 4K1LA 3H5NA 1BW9B 1YE3A 3PJGA 4I9HA 3OJEA 4GQAA 4U7WA 1Y5RA 1SC6A 4GX2A 4O0LA 4MOWA 3EVNA 1I8TA 3I3OA 3JQ9C 1BVUA 2NTVA 4MIEA 2ZB3A 3KETA 1RJWA 3G79A 3EMKA 4XB2A 1IHYA 2VWQA 2BLLA 3D4NA 4YAIA 2B83A 1X1TA 4D42A 2C7GA 3MTGA 4TKMA 3GNQA 2EG9A 1JVSA 2B4RO 4GWKA 2CD9A 4DIOA 5DOZA 4NG5A 3ZNOA 1A4IA 2J3HA 1LSJA 1U28A 1H94A 3W1VA 1LBEA 5TJ9A 4XDYA 1ZKMA 3OJLA 3I9NA 1U7HA 1YBVA 3IAHA 3U4IA 4B3JA 5A5EA 2C54A 1E3JA 1OAAA 2O4UX 1I32A 1Y8RB 4E5KA 2AE2A 1VLLA 3B6ZA 2EXXA 3DL2A 4BO8A 2O2SA 4UVHA 3PQDA 1E1MA 3KTDA 4YJHB 3R3JA 5EPOA 4DUPA 2X5KO 3GLQA 2RH8A 1WP4A 1AHIA 2V6FA 2JFHA 1H9BA 2X5OA 3O4RA 4FR5A 4D45A 4F6LA 1FK8A 4DYVA 1XLTA 1Y81A 1V35A 3QIVA 4YT4A 1ZVMA 1P33A 1Y5MA 1YB1A 4AJOA 5KOIA 2FPIA 2D8AA 3PHHA 1MUUA 4HNGA 4PGFA 2VN8A 4LW8A 1OOEA 1R0LA 4HP8A 1P74A 3GZNA 3F46A 1EVJA 1PL6A 3KEQA 4Y98A 1C3VA 4RF3A 5JNLA 4JP3A 3KLPX 4RF2A 4WOJA 3GRKA 2SCUA 4MVJD 3W8EA 1HE2A 2R00A 4L8VA 5THQA 3ETEA 2YDXA 2ILTA 5K0ZA 3OFSA 4CODB 2C5EA 4ALNA 1E6EA 1PGJA 3TFOA 2O3JA 1GTMA 2QYSA 4AJ4A 4E13A 1QR6A 3KLMX 1N92A 4ZRMA 4UULA 3ORFA 5F1PA 3JD1A 2NM0A 1ZEJA 3NT5A 2C20A 1LA2A 1U4SA 1GU7A 2VYVD 3DOCA 2X0IA 3FNFA 1Q7CA 1YL6A 1QV6A 1KEPA 2EKPA 1IZ9A 4RVGA 3VH3A 5CDYA 5C7LO 3WTBA 2Q1SA 2VYND 2JAPA 5AXBA 5DT9A 1E3LA 2X9GA 3G17A 3KM0A 1J4AA 3QHAA 3U0BA 4PIVA 1RKXA 5T8KA 3NYWA 1H9AA 5H82A 3D1LA 3OETA 4TQGA 3RSHA 3BMCB 4M87A 1XKQA 1GYQA 5IN4A 1U5CA 4GMGA 4L75A 3LT0A 1M75A 3GGPA 4O5OA 5A4DA 4Z9FA 4PG6A 3RFTA 4NBWA 3ICCA 3FD8A 5I8WA 1D3AA 3M1LA 4ALKA 1WPQA 2PA3A 1ZNQO 4H15A 4JBGA 5TC4A 3JTMA 2O2YA 1DEHA 1SBYA 3SC6A 4XGKA 1U4OA 3VTZA 8ADHA 5L53A 1BW9A 2YJZA 1ISHA 4YQZA 3MOIA 5A9SB 2FR8A 4R4JA 5I7VA 1GUYA 2EKQA 1BSVA 1Q0LA 2P91A 2ZB8A 2WSBA 1PS9A 4NIMA 4ID9A 1HDYA 4DPKA 1MP0A 1YBMA 4DLAA 3D5TA 3ZWNA 2VTEA 2ZYGA 2PH5A 4I1IA 4BNHA 4R1UA 1L7DA 2DC1A 3UICA 3UW3A 2FZWA 4BO4A 2PTGA 4EUHA 2YQ4A 1LRLA 1ZW1A 4JQCA 3GPIA 3Q0EA 1H93A 3JYOA 4JLWA 4LK3A 3ZWYA 1GD1O 2AEFA 4YT5A 1LTHR 3JQAB 1BHSA 1IY8A 3FBGA 3B20A 4GVLA 3UCXA 3U9LA 4PN3A 4D3SA 4WCDA 1Y8RA 2Q99A 4J1NA 4AJJA 1Y9EA 3F47A 5DP1A 4RL6A 4BKUA 1PL8A 2AW5A 3E5RA 3Q11A 2PKRA 3SX2A 4WOKA 4NU5A 3FN4A 1XGKA 4YJHA 2B0JA 3TNLA 5B4TA 1QV7A 4PCVA 4AJPA 3ETGA 3GVCA 1NFQA 3TWOA 4BNTA 4NNJA 4P8RA 3DMTC 2VYNA 4CM5A 1T2AA 1NHGA 4RQUA 3ZHXA 4R1SA 1P77A 3TZCA 1VSVA 7ADHA 1YXMA 5HRUA 4B4OA 4BQPA 2Y66A 1LSSA 1QLHA 2DTDA 2PD4A 4CLXA 4DIBA 1QYVA 1GADO 4GAEA 5GZ6A 4CM9A 4CLDA 3HDJA 1PEDA 1W6UA 3GGOA 1O6ZA 4IJWA 3V2UA 3G1TA 2BI7A 1HYHA 4BV8A 4XR4A 2HK8A 3L6OO 4BMNA 1R66A 4BIIA 2EGHA 2P9EA 3SEFA 2WD7B 3OSUA 3E6AA 3VDRA 4JN6B 3PGXA 4N18A 1N9GB 1A27A 2OFPA 3JSAA 4J7XA 1DO8A 2O3SA 2Y1OA 3BMOB 3OJFA 5TIIA 4XZ3A 4E32A 2A94A 3RU7A 1LLUA 4CMCA 3Q2KA 1I2ZA 1N7HA 1EUCA 4TMFA 1U9JA 3E9MA 4Q3DA 2VNSA 3Q9UA
chains in the Genus database with same CATH superfamily
4YHHB 3OIGA 3M3PA 4HMOA 4BDSA 5FOVA 4KL8S 4AJ9A 1UBRS 2W0MA 3W0LB 4G97A 5T4EA 1BKDR 2XQJA 3Q6IA 1IMOA 2LIVA 3L8FA 1X42A 4CNBA 4CEJA 1TVKB 2IOYA 2D00A 2IEIA 5AKLA 4AXBA 1K7EB 5HQJA 2J08A 4BQIA 4YIHA 1DKLA 2BKLA 2WFLA 3ZPXA 5JZSA 1DE0A 3L9XA 2FSPA 3OESA 1TTQB 2P4UA 5CA1F 5ELXA 3Q3EA 2D2VA 3MJFA 4RPHA 2FOLA 4QYXA 5ICEA 2IHJA 1TTTA 2RKWA 4PZYA 2XZTA 3BCUA 1GG5A 4BO1A 1UMCB 1QZXA 1PT9A 2AQHA 4BEVA 4BO0A 5ALZA 4R1MA 3TGPA 2RAFA 1PGNA 3Q4GA 3R75A 3ZXUB 2QSJA 2G9RA 1N0WA 3CLTD 2TMYA 3MTEA 2QUKA 5EP3A 3L4BA 3UCFA 1J2YA 1NBMA 1C3EA 2W4MA 2IUTA 2CEAA 3ANMA 1JHZA 3KDPA 4DBLC 3EBOA 1LQUA 3PQ6A 4MVJF 4BVAA 4Z7NB 1PUJA 1W88B 4P4GA 4OHBA 4CF6A 3HI4A 5C5IA 3STTA 1BOFA 3B3GA 3JARA 1GFWA 4FJ1A 5AO9A 4LMRA 2P11A 4NBSA 4ZD6A 1ZIYA 4CLHA 3EUAA 1EX6A 4GW3A 3VVMA 1ZM9A 4K6GA 4R16A 3V1MA 2VJMB 3ECSA 1CVRA 2ISCA 2OSVA 4FN5A 3LQRA 5LB4A 4A6XA 4F84A 3BL6A 3PHGA 5CCDA 3SKVA 3LKZA 2QN7A 1UZUA 1C41A 2CJPA 2VJOA 1H3FA 3M6LA 4QHTA 1RWVA 1HQYE 4FP9A 3A28A 4HMQA 1J99A 3FYUA 1MX1A 2IEDA 1T4MA 3JQAA 2IWRA 3VAAA 1X9HA 3DE1X 4DCPA 4ZZIA 4B2PA 4B75A 1P60A 5IG2A 3T9BA 2HYDA 4WLUA 3WKCA 1GGFA 3TCXB 2V1UA 1BVHA 5G1PA 1YQQA 3VYTB 5BSUA 1NYQA 2IH5A 3GJ8A 1YIDA 5AOAA 3NNNA 5T8KC 4WBNA 2GFQA 3CH7A 4AKHA 1TDJA 2H7VA 1NLMA 3ECAA 3ISTA 1R8QA 2OYRA 3ESAA 1O96B 1QE5A 2AG5A 3K6SB 1GPBA 1Q1NA 5GVRA 3KZXA 1CJCA 3PBKA 4C4TA 4AKGA 1R0WA 3ILXA 1TCAA 1OXUA 1VIMA 1CPYA 1MB9A 2ORWA 3W2EA 1U3VA 2AFIB 4MKIA 2NXJA 5EJ9A 3WYFA 2ARKA 5FWNA 1M6VB 4LJYA 1VJRA 2ID7A 4W7IA 3CMCO 1LNZA 2DFTA 2JAXA 4HEHA 4TROA 1JJ7A 2EJUA 4PAWA 3U80A 2WHRA 4BB0A 4RGYA 2B4YA 5HP4A 5A3SA 4HNHA 4IIJF 3UMSA 3EZNA 2IXDA 1YVRA 3DBVO 3NWEA 1QFYA 1ICEA 1NBIA 1T5TA 3WLQA 3GLGE 1Z47A 4DKJA 2LCFA 1OV4A 1UP4A 3GDHA 5ETJA 1DPFA 3C14C 2XGJA 3I6QA 1N25A 3SZMA 4B3MB 3S28A 3KB6A 5EUBA 5HDQA 4TUYF 3IOEA 4HJXA 4PPYA 5C8YB 1L7AA 2YC4C 2NV0A 4IPTA 5HF6A 1Q19A 1OFGA 3M4ZA 1GILA 4YONB 1H9CA 4AO7A 4LJAA 5JNUA 2BFOA 4TL8A 5AHOA 3VHXB 1HC7A 1L3CA 1P3DA 2CW5A 4IH1A 4AP6A 1NVBA 2YC2C 3G2HA 4DCOA 1DXHA 4M60A 1VJGA 1LBIA 1UOEA 1QHHB 1QYDA 4ZK2A 2C2KA 1C3JA 1I7LA 2CFCA 2J6BA 4NRDA 2H4JA 3IOMA 1UINA 1UKEA 1WNTA 3QV1A 3HB7A 5HR5A 3ETDA 5CCXA 1FSPA 3SQLA 2ACWA 1XZFA 5F9FA 2VDJA 1XTUA 2FGKA 3VR6H 1SXJB 4EL5A 1O0BA 3AUYA 3AXTA 3QGMA 3K71B 1EK0A 4J07A 1YIOA 3E35A 1U3WA 3HUFA 4CF3A 1H1LA 2HSZA 4QHYA 4PFJA 1LS6A 3HCNA 2X7HA 2L18A 1NAHA 4OBBA 2A0YA 2RJNA 3DB2A 4D0NA 4UAVA 5LKRA 5JH7B 4RZ3A 3E4CA 4L0CA 3M82A 5CB4B 2C78A 3VR5D 3CG0A 3JR7A 2I3DA 1PR6A 1J2RA 1TVKA 3NNDA 3PC6A 2ZUDA 4FZVA 4XASA 1OZFA 5G0UA 4KXQA 5K1ZA 1OHHA 3C8UA 4DCGA 1D1TA 5KJFA 1J5XA 1NVFA 1Q2UA 1XTQA 2FRVA 1C50A 3QKRB 4PHFA 5C5DA 3MCZA 5EXXA 3KSAC 1QX4A 2C5GA 4P4SB 6ADHA 4QM6A 2BHLA 2ZPAA 2DPXA 5EINA 4KWCA 3VKGA 4H17A 4Y2RA 3A14A 1UMCA 3EYAA 1S2NA 2WIKA 4EMTA 1IHPA 5AKJA 3I2YX 2LGJA 6PFKA 4J1TC 4KHPB 1P8JA 1BVRA 5DGXA 2ZVDA 4R2KA 3PD1A 4FZRA 1Y1TA 3R4VA 5TV2A 5L4NA 1IK6A 1FS5A 1WCV1 3KVVA 3A1NA 5M34A 1ZGBA 3W05A 2FPPB 1W88A 3I53A 3TZQA 1TVCA 3OBIA 3E9YA 3JYNA 1IZ0A 5EIOA 1SVIA 2H07A 3VPBA 2VZ8A 4FNGA 1HEUA 1NZFA 1DBVO 1QGOA 1ZM2A 2GASA 2AN4A 2N9UA 2Q0HA 2VJMA 4HHEA 1WUKS 3E7XA 4HQRA 4R31A 1AN9A 2Q3DA 2X2PA 4UNRA 3S1LA 4ZCSA 3S7ZA 4JU8A 3PUXA 4S2UA 3X1DA 4XQEA 3MCUA 1MB3A 1UMDB 1G66A 3LDUA 2AZMA 3NR2A 2JC3A 3GAZA 5L6MB 2PMEA 1ETHA 1V37A 1KFJB 3IB3A 1TK9A 3FMPB 4PYMA 4XOIA 1DOZA 3RGWS 1KVQA 1PFKA 1MAAA 2FR1A 3CLKA 4ONEA 3ZDEA 3JD3A 4WBXC 3J80A 4IDAA 5DTJA 4RY0A 2W11A 4E88A 1OPRA 4N6OA 3NOVA 4QUHA 4TTSA 4DC0A 3Q88A 4AY4A 4OSOA 2HQSA 2VPIA 5FNVF 2C2YA 1U7OA 2IQ5A 4KAAA 5CX4A 3V7FA 2D1TA 3RSZA 2W7TA 5BUCA 1N8NA 4UAUA 4DV4B 2W6MA 4LTNA 1O96A 3NX4A 3QOYA 4OB7A 3K6SA 2O0JA 1KVTA 2VDOB 3RARA 4A8JB 3NHLA 4W5NA 2C0PA 1V3QE 2X8BA 4CKZA 2RGGA 4Q0MA 1M6VA 4JOSA 5JSFA 4HCJA 1KI9A 3TQOA 3PXEA 1D5CA 5ERGB 1FDOA 1JKJB 2Q6TA 4TRJA 1KHTA 3HXTA 1W48A 2N1MA 3DS8A 1M8PA 3D2LA 2J6HA 1ORRA 3PA8A 2AR0A 3B1WA 3WV5A 3IAM6 1GTRA 1X19A 1E2GA 1U0HC 1H5NA 4TLEA 3FETA 1M1ZA 3CUSA 4GKBA 2AXEA 5FL7A 1XZIA 1W0JA 3OPYI 2G8NA 4XUGB 5C8YA 2G9VA 3ENNA 2GDZA 1N2JA 3RBXA 2LDBA 3A7DA 3B1XA 5I5EA 4N4AA 3VHXA 1XE3A 5EIWA 2DT8A 3O38A 2YL2A 3H9EO 3HCOA 4NQRA 4GU5A 1N33B 1FTNA 4HX5A 5DHTA 1QHHA 3P0FA 3SFZA 2XRFA 4JVSB 2WWRA 2I3ZA 3KR1A 4EY3A 4RVCA 4P33A 2J3DA 3D7MA 1E2DA 3BHIA 1KMHB 1JJAA 2BZ1A 4DXAA 1Y8AA 4OJMX 3W5SA 1SXJA 4KQMA 3TSZA 1CLEA 2FPWA 1JL3A 2HSJA 2QMUA 2H5JA 3NBAA 4FWTA 2GN8A 4Y67A 4POOA 3KSDO 5DXJA 3UWMA 1R8JA 2KE5A 1MC5A 1HNNA 1TW2A 2YZNA 2EGUA 1AXEA 5DTMA 3FHLA 2XB4A 4DEVA 2AHOA 4FFNA 3R7LA 3SQWA 1ZUHA 4TMZA 1NYTA 2QVCA 1XA3A 5CDFA 5EE9A 5JH7A 1DX9A 5K3SA 5CB4A 2IH2A 5BYBA 3QSYA 3GRAA 5HUHA 2PUAA 2QL7A 2XTJA 4BNDA 5GTDA 3RS2A 4B3XA 2G28A 5DTEA 3LQ2A 5FI5A 1PQUA 4FHEA 1Q0ZA 3QKRA 1E4YA 4MIKA 5FBLB 4NNPA 4P4SA 5BSMA 2QR2A 2PSSA 3WGUA 1ISFA 4L50A 1V1RB 2HDOA 3KD3A 3TTVA 1SVUA 1KXJA 1OGIA 1XZJA 2PRKA 3RS8A 1V25A 4M7PA 2FMXA 5A4AA 4MICA 5GADl 1DTWB 2A8YA 2HA2A 4EGCB 2F3RA 3OT4A 3BWMA 1PS0A 3LK7A 4I1SA 2K2WA 2EQ5A 1T3ZA 3H1GA 5AJXA 2A3NA 2D4AA 2HA4A 3LUBA 1VI2A 3G7UA 3FNBA 1IDOA 1P1FA 5IARA 3PNKA 5CM2Z 2CYAA 5FFFA 1KNQA 2FPPA 4PLWA 5JAQA 5TT1A 2GPAA 2H9IA 3WI7A 3DV0B 4LVUA 3UGTA 4EARA 4HGZA 1IN7A 1ZMTA 3PDIB 1UWKA 1Q22A 2HRCA 3AFNA 2VBFA 4RZXA 1VLJA 1X14A 4P5DA 1L4MA 5LD2B 2UUCB 1QYWA 3GH1A 3G5TA 2QTHA 1Q7BA 1XRRA 4L08A 2HHAA 2TMKA 3D2CA 2RB5A 3T7TA 3WRXA 1V5FA 1UMDA 3K4QA 3L0SA 4DZTA 1E2LA 4H31A 4IMPA 4BQOA 2HOQA 4QASA 3AEUB 2F8SA 4Z8XA 4KWIA 3HZHA 1U2SA 3QW4B 5IKMA 1SY7A 2A84A 3S8EA 2BEUB 3EHDA 2V8BA 4KE7A 3HLYA 2BTOA 2VP5A 2X58A 1M8FA 3H0EA 2ZJ5A 3SS7X 1TX4B 3U31A 3WLTA 5F7OA 4HDAA 1HTBA 3N75A 4Q15A 4GO1A 1H6AA 2QRKA 1OR8A 1GRNA 4PLPA 3TIVA 4OHXA 4HEJA 3K9QO 1R5BA 2RHRA 2COUA 1JXOA 4GZMA 4A8JA 4WOPA 4YQFA 5BPHA 3QFHA 2UU9B 2CDCA 2PK3A 2XDYA 3CZMA 1CJKC 2ODTX 5TE9A 4ON9A 1NT2A 2AEJA 2LP4Y 1Q0RA 3MGAA 3HCDA 2J46A 3DQQA 4JGBA 5IAOA 1JKJA 1RLOA 2O50A 4MR9B 5ABPA 4YAJA 5A5DA 3ZHRA 2H2IA 4ZI7A 2O8EB 5TGTA 3P2YA 5K3EA 1L4YA 3RI3A 4B47A 2CGEA 4XSHA 5G4KB 3CZAA 1CG6A 1M6EX 1YZHA 3C5WP 3PFIA 4MGEA 1KH2A 1NUTA 4DJFC 2VJQA 3ADBA 2QLBA 4F8YA 3IUPA 5EXPA 5KVVA 2GBLC 1T2DA 1AUPA 1PTKA 4P7GA 3TUIC 1C0PA 1M5TA 1MT3A 5ER9A 1MJ5A 3UJDA 3TL3A 4AWAA 4L76A 5L4LA 1UBJS 1ZMRA 3U5ZB 1XNRB 1T8SA 3T8YA 2HMAA 1KETA 1ZCJA 1ZHHA 1FFCA 1VBFA 2FG6C 4FHDA 3ZHTA 1U31A 3A32A 3BRSA 4M1OA 5C0OE 5FEUA 1TA4A 1Q0TA 3Q9NA 2A1TS 5L4SA 3FKQA 1IAVA 1U11A 1ELOA 1S2LA 3M5CA 2NXNA 4IFTA 4JI6B 1YL7A 1KMHA 2VPWA 2Q0XA 1NKSA 4O6VA 4PTLA 2AJCA 2Y8EA 1WOYA 2A58A 1EXMA 3IEPA 4CQMB 3PR3A 4D9NA 4Z51A 1DINA 1WS6A 1EESA 4ZMRA 2HQ1A 2Z58A 3W6NA 1GZ4A 1PZNA 3S2SA 4BZQA 1QO7A 1GM5A 4OJQA 3SHVA 5FH9A 1UEXC 3D02A 1MV8A 5AVKA 1Y63A 2XBMA 5KNDD 4XWGA 1UWVA 3IIMA 3ILYA 4OIMA 4EVQA 2IXAA 4RLSA 4GECA 5TQ0B 5K03A 2VJPA 4P3NA 3S2EA 4UDXX 4IV5A 4TQAA 1UPTA 5E4TA 1XCBA 1T1IA 1XTPA 4IWYA 3ORQA 2YN0A 4TLMB 3BHNA 1MA3A 1W5AA 1X8XA 1R37A 2EF0A 2Z43A 3PLNA 3UK6A 1EK1A 5ICMA 5ITWA 1PYOA 5A1JA 4TRRA 2SICE 4ENPA 2O2JA 4K1XA 2DFVA 2ZXFA 3ASUA 2PSFA 1CULC 1ID1A 3NYIA 2SHKA 3EA0A 4FZ5A 1CQWA 5HMMA 4ZJPA 2PZFA 1V1RA 3NXSA 4WLEA 2IXTA 1JE1A 3L7YA 4TQUS 4F1KA 1RWPA 2BGMA 2XKBA 1RYEA 5EJ4A 4N8SA 1H0SA 1H0RA 2A57A 4G1VA 2IWHA 4G01B 4RVSA 1UDBA 2AMLA 3KTAB 1EDBA 1DTWA 3B12A 2YWGA 5D5PA 3L1JA 4EDFA 1I24A 2AGVA 3MJRA 4N3GA 1B42A 3MOSA 4PLZA 1FFBA 5H7XA 5FTMA 4NXMB 2WPDD 5LVAA 1PGPA 3CQ9A 4WXHA 4B9AA 1I14A 2IYNA 2HQOA 3QBJA 1HFWA 4Q1VA 2K6GA 2WJZB 2ZTLA 4OQXA 1T6ZA 4WZBE 1B8VA 1QR2A 3QENA 3IR6A 3DV0A 3G2NA 5J43A 3W3AA 1KU6A 2ICAA 5ED0A 5ALSA 4M86A 3PDIA 3CSUA 1TZKA 1U1DA 3HVIA 3JAKB 2HO4A 3MAAC 4UUNA 5E6UA 1XROA 1TKBA 4B09A 1I2MA 2R1UA 2I91A 3Q5EA 1VMDA 3CW9A 3QMWA 2YVUA 4M1TA 3M3HA 3PLAE 2ZRKA 1MFZA 3A3NA 2ZPUA 2XYVA 1E20A 3EZ7A 2PLAA 5AK4A 2QQ0A 2E55A 2H7YA 4EHAA 2QTMA 2EFGA 5E4YA 2LE0A 4PPGA 4CGYA 1KAOA 2DLCX 2BEUA 2JGNA 3QVSA 4Z1OA 1XU9A 5LZ8A 5REQB 1RLUA 4H3HB 3KAKA 4Z53A 5HE8A 1N2IA 4HUTA 1JDZA 2P0EA 2CL5A 3KZNA 4N48A 3VI4B 2CV1A 4J16A 3U3XA 2ZUUA 3LP6A 4YXFA 3E82A 4UARA 4P3YA 2P77A 1BQ3A 4MUFA 2WTAA 4QELA 5DCYA 2Z5GA 2AS0A 5LZ5A 3RCBA 3QX9A 2LD4A 4PPQA 2WPNA 2FP4B 3FSJX 3RVJA 2AHRA 1U9IA 5U4QA 3OFND 3PGJA 4JLBA 3O8RA 3E22A 3IUNA 3EVCA 5ED4A 3CZCA 1ZCAA 4F6RB 4MR9A 2DM6A 1D4ZA 2HF7A 3RSOA 2OV8A 1UBTS 2O8EA 4RCYA 1KMIY 4BVHA 1OTHA 1DIGA 4RDXA 4P4TA 3RC7A 5G4KA 4M6WB 4H60A 4IBOA 3EC2A 3F8TA 2QI9F 3HU2A 3LQ1A 3UWDA 1YUBA 3ASVA 1JLLB 4OQNA 2OK7A 5AJYA 4CF5A 5H1YA 4ENUA 4B0PA 5SZJA 3OLXA 4I8DA 1ONPA 2VOEA 3RYTC 5KPJA 4UUAA 2MSKA 3ND7A 3QYFA 5FPYA 1GUAA 2CK3A 2XCOA 2WV9A 4BRUA 2HDWA 1YKGA 5ALQA 2PS0A 4CIAA 2WINI 3TDKA 1TKRA 2ENUA 4EG5A 3BZWA 2I65A 1Q14A 4JT9A 3R7DA 2JGFA 5HVNA 2G0TA 4QUBA 5FYDA 3RTBA 2R6DA 1DZIA 1GT91 1PV1A 2DUNA 2ZTUA 4KQJA 3FOBA 3WWZA 5IULC 1B74A 3CH4B 3SZUA 4C3OB 4CU2A 1XZHA 1F7UA 3QIAA 2F90A 2IITA 4KAJA 1M34B 3GZTB 4II7A 1K2WA 1C7QA 2BISA 3HM9A 4D25A 5CM8B 2M6SA 2RB4A 5EZYF 1YL5A 3N8DA 3W8FA 5I9SA 5BV2P 4YX9A 1BWSA 3JPYA 4CQMA 5IWCA 2FEPA 4L9RA 3EGIA 1NBMD 4LRYA 2YV1A 4C7OA 5AJUA 1KFEB 1SKYB 1GZ7A 4NCHA 2UXBB 1YVDA 1N6LA 3PD7A 1SVMA 3NVDA 4OMFG 4U0JA 3FUVA 1VL2A 4JLOA 4R0MA 5FUWA 2OORC 2HIAA 1Y3FE 2KQUA 5JDCC 5TQ0A 4AKSA 1W5EA 1NM5A 3TW8B 1EFPB 3EX7C 1LS1A 2DULA 4Y6SA 4JI5B 4DE5A 5DGHA 1VJTA 4KNVA 1SD2A 2P35A 2CJYA 4FBGA 3T4PA 4F3TA 1Z4JA 3OPYB 5HYVA 3DO6A 2CLLB 4JBIA 1T2EA 3MB8A 1OBOA 1ZP6A 2VT3A 3BFKA 4UCQA 3SBOA 3UAGA 3UTCA 4C14A 4M2LA 2I7DA 1YC5A 1C80A 3EARA 4BZPA 2VAPA 5IASA 1M1YE 1ABBA 5DCWA 4RELA 1WXFA 2YOGA 2XWJI 4RTLA 5LUAA 2OZLB 3WBKA 3L4KA 1V8ZA 2YWHA 3JQAD 3OPQA 4C05A 4BO3A 1HTWA 3L82B 2RGEA 1UANA 3KTAA 1N2HA 3I9V6 2D8MA 3NIDB 2CV0A 4KFTA 2QHXA 4DCSA 1BN6A 2KLBA 2FWAA 3FVWA 3WK9A 4ALMA 3K0SA 1RXCA 4GOMD 3PRKE 3GA7A 4HAOA 3D64A 1P2DA 2JA2A 3OIVA 1H6DA 3GFQA 2NVOA 4PLFA 5LU9A 2ZUEA 3EUEA 3UMMA 3ZV4A 1NXVA 3SOPA 5E9QA 1KFKB 1RAFA 4NK5A 3TRJA 1QPBA 4YPOA 3U7HB 1E0KA 3T99A 3JAKA 4MA5A 2A0WA 4GGPA 4DUPA 2C9CA 5ALNA 5HIIA 5ADWA 3ANNA 2FQWA 3HVKA 3I1YA 4QOSA 5IEBA 1FMLA 1K0UA 1SFRA 3I04A 1CX9B 3HPRA 5G3YA 5IT9A 1Z07A 5I8ZA 2P9BA 4G0QA 5AKXA 1NR5A 4F85A 4JLNA 3TCKA 4QEKA 1FL9A 1XRJA 2IHUA 3DZKA 3KKMA 9LDTA 2XYQA 1UBEA 1Z28A 3ROQA 2OCXA 1OBHA 4ZO8A 5BNFA 4BB6A 5KKNB 2J48A 3IT2A 3CXRA 1VJ5A 2ID9A 2IF2A 2WFMA 3ZI7A 4ZYXA 1HR0B 3D1JA 2A35A 4MEJA 5ARDA 1ADBA 5JASA 3OZEA 4LA4A 1WBJB 5REQA 4GMFA 4GX1A 4LVCA 3OE4A 3QNUA 1BHJA 2WRZA 5A0VA 3DONA 4ND5A 2QSZA 2GSWA 3ZWBA 5IFKA 1ZQ1A 1ORVA 5DTQA 3COZA 4DY4A 4TTRA 4OQMA 4J6EA 4MRAA 4UATA 1NUHA 3BWEA 4D56A 1E6WA 2IS4A 1GAQA 2IPOA 3U1VA 5BSFA 1D2CA 3C8ZA 4IHQA 2FP4A 2PL9A 1Y7LA 4QAJA 3K30A 3L7KA 4F06A 5C1PA 1B0UA 1UXIA 1NNUA 1FLVA 2CE2X 1OWLA 2G9QA 4PS1A 2OCKA 1W93A 3HO8A 3C87A 4F6RA 3ZE6A 4PCAA 1UBCA 2JARA 5D5QA 2DHQA 2OMEA 4NZOA 3H3FA 1LFAA 4CV2A 1SJ9A 4FLFA 3RBAA 4CKEB 2CLHB 2ZJ7A 1N5OX 4M6WA 2WYVA 5C9ZA 4Y3UA 3H5IA 1IQPA 1X9GA 4E03A 2K87A 1XZDA 2UYQA 1Z08A 4F4CA 4JMPA 1JLLA 1HXHA 4JR2A 1E3TA 2VXOA 1UZAA 1FNDA 4OOFA 2PVSA 3ZNQA 2XUIA 3BH7A 1RQ2A 2EWVA 3MG9A 3U2QA 4QZVA 2AI2A 4J1SA 2Y0DA 3LUKA 4QO8A 5KAMA 3LL4A 3HACA 4RD2A 4D4MA 1TRHA 2QRUA 2ZYHA 3V4RA 1SRQA 1OHHD 2WD8A 3BHJA 4PINA 3UH1A 3TTXA 4EW2A 1M8JA 2CHVA 1UKCA 1KO5A 4OKSA 2VNKA 4DAEA 2PKEA 2R48A 2N42A 4LRWA 4ZYLA 4JC0A 3GPLA 4I1YA 2AK3A 4I9GA 1M34A 1J21A 4DM4A 2OY0A 1PJTA 3OJCA 2ZCUA 1K9VF 1DV2A 4MYCA 3TJZA 1TE2A 2O3RA 4AB1A 4HFNA 3DBHB 1JG6A 2D54A 3CJRA 3LYUA 1X7GA 4IP0A 1NQTA 3OJWA 4JT4A 3QKIA 2GAFA 3LS2A 3LBNA 4P2GA 5AOVA 3W1EA 2QTZA 3PHIA 3K5IA 4WVLA 1U2QA 1T9DA 3NORA 2VUTA 2WJ6A 2Z2JA 1HT3A 4ZYTA 1KFBB 3LVFO 3TW8A 1EFPA 4TTAA 5ARCA 5ICFA 3PDJA 4RDIA 2P4HX 1XQ9A 4FS8A 4ZYYA 4XM0A 4C3ZA 3K9NA 4V0RA 2FSVA 1D8TA 2O6HA 5EHXA 2BM1A 1NTRA 1UJ4A 2DUMA 2XB9A 5HF8A 2XUZA 1ORTA 3KOUA 5CLFA 3DZCA 5AK3A 2HDHA 1XIVA 4HPJB 1D04A 4ILKA 3S27A 3AJ8A 2NUPA 3ORYA 2H1LA 1N57A 2NG1A 3DTTA 3R6GA 2GEFA 4NENB 1FYFA 1U0LA 2D1YA 3PC7A 5FTLA 2OZLA 3HVJA 4QDUA 4D9JA 4H9GA 5I8PA 5CLJA 2X5JO 4RYLA 1EBBA 1JEDA 2AFVA 2AFIE 4RO0A 1C8VB 4NTZA 2MHCA 2OXRA 3UKOA 2WQ7A 4ZQFA 1MZPA 5FOWA 1GV1A 1ZZEA 3LCRA 4ZTBA 5EMMA 5JQGF 2QX4A 5AW9A 5J2UB 3O5AA 2DHRA 3B6MA 4WI1A 4Y6QA 5EHGA 3W9SA 3NBFA 3CJTA 2IK8A 2YV4A 1GNLA 4B2LA 2GBPA 3IR5A 2G88A 1P9NA 1WMBA 2OSBA 5FRDA 2QKYA 2BM9A 2BP7B 4TVBA 4Q37A 5DRTA 3TQHA 2HPZA 2C4VA 1TF2A 4DQXA 4DV1B 4Q9HA 4Y6RA 2OD7A 2F1JA 4FPXA 4P80A 1RJEA 1RCUA 3OLYA 1MO4A 1UDXA 4BMDA 3S1SA 4MYTA 1HEYA 5T5QA 4RMIA 4PY2A 3QYPA 3GV0A 3BWBA 1DAGA 4BO6A 2JEOA 1KGSA 1OFIA 3UMCA 4QGSA 3DLBA 1C4KA 4UM7A 5FL7D 3ZE9A 4GLOA 4C0JA 3JQBC 1W0JD 2A1UB 4DC9A 4FZ3A 1OLOA 4JT2A 5EE1A 5DN6A 1FY2A 3FPAA 4TN5A 2P5YA 2FEKA 4FWBA 3DBIA 3LHSA 3WYNA 3ZE7A 5C53B 1IJFA 2Z09A 3TOXA 2AKEA 5IAGA 4OG2A 3T7KA 2VT7A 4IS3A 3SZ3A 4XX0B 3SZRA 2CVPA 4HWKA 4U5QA 1Q57A 1Z0UA 1D9ZA 3AZPA 1MN6A 3GRPA 4HG2A 2Q3FA 3VUEA 2ZS9A 5TSDA 4ZOCA 2ZRMA 3D8SA 4H7EA 1BXRB 4CUJA 2NZYA 1JR3A 2Y2UA 3D7NA 1SXJD 1T0JB 2YTZA 3EQ9A 4I1OA 4I5EA 1IBLB 4PW0A 1N77A 2NTNA 3BSYA 2ZI5A 5AK5A 2D06A 1KI4A 5F7XA 2J07A 3CYFA 5LC1A 1AB5A 2I03A 1R8SA 3EG5A 3L0CA 4W5OA 3CRRA 4C06A 2MOKA 3P97A 3T3HA 3MJVA 1GPAA 2FMHA 4CKEA 1FLDA 1GSAA 5FUMA 1UOOA 3ZS9A 4MVJM 1F9AA 3H5OA 3VVLA 4PO3X 2A9FA 3UFXB 3QUCA 1YA4A 3OFJA 5EHNA 3EXG2 2R8YA 4WBNF 1ZK2A 1P1HA 4KFSA 5AP9A 1E1LA 3NC0C 3X1JA 4CMJA 4EGFA 5B6JA 2R6ZA 3TQFA 4FEGA 4GYJA 2IRWA 4QWMA 4YVFA 4LHWA 2I1VB 4DCMA 3OT1B 1GNPA 4YEDA 1IXKA 1I7DA 2J3KA 2BBSA 3FUXA 4KYVA 2KJQA 3SXJA 1IH8A 5HWSA 2J8ZA 4KHZA 2FRXA 3LM8A 1FS6A 3G49A 1ORHA 4JELA 5ECWA 3SIPA 1A96A 3IJRA 4YB8A 4EAQA 2BKAA 3QITA 4NMWA 3KT8A 5KC9A 4AM8A 3LY8A 3DT9A 4AJHA 2EDAA 1Q7RA 1S9DA 4KWHA 4TTPA 1Z63A 3L8GA 3DBHA 1Z0AA 2GZ1A 1ZC3A 1YBHA 1YCFA 2YJ5A 4W9NC 4IO1A 1KK3A 1CETA 3AC0A 3QBDA 4OHPA 3IQEA 3ZEAA 1JEOA 2DFNA 2XLCA 4KX5A 2RHOA 4QDJA 3GHYA 5EIEA 2IEYA 3EDQA 2KBEA 4LE2A 3TVDA 2VHEA 3W5VA 3AF3A 5B3LA 3RTGA 2JJ1A 1DIRA 5D5HA 3RTDA 3W9YA 2DUUA 3IUYA 1TUIA 4L7VA 2I2CA 4F45A 1XCOA 1WNFA 5LBTA 3TYXA 1A7AA 3K1YA 4MIOA 2RI6A 1ADFA 3DO8A 3V3TA 3ZEIA 5EJEA 4B3TB 1EIWA 2ZRQA 3ZNPA 2XECA 3F7MA 4W9MC 4EG1A 4KOEC 2JIMA 2QYOA 2BELA 4H3SA 1PT5A 2FPUA 4I5DA 4Q4HB 1P2FA 1IRXA 1P1RA 1Y9ZA 3E3LA 4RDHA 5TARA 1EMDA 4NENA 4UQOA 3ZX4A 3KL2A 5J40A 3WWCA 4LI0A 3RAPR 4G0XA 4DUZB 3MRSA 4EHLA 1DC5A 4AWBA 1BAPA 2Q4EA 3HLKA 6AT1A 4CUKA 5ALRA 1AS0A 3FRJA 2WAAA 4A9AA 3K94A 4C87A 1YJ8A 1CJUC 2PNFA 1U2ZA 2H63A 2YMPA 4PHTA 1V71A 2RAVA 4J0HA 4XLTA 1A8PA 1PQ4A 2QMEA 5FTKA 1A7UA 3HFSA 4EA9A 1KDVA 5J2UA 4X44A 5K0BA 1LDBA 3RWOA 3MJDA 1SBHA 2UDPA 4P93A 2HZBA 1FUYB 4IFIA 4AKEA 2A2ZA 2EGGA 2NV2B 3LHDA 3IGFA 1SQSA 2VPTA 1LX7A 3QVGB 4E5PA 2BP7A 4DT1B 3CTPA 2ZG6A 1KGDA 2QY9A 5GM1A 3IPXA 3W2FA 5KQMA 3RC1A 6ABPA 5IM5A 1M2WA 4AQ7A 3O03A 1D2NA 1H22A 2NSHA 1WRBA 1N7JA 1E9VA 3A1EA 1VMAA 4MV3A 4YRBA 1ZWKA 4UEQA 4YRJA 2Z95A 4A4DA 3S7TA 1SRRA 4IVPA 2GYVA 4KO1S 4OAQA 4QRDA 3LP5A 4DV3B 3IVAA 5EUCA 4A6EA 5KB3A 1ZI9A 2QLNA 4PFSA 5K6AC 1V5IA 4AJ2A 1GUDA 2EKZA 2XZOA 1Z6XA 1PV4A 1N4DA 2NXWA 1JU9A 2JH8A 1GZHB 3AHIA 1TZJA 2A1UA 2HPHA 3GPBA 5GJVC 1LKZA 1G17A 3SLGA 3U5TA 3PC3A 2ZSUA 5BQOA 3AR8A 4RVOA 3GN2A 4EABA 2B6NA 2FG5A 3ESRA 3VR6D 4WVFA 1MT0A 2JLQA 3CF0A 4IEEA 2R25B 1E1KA 3GVHA 2ANBA 3NNSA 4XX0A 2E4XA 1CTQA 2IXFA 4U2DA 2ASVA 3O9MA 4G4JA 3RVLA 2DBYA 4CT5A 2NNLD 4HZIA 2B2NA 3CIOA 1FC0A 4LXHA 3SM9A 2XJ9A 4IKPA 4DQLA 1FQJA 2EFJA 3EA4A 4QDOA 2R5NA 4WESB 5IK2D 1JFSA 1XP8A 1C14A 4I36A 4GC9A 4PQEA 5BW8A 4V0SA 4QLBA 2J3IA 3BB4A 3P26A 4KUEA 5DNAA 3OWOA 3FE2A 3QOFA 4IRMA 1IZ7A 2QJRA 2QRMA 16PKA 3TLCA 4TLCA 5JCXA 2QYTA 3M9LA 4JEIA 4J0FA 4L9AA 4LHYA 4XXHA 4K6KA 3UFXA 1XXHB 1AA6A 1NP3A 2IZOA 4A92A 1JAIA 4CXMA 1T8WA 1J8MF 1II0A 2OZEA 1NOJA 1CWUA 4CN8A 5DISB 4IDQA 3CNQS 1ZNYA 1V16B 1Q5PA 4UHKA 4MINA 2ETVA 5KEIA 4OLAA 1ZAKA 4HYYA 3OT1A 4J0JA 5BO5A 3SJBA 2BT4A 3ZKAA 1S01A 4KSYA 4ZAGA 4B4UA 3K70B 1B8UA 2H18A 2Q1YA 4QNNA 2ERCA 1FDSA 2OXIA 3R0IA 1J56A 1OLSB 5IBRA 1GVNB 2QMQA 1DIOB 3KUCA 4OUDB 4R7ZA 1D1SA 1HE5A 1G8KA 2A92A 2WJHA 3KB8A 2QTNA 1HLPA 1N5RA 1RE1A 1XZAA 3OF3A 1GRRA 3QVLA 4PR0A 2WWVD 5IC6A 1N78A 2PBFA 3OZUA 1U0NA 2AA3A 1WB6A 1BXGB 1E6KA 1NLFA 2FFJA 1QFSA 1L7XA 2DCUA 4R8SA 3VC1A 2C8JA 2PGJA 3PXDA 3H6HA 4FYKA 3W3AD 3I61A 3AGPA 2IZ1A 3EPPA 3ROGA 1O9HA 4FDTA 4EB6B 3E3NA 3NEPX 3W2TA 1IY2A 2EFDB 1V95A 2QX7A 4XJVA 3AL2A 4U39A 1AXRA 3KV1A 5DM4A 2I4RA 1Z62A 4Q4HA 4OHRA 3EIHA 3ELWA 4PLGA 1YBAA 4LTDA 3IQDB 4OHFA 5AM0A 3EAFA 3L49A 3ZE0B 3MUEA 4NCAA 1RJGA 3DEIA 1GN9A 2A9VA 1M1UA 4FCWA 1V8BA 4YN3A 1YB5A 1SUBA 3H4IA 2TMDA 1FDTA 1T9GS 1CR6A 3GFOA 3KXDA 2Z98A 4R2MA 4PZLA 1KPGA 1I6KA 4ZMSA 3R0XA 2XHZA 3HB4X 1CF9A 1SWWA 2WI8A 2WUVA 3JS5A 4G0YA 5CITA 1JFFB 3OVMA 2Q5IA 3CR8A 2NUAB 1KSJA 5JH7F 3QF7A 2WR8A 2WWHA 2RJ3A 3RRNA 2XMQA 2C0CA 1JI3A 4PLHA 5CB4F 3FCEA 3AMVA 1DG9A 1HRKA 4MO2A 1FRFS 1YZKA 2UXDB 3QVGA 2P6PA 2X8WA 2M6LA 4DT1A 3Q15C 2EIXA 4RD3A 3UMRA 2HPAA 5D7BA 4CFYA 4HO1X 4D74A 1P0CA 4Q01A 4EMSA 4CKCB 1YFJA 1Q7EA 1UJNA 3RHTA 4J0CA 3RIMA 3U7QB 1B00A 1X3SA 4YFVA 3P0RA 3CISA 3RF6A 3ZTWA 2WG2A 1SQ0A 2HF9A 2P9QA 3FKSA 5B64A 4FIDA 5E3IA 1NE2A 1SEVA 4IO0A 4CT0A 4YLYA 5KWEA 3B9BA 1OXXK 4MIYA 1WEHA 3PPIA 1JQBA 3C3YA 4LXXA 5BUSA 8AT1A 2LIPA 3RK0A 1DKMA 3J7TA 1HFKA 4LDQA 1B1CA 4FE3A 5E3JA 2PA0A 4XKJA 1BC5A 5CNKA 4B3GA 4KLCA 1Q1BA 3EXHC 3VA7A 3OJ0A 3ORRA 5JDIC 2C7VA 2ZLBA 3SFVA 4L22A 2WMNB 4IH4A 2RGXA 3D31A 4QT4A 3IEUA 1O58A 1E0JA 1F4VA 3MCWA 3OM8A 3D54D 2GI4A 2QNIA 1E64A 2W6NA 3GEMA 2YXDA 3ZWMA 1Q3KA 1U7PA 4U6NA 1VHTA 3WLEA 4F71A 1OIVA 2BJWA 3R5SA 1KJIA 4RK5A 1TM4E 4HAVA 1CE8A 4BN0A 5TF0A 3DDSA 2VJAA 4WESA 1MJNA 1AGPA 1ZA2A 2YUIA 2WIDA 4OY3A 1SHZA 1I51A 4CQMD 3PNMA 4MA0A 2NGRA 3TTUA 4HF7A 4NHEA 4DRXB 5BWCA 3WGTA 2AVDA 3F4BA 1HRDA 1L3BA 3MOGA 5EPEA 3PJEA 1U5BB 4M89A 4YH1A 1M66A 3KQMA 1PW7A 3F9RA 2BUBA 5JPIA 3V1UA 3ETHA 3I37X 3ADOA 3HR8A 4DAOA 5A7FA 3CINA 3FCSB 4MAAA 4JSTA 4H0CA 2IY8A 1XXHA 4DLPA 4HEA6 2WICA 5TB5A 2C9OA 4R5HA 3TB4A 4XQ9A 1LF0A 1NW7A 4CG3A 1ADGA 1O9BA 4DJDC 1VG1A 2VP4A 3HABA 4KVFA 3WBBA 3E3OA 1V16A 3E8XA 1OAOC 1WMFA 2FXVA 3E5NA 4K03A 3ISVA 1I0LA 1OIXA 1U2GA 4XWTA 3IODA 3UF0A 1SN7A 4LBZA 1NX6A 1JAXA 3EIXA 4N39A 4FBLA 2X41A 1EVEA 5AJWA 3OCYA 1NUPA 4A8PA 4IDEA 2HF8A 2Y3IA 4V24A 1ZD1A 4WW0A 1OLSA 3VSDA 3B6KA 4X60A 3GP3A 3TUZC 1RI1A 1Z2CA 3GJ5A 3LCUA 4IOKA 4OUDA 4R2XA 3TE6A 1ZCBA 2DRIA 3QTBA 1O95A 2KW5A 2FWBA 3JVEA 2WU3A 4E22A 2Y1DA 3KHUA 2C4MA 1XVVA 5DHUA 4DY6A 1PZEA 3RC9A 3IPCA 3UTDA 1Q1GA 5CT5A 4BGVA 1BXGA 2DLDA 4C21A 2P7IA 3LQQA 2AUNA 3FTDA 2F59A 4CPDA 2J0QA 2R7LA 4UOEA 4QARA 3Q9SA 1WL8A 3ZU6A 3ZHCA 1O97C 2C2ZA 1X86B 1ZLXA 1QONA 4KBFA 3WWYA 4OXQA 5BNIA 2I2BA 4TGLA 5DM2A 1WUJS 4Q3NA 3MCAA 5FPPA 4EB6A 3CRQA 3M4NA 5T6BA 2BFDB 2EOAA 2CFRA 2SBTA 4YS6A 2LDXA 5LZ7A 5AM2A 2ZBRA 3ZZ0A 3BZBA 2AH5A 3K0FB 2OBFA 4KODA 5JS6A 3WR5A 4DIFA 3T5AA 2V59A 1OC2A 1KBQA 3IP5A 1Z75A 4CI0B 2X13A 4UNQA 4M88A 2AJLI 1OA1A 4H27A 2O6LA 2FW6A 4WT7A 1YFZA 3VQTA 4BCDA 1CP3A 1JIUA 3GGSA 4HDMB 4JJFA 1PR0A 2IYUA 3VR2A 1KWGA 1VCOA 4FLMA 5DGDA 2FKAA 3BA1A 1OGYA 1JFFA 1VMKA 1JEEA 2HTFA 4WD3A 1GDDA 2NUAA 5JMOA 1BE6A 1TA0A 3DWEX 1KDZA 1IBSA 4AU1A 1Z4IA 1Y33E 3AF0A 1QHNA 3A1FA 2Q6OA 4MKGA 4OK3A 1GKLA 3HCEA 2R68A 4RQBA 1OH6A 4LTMA 1KDYA 3DC7A 1E3DA 3UCEA 1PDVA 4X1YA 1E1QA 3KKNA 1G2PA 1WU7A 4HC4A 4AUMA 3EEYA 2QSUA 4CKCA 1AZLA 2XRYA 3H9UA 4QE3A 3U7QA 1RKUA 1USVA 4BCCA 1HNWB 2O48X 1Y7TA 1GU1A 1HEIA 2BHTA 2W58A 4WV3A 1WAMA 3KQSA 4EJSB 5LOVB 3HYCA 5AXAA 2PLRA 3L4EA 2YBEA 4MNTA