1PX0A

Crystal structure of the haloalcohol dehalogenase hhec complexed with the haloalcohol mimic (r)-1-para-nitro-phenyl-2-azido-ethanol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 88
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1px0A00
1E0DA 2DU8A 2PZKA 3RC9A 1M66A 1SB9A 3F46A 5EINA 2OFPA 2NM0A 2X6TA 2DLDA 2BD0A 1K89A 2BI8A 1ENOA 1MG0A 4J16A 3X2EA 4DTIA 3OQBA 3HN7A 4MP3A 2DAPA 3QVTA 2XAAA 4PCVA 3H5NA 2C2XA 4IXWA 2FPGA 1HKUA 3PYMA 4HP8A 4MVJP 3JYLA 5G0WA 1HEUA 4D3FA 2POQX 1WXDA 1XYGA 4GKBA 1MFPA 4AJ4A 4NBUA 1G0OA 1K2WA 1PR9A 4ND5A 1WWKA 3NAQA 5CEFA 1R6DA 4IS2A 2P5UA 3P7MA 2ZTUA 3D3WB 3EDMA 1JW9B 1KEVA 5JE8A 1DPGA 2GN6A 3ROQA 3PHLA 3GEGA 3GNTA 3UUWA 2OORA 3HNPA 3RUIA 4JK3A 1YOVA 3LDHA 5DCYA 2Y0CA 3DZIA 3BZUA 3VPGA 1Q7GA 3IJRA 3AI3A 2OHXA 4L4SA 4XGNA 3EAGA 1E3JA 3ZNQA 4AVYA 4JJIA 3L6DA 1N7HA 4UUPA 5LC1A 2D2IA 2YUTA 3I9JA 3R3JA 4LSMA 2GLXA 2ZYGA 4F45A 4E0BA 1HT0A 2OP0A 1IZ9A 1TLTA 1JWAB 1U2GA 4BKRA 4D79A 4FFMA 1NWCA 4DGSA 1QYDA 2YQ4A 3UGKA 4BO6A 4E12A 4WJZA 5AXBA 3DTYA 4E2YA 3PQFA 1H9BA 4IUYA 4UVDA 5BSFA 4R16A 2O4UX 4WECA 4RV9A 5JDCA 1AHIA 1VSUA 5CP8A 4Z6KA 1HE4A 3JQAD 4HFJA 4WLEA 4YQZA 3EVTA 1LRLA 1A72A 3F6YA 3AUAA 4Q3NA 2D5AA 1GYPA 1LLUA 4WKGA 1ENPA 1FF9A 2EHDA 4WLOA 1QKIA 3LZ6A 4ZGWA 4NIMA 3EHEA 4OJNA 4FD3A 4J7CA 2VNSA 2ZJ1A 2GERA 4MVJG 3E5RA 3UKOA 2EP5A 3DBHB 3GN1A 5COAA 5KTKA 2PD4A 1XSEA 3GT0A 1BRMA 3CMCO 3GVXA 3M6IA 3OQ1A 4AJPA 5IZCC 4HUJA 4D3SA 3WIDA 5IFLA 1L1FA 1AXEA 2DBZA 3A9WA 3MJTA 5G2OA 5A3VA 5IXSA 1A7KA 1YRLA 3G79A 4XQGA 4EEXA 3GGOA 1BW9B 1KC1A 1D3AA 1U4OA 4R1UA 2R00C 2O3JA 4UUOA 1KVQA 2CNBA 4GX1A 4TRMA 2DBRA 4DBZA 1KEPA 1V6AA 3PDJA 3W1VA 4R51A 2DT5A 1EVJA 1LRKA 2QRKA 3KEOA 3PGJA 1HYEA 1BDBA 4RPLA 1KEUA 2D0IA 4BNIA 3VHRA 5CEEA 3PIIA 4ALKA 4CQLB 3VZPA 1DC6A 1U5AA 3QVWA 4FFNA 3GDGA 1TEHA 2B69A 3AFMA 3G1TA 4B8WA 3RUHA 3C7CB 4GSKA 4R01A 4U6QA 3VKVA 1EDOA 5A5EA 1NBOA 5KOIA 1LC0A 2J5RA 1DIHA 4YA6A 4DMLA 3H8VA 4E4YA 3BHJA 1N1EA 1EUZA 4CLRA 2DFDA 3WTCA 1LX6A 4CLOA 2V6BA 3WGOA 1GEGA 3Q2IA 3IKVA 1WZIA 3W6UA 1ISJA 1MLDA 1LRJA 2GR9A 2O3UA 3OFSA 2GSDA 5L4SA 2EXXA 3QRWA 1B8VA 1ZJYA 4R3WA 3WSWA 2DTEA 1ISGA 3HWRA 3ADPA 3QA9A 1CF2O 3FR7A 3C1OA 3FNGA 2IZ1A 3KBOA 1QYWA 3K30A 3MOIA 3SEFA 2HMSA 2O50A 1DJQA 2B4QA 5F21A 2E48A 1E7RA 3OIGA 2YFHA 1SO8A 3WIEA 1B14A 1DFGA 3P2OA 2X4GA 2CVOA 2HCTA 4N18A 1C0PA 3VPXA 1EVIA 3WJAA 1YDEA 2DBVO 2UUOA 4NR0A 1ZK3A 4Z0PA 3PFFA 2G5CA 1DC5A 1EQ2A 4YQYA 4EUHA 2AXQA 3INTA 3O8QA 3V2GA 4CR6A 5BNTA 4ZICA 3PYXA 2GN9A 2PGDA 3OJFA 4EUFA 1T4DA 3ZCXA 2JCXA 4J2OA 2O3SA 3JQGA 3GGPA 3K96A 4CM5A 4B3IA 1V0JA 1MC5A 2QZZA 4FN4A 1R12A 1O9BA 1QLHA 1C0IA 4FJ1A 4OQYA 3DHNA 4TMFA 2JCVA 3GZNB 4DPLA 5ER6A 5AXCA 1F8FA 2NTNA 1QV6A 3TZ6A 5L51A 1OC4A 5TJHA 1F12A 3ABIA 3EGOA 4QSMA 4DQUA 4QTZA 1J5PA 3E9QA 2EP7A 4MVJA 3CE6A 1O8CA 1KVRA 3K2BA 2ZCVA 3M2TA 1VJ1A 1F8GA 5FI3A 1SEVA 2H1SA 4R54A 4DUPA 3WLFA 1UXIA 4TZTA 4A0SA 5HA5A 4R3NA 3RU9A 1FJHA 5JBIA 1AHHA 5TT0A 4NG5A 5EERA 1Z74A 1I01A 1QP8A 4IY1A 3STHA 4FC6A 3ZNOA 3E6AA 1OOEA 1KC3A 2AE2A 3KOUA 3GR6A 3UXYA 5TX7A 3WSVA 5K9ZA 3U5TA 2PGLA 3ASVA 3RUCA 4FCCA 5CDUA 4IXTA 4N5MA 1M6HA 3H9EO 5IJZA 3PYLA 5A3JA 4D45A 1NQ5A 1TT5A 2BFMA 3I6QA 5KJ1A 1I3KA 3WFJA 3MTGA 1NP3A 1Y8RA 4UVIA 2JFGA 4B79A 4LVCA 3QY9A 2X5KO 1NTOA 3L4BA 1K6XA 1GTMA 2OP1A 4BQPA 1H94A 1PJ3A 3JQ9C 2B0JA 2ZYAA 4O0LA 4II3A 2UV8A 5I7EA 2YYYA 1PJLA 3GRKA 3DEYX 1LDNA 2NUAA 4FDAA 1PWZA 2HK7A 2NU8A 1DDOA 4BGVA 4I9UA 3PJFA 1GU7A 2H9IA 5DCWA 3N74A 3GOHA 1RM3A 5HBRA 4YXFA 1UXKA 4OKIA 4W82A 4CM3A 1N9GA 3JV7A 5DCUA 1C14A 1U8FO 2DM6A 4B7UA 3RUDA 1D1TA 2VUSA 3CEAA 4QT0A 4CMAA 1ZVMA 1PR3A 3PI7A 4M8SA 1LC3A 2IXAA 4HNGA 3TQHA 4S3MA 1Q1NA 3DQPA 1PX0A 4BO1A 4G81A 3WNVA 1T2FA 3KM0A 4IDAA 3ZHBA 2IEDA 1YQXA 2NU9A 3F4BA 4LN1A 2VHXA 3AU8A 2QHXA 1O6ZA 5A5FA 3PQDA 4J4TA 5IG2A 4DPMA 1I2CA 5B1YA 3GHHA 3BMQA 4CV0A 2VCYA 2JCYA 3I9KA 5K6AA 2I67A 5CDSA 1L7EA 4JBHA 2AA3A 4YAJA 8LDHA 4HWKA 1ZXLA 2Q46A 4PG5A 4BV9A 2DPGA 2PR2A 2RH4A 4MVJF 1YKFA 4BVAA 1DHTA 1FDWA 2W8ZA 3GVHA 3A4VA 2X7HA 1P77A 5F1KA 3EZYA 5AYVA 1LLDA 5LDGA 5IDWA 4I5EA 1IOLA 4XYLA 1R0LA 4OOEA 4RVDA 3ZWYA 1X1TA 3RROA 3OJ0A 4PLCA 3DHEA 4NNJA 4CM8A 1Q7BA 4UULA 1PIWA 4M1QA 2WD8A 1W4ZA 3UFXA 5GY7A 1E3EA 1EK5A 4QECA 4MIEA 4B7CA 3DBRB 3V5NA 4FFOA 2ZYDA 1P0FA 2FZEA 3EC7A 1VI2A 4KWHA 2PD6A 2YDYA 4BNHA 1HTBA 3B20A 3ITDA 3K73O 4L76A 4M87A 2UVDA 2B37A 3F4LA 4XKJA 2YV3A 5T64A 5JDIC 2UAGA 4J1TA 5IN4A 4KUGA 4JQCA 4RLSA 2EF1A 1DIGA 5MGBA 2J3HA 2HK8A 4YT8A 2GZ2A 2X0RA 4HNHA 4WLVA 1MXHA 4PLHA 3UCEA 2BI7A 4JXKA 4BNFA 1EZ4A 3FSRA 4I8XA 1EFLA 2ET6A 4S1VA 1LJ8A 4G65A 5CPFA 2PZMA 4FJ2A 3SBOA 4B4VA 2AG8A 3LC1O 5BSEA 1E92A 3B1FA 1T2DA 1A27A 1O95A 2VHYA 1ZBQA 3DZGA 4U6SA 3GAZA 3FTPA 5HWSA 5G0UA 1GDHA 3BMOA 4EBFA 1T2AA 4NBWA 2XXBA 1GV1A 2Z95A 4OO3A 3ZU5A 5JCJD 4LK3A 2B5VA 1MX3A 1HSZA 3RI3A 2Q45A 4ID9A 2VRCA 4AJIA 5JMWA 1NYTA 4XB2A 2WM3A 1QR6A 4GX5A 4J1QA 3ZHZA 4A7PA 3BTOA 3U09A 5ITWA 4B3JA 3L77A 4J43A 1LA2A 5B4TA 3CZRA 3I9LA 3DL2A 3KTDA 4IIVA 4AJJA 2G76A 2HKIA 1E1LA 4WE3A 3PPIA 1LXCA 4MKRA 1LLCA 4ND2A 5AOVA 4EDFA 4YJFA 3ICCA 1GADO 4Q3AA 3PXXA 4PZDA 2RAFA 4JIGA 3RD5A 2ZTLA 4E2XA 1U7HA 3I83A 4CMJA 4OM8A 4H3VA 1QRRA 2JFHA 2NVBA 3PGXA 1DIRA 1BGVA 2GD1O 4N5LA 5I7VA 2O7SA 2PA3A 4QFCA 4XR4A 4YTEA 3QLJA 3DWFA 4CMIB 3M2PA 2NTVA 2JAHA 3QSGA 5HS6A 3NRCA 4LISA 2BFPA 5CFZA 2FY8A 4FFPA 1LLQA 1A4IA 4GWKA 2JD1A 2ZCUA 4RO0A 4WK6A 4A5OA 4CPDA 4BNMA 4GVLA 4TWRA 3GRPA 3OEWA 1LEHA 2C5EA 3MOGA 3VZRA 3D4OA 5TIIA 4D3DA 3BHIA 4DYVA 5JC8A 1H0KA 1H6AA 1DFHA 4FIZA 4IS3A 3JQGB 1XLTA 4MPDA 3JQ7A 1MA0A 2NU7A 3H9QA 3ZGYA 4E5NA 3CINA 3VZSA 4DBVO 2B4TO 4YJHA 1U7TA 2CF5A 1HYHA 3NGXA 1E7QA 2DTDA 2OOSA 4NH4A 3ZWXA 3MJEA 3Q0EA 2ZATA 2CUKA 1KYQA 3K92A 3MTJA 3ROKA 4AFNA 5ILOA 2EG9A 3DFUA 1UP7A 4IPTA 3ADOA 4KWIA 4YAGA 2B35A 3IC5A 1PU2A 3NJ8A 5BSGA 1GYRA 1TB4A 2PKQP 5GMOA 1ONPA 1UP6A 5L95A 3JQCA 3V1TC 3E48A 3ANMA 1HDOA 3S1LA 4DA9A 4BO8A 3JYOA 3PHJA 3GPDG 1YJQA 2GDZA 1PJBA 4E30A 2JFFA 2EKPA 4W7HA 5GZ1A 1JKFA 4OL9A 2PTGA 2RH8A 4QO7A 5T57A 1YQGA 4BNYA 5ICMA 1ARZA 5IDYA 5L7WA 4RVHA 2B83A 1P1FA 1R16A 3EK2A 2DVMA 4IDDA 3GPIA 3TN7A 3C7DB 1V8BA 1C3VA 4JBIA 1U3UA 1GPJA 1R4NA 2I9PA 3COSA 2HMTA 4ZQHA 1I36A 3B70A 2AEJA 3N58A 1KVSA 1KVTA 1VLLA 2J6IA 3GQVA 4IZIA 3ZWBA 3KLPX 5CHEA 3HG7A 3ONDA 1U3WA 3CMMA 5TC4A 2PGJA 4ZVVA 2WDZA 4A26A 3C1TA 2V65A 3ONEA 2FPPA 1NVGA 1OMOA 1ZNQO 3C7AA 3MCVA 4MP6A 5KJFA 4YAKA 4ZRNA 3D3EA 5IXYA 5JO0A 3HDQA 5G4LA 3TRIA 4Z9YA 1FDTA 2FHSA 3NDIA 4FW8A 4NFHA 4C7JA 1PGJA 1I8TA 1NHGA 1GV0A 1ONNA 1WZEA 4Y6PA 2VN8A 1L7DA 1CRWG 2J5QA 2CSUA 4NBRA 5EJ2A 1IYZA 4IGEA 1EBFA 2VT3A 1N9GB 4Z3KA 1Y8QB 2X23A 1C1XA 2Q2WA 5DZSA 3ZW9A 4YT4A 4AJEA 4GX0A 4OAQA 4CMGA 4KTVE 4KDFA 3RSHA 4WLNA 4RORA 4UVGA 5DP1A 4BGEA 4BHTA 1MP0A 4R68A 2EGGA 3F3SA 3OM9A 4BKPA 2R2GA 2ZB8A 4YAIA 5ICSA 4BV8A 3N7UA 3FWNA 2YFQA 3UHAA 1LDMA 1U5CA 3VH4A 4YRBA 3WYEA 4IQ8A 2F1KA 1PJTA 1I3NA 1TI7A 3IJPA 5JAQA 1NWHA 1DLIA 2P9EA 4WCFA 1DRUA 4BNXA 3FCOA 1ISMA 2Q1SA 3DZKA 3WS7A 1DOHA 4E3ZA 1M75A 3BMQB 3NTRA 3Q11A 4Q9NA 4NJMA 2FPIA 4YJDA 2IYOA 1ZH8A 4MIYA 4HY3A 2GNAA 2EEZA 3RUEA 4Q3CA 2I66A 5L40A 2O3RA 1YWGO 4OGWA 2C5AA 2QRLA 4CMKA 1E3WB 1Y5RA 4PG6A 4E21A 1GCUA 3GMSA 3PHHA 4ESOA 1ADCA 3GNQA 3JQFC 4Z0HO 3S8MA 4JX8A 4PLPA 3G3EA 3KVOA 4AJHA 1E1NA 4RDHA 4KUEA 3TSCA 4KDEA 2G82A 2WJPA 5EL0A 3L9XA 1SMKA 5L7YA 4PFJA 1NFFA 3PTZA 1U2DA 3R3SA 4CM8B 1K3TA 1GL3A 1HZZA 4L75A 4GI2A 1ISHA 3LC7O 1VL6A 4CQMA 3FI9A 1BTOA 1RM5A 3GEMA 4WPGA 1AUPA 3JCZA 3D4PA 3DOJA 3U4IA 3W4KA 4DVJA 3GA0A 1MXFA 3ZWAA 4BNKA 1VKNA 3BMCA 3JQBA 2W2LA 5JDIA 1QYVA 3GVIA 4OXNA 4XYEA 3TJRA 1ZKMA 3RJ9A 4WLUA 2DC1A 4E32A 1NQOA 4ND3A 3RUFA 4FSHA 4IIUA 1Y5MA 2GCGA 5T8KC 2WYVA 4J2HA 3UOGA 1Q0QA 3LQFA 4XB1A 5KJEA 5GZ3A 2Y68A 2CDAA 3DHYA 2PD3A 1XA0A 1ULUA 1B8PA 5EQFA 3ZHXA 3NTQA 4I5FA 4RCVA 4L74A 4CR7A 2FMUA 3HFGA 1BG6A 1X7DA 4MOWA 1YJ8A 2P91A 1VM6A 3KYCB 4NBVA 4OSPA 4XYMA 4KQXA 5ENDA 4ALLA 2DBQA 3FBTA 5L4NA 3GGGA 2CZCA 3UCFA 4C7KA 2WE8A 2H5LA 1EDZA 1CEQA 1GYQA 3SC4A 1JKIA 2VRBA 2GO1A 3LC2O 3AM3A 4R69A 3I52A 4DXHA 4YRDA 1EVYA 2Q2QA 4CMCA 4PVDA 2EWMA 4IDEA 4M49A 3IIEA 1NFQA 3BMOB 4N54A 1V3VA 3W8DA 2CVZA 2NACA 2Y0EA 1UJMA 3NGLA 2Q3EA 1E3SA 1ZK2A 4JROA 4PLVA 1K0UA 1R4MB 1FDSA 3GHYA 3QV1A 4OXKA 1QMGA 4K6FA 4Y67A 2JHFA 1IPFA 4IDGA 3WMWA 1VKOA 7ADHA 3GH3A 1Y81A 2OBNA 3JD3A 4BNTA 2FSVA 3Q3CA 2FR0A 4D42A 1V3TA 2OBYA 5AQ1A 2I6TA 1WP4A 4R9RA 2W2KA 4EW6A 2ZIZA 1YH3A 1T4BA 4AJNA 2Q99A 2TMDA 4IM7A 3DO5A 5TF4A 4CM4B 4YJFB 3DFZA 3A06A 3GFGA 4AJOA 4TQGA 2NTJA 1YL5A 5A4DA 1U28A 3PK0A 4D43A 1XWFA 3PZRA 5CG2A 3O26A 4K9DA 1E6EA 4MP8A 1UXJA 3AI1A 3WGGA 4AL4A 1JLLA 1ADGA 3OJLA 3OA0A 3TOXA 2DFVA 4L73A 2BHLA 4BKOA 3FPCA 1FXSA 3ZNPA 4XR9A 1CYDA 4F6LA 1VJ0A 2FR1A 1NHWA 2WWRA 3S2GA 2EERA 3KB6A 1XR3A 4UREA 4DL9A 5ITVA 3AUTA 1Y9EA 3B1KA 4W9NC 4N5NA 5ADHA 2VOJA 3FNFA 4DYDA 2X1HA 4GQAA 2AEMA 1KY5A 1UDCA 4RLHA 4J90A 4YWJA 5G0SA 1O0SA 2OZPA 3WFIA 3DB2A 3TZCA 3H4VA 4NHEA 1CQJA 3UCXA 4E5MA 4WNIA 4IJWA 1E3IA 3HDYA 2Y93A 1LTHR 4OKNA 2TMGA 5H82A 3H7AA 2ZTMA 4Z9XA 2Q50A 4J9UE 3W4JA 2JL1A 1I2ZA 1ENYA 3O38A 5G4KA 2YV1A 2HK9A 2NSDA 3FWZA 2X5OA 3RKUA 4BMSA 3WBFA 1NX6A 2C29D 3RJ5A 3KYDA 2RHCA 3DXFA 1P1HA 3DC2A 1XQ6A 4ALIA 1PQPA 3OIDA 1PS9A 2PH3A 3I3OA 1A71A 2VT2A 4BO5A 3JTMA 2G0TA 4MVJD 1ZZEA 1RKXA 4PZEA 2Q1WA 1DRWA 4EJ0A 1Q2XA 5FI5A 4E2WA 1PTJA 4DRYA 4YJGB 3RC2A 1GZ4A 5KKCA 3RAJA 4ND1A 2BGLA 2EKLA 1DC3A 3ZW8A 5TS3A 4YCAA 3UN1A 5DN9A 1UDAA 2HMUA 3GG9A 4NK5A 3ENKA 4CLXA 4L4XA 1E3LA 1GD1O 5KNLA 5A04A 4IDCA 1VRWA 1XEAA 3HB4X 4CM9A 1ZSVA 2PY6A 2G1UA 4BOYA 1YQDA 3QWAA 1D7OA 3GK3A 4RJTA 4HV4A 1PZFA 1C1DB 4LCJA 3F47A 4ROSA 4W7IA 4Y6SA 2E49A 2VYNA 4G2NA 3S2EA 3LT2A 2X58A 1YB1A 2YHIB 1BVUA 2I65A 2DKNA 4FFRA 1EVZA 3PZBA 2C2YA 3QE3A 4GX2A 4EUEA 2IXBA 3CXRA 1X15A 1KBZA 4M86A 5EPOA 1SCUA 2QX7A 3MWDB 5CDGA 3HADA 1V3UA 3QW2A 4YBZA 3ZV3A 3H5AA 1K5HA 4NQZA 4E5PA 5THKA 4KMSA 1C1XB 2D59A 2CD9A 3ST7A 3G17A 3E8XA 4H7PA 4GVXA 2YY7A 3RFTA 4BQRA 1V9LA 3AK4A 3UW3A 3FRJA 1LDYA 1ZK0A 3OICA 1NASA 1PGPA 2QG4A 5K0ZA 2CDBA 1VL8A 3U4DA 3RBXA 3K6JA 4TVBA 3VVBA 1I30A 4RF3A 3CIFA 1QSGA 5C7IO 2F00A 2NV6A 3I9MA 5JS6A 3H3FA 2VQ3A 4YT2A 3H9JA 4XQCA 4MKXA 4WCFB 4ITUA 5DBIA 4YEDA 2Q4EA 1NPYA 2OXIA 4NJMB 5ILGA 3KZVA 3RIHA 3ETEA 8ADHA 4L0QA 4OMUA 4RGBA 3L9WA 1PSDA 3TFQA 3IDSA 2BMAA 1Z7EA 3SX2A 1F0YA 4P22A 5KVQA 3E9NA 4BO0A 1FK8A 1PZHA 1HDXA 1ZSYA 4CLDA 2AE1A 4RZIA 1NPTO 1ONOA 4B4UA 5J23A 3DONA 1WPQA 4CMHA 4DQXA 1J6UA 1LDEA 3AOEC 1EQUA 1H6BA 2HMVA 3PWSA 1Z7BA 3VPFA 1CDOA 3WGQA 1C0LA 4DWVA 2V6GA 5H83A 2X9NA 1B16A 4CQMB 2ZQYA 1P1KA 5CDTA 5A02A 1PQUA 2Q2VA 3ETDA 2RHRA 4BO3A 1VC2A 1B3RA 2QIOA 4XJSA 5FWNA 1JWBB 3BMCB 4RQTA 2AMFA 5TJ9A 2HUNA 1PWXA 5T8KA 1ZSNA 1NR1A 1N1GA 5EQDA 1YOVB 3WMXA 3HB5X 5FFFA 2BGMA 1RM0A 1I3MA 2GGSA 2OGUA 4WGGA 3UVEA 1NNUA 4A2CA 1N8KA 4LRSB 3WICA 4UVHA 3VDQA 4AG3A 1ISIA 1H6DA 5TT1A 2VZ8A 4GWGA 2E82A 4DPKA 4FR5A 4Q3DA 3RQSA 4CM7A 3JYQA 4ZN6A 3SLKA 3W6ZA 5AXAA 1HE2A 7MDHA 3KYBA 4UEJA 5I9NA 4GLLA 2FZWA 3QWIA 3WDSA 4E33A 1UZNA 1VJTA 1E6UA 4KOAA 4WCDA 3I23A 1BXZA 4BL5A 4DIFA 1B2LA 3VOSA 2P5YA 2GN4A 5A1TA 4J4BA 3ICPA 5KKAA 5KWEA 1EK6A 3IL2A 3QVOA 1Y1PA 3GAFA 4JCOA 4XGIA 2RCYA 2A9FA 4RPJA 1LI4A 1KETA 1WMAA 5AXDA 5EIOA 3E18A 3E03A 4NI5A 2O23A 3D64A 3FD8A 4PG8A 1XGKA 2VWHA 3OSUA 2Y0DA 4BKQA 1QYXA 4I9HA 5IZCA 1CWUA 1PEDA 1X7HA 3L4SO 3C1AA 4XX0A 2NNLD 5DOVA 2VZ9A 4FB5A 2W2KB 3A1NA 2BH9A 3BHMA 2B4RO 4R1TA 3WLEA 4F3YA 4CL8A 4CLEA 5A9RA 2ZK7A 1XQ1A 1K6IA 2R00A 3D3WA 1H2BA 2AQHA 1OFGA 2VRCD 3NKLA 3BTUA 2V7PA 3C3XA 3DMYA 5DULA 1UDBA 1I2BA 5JO9A 3TFOA 1BHSA 1VE9A 3JSAA 4RVUA 1P44A 1VPDA 3DR3A 2O7QA 4RZHA 4U0KA 5T67A 4RVFA 3AUUA 1WDMA 4W4TA 1ZCJA 4YR9A 4PLGA 2D5CA 2BELA 1E77A 4E13A 2PH5A 1JAYA 2O48X 3VPHA 3HQ4O 2C07A 2WMDA 4XYGA 1BXGA 1PJQA 1T25A 3CTMA 4IJVA 4YACA 2IZ0A 6LDHA 1U3TA 1GR0A 4W99A 2GF2A 4RVSA 5DP2A 3TDKA 3IQDB 4I5GA 1DSSG 5L45A 5F5LA 1P33A 3VVCA 3I6IA 2Y1CA 3FNEA 3H65A 4KP7A 1SOVA 5TSDA 4NK4A 1R66A 1I24A 4ZD6A 4CLRB 1WMBA 3AOGA 5JLAA 4WLFA 4CLOB 2D8AA 1OI7A 2A35A 4J0EA 4RF2A 3PJEA 5G0VA 4UUMA 3ZH2A 1SB8A 4DMMA 3OP4A 1A5ZA 4P4GA 4CV2A 3GNSA 3OJOA 1F06A 1PS8A 1DFIA 1T2EA 1HYGA 1OBFO 1XKQA 3OJEA 4BNUA 3VC7A 1NR7A 1N92A 2ZJ0A 5JDCC 4A10A 4DLBA 4AJ2A 2E6UX 2EKQA 2VYVA 4M89A 5G4KB 3MJVA 3C85A 3JQ8A 1QV7A 3GY0A 2PV7A 2DUUA 4FOOA 4U7WA 4UEOA 4P4NA 2LDXA 3V2HA 4BMVA 1P1RA 2QYSA 1E5QA 3KYDB 3ZZNA 1PGOA 5FEUA 3DBHA 2X9VA 4RQUA 3VDRA 1I0ZA 3F5QA 1ID1A 1P1IA 4GGPA 5TLSA 2EJWA 3U4HA 4FC7A 3VH3A 2HJRA 2X0NA 3O8QB 3S2IA 1AGNA 3ZWWA 2YJZA 2IE0A 1DAPA 5G0TA 5CAEA 4IQ0A 3VTZA 2V6FA 4JJFA 4YDRA 1RYEA 2AQIA 3AWDA 3F5SA 1Y6JA 3QWBA 4WOJA 2O3QA 5HS4A 1H9AA 4EJ6A 1I33A 3BIOA 4TKMA 5DBGA 3TL2A 1X0VA 3CPSA 2XXJA 4AJ1A 4CQLA 4BNJA 5GZ6A 2CY0A 3AI2A 5JYEA 1UXHA 1GUYA 2BGKA 4GMGA 4MVJM 5U9CA 3G1UA 3WYCA 3RBZA 1IHXA 3H2ZA 4IQGA 2X22A 3LU1A 4XCVA 3U0BA 5C3MA 2VZ0A 5BNFA 4HFRA 4IZHA 4P8RA 1D1SA 1XG5A 3F1LA 4NU5A 3IAHA 4R1SA 1QG6A 3OECA 1HLDA 4J7UA 4IDFA 3WQSB 4O6VA 1JQBA 5IN5A 1YGYA 1Z6ZA 1LSJA 4G5HA 3DBVO 3I4CA 4L9RA 4RF4A 4CODB 5THQA 4EGFA 4D46A 3LLSA 5I9LA 1XCBA 5JSFA 3E9MA 2OL4A 2PFGA 2Y1OA 1YB5A 3DZFA 2X0IA 4TRNA 5T6BA 1BDMA 1OZAA 1P0CA 3Q9NA 1U3VA 2XF8A 3O03A 3ZN2A 1QYCA 1TT5B 3L6OO 3NV9A 4KTTE 4Q39A 3RBVA 1ZEJA 2IRWA 1ZK4A 9LDBA 3JQ9A 4RF5A 1Y8RB 4L4RA 4H15A 5DOZA 1HE5A 3K9QO 2BKAA 1RM4A 3TF5A 3K2EA 3P19A 3GDOA 2VTDA 1YDWA 2J3KA 4JGBA 1BVRA 4HFMA 3ZWVA 4BO2A 3GDFA 4R5HA 4Q3EA 2JAPA 2PKRA 5ENVA 2ILTA 3KO8A 1HDCA 5EMHA 1NVTA 1P74A 3PHIA 2ZB3A 2CDCA 2Z5LA 1Y7TA 3PHGA 1O89A 1XHLA 3AU9A 4ND4A 4Y98A 3AOEA 2X8LA 2IEBA 1C0KA 4CR8A 1ML3A 5COBA 5JY6A 2BFOA 3GZNA 1WAMA 3HDJA 3NUGA 4FS3A 3RUAA 4OXYA 4IMRA 1IHYA 1R37A 1DB3A 4CJXA 1GFSA 2X0JA 2BLLA 4PVCA 3TZHA 3B1JA 2P9CA 2C7GA 3BTSA 2GRAA 3BA1A 2ZB4A 3SXPA 4ALMA 3BXXA 4PGFA 4ZHSA 3F1KA 2OMEA 4M54A 3IUSA 3VH2A 3ZU2A 4XQEA 4PRLA 4UVEA 3DZBA 2Q4BA 1HL3A 2B36A 3EVNA 1T24A 2AEFA 3KEQA 3PRJA 5HTOA 4N7RA 3UAGA 1I10A 3NX4A 3RC7A 4WNCA 2VWQA 5JCXA 1AE1A 1VL0A 5L3ZA 2IZZA 4BO4A 3LSYA 1H6CA 4CQMD 4ONEA 3WTBA 2X9GA 5F5NA 4RDIA 1E1MA 4O63O 4Y9DA 1SC6A 3W8EA 4RPGA 3KSDO 4X54A 4ZJUA 4K26A 5JY1A 5BR7A 1UZMA 3EUWA 4TSKA 2W2LD 3WQQA 3WXBA 1PZEA 2UUPA 1UP4A 2XOXA 2GZ1A 3BYZA 1OC2A 3MZ0A 4Z9FA 3WGYA 1EFKA 1Q7CA 1YBAA 2J8ZA 4JBGA 1H5QA 3PEFA 4CMBA 4FGWA 4TRRA 3OIFA 4FJ0A 5CG1A 1Z82A 3TZKA 1PGQA 2FRDA 3HJAA 4MKZA 3L4BC 1DO8A 1UAYA 3T4XA 4DQVA 1BWSA 1G6KA 1XDWA 2HMWA 4XEHA 4YVFA 3DBLA 3RWBA 4L8VA 1PJ2A 3CZMA 3QP9A 2O4CA 1JN0A 3ROPA 1HETA 3HE3A 3AY7A 3SVTA 3W8FA 1IUKA 4IMPA 4DLAA 1GPDG 2W98A 1JDJA 1BMDA 3FR8A 2CMDA 1PL6A 4J3FA 4Z3DA 2VTEA 5I9MA 2NADA 1GCOA 1ADBA 5JYDA 4EZBA 4BIIA 1HXHA 1AXGA 1MGOA 2PLAA 3ANNA 4GLOA 4YB8A 5FYDA 1D8AA 4OHUA 5KVSA 2C82A 2YW9A 2FOIA 4E2ZA 2AG5A 1ZEMA 4QEDA 1T2CA 3HDHA 4BO9A 4MO2A 4XD2A 1I3LA 4XGKA 2C59A 4LMRA 2CFCA 2D3TA 4UUNA 1UR5A 5F1OA 5TQVA 4XRGA 2CF6A 4LMPA 4CV1A 1LBEA 1W8DA 3RCBA 2LDBA 5B4UA 2P4QA 4WUVA 4BKUA 4MJLA 3DAFA 1B7GO 1E7SA 4K1LA 5HRUA 4P38A 4NFSA 3PLNA 3P2YA 3WX0A 5K6AC 3IKTA 3ZI0A 5EESA 1TVEA 1CERA 1UXGA 1R0SA 1BXGB 1DIAA 3E5MA 3RFVA 3KSZO 3C24A 3KV3O 3JQDA 4ALNA 3KRTA 1UZLA 1BSVA 4XDYA 1ZW1A 4IJKA 4D41A 1U4SA 4PLZA 4CLHA 4WASA 2DPHA 1WDKA 4ZA2A 3CKYA 3U9LA 3L0DA 5U1PA 4XDZA 4B3HA 3S2FA 3WWZA 4YAEA 1DRVA 3RFXA 5KJCA 1ZK1A 1PL8A 2WYWA 3LYLA 1UAGA 2WSBA 4WEQA 3DBRA 3U49A 5IDXA 3QVXA 1FDVA 3F9IA 4E6PA 3WGHA 4QO8A 5CPBA 1W0CA 2YDXA 3PLRA 2R6JA 3QQPA 1SAYA 1HDGO 4EEZA 4I1IA 3ZU4A 4LRTB 3KSUA 4IINA 2A94A 4KQWA 3LT1A 1SEPA 3JQ8B 2J3IA 4HBGA 1MC4A 5JW6A 3GVCA 1HRDA 5DBFA 3VH1A 5A03A 5I7FA 5L9AA 1U1IA 4MVJI 3T7EA 1LQTA 3OETA 1E7YA 3EY4A 3IP1A 3OF2A 3S55A 4OYRA 2NWQA 4R4JA 2VUTA 4PG7A 3KUXA 4Q3BA 1DXYA 9LDTA 1ZJZA 3NYWA 1LSSA 2HLPA 5BT9A 4O1MA 1B0AA 1IY8A 1RPNA 1IB6A 3JQAA 3WGIA 1IZ0A 3ZV4A 1LQUA 3FF4A 4QUKA 3H6KA 1E5LA 4TRJA 4JLWA 1IULA 5BNIA 3PFWO 3JQ7B 5EN4A 1HDYA 4NZ9A 3JD0A 4EI2A 1N7GA 3GUCA 4FBGA 1NQTA 4HFNA 3ONFA 4U0JA 3ZNNA 4CM6A 5ER9A 2O3TA 3I9OA 4R41A 1Z73A 2Y05A 3E1KA 3OHSX 4YJHB 5T5QA 3LVFO 3A28A 5U4QA 5F1PA 1E6WA 3ZWOA 2Y67A 4URFA 4ZRMA 3ZHYA 1PJCA 3OQ6A 4IJUA 5TNXA 5KCZA 3HUDA 4GKVA 2JKVA 4JP3A 1QORA 3INRA 4RPHA 2PK3A 4ZQEA 4E31A 1H2HA 1J4AA 1EUDA 3GN2A 3QHAA 1X1EA 3C8MA 4F6CA 3V1UA 1VSVA 1WNTA 3HSKA 2Y1DA 5A9TA 4CM9D 4JP2A 5TRTA 4O59O 4MVJH 3D5QA 1M76A 1TXGA 3GFBA 1JTVA 3TL3A 3GLQA 2YQ5A 2VYND 4E5KA 3VPSA 4BB6A 3ZWCA 3H5RA 4B4OA 2DUWA 3CSDA 1EE9A 1A7AA 4PN3A 2W4QA 2PZJA 4AJLA 4FGSA 3G0OA 4IDBA 3OMLA 3GF4A 4JNKA 5C7OO 3BMNA 2JD0A 1KY4A 1G1AA 3LK7A 1EBUA 1GQ2A 1X0XA 4BMNA 3OEYA 2NLOA 4PZCA 5FF9A 3V8BA 1R4NB 3NT4A 2FR8A 4CMIA 4J7XA 3K5PA 3P5SA 4HADA 4Y8VA 2Y99A 1OAAA 2J5KA 1KOLA 1EEHA 5ES3A 1KERA 3HZZA 4O5OA 1PQWA 2ZQZA 2VWGA 4JJGA 2P68A 2SCUA 4I08A 4ZU3A 4PRKA 4LW8A 5IZ4A 3L07A 3T7CA 3D7LA 5A9SA 3ZWPA 3PJGA 3NJ4A 3RKRA 4AJKA 2FP4A 3IOYA 4W6ZA 3V1YA 4AICA 3E82A 4XA8A 3MEQA 3EW7A 1SPXA 1ADFA 2GASA 2Z1MA 1FDUA 3JYNA 4MIOA 3HN2A 3T4EA 1R15A 4D0RA 5JAMA 3OA2A 3FTNA 4H16A 2GYYA 3DTTA 4INAA 2I3GA 2PKQO 1MV8A 2VHVA 1P1JA 5I8ZA 1F17A 3SC6A 1P9LA 2HQ1A 1T1RA 3O4RA 4R5MA 2A4KA 1PS0A 1B3BA 3U4CA 1I5RA 4BUCA 2V6MA 2J3JA 1SOWA 3QVSA 2NVUA 1A9YA 3R1IA 1DAOA 2WTBA 4IGFA 4J0FA 2D4AA 4XWYA 2WD7A 1B26A 1DEHA 1M2WA 2VOEA 3U3XA 4J49A 1ORRA 3RVDA 5IF3A 3Q6IA 5I8WA 3PWKA 3AW9A 4HXYA 3PVZA 4PLWA 1X14A 4K28A 4D0SA 2ZTVA 1JKJA 4OH1A 1NFRA 2NQ8A 3JQFA 1RYDA 4EYEA 3Q9UA 1P31A 3WYBA 1YB4A 4YYZA 2EW2A 5B12A 4RL6A 4D7AA 1PJSA 2XPCA 3DAGA 5DNAA 5B37A 1WW8A 3PJDA 1SNYA 3ZWNA 3DMTC 4WEOA 5JAZA 5LDHA 4KZPA 1WVGA 3B6ZA 3PQEA 1SBYA 5JFOA 1U9JA 1DHRA 4B4WA 3FN4A 3ON5A 3EZLA 5L4LA 1HF3A 1NQAO 3DBLB 1LDBA 2IYPA 4A73A 5KJ6A 4U8GA 1GY8A 3IP3A 1QLJA 2QZ9A 3G49A 1CIVA 3FPLA 4R9SA 3CH6A 1YO6A 4BGIA 4CUJA 1Y8QA 4U5QA 3I1JA 2O2SA 3WGZA 3UICA 4XJTA 3AM4A 1P45A 4DREA 3KHUA 2CVQA 1MG5A 1IPEA 3DZJA 2NVWA 3KXDA 4UEKA 1ZO8A 2C20A 1RJWA 4MDHA 4NFYA 5C7LO 1LUAA 1ZIDA 2EGHA 3VZQA 4J9VA 1LSUA 3INGA 5CEJA 1XU9A 1N5DA 1ZMTA 1T1SA 5MDHA 2AW5A 2HO5A 3JD4A 4NDNE 5DDIP 4NMHA 4B7XA 1NVMB 3UH1A 3NDJA 1YS4A 4OSOA 4KUHA 4DC1A 1YVEI 3ZV6A 3AJRA 4NPCA 2IDZA 2BF7A 4XIYA 3ZU3A 3DDNA 4WCFC 1KEWA 1WLYA 2HU2A 5BQFA 1CETA 3JD2A 3W4IA 5DT9A 4XYBA 1Z75A 1HDRA 5IAAA 4NJOA 3HFSA 5KIAA 1DBVO 4DLLA 3AFNA 1D4FA 4RPKA 5KVVA 1E3WA 4CMEC 1TT7A 1BXKA 3ITKA 2FN7A 1NPDA 5JNLA 1GQQA 5B4VA 3I4FA 4PLFA 1ENZA 2C0CA 4BNGA 4PG4A 1XU7A 2HAEA 3VTFA 1X13A 4Y6RA 1MFZA 2FSSA 1HDZA 1P3DA 3QJ5A 4QX6A 1HSOA 3SLGA 3GC6A 1GUZA 4B8ZA 1U8XX 1YBVA 2OUIA 3MJSA 5IDQA 3H9UA 1YBMA 3JD1A 4NU6A 1GAEO 3KLMX 4TROA 5F3RA 1F14A 4PLYA 1DJNA 2Z1NA 3LT0A 4Z0TA 4BNVA 1YL7A 3WB9A 3M1AA 5JMPA 4WOKA 4ZQBA 1IE3A 5AVOA 2I3AA 4PIVA 2VWPA 4YPOA 2NQTA 4TVOA 2H63A 2EV9A 3IS3A 3WR5A 2P4HX 3CUKA 3NDRA 1GUFA 2O2YA 3JQBC 2WYUA 1HLPA 4TZKA 3ZWMA 5CDYA 2C7VA 4J1SA 1SZJG 1EE2A 4FPXA 4GL4A 3DAPA 3BTVA 1LSOA 1Q0HA 4GGOA 3VAZA 3H2SA 3HHPA 1NAIA 1LU9A 3JQ6A 4W9NA 2AHRA 3QWFA 2VYVD 4DIOA 1O5IA 3UF0A 1GZ3A 3KYCA 1H93A 1J0XO 2JHGA 3JQAB 2VHZA 1JA9A 1N2SA 3U62A 1M67A 3I9NA 1X7GA 3ZDFA 2JD2A 3H9GA 3Q2KA 1NAHA 2GPTA 1E7MA 1CJCA 1JVBA 1PGNA 2P9GA 2Q1TA 3I5MA 3LT4A 4EJMA 1FMCA 3Q1LA 3WQRA 2B5WA 3DZHA 4CM1A 1GEEA 2VHWA 1ULSA 4J6FA 1A9ZA 2VUUA 4I5DA 4FOSA 4EITA 1PL7A 4HKTA 2I5PO 3WJ7A 3MJ4A 2Y1EA 1YONA 2QQ5A 3VKUA 1JAXA 3NTOA 1R4MA 2GN8A 2QW8A 1KS9A 3TPCA 2RIRA 3KETA 4XQ9A 1UH5A 1CQIA 3TZQA 2IODA 2VNAA 2WEKA 3PIDA 2E4AA 3R6DA 3ETGA 2W90A 5KVCA 3ASUA 4CL3A 1LDGA 2E37A 2JJYA 4CUKA 2Q1UA 3TOZA 2I76A 1W6UA 3EYWA 5A06A 2HRZA 4BO7A 4CUZA 4XRRA 3OBBA 3PDUA 4GAEA 1I32A 1KVUA 4CM4A 5JC1A 2HRBA 4GBJA 4GMFA 1PJ4A 2ZKLA 2NU6A 4QFDA 1BW9A 5C37A 1NM5A 5JCJA 1EUCA 2PNFA 3BMNB 1KIFA 2Y1GA 5L53A 1Q0LA 3JQEA 1HE3A 4XIJA 3SJUA 3RU7A 3RC1A 2HDHA 1ZMOA 1O94A 3NEPX 3DOCA 4LGVA 4QXMA 3GUYA 4BB5A 2C54A 2BFAA 2UYYA 2Q49A 2A92A 3PP8A 2DQ4A 3ULKA 4DC0A 1JU9A 1R0KA 3NT5A 3BAZA 3H3JA 3ROMA 2I99A 4F46A 3ZV5A 5A9SB 2AQKA 4TKLA 5I7SA 5JXWA 1ISFA 3L6EA 4QQRA 1V35A 3QIVA 4RVGA 4K6CA 1HWYA 4E5YA 3QWHA 4PLTA 1PZGA 3R0IA 4M55A 3O9ZA 4BNZA 3M1LA 4HX5A 3WWYA 3GVPA 5C5IA 3PWZA 2NVUB 4UAGA 1G0NA 4BNNA 1K6JA 2WD7B 2YHUA 4XZ3A 4MVJE 3OH8A 1YL6A 2Y1FA 4LSWA 3A14A 2OO5A 2YZ7A 4II2A 2H6EA 4OOFA 1ZXBA 3AY3A 3AM5A 4D44A 1DIBA 1M6WA 1UUFA 3LLVA 5LCXA 5H81A 4MINA 1T26A 3WNQA 1ZUD1 3ENNA 1WDLA 4YJGA 3IUPA 1GZ6A 4A27A 1HZJA 1GQYA 3GMDA 3AUSA 3TWOA 4FFLA 3K31A 3LF2A 3WBBA 4DIBA 5JAIA 2DTXA 3TNLA 3MWEB 1S6YA 4ILKA 3JYPA 1YXMA 6ADHA 3ANLA 5L7TA 1DLJA 1DC4A 2UDPA 5BSHA 3DMTA 3MJCA 2D1YA 1Y9AA 1S7CA 5COQA 1ZFNA 2EIHA 1MB4A 3IMFA 4GH5A 1E1KA 4LVUA 4P4LA 2FWMX 4LCEA 1AN9A 1LNQA 2Y66A 1C1DA 3FBGA 2EJVA 2QYTA 3WG9A 4CV3A 3GG2A 1XIVA 1IL0A 2AQ8A 2QRJA 3X2FA 1EMDA 2YHIA 3D5TA 1J49A 3NT2A 3D0OA 3WGTA 3FHLA 2YV2A 4GSLA 1E7WA 2BRUA 3RASA 3ORFA 1B8UA 1B15A 1NXQA 3WOHA 4J4HA 3SJ7A 5DF1A 3D4NA 2PZLA 4IBOA 4OIMA 5A05A 3GZ4A 4OQZA 4BNWA 1RWBA 2P2SA 3V2UA 4J91A 4C4OA 4A03A 2X5JO 1JVSA 1Z45A 4ZQFA 2RBEA 2HJSA 1W73A 1A4UA 4R1NA 1TA4A 4ALJA 4BS9A 4YT5A 2X86A 4ZQGA 5JPIA 2ZB7A 4YRAA 3EMKA 4JN6B 5TGDA 2PWZA 4BNLA 5HM8A 3K8ZA 3D1LA 2GZ3A 4J1NA 4NBTA 4BGUA 3FNHA 3AY6A 1QXSA 2WE7A 2HSDA 4I9NA 2GUGA 3DOOA 1MUUA 4FQ8A 3GEDA 4CMEA 4GPD1 3LF1A 1YE3A 2EW8A 1XELA 2G17A
chains in the Genus database with same CATH superfamily
1E0DA 3S3TA 1B41A 2EAUA 2G70A 1SB9A 5CLGA 3VR0A 1R8YA 3DW1X 1H2EA 1NMQA 1NYRA 2BHNA 5IJWA 1YQWA 4RTJA 1W52X 3C6YA 2PGOA 3X44A 3FZNA 1Y1QA 4DR3B 4MPTA 5JD4A 5AKEA 4ZCLA 4P3OA 3PIRA 2HHCA 1RTTA 5KAPA 1QAMA 4HDKB 3QTTA 2BI8A 3X2EA 3MWJA 1AA9A 4DTIA 1AHPA 3OQBA 3HN7A 2V7EA 1S8AA 2OECA 3QVTA 3M89A 3H5NA 4GE3A 3UQYS 1HKUA 2H9YA 4MVJP 5FBQB 1AZLA 2OAGA 3OT1A 2PX8A 1YT5A 5KS2A 1HEUA 1TZCA 2R86A 1WXDA 4ADSG 3EZXA 1MFPA 1DQYA 2LIPA 4ZI7A 3DGFC 3BFXA 3ZGOA 5GONF 2YIJA 4L1KA 2HHJA 4IS2A 1QJ4A 5JZSA 3IQIX 3ESQA 4MR7B 1CY0A 2H5IA 2WWXA 4ZREA 2OGZA 4DSTA 2GVZC 3P27A 3CJRA 1UMDB 3PHLA 3SR0A 3I5YA 1LPBB 3UUWA 1Z5VA 3RUIA 3WK6A 4S05A 4ZOLB 3LDHA 4M99A 1KAHA 3ISJA 4P7JA 5EWJA 5CXXA 3VPGA 1KBOA 3O3MB 4L6AA 3IJRA 3WKDA 4EHHA 3V9PA 1YJXA 3AI3A 2IEYA 4IICA 4L4SA 1I9GA 5AJYA 2I87A 1EXNA 4LDZA 1E3JA 3KWJA 4C5AA 5CK5A 4CWAA 4AVYA 1Y5LA 3FHCB 3V00A 4JJIA 1Z8DA 3R6TA 4H18A 5LC1A 2YUTA 2C4TA 3I9JA 1N32B 1ZI8A 2GLXA 1NUPA 1YZTA 4R31A 4F45A 1F4PA 3MINB 1EB8A 3GLFA 1IN6A 4RANA 3ZVKA 3PC3A 1SVMA 1QX4A 3GJTA 2C9CA 3EQ2A 2PPVA 4DUYB 2Y6UA 1K7FB 1NWCA 4KPEC 1QYDA 2YQ4A 1FX0A 1TLLA 1USKA 2HA3A 2ZRFA 4BO6A 4CCAA 2DHRA 5HXAA 5AXBA 1KAQA 1H9BA 2HTFA 3PQFA 4N8DA 3WZMA 4BVKA 4ESVA 1GLGA 5B3JC 4KNYA 4UVDA 4J3NA 4B1FA 1EE1A 5KZMB 5FLYA 1XZMA 2XGOA 4RZUA 5JDCA 2FWBA 3I39X 2H0RA 1RCFA 1HE4A 3JQAD 3DD1A 1LRLA 4LHEA 1Y5NA 2MSCB 4MULA 4QGGA 2Y6VA 3ORHA 2AOUB 1LLUA 2C9OA 2WV9A 4DWOA 3V8EA 1QH9A 1KAGA 3MD9A 4UM8B 2GEDA 3A6DA 2PXAA 3BJZA 3HP1A 3WHIA 5IKEA 4EELA 3NLLA 1L7BA 2A57A 4ITVA 4DUZB 3EHEA 4J7CA 4XX1A 4ENQA 4WK2B 4YAOA 5JPCA 1T6NA 5E4JA 1DC8A 1XMVA 1XRSB 3GP5A 1FFBA 3M6WA 1XD2A 3NM5A 2EP5A 4TLBA 4TSFD 4TV9F 5EQTA 1M0WA 4ESHA 2XZLA 3IKJA 5JARA 1YA4A 1ZA2A 3IE2A 3WLLA 1FNBA 1XSEA 3JZMA 3O8NA 2ZBVA 3GT0A 1WCYA 3M6IA 5IZCC 5KX5F 2E4XA 1QB8A 1A88A 2EJCA 3AEXA 4J0JA 1V6SA 4NULA 5HGJA 1J9GA 1L1FA 3A9WA 3QK7A 4GO1A 5G2OA 1RW4A 3VOAA 5CD1A 2CWDA 4EEXA 5DGCA 5F7XA 1YC5A 3DE1X 2FCRA 1KC1A 4TYMA 4KQHA 3ERCA 1CZNA 1C1YA 2R00C 4TQUS 4DDVA 4AWXA 1KVQA 2GOYA 1P73A 1CFJA 1OR8A 1U9IA 2OD7A 4DBZA 2OHVA 4WRRA 5J1SB 1EVJA 1DKLA 2QRKA 5FP0A 1MAVA 2AI1A 3RF7A 1BDBA 4RPLA 2DBYA 3EYAA 5TPWA 1KZHA 1D4AA 4JYBA 4QVIA 3OPXA 3EWSA 5CEEA 2IA5A 1O6CA 2IT1A 4FWBA 4XIGS 2B94A 4M22A 3G8AA 2LE0A 5C1IA 4NCKA 1DC6A 4X20A 3UYLA 3QVWA 1D1PA 2ZT6A 2KQUA 2NT4A 2F1RA 1G5PA 2IDKA 3OEED 5E1OA 3VR1A 2HJWA 4UNSA 4CRWB 5FBVB 3I6MA 4FOLA 4ARIA 3V34A 3BWYA 1EDOA 2GO7A 3MB5A 3LW7A 3H8VA 3E3LA 3V6MA 4E4YA 4ZV7A 2VDWA 3DL0A 1XFDA 4NXNB 2ZDQA 3STYA 3O3OB 4PBTA 3RLIA 4I6JA 1N0VC 1ISJA 4IR7A 2P8SA 4C21A 1I2AA 1TZBA 2P41A 3OFSA 3T0IA 2GAOA 5IKPA 5L4SA 1B8VA 4B35A 4TTPA 3GFRA 3SIPA 1W4CA 2DTEA 2A78A 3M4XA 3N07A 3FR7A 4BX8A 1XPRA 3AEYA 5MFZA 3NVMB 3ZVNA 4HQFA 2IZ1A 3D8TA 3TTYA 3KBOA 3N8HA 1P0IA 4X8OA 2RHTA 3R7AA 2AOVA 5M04A 3A0RB 1BDJA 4HLCA 1IFXA 4F72A 5D51S 2AGVA 2HMSA 2VPYA 1DJQA 2XSZD 5AI5A 4TTRA 4MEJA 5GJVC 1L8AA 1BS2A 2QN3A 2YFHA 3BB4A 3GRCA 3RW9A 4JU8A 3HXLA 3O91A 1OIVA 1AGXA 2IE8A 2OV3A 1EPUA 3DEJA 4JC0A 4N18A 4BDTA 3FPJA 4NR0A 1RFLA 3TVTA 3PQ4A 1JUDA 3PNVA 3TFWA 2O8DB 2YWHA 3B2NA 3REGA 2D06A 2XOKD 4CR6A 5I7WA 4ZICA 1PBNA 3PYXA 1Z0ZA 3P0JA 4AW9A 2ZI7A 2OGWA 3OJFA 4WIAA 5DO9A 4EY8A 4X7MA 2DKOA 1K3FA 3ZCXA 4RM3A 4GLFA 4X7BA 4QOIA 2XNSA 1DEAA 2O3SA 5CJJA 1R5OA 3K96A 5LQNA 1ZCFA 4B3IA 2NZXA 4FN4A 1OROA 3WKBA 3RAFC 2C61A 3AP3A 3PNQA 2EZUA 1QG0A 2VK8A 1F2DA 2ZAMA 2HWYA 3NBYC 4GYYA 5CITA 4KYIB 4IG9A 2WA1A 1E9BA 2C31A 1QV6A 1Z6PA 3F5DA 2BKUA 4RHEA 5CDFE 1F12A 3ABIA 1RXIA 1X1DA 3HA7A 3NIWA 3TINA 3LLCA 2EP7A 1K97A 1KVRA 3FFTA 4ZO6A 2HXGA 5CLQA 3M2TA 4NE9A 2ZS9A 2FN9A 1T5LA 2OQRA 4X6YA 3RTCA 4UHEA 2FX2A 4F2PA 3QW4B 4UQLA 2VQ6A 4DUPA 3WLFA 5KBYA 3IMGA 4TZTA 3SEQA 5LLDA 5CJ2A 4R98A 4R3NA 4IUCS 4UXJA 1IBSA 2D1TA 1FFXB 5GGYA 4CGYA 2COKA 3AVUA 5EERA 4ZCRA 4NABA 1F3OA 2BZ1A 3SQXA 4IY1A 1G3QA 2CHFA 4FC6A 3CVJA 2NYRA 3E6AA 3STHA 1H3FA 5KNDD 3KOUA 4MAMA 5IKXA 2A3NA 5LU8A 2H54A 4JBLA 1EINA 4QIHA 3Q98A 5LP6A 2RGRA 1TJ3A 1YHZA 2QTAA 2ZBEA 4OQ4A 5IULC 3KQKA 5FHQA 2QVBA 1PDOA 3HH8A 1WD5A 5FORA 1U0TA 3DTVD 5CDUA 2AXEA 5F7JA 1C1HA 1QBGA 3FJ1A 2QRNA 4EKYA 5IJZA 1Z5OA 2WT4A 1E4YA 1P9NA 2BFMA 2WINI 1UBCA 4Q21A 4TKVA 3RSCA 4IVRA 4J7AA 1GA6A 4UVIA 3W5BA 3OCXA 5TEWA 1Y9ZA 8GPBA 1N3LA 1VL2A 4LJSA 1FEZA 2GARA 2WUFA 3MXOA 4D57A 3V7NA 4CDMA 4L2IA 1GTMA 4BQPA 3IEMA 5EJFA 1PJ3A 3F3KA 5AVWA 1QNFA 3ECCA 1OU0A 5D87A 2BBOA 4O0LA 3QXGA 4II3A 2X6QA 4O5AA 3TZEA 4DVGA 2YTZA 4EECA 5I47A 3DOHA 1PJLA 1OYOA 3GRKA 2RGCA 1ODTC 2NUAA 3QEJA 1X1AA 3A3YA 2QN1A 1FFDA 1BEUB 4G4IA 2XUQA 3HCNA 2J9FB 1DDOA 1GP2A 3LK6A 5H9WA 3RSSA 1GSHA 2RAFA 1E2LA 1I0LA 5H02A 4JR0A 4QGFA 3GOHA 5HIMA 1VI6A 1HH4A 4ZVSA 2QM7A 5C80A 1TU3A 2E5FA 1I1NA 3CW8X 2VH5R 4FYIA 4LBYA 3FLMA 4JODA 4OKIA 5HF6A 4CM3A 3SIWA 3H2HA 1G8HA 4B7AA 5AI6A 2DHEA 1N0IA 1YR1A 5D86A 5EZYA 3RUDA 3TLGB 3VPCA 4B45A 5DM70 3VDNB 1ZVMA 3GJZA 3CNQS 2CEKA 1D2RA 3HYTA 1LC3A 2IXAA 3PI7A 4HNGA 1M2HA 4UU7A 1MW9X 4JQYA 1B6GA 2OBFA 4R7TA 3TQHA 1XCLA 4DR5B 1SWVA 4AY6A 4MKHA 3RK0A 1B76A 1S8NA 4C88A 2WC1A 4RACA 4F9GA 1JJVA 3KM0A 3ZHRA 3THSA 2C97A 2JJ8A 3E27A 3QU7A 4Z86A 1Y7IA 1ORIA 1YQXA 2NU9A 1B8OA 2VHXA 3ABSB 4E3WA 4HF7A 2EFJA 3PQDA 2AKYA 4BFTA 1I2CA 4I50A 3N1UA 4GOOD 5B1YA 2PS3A 3BMQA 4CV0A 2I67A 4LWZA 1L7EA 3FRHA 3PHCA 4BFWA 4JBHA 4YAJA 1VP9A 1KK2A 3HDVA 4K1XA 5FBLB 1WM1A 1ZXLA 1UM9A 3PVCA 1U90A 3QF4A 4BV9A 4DSOA 3KEMA 4E07A 2ZUSA 4MVJF 5C5EA 3LRXA 1K5PA 2FDRA 3CQ9A 2O8BA 3BD6A 1JJAA 2TRSB 2VLBA 3O0DA 3GVHA 1CVLA 2NUBA 2R48A 4L15A 5FPYA 3VHXA 5DV9A 4F3KA 2DFKB 4CF7A 4MPRA 3SVZA 1W2WB 3KT0A 3QUQA 3N8GA 2FHPA 2OLEA 3NIFB 4RD3A 2C7RA 1SBZA 3E9CA 1JSZA 2JAQA 4OKSA 4OAPA 4A6XA 1DOZA 1JIVA 5CU7A 4BZQA 2XTJA 5AVKA 3KR0A 4ETIA 5HBGA 5JPDA 5LNK6 3HWSA 1JLHA 2JK1A 4M1EA 5J43A 2M9MA 5ISMA 4CM8A 4UULA 3AM1A 1L4BA 4Y6GB 4F9EA 2RHHA 1EWKA 2PZBA 1W4ZA 4KAAA 4ZRDA 2G8NA 2MT9A 3RADC 3ZE0B 2BEVA 1QHYA 1E3EA 4G4GA 5GY7A 5EKXA 3UATA 3V5NA 1ZR2A 5JBNA 4EA9A 2VNJA 5AIBA 1HGXA 1JIQA 5C8VA 2PMDA 4QTYA 4YRSA 5EHXA 3LP8A 1VI2A 3GWGA 3M1YA 1E8DA 3J80A 4LYYA 2DPXA 4JY7A 1HTBA 4Q4DA 4BZWA 3V7UA 2ZUDA 3TM5A 3EEOA 1JZTA 2G88A 4JLSA 2YV3A 4FYPA 5T64A 2AK3A 4H3SA 5KSZA 3OM0A 2UAGA 5FTJA 3C5HA 4MUMA 4Q3LA 4Q1DA 4JQCA 2EF1A 4IFIA 3MHTA 1IVNA 4E4TA 5MGBA 1KYWA 1L4FA 1UWLA 2GZ2A 1R6BX 2HJVA 3FYSA 5EIBD 4D97A 4YT8A 4YMLA 1KK0A 2BBSA 1FFAA 1MXHA 1J7KA 4TM7A 3UGTA 4JXKA 1PEAA 1XXHA 1Z6AA 1DJMA 1YMVA 1BAPA 2HPAA 2JA2A 3HVIA 4INZA 2XMGA 2ET6A 3MJDA 1NN3A 4I55B 1NVXQ 3BREA 4G65A 4B3SB 1PKXA 1E92A 1JG1A 1DKRA 3RC8A 1C50A 2N75A 2L69A 3DZGA 3JARA 2IUUA 4FHEA 2X2FA 5AVVA 3RNOA 3MB8A 4DLVA 4AD8A 3TJZA 1RXSA 1ESZA 1K27A 2QTVA 1GDHA 1NDUA 5FR2A 1CUUA 2YN0A 2R6GA 1FJ2A 4OO3A 2Z95A 1XO1A 1Z22A 1EDEA 3IP6A 5FNZA 3URKA 2I7CA 3RFUA 3PT9A 4LK3A 3IVGA 1NRIA 4QOJA 1HSZA 4EKDA 1NP6A 2FFRA 1I2DA 3D43A 3PFKA 3Q8WA 4A6PA 2GCNA 2W0MA 3BXHA 1DV1A 3ZY2A 5J9FA 4BMYA 3IT0A 4EG6A 4HDOB 5AD1A 3RYFA 4A7PA 1BCRA 3UT6A 3L77A 2P2ZA 4J43A 5E2IA 4JL5A 4AQYB 2HOQA 2F7SA 1GLNA 2JLBA 4FGUA 2WQ6A 2X7JA 2GHQA 2G71A 2C0QA 2IOYA 3PPIA 1LNSA 1N8SA 5T4EA 1D04A 2PLWA 1AF4A 1Z5GA 2WOOA 5AOVA 4RJ2A 2QD5A 4F6RA 2YHBA 1QF7A 3VZCA 3IH5A 1D6NA 4KXQA 4IIYA 4X1KB 4CMJA 1VPLA 4OM8A 3TW8A 4WFKA 1B0PA 2XUKA 1DIRA 3EMVA 4G0PA 3INNA 1HRKA 1S1CA 2C4KA 1FLDA 1OXSC 2O7SA 4QFCA 4XR4A 2Y9MB 4YTEA 2GXAA 1UPUA 2BF4A 4OHFA 4RM2A 1Q21A 2JGJA 2NTVA 3M2PA 4CMIB 2BFPA 4FFPA 2C96A 1SBHA 1BX0A 2ZCUA 3EY9A 2OPHA 3ZIUA 3D2LA 1MAAA 3GJ0A 4BNMA 5H80A 1RLIA 1LEHA 4IXNA 1RAFA 2P11A 4PXYA 4YFYA 4OXIA 1MN6A 4D3DA 1CE8A 3EZ2A 2O0LA 1ZOIA 1YCHA 1H6AA 2EL7A 5DNDA 3DFMA 2C57A 3OZTA 4IS3A 2VQFB 3WDLA 1XLTA 3JQ7A 3A05A 4V0NA 3PUKA 2NU7A 3F6EX 3ENZA 3H9QA 3NWBA 4XOUA 1Y3CE 5EJEA 4HDQB 5LKAA 3DZDA 4GRAA 5IEJA 5GJWC 1UODA 5EJGA 3NGXA 3TH5A 1E7QA 5C4GB 3WKCA 2F1HA 1YUMA 1UAAA 4LFAB 1H4TA 2F6RA 3N2GB 4FGJA 3Q0EA 2W2TA 1JEEA 1L7QA 1RJFA 3DNFA 2GJ4A 1EG2A 4YRZA 2ZREA 5ILOA 1KAMA 2EG9A 3UJ3X 4I2NA 1XZCA 3RTBA 4YAGA 3OHMA 5K0JA 2ZUWA 3USZA 3K70B 1T2VA 2B35A 3IC5A 3TIIA 5JLJA 1GYRA 5GMOA 1X39A 2PTHA 5L95A 1NOKA 4CEIA 3ELUA 1AUXA 2BMVA 4OBWA 1CNEA 1EB9A 1XQ9A 2H0QA 2X40A 3ANMA 2ZDGA 3SHVA 3PGMA 4KSCA 5EYPB 4BO8A 3P9SA 4OHWA 3NQ41 3PHJA 2E3JA 2P9ZA 3M5DA 3BSSA 1DTEA 4RZQA 1IBLB 5H59A 2JFFA 3L0IB 1LV7A 3K0SA 4KQKA 1UK9A 4QTXA 5GZ1A 3G2NA 4GD3Q 4OL9A 1SCQA 2PTGA 4QO7A 1QOZA 1STOA 5T57A 1QZZA 3HJTA 4BNYA 1ZN8A 2QE7D 1OH7A 1P9OA 2BUCA 5L7WA 3LI2A 1MB2A 1P1FA 2B83A 5J2TF 5BYKA 1UWVA 2QD4A 4NESA 5F7OA 3LYHA 3L7NA 1MTOA 1T8UA 4X24A 4ZPJA 4DYHA 4YUYA 1YR7A 3N2YA 1U3UA 3IXMA 1C8KA 3NPMA 1XK7A 2I9PA 5K2OA 5H8WA 1GTSA 5D3ZA 4Q1VA 5BOSB 1ICEA 1KIMA 1XZAA 1IVYA 1XE3A 2J6IA 1SG0A 3DVSX 3GQVA 3WSTA 2GB4A 3QYAA 4E7OA 4N1AA 4CCYA 4LE1A 4B3XA 1J8MF 5CHEA 3HG7A 2HI0A 2J3LA 2AFHB 3A9UA 2AUTA 2WDZA 4N3CA 5AMXA 1OMOA 2CMHA 5AK6A 4EG8A 4AUEA 3D3EA 4YAKA 1NGSA 4LGMA 2NO7A 3JY6A 1SKUA 1FDTA 4NFHA 3CLTD 1JX6A 1I8TA 3DWIA 3VKGA 1GV0A 2DQKA 1ONNA 2Q6VA 1BKSB 2FN3A 2VN8A 1XEWX 2Q7DA 4UNRA 2J5QA 2AYYA 5F2NA 4XASA 4FOTA 1KS2A 3D6JA 1E59A 1IYZA 3PVSA 3W1EA 2G5PA 1N6HA 3ZHQA 1EBFA 4MV9A 3ABZA 1N9GB 1UADA 1Y8QB 1R9GA 5DZSA 3PE6A 3OLZA 4GX0A 4AJEA 1BO6A 1RXUA 1ZIYA 2VBIA 1EIZA 3KJEA 3HO8A 2BFFA 3KQQA 2FUCA 2YVUA 4KTVE 3KQOA 4GC9A 4LE2A 4LOAA 2R6AA 2JAUA 4RHTA 3REQB 2IGTA 4RORA 5JR3A 5DP1A 3ZY6A 3B53X 3WZLA 4XXHA 4BGEA 3K5WA 3OTWA 1NP7A 1RT9A 4JI3B 1R1DA 3F3SA 3OM9A 1E5TA 1SQFA 2TYSB 5KYUB 4NSNA 4KO8A 1OWPA 1LDMA 1U5CA 3I73A 4LBWA 4KMRA 4KPGA 1M8KA 2F1KA 1PJTA 1I3NA 1TI7A 2HBZA 1T6ZA 4CL0A 4D26A 3DJYA 4MZDA 4WCFA 5E3HA 1DRUA 3FCOA 1ISMA 1Q1EA 1G63A 2VF8A 5KYKA 1AGYA 5AM0A 4E3ZA 4B80A 4JCCA 2GZDA 3Q7RA 5LD2B 2YY6A 3H5VA 4NJMA 2J0UA 3HEAA 3UJAA 1ZH8A 1G9SA 1JFTA 1EP1B 1L4LA 2GNAA 3DMHA 3IBGA 3WNDA 2K2QB 1HG1A 3E9EA 5EVJA 3RUEA 4Q3CA 1KMHB 2PMEA 3OIVA 1GNTA 3ANSA 3SC2B 1M2OA 1XNRB 4OGWA 3D8RA 3HKEA 5K7SA 3EVGA 1Y5RA 2XECA 5F7ZA 2AR0A 2BJWA 2RJ3A 5KUTA 4PG6A 2BM8A 4OYLA 2DCMA 1PKEA 2OMKA 3GMSA 1ADCA 3S8MA 1YJBA 1Y6ZA 1H1LA 4Q1EA 3AEUA 3C74A 5LMUB 2WUDA 3Q9LA 1EGMB 1WKBA 4KDEA 1ZP6A 2E4VA 3HPRA 1NY5A 3EDCA 4EK9A 1G60A 2OLKA 4PFJA 4JR2A 4U5XA 5AT1A 5JAHA 1NFFA 2A5YB 2B30A 3BL5A 3R3SA 1FZTA 1W29A 4YO7A 2XNHA 1G291 3H6GA 1GL3A 2W2NA 2WJYA 1MEEA 1QVVA 3EGXB 2P9QA 3D4IA 4FX5A 3OUZA 3TOCA 2B8EA 2CGEA 1T5OA 1BTOA 2WT8A 3D2BA 3V4OA 3FZQA 4O25A 1QHEA 1AUPA 1P4JA 3TX6A 4FYJA 1H3NA 3G2HA 3HR7A 3U4IA 4JUFA 1IM2A 3W4KA 1RHQA 1MXFA 4LV8B 5F4BA 5KO2A 3BMCA 3SQMA 4TWAA 3T5PA 5JDIA 4OXNA 2YS7A 2W71A 1DKMA 5CJPA 4XVCA 1V1RB 2B34A 1HOXA 4S1OA 4UBNA 4QKQA 2XYPA 5CYPA 1SCJA 3F3MA 4UARA 5C34B 1OZ0A 3MBOA 3P26A 2IP4A 1NQOA 2I7VA 2NSYA 3AY0A 3RUFA 4GEGA 4RD6A 1Y5MA 2J7PA 3A6JA 2GCGA 2XNDA 3CZPA 4M9CA 1T3ZA 4Y2VA 2J5BA 5T8KC 1JAZA 4YECA 2JA1A 3RODA 1GZ5A 5KJEA 4S2EA 3R8FA 4OK5A 5ENZA 1MRNA 4KR6A 1WUIS 1Z0FA 3RHFA 1B8PA 3T5DA 2LXNA 5D7BA 5HOEA 3KKKA 4PZ0A 3NTQA 3ZHXA 3IIKA 3SJZA 1N6NA 4L74A 3ES9A 3NBAA 4GECA 2NT3A 4CR7A 4Z53A 3PQ3A 3LBNA 4AROA 2EZTA 1YJ8A 4XYMA 1G17A 1VM6A 4MMYB 4NBVA 3TQIA 1Z34A 1S2IA 5AI4A 4ALLA 2CXOA 2F1IA 3PSAA 5IAJA 5A4JA 3HXTA 5L4NA 3HTXA 2CZCA 4LC1A 2CXPA 4B8YA 1JG3A 1GYQA 5FNVA 4ZVQA 3LC2O 4MUYA 4Z8XA 1ULHA 3I52A 3M8KA 4D80A 2YCBA 4UM7A 3BN3A 3LQYA 3T0GA 1QIIA 3W3AA 3OQOA 4A8HA 3BJMA 1V3VA 4A8JA 1E3MA 4B6JA 1A8IA 1TKBA 5M34A 1UJMA 2HHAA 2O20A 3DR5A 4I8IA 3DUFA 1QIDA 3DSRA 1RABA 4X44A 1MVOA 3VJKA 3B78A 1SQ5A 2HN9A 2ZWPA 5ICCA 3THWA 4LJ9A 4GOMD 4Z4IA 1K0UA 1R4MB 4DDWA 4OXKA 1JHDA 3KJHA 5ALTA 3OKCA 1QMGA 2CXSA 3K6KA 4ZODA 2JHFA 1D2AA 1XQVA 1CNMA 1MVLA 1IWBB 1WHTA 3DC7A 5IJ9B 2CV1A 2OBNA 4GM1A 1RQ7A 2H7XA 5BP7A 1U04A 1JG4A 4D42A 3Q3CA 2PGIA 2C99A 4EVIA 5FTLA 1V3TA 4A4DA 1ZAKA 4ECEA 2I6TA 1JP7A 1Z8NA 2J31A 2A4MA 3R24A 5JZMA 1YH3A 1T4BA 2OD9A 4AJNA 2E18A 2C8VA 5IVPA 2UUAB 4KGVA 4OQEA 4PF1A 4W7SA 1ZGBA 3DO5A 4FBMA 4D8YA 3E05A 3PUZA 4FXOA 1B6SA 2H0AA 2WHEA 3P52A 4LRXA 4MX8A 4AJOA 3DLIA 5D00A 2NTJA 5HILA 4CT0A 3FTFA 3JSXA 4X6UA 4YN3A 1EUCB 2B6HA 1FRNA 1SC9A 4F21A 4MUEA 2O8EA 2R5WA 1USWA 2QJFA 2ZAIA 2COEA 3O26A 2N0SA 4MI1A 4MP8A 3AI1A 1CBUA 4AL4A 4TMVA 2PEYA 2QV0A 1YNOA 2DFVA 4BKOA 2OM6A 3A1SA 5T3UA 3KSMA 5AW7A 3PUJA 1FXSA 3HVJA 3A3PA 4P33A 3MW8A 3ZDQA 3MGAA 5BV0A 5JADA 1TVKA 1TZMA 4YRNA 5DLEA 4EHIA 2IYZA 2OAEA 3WIUA 3S2GA 2D0OB 1IXZA 4AAYA 5AFSA 1TYEB 5KVAA 4GMKA 1VPTA 4RKWA 2QR5A 1PT9A 4DL9A 2VHCA 1SUCA 1RNLA 4W9NC 1JA0A 2F4NA 1W0KA 5ADHA 3IAS6 5J63A 3FNFA 3OUUA 2CB0A 3IRVA 1E32A 1X2EA 2GMWA 2AN1A 1DWQA 3LQQA 1UDCA 4RLHA 5F98A 4YWJA 2C2GA 3IBCA 4OHMA 1O0SA 1P8JA 1OT5A 1XALA 2WAAA 3DB2A 2XKJE 3HI4A 1FFGA 3BM5A 1FVXA 2ZM6B 4H27A 4HN9A 3HDYA 3K9BA 1A5SB 2Y93A 3QKWA 1XL0A 2LD4A 1M2VB 4RD4A 3RB8A 3WY9A 3X1KA 5JAPA 3U5ZB 2QPTA 4Z9XA 3DPUA 1NULA 1NJ2A 3IDAA 3FMVA 1MH9A 4J9UE 3W4JA 2DQSA 3Q3EA 4ZEWA 3O38A 5G4KA 1UJ5A 1J23A 5FO1A 1RS0A 1NTRA 1CQWA 3FWZA 3L82B 5ERYA 4D9FA 1MO3A 1NX6A 1XNGA 1EZ1A 3KYDA 1UJ6A 3DXFA 3R3WA 4Q19A 5SV2A 3SFVA 2CHVA 1TLFA 5DHRA 3DC2A 5G40A 1PQPA 1LPOA 4OJKA 3ZLVA 3Q8XB 1SCBA 2PH3A 3MJRA 2C1XA 5BN4A 1QGOA 3GNLA 4BO5A 3H11B 1S2GA 1ZZEA 1MBZA 3LCCA 4KQIA 1DRWA 4EJ0A 2XWJI 5KREA 3NOQA 1U2EA 2PU5A 2AEEA 2Z5VA 3Q0IA 2BDUA 4QNMA 4E2WA 1E64A 1Y3AA 4YJGB 5KKCA 2D2VA 3AP1A 3CT4A 1JFRA 1IZYA 2BBWA 2EQAA 4RD0A 2ZUEA 1MAUA 3VJLA 3FDIA 4G4JA 1CR6A 2Q0QA 3ZW8A 2ZYRA 1I51A 1OX5A 3ZZUA 2V9CA 4BPBA 3HV0A 1UDAA 4R83A 2C2WA 1O7JA 4NK5A 5LYJF 3S7ZA 3P96A 4AZ3A 3EGWA 3TVYA 1GD1O 1PT6A 2PZFA 3CUTA 1PWEA 1Z2DA 3H8WA 4G0XA 1MT3A 1LBHA 3V8VA 2JW5A 3PDIB 4EFDA 4ZK2A 1VRWA 1XEAA 3LY5A 4HQLA 4V3CA 4EI8A 1XI2A 1W0JA 2PY6A 2IHVA 3R3ZA 2IC5A 2XUPA 2YYAA 4ARZA 3DEIA 4BOYA 1KFCB 4O4HB 4PGAA 1D7OA 1SIUA 3GK3A 3PNLA 1PZFA 1C1DB 1Z35A 3A4MA 3E7DA 3JZIA 4M9QA 5DRTA 4A6EA 4DMHA 2VYNA 1C8LA 3EWNA 3EVEA 2X58A 1J56A 2DHQA 3NIBA 3WDKA 3C8UA 1V8DA 2CLOB 2TECE 3I2IA 5H16A 3VNAA 1T9BA 3ZCUA 4UQPA 1C7IA 3PZBA 3QE3A 4HJRA 4EUEA 2A88A 5E9QA 1TYBE 1FXWF 1ZJJA 1UPBA 5CDGA 4BAZA 3DE7X 1V3UA 3QW2A 4YBZA 3IEKA 2A5GA 5K3AA 3ZV3A 1I7DA 4E5PA 5CYGA 3B5IA 4KMSA 3TG2A 1IQ0A 4QEKA 3E8XA 4FLMA 2Q3DA 1EI9A 2YY7A 4NBLA 3HL0A 3H75A 2W2MA 2C2OA 1ZK0A 1PFVA 1N6LA 1PGPA 2QG4A 3GARA 3WV4A 1NVWQ 3B1VA 5K0ZA 2CDBA 1VL8A 3TR6A 3U4DA 1ZL0A 2ZIXA 3GV0A 2HBRA 1G7TA 1KYVA 3R20A 2VJYA 4TVBA 4P92A 4ENSA 3VVBA 1I30A 5CVUA 1X38A 3F8WA 3HO6A 3IT2A 3TUJC 1QSGA 5C7IO 2F00A 3I9MA 2IIPA 4B2LA 3OWXA 5JS6A 2ATXA 4DRXB 4DV2B 4WBXC 3VKFA 2V97A 2OBLA 2IOQA 5ARDA 4MUKA 3U81A 3LUFA 5FADA 1FP6A 3HJFA 2AC4A 4EI7A 4FKBA 2G04A 2OHJA 4O4JA 4KK3A 5ILGA 1RE1A 1E61A 1QFZA 3RIHA 8ADHA 1E9SA 3VFDA 3IPLA 1U7WA 3L9WA 1PSDA 1UPCA 2FUG1 1KI1A 2JLYA 1MOQA 1CJKC 2GSWA 4YRGA 2O14A 1H69A 3I2KA 1VDZA 4P22A 1KZ6A 1T5DX 4Y2PA 3E9NA 4DJJA 3IAUA 4X60A 5IKOA 1KDRA 1PZHA 5EJMA 2H4FA 2V3VA 4Y2TA 4CLDA 3O2NA 1WB6A 1PAUA 3QHQA 4LOJA 3NYIA 5AVTA 1AUOA 5JRZA 1WPQA 3LQ2A 4D4GA 5H3HA 1OSNA 3MMSA 2AV6A 4JFRA 1LDEA 5LJLA 3U9TA 2RGAA 4FMPA 1Z7BA 2QD1A 1QQ5A 4GR5A 1L7NA 5F51A 1C0LA 4G01B 1J0CA 2BFWA 4G41A 2NO0A 2ZFUA 3DKRA 3OT1B 3H86A 2X9NA 1HR0B 2FZCA 2C2HA 4QUEA 4BBPA 1C7JA 2A0YA 2GBFA 1U9ZA 4RPCA 4KBFA 5IT4A 4Z3OA 2WF9A 1KL7A 2DSNA 3I0ZA 1NBHA 1IWPB 1Z4OA 2X0FA 2VAWA 4BO3A 3WL4A 1VC2A 2QIOA 1LCIA 3EUEA 4XJSA 1HY3A 2CLCX 1G64A 1H3EA 4MYCA 5JRJA 1TYZA 3FPAA 2JEYA 1NR1A 2A9PA 2PQ0A 4R8VA 1DCKA 2REXB 3UO8B 3UJ9A 5EWJB 1ONSA 3LKVA 4RADA 2REBA 4GSYA 3FX2A 1I3MA 1WO8A 3DBOB 4PYLA 5KEIA 2GGSA 4WGGA 2AL7A 1BCSA 4WESB 2DG2A 3HJGA 2WKSA 3WICA 1E98A 1LPAB 3OCWA 4MWDA 3SSOA 4JXXA 3VDQA 1VP3A 3A2LA 3RSLA 1SJ9A 2R6DA 1ISIA 2PIAA 4G1MB 2BE9A 2OD2A 4RH0A 2QP4A 4AZ0B 1KSHA 4FR5A 3RQSA 2XCTB 3W6ZA 3KQYA 7MDHA 4EO7A 4GLLA 3WLJA 2WU3A 1AXRA 3THOA 2ODAA 1FX0B 1E6UA 1G7SA 3COVA 4KOAA 2YJGA 4F5WA 2XGSA 3A1EA 3D81A 5C8YA 3I23A 3WRWA 2PL3A 1BXZA 3MYYA 3F96A 4HTFB 1N3BA 4OI4A 1B2LA 1WNFA 2DULA 3VOSA 4YJ2A 1OV4A 4J4BA 2NSHA 1FTNA 2BGWA 1VBMA 3HC7A 4JLBA 3GAFA 1Z5UA 1V48A 3RS8A 4HHEA 2Y0PA 1T9GS 1VMDA 1RBQA 5DT2A 1AS0A 1JIUA 1UFKA 2HU5A 1E6CA 2IXDA 3THXA 2FYTA 4MB0A 2V7WA 4I6GA 2RAUA 2Z9BA 4I4LA 3W2GA 2J3MA 5EFZA 2O23A 2Q9BA 4JWKA 1FLVA 4QXPA 2B0CA 2X4LA 3FOWA 2Y0DA 4OHCA 4BKQA 3ZIAA 1OXVA 4LDNA 4C0XA 1CWUA 1CZHA 1XD2B 1RWMA 2PMFA 2CB9A 2VG8A 4NDZA 4ZO8A 3UENA 4FB5A 2VZ9A 5AKHA 2W2KB 2H18A 5HUQA 2P2YA 3OPQA 2BH9A 3G23A 4O2BB 3VU0A 1BE8A 3W5IA 4D8TA 1FVFA 4ERXA 3PG5A 2HBQA 1GZVA 3EFEA 3I04A 4IHAA 1LF5A 5CFLA 1H2BA 4C5BA 5DYYA 4MUAA 4PTZA 3O94A 3D54D 5E9AA 4CEJB 5DULA 1UDBA 5DHUA 3KD3A 5ECYA 5JO9A 3WYGA 1BHSA 1VE9A 4ISBA 4RVUA 5A4MS 1GT91 1RWWA 4YMSA 5BORA 1P0MA 3AJ8A 4U0KA 4EHKA 4LYJA 5T67A 1DDGA 1WDMA 4IW3B 4W4TA 1BQEA 2PM8A 2CYCA 4YR9A 4DR7B 2IYYA 1QWSA 4PXAA 2AYXA 5EGSA 3RBAA 1JAYA 3F2VA 3WLIA 3OTQA 1SIWA 4P2GA 1R6XA 2X77A 2OV1A 2H48A 2VDNB 3DBIA 4Q1CA 1YS1X 4PZZA 1ATIA 4XYGA 3OUTA 4U3JA 1BXGA 2PYDA 4JH0A 4X20B 3KT3A 5AHKA 4ER3A 1S4QA 1GR0A 4O4IA 1FMJA 4RVSA 1PDVA 4ZVUA 3R7WA 4ENPA 2B3TA 2BWJA 3TDKA 1FFSA 4OXXA 2ZJ7A 1GTZA 1THTA 1G66A 1MEJA 3I6IA 4EL5A 2Y1CA 3VNUA 4OAQA 2EX1A 1P1BA 2Q3JA 1NLZA 2GAIA 4FHFA 2VDWB 1PUIA 1Z3IX 2Z9CA 3AOGA 3S4YA 1T8RA 5JLAA 3NZEA 1P6XA 1KBQA 2Q29A 3PJEA 4KQMA 4UUMA 2VUIB 2XMPA 4DMMA 2RE8A 1M33A 3FFXA 4QYIB 2G4VA 3GNSA 2VDVE 2QAJA 1DFIA 2XI4A 4NONA 4ZO7A 5T7BA 2H1WA 1OBFO 1QDLB 3A10A 4UAVA 4KIGA 1NR7A 3O92A 3Q0TA 3QUCA 4FMDF 5HQTA 4A10A 4DLBA 1Q17A 3ROFA 1YTUA 1M2EA 3MJVA 3C85A 1T3TA 3NB0A 3JQ8A 3ZC3A 5IU6A 1YDMA 4FYHA 5DIZA 2A1UA 1L3CA 3V2HA 4BMVA 1P1RA 1IK6A 1KF0A 4GNRA 1GPBA 1S3SA 1JPVA 2GJ9A 2IXGA 4LZJA 3IUNA 4NCXA 1BA2A 2G83A 4EZEA 1I0ZA 2FZLA 1ID1A 4C0JA 1P1IA 4GGPA 3TRJA 3NEYA 4ATNA 5TLSA 4R1MA 2ORWA 2RHMA 1FRZA 1NQVA 3K8YA 2ZPTX 4K0RA 4I8DA 2C94A 5CGQB 5E4FA 4ENVA 2XD9A 1XMOB 1JQ3A 4MQ6A 4B6RA 4AI6A 4KX3A 1RI1A 3AC0A 3RAEC 1X8JA 1ADJA 4E11A 1QONA 1YKGA 2C04A 5G0TA 5CAEA 2BTEA 2KS6A 1ESNA 1B00A 2GRUA 3I62A 2XXAA 2PAFA 1IC6A 1KI2A 1KQPA 3SF0A 3WP1B 2JI7A 4BZXA 1ICIA 3QWBA 4FYWA 4XUDA 1MX1A 2PS9A 2ZTHA 3R0JA 3RRYA 2AJCA 2O0KA 3U1BA 3TD2A 1H9AA 1YAJA 3LL7A 4KACA 4Z0NA 3ICEA 5DBGA 2BSAA 4O3FA 5KQLA 1HL7A 2HZ7A 1Y34E 1RWVA 2KSQA 2QWXA 3ER6A 3QEKA 4BNJA 3HWX1 4ZCMA 1GR1A 1SGWA 2CY0A 3AI2A 3M6VA 1CQZA 1MQ9A 4GMGA 3DFIA 4FIDA 3ZX4A 3WYCA 4OM7A 4ZYVA 4I36A 4P3YA 1XRNA 3AF2A 2H4WA 4HPJB 3U0BA 5C3MA 5BNFA 1SH7A 2H92A 1G3IA 1XG5A 6PFKA 3W2FA 1CFZA 2OFXA 3FUCA 3IQHX 1ZI9A 2C2ZA 3TRFA 4EFMA 3OWOA 4CDNA 1TUGA 1QG6A 2TSYB 1JQBA 2FK8A 2G4CA 5KNBA 3H1AA 5IARA 4O2AF 2IHNA 3G1WA 1LSJA 2J09A 3DBVO 2W00A 3PE4A 4F1WA 4RF4A 5THQA 4EGFA 4AP6A 3ZD7A 1M0EA 3SZMA 5LP6B 1UKVY 2JGDB 4NOKA 3TEMA 1T8YA 3ZJ4A 1R0CA 1XCBA 1UJ2A 2R1ZA 4P54A 4RFLA 5DH9A 3DDHA 4FWIB 5K0GA 2XB6A 2ZJZA 1P0CA 5EHQA 1JWLA 1DWUA 3KQPA 3LA8A 4LYGA 4A36A 3ZN2A 4EATA 4KTTE 3NV9A 5HEKA 4URXR 2ZUFA 5FUXA 1T5IA 2IRWA 3I2GA 4DCSA 4U2DA 3JQ9A 2O54A 3WKEA 4D8XA 1G5TA 3BE6A 4RHXA 5HKOA 5CNIA 4I2VA 2VF5X 4AUKA 1U2QA 1ABBA 3TF5A 4PGGA 3PWTA 4P82A 3H05A 3GDOA 2VTDA 1LK0A 1OX4A 4N48A 1J90A 2Z2XA 1GM5A 2HDWA 4FYVA 1V45E 2Z2KA 1F2TB 1IHPA 3ELWA 1RLJA 4QUIA 5FWDA 3WI7A 3GDFA 2XR1A 4DMUB 1RJ9B 2XUOA 1I3CA 3MT7A 1GLVA 5D1NA 5TVKA 1Z08A 1YRHA 5LZ2A 5CX4A 1U1EA 1PD0A 3RYCB 1HDCA 1YZYA 1PNOA 2GD2A 1K5GA 1Y7TA 3NYQA 3PHGA 4NYJQ 5JZBA 4Y98A 3CRZA 3AVVA 2AMJA 4QBGB 1Z88A 4URHA 1GKUB 2R4UA 4MUFA 3U7IA 3ZPXA 2N3ZA 3GZNA 4CN8A 4FS3A 3J7AC 1TMGE 1QR2A 3RUAA 2XYQA 3DXYA 3MELA 4OXYA 5JD5A 4R8KA 1RVDA 1IHYA 5TMDA 1R37A 1DB3A 3KEFA 4BECA 4CJXA 1VE5A 3FUVA 3A6ZA 1OQAA