1P4SA

Solution structure of mycobacterium tuberculosis adenylate kinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural and Dynamic Studies on Ligand-Free Adenylate Kinase from Mycobacterium tuberculosis Revealed a Closed Conformation that Can Be Related to the Reduced Catalytic Activity.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 49
structure length 181
sequence length 181
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p4sA00
4DCVA 3OE7D 4X8OA 4IW3B 1OXXK 2QPOA 3WP1B 2QAGC 4DLRA 2ODBA 2VEDA 1IHUA 3P20A 4P4TA 1CLUA 3L82B 3HU1A 2W58A 4GFDA 2PT5A 1HE8B 4M0LA 1NVUQ 1XZQA 3CWQA 2B8WA 3U7GA 3KDSE 3NH9A 3W34A 5LB4A 3REGA 2GF9A 3N2IA 2IA5A 1PZNA 2BWJA 4LY6A 1YZTA 2FZLA 3T06B 3JVUA 3PV0A 3UMRA 1P2SA 4LC1A 4D0NA 2BC9A 3OEEA 3RSLA 2D7DA 3QNUA 4GMXA 4C9BA 4OHWA 4DWJA 4HB0A 3AVWA 2ZRPA 4E07A 1UF9A 4PX9A 4UNPA 2IYVA 3M0EA 2ZRDA 1E2DA 2VRWA 2HJVA 2BVNA 4HZUB 2D4HA 2YKGA 2BHRA 1KI9A 1DARA 2XSZD 5EE3A 3U3RA 4Q4AB 1NL3A 3HYTA 5AR1A 4DT1B 1L8QA 3AVOA 4ITRC 2NZJA 4NCNA 3ADKA 4NBSA 1R0ZA 2P5TB 4TMWA 2ZS7A 3AQ4A 1VIAA 2LCFA 4JT2A 5DYIA 3SFVA 1AN0A 1FNMA 4TTQA 1J8MF 4OI0A 4LJ7A 4Q7JB 4YMWA 1Q1ZA 1HT2E 5KYKA 2JLZA 3AKDA 1G7RA 2ZQ5A 1J99A 3CRRA 3BWDD 1S8FA 4B2LA 1E32A 2FZ4A 5EUMA 1X8KA 4YMVA 1ZYUA 4BECA 2GZAA 4MYCA 3UMSA 3PEUA 3PEVA 5KOYA 5KSYA 1W1WA 2RMKA 2KJQA 3TUZC 4BRUA 2EVWX 1P2UA 1HEIA 2FSFA 4ZDKA 4CEIA 5GJWC 1CR1A 2FF7A 1TL7C 1DELA 1EGAA 3B60A 4AKEA 1CRQA 2BMJA 2ZRCA 3VR6A 3THXB 3U4QA 1GIAA 1RZ3A 1D2MA 4HUTA 1NJGA 4M9SA 3QVUA 2GTPA 4A8JC 5DLQC 3ZIAA 4LBZA 4I1OA 2A5JA 4A92A 2RAPA 3KUCA 3BERA 4QBHA 2ZI9A 4GRAA 3LQQA 1G9XA 2GBLC 5CLQA 4C0AC 1DAFA 1NVVQ 3WRYC 4OKSA 4IEEA 4Q1DA 2HF8A 5JLJA 4Z1MA 1YR9A 4W5WA 3RANA 4W7SA 2ZI3A 3Q8XB 4MRSA 5EZ5A 1X8LA 1Z6YA 4NMMA 5HZKA 5FPHA 1ESNA 1JR3A 2BIFA 3EC2A 4DC9A 2QTVB 1W49A 4HDCA 2REXB 1GILA 4BLTA 2NMVA 3VX3A 2IS4A 2RH5A 3LNCA 4ZDIA 4URXR 1AK2A 2L0XA 4TYNA 2QRZA 3I72A 1J7KA 3DZDA 1S9HA 4DVGA 3PUVA 1VYVA 1AA9A 1KO5A 1N5KA 1Z2AA 2IYLD 4GSYA 5EZ6B 4A1FA 3EPHA 3KXKA 2IYQA 5DHAA 3H1TA 3QF4A 2RGAA 4BZQA 2XZOA 5TXGA 1E99A 3Q72A 4WA7A 1YZGA 3PENA 5SZHB 2BEJA 3DEFA 5HE9A 4ZKDA 4O2RA 3K9NA 2O8EB 3GEHA 3LAWA 3THYB 1OFIA 1OW3B 1LNZA 4L8GA 3VU9A 1S2MA 3E70C 4Q4HB 4F93B 3CBQA 2QORA 1GUAA 4PHTA 4DJTA 2EFEB 1W0JD 3NH6A 3IIKA 4NYIR 2QUZA 2ZRHA 4HLUC 4CIDA 1TQDA 4IFEA 5AJXA 3ZDQA 4BFTA 3K0FA 2DWQA 4F4JA 2KB0A 4RD0A 3PJRA 3QBVA 1XJQA 3RS4A 2ODEA 4OQFA 5DYGA 4WZAE 1UJ2A 4EPRA 3GLIB 3BGWA 2GJKA 4K81B 2C2HA 4QOSA 4HLCA 3S1AA 1RRPA 4QFMA 2JIZA 2NIPA 4AIIA 2QPTA 5D3MA 3TH5A 3EZ7A 3NG1A 3UKDA 2BKEA 4KV9A 1S3SA 2DFLA 2F43A 5H8WA 4LUCA 4IOLA 1R0WA 4LBVA 5GJBA 1KDRA 4BQSA 4Y0AA 5JI3E 3EPKA 2ZRAA 3ZZTA 2OE2A 4DSUA 4PZYA 2JA1A 1L2TA 3K09C 5AJWA 1KDPA 1Z5ZA 3KQLA 4KVAA 4BLRA 5K8LA 3LQRA 2FPLA 3LBIA 4CZ2A 2AK2A 2AX4A 1XP8A 2OSBA 2XB4A 4LPSA 3RAPR 3B9QA 2ZI7A 2GXUA 5TY0A 1CF4A 2GCOB 1TU3A 1T5IA 2A5GA 2FWRA 3QVVA 2GETA 4NKRA 5AUNB 3QEOA 4JKIA 2WJIA 4Q00A 2J1LA 4Q66C 2VO1A 1Z0JA 1GRNA 2WPDD 4YMUA 2RGCA 3TAHA 2NO1A 1N5JA 4UXHA 1RFLA 4JL6A 1IBRA 3DDCA 4QNRA 4RD2A 1SULA 3GLGA 4TLEA 1CP2A 4V0ME 1TADA 1Z22A 4YMTA 1A82A 1OHHD 3MWKA 2RGNC 4OQNA 3EA5A 2BM1A 3FHOA 1ZNZA 4JZKA 4E5UA 1OXTA 4C0HA 5DISB 1R8SA 4JYCA 4C2UA 2BBWA 2QQEA 1PUIA 3QKRB 2WKQA 4TMXA 3SC3A 4CEJB 3LY5A 2C9YA 4LPKA 4BFUA 5AUOB 2NTYC 2W0MA 3H2YA 2VSOA 2GEDA 2V1XA 3B1XA 3FGNA 4MYUA 2BV3A 1R5BA 1LB1B 1OFUX 4JMPA 1D2EA 2PL3A 4Q7MB 3K70B 1X3SA 1ESMA 3JZAA 4A6XA 1N6HA 5BQ5A 1T5LA 1OH6A 1SXJD 4HDQB 3CF6R 1XB2A 1JXOA 3NBFA 2QZ4A 3NEJA 1HH4A 1TPZA 3ZJYA 3UWKA 1FMJA 1U2RA 4D6PA 3QSYA 1E2MA 3EZ9A 4M9XA 1OB2A 1WE2A 3A37A 1COWD 2ZSAA 2QMHA 2XZLA 4ZDWA 3ZQ6A 4URVR 2VTKA 1XF9A 3SI7A 2IS1A 3T1TA 2DPXA 1Z2CA 3ETLA 1Q22A 1N5LA 4KVGA 5FUYA 4TL6A 1R0YA 2R6DA 2W6ID 2FSGA 3IDQA 3PCRB 2ZS8A 3RLFA 2ZAOA 3K9HA 4B3CA 2IC5A 3P32A 2P0EA 2WSSD 1C4OA 2ZYUX 3K1JA 4Z51A 1IN4A 4RZ3A 1OIVA 4KCGA 4AK9A 1QVAA 1XXHE 4OHVA 4DXAA 1ANKA 3BB3A 1UEJA 2WMNB 2ZTSA 4ZDJA 3FHTA 4OHZA 1NN3A 2HT1A 2GWHA 4TSFD 3CO5A 4XVRA 1OXVA 3X1YA 1A1VA 2YWEA 4LHXA 5EE0A 1JR6A 4JL5A 4OQLA 1ZRHA 2AXNA 2WWHA 4D80A 2FX3A 2XSZA 4K8OA 4D82A 3LX8A 5BWMA 1GFIA 5F3WB 1M74A 1Z6AA 2WM9B 3KJEA 4AURA 2CEAA 2OCAA 1OFHA 3AKCA 4GDFA 4MYTA 2FA9A 4F91B 4KFRA 2A3RA 4MKHA 1G6HA 1Q1BA 4HI0E 4JYBA 3RRZA 4PSKA 2YNMA 2C98A 4KYIB 1WA5A 1DEKA 1SVWA 5L8VA 5LB2A 3X1XA 2OO7A 4K46A 2GILA 3A4LA 1E2NA 2QAGA 3W3ZB 3OF5A 2BJWA 3K0CC 4M2LA 1DG1G 4TLBA 5IRCD 5JEEA 4I4LA 1NKTA 1VYUA 3BC1A 2CE7A 2IT1A 3QE0A 2AKAB 1D6JA 3C14C 2D3WA 3ZZUA 4ZIRA 3UATA 1P2VA 2G1KA 1E79A 1V43A 1W0KD 2D74A 4BLPA 3BFVA 3FFBA 6Q21A 1WBDA 4UJ5A 3FOZA 4TZ0A 1D9XA 3WNBA 4XD7A 3EIQA 1P73A 5C4GB 1H8HD 1CJVC 3ASZA 3QG5A 3HPQA 3KKOA 4HSEA 3R7WA 3W5JA 2A5YB 5JECA 2H8KA 3EZFA 1SKQA 1CR4A 1NBMD 2XJ4A 4MGKR 2XX3A 3V9PA 3CM0A 3AF4A 1Z28A 1ZC3A 3MAAC 4PC2A 5FTLA 2Q9AA 3CWZA 3PVSA 3B1WA 3OIWA 1G4AE 4OYHA 3VU9B 1FW6A 1IXRC 3BORA 2GK7A 3D31A 4H1UA 4M1KA 2JLSA 4Q4LA 1E9RA 1E2JA 1M2OB 1JAIA 1W5TA 3BIFA 1C9KA 4HAUA 4B47A 4NTZA 1S9DA 4NYMR 4GOXA 1SZPA 2KI5A 3MUFA 4WIAA 4FWTA 3AVQA 1LV7A 1XX6A 1XEFA 5UKDA 5JCZA 3OIVA 1FQJA 5CDFA 3TLXA 1S1CA 4HEJA 4LBWA 5H68A 4C2TA 2EFCB 4L5BA 2W2VA 3CR8A 3ZH9B 1NN1A 3C41J 3S1AB 3IIMA 1ZBDA 3IPXA 1NIPA 1W44A 2WWXA 3AGPA 5CITA 5J4YA 4Q9LA 5D3MB 5HPYB 4EIWA 1FZQA 1JEDA 1PLLA 1U0JA 2AWOA 2F43B 3CF2A 2IS6A 1Q1EA 3B7GA 2LKCA 3IEUA 3TUJC 3UANA 2SHKA 4YLGA 3OIYA 3QKUA 1ZUIA 2HLDA 1EK0A 1AGRA 3QG1A 4EFMA 5JHHB 5JWRA 2A78A 2WWWA 4M1TA 2PEZA 3KUDA 3WXMA 3NHBA 4KLNA 3SE0A 2DHRA 2ZRIA 3N2EA 1W0JA 4A8JA 5BN3A 3LWNA 1GM5A 4N3NA 3TQFA 4FXPA 5FR2A 2V55B 2CNWD 2ORWA 4UQOA 3VTKA 1CS4C 3NBYC 3B6EA 1ZM7A 2FGJA 2GBLA 3L0SA 4YONB 4D26A 4S2EA 2G0NA 1J2JA 1XD8A 3E1SA 4J0QA 1EXMA 4UKDA 1ZCAA 4FD2A 3TBKA 5C46F 3PUYA 1S0UA 1FX0B 3WMGA 2WJGA 2EFGA 2CL7X 2HJGA 5LDDC 3EX7C 2NO6A 4MKIA 1ZIPA 1NG1A 2J59A 4H1VA 1OE0A 4UNQA 3LO5A 2AR7A 3AUXA 4R71A 2J87A 3GLGB 5GVSA 3KZ1E 4NDZA 1SVSA 1ZUHA 1M7BA 2IYUA 4WZ6A 2BDTA 3CONA 3RS2A 3GLHA 4DHEA 1IY1A 4Q01A 4DSOA 1NJFA 3FWYA 5JZVA 4PHHA 3KX2A 3ZQJA 3WY9A 5FPKA 2QMUA 4TMVA 4PSVA 2WMOB 2BBSA 3L8ZA 4P32A 1DAMA 1E2LA 2VP0A 1W36B 2J0QA 2GA8A 3GFPA 2KWIA 2P6UA 4RZUA 4TTRA 5CB8A 1TQ4A 4LV8B 4WXRA 1KK2A 3CNLA 4FMCF 2RHMA 3WHKA 1UADA 1B23P 3QKTA 2VL7A 4S35A 4EJSC 2OG2A 1Z0FA 4TYWA 1E94E 3KFVA 1SHKA 4TYQA 4O3MA 4M1WA 5A4JA 2CJWA 2PJZA 1LW7A 3Q9LA 4C0KA 4M8NE 1RKBA 2ZIAA 3GLIE 3A1WA 4DIEA 5FTJA 2XEXA 1S96A 2VP2A 2Z6VA 3T5GA 4F7WA 3KQKA 1EFRA 1KDTA 1OHHA 4AKGA 4Y0VA 1KTVA 3KXIA 4OQXA 2C95A 3AVYA 2F7SA 1EESA 2W83A 4JLJA 1KY3A 1KI8A 4PSAA 4US2R 4XWKA 5E7MA 2ZYTX 1TEXA 5JEDA 5LD2C 2J5XA 1WBBA 5BW8A 1KSGA 5JMTA 2RKOA 1KMHB 2GJAA 2HXSA 2PCLA 4PAMA 3CUEF 2ZUDA 2PMDA 4LC0A 2JLYA 2IYWA 5EE5B 5BYKA 2QE7D 4NYMQ 2Q6TA 2HT6A 2ZRNA 2ZU0C 3K09A 4RD6A 5FOTA 1WP9A 3QEJA 4UNSA 5DI3A 1EX6A 4I99A 5TB5A 4QKQA 4GP6A 4IRUB 4Q1CA 1R7RA 1KO7A 4Q1FA 4DBLC 1FP7A 3FKSA 2A30A 1V5WA 1CRPA 1JJVA 1E4YA 3DZ8A 4MDEA 3T1VA 2YOFA 2W2TA 4AG5A 1KI6B 2H92A 2QI9C 4FWIB 2ZRKA 1WCV1 5EUQB 1COWA 3CNNA 3W8RA 4U7DA 3MG9A 2FEOA 5CM8B 2RGGA 2UZ3A 2R6CA 3CPEA 4KODA 2KBFA 4U5XA 1QHXA 1I2DA 3AEZA 2VSXA 5JJIA 2FFAA 2FG5A 4DLTA 3IKJA 4JT4A 4OK3A 4F4IA 3A4MA 4MGIR 4ESVA 1QHHA 1CJTC 2W6IA 4HLQB 2DB3A 4AY2A 4TQUS 2QSZA 4G5RA 5KNDA 3CRMA 2BBOA 1J70A 2HUPA 2WSSA 2QROA 3IQXA 5DH9A 3TRFA 2RGNA 1L4YA 1XRJA 2B92A 3K0AA 3U3KA 1RJ9B 1VKJA 2J0UA 2NO0A 3CB4A 1S4QA 2OV2A 2YOGA 3LW8A 2F1RA 2QAGB 3VR2A 4ASUA 4MRNA 2X2EA 1ZINA 1FTNA 3KTAA 4R2IA 3I5XA 1D8TA 1ETUA 2G1JA 4PO8A 3LW7A 3QXHA 4DCUA 4TLAA 1OFTA 1NVVR 2X1VA 3SU8A 4FN5A 1YJ5A 3HYRA 4OJKA 4W5JA 4QJ5A 1XEXA 2B21A 3AH8A 1LY1A 4GNKA 4EDHA 2UZIR 4A4DA 4A2WA 3J81k 4MITA 4CVNA 2Y8EA 1WXQA 3PQCA 1MOZA 1N6OA 1Z6XA 3DHWC 4DDVA 2QT0A 1FFHA 1Z6GA 5C2JB 5EXTA 5A0FA 2GVZC 2J46A 4XSHA 1IOZA 1KNQA 2A5DA 1R10A 2FSIA 4Q48A 3LX5A 3F5FA 3DM9B 2HXYA 5CIWA 2BCGY 2FH5B 2YZ2A 4ESHA 1VHTA 5CIQA 2GXQA 3A1VA 1N0UA 2X8AA 3N70A 4PC1A 3ZS9A 2F3RA 1GL6A 3AP3A 4Q7KA 4ZCIA 2WKPA 5H70A 2QA5A 2ZJ8A 4GT1A 4NH0A 1NG9A 3TSZA 2VSFA 2JJ1A 1YQTA 1VMAA 1G8HA 1NN5A 5HTKA 4F38A 3U6BA 1KI2A 1PVOA 4Q9JA 1XTIA 4M1MA 1F3OA 1AZSC 3GLFA 3B1YA 5CLLA 3CKLA 5BN4A 2NQ2C 1XMIA 4PQRA 3RRMA 3WYGA 5KDOA 5CM9C 1H8HA 4FMBB 3SR0A 1VG8A 4BLSA 4B43A 1BMFD 3TIFA 2XXAA 2F3TA 1G18A 1KSJA 2IW3A 2AWNA 2BJVA 5FOWA 3GJ5A 1NBMA 2OBMA 3IGFA 1DAHA 4E22A 1LS6A 4IVQA 3LVQE 1G6OA 2O8FA 2R6FA 2ZE5A 4PAQA 3PUXA 4E03A 3AP2A 4MRPA 2ZJ5A 4MGYR 3OAAD 4TT3A 2NPFA 2OCPA 4P0TA 2R6AA 4KJZA 1UM8A 2IYRA 5FPTA 1NY5A 1E1QD 4POAA 1OKKD 4TWZA 2V6JA 3DKPA 1T4GA 1N6NA 5FOXA 4TLCA 2AD5A 2VF7A 1K6MA 4ZI3A 2VHQA 2QMOA 5KTYA 1N6PA 2J7PD 3K0CA 4LJ8A 1G41A 2V7QA 3AKEA 1JR3E 4NL4H 1PV4A 4EPVA 4ARZB 2IWHA 1A2KC 3D7MA 1QF9A 3C5HA 1YVDA 4B6EA 4EQ6A 1UKZA 2GZDA 2WWYA 2GK6A 4A36A 1OIWA 5FBVB 5FPYA 5C1BA 1G8YA 1XD2A 2XTNA 4P33A 5SZKB 2VH5R 4CF7A 5HR5A 3ICEA 1ZNYA 1TF2A 1NSFA 3WMEA 5CJ2A 1MV5A 3SJCA 4RCZA 2IHYA 3P26A 3SOPA 5IK2D 1AGPA 2PLRA 2J7KA 2ZEJA 2BCJQ 1SVOA 4C0BA 2IF0A 1ELOA 2CNWA 1DOAA 3H4MA 5DNYB 1X6VA 3PR1A 3GEIA 3SFZA 1G8GA 4DDUA 1NNEA 2JJ2D 1NMXA 4LDJA 1E2FA 1OT3A 2HYIC 1UKVY 2Z43A 1U81A 4RFSA 1OIXA 1G20E 1FTSA 4HB3A 3FMOB 3TQCA 2ORVA 1GDDA 3U44B 2ONKA 3IHLA 3BXZA 4FI3C 3H86A 4OBEA 2ODNA 2ANBA 1G8PA 3B82A 3RHFA 4C0JA 1ONBA 4ZI2A 4RD3A 3TAUA 4DSTA 1Q3HA 1G3RA 3TMKA 1DAKA 4HAYA 1CJMA 1G1MA 4NCKA 1AS0A 2WHXA 5B64A 2CHGA 1ZCBA 1VG9B 1R4AA 3LA6A 1JAHA 3ZD7A 1BS1A 4P31A 3FTQA 2XTMA 3BAFA 5JS7A 5FPSA 3TVTA 4B32A 4X8HA 4QNMA 1YZNA 2W6JD 2P67A 2YC4C 3CLVA 3ADDA 5IT5A 2CLDX 1U0HC 2VA8A 1IJFA 3I3SR 2JCSA 5KDDA 3D3QA 1IN6A 5CK4A 1U0LA 5J5CA 1E3MA 3W6PA 3L0OA 3QENA 4KITB 1IXSB 3UWOA 5DI3B 1XTSA 5AWFC 2XNDA 4P3YA 1TAGA 4G0NA 2FPMA 4BPBA 4KBGA 4LJ4A 1VECA 2WICA 3B1VA 1PLKA 1E69A 3RWMB 3K8YA 5K8TA 1CR2A 3LBHA 1TEVA 2OZEA 3EG5A 3ZVRA 4B6FA 4WAUA 3IEVA 4LCBA 4XVQA 2IWRA 4I81A 4LYFA 3UG6A 4DIDA 2RGDA 2AL7A 2C96A 2VF8A 1G4UR 1US8A 1YKSA 2ZJAA 4G5GA 4LI0A 5CB6A 1E96A 1CULC 1UFQA 5J4HA 4LJYA 4JSTA 4G5QA 3VMFA 3WRXC 4PC6A 3GLGE 4AWXA 1B0UA 3SJZA 1U8AA 1KI7A 3RS7A 4CEHA 3HP1A 1E2IA 2WJJA 1G5PA 1IN7A 4PHGA 521PA 3CPHA 4QL3A 5BXQC 2R62A 2RHDA 3LXRA 3QPUA 1KO8A 2QE7A 1MH1A 4Q5IA 2O8CB 1BIFA 3IBYA 5EJEA 1Q20A 2J0UB 3T5DA 5JWOA 1E6CA 2QBYA 2ASEA 4UNNA 2XTZA 5KNCA 4ZCLA 1SQ5A 5FH9A 4EPYA 1EWQA 2J0SA 2HYDA 3WMFA 5FL7A 1SXJC 2YWFA 2WWIA 2ATXA 1VYTA 1KKMA 4EJSA 1XEXB 1NI3A 4D4LA 1XCGB 2WWFA 1P9RA 1YRAA 4OQMA 4BFYA 1GP2A 4B73A 3CW2A 4QJ4A 4URYR 4US1R 4PXAA 4MDFA 1KO4A 3B13B 3FKQA 5EE9A 2NG1A 1ZM4A 1ODFA 2O5VA 2WOOA 3Q3JB 1OB5A 4A2PA 3HR8A 1XFAA 2NPIA 3CH5A 4P4SA 5AUQA 3ZLJA 1E2HA 4GZLA 3GP8A 3CX6A 3NWJA 2D2FA 1P61B 3LLMA 5KNBA 1SGWA 2ZRFA 4BEBA 1SVLA 2A9KA 4Q9KA 1QG4A 5DGXA 1NLYA 1JPJA 1CBUA 3LBNA 4NHOA 1GTVA 4IHQA 3F8TA 4O25A 2UKDA 1T3SA 2IXEA 3BFKA 2OILA 2IEZA 1CJUC 1GAJA 5FBLB 1TUEA 2ZE8A 3L0PA 2CCGA 1IJEA 3DMDA 3NC0C 1GITA 1HUQA 1E2QA 2VP4A 2ZANA 1IN8A 4B2IA 2WZQA 3C8UA 1MABA 4FMDF 3UIEA 4AG6A 5EXPA 4BLOA 4JS0A 3GJ8A 4ACBA 4M21A 5FUVA 2XXAB 3OZXA 4TMKA 1KKLA 5J4VA 3VKGA 4TYPA 1M8PA 1P2TA 5KPDA 5JJLA 2JLUA 4IDPA 1NF3A 2IUUA 2XNSA 4JBWA 4LYAA 1GNRA 2A7QA 2Z5FA 4W9MC 1O87A 3U7HB 2JAQA 3Q7QA 2O8FB 4DB4A 3SNHA 2ZVPX 4OHYA 1GRQA 3AVTA 3JZMA 2XJ9A 4OHXA 3OFNA 2EFHB 2ZREA 5HCIA 2ERXA 5G3YA 5FI1B 3OE7A 5L3SA 1GKIA 4GOJA 3O8CA 1KJYA 2QT1A 4DEYA 1M7GA 2DFNA 4X8LA 1NSTA 1TX4B 5FTMA 4PC7A 1JI0A 1RRFA 2J3EA 2ZJBA 4EFNA 2RGXA 3TW4A 1N3BA 3IO5A 5EP3A 3GMTA 2GESA 1XMVA 2V8OA 4LBYA 1R6BX 1BMFA 2FFQA 1WDTA 2CLSA 2Z4RA 4NU0A 4F92B 4OI4A 5ANRB 4GL2A 4GPTA 1DTSA 4V0LA 4BE7B 2GEUA 4V0MA 1J90A 1AIPA 3ICQB 3MSXA 3AVVA 3RABA 3NKVA 1ZM2A 4QC2A 1XD2B 3W5IA 4R98A 4KU4A 4CEIB 4U02A 4TL7A 3Q5EA 4LJAA 3OAAA 1VPLA 3KFXA 3U60B 1U8ZA 2EWWA 4II7A 3U4QB 4JJZA 1DADA 4YDSA 3GCGA 5B30A 4V0OA 4TQ9A 4AYWA 4DEXA 2EFDB 2QY9A 2PJRA 1OKKA 5DN6D 4GOKA 4DUGD 3CF0A 3EPJA 2RCNA 2JATA 4B35A 1YZKA 4YC7A 4ERNA 1R0XA 2Q9BA 4R9UC 1U8YA 3VKWA 4HAVA 5GADl 2P2LA 4DLVA 4IDNA 1ZUNB 5JCPA 3RNLA 4R2HA 1II0A 4B2PA 3OEHD 3KJGA 2MMCA 2ZSDA 4RZXA 4MKFA 4LWZA 2KE5A 4MH0R 4Q19A 5TV2A 3O8DA 3AM1A 1JJ7A 3GJXC 5EP4A 3R9XA 3B78A 5J40A 4Q18A 2WIBA 4CDGA 1XU4A 1Q21A 4IJMA 4A82A 2CDNA 5EE1A 4B34A 4WOPA 1EG7A 3HPRA 4CT5A 5IK2A 4CYMA 4LJ6A 2ZM5A 4LHZA 2HCJB 3ZVMA 5IDVA 3KB2A 2FDCA 4PZLA 8OHMA 2OXCA 2YYZA 3QF4B 1GKYA 5EXSA 3V4FA 3DKVA 1F2UA 2JJ2A 3VHXA 2ZSFA 1F2TA 2DYKA 1E0KA 1XXHA 2F6RA 3BD9A 5FTNA 1FUKA 1RYFA 1R8QA 1UPTA 4Q4JA 3AGQA 4IDQA 4RCYA 4B74A 3I5YA 2BOVA 4DDWA 4GI7A 2J45A 1N25A 1TTTA 4QM7A 1I4TD 2DR3A 1IQPA 5AUPB 3QPVA 2P6NA 3UK6A 2AFHE 1Q57A 3W90A 4DRZA 3PEWA 2HV8A 3MWYW 2O8DA 4UXIA 1ZU4A 3K70D 5K8UA 1UBGA 1FP6A 4Z8YA 2ZPTX 3SBEA 3I73A 1CTQA 2ANCA 1UBEA 4QGFA 3K0FB 3T1QA 4A0GA 5DSZA 3TNFA 2QG6A 1DS6A 1KO1A 1N5IA 3FMPB 1IY2A 2AN9A 4PTLA 2K5UA 1HT1E 2WWGA 4CEHB 2W6JA 3GLHE 2J9RA 3IILA 1KAOA 2OXRA 5AJVB 2PH1A 1DE0A 2ZRJA 2C78A 4M9QA 1Z0DA 1G3MA 4L9WA 1DVRA 1ZD1A 1E9DA 1W4BA 4B76A 2JASA 1H8ED 2QBYB 2BMDA 2OCYC 5KUTA 3GPLA 1U94A 2IF2A 3L0IB 1NP6A 3E5HA 2FFHA 3EARA 3R9IA 2IEYA 3PITA 5KHOC 3QUSA 3BH7A 2I1QA 2EU8A 3EXAA 4JIMA 2R6GA 3DOEA 1XCPA 2Q3MA 2JLVA 1SHZA 4IXMA 2RGBA 2YWHA 4E09A 4EJSB 1N6RA 2GJ9A 3DPUA 4BFWA 3C7KA 3U61B 1Z06A 1YZUA 1ZM3A 3CX7A 3P27A 5ELXA 3SHWA 1E9CA 2F1IA 4HZUA 5HZHA 4I1VA 3WNCA 3HU3A 1U9IC 4EKDA 3GJ7A 4EPXA 4Q4AA 1CKEA 2CHQA 4P4SB 2ZXUA 1H65A 2V1UA 4DT1A 3TSWA 1XPOA 1ZD9A 2W0SA 3EWSA 3IPYA 3I61A 1RIFA 1XTQA 2QL6A 3GJ3A 2ZYWX 3PIRA 2G83A 4PAOA 1D5CA 4LJ5A 1A7JA 2ZRGA 2IX3A 4XH9B 2GAAA 1WF3A 3CX8A 3DM5A 2D62A 1GL7A 4Q03A 1RRGA 3NHAA 3T12A 121PA 3X2SA 2WJVA 4Z1MD 1GZSA 3GFTA 4B3FX 4QJ3A 4A9AA 1JR3D 1W47A 421PA 1QBKC 3KJHA 3P4XA 4GMDA 4LYJA 2GEVA 2IYZA 1E0JA 1RYHA 3PUWA 4JLMA 1MABB 4M4SA 1EFTA 2NOAA 2WPDA 3B85A 5FOUA 3FMIA 1NKSA 3H84A 3FVQA 2JLRA 3QKSA 1DAEA 4HLUA 1CR0A 1LF5A 3NIBA 3KKPA 4WXPA 2ZVQX 3THXA 2OFXA 2QU8A 1IM2A 2Q3FA 4AYTA 1N0VC 1G7TA 4JJKA 2MSEB 5B2ZA 4FW9A 1UDWA 3IBGA 1YR7A 2V4ZA 1G291 3BE4A 4JLVA 2PCJA 2D2EA 4Q1BA 4PQYA 4EPWA 1X86B 4G01B 4UJ3A 1NY6A 2H1LA 3G82C 2MMGA 3ND8A 1ZW6A 2DWOA 2BBTA 2HEIA 2C77A 1QVRA 3WBKA 1MRSA 1OYWA 3SQXA 2IHBA 1GNQA 1GL9B 2IYXA 1Q0UA 2ECKA 2YHSA 2AXPA 2VIIA 3QPWA 2O8BA 3A58B 1FQKA 4IOKA 3CRQA 2R65A 2VYFA 1SXJA 5JS8A 2OT3B 1N2CE 2PX0A 3HDTA 2E9SA 2GCPA 4BUJA 1PJRA 2D7CA 1XWIA 2WOJA 4JBXA 3EZ2A 2QM8A 1CU1A 4AYXA 1ZAKA 721PA 2QMEA 1XEWX 4OI1A 2ZRLA 3AVXA 3EIHA 2QENA 2B6HA 4RKEA 3SDZA 4TZ6A 1W36C 1CXZA 1UBFA 3HU2A 1KK1A 3MGCA 2ERYA 4TL9A 2ZITA 3GJ6A 3OHMA 2O8EA 1UKYA 1YU9A 1HV8A 2Q0HA 3AF3A 3TVDA 3THYA 1YE8A 4Q4HA 3DOFA 5JHGB 4D81A 3GEEA 1ZVQA 4TN1A 4ZPXA 3FFAA 1KI1A 4M1OA 1TUIA 3LDAA 1P7CA 4DLYA 2G88A 2CBZA 1HTWA 4R7ZA 5P21A 1BO6A 2ZI5A 3ADBA 2IUSA 4IVPA 4ABYA 1EFUA 1JNYA 1IY0A 3PFIA 5DE3A 5EP1A 4PO9A 3W8NA 1AKYA 5AJZA 1E0AA 3NC1C 2OUKA 3X1WA 3WYAA 1SVIA 3SYNA 3G0HA 4TSFA 3GLFE 4PO1A 1BKDR 4ZIRB 2X77A 3WP0A 3MWLA 1W4AA 1G8FA 2Q21A 4KFTA 2MSCB 4TQAA 1Q3TA 3TR0A 3K9LA 2MSDB 3L8YA 3E2IA 3B9PA 4OJQA 2QP9X 3Q85A 4DSNA 3VX4A 1D2NA 1L4UA 1G64A 1XBTA 1XNJA 3DO6A 1G3IA 4PANA 3NDPA 1DG3A 3O8RA 3KQHA 3R7WB 1G3QA 4QXAA 5DN6A 2BMFA 3BH6A 4KHZA 3I92A 1VHLA 5F98A 1NN0A 4DUGA 1F2UB 2IUTA 4D0GA 1U99A 3KKMA 1ZJ6A 3NVAA 5JBQA 5TDHA 4XVUA 2C03A 1W4CA 1RC8A 4L9SA 1E9SA 1W36D 4AKHA 2GZHA 3KKNA 1Z0KA 3C5CA 2WJHA 3RS0A 4HAWA 4BFVA 1FMLA 4Q02A 3NBZC 4D25A 1SVKA 1E98A 1E9AA 1ZU5A 2V54A 3OEHA 5KU1A 2REBA 2O8DB 1GWNA 2QP3A 3KKQA 1N6LA 3AVUA 1W0KA 2AHOA 1NVWQ 1CEEA 3VAAA 1XMJA 4DLZA 2GJSA 2VHJA 1F48A 5TVKA 2JJ8A 3C4JA 4Z54A 1Z63A 1MT0A 2N42A 4WZBE 3N5CA 2NZ8A 1AZTA 4Q7LA 2C8VA 4WBSA 2F1JA 1RRCA 4LOAA 2ZJ2A 3CPJB 4NZYA 1KJZA 2ZE7A 3R9WA 1GOTA 2IK8A 3T34A 1SKYB 1MRNA 2CL6X 3FYHA 4C7OA 3MWJA 1JECA 1FPMA 3QKRA 1RPZA 3MD0A 1P6XA 1KZGB 5JJKA 3W6OA 4CEJA 5HKKD 4IVRA 2YVUA 2ZUCA 4C0LA 5GJVC 4NYJQ 3X1ZA 4UXJA 2HF9A 3NEYA 4NPHA 2QGNA 3VNUA 5C18A 2LWIA 2V6IA 5J4LA 2W00A 3JVVA 4LV6A 3A1SA 2YJTD 3NBXX 1G17A 4XWAA 4A8JB 1NMYA 3WHLA 5JRJA 1GKUB 2FPKA 2CCKA 1E9BA 4PQFA 2N46A 3L2OB 2G0TA 2E1RA 2Q3HA 4NP6A 4MYHA 4MUAA 2A5FA 3I8XA 3QJYA 3V4RA 1A4RA 3Q5DA 4NCHA 5B58C 1OYYA 2PX3A 4TMZA 3C15C 4Q9IA 4JLNA 1DAIA 4ZV4A 1OH8A 4JVLA 2J41A 3K53A 2A2ZA 4LHYA 4KAXA 5LPNA 1W5SA 1K5GA 3GLHB 1H8EA 5E4FA 2YOHA 4BFXA 2IL1A 2ZROA 3F3YA 1VTKA 4IDHA 1QHSA 5JWHA 4G1UC 4WVFA 1FUUA 2VHCA 3K0SA 4D4MA 5HCNA 2JEOA 4Q9HA 4HLDA 1E2KA 2H17A 5J47A 3AF2A 1PUJA 5JI2E 4RKFA 3ZYCA 5FUWA 1NLFA 2QEQA 3VR3A 2DY1A 3A6PC 1IONA 3UG7A 3ADCA 2P3SA 3CZPA 2FSHA 1E79D 4A0FA 1OSNA 2ORIA 1XEWY 3HR7A 1FNNA 1Y63A 5AJYA 1LFDB 5FL3A 2ODWA 3GQBA 1GG2A 4KBFA 1T3LA 2CJWB 4DLWA 3FHCB 2H57A 3QKSB 4DKXA 4RD1A 4XD7D 1OLOA 1T8UA 3KL4A 2ZU6A 1YZQA 3OESA 2VHUA 3ASYA 4B3BA 4O2LA 4IFBA 3QXXA 1P5ZB 2ZRMA 2OBNA 2AFIE 4C0SA 1AJEA 1T6NA 1I4DD 2VHTA 1D9ZA 2Z83A 3X1DA 2BM0A 2DFKB 2GNOA 2NO9A 4LHWA 3ZD6A 4HUQA 4V0NA 3UPUA 1IXZA 1QDEA 3TJZA 4D4JA 2FV8A 1ZP6A 4MGZR 4FMCB 1KAGA 2VP6A 5FBWB 3EIEA 1OXUA 1KYIA 4RZ2A 1ZD8A 4OL0A 1JPNA 1TQ6A 1P72A 4Z8XA 5FR1A 2RGEA 2O8BB 2QPAA 2ZRBA 1IAQA 2KBEA 1SXJB 2UVQA 3WBJA 3KJIA 4GZMA 2JLWA 4BASA 4KI0A 1OV4A 4PZZA 4JLDA 4EUNA 3RC3A 4XWOA 2REOA 2D06A 1A5TA 3FDIA 4US0R 3EASA 2R8RA 1KSFX 5JSZA 4IEIA 4PFSA 1U9IA 4LK2A 3M4YA 4M1SA 4QGGA 1HYQA 4QBIA 3MRSA 1QHHB 3R20A 3R8CA 2ATVA 2C9CA 4GBMA 2HLDD 4BGDA 1JQJC 2FMXA 3P4YA 4HB4A 2CHVA 3TUIC 3U3MA 1TMKA 3GD7A 4PHFA 3B1ZA 3RVBA 5B57C 4G3XA 4RVCA 3K0AB 3QI2A 4Q21A 5FI0B 2FN4A 2CL0X 3THOA 3MFYA 5FBQB 2CK3D 1I2MA 3KB1A 3FPAA 1VCMA 4QBFA 3KTAB 1PLJA 5BYJA 4LGMA 4CRWB 4BEJA 4M22A 1I4LD 2FFBA 3MCAA 1JALA 2N1BA 1XD9A 5DO9A 3TW8B 5L3VA 1P75A 4WW0A 2BKUA 1C1YA 1KK0A 1ZNXA 1BH2A 2JLXA 2GJ8A 3SQWA 5FTKA 1T8TA 4FCWA 2H7VA 1XPRA 2JLQA 4DDTA 3SJAA 5G41A 1Z6TA 1AQUA 3WYFA 1XZPA 1VIYA 4FINA 1W46A 4YQFA 1OH5A 3PUZA 2BEKA 1OPXA 2PZFA 1FL9A 1P3JA 1TNDA 3DVLA 3K0EA 4JKYA 4HDOB 2XZPA 1M1YE 2Z4SA 3EW9A 2AK3A 4OK5A 5CK5A 3IUYA 4RJLA 5KDLA 1HA3A 4QRHA 2QTFA 3GFOA 3BBPA 3U2QA 2FEMA 4TMTA 3REFA 2WSMA 1XTKA 1K5DA 3TK1A 3W6NA 1L7VC 1QHGA 4KFSA 4BWYA 5EP2A 1FX0A 1R2QA 1ZIOA 3LV8A 4JVMA 2PBRA 4XIGS 2GXAA 4NONA 1G7CA 5A5GA 1X1RA 4DLXA 2QGZA 1HURA 3RRNA 3SZRA 3A4NA 4HAXA 2PZGA 1WMSA 1WRBA 1E4VA 1M7HA 1N6KA 1U90A 4IOMA 2G9NA 5KSOA 4L16A 4O0MA 2KSQA 3GLFB 2HDNB 2WVJA 1G7SA 2BMEA 4KSCA 1Z8FA 1E1RD 3B2EA 4N0EA 1EFRD 1KI4A 3C16C 3BB4A 2CVHA 1T91A 3AF0A 2GAOA 2QNRA 2V3CC 3CRVA 5KPJA 1YRBA 4ON9A 4C7OB 1YZLA 3RWOA 3KQUA 3W9YA 1T0JB 4UNRA 2JDID 1R5OA 1QG2A 2Z0MA 2ZI4A 621PA 4RY2A 4JLAA 3BOSA 3BH0A 1EFHA 1JQLB 2PEYA 4KXFB 4DZZA 3IIJA 3GJ4A 1J8YF 1TU4A 3V00A 5C4MA 3MLEA 3RRYA 2NO7A 2FGKA 4N0DA 5FOSA 1MO4A 2WIAA 2ZE6A 3GJ0A 2EQBA 2DFTA 4QG7A 5TARA 4AKIA 2XITA 3FKSD 2ZSEA 3LLUA 3R8FA 1N0WA 4KLZA 2H5EA 4BRWA 2AD1A 1OJLA 1XJ0A 5E95A 2H18A 4HYYA 1GRRA 3DMNA 2DCUA 2VP9A 1RVDA 2PZEA 5G40A 2VP5A 4PPGA 5EXXA 5HE8A 1Q12A 2JGNA 2ZR0A 3BRWD 1MO3A 4F4CA 3QBTA 4EQ6B 3IQWA 1GNPA 2TMKA 1IN5A 4A15A 3B8HA 1WQ1R 1YR6A 1KMHA 5HKKA 1JEEA 1TQ2A 3A1TA 3WNDA 4HB2A 4XOIA 1XTJA 2GF0A 4DCNA 5M04A 4A6PA 3FE2A 5G53C 1VCNA 2OLJA 5J4KA 1FOEB 2EWVA 3CH4B 1Z3IX 2X2FA 1G3UA 4NYIQ 3T15A 4KFUA 2G6BA 1XTRA 3SBDA 1NVXQ 2DBYA 1X8JA 2QAJA 1E1QA 2ZR7A 4ASUD 1P4SA 1DO0A 4EAQA 3U6KA 4M53A 3K70C 1E0SA 3L43A 2J7PA 2F9MA 4C3ZA 4RFSB 1W48A 1KI6A 4LSGA 4B44A 5BN5A 2EW1A 3CR7A 3PXGA 1G19A 4OK6A 5LBIA 2F55A 1Z83A 1OF1A 3U3JA 1XJCA 3THWA 2XOKD 4PPFA 1UAAA 5CYPA 1F60A 1E9FA 2IS2A 2ZUBA 3MJRA 3EWAA 5DI9A 3LRPA 3EC1A 4NCJA 5CDFE 1M6NA 2CE2X 1WB9A 2FE4A 2IYYA 3OIUA 1LVGA 4QHSA 4DLSA 5JFGA 4XJXA 221PA 3QF7A 1II9A 5GJCA 4V0KA 1SKYE 1RE0A 2ZI6A 1RJ9A 4V03A 3A8TA 2E87A 1O3YA 3W3AA 5SZIA 3VFDA 1KK3A 5GVRA 3SS8A 4AI6A 3SEAA 4HUQB 4YXWD 1R5NA 2O0KA 4NCIA 1KZ7B 1X1SA 4BLQA 4DCTA 3UXMA 4D0LB 4LJ9A 2WKRA 2PLFA 2DWPA 1II8A 1AKEA 2JJ1D 4ILEA 2YWGA 2CVFA 3AB3A 4JL8A 5L3QA 3VR1A 4V02A 1KHTA 3RSOA 3B5JA 4MRVA 3RDPA 1VG1A 4MA4A 3MJHA 1BYUA 4LV5B 3QOFA 4QM6A 2O52A 1TF5A 5CYOA 2R9VA 3I8SA 1KMQA 2OM2A 1MR3F 2ZYVX 4KYUA 5FOVA 4QGAA 5F9HA 3UMFA 2FU5C 2O0HA 4B48A 1TF7A 3OEED 4B3XA 1EFCA 2H16A 2CCJA 1Z47A 2YINC 4TL8A 5IHPA 4TLDA 4B75A 2IYTA 3NDBB 1G5RA 1US8B 4KO8A 5JSZB 4HATA 2F1HA 3AKYA 4AD8A 3MMPA 1KIMA 4L15A 4HZIA 4LHVA 4A2QA 4I1SA 2LKDA 4JVNA 4QHYA 3VQTA 2IXFA 2Q9CA 3U5ZB 2WJYA 5AK0A 3NXSA 2G3YA 4TT3D 5E7JA 3O47A 4FCTA 4I1UA 3AP1A 3U7FB 4Q1EA 4EFLA 2I4IA 1DO2A 1KI3A 3BB1A 2OHFA 3NTUA 3Q7PA 2VLIA 4C4PA 4ZKEA 3VR5A 1YHNA 3LXXA 1MO6A 1AS3A 1G21E 2GDJA 2J0VA 3EA0A 1G5TA 4JLKA 3BS4A 2V7QD 4YDHB 5K8IA 1W7AA 1DPFA 1DBSA 4X8MA 4BZXA 2B8TA 2WBLC 3U7EB 1UEIA 1Z0AA 4IKEA 5F2EA 4A0HA 3CZQA 1T9HA 3VNVA 4LYHA 5IF9A 3SYLA 2ZAMA 3RS3A 4B3DA 3PEYA 4PC3A 3P1JA 1W4RA 4B33A 4N1AA 4PPQA 5FBRB 2PT7A 4KSBA 1VCIA 4QHTA 5TMPA 3AV0B 4QGHA 2YC2C 3QXJA 4PR0A 4HAZA 3QIAA 3RS5A 1QHYA 2EYQA 1T0HB 1Z29A 1E2GA 1S1MA 3AVPA 4IDOA 3FMFA 4MQBA 4RSGA 2QTHA 4EPTA 2CK3A 2IXGA 1N6IA 4ZO4A 3ZIAD 5LD2B 1E2PA 3HJNA 2C99A 1EWRA 2B7BA 4TTPA 3ZVNA 1CIPA 3T35A 1NRJB 1KSHA 1M34E 1XCMA 2RB4A 2VPPA 2ZR9A 2VQSA 2OBLA 4G5OA 4IXNA 4JVSB 4ARZA 2ONJA 1E2EA 2I1VB 3DL0A 4B71A 2PMKA 3EZ6A 3CIOA 1P60A 1Z08A 4H9GA 1SXJE 1KY2A 3PG5A 4CW7A 4BFSA 2CXXA 2GVDC 5KSPA 1LS1A 2QN6A 5G3ZA 4U00A 1XMSA 1RW4A 1Z0IA 1NIJA 2ZETA 4DLUA 4CT4B 5F9FA 5CJPA 4M9ZA 2XB2A 4OI2A 2NGRA 1G16A 4M1YA 1OH7A 1VDZA 1MKYA 3EPLA 4IOJA 3BFXA 3ND9A 3T61A 2OLKA 3VKHA 3I4LA 3M1IA 2OAQ1 4L4UA 4MRRA 2GRJA 5FUXA 2QM7A 1ZC4A 3F0TA 4URWR 3H0KA 1P9NA 1NLZA 2QSYA 1KDOA 3A1UA 3LH5A 5L3SB 1KJWA 3SYKA 5H1YA 3CNOA 3TSOA 1QZXA 3ZVLA 3U44A 1EX7A 2HCBA 4MUBA 4URUR 2XNDD 4NYJR 2ZJYA 5EQTA 1KNXA 2OCBA 3ONWA 1GVNB 5KSZA 1E1RA 2FNAA 4PPNA 3TGPA 3SHFA 1HQYE 4BFZA 2QRNA 2ZJOA 1Y3AA 3D6TB 4FMDB 5DIFA 5KO2A 1AM4D 1BYIA 4AC9A 1CJKC 3AF1A 1SVMA 2C04A 2O0JA 1GSIA 1QHIA 2X19A 2OAP1 2WAYA 2ZS9A 3KXLA 4BZPA 1JBKA 4CGZA 2CLCX 1YR8A 3CRW1 1MO5A 2JDIA 4D4KA 821PA 2P6RA 1QRAA 3LD9A 1HY3A 2VBCA 2ZJZA 2JIZD 4D2IA 3TR5A 1LF0A 2I3BA 3A36A 3BK7A 4B3GA 5E7IA 4W5HA 2C9OA 3ECCA 1JB1A 1E9EA 2OFWA 2QQ0A 1P62B 3TE6A 2B7CA 2WTUA 1Z07A 3HWSA 4JLBA 1OXSC 2R44A 2FJUA 3VR4A 3G5UA 4ACAA 4RFVA 3SJBA 3EAQA 4GP7A 1UDXA 4A0RA 3IHWA 3KQNA 2QP4A 1VG0B 2P5SA 4Q1AA 3LFUA 5FL7D 1QHNA 1HE1C 3I32A 4LRWA 3RYTC 2YV5A 2V9PA 1UBCA 3I62A 3TKLA 1ZM9A 3I1FA 3ZZ0A 1JXMA 1U98A 3THWB 4NE2A 1NMZA 4G5SA 4XTCS 2GXSA 3AUYA 3IO3A 3GLIA 2F9LA 4FCVA 2IYSA 1S3GA 3RC8A 3U3OA 1F6BA 2OESA 1F5NA 1ZMXA 2GCNA 5E3HA 3QXCA 4DCSA 4RD4A 3QY0A 2WV9A 1KGDA 1DAGA 5SZJA 2GHIA 4C30A 2G77B 1LTQA 4JLPA 4JSYA 4LX0A 1KOFA 5L3RA 2O8CA 1T3HA 1NBME 2EYUA 1XPUA 1W2HA 2IBMA 3LVRE 1BOFA 4YMSA 3D8BA 1Q44A 2GKSA 3FB4A 1F2TB 3ZS8A 1XXHB 2XAUA 1ZNWA 4MKGA 3K9GA 4Q4JB 4XSGA 1UKEA 1II8B 1HQCA 1K8RA 4JLOA 1Q1QA 2WAXA 3M6AA 5L3QB 4URZR 1P9WA 1AS2A 5D3QA 2XOKA 1XDBA 3QXSA 4FIDA 2GCOA 4Q47A 3ZGXA 2C5LA 5JRZA 4P4UA 2CMKA 4XTRA 2FOLA 3QQ5A 1VCOA 3O8BA 3VHLB 2OEPA 2XGJA 5DHFA 2W2XA 1A2BA 4JBYA 4TYYA 1W2GA 5FFMA 4LZZA 2AKYA 4C0QC 4DB2A 3T1OA 2R2AA 2OFOA 2P65A 4ZCMA 1AQYA 4QBGB 3OFND 3SN6A 3BJIC 2ZSBA 4YXWA
chains in the Genus database with same CATH superfamily
2XDQB 4EH1A 2VAVA 1IEWA 4DCVA 4RWEA 4IW3B 2OV1A 1IM8A 2ODBA 5JANA 1V1MB 3ROMA 3TQHA 1IHUA 3P20A 5EVJA 3ZBPA 1JJIA 4XQCA 1QB7A 4GFDA 2W58A 3H65A 3COJA 1MGOA 5LMZA 1NVUQ 4FYPA 3PJDA 5AKLA 4AZ3A 1NF9A 3BEDA 3V1YA 4MWTA 3HNOA 4TRRA 1YB1A 1I6MA 3LT2A 2FJ0A 4J9VA 2HCRA 4NZPA 4P53A 4C21A 2PUEA 1PZNA 1Z6PA 2BWJA 4NOJA 4IGEA 3NRBA 3PV0A 1O5IA 1W59A 3T06B 2DHCA 2FN3A 2YCLA 1QVWA 2BC9A 3I4FA 3PD0A 4LC1A 1TC1A 1SUAA 5ALHA 2QNIA 5I9LA 3N6VA 3MA0A 2GA9A 4DWJA 1XVAA 4KN6A 3BWYA 1M10A 1JU3A 4BWVA 4DMRA 3GY0A 1V16B 2E5FA 4E07A 3ILVA 1RMYA 1GTMA 2IYVA 2V6FA 3M0EA 1GAWA 1XHFA 2ZRDA 2PGIA 3VBEA 3LNTA 4FSDA 3AEQB 3JYPA 1OVMA 3H4VA 1EVQA 1KI9A 1DARA 2BHRA 2XSZD 4RL6A 2R6R1 1EQAA 5EE3A 4BVLA 4E5PA 2OY0A 1NL3A 1RAGA 3V7FA 4EG6A 3JQAB 1GR1A 3GWZA 5AR1A 4LE1A 3HJUA 4A16A 5EY5B 1L8QA 1NA5A 4NCNA 5AK5A 3H3XA 2BSXA 1A50B 1R0ZA 2ZS7A 2XQGA 4M8IA 1P5RA 3JWEA 2Z57A 3MYRA 4JT2A 2C7RA 1YKGA 4K0RA 1AN0A 1FNMA 1QK4A 4OI0A 4L57A 1S2IA 4FP9A 1Z4LA 1KVQA 4I3GA 4Q7JB 4UE3S 2PQ2A 3DPSA 1FSGA 1G7RA 3CRRA 4IIBA 3BWDD 2R8ZA 2FR8C 1GCIA 3PE4A 1QIFA 2UUOA 2QIPA 1CRLA 5EUMA 2QJRA 5A9SB 3NTQA 1UANA 5EZYB 4MVJM 5LQKA 3RRFA 1ENYA 3PEVA 1RHUA 3BSSA 1W1WA 4RL4A 1LPMA 4NS4A 3NMUF 1XPJA 2Y1KA 1WNTA 4RQAA 4NU8X 4EUFA 4N7BA 1P2UA 3OSZA 2FSFA 2YHUA 3RRXA 5BW5A 4CEIA 5GJWC 4I14A 3NTXA 1MB0A 5FCDA 1CR1A 1WPQA 3SX4A 1DELA 3UV6A 2EHDA 1J25A 2BMJA 4ZI7B 2YXBA 3SVZA 1FDWA 4RK7A 3LP6A 3U4QA 1GIAA 3OC6A 4R1MA 1NW8A 2C4HA 2JCBA 1NJGA 3C5VA 2VT6A 1LBHA 3PNPA 4YCJA 5ER9A 1KYXA 3KP1A 4C87A 5JW6A 3U3ZA 2P3OA 1K66A 1IWBB 2H0QA 4A8JC 4C3OB 3ZIAA 1HO3A 1RCFA 4LBZA 4LOJA 3VVCA 1CQJA 1AT1A 3AI2A 3RF6A 2ZI9A 1Z6QA 2JAHA 4GRAA 4C0AC 2GBLC 1IPEA 2HLPA 1SHUX 4UM8B 3WRYC 3HSKA 3H9QA 1J21A 1THMA 1ZIYA 8ABPA 3HZHA 5H02A 1PQYA 3AHDA 4A0SA 2OHGA 2CZGA 4QJIA 4W5WA 4W7SA 3U31A 5BQFA 2VUIB 2PUHA 2QTBA 2X5XA 1ESNA 2MDTA 4DC9A 2QTVB 2XYVA 5C8XA 4BLTA 1SPBS 2IS4A 3LNCA 2UZ4A 3OLZA 3F6BX 4MDHA 4ATNA 4RDXA 2RAUA 3H19A 2QMZA 4TYNA 1CYEA 4D8TA 4LYGA 2NYAA 3CH7A 3L6UA 4JD5A 2Q1WA 4O29A 4EMSA 1AA9A 4GSYA 2IYLD 3OLCX 4IV8A 4D3SA 2ZUFA 3EPHA 2R7KA 5E2IA 1JMYA 3OI7A 5GM1A 2XYRA 5REQA 3KKZA 1JSLA 2FPIB 5TXGA 1E99A 4LE0A 4W8OA 4AZTA 3NT5A 1JG3A 4X84A 2XIJA 3UXEA 1T4CA 3R1IA 3NO4A 1AHHA 1KBOA 3K9QO 4XQ0A 3LGSA 4X93A 4MR8B 3RFTA 1RR6A 3K9NA 3KQTA 3UT6A 3THYB 2O8EB 1OW3B 1JDNA 1F3LA 1YDFA 4ZYWA 2JHGA 1XV5A 3OTQA 4JAVC 4N82A 2DJIA 3VR0A 4FOSA 2QORA 1JDVA 1A1SA 2PMFA 2QRVA 5CIYA 1Y37A 1W9HA 1BCSA 1JEQA 4OXIA 4UHFA 4HXFB 3SDBA 4CQLB 3K0FA 3G0BA 4B9EA 5ALLA 4HFRA 4O02B 1XQYA 1JT9A 4X41A 4HY3A 5CU7A 1ORVA 3RVNA 2JGDB 4BEWA 1UJ6A 2FPOA 2RG1A 2ODEA 3ENWA 3G02A 2Y4OA 1WF6A 5DYGA 5E2AA 5E7QA 2JIPA 3N7TA 3U4DA 3VYTB 1NE2A 2E0IA 2NTEA 2WPNA 4Q3DA 3RARA 3ZDRA 3LCRA 4PNHA 3DE4X 1C0EA 1HMPA 3BX1A 3G49A 3JAWA 3R23A 3W5UA 2JH8A 1EVKA 2NIPA 2P1RA 4DG8A 2O1EA 3O75A 3TOSA 2BKAA 2QPTA 2WD7A 1REQA 3B51X 4B85A 3KEMA 3T7JA 3N58A 3EZ7A 1AF4A 3NG1A 1QFXA 2QN9A 2BKEA 3Q3GE 5L4LA 1EQ2A 4FFOA 1S2NA 4IOLA 4QPJC 1R0WA 5GZ6A 5I9SA 1SQFA 4LBVA 3RJ9A 3SIRA 1U7OA 1CY8A 1USWA 3HKEA 3KOUA 4XYBA 1VE9A 3NNNA 3ZZTA 3P9NA 4NZOA 5B3LA 3O8QA 1QTQA 1VBNA 1YD7A 5I4IA 1KDPA 3F8WA 2AUTA 1Z5ZA 4F6RB 4Z4GA 1N5OX 3KQLA 4KVAA 2XQVA 4BLRA 4OQQA 4IXTA 2AK2A 3FGPA 3WI7A 2OSBA 2XB4A 3KJXA 2OCLA 4LPSA 2VXOA 4BKRA 5FJIA 1QO0D 4OL9A 1T6YA 4IHJA 2OORC 3FR8A 5TY0A 4QYSA 4CV2A 4Y9UA 5HKOA 2GCOB 5F64A 2FWRA 2YX1A 4HDNA 4I1YA 2DJ5A 4TKVB 4YX9A 4N8EA 1H42A 2RGYA 2WJIA 5K3CA 2J1LA 1AUVA 2L19A 3NORA 4UREA 1RWVA 1UIRA 4F85A 4BEVA 4RS4A 3DE0X 4JLUA 1A7UA 5CNMA 1KYWA 3BWCA 4E7OA 1SNYA 3ORYA 2Z9CA 3DQQA 1MB3A 4ZQEA 1K68A 3V1NA 3ZD8A 1ZLYA 3W1EA 4BVGA 4INZA 5GONB 1OXMA 1T1RA 2RGNC 4OQNA 4P4NA 1HDEA 1GFSA 3FHOA 4OXQA 4LFBB 4JZKA 5AK4A 3LE8A 3OZAA 1PNOA 3BN3A 5AIBA 3D7RA 4QTZA 3MB5A 2BBWA 3DAGA 4HWTA 1AGYA 4TWAA 4WUTA 4F2GA 2K6GA 2TRSB 4MW6A 1QAOA 2C9YA 4L07A 5AUOB 1V96A 1ESZA 3I58A 2DH6A 4YAKA 3K9CA 2VT3A 1UWCA 4UM9D 3UEOA 3JQ6A 1WM1A 1YQXA 3WIDA 2VA9A 4AZ0B 4UTVA 2WP8J 3Q0TA 1C1HA 4Q7MB 4K86A 4CCYB 1N6HA 5BQ5A 1T5LA 1NT2A 1I3MA 1HG0A 1R12A 5AT1A 1OWLA 1QNFA 5HGJA 4YRGA 3CF6R 3O3CA 1NONA 1XB2A 3F4BA 3NBFA 2RB5A 4ZP1A 1TPZA 1U2RA 4D6PA 4F86A 2ZSJA 1E2MA 3T9DA 3OP4A 1B0AA 4YHHB 4JVOA 3V2IA 3AXTA 4YBZA 1HR0B 2G70A 2HO4A 3KUXA 3OFJA 2YZ7A 2GAJA 4IIGA 4TV9A 4J43A 1W4LA 5I7EA 2HJRA 2XZLA 4ZDWA 3QQPA 1M1YA 4URVR 3JYLA 1N5RA 3HWWA 5E0KB 2NU9B 3SKYA 2ROQA 5BRAA 1N5LA 3EY9A 3OECA 5FUYA 3RBZA 1W1UA 2JFZA 3BGOS 1GGNA 3DWGA 3R0JA 5DSXA 4XB1A 1ZVJA 2FSGA 3PCRB 4HHEA 3TWOA 4B3CA 4D45A 2I2CA 2P0EA 5DF1A 4YT8A 4NSNA 2ZYUX 3VOSA 1IUPA 4NX2A 5C3MA 4PYJA 1BXGB 4JASB 2YJ4A 3P9SA 2A9RA 4OHVA 4ZTZB 3LGAA 4I3HA 3BB3A 4TUYF 1NDUA 2FSPA 1C1DB 1EA7A 3F9CA 3VR2D 1XK7A 1GZ6A 3GZTB 2C54A 2BGKA 2AUNA 1EFLA 1IE3A 2X3YA 1XVLA 4P1ZA 1OI4A 5DTEA 2A4MA 3QLJA 1R1DA 2ONCA 1DFGA 3UYKA 3GRKA 2GLXA 3VO9A 2P8JA 3OSUA 4A2CA 3ABQB 1JR6A 5ADHA 3Q9SA 1SHLA 4M46A 4ZRDA 4D80A 1H05A 2JHFA 3AZQA 4L8WB 4D82A 2I2FA 4DR2B 5EWLB 1U2GC 1K4MA 1O9HA 3M8KA 3PFNA 2L18A 2YCBA 3GN1A 2Q8NA 1SQGA 1JAZA 3H6GA 4UUOA 5CT9A 2ZIXA 1TW3A 1UBNA 2CEAA 3ZE8A 5BSEA 1AMNA 3BIXA 2ECOA 1K7XB 5HWSA 4KR6A 2ERCA 2FA9A 3DOUA 3O94A 2P2GA 3WC4A 4P0QB 1G6HA 1X1CA 3HRHA 4HI0E 4ZVKA 4N47A 2PBZA 4RPHA 4KYIB 1WA5A 1DEKA 5ALJA 5L8VA 5LB2A 1BFDA 3MMNA 5A9RA 4ZRMA 4BFLA 4K46A 5CLJA 4IZIA 5K2OA 3JSAA 2QL7A 3W3ZB 4M2LA 5JEEA 2QQFA 1MB2A 4NDNE 3BC1A 2CE7A 1WU8A 3IEPA 3N75A 1UDAA 1D6JA 4MUGA 3N53A 2D3WA 3W9BA 1R27A 5IYZF 3ROKA 4UU8A 1PTKA 3LC7O 2EG9A 5C7YA 3IP8A 4BLPA 4U6NA 3BFVA 3EGDB 5IDWA 3K71B 5AH0A 2EIHA 2I2DA 3L1VA 5T8KA 4D98A 2P4HX 2GEBA 2QLBA 4TZ0A 1GR0A 3WNBA 3CEHA 4XDYA 1JKMA 4Y6SA 3A9VA 1V1RA 4HMPA 1WUTA 1DHTA 1ZWLA 2FLWA 2P6OA 3LIPA 4C0WA 2G09A 4HSEA 5IDQA 1WMBA 4MW2A 4R1UA 1ENZA 5KZMB 3BXEA 1D1QA 3PGMA 4DQUA 4RZQA 1J2EA 4AJOA 1CR4A 1NBMD 4MGKR 1NASA 3PQ3A 4PFJA 4GC9A 1R9JA 1TTQB 1GZ4A 2PPLA 3CM0A 3DLPX 3HDJA 2IPAB 3B6IA 3P0FA 2I62A 1MCZA 5AM4A 1Z28A 1ZC3A 3MAAC 4EFKA 5FTLA 2Q9AA 3ERCA 3PVSA 3T3NA 4HXEB 5BMVB 1IK6A 1HDYA 4Z0PA 2B7LA 3VU9B 2JFGA 3BORA 1FW6A 5AI6A 3PJEA 2X7JA 3QFFA 4H1UA 4DG5A 2JLSA 1JSZA 5DMHA 1HBJA 1YZFA 4B09A 3ESRA 3IE2A 4R4JA 5TPWA 5H80A 3FOBA 1V6CA 4UMVA 4HUJA 1ILWA 3SLKA 5KU7A 1COZA 3O4VA 3EQ8A 3HM2A 5IVHA 1N77A 1SZPA 2KI5A 4F12A 1EJ6A 3O8OA 3AVQA 1LV7A 3PQ7A 2JBWA 5JXHA 1B26A 1XEFA 2JI6A 4NNJA 2WSYB 5UKDA 5KYXB 1QWOA 2AMYA 5ALKA 2VDLB 1BX3A 3AJ8A 5FLKA 2E3JA 5CDFA 2ISQA 3M3DA 3DEYX 5LXTA 4FEAA 4QAJA 3S81A 1CHDA 2QN2A 4GI1A 4JEUA 3ZH9B 1UWKA 1G8KA 3RC7A 3FBGA 3IIMA 3L0YA 3IFSA 3M82A 5E3JA 1W44A 2WWXA 3S7TA 3D6NB 1QHEA 4K1LA 2HHLA 2CXOA 1QG6A 4WFJA 1U3TA 1DWUA 1NRWA 5D3MB 3IUMA 4K6CA 4CXMA 2F43B 2FPXA 1IU9A 1H6DA 3B7GA 1W5AA 1X80B 2LKCA 5BR7A 3IE0A 3ZE1B 5JQWA 1RAHA 5CPBA 5CVDA 4CQMB 1AGNA 5E6UA 3QU5A 2JVIA 5B55A 4XZ3A 3OIYA 4QAQA 2W43A 1IQ0A 4UHKA 1AG9A 5T41A 1YA6A 1XXLA 3NGLA 2E89A 3EHEA 4L85A 3VJLA 4FUQA 5D86A 4ER6A 2E4ZA 3FWPA 2DHRA 3N2EA 1HQDA 3BJMA 3D81A 1C3JA 1FFEA 3LWNA 2V55B 1OOEA 3UT5B 1N9KA 3H3JA 3WYBA 4D26A 1ZM7A 1YB5A 5F7XA 3GPBA 2A1IA 3K2IA 2MIIA 3E1SA 4J0QA 4O4LA 2PXCA 1MENA 4FD2A 4LOKA 4LW8A 5ECDA 3EXFB 4D9JA 3OETA 1S0UA 1E4OA 1N0IA 1TYBE 3I42A 1PD1A 4DMHA 4EI9A 4YRNA 4UUBA 2NO6A 4BUCA 5HUHA 1XG5A 1CUFA 3GDFA 5KAMA 3PUHA 2HZBA 4WXMA 4KGXA 3TB6A 3USES 3TFOA 7MHTA 4KDCA 3F47A 4U6QA 4Y9RA 4DMKA 1OZHA 2Z2KA 3Q15C 1T2CA 4C78A 2J87A 1PDWA 3MRTA 1IHDA 3GLGB 3BREA 3BBLA 1IQUA 1ZUHA 2QRKA 4WT7A 5I7WA 3X0DA 4ER0A 5A3RA 5JOQA 2X23A 3OCZA 4QTXA 3VXKA 5JZVA 4U9HS 4RW0A 2IYFA 3KQOA 3KX2A 5FPKA 3GBVA 4PSVA 3D4BA 2H9IA 2C5EA 5BWOA 4M37A 2J9FA 5FUMA 4JWKA 5ICCA 5T3UA 1E2LA 4BDTA 4AY3A 3DMYA 4R2XA 4RZUA 4ZFNA 2XRFA 4UM5A 2NVUB 5CB8A 3KLOA 4LV8B 4WXRA 3DWIA 5ESWA 4FMCF 2RHLA 3WHKA 1TEHA 3SF8B 3DVAA 4F11A 5KNLA 3Q3CA 2R7AA 2VL7A 4TS9A 1L5KA 1RXEA 4JJGA 5CT6A 5LFAA 3STYA 3VU0A 2PNFA 4IH4A 1JTFA 2RHCA 3LOPA 4OGLA 4UE2A 4O3MA 1CY1A 1A5AB 1JDZA 4KN5A 4AJEA 5A4JA 3TD9A 1WCYA 2FE1A 3Q9LA 1B15A 1FPQA 3U19A 4U2FA 2Z6QA 5TNXA 3JYOA 2J09A 3STTA 2HR1A 4MWDA 4KEAA 2Z6VA 3T5GA 3ISVA 3ZV3A 4F7WA 4FGWA 1S7CA 1EFRA 5ALGA 2COUA 3RKRA 5FJJA 4AKGA 4Y0VA 2HF7A 4YIHA 3KXIA 4OQXA 2C95A 4D8XA 1CVLA 3SBXA 3IUSA 3MJEA 4U7JA 1Y8CA 1KI8A 1OAKA 3DB2A 3UWSA 1GTSA 2Z3VA 3GGDA 1NNI1 3FSRA 3H18A 4MS1A 4P9NA 1LKZA 1NLUA 2HU7A 2J5XA 2FW6A 1L5WA 1D3AA 1KMHB 3I1JA 2Q8PA 2GJAA 3RUIA 4ZWNA 2NZYA 1BKSB 4LC0A 4X6XA 1YCDA 3CLSD 4XFKA 5EE5B 5K9ZA 4FZJA 2JLYA 4FONA 4R0MA 2G04A 2ZATA 1OLSA 2V74B 3G7SA 4C4XA 3K09A 3CVVA 2WTNA 4RD6A 5KMGA 1DB3A 2L17A 3GFVA 5FOTA 2A33A 4UNSA 1Q0HA 3K15A 4D3YA 3EVCA 4D1YA 1TYDE 4D97A 4DC1A 4OUDA 5BSGA 1O9BA 4QKQA 5KNCD 1DIGA 3H7AA 3JQ7A 2UVPA 1KO7A 1S4MA 1V35A 4ND3A 4N5HX 1ZK2A 5TF4A 5JZ9A 6REQA 2C3PA 2HK7A 1CRPA 4C76A 3DZ8A 3A7DA 4P08A 2W2TA 4AG5A 1XTVA 4HQ6A 4HGYA 1JKJB 2HBQA 1WCV1 3T3GA 1COWA 4FX5A 1JWLA 4K3UA 3OZBA 3A70A 4OUKX 1IWPB 5HIMA 1QHXA 3AEZA 2P4QA 4R1LA 4MJ7A 2PWAA 1A5ZA 1E20A 4M49A 3OLWA 1YOVB 4F4IA 2JVKA 3K1ZA 1FTQA 4ESVA 1QHHA 1CE8A 2XMRA 2G5TA 4BP8A 1VJ5A 4C7JA 2O7SA 3D4IA 2A9OA 2BBOA 3N74A 3HY3A 5EJ6A 4YY3B 3IQXA 2EP5A 4C6TB 2JHPA 2ZDQA 1XRJA 5CB4F 1HDRA 1SG9A 3I9V6 5C8YA 3U3KA 1RJ9B 1OVGA 1VKJA 2CN1A 1PJCA 5ITWA 5KOJA 4S04A 2G7MC 2QG9A 3UK7A 1MW9X 1MLDA 1XKXA 1VDMA 3T5TA 3ZCVA 4B6OA 2QX8A 3TTTA 2AUMA 3A6JA 5EIHA 5JSUA 3LUPA 3CSUA 3DCIA 2G1JA 2CMGA 2GRUA 3WOVA 3AI1A 3LW7A 3G2PA 3SE7A 4K6HA 4GLJA 3RUPA 4TLAA 2Y6UA 1NVVR 1P29A 3OTIA 1MIOA 4WFKA 3HYRA 3SU8A 4G0VA 2BFNA 2B21A 1JUDA 2ZFUA 1T34A 2TS1A 1Z7YA 2XHEA 2Z2YA 2JJQA 4PXSA 3H13A 2G1UA 3N76A 2A9FA 4CF6A 2Z8XA 4HQKA 1VPTA 3IR6A 1MOZA 1N6OA 3DHWC 3PQCA 4YJHA 3UF0A 2G07A 2VNJA 4N40A 1O54A 1FFHA 4GBJA 3H9EO 4RLSA 4Y2YA 5FQNA 5I7AA 1L6RA 4DA9A 4HNUA 2P9GA 3DCNA 4OD0A 2Z1DA 5EXTA 4DXHA 1NQAO 3QBEA 4LCEA 1XVUA 4Q48A 3F5FA 3MINA 1ZEJA 4A10A 2VWGA 5JJCA 2BCGY 2FH5B 1EQUA 4CL8A 5CIQA 5JARA 1N0UA 3BMCA 4C7BA 4ENWA 4EGAA 1Y6ZA 3EIOA 1GD1O 1PJAA 4I7EA 5J43A 1FXWF 1YVPA 4WSOA 5B6JA 1SHTX 2ZJ8A 5L3SB 3PU6A 2XE7A 1NG9A 3HFSA 4NHEA 2NU6A 2VSFA 3R0XA 1YQTA 1VMAA 1G8HA 4RQUA 4F38A 3KD3A 1KI2A 1PVOA 5KKAA 1DUVG 3I53A 1FMCA 2PAFA 3GH1A 1YFJA 1OAAA 3O7WA 3RIHA 4DCJA 3ZCUA 1ZISA 2D1SA 4MCHA 5DLPA 3GLFA 1U2QA 2HBRA 4X1KA 3KEFA 4AX4A 1XMIA 4H4DA 3IOBA 3DTNA 2F3UA 4HGOA 2YVQA 2B25A 2VT7A 3E58A 3INRA 3N8DA 1AZWA 4J1TC 4LY9A 1H8HA 5CM9C 4C6TA 4IPTA 2FDXA 4UTRA 4BBZA 4B43A 3ANMA 1KH2A 5IKPA 2F3TA 2FFRA 3JQFA 1UKAA 3OWOA 5FOWA 3GJ5A 4YPOA 4V1CA 1BKYA 1RJGA 3QMVA 1FDOA 2VTEA 1B8UA 1HYHA 3DZGA 2Z95A 4MV5A 4FLMA 1J2YA 2IU6A 3M34A 1G6OA 2O8FA 2R6FA 4D43A 1XMOB 3UJCA 1QLWA 3OVMA 2I67A 4M6WB 3E9EA 5TGTA 1CF2O 1XK6A 4E03A 1MAAA 3AP2A 3W5DA 4KQHA 2XKJE 3LP8A 1PT6A 3O91A 3H2BA 2G67A 4TXLA 1C0IA 1LBEA 3DP7A 1XELA 1ZK1A 3KZMA 1GEEA 2NPFA 4DV1B 3ICPA 3LU1A 2JS7A 4LWOA 2QTLA 1Y9DA 3R5HA 3U39A 5LQUA 1NPYA 2XZTA 2IYRA 3H0EA 3COPA 3K4PA 2WMDA 4DSAA 3DKPA 4BNJA 3D2LA 4JOQA 1ORWA 2VF7A 2JIBA 3HCBA 4MUNA 2PQ0A 1VXRA 3H4TA 4HK4A 4AUKA 3R4CA 3G2HA 2JGIA 3L7IA 4WCDA 4NL4H 1V3UA 5H59A 1EAMA 2HTEA 2NZWA 1CQIB 2IWHA 5IJ0A 5AXCA 5ILOA 3DH0A 3RROA 1SBQA 1YVDA 3GIWA 1FMTA 2GZDA 3WDLA 3B6MA 3R3SA 1MAVA 2Z8YA 1OIWA 4FGJA 3ZW9A 5DJ5A 5E9WA 5ULLA 1MW8X 2EKZA 2H9YA 2XTNA 1GFZA 2HAEA 2J32A 1C8VB 4P33A 3E9QA 4XYLA 1UAGA 1ZNYA 4B3JA 1NSFA 2I4NA 4JKOA 5CJ2A 4YRJA 3W1WA 1J0EA 3RGGA 4AP9A 4YRCA 3ZGOA 1PBNA 4BGIA 2VZ8A 4HX2A 2PS3A 5M3BA 1F12A 4LRSB 4J3NA 3N59A 5KINB 1TYAE 1Q7TA 3CVXA 3W3AD 1ATIA 1ELOA 2CNWA 2JJMA 4GWGA 3J7TA 4A5OA 5F23A 3PNQA 2JJ2D 5DW3A 4KPUB 4RM3A 2BEUB 4IYJA 4RFSA 4X20A 2G80A 1G20E 1RC0A 1TFUA 3BTUA 4P5DA 5EQFA 4WESB 4RJIA 4J7CA 4G41A 1VJDA 1Y1SA 2HPAA 1DJMA 1DBVO 1NMEA 2ONKA 1ZUNA 2P9CA 2ODNA 2ANBA 5ALIA 2QSUA 5KBYA 2O3UA 2O0LA 3B82A 1PR3A 2A1UA 3T95A 4A8TA 2BCEA 4C0JA 4RD3A 8AT1A 1XQWA 3OZWA 4MB0A 1Z13A 4HAYA 3T3MB 2OCXA 2BP7A 4OV6B 3INTA 2QYTA 1AS0A 5MHTA 3NYQA 1DCKA 1HE2A 3NDJA 1R9MA 4ZN6A 3C3YA 5CHEA 2AEMA 4E13A 4IO1A 4AQYB 4N5DA 4J90A 1QMGA 2F9FA 2FXVA 4P31A 4CHTA 1ULAA 3FIUA 4WGGA 2XTMA 3SBOA 5DTJA 3SD7A 3MD9A 1P6UA 3TVTA 4RPCA 1XLTA 4I2VA 3NOQA 4ZEXA 1BHSA 4QD3A 1QGOA 3BRQA 1YZNA 2VPQA 3V46A 2XDYA 3HG7A 2YS7A 2VJLA 3CUKA 2CLDX 4L6CA 5F1KA 1I1HA 3CJQA 4GOLD 4PLFA 2DR2A 4FFRA 1VGVA 3K94A 3KZNA 3QKWA 3PVCA 5LR6A 3D3QA 4BAZA 5M34A 1FVXA 2ZULA 5CK4A 3IMKA 5HIIA 5J5CA 3QENA 4G8CA 1YNOA 4CMEC 3UWOA 4AB1A 5DI3B 1CDDA 1ISRA 2QD1A 5CBPB 2CUZA 2IUYA 2OD7A 3I1YA 4RY0A 4DIKA 5B2FA 2FPMA 4TV8B 1TJ3A 4KBGA 1L5NA 3KEOA 3R6TA 2GPTA 3SYRA 1CY4A 3RWMB 3FWNA 4B6FA 2OZEA 2PGDA 3H87A 3DUFA 3PQ8A 1NNLA 2FZ5A 2ZPAA 3FA2A 4FHFA 1CLEA 4UBIA 2ZZMA 1EE9A 3OT1B 5K0FA 4BNTA 5JVDF 3I5AA 1G4UR 1US8A 2ZJAA 4A3SA 3PNBA 4I4TB 1LLDA 3F3MA 1CULC 3W2HA 4XFDA 4CLRB 4LJYA 5J4HA 2PGNA 2OD2A 1G9SA 3GLGE 2ZUEA 1CS0B 4AWXA 4ZYUA 4CEHA 2CYBA 3EMDA 4PHGA 1VE1A 1IN7A 2AFIA 3ENZA 4HDMB 3BWEA 4OSOA 5I01A 3CCFA 1IB0A 5JY6A 5D1HA 4C01A 1YAJA 1UQRA 3IJ5A 6LDHA 4FKMA 3L40A 1FUEA 2FKAA 2GFQA 4B3TB 1KO8A 4FZ5A 2JFVA 1YB2A 3IBYA 4GF5A 3GEPA 3GYBA 3RF7A 2TMGA 4UPDA 4BQPA 4XA8A 1E6CA 4FT4A 2EIXA 4IV5A 2B0CA 2QBYA 3DMTC 3ONDA 4RA9A 2XTZA 3R3ZA 4JC0A 4MP6A 3RR2A 3OG9A 2C59A 2GH1A 3WG9A 4EPYA 1N78A 1S2OA 4KN9S 1SXJC 2GCEA 2P4UA 2PL9A 2WWIA 2P27A 1FB5A 3TZBA 1QMPA 2VDQB 2ZWIA 2D4AA 3PC8A 4FFNA 2DHEA 1TPYA 1U1EA 4C14A 4EJSA 5BV8A 4CG3A 3P71T 1XAJA 4OQMA 1SJ9A 3RIMA 2WZCA 1VFPA 3ZE0B 3DZIA 4QJ4A 3DKKA 4UUPA 1M6WA 4PXAA 4US1R 5AKYA 5JSKA 1KL7A 1E6EA 3F1LA 3FKQA 4FNOA 4B46A 1YBVA 1QK3A 2O5VA 2WOOA 4B3IA 4DLNA 2B94A 1TT7A 5I3CA 4A2PA 5HP4A 1JYSA 3HR8A 4Z7JA 3CH5A 3BL5A 3PBKA 2VYVD 1E2HA 3EQZA 1YRQA 2R60A 2QZPA 3GP8A 1FFXB 3BXHA 3FWKA 3UJPA 4D4IA 3LLMA 3PE6A 3Q0EA 3KAJA 2ZKIA 2ZRFA 4UVHA 1NW9B 1SVLA 4WE3A 4UAVA 4Q9KA 1KZHA 4BEBA 2NP6A 3W1VA 1ACMA 2BHSA 1G2QA 1X7ZA 4FGZA 3N07A 5JNUA 4X97A 1IRXA 2WWTA 2A7XA 1GTVA 4HXGA 3T9BA 1JQ5A 1V8PA 2WA1A 1V8ZA 2XUPA 3NAGA 4O25A 3ZEAA 4DR4B 4DL9A 4CKWB 5IDXA 3MJ4A 1DKUA 1PR0A 2FSVC 3X44A 2OILA 2NVOA 4XDHA 3C3PA 3WSVA 2ZE8A 3F7NA 3RVSA 1JX6A 4WZAA 3MXOA 3NC0C 1GITA 3H9GA 5DDIP 4IQ4A 1DJNA 2V97A 3TLMA 4HUTA 4R8LA 2BFEB 1JEYB 2PUVA 3REQB 1UMKA 5HKAA 4I66A 3C8UA 1MABA 1J9GA 3FGZA 4HVLA 5BNTA 3OFVA 3KIPA 3IPLA 2HIAA 4M21A 4ENSA 2ODAA 5FUVA 1VLVA 3FD8A 3OZXA 4JEHA 2YH2A 3TLKA 1KYQA 3CUUA 1JFLA 4TYPA 3F1KA 1T3ZA 5KPDA 1Z0ZA 3LXMA 4CM8B 2JLUA 3PWKA 1NGSA 1NF3A 3KT8A 3P9IA 2Z3ZA 1O87A 4D4HA 1RHJA 1BHQ1 1TJ4A 2ZVPX 3EISA 3P0HA 3SNHA 4OHYA 2XPCA 1JQEA 3ABSB 3TD6A 4Q16A 2XJ9A 4GHWA 2B8NA 3DOJA 1V4NA 4J0CA 4OP3A 4HH1A 4ETMA 1LDGA 1LPAB 2ERXA 1IVSA 5G3YA 2FETA 3WLNA 4EECA 1WO8A 4CKBA 1HI9A 4RXTA 4O1HA 5LUBA 5L3SA 2CNOA 1HYBA 4XI9A 5LYJB 1J06A 1KARA 3L18A 2EFYA 3DG9A 1ABEA 2CC2A 2PY6A 3M2PA 1G5HA 1KJYA 1IJKA 2XMQA 4I50A 3L0CA 4K6KA 2GM3A 2DFNA 1J8FA 1EM8A 1J5XA 1H2ZA 3GXBA 3RAGA 1AQLA 5TGZA 1SB9A 4JC4A 1JI0A 4H6WA 1P18A 2Q1XA 5ALYA 2O19A 4RVSA 3NC4A 2ZJBA 4CTJA 2FOXA 2RGXA 4BNVA 3IO5A 3C8MA 2GESA 2OSVA 2WMYA 3CX4A 3MOGA 1IULA 1NBEA 1WDTA 4AJ4A 4GL2A 1ZGZA 2CZCA 2D1QA 1TEZA 4ZO7A 4L7VA 1DTSA 3BCUA 4DMMA 1A9SA 4NZNA 2GEUA 4R1NA 1AK9A 2C07A 1J90A 4V0MA 2GYUA 5FV4A 4WK2B 3VR5H 3ORQA 3AVVA 4WZBB 5JXWA 4D57A 3RABA 1U1DA 4XX0A 1XD2B 3DHYA 4DNFA 5E1DA 4UDOA 4FIZA 4RLQA 5HOEA 5F5NA 1FE8A 3LTNC 4D8UA 4JP5A 5DP2A 1LVHA 3WKCA 2I66A 1U4SA 1VPLA 1GPUA 2HJ9A 2MSNA 2WIFA 1MG5A 2Z04A 2EWWA 4G4GA 4ZMSA 4HO1X 1DADA 3RVQA 1HL7A 5B30A 4V0OA 4P81A 3B1FA 1PU2A 2PX8A 3PE3A 2WU3A 3B3QA 1F8YA 5IM5A 4BYMA 4GOKA 2YZKA 1HLDA 2WINI 1U2PA 2D5AA 1V9SA 3A26A 2XUKA 4DUGD 3C3WA 4UMFA 5AVOA 3QBJA 2JATA 1OZFA 5K0LA 4BN5A 3LT1A 1XDDA 1RZRA 1R0XA 4R0VA 3MMSA 4R9UC 2WQ6A 2O1WA 2P0YA 4HAVA 3LUBA 4MMYB 4IGIA 2JGMA 5CDUA 4WLOA 1T1EA 5FNVB 3VZCA 3IDSA 1M83A 2P9FA 5JNVA 1MVLA 3RPEA 1KBQA 4L4SA 5D7BA 1VPDA 1P0MA 4ZICA 1RIIA 2CLFB 2IUFA 3L0BA 2HTFA 2FUNB 3NV9A 3OEHD 1QSGA 3VHRA 1DKPA 2V4UA 2R47A 5TQJA 4WERA 1TKAA 3OE1A 1YZHA 4QQNA 4DILA 1Q11A 4CDGA 4G8DA 3AY7A 4D56A 1H3EA 2ZBDA 1EJBA 2CDNA 2QG4A 2NTVA 4I9NA 4ZAXA 2E2WA 3HPRA 4B34A 4UHDA 1U7WA 1FYXA 1P0CA 3EZXA 4L2IB 4NQZA 4JHLA 5IK2A 5DTRA 4CYMA 2V7TA 5D2CA 2BGNA 3KB2A 1R4NA 4BKPA 3J7AC 1MXHA 2R8YA 4PZLA 4RADA 4U2DA 2QW0X 1X87A 4Y67A 4Z9BA 5THKA 4IY1A 2QDXA 5EXSA 3OFKA 3V4FA 1HE5A 1ZRNA 2ZSFA 3BD9A 1XAHA 4N8DA 1XXHA 2F6RA 2P3LA 3LZDA 3ENKA 1RYFA 5C8DA 4IDQA 3EXIB 4RCYA 2I4RA 4IDAA 1JLKA 5WRFA 1EX9A 1IOVA 2BOVA 1LSJA 4GM0A 4DDWA 2J45A 5AJTA 2V6MA 5KC8A 4YVFA 1B74A 2Z5GA 2PSHA 4CM7A 2UYQA 3QPVA 1A9RA 4N8SA 1S6YA 1CUYA 1YS7A 2ISCA 3KSMA 2HV8A 5FA5A 2QRGA 5FEMA 1Q0QA 1SFRA 1Z75A 3QV2A 4MI6A 5J1TB 3ZE7A 3QE2A 4HQ0A 4R8SA 1T5SA 1LDBA 1RPNA 2ANCA 4FFBB 2HHAA 3BM5A 4J07A 3PL1A 3D64A 4LDNA 4A0GA 3EW7A 3Q8KA 5DSZA 1DIRA 4B7XA 5J2TB 1PNQA 2H2DA 2DRIA 4PZUA 4V39A 2DTEA 2AYYA 3FMPB 3PYLA 3UFXB 1KVTA 1SU8A 3L7JA 4QULA 1M5UA 2GYWA 5DM1A 1MH9A 1WXFA 1TYCA 1F1JA 4PU0A 3GLHE 4ND4A 1JMKC 4NAUA 5GY7A 2OXRA 1DAPA 4ADSG 1AXEA 2O50A 4Y0NA 2Z3WA 1P3DA 2HU5A 4O4HB 3S29A 5E6RA 3EQ2A 4OFBA 5AKHA 4WBNB 1DVRA 1ZD1A 4JR0A 3VSAA 4PAWA 3ZE2B 1NNUA 1BC5A 4DA6A 2WW8A 1Y7HA 3L0IB 4CM1A 1RVV1 1NQWA 3EARA 2BFCB 2PMCA 1WL8A 3L6BA 3BH7A 3QFSA 5DWDA 4QDZA 2FCAA 3KZKA 4JP1A 1YA4A 3C3JA 3E7PA 5DYYA 1C0PA 1SHZA 2Q99A 4IXMA 5J1SB 2BKLA 3O1LA 2FUKA 3FGOA 3EC7A 2CHEA 4NEQA 4E09A 1N6RA 4R8KA 5EZYF 1FU8A 4BFWA 2Y1LA 4EKYA 8GPBA 2PN1A 3GAFA 3LCJA 3NGXA 2UYCA 1LX7A 1Z06A 3PWSA 1PF7E 3AERB 1ZM3A 2BFMA 2OZVA 4HC4A 1Z39A 2PQ6A 2ABWA 5BR1A 4E32A 2F1IA 3HBAA 4BMOB 4L0MA 4XLLA 3VH3A 1CD5A 1R4MB 3U9LA 3JD4A 2IOFK 4LXYA 2WP0A 2NVBA 1CKEA 1J22A 1TB4A 1H65A 3S27A 4F04A 3GAZA 4NY1A 2G82A 4ZEWA 4DT1A 2YDYA 3PGVA 4YUVA 3A9TA 3I61A 1RIFA 3X2FA 2CLEB 3CJTA 1XTQA 3GEGA 2UZ0A 3RRBA 3DYVA 3H8JA 5AW4A 1M1UA 2MTBA 3JQBA 3UCFA 4PG7A 1B8OA 4IZ6A 2BTQA 3GL9A 4XIYA 1ZD3A 2ZT6A 4XJVA 4XH9B 4AWAA 5HZGA 3QW2A 4XOUA 4TSKA 1S2DA 1RJDA 4O4JA 1L5GB 4PBRA 4GOND 1GL7A 5B7QA 1RP7A 2B0JA 3KBBA 1XZDA 2JGFA 2WJVA 3VVMA 2GN0A 3GFTA 1N2XA 5JT1A 1KU6A 1P4HA 4B3FX 2O7RA 4UZSA 1G5FA