1P4SA

Solution structure of mycobacterium tuberculosis adenylate kinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Studies on Ligand-Free Adenylate Kinase from Mycobacterium tuberculosis Revealed a Closed Conformation that Can Be Related to the Reduced Catalytic Activity.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 49
structure length 181
sequence length 181
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p4sA00
2QG6A 1T5IA 621PA 6Q21A 3AF2A 3U4QB 2IW3A 2OCAA 3M1IA 3NWJA 1VG0B 3HWSA 3K9HA 3KKMA 3BBPA 5C1BA 4V0ME 4L5BA 4XWAA 1CJVC 5IRCD 3REFA 2AK2A 2FGKA 1T6NA 2EFGA 2JJ1A 2RGEA 3E2IA 4GL2A 2QPTA 3EC1A 4QFMA 1M7GA 2JGNA 1US8A 4A36A 1SXJC 2NMVA 1MRSA 2JLWA 5B2ZA 1N3BA 1ZP6A 4OJKA 5EP3A 3WMFA 1A1VA 4YDHB 4GBMA 4M8NE 2ZSEA 2OXCA 4EQ6A 4M9SA 2Q9CA 5AJXA 4G5RA 1ZIPA 1G19A 2CVHA 4KSBA 1E2HA 3NBFA 721PA 4GDFA 4LHVA 4FMDF 4MGIR 5LBIA 4ZCMA 4Q1CA 4DEXA 4NHOA 1JPNA 3K0EA 3SBEA 2ZYVX 4P32A 3FYHA 2REBA 1SVOA 5FTKA 1GILA 2D62A 2QSYA 3W9YA 5JECA 5KSOA 1W36D 3RYTC 2ZTSA 5JSZA 4E03A 3WYGA 2JLYA 4M22A 2O0HA 1HT1E 3LV8A 1Z3IX 5JCPA 1WB9A 4JZKA 1R2QA 1QG2A 5J5CA 1OIWA 5DNYB 2GCOB 2B7BA 2PZGA 2NO0A 4P4UA 3IHLA 2BBOA 1Q1QA 1T4GA 1FFHA 4DLSA 2VBCA 3QEOA 4URWR 1K5DA 2Y8EA 3AV0B 5JHHB 4QM7A 2I4IA 3DHWC 3HR8A 2FPMA 3OEHD 2BBSA 1FX0A 4YLGA 4FWIB 1US8B 1FTNA 2CCKA 5EE5B 4Q4HB 5EXSA 2YVUA 4YMVA 3K09C 1Q22A 1YRBA 2QI9C 2FPLA 3KFVA 4DLVA 1NMYA 3UANA 2ZRLA 1XCMA 1KHTA 3QG1A 3AVVA 3HU3A 1MO4A 3RRYA 3UMSA 3T15A 3AF4A 4B34A 1DO2A 2VO1A 1G3MA 3THOA 5CB8A 2LKDA 1BKDR 2ZSFA 3FMFA 4IDHA 4EAQA 4B74A 3EPKA 5DGXA 2ZETA 3BFXA 1OF1A 5DE3A 3GLIB 5EE1A 3D3QA 3ETLA 1N0VC 2QP4A 5TVKA 3LFUA 2D4HA 2FFQA 3K0AB 3P20A 4YMWA 5H70A 4QGAA 2FGJA 4KFTA 1TUIA 2OFOA 3VTKA 2W2XA 2ZUDA 2PX0A 4KV9A 3N2EA 5DLQC 5TARA 2IF2A 2B8WA 1Z06A 5JS7A 1T8UA 1ZVQA 4LJ9A 2JJ2A 3IBYA 1NN5A 4PAMA 4V0NA 3ZVLA 5HCNA 4C0LA 4NCKA 1VDZA 1R10A 5GVSA 4F7WA 2OILA 4LZZA 5HE9A 2VHJA 5J4LA 5DI3A 4IHQA 4W5JA 2CCGA 1U0JA 2FFAA 5CLLA 1AQUA 3AH8A 4Z1MD 2R8RA 2BCJQ 3CH4B 4TT3D 2FSIA 4BFUA 3ZLJA 4BZQA 4YMUA 4PSKA 4R9UC 1NBME 4EUNA 1W36C 4NMMA 4PHTA 4O2LA 4IVRA 1G3UA 3K9GA 4C9BA 5BN3A 1NIPA 2QM8A 2IYYA 2V1XA 4WOPA 4R71A 5DSZA 5AJWA 1CLUA 2QQ0A 3KKNA 2RHDA 4JSTA 3H2YA 1A7JA 3WRYC 1NLYA 4OI1A 4WBSA 4XD7D 4NDZA 1RRCA 4UXIA 2Z4RA 2FEMA 2OCPA 3FHCB 2WWYA 3JZAA 3CW2A 2PZFA 4GFDA 4TZ6A 2XJ4A 4Q4JA 3C16C 1GG2A 2A30A 1LW7A 1SZPA 3K70D 4DLUA 3X2SA 4CT5A 3PUWA 1XZQA 2ZRHA 1F2UB 1HEIA 2WJJA 4M1OA 4DDTA 4HUTA 4CEIA 2QY9A 3RHFA 4AYWA 3A58B 4URXR 1U98A 4EFNA 4RY2A 5AJYA 3CWZA 3IIKA 1J90A 2H5EA 3TBKA 3DOEA 4E07A 4Z1MA 2XZLA 3FKQA 3U44B 1IHUA 2XNDA 5CDFA 2I3BA 4NL4H 4RD1A 4EPYA 1NY6A 1GAJA 3AKDA 4Q7KA 1WXQA 5C46F 2GEUA 1GKUB 3CF2A 2B21A 1F6BA 2QMUA 3DMNA 1F2UA 2NZJA 4GSYA 3TAHA 5LPNA 1JQJC 2HXYA 2ODBA 4RVCA 5AUPB 3GJ7A 2ZXUA 2WTUA 4OHYA 5KNDA 5JBQA 2WWHA 4OQFA 4TQUS 2O0KA 3A1UA 1XMSA 2XXAB 2ZM5A 5FBQB 3ND8A 3OFNA 4EFMA 2A7QA 2I1VB 1ZM7A 2VTKA 4QHSA 4D0LB 3ZVMA 4BFTA 1N5KA 2ODEA 2VP4A 3QF7A 4JLKA 3VHXA 4HLUC 4IEEA 4Y0VA 5CJPA 1DELA 2F9LA 2WWWA 4B2PA 3ZD6A 3LLMA 5FUXA 2GZAA 4N0DA 1XP8A 3MAAC 1CRQA 4M1TA 2C2HA 3KKQA 521PA 1KI8A 2OV2A 3HYTA 1N25A 2J0UA 3ASZA 4PC3A 5H1YA 1QHHA 1YKSA 4JLMA 4DUGD 5L3SA 4RFSB 1MH1A 3PUXA 4LCBA 3CR7A 5SZJA 1QG4A 2WOJA 3IQXA 4BEJA 4H1UA 4O0MA 4LJYA 2EU8A 4OI2A 5DI9A 1XD8A 4EIWA 4NYMQ 1JEEA 3B1YA 3OZXA 4BQSA 1MO6A 1CRPA 2WIBA 4NBSA 3I4LA 4JLJA 3U6BA 4C0AC 1E0AA 3IPXA 3ZIAA 2GCNA 1JECA 3I3SR 4BUJA 2CL6X 4A8JC 3TJZA 3DMDA 1E2QA 3VR4A 1Z29A 4JL6A 2RGBA 4KYUA 1D5CA 3VQTA 2C04A 4B2LA 2Q0HA 4ACAA 1JJVA 3KKPA 1W36B 3T1VA 4XOIA 1JI0A 1G6OA 4JS0A 1KMQA 4A0RA 2ZYWX 3CIOA 4BWYA 4WW0A 3PITA 4NCNA 2HEIA 4OK6A 4QC2A 1XMVA 2F1JA 3SQXA 4JVSB 3KFXA 3SHWA 2PBRA 5E7IA 3CX7A 2ZI3A 5EUQB 3IO5A 3X1XA 2NZ8A 4Q47A 4TLAA 1SVWA 1VHTA 1ZJ6A 3NKVA 4U02A 3T35A 1Y3AA 5TV2A 3TMKA 3CM0A 1S1MA 1Q1EA 1TF5A 1K5GA 4W7SA 1HTWA 1XNJA 3RS2A 1FX0B 2Z83A 3NDPA 4MA4A 3BFVA 5FBRB 3X1DA 3THXA 1ZNYA 1HE1C 4L9WA 2IUTA 1TQ2A 3FWYA 1ZINA 5GVRA 4TLBA 1W0JA 2F43A 1MABA 3UWKA 2ORWA 1VCNA 4BGDA 2DFTA 3LBHA 1JPJA 1OIXA 1JB1A 2JLUA 1W2GA 4U7DA 3TVTA 1VYTA 4DCTA 1UADA 3NDBB 1NN3A 3V4RA 4PSVA 1HYQA 3LWNA 2W6ID 4II7A 2BEKA 4BPBA 1AGPA 4DLZA 2YOGA 5KYKA 1RE0A 1JEDA 4XWKA 4NTZA 5EQTA 1TEVA 2BBTA 3PV0A 3QF4A 4BLRA 5KSYA 3KQHA 2G1KA 3I62A 4KFSA 1HA3A 1T0JB 1U8AA 4QG7A 2IUSA 1EXMA 2PLFA 3CO5A 5BYKA 2CHQA 3BE4A 5C18A 3OF5A 1YVDA 4Q4AA 4ILEA 1ZCBA 3A1SA 2EFEB 1HQYE 3FVQA 4CW7A 2Q21A 3LRPA 4HLCA 4IFBA 2IYTA 1W0JD 4TYPA 1DTSA 3I61A 4HUQA 2HDNB 3SQWA 1XD2A 2QQEA 3ZS8A 1QHGA 4GPTA 3EZFA 1DAEA 3CPEA 1N6KA 1KSGA 4PZLA 3UKDA 1EFUA 3X1WA 4KITB 4LJ8A 3SJCA 1Z22A 4Q7JB 4OHWA 3LBNA 5UKDA 1J8YF 1FPMA 3X1ZA 1E1RD 1JR6A 3WBJA 5K8UA 2W58A 3AVPA 5TMPA 3TW8B 1Q21A 2QU8A 1YHNA 1E0KA 4QBIA 3TW4A 1LTQA 1T8TA 4PQYA 2YOFA 3GJ4A 2H17A 5JRZA 1PZNA 3DDCA 2WJIA 1TU4A 2GF0A 4H1VA 1UF9A 1ZD1A 3B5JA 3FMIA 2JLSA 4JKYA 4DC9A 5JI3E 4L15A 1G20E 1X3SA 2J59A 2XB4A 4QL3A 3CX8A 4OQXA 2KWIA 3OIYA 4TL8A 2X77A 4HLUA 3U7FB 2Z43A 2UZIR 2QPAA 3RS3A 3BK7A 3SBDA 1JAHA 2VHUA 2W6IA 4QHTA 4EJSB 4HDCA 4KCGA 1VIYA 4NU0A 5HTKA 1KSHA 2V7QA 3OAAA 3RNLA 2PX3A 4HZUA 2FSGA 2VSOA 1QF9A 1N2CE 3K0AA 3UATA 2HF9A 1AS2A 2VP2A 3JVUA 1Z6GA 1EWRA 4C0SA 3AVTA 1WRBA 4RD2A 2VYFA 2OLJA 4DWJA 2ZEJA 1X8KA 1GITA 1T9HA 1ONBA 3UWOA 2VLIA 1YZLA 3BORA 1TQ4A 1I2DA 3L0OA 1ZCAA 1K6MA 2A5DA 4DLRA 2EVWX 2AK3A 4W5HA 4OHXA 5HZHA 4GP7A 1IJFA 4M0LA 4BRUA 2WKQA 4U00A 3F0TA 2VIIA 5JWRA 4IDNA 2JLRA 2O8BB 3BWDD 3VKWA 4MDEA 4QJ5A 1YZNA 2ZVPX 1KJZA 1TQDA 2WAYA 3KJIA 4TTQA 1XTIA 1W5TA 2R2AA 4AC9A 1E0JA 2OCYC 2Q9BA 1DG3A 4KLZA 2GWHA 1KDTA 2QTHA 1UJ2A 3MG9A 3QENA 2ODWA 4FW9A 3M4YA 4RFVA 2J0QA 3BAFA 2OUKA 5DHAA 1CR0A 1D6JA 1KJWA 1Z6XA 2AXPA 5FFMA 1GIAA 3H0KA 2OO7A 2GNOA 1ZYUA 1LS6A 221PA 2O0JA 3UMFA 2VQSA 4ZO4A 1NNEA 1SHKA 5FBVB 4B47A 1P2VA 4BLPA 4JLPA 1MOZA 4WZAE 3ZDQA 4ARZA 5B58C 1P2UA 3WXMA 3RS7A 1KNQA 3BJIC 2KB0A 3LW7A 1XX6A 3ZIAD 1CBUA 3QOFA 1TF7A 4QGGA 4C4PA 4CDGA 3EA0A 1OYWA 1UBFA 1II8B 3TUJC 3B6EA 1XEWX 3ND9A 3EAQA 3I32A 3L82B 1NMZA 3U61B 2AL7A 5L8VA 2G77B 4EPXA 1ZUHA 4V0MA 2CE7A 4QGFA 2VHQA 4P0TA 4OK3A 1N6LA 1NVXQ 2AX4A 2IHYA 4XSHA 2NIPA 1X8LA 3NBXX 3A1VA 1EX7A 3PEVA 5FOTA 5G40A 2OFXA 1CIPA 2H92A 4A0FA 1M74A 1TPZA 1IXSB 4DIDA 3THXB 4HZIA 1CR1A 1NIJA 3TLXA 4PZYA 2CL7X 3K70C 2ORIA 2JATA 5H68A 4L16A 2PJRA 1E2DA 1H8ED 4AURA 4FXPA 3MCAA 2WV9A 1I4LD 1VCOA 3BB1A 3WRXC 5E3HA 3U4QA 2IEYA 2W6JD 2OFWA 3CNOA 3QY0A 4FWTA 1U0HC 4HI0E 2W2VA 4B3CA 1D9XA 2W2TA 2DFLA 3S1AA 4BFYA 5AUQA 5JMTA 4FI3C 5TY0A 2WIAA 3GPLA 2ZUCA 1IN6A 5AUNB 1Z0DA 2ZR0A 1S9DA 3I8XA 4MYUA 5K8TA 4PC1A 3GLIE 1XPRA 1II0A 4URUR 1RJ9B 3KJEA 1UBGA 2NQ2C 2G1JA 3KZ1E 3R9XA 4DEYA 1Q1ZA 2GETA 1V5WA 3R9WA 1G6HA 1G21E 1OJLA 1L2TA 1F2TB 3LH5A 2ZRFA 4B32A 1WQ1R 3NXSA 1VHLA 4QRHA 3CPJB 3O8BA 1CJKC 2FSHA 1XB2A 5CJ2A 1E32A 3OE7D 4OL0A 4DCVA 1AM4D 1E0SA 4JLAA 1Z63A 121PA 1H8EA 2ZYUX 1OXVA 4RD4A 1D8TA 5EXXA 2WWXA 4OJQA 3A6PC 1E9BA 1EK0A 4Q4LA 1R0XA 3FMPB 1YRAA 3O8RA 5G3YA 3AF1A 2IS1A 2WOOA 2IYVA 2GILA 1UKEA 1W4CA 2E1RA 1G18A 1PJRA 1PUIA 2GK6A 4X8HA 5G3ZA 3B7GA 5JCZA 1X86B 2EWVA 2BCGY 1T3SA 2HJVA 5F9HA 3TQCA 2X19A 4NCHA 4MYCA 2LCFA 2IYUA 2RMKA 5IHPA 1NY5A 1VCIA 4M2LA 1L8QA 2D3WA 2KJQA 3EIEA 3T5DA 3BERA 3R9IA 2OAQ1 3D8BA 1OH7A 1E9FA 4M9XA 3RWMB 3NH6A 1NRJB 5KDLA 3P32A 3QEJA 3T5GA 3GFPA 3KX2A 4PHGA 3SOPA 1H65A 1CKEA 2P6RA 3B85A 4LDJA 3QJYA 4BASA 3TK1A 4Q1AA 2P2LA 4TTPA 1RIFA 1YR6A 1FMJA 2BC9A 2FX3A 3FKSD 4RSGA 4ZDKA 2BMDA 2FOLA 1N6NA 4IJMA 2OXRA 4F93B 5JZVA 1R0WA 3Q7PA 3QVUA 4G5QA 1LY1A 1XXHA 2YWEA 4EJSA 3KQNA 2VF7A 2OBLA 1NI3A 1P75A 1UPTA 4NYIR 1P2TA 2O8FB 1JR3D 4LBWA 1X8JA 1II9A 4E5UA 1NLFA 3FKSA 3Q85A 3ADKA 3RAPR 4XVUA 1WBBA 3ADCA 5BYJA 1D2EA 4URYR 5FOXA 2R6AA 2P5SA 4ZCLA 2ZRKA 3B1XA 4NONA 3B2EA 4EPWA 1WF3A 4MRSA 3PJRA 3C5HA 1OT3A 3TSZA 1E2NA 2C03A 2A5YB 1KDOA 1T5LA 3IO3A 4JVNA 3MWYW 3S1AB 4ERNA 3PUYA 4Q9KA 2HJGA 3EPLA 1TAGA 2FDCA 3SJAA 1O87A 1QRAA 1OH6A 3KQKA 1PLLA 2JEOA 5L3QB 1A4RA 1NG1A 3K9NA 4B3FX 4XVQA 4GZLA 1VIAA 2GTPA 1KKMA 3OEEA 2ZR9A 2GRJA 4IKEA 1GRRA 4MYHA 1AZTA 4QNRA 4TQ9A 4UQOA 4LY6A 1E4YA 1N6OA 4B6EA 1XTSA 1LFDB 3GMTA 4FN5A 2C78A 2ZU6A 2GXSA 2QE7A 2XOKD 5KHOC 3GLFA 4A8JA 3BC1A 4TMTA 4A2WA 3QKUA 2PEZA 1G7CA 2RGCA 4FMBB 4PXAA 3AF3A 1AQYA 2QNRA 3CNNA 2PMKA 2V6IA 1ZRHA 1KK3A 5DYIA 2C77A 3GD7A 1NMXA 421PA 1UKYA 4OQNA 1DO0A 1VCMA 1G4UR 3B60A 3VFDA 2ZE8A 2XTNA 2OLKA 1A82A 1KJYA 3B9PA 5C2JB 4BLTA 8OHMA 1U2RA 5KU1A 1SQ5A 3GEIA 4G3XA 3W6OA 4FD2A 1XJQA 1G16A 3I8SA 4PO1A 1A2KC 5KUTA 1R0ZA 2ZVQX 1G5RA 2IC5A 2R6CA 3NC1C 3C7KA 4LWZA 2RHMA 1K8RA 1Z0AA 3D6TB 4NP6A 3W3ZB 5JRJA 1PV4A 3EX7C 2PEYA 3SN6A 3TQFA 4ITRC 1IY0A 1ZNZA 3KJGA 3AQ4A 5K8LA 3LQRA 5LD2C 2J0VA 2JJ2D 5A0FA 2IX3A 2WJGA 3UK6A 1IN5A 2HUPA 3AP3A 1KNXA 4FMDB 3N2IA 4F4CA 3RSLA 4B35A 4OI0A 4M9QA 2OBMA 3PUVA 5JEEA 2ZE6A 2X1VA 1IQPA 4H9GA 4GMXA 1E79A 1FP6A 3P4YA 4W5WA 2CBZA 3I92A 2OM2A 1R6BX 2Z4SA 5JWHA 3REGA 3DO6A 3RS5A 4ZDIA 2QP3A 3Q8XB 2OAP1 4UNPA 2JCSA 2JDIA 2N42A 4Y0AA 3GJ5A 3QUSA 2O8BA 2QAGC 2C9CA 2WMNB 3J81k 1MRNA 1GL9B 2J1LA 3KXKA 4KSCA 3DM9B 4LBYA 1P62B 1UDWA 3L0SA 2NTYC 2VA8A 4HB4A 4AG6A 2CLSA 4KU4A 4US2R 4GOKA 2FNAA 4PHHA 2RGXA 2CVFA 1E2PA 2WSSA 3GLHE 3V00A 4BFWA 2O8EB 1R8SA 1RRPA 1G3IA 4M1SA 2FJUA 2GXQA 5EP1A 1RYHA 1AZSC 3BS4A 4KODA 4NH0A 4LV5B 1ZIOA 3PEWA 4Q9IA 4ZI2A 3EA5A 4HZUB 3TSWA 3VMFA 3VX4A 1ZBDA 4TYWA 4C3ZA 2ZJBA 3WNBA 4Z54A 3VAAA 1B23P 3AGPA 4AKIA 2WWFA 5CB6A 2QENA 4V0LA 5B64A 1Y63A 4LJ5A 3A4MA 2JLZA 3QE0A 4AI6A 1LVGA 5DHFA 4DJTA 1NP6A 1OW3B 1Q57A 2QGZA 3IPYA 3GLFE 1GRNA 1VECA 2ASEA 3AP2A 3GJ0A 4LV8B 5CYPA 2J3EA 3H86A 2HCBA 4C30A 2GEDA 3QKSA 2G3YA 4IFEA 4LX0A 4DDUA 3T1TA 1N5IA 2JIZD 4A8JB 1P7CA 3KQLA 4YDSA 2PJZA 4BLOA 1XD9A 2GESA 4ASUD 5CDFE 4LBZA 2C99A 4QOSA 4MGKR 4ZIRA 2YWHA 2ZSBA 1IBRA 2BEJA 1OXUA 1Q1BA 2GAOA 3NBYC 2IYZA 4JLNA 3WNDA 1WDTA 4PC6A 5EJEA 5L3SB 3ZVNA 1X1RA 2JIZA 3UXMA 2OT3B 4F4IA 4TSFD 4JT2A 2ZS7A 3SR0A 4TLDA 3KJHA 4BRWA 2F9MA 3VR6A 4XWOA 4LYJA 5FPHA 4D80A 2UZ3A 4UXHA 3ZZTA 1CJMA 1EX6A 1I4DD 2REOA 2UKDA 3GFOA 2QTVB 2QT1A 2ZE5A 3C5CA 5LB2A 4JL8A 1BH2A 4KXFB 1OPXA 4LYFA 2IS6A 3GLGB 2FFHA 1NJFA 2VP0A 2WHXA 2ZE7A 2HCJB 2EQBA 1OLOA 1KI6B 2ZRIA 4WZ6A 4TYYA 1EFRA 1NBMA 1P2SA 4Q00A 4N3NA 1FP7A 1G3QA 2ZRPA 3I1FA 4MKFA 2V7QD 3X1YA 5IDVA 4IRUB 5CK5A 5J40A 1E2KA 1ZUNB 2WSSD 5DISB 1FUUA 4TQAA 5GJVC 4QGHA 2GEVA 1Q20A 3A1TA 4Q4AB 5JI2E 4M1YA 1EFHA 5LB4A 3VR2A 1JJ7A 4M9ZA 3WMEA 2MSCB 2CXXA 4C0QC 1EFCA 3PQCA 2ZREA 3A1WA 3K9LA 1IM2A 4WZBE 3M6AA 1GOTA 2BDTA 3U3JA 2AHOA 4AKHA 1Z5ZA 5M04A 1SKQA 3SYNA 1RYFA 2TMKA 3AKCA 2CDNA 4PANA 4NKRA 2PL3A 4LSGA 2AKAB 3IDQA 4JJKA 5KNBA 2DR3A 2ZITA 3CBQA 3SNHA 4PO8A 1ZMXA 2FG5A 2IYRA 3UG7A 2VP6A 1QHXA 2NO7A 5GADl 1DAKA 5GJWC 2QA5A 2ZS8A 2J46A 3I73A 1DG1G 4TTRA 4E22A 4OK5A 4BFXA 5AR1A 1HURA 1PLKA 3CUEF 3BH0A 4PAOA 2GJSA 4KBFA 1CXZA 2ZJ8A 1ZUIA 4PR0A 4DIEA 1DAMA 5TB5A 2XB2A 3KXLA 2ODNA 4XSGA 2J87A 2QP9X 3PG5A 3LX5A 4CEHB 1IY2A 1E9AA 1PVOA 5JHGB 3MJHA 1S8FA 2Z5FA 2WZQA 1E1RA 1Z07A 1GL6A 3NTUA 4IVPA 1TU3A 4KAXA 1J7KA 5L3QA 3Q3JB 5FOWA 4D4MA 1G291 3BH7A 4MKGA 4GMDA 1UFQA 2CL0X 3GQBA 4IOMA 1W49A 3V4FA 4DB4A 1E9RA 3MSXA 3BD9A 4HATA 4PX9A 4RD0A 3R8FA 3F3YA 1P72A 2DY1A 4KO8A 1KI7A 3BIFA 1IY1A 1SXJA 2GDJA 3Q9LA 1RVDA 4RZUA 1E99A 2NO1A 1J8MF 2ZJAA 4I81A 2BJVA 4AD8A 4B3XA 1XEFA 1Z2AA 1I4TD 1GTVA 4K46A 1R5NA 4WXRA 5SZKB 2QMEA 2JJ8A 2YNMA 3O8DA 1KK1A 1YZQA 5DIFA 1XEWY 3E5HA 3LY5A 1JR3E 4FMCF 3EZ7A 2D7DA 4BFVA 2DHRA 4PO9A 2GZDA 1AN0A 4EFLA 4F91B 2XSZA 2PCJA 3OEED 4B3DA 3D7MA 1RKBA 4BLQA 2IXEA 5H8WA 4JL5A 1FOEB 4M1WA 5CM9C 2EYUA 3QBVA 3DPUA 3CRMA 3OIUA 1PUJA 2EFDB 3LX8A 2QRZA 3W6NA 3Q5DA 4PQRA 3WYFA 1ELOA 1PLJA 1QHHB 2DWQA 2W0MA 4B44A 2IUUA 1YQTA 1JAIA 1G41A 1XTRA 5HKKA 4PPNA 1DVRA 2WICA 2W00A 3QKSB 1ETUA 1QZXA 3ZS9A 4CEJB 3MGCA 3V9PA 3B1VA 1E2JA 2ZROA 3VU9A 4AIIA 1XTKA 1YZTA 2VSXA 2ZU0C 2CE2X 2IS2A 1KDRA 3G5UA 4LJ4A 1SVMA 3Q72A 1RZ3A 2GCOA 2B92A 1E2FA 2ZRMA 3MWJA 2O5VA 1LV7A 1N6PA 1SXJB 1G17A 4L4UA 1W46A 2YOHA 4MGYR 4FCTA 4IDQA 4PZZA 2O8EA 1H8HD 1XU4A 4DXAA 2CJWB 1W0KA 2F1RA 1QHNA 3O47A 1TL7C 4C2TA 1MO3A 2QORA 3BOSA 3VHLB 2R44A 2MMCA 4US0R 4ARZB 1TNDA 3ADBA 3OHMA 1N5JA 4YMSA 3IBGA 2P65A 1SVSA 1KI4A 3U44A 4R2IA 3NEYA 4Q01A 5FBLB 5FTJA 3G0HA 2NO6A 1T3LA 1TEXA 2VSFA 3P4XA 1TQ6A 5IT5A 3K0SA 3LW8A 3HPRA 3QXCA 2WJVA 2WPDA 1CU1A 2LWIA 4B75A 3THWA 1E2IA 3JZMA 1DADA 4V0KA 3K0FB 2BMFA 5L3RA 5JJLA 4MRRA 3VU9B 4TL7A 2IYSA 3K0CA 1UEIA 3BB3A 3OIVA 1BOFA 2A5GA 2O8CB 2CHGA 2D2EA 3L2OB 3AUYA 1SULA 4DUGA 3GLFB 1AJEA 1OV4A 2ANCA 1S96A 3DZDA 1XCPA 4R7ZA 4ZI3A 1VYUA 4A0GA 1HT2E 5J4HA 1KK2A 2DFKB 3NG1A 4UJ5A 1JR3A 3EIHA 2CHVA 4P31A 1OFIA 2I1QA 1S1CA 1W0KD 3K70B 4JVMA 2EYQA 1DOAA 2IEZA 2ZS9A 3KL4A 3L0IB 3ZD7A 2OBNA 4DKXA 4ESVA 1ESMA 2A78A 4IDOA 4LPSA 4XTCS 2XITA 5KOYA 1W4RA 3RC3A 4P3YA 4DSOA 4MRNA 5J4KA 5J4VA 1HUQA 3T34A 4NCIA 4MRPA 1OFHA 4A4DA 2HLDD 3U3OA 2XZOA 2BV3A 1QBKC 3B8HA 4ABYA 4DCNA 2GCPA 5FL7A 4IDPA 5HZKA 5BWMA 3IGFA 5HKKD 1G9XA 1NVVQ 4BFSA 1XXHB 2ZIAA 4F38A 2GK7A 5KSZA 3A36A 3AF0A 4GT1A 3EPJA 3SZRA 5D3QA 1II8A 1XPUA 4XJXA 4PHFA 1XCGB 2ONJA 4D4LA 2DFNA 1G8HA 3C8UA 3NIBA 2DB3A 4HLDA 3WYAA 2GVZC 3B1WA 3NHAA 4IW3B 1N0UA 4TMKA 3C15C 4O2RA 1S0UA 4V02A 1G8PA 4D6PA 4LRWA 2HXSA 2YHSA 1XXHE 1Z6TA 4DRZA 5G53C 4XIGS 1Z28A 2ZJOA 3IIJA 3SDZA 2ZRCA 1HV8A 4V0OA 1N6RA 2RGNC 3W34A 4TN1A 3LQQA 1E9DA 4JLVA 4ZCIA 4KVAA 1BS1A 5B30A 4HAUA 1BO6A 3BH6A 3PCRB 4UNRA 2ZRNA 1GDDA 2ZJ2A 1ZNWA 3AUXA 1VKJA 3GLHB 3MWKA 2N46A 3TRFA 2R62A 1P73A 2R65A 5FR1A 3ZGXA 3HJNA 4Q1FA 4YXWA 3FDIA 4EJSC 4HYYA 5GJCA 1QHSA 3TUZC 1NVUQ 4E09A 3CRRA 4DDWA 1S9HA 4OBEA 3KTAA 4EDHA 2NGRA 1VG1A 3B13B 4JBYA 4B2IA 4DVGA 1KIMA 1DPFA 4G1UC 1X1SA 2J0SA 4US1R 4RKEA 1VPLA 1CR2A 4PPGA 4XH9B 3FHTA 3LA6A 3WP0A 1WCV1 3EW9A 2C8VA 2F1IA 3QF4B 2HV8A 2P5TB 3E70C 3UG6A 3NC0C 4S35A 5FL7D 3HU1A 1KOFA 2CJWA 4MKIA 1LS1A 3AVXA 4C0BA 1YZUA 2RH5A 4CEIB 3AEZA 4QHYA 4B3BA 1I2MA 2RGDA 3RRZA 2PT7A 4V03A 4PC7A 2CCJA 3IHWA 2Q6TA 3U3KA 3RABA 4Q4JB 3U7HB 4KHZA 2AR7A 1LF0A 4A15A 2WBLC 4C2UA 5F3WB 4LHWA 3U3MA 5HCIA 2OZEA 3TR5A 1OXTA 3SYKA 2QBYA 2PLRA 4TZ0A 1W44A 4JVLA 3RVBA 3RANA 3FFAA 3WNCA 5DH9A 5A4JA 1CF4A 2CEAA 2QM7A 1JQLB 4CRWB 1ZD9A 2CLCX 2W0SA 5FPSA 1KO7A 3MWLA 5SZIA 3M0EA 1P61B 1EESA 1RW4A 1EGAA 2J9RA 2K5UA 5FTMA 2J7PD 1S3GA 3CLVA 1G5PA 2BHRA 2ANBA 2NG1A 4A2PA 2A5FA 1KI1A 2XNSA 1WP9A 3PR1A 3I5YA 5HPYB 2Z6VA 2GJ9A 1AK2A 5TXGA 3P26A 5FUVA 1P3JA 2ZRGA 4Q1DA 1V43A 2F7SA 2AXNA 3K53A 4HAYA 5AJVB 4DB2A 3LBIA 2WKRA 2ZJYA 1QHYA 1ZM9A 2BJWA 5JJIA 1Z8FA 2FE4A 1FQJA 2QTFA 4TLCA 1XPOA 2R6GA 2BM1A 2AD5A 3CRQA 1U8YA 1UM8A 3W5IA 3AVOA 4NCJA 3QPVA 4PPFA 4WXPA 2YC4C 4QXAA 2GA8A 2J7KA 4KLNA 3R20A 4QNMA 3LD9A 3SS8A 4DT1B 2NO9A 4HAZA 5DO9A 4A92A 2H18A 3CB4A 2ONKA 2WAXA 1RRFA 1W7AA 1F3OA 5CIQA 1DAGA 1XZPA 1BMFD 3MUFA 3RDPA 1T91A 5J47A 3VR3A 1Z0IA 3EWAA 4JSYA 1BYIA 4AYTA 1E2GA 4CF7A 5AJZA 5JEDA 4M53A 3I5XA 4RFSA 1XFAA 4RZXA 1N0WA 5CM8B 5FI0B 3AB3A 4ASUA 3EASA 4BFZA 2J0UB 4QJ3A 3FHOA 1MR3F 2DWPA 4PC2A 2XNDD 5DN6D 4YC7A 3PIRA 2IXGA 3QXHA 1G3RA 3CX6A 2EWWA 4RZ2A 4LYHA 5KTYA 4OKSA 4Q4HA 4QM6A 1IN7A 1KO4A 3EXAA 5F2EA 2V3CC 1XDBA 1GKIA 3TSOA 2JJ1D 4P4SA 1R4AA 2BM0A 4GRAA 1SXJE 4EKDA 4YXWD 3THWB 3U3RA 5B57C 3GP8A 4C0KA 2XXAA 4D82A 4Q5IA 3DL0A 1F48A 5CK4A 1C1YA 1R8QA 5JS8A 1S3SA 3HP1A 4NYIQ 3QXJA 4ON9A 1IXZA 2N1BA 3B1ZA 3OAAD 1FNMA 1P9RA 2H57A 2WVJA 4L9SA 2DBYA 4X8MA 5FPYA 1OFUX 3QXXA 5G41A 5KDDA 4XD7A 2OE2A 4N0EA 4JIMA 2F6RA 3WBKA 3CF6R 4MUBA 4UNNA 4JMPA 1YR7A 3EARA 1RPZA 1AA9A 1XTJA 3FTQA 3GJ3A 4NYJR 1DE0A 3FB4A 3CNLA 3FGNA 4HB0A 1DBSA 1IN8A 1XTQA 2NOAA 2P3SA 3K8YA 4LPKA 4I4LA 4B71A 2WM9B 4K8OA 4MRVA 4UNSA 5EZ6B 5HR5A 4D4KA 1SXJD 2AD1A 1YR8A 2BMJA 1D9ZA 4IOJA 1JXMA 3UPUA 1E9CA 4Q02A 3QKRA 4M4SA 1G4AE 2ERXA 2G83A 1Z83A 3THYB 3HYRA 1CP2A 3A4NA 2QAGB 3L0PA 4LJ7A 1CJTC 4Z51A 2FMXA 2E87A 4TMWA 1HY3A 2A5JA 3KB1A 4Z8YA 3UMRA 5JWOA 3PFIA 1QVRA 1XEXB 4LOAA 1A5TA 4TWZA 2PMDA 2VEDA 1MV5A 5DN6A 1O3YA 1XF9A 3TAUA 5FPKA 3B9QA 5IF9A 5FPTA 3U7GA 2C95A 2V6JA 3MLEA 4Z8XA 1MO5A 1GNRA 3P1JA 4LHZA 5FUWA 3T1OA 3C41J 4D0GA 2J41A 1OKKA 2QUZA 1C4OA 4Q9LA 1KGDA 2GKSA 3CF0A 1BMFA 2KI5A 2HF8A 3UIEA 3W90A 4DSNA 2EW1A 1P4SA 3U60B 1N5LA 4B73A 5IK2D 2VHCA 3SJBA 1S2MA 2GF9A 2FPKA 4ZPXA 2PCLA 3B82A 1CTQA 4A1FA 1GNPA 1NVVR 5EP4A 3OESA 3VNUA 1SKYE 4W9MC 1L7VC 2QZ4A 1IXRC 1U90A 2B8TA 2CNWD 2VRWA 2ZRAA 3H1TA 1WBDA 1NJGA 1XBTA 2V8OA 4KI0A 1E94E 1GWNA 3H4MA 4C7OB 1XD2B 2XGJA 1W5SA 4PAQA 3G82C 4LC0A 3TVDA 1RJ9A 4MYTA 3DOFA 2WPDD 4BZXA 1KSFX 2IL1A 2NPFA 3DM5A 3L8YA 4CYMA 4GZMA 1W47A 1AS3A 4FMCB 4JYBA 3SE0A 1TF2A 3VR5A 1GP2A 4MKHA 5JJKA 1DEKA 4OYHA 2BIFA 3HU2A 3PENA 3ICEA 3BB4A 4A6XA 4DCUA 1E2LA 3QKTA 1G1MA 5FBWB 1X6VA 3CR8A 3FE2A 1OHHD 3SFZA 4CT4B 2ATVA 3BRWD 3GLIA 1Z47A 2ERYA 1EFTA 1E2EA 2QROA 3EZ6A 4CGZA 3SU8A 5KDOA 1Z0KA 4NYMR 3SFVA 4LJ6A 3KTAB 4PPQA 4Q7LA 4AKEA 3I72A 4D2IA 1KY2A 2ZPTX 4NE2A 2OHFA 3QG5A 4DZZA 3OFND 3ZVRA 3GFTA 2CLDX 4OHZA 1NKTA 1ESNA 1G7RA 2DPXA 1QHIA 2V54A 1G5TA 3LXXA 1JBKA 3U2QA 1DS6A 5CIWA 2XEXA 1Q3TA 2G0TA 3H84A 5FI1B 2HT6A 2WWGA 3GCGA 3LO5A 4AG5A 1M1YE 3MJRA 3HDTA 4S2EA 4GP6A 1OXSC 5AK0A 1VYVA 4AWXA 3WHLA 2P6UA 2XX3A 2Q9AA 2GBLC 1WE2A 2KBFA 4A9AA 1ANKA 5SZHB 4B43A 3FFBA 4YMTA 2GVDC 4BLSA 3QIAA 4B76A 2YYZA 3CH5A 1XJCA 4FIDA 4CVNA 2KSQA 1KI2A 5JSZB 1EWQA 3CKLA 2O8DB 1UEJA 2AWOA 2V4ZA 1YE8A 3T12A 5GJBA 2AWNA 3IIMA 4FINA 1FW6A 1GVNB 1P60A 1NSFA 2VP5A 2O8DA 2IF0A 4ZDWA 2ZI9A 4HB3A 5KSPA 2ZI5A 3RSOA 4FCWA 4OI4A 2G0NA 5EXPA 1VMAA 3F8TA 4YQFA 1NG9A 4CZ2A 1ZC3A 5DI3B 2O52A 3ASYA 3RS4A 4CIDA 1ZAKA 3CRW1 2QT0A 2GXAA 2A2ZA 1AS0A 4U5XA 1HQCA 2F3RA 4C0HA 1OXXK 1W48A 2QMHA 1CS4C 3LXRA 4BECA 4G5SA 3W5JA 2WWIA 4WA7A 3FMOB 5EZ5A 3IKJA 2AN9A 1A2BA 3TE6A 3EWSA 2RB4A 4R2HA 1SHZA 4P4TA 2XZPA 2EFCB 3Q5EA 2CNWA 5EE9A 3R7WA 2ATXA 3C4JA 1CEEA 5FTLA 2X2EA 4LUCA 5FOUA 1WMSA 1GSIA 2REXB 4JKIA 1JNYA 4XVRA 3TR0A 4JYCA 2CMKA 3VKHA 2QL6A 4L8GA 4ZV4A 1W4AA 2C9OA 4I1UA 3EZ9A 1KO5A 2JDID 3VR1A 1SVLA 2J5XA 2YWGA 2CK3A 2RGAA 1YZGA 2QPOA 1D2NA 3DEFA 3F5FA 5C4GB 4IVQA 2V55B 2IWHA 1YZKA 3U6KA 2IT1A 1U9IC 4TL6A 2OCBA 1R0YA 2FV8A 2VP9A 1E9EA 1OIVA 2HLDA 3ZJYA 1OSNA 4I1OA 4Q19A 2WKPA 1HE8B 1J99A 1VG9B 1C9KA 3ECCA 3KKOA 1NF3A 3AM1A 3RWOA 1YR9A 4DSTA 1Z0JA 3K09A 2JAQA 5D3MA 1NKSA 4HEJA 1GKYA 2HYIC 3AGQA 1U81A 1W1WA 2MSDB 3EC2A 4JJZA 1TTTA 5L3VA 3L43A 4AKGA 2W6JA 3NBZC 2CK3D 4OQLA 4D26A 3Q7QA 4EPRA 2W83A 4B3GA 4R98A 4KYIB 4WAUA 1DARA 1F5NA 4RD6A 1Z6AA 3TNFA 2F3TA 3EG5A 2H8KA 2YWFA 2QRNA 5BN5A 1UAAA 4ESHA 1KO1A 1Q3HA 2ZI6A 3W6PA 1M34E 1MT0A 4IEIA 3SEAA 4IOKA 4Q48A 1XRJA 1KSJA 4IOLA 4UKDA 4CEHA 2OESA 3OEHA 4F4JA 4C0JA 1U0LA 4ZKEA 5ELXA 4MGZR 4I1VA 4G01B 4LC1A 2VPPA 1E1QA 3NVAA 1ODFA 4PTLA 2WSMA 2HT1A 1M2OB 1TX4B 1SKYB 4Q18A 5E4FA 2BKUA 3QPUA 1OB5A 1JXOA 2Q3FA 1ZM4A 3QPWA 4IXMA 2AKYA 2XJ9A 4Q03A 1UBCA 2QAGA 3KXIA 5CYOA 4MH0R 1EFRD 1JALA 2ZR7A 3RLFA 2JLVA 2F1HA 2J7PA 4TYQA 2MSEB 3EPHA 2P0EA 3C14C 4X8OA 2E9SA 3LLUA 2Q3MA 3MRSA 4Q9HA 1CR4A 3DKPA 2JA1A 2FWRA 2V1UA 1W4BA 2IYWA 2VHTA 3A37A 2SHKA 4M1KA 3VNVA 4TSFA 4G5OA 2BBWA 1LB1B 5F9FA 4LHYA 5E7JA 4KVGA 2YZ2A 4D4JA 5BN4A 3IUYA 3VKGA 1KZ7B 2C98A 2PZEA 2KBEA 2IYQA 3GEHA 2PT5A 1Q12A 1N6IA 3NHBA 1UKVY 4IXNA 2ZRJA 3CPHA 4TL9A 3WY9A 2DWOA 3T61A 2R6DA 1ZU5A 1FZQA 3O8CA 4UJ3A 1G7SA 2C5LA 3QVVA 1F2TA 3QQ5A 4POAA 1P6XA 3W8RA 1RRGA 4D0NA 2MMGA 3PEYA 3MMPA 3B78A 4GOXA 2ORVA 1M8PA 1MABB 1U9IA 4NPHA 4JLBA 4Q1EA 3WP1B 4G0NA 2BOVA 4KJZA 4DLTA 2B7CA 2ECKA 3GLGA 1E4VA 4LBVA 4JLOA 4B6FA 1DAHA 1CJUC 4HAWA 4HAXA 1J70A 1KAGA 4TMVA 3TH5A 3FOZA 5FUYA 2FN4A 2Z0MA 4LYAA 3IQWA 5CITA 4TMXA 1D2MA 2ZI4A 3QI2A 4A0HA 1M6NA 1E1QD 3SYLA 1AKYA 2H7VA 3R8CA 4NYJQ 3KUCA 4WIAA 2C9YA 3RRMA 1KK0A 2QGNA 2A3RA 1FUKA 5KPDA 5KPJA 2H1LA 4ACBA 2GJ8A 3RRNA 1GUAA 4ZIRB 2FZLA 5EUMA 5DYGA 4Q7MB 1LNZA 1J2JA 3KB2A 3ONWA 2FF7A 2WMOB 2IHBA 4AK9A 4A2QA 3FPAA 3VX3A 3SC3A 1U99A 1XEXA 3BGWA 3KDSE 4O3MA 1ZU4A 4GOJA 4DT1A 1U94A 1GNQA 4HDOB 1Q44A 3SHFA 2O8FA 2BWJA 3THYA 3RS0A 5KNCA 1FTSA 1FNNA 5CLQA 4O25A 3OIWA 1LF5A 3L8ZA 1Q0UA 4X8LA 2AFIE 2OEPA 2FU5C 2UVQA 4LHXA 3AKEA 2A9KA 4FCVA 4MITA 1VG8A 5IK2A 4B48A 3ZQ6A 4RD3A 2ZAOA 1XWIA 1TMKA 1KTVA 4I99A 5EP2A 1EG7A 1KYIA 1S4QA 1QVAA 3LVRE 4UXJA 4QKQA 4F92B 1GRQA 3PUZA 2JLQA 2AFHE 4TMZA 3GEEA 4OHVA 4EPTA 4DBLC 4LV6A 4JT4A 1FL9A 3SJZA 5FH9A 1OB2A 3T1QA 3QXSA 3QNUA 1T3HA 1Z2CA 1GFIA 2WJHA 3IEUA 3ZH9B 1ZM2A 4DLXA 2YC2C 2BVNA 2IA5A 2GJAA 4MDFA 1ZM3A 4DLWA 4LGMA 4QBGB 4RKFA 4MUAA 3JVVA 1OE0A 2XTZA 2ZI7A 1KZGB 2FH5B 1UBEA 3CZPA 4YONB 5BW8A 2VH5R 4Q1BA 4HB2A 2D7CA 4JBWA 2G9NA 3SI7A 4AYXA 2F43B 1HH4A 2IYLD 2PH1A 2ZRDA 2VL7A 5F98A 1G8FA 1U8ZA 4P4SB 5K8IA 1IAQA 2DCUA 1MKYA 2VF8A 4HLQB 3W3AA 1ZD8A 3BFKA 4N1AA 4Q66C 3CONA 1UKZA 3TIFA 5AUOB 3A4LA 2X2FA 2WJYA 3HR7A 1QDEA 3AVQA 2G88A 3ZZ0A 5A5GA 1L4YA 3GLGE 4OQMA 4RJLA 1ZC4A 3LVQE 3CZQA 2P67A 1XJ0A 3CWQA 1IN4A 4QJ4A 4KFUA 4UNQA 3ADDA 1E3MA 1E69A 4B33A 2IS4A 2QMOA 2JLXA 3N5CA 2GAAA 2YKGA 4KFRA 1NBMD 4TT3A 5D3MB 1BIFA 2IK8A 4K81B 3A8TA 1UDXA 3LNCA 1TADA 1AGRA 4LI0A 5JFGA 3N70A 2YINC 2IWRA 3WHKA 2FA9A 3EIQA 3MFYA 4D81A 1KDPA 1R5BA 3IEVA 3EZ2A 1NVWQ 2RAPA 1OYYA 1M7BA 4AY2A 1H8HA 1NLZA 5BXQC 3U5ZB 2QEQA 2V9PA 3AVWA 1YU9A 3DVLA 2J45A 2EFHB 1RC8A 2L0XA 1G64A 1AKEA 1E2MA 2RGGA 2ZAMA 821PA 3GJ8A 4Q21A 1BYUA 3K1JA 4XTRA 1CULC 1KKLA 1XMIA 1AIPA 2QN6A 3AP1A 3DKVA 3R7WB 1VTKA 4TLEA 1B0UA 1IONA 1Z0FA 5FL3A 4BZPA 1KMHB 4EPVA 4I1SA 4BEBA 1N6HA 2R6FA 4BE7B 2D74A 5E7MA 1SVIA 2GZHA 1NSTA 1OHHA 1G8GA 2QBYB 3W8NA 3GJXC 2F55A 1E96A 5FOVA 2ZUBA 2G6BA 1NN1A 2QSZA 3QKRB 2LKCA 3MD0A 2ZQ5A 2GXUA 4HUQB 3RC8A 3DZ8A 1NL3A 2RGNA 1KO8A 1OH5A 3ZYCA 1NN0A 2KE5A 4PSAA 5HE8A 4MQBA 1ZW6A 2XSZD 2ZANA 3KQUA 4NZYA 4PQFA 1T0HB 3AKYA 4DDVA 2QAJA 3QSYA 2GJKA 3LDAA 5P21A 2Q3HA 5FR2A 4DCSA 2OG2A 3NH9A 3IILA 5E95A 1E98A 4M1MA 4ZDJA 3LAWA 4GNKA 1XMJA 5FOSA 1Z08A 4LK2A 3OE7A 4HSEA 4URVR 1SVKA 4P33A 5TDHA 3PXGA 1FQKA 1YJ5A 1FMLA 1G7TA 1E9SA 5ANRB 4Q9JA 4G5GA 2RKOA 5LDDC 3ICQB 5FTNA 4PFSA 2ZSAA 1OKKD 4QBFA 1KI9A 2DYKA 2O8CA 2OSBA 1E79D 4URZR 3GLHA 1DAFA 3WMGA 2X8AA 5AWFC 4A82A 4DLYA 1GM5A 3BXZA 2GBLA 1KI6A 1RFLA 1W2HA 3K0FA 3PVSA 4HAVA 5EE0A 5JLJA 4RCZA 2H16A 2FFBA 1WA5A 3TUIC 1IJEA 4TYNA 4GI7A 4RCYA 1E6CA 3CRVA 2ZYTX 3ZQJA 2ZSDA 1M7HA 2P6NA 1GZSA 2RCNA 1R7RA 2GHIA 2HYDA 4ZKDA 3AVUA 2YJTD 1L4UA 2ZRBA 3HPQA 3ZZUA 4WVFA 5C4MA 2IYXA 4QBHA 5BQ5A 1P9NA 2D06A 1GL7A 4HDQB 1DAIA 3AVYA 1G8YA 1P5ZB 3NEJA 2BMEA 3QBTA 1TUEA 1SGWA 1OH8A 4A6PA 3T06B 1KAOA 4KBGA 4M21A 5EE3A 1F60A 5LD2B 5KO2A 5EXTA 3KUDA 1P9WA 2BKEA 1KI3A 3GJ6A 2B6HA 4J0QA 2ZJZA 2IBMA 1COWA 1R5OA 2XTMA 2FZ4A 3D31A 3K0CC 4C7OA 4D25A 4JLDA 4EQ6B 2XAUA 4RZ3A 4DSUA 2IXFA 2FEOA 3TKLA 4JBXA 5J4YA 2ZJ5A 1IOZA 2JASA 2C96A 2YV5A 1ZNXA 2NPIA 2QE7D 2XOKA 4LJAA 2D2FA 3TGPA 4CEJA 1KMHA 1Z6YA 1KY3A 1COWD 3U7EB 2R9VA 2FSFA 4DHEA 3P27A 1OFTA 3PEUA 3E1SA
chains in the Genus database with same CATH superfamily
1X7HA 2P79A 2QG6A 2G7ZA 3AU9A 3C6XA 3JS5A 3U4QB 2ID8A 2QUJA 1ENOA 4LYYA 5FWXB 3ZHQA 1H69A 3TIGA 1VZ3A 2CJYA 1RJEA 3B53X 5C1BA 5KJ1A 2NP7A 1TIPA 4L5BA 3LX4A 4V0ME 1Q0RA 5ICCA 5L45A 3GNQA 4A27A 2HRRA 1PO7A 1Z4KA 3ZNOA 1JFTA 4N3AA 3FTPA 2ZB2A 3TL2A 5IVIA 2OORC 5AVQA 3ZXSA 1KWKA 4BB5A 3OZRA 5E4TA 4RSMA 4A36A 3L7NA 1MRSA 2KYRA 1N3BA 1I33A 1VJ0A 3ZHOA 3LGAA 4OJKA 5DM60 1A1VA 1DFHA 3D8SA 2J30A 3LK7A 3FPCA 2V97A 3CXUA 4EQ6A 2PKYX 1XQ6A 4D3XA 1YDMA 5LU8A 1T1JA 3TX6A 4JFAA 2I22A 2Y1EA 4BNUA 3ANLA 4UAJA 4ZCMA 1R0RE 2XYVA 2YY7A 2ZXFA 2BR3A 1F0PA 4B8WA 1KU0A 1JPNA 1WZCA 3SBEA 2ZYVX 3WGLA 5DBOA 5BR7A 3D5QA 1PG2A 4P32A 3FYHA 4QYIB 3N39C 4DTCA 3QEBZ 1H85A 3HCOA 4QT0A 1RWXA 4NY1A 4F1JA 3QNMA 5TPZD 1L9KA 2NYAA 4YEDA 5AK3A 2ZTSA 5JSZA 4H0CA 2RONA 2YXLA 3A1FA 4I50B 4G2TA 2HMTA 2JLYA 2PUVA 5CRIA 3UAYA 2BFMA 1HT1E 2PD3A 1Z3IX 5JCPA 3WL8A 3RVRA 4JZKA 2P8SA 4Y9UA 1OYOA 5J5CA 3W2HA 1IIRA 5IX8A 2M6LA 5DNYB 2B7BA 4BEVA 4P4UA 3RUFA 4LF5B 2VRNA 4LOIA 2VBCA 2AG1A 4YRGA 2BGUA 2PYZA 1P6QA 2XKAA 3AV0B 2HA0A 3DJYA 1W1IA 3DHWC 2FPMA 2JH8A 2PPVA 3B6ZA 3UY4A 2W4QA 2XF2A 1P8JA 4Z5XA 1DI0A 1K7YA 5EE5B 1LPOA 3U4IA 1DRWA 4GRIA 3KFVA 3KYDB 1KHTA 2QL7A 1NUAA 1Y4SA 2INGX 2RDMA 3MTEA 1GPDG 1DAPA 2ET6A 5C8YB 2QVCA 2VO1A 3THOA 1EA7A 1BKDR 1SOWA 3DNPA 3H7AA 4FDUA 3VNAA 2VF5X 2AI2A 3O1HB 5DE3A 5EIAA 4FHCA 3DTYA 4LZJA 3R7BA 1J5XA 3OT5A 2IPAB 3I76A 2EZUA 5EE1A 3U39A 1E58A 3NI2A 1BG6A 3KR1A 4LRTB 5TVKA 3CZRA 4I9UA 3IAM6 1SIUA 1XTPA 4HT3B 5INTA 4CLEA 2AYYA 2OFOA 3GIWA 2D3TA 1C8LA 3OZIA 3MIZA 3MZ0A 4KWEA 4LDNA 1N1EA 2Q50A 1FUYB 1C14A 3CLKA 2B8WA 3V2GA 4ANFA 3IBYA 1K5HA 3ZVLA 4OVKA 1K1EA 3HBAA 3S3TA 4NCKA 1VDZA 1R10A 1GZ7A 1OLUB 1OZ0A 5F33A 3TSYA 2AN5A 3OQVA 1SUPA 2VZ0A 4FGZA 3T4XA 2HU5A 5AXAA 4W5JA 4X41A 2CCGA 1VBFA 4KQCA 5FJJA 1U0JA 1E66A 5CLLA 1AQUA 3I01M 3PE3A 4DR4B 4TT3D 4P7FA 4BZQA 4AXBA 1VA4A 4YMUA 2I66A 1NBME 2X8JA 3W4IA 4WLUA 2XVZA 4UE2A 4GMGA 2I80A 3H6HA 2R1VB 1XN1A 1O6FA 2YHBA 4K03A 4IVRA 1G3UA 4O2LA 4G37A 2C4TA 2QM8A 1KDZA 1KXZA 10MHA 5CG2A 3P5BA 2W11A 4ZCPA 1ICIA 3M5PA 4Q6BA 1O58A 1U7UA 3GGGA 4AMYA 2FE1A 4R31A 3WRYC 3QE2A 1NLYA 3VZQA 4WBSA 4ALMA 1PQ4A 3L5OA 1P4AA 2R7MA 2W43A 1HL7A 4H35A 4OP2A 3DVRX 3QOXA 5FBZA 4EATA 5I8PA 2GNPA 3UEOA 1FLNA 1PX0A 2C2KA 2H9IA 3CW2A 4XPIA 3I34X 3BGVA 2YZNA 1GG2A 3C16C 3HFJA 2OP0A 4QREA 3UJDA 2A30A 5GQSA 3V8QA 3FYUB 1LW7A 1WOYA 3MGGA 3PL1A 2GD6A 4DLUA 3CLSD 2IW1A 3G23A 3AW9A 3PUWA 5IS2A 1SVNA 5C8ZA 3BZWA 3EMVA 1LI7A 3RHFA 3MJEA 4JUDX 3DVSX 4MJLA 4F12A 1RCFA 4URXR 4EFNA 5CXXA 3GZNB 3S28A 3CWZA 3IIKA 1XPRA 4L3VA 4BNNA 3GUCA 1F8FA 2YR0A 3FKQA 4EB0A 2WUEA 1X0XA 3U44B 4U63A 4OH7A 1GJRA 2I67A 3VVMA 1VSVA 5ECDA 1B42A 4NBLA 1NY6A 4IQ0A 5KYYA 1WXQA 2Q2VA 2YQ5A 3GRVA 1Y6ZA 3WTBA 4FEGA 3MXOA 1X19A 2H51A 2QRLA 4P86A 1TJYA 3ZY2A 1F6BA 2QMUA 3DMNA 4LYGA 2NZJA 1TW2A 2CW5A 1QGDA 3N2GA 2XCIA 3ZI4A 4BCCA 1RBYA 2ODBA 2DC1A 3V8PA 4BX9A 1GG9A 3ORFA 3STVA 4C4YA 1SN7A 1ZHFA 1HDIA 1C3EA 3WGNA 4URHA 4NPCA 5JBQA 4I66A 1MF7A 2HUNA 3RIMA 5ALZA 3H04A 5KKCA 4JUAA 1W93A 2A7QA 3DV0A 4WNIA 4D0LB 1SPXA 4CKZA 1D03A 5KTMA 4KXMA 2R86A 1O4WA 2ODEA 2VP4A 3VHXA 4JLKA 4CTNA 5DNCA 5AQEA 2WKWA 3LOQA 4C1NA 5DNDA 5B1HA 2P3OA 1WHSA 3DW3X 2B4RO 3MAAC 1RRVA 1S3IA 4M1TA 4X7MA 1FDIA 1T5SA 2P6PA 5I7HA 4XIJA 1A9QA 3I2GA 1EB9A 2OV4A 3PNBA 2QZSA 3CR7A 4EJ0A 4QLBA 1U7OA 3IQXA 4O0MA 1YIAA 2CB9A 3IVGA 4DQXA 2W6PA 2C2XA 2XT0A 4DVJA 2EU8A 1FU7A 2WYHA 1Q14A 4NE9A 4MJXA 2W93A 4NAUA 3BSFA 2ZUWA 2GBCA 5DFAA 4OBWA 5C1IA 4C0XA 4PO3X 1DBWA 4ZU3A 3ADPA 1GU0A 3BXGA 4QDJA 2YNMC 3T7JA 1CRPA 1ZD5A 4AJLA 1Y7TA 3UAWA 2AZXA 2W6ZA 1L4GA 5AW9A 1E0AA 3IPXA 4KXYA 2GKGA 5FNVF 3L7BA 3C5WP 1WSAA 3JYNA 3R75A 5HK9A 1E2QA 1X7ZA 1DKNA 3SVLA 5F76A 1HXHA 3R3SA 1WPQA 3PF8A 1FW8A 4PYRA 3EFOB 2FR8C 3GXBA 2Q0HA 4B2LA 4D98A 4ZQGA 2PKCA 2DKFA 2R1TB 4JQZA 4KG7A 4XOIA 1W36B 1XDWA 2I4NA 2ZYWX 3OM1A 2ODTX 2FPPA 3BK2A 3G7NA 3ONEA 4E4RA 1GR1A 1DKMA 2HEIA 3HXLA 3Q6NA 2NNLD 2A8YA 1XMVA 1E6KA 4L5IA 3H75A 4TV9A 3KFXA 3KR9A 1JAXA 2O0LA 3D4BA 1HNXB 2Y05A 3JY6A 5JH7B 1AKWA 3IBCA 5EUQB 1MX1A 3DWGA 2NZ8A 4TLAA 3BMNA 1EVKA 3EXEB 3L8CA 4KTTE 4U02A 4E12A 2Z2XA 3NVKI 4UCFA 1EVZA 3H3XA 1Q1EA 4NI5A 1R88A 5HEKA 4EMTA 2VF4X 3G0DA 4D9FA 1AKTA 4W7SA 4MLZA 2ZSIA 4NENA 1HTWA 4PPYA 1VJTA 2NU6B 4BNDA 4WECA 1MIHA 3W1VA 1APBA 1V5EA 2Q5FA 2VZEA 4P9NA 5JY1A 2JGRA 1HE1C 4L9WA 3AR3A 2PZKA 4BU0A 1ZINA 5GVRA 3SF8B 5J2UB 2YWDA 1N2CA 3LYHA 4AZVA 1V3VA 4LTMA 2ZYDA 1CDOA 4RVHA 3TQQA 1BGXT 1RAAA 2ORWA 3DAFA 1RJWA 5C80A 4RTLA 3ETNA 3PHIA 2JLUA 1W2GA 3FNGA 4F2DA 3NDBB 4WNAB 4B4UA 3HU5A 2B4TO 4JIGA 3G1WA 1YCDA 1NQUA 1YS2X 2YHAA 1IM5A 2JFYA 4K8RB 1DRVA 4PSVA 4OB6A 3SGLA 3RT9A 3DPSA 4BPBA 4MHSA 4DLZA 4EFKA 4OB8A 3ZDRA 1RE0A 2E85A 1TD1A 1WMBA 2PX8A 3BVPA 3CLRC 4UBJA 4AMUA 3GA5A 3GEBA 5EQTA 1HGXA 1SBHA 3PV0A 4M8LA 4BVHA 3PQFA 4COOA 5KSYA 3NOOA 1IB0A 1AO3A 5K0LA 1MW8X 2JIQA 4KFSA 2VLBA 3OD1A 1YDWA 1CUFA 4NH4A 1H6CA 1V8BA 1BNCA 1CZUA 3NHZA 1JFRA 3ODPA 1HLFA 1V3UA 2GAIA 3OF5A 4IF6A 4LISA 3VH4A 1B3BA 1W8DA 1V4VA 4ILEA 3W6UA 3BIOA 3D1VA 4R0VA 2EFEB 3I5UA 1UZAA 1XKQA 2PGXA 4CW7A 1QB7A 1V95A 3IRUA 2Z6AA 2Q21A 3LRPA 4O4LA 1DGQA 3LFTA 1JG7A 4JBGA 3ZWOA 1HT3A 4O4JF 1AZLA 1R15A 2HMWA 1IBCA 2HDNB 2MYUA 3FPLA 1N7IA 3LA8A 1L5GB 1MW9X 4HD8A 1DAEA 1PZXA 1SVUA 2A0KA 3S2SA 3WB0A 3LSTA 4HQNA 3RJTA 2NYRA 5JDCC 4LJ8A 1EQ2A 3BQ9A 1Z22A 4EHNA 5FOQA 3DTTA 1D4ZA 1KIAA 3HH8A 1QO0D 1E1RD 3E2PA 1JR6A 4P93A 2AQHA 1CQPA 3DXYA 3GEPA 3ND5A 2XLCA 3KQYA 3ILSA 1RWMA 5TF4A 5EIEA 5KTTA 3TW8B 1TKRA 4DR5B 2KQUA 2XRZA 2F8LA 3TI9A 3TW4A 2GX6A 4IQ4A 1HDZA 5I5EA 3EQ7A 1JU3A 2CDAA 1I7PA 2ZCJA 1NT2A 4N5DA 2YOFA 4DNFA 5JZSA 3PC3A 4QOHA 1Z34A 3UK7A 5LMZA 1UZUA 1J0XO 3UJBA 3ETEA 2X4DA 2XE8A 5LIRA 3QVXA 1ZD1A 4F5EA 2XKKA 1NAIA 1E1DA 2GARA 3AEUB 4Y6RA 1J0EA 4PZCA 1K7EB 1Q74A 4TKUA 1XZBA 4QXPA 1J07A 2HCTA 2GM5A 4DC9A 3OZTA 3QOYA 4WBNB 3T4PA 1J2RA 4RNCA 3UOAB 1NHGA 2KWIA 3OIYA 4TL8A 1YNOA 2I4LA 4G0UA 5C1PA 2Z43A 3L7AA 2EJUA 2QPAA 2X3UA 4Y3UA 2AZ4A 3BK7A 3K1TA 2V6MA 3KVYA 2WY2D 1EQUA 5C7OO 4G0VA 2XMRA 2ZT7A 4HDCA 1VIYA 1CWUA 2V7QA 4IWNA 1CUBA 3ENWA 4DF3A 2R25B 3ILYA 2FSGA 1I0IA 4H15A 13PKA 3DA8A 4CF5A 2YUIA 3Q9UA 5HGXA 3JQGB 1C9NA 1G2IA 1QX3A 4JKOA 3CF4G 4C0SA 1WRBA 4RD2A 2OLJA 5M29A 3OZDA 3VM6A 2NO4A 4RK7A 2C97A 3EIOA 3QU2A 4U7WA 5E8JA 3ISVA 3HI4A 1RWWA 2BEUA 1ZQ1A 3ROTA 4F4UA 5ED4A 4HWKA 3ESQA 4WDQA 1LQUA 2ZG6A 4DV2B 1K6MA 2X1HA 3JAKB 3PSAA 4RACA 4DLRA 2JHGA 3RV3A 3IX7A 3R76A 5HZHA 1PZHA 4LXXA 2G70A 1RD4A 4KQ1A 5FBKA 2IP4A 2HIAA 4U00A 1ULTA 2O8BB 1J1ZA 4DMRA 1G8KA 3JD0A 1VLLA 1C4XA 2C82A 1TQDA 3P2KA 2WAYA 2YJ3A 3KJIA 2XYRA 3GGDA 4S1WA 5C5IA 2A9PA 3QVSA 1ZA1A 1AT1A 3AXTA 4KLZA 3HUUA 8LDHA 3V1LA 3JATB 4FW9A 3TCKA 1G5IA 4GVXA 1I1HA 2AJDA 3M4YA 1XQWA 1PZFA 3BAFA 2P1ZA 2OUKA 1O96A 4HPWA 4MQUA 4XYGA 5ISMA 3L7LA 2VA9A 4PQGA 5FFMA 2FCAA 3JPYA 1TCVA 5C0OE 2XBMA 2ZK7A 3P9SA 2HO4A 2VQSA 2OCXA 1SHKA 2TYSB 3P9KA 4GX2A 4H17A 4KN6A 5FPQA 5BO5A 3PT5A 4IRMA 1QM5A 1B0ZA 3C3DA 4LE1A 5EKDA 1MOZA 1GUFA 2WSBA 5M3BA 5EIWA 2H29A 2M98A 2QNBA 3BMCB 4JOBA 3ZIAD 1IRIA 1A50B 3D81A 3VC1A 3WZLA 2A1TR 3EA0A 4EI2A 4UHEA 1G8MA 1QQAA 3IT1A 2J4FA 1II8B 3B6EA 1I2CA 3EAQA 3I32A 2OHGA 3PUKA 2JCGA 4RIGA 3KAQA 3RSZA 1TCUA 2GD0A 3CLHA 2VHQA 4B4DA 3IB3A 3SVTA 1PT6A 2FX2A 1N6LA 1W8IA 2LIVA 3RRBA 4DADA 5B7PA 3OTGA 3TXXA 2M1XA 1MORA 4PEVA 4BTLA 2JARA 5ALXA 2D4AA 3IV7A 4C5AA 3R3JA 1HSOA 4IRXA 3ESRA 3OM0A 3RHSA 6CHYA 3G68A 4FGSA 4RYLA 1MOQA 5I7FA 1A4XA 1JLLA 1QYCA 2FK8A 2NU8A 1TPZA 1PQWA 2PLWA 4V2UA 1D3AA 1L4NA 3HO8A 3FOAA 2C29D 3EVDA 2CL7X 3K70C 3A10A 4FUQA 5K4HA 5H68A 4B7UA 5CB4A 1TO6A 4IIDA 3WLMA 1T35A 2H5LA 4PXYA 4RQUA 1H8ED 3UCXA 3H1PA 1UM9B 1ULHA 4JP5A 1JFFB 1K88A 3MCAA 4TLLB 1U5AA 2WFZA 1QV6A 4MUKA 3UFBA 4YBZA 4YQZA 1RLUA 4ETWA 2WVGA 3IIEA 1FTWA 2W6JD 3BXFA 3H4IA 4ML3A 4QU0A 1WXXA 3T54A 3L79A 1BXZA 1J1IA 1U0HC 2HK6A 1YMUA 3BHIA 4TX1A 2B94A 1F2DA 1SG0A 2W2VA 1D9XA 2A58A 2WF5A 3HCEA 3S1AA 1JKIA 2UZ1B 4XDYA 3SQNA 4EGCB 5TY0A 2XE6A 1EU1A 2VAPA 1QFSA 1Z0DA 1S9DA 2DBZA 4HDKB 1VSUA 4L74A 2DG2A 4J91A 5FB3A 4LJSA 2HA7A 4K9RA 2NQ2C 2ZYHA 1PVVA 1IE3A 4KGDA 2BGWA 3I83A 5KYXA 1S6YA 2GETA 4G9EA 1M2HA 2OL4A 2VDNB 4PGFA 3LH5A 2QWXA 5CHEA 2MWMA 3UHJA 2XODA 4LK3A 4MTCA 2C4WA 1TCBA 1HDGO 4DE5A 4WMLA 5DNEA 1GU1A 2P1RA 3LBYA 2PSSA 2QRMA 1E32A 2P9FA 3BL5A 1EUCB 1EVJA 3IJ5A 4DCVA 5CA1B 1NVEA 4OLJA 121PA 2JZOA 1UDRA 2ZYUX 4V1CA 5F64A 5JTTA 2P11A 5K8VA 3DCIA 5EXXA 4UFPA 2WWXA 2Q3BA 3MRXA 3QLUA 1EYZA 4FYJA 4IIVA 1T9KA 5CPBA 1R0XA 3FMPB 1YRAA 1CCWA 3O92A 1NQVA 1JBQA 1G20A 3BEDA 3AF1A 4Y1RA 4C5BA 2E3JA 4CM3A 3RFXA 4XVHA 1CUXA 1G63A 4OL9A 5AOCA 3CVVA 1G18A 2GK6A 3PFWO 2FWPA 3RB8A 4X8HA 4G1EB 4JP3A 4KQJA 4GX1A 1PL7A 2SICE 2DHDA 3LYLA 2IKQA 5F9HA 1YS4A 2NADA 2X19A 3IP9A 4MYCA 3S44A 2LCFA 2IYUA 3EQ2A 4M0DA 4NIMA 4B9AA 2FDXA 4RK5A 1NY5A 3OWHA 4NXNB 1KYVA 2D3WA 3LKVA 1C2YA 4PYOA 3Q0IA 3EIEA 2VNSA 3M83A 4MI3A 5EKTA 1E2UA 4GD3Q 2Z9DA 3KAPA 4JI6B 2QL9A 3D8BA 4QDOA 1XA0A 2IVZA 3JZDA 4K05A 4MCJA 1D0IA 1NDHA 1FBTA 4CM9D 3NUGA 4CM1A 2DR0A 2X0IA 1NRJB 1O6CA 3UT5A 1JDNA 2O7VA 2IOHA 5AI4A 4HNUA 1Z12A 3FWNA 3ECAA 3GP3A 1ZJJA 1GCIA 5G4LA 5CD1A 1VGQA 3RHZA 3B85A 4MPRA 2EBWA 3QJYA 3SSAA 1Q1NA 1L8LA 1RIFA 4HH1A 2OHIA 2P78A 4OIMA 5DGHA 3K2QA 4FLMA 2P3LA 4XVCA 5C7YA 3BRSA 4JBIA 3VR3D 1R0WA 3Q7PA 5JZVA 4Q3NA 2H59A 3QVUA 3BE8A 4G5QA 2FR1A 1UBMS 1LY1A 2NT3A 5B2FA 5AW3A 3K5WA 2WM2A 3NNNA 1WMEA 4QUHA 2VEOA 3U62A 1YBMA 2GZ3A 3QLEA 4K86A 4KKVA 1YS7A 4PFQA 1P75A 1P2TA 2IDKA 1H22A 1DO8A 2PHZA 3AUJB 4LBWA 1X8JA 1KYYA 2QV7A 3ESZA 3Q85A 4L51A 2DH5A 1R27A 4XWYA 1ZLYA 2JD0A 3ADCA 1WBBA 1D2EA 3OFSA 3F74A 3NGMA 3U4DA 3UV3A 4URYR 3R6WA 4AUMA 5J59A 3CCFA 2PN1A 2CXNA 4MRSA 1L7EA 5LQSA 1OT3A 3TSZA 3I53A 1V37A 2PYIA 1KDOA 4ZZ3A 1NXPA 3HHPA 3PUYA 4Q9KA 4CM9A 4MVJG 4KP7A 2FDCA 3SJAA 3SKVA 4N6OA 1PLLA 1BEZA 2HA4A 5TLSA 1E62A 2H6EA 5FWNA 2X5XA 4GZLA 3ZLTA 2XGJA 1Y89A 5JY6A 1RWQA 1QP8A 4NOKA 4TRNA 1YRLA 1AZTA 1DKUA 4TXNA 1ZSVA 4LY6A 2VG8A 2EDAA 1G8AA 4RWEA 2J31A 1ESDA 3VI4B 1C0PA 4NDAA 4B6EA 5JMOA 1QCCA 3QM1A 1TJ4A 2C78A 4N18A 2GXSA 4A5SA 5KHOC 4S04A 3GLFA 4E5MA 4TMTA 4X6YA 4A2WA 4CF4A 1S2LA 2PEZA 5ARDA 5F5NA 2EX4A 3OPXA 5JC8A 1AQYA 2NU9B 1VIMA 2BHNA 3W9UA 2J5KA 1GQFA 4ALLA 1W5BA 2ZBEA 4TTAA 3GD7A 1UKYA 4OQNA 3LHDA 4GM0A 3VFDA 1ZHHA 1G4UR 3UM9A 3LY7A 3VGPA 4QQKA 3ZN2A 1CQJA 2OLKA 5LOVF 1KJYA 4B3RB 1F0YA 1MTOA 1LW6E 3W3AH 5JXHA 4IZHA 2C2WA 1Z39A 4LJRA 2FRXA 2H9YA 1KBZA 1T9DA 4G3XA 4J9VA 4O2BA 2ZIEA 3LIIA 4S1NA 4PO1A 3DZBA 1A2KC 4GBGA 1QP7A 1KJ9A 1W25A 2ZRQA 2ZVQX 2IC5A 4OLBA 4H1TA 1L5LA 1Z0AA 2FQ1A 1LX6A 3D6TB 3QVLA 3LDUA 4YH1A 3UJNA 1M5UA 5BORA 4Y6QA 1CQZA 2PEYA 2RJOA 4L72A 5EJ6A 1AGNA 1G5FA 4AY2A 3H19A 3LQRA 1RAGA 3F3MA 4IDGA 3ZDFA 3G59A 3T8YA 1E1YA 2C7BA 1IEWA 4IUBS 4FMDB 1KNXA 1Y9AA 3GVXA 4AKTA 3RAEC 1O9HA 4OG2A 1KA9H 4QIHA 4RV9A 4M9QA 4B9EA 2OBMA 5HZMA 5LUAA 3B1JA 5CYGA 1ZN2A 5AKXA 2ZE6A 4D9KA 1ZW1A 2D6FA 2X1VA 3TINA 5EWLB 3W5UA 3ZCUA 1IQPA 4H9GA 4NV0A 1XQVA 1XVUA 3AYXB 4LHSA 4GBJA 3SQOA 3BD6A 1GA1A 1H66A 2B9EA 2EXXA 2QP3A 1ZOSA 3N8IA 1XHEA 3OM8A 4DBLE 5KOJB 4D6YA 1G9TA 3HDGA 1A5BB 3EH2A 4UNPA 2FLWA 2JCSA 1PT8A 1O6BA 2Z09A 3BZBA 4ZHSA 4BGUA 2CWWA 4JXJA 4DT1B 4UULA 3IAEA 3VH3A 3F2VA 5IMBA 1SY7A 3KQMA 4QULA 4YB8A 4PYJA 1ZN9A 2PTGA 5B7NA 3J81k 3WQQA 1MRNA 5AKIA 1GL9B 3KXKA 3L6CA 2NVUB 1QO9A 3FTCA 3HXKA 3HFSA 3M34A 5F7OA 3ORYA 1ST3A 4C07A 5ALHA 2VA8A 2D7JA 3UGKA 5CLFA 1SOMA 4AG6A 1A72A 4KU4A 4US2R 1DZIA 2J6BA 4PHHA 2P2NA 2JAWA 4Y2PA 3SIPA 4FLEA 3C6QA 3U37A 5JISA 5ELLA 3CBGA 2GXQA 4ZT4A 4RHYA 4V39A 5EZSA 2BGTA 4LV5B 1PX2A 4Q9IA 2WHRA 1GPUA 1X7DA 2XF8A 3UFXA 3EA5A 4CFYA 4ZI2A 5HHTA 3M6LA 3VMFA 4EGJA 1ZR2A 4TYWA 4C3ZA 3WNBA 3VAAA 3IDAA 1XU7A 2BISA 2FW9A 3NTXA 2IGBA 3D0KA 3L1JA 3ZW7A 4V0LA 2ZLBA 2RKBA 1H0RA 1WP4A 1NP6A 2QGZA 3IPYA 3L6OO 1EEHA 2K87A 4MIEA 4WNYA 1VECA 3AP2A 2ASEA 3HGMA 1HC7A 1JEQA 4G36A 4OYYA 3MTGA 4PR3A 3UC5A 3AEXA 4Y6PA 2GEDA 2VWPA 3MS7A 4LX0A 2CVQA 3V2UA 1MJGA 2REQA 3LYUA 3WG9A 2JIZD 3WWYA 2GYUA 3PNKA 3BBLA 4BLOA 1MGOA 1NQXA 2GESA 4ASUD 3CVWA 2HA2A 4MVXA 2C99A 3ZJTA 2YWHA 1MB9A 3A6FA 3HCBA 1N34B 1SAYA 2FHPA 2GJ4A 1PQUA 2PZLA 4NMHA 5FLEX 5EJAA 5JYDA 4D4HA 1POWA 2I2CA 2P77A 3SR3A 2YASA 1FFEA 1K6EA 2IYZA 3NBYC 4JLNA 1LLFA 4PC6A 4S24A 1T4DA 5L3SB 3CLTC 1FFXB 4ZVOA 2JIZA 4JJAA 2OT3B 2P6MA 4TSFD 3EQ6A 3EXHC 3BHNA 1E5VA 1XRRA 3SR0A 1ZJ5A 2WDZA 2ZQZA 5I47A 4RSRA 1W6RA 4D80A 4UXHA 2GTHA 2RB5A 4E1AA 1R12A 4E3WA 2QTVB 3U3DA 1VLVA 5LB2A 3NMUF 4LVNA 2FG7C 1BH2A 5A7HA 2IS6A 4LYFA 1HDOA 3ROMA 2FW0A 4KR9A 5KTSA 1T26A 2YBEA 4P98A 3L8EA 4RS4A 4TYYA 4KH0A 1LPAB 1NBMA 1P2SA 3NHSA 4YXFA 2VZ8A 3PD1A 4JJ6A 2ZKIA 4COKA 3AC0A 2D5AA 2ZRPA 4GPZA 5CLJA 2F00A 2QTLA 4IRUB 4RH0A 1L5YA 3AW8A 5CK5A 3F3SA 5J40A 1E2KA 3RQSA 3E9MA 4G89A 4JHXA 4LF4B 1BD4A 4EY4A 2GEBA 4QGHA 1HTTA 1J09A 1P0FA 1Q20A 2FCRA 4KDRA 1AUVA 3A1TA 1OT5A 4QVGA 5IDWA 4R8LA 4Q4AB 1QIFA 4ZI5A 2RC6A 5J5AA 4CF3A 1EFHA 2QUIA 4KMOA 5LB4A 2HGZA 2PX4A 1U3WA 1VJRA 1ISSA 3JQRA 3QQPA 4M9ZA 4RF4A 5AM1A 4OFXA 1EK6A 2CXXA 2A5LA 5DOVA 1MPXA 1PR3A 2ETVA 3HA5A 1OBVA 4NBTA 3C7CB 1HEUA 2HM7A 3G2LA 4WZBE 1GOTA 2J09A 1H9AA 4G5HA 4X20A 2TMKA 4PANA 4XGRA 2CDNA 3OLZA 2XOEA 1GUBA 1O96B 1ZL2A 4FDLA 3NFYA 4OHRA 2AKAB 5JU6A 3EEYA 4NPAA 4YJ3A 2ZITA 4ND6A 4X61A 2AR9A 3SNHA 4PO8A 1MENA 2VP6A 1QHXA 1IVYA 5IM4A 5GJWC 5GADl 3IAS6 1Q16A 3ZE9A 1XCLA 2QA5A 2J46A 2ZB3A 2ZS8A 1PL8A 3I73A 4MR7B 3WLHA 4BAZA 4H1WA 1J8VA 1G6KA 5BSVA 5JALA 2AMYA 5E1OA 2YJ5A 2V9CA 2IEDA 1UC9A 2R4UA 5MN6A 2O4UX 3CUEF 5FBHA 4AY3A 4BBPA 4MLPA 5IAGA 4EG6A 4KBFA 1RHQA 2QTVA 2ZJ8A 4PR0A 1Z82A 4DIEA 2J0EA 3HKEA 2WZCA 3KXLA 5TB5A 3T99A 5CB4F 2X6RA 4ARUA 3U1BA 2J87A 3F7MA 3LX5A 3PG5A 3PYXA 3DZCA 1I0ZA 5HQJA 4JEUA 3W7BA 1C3XA 1DQSA 1K7FB 3MJHA 1UOPA 5KYUA 1PVOA 1E1RA 3HDVA 1SKBA 3NTUA 5EHNA 1MAWA 2JI4A 2CVPA 1J7KA 3MJ4A 1SU8A 2DECA 3Q3JB 1G291 2SKDA 3BH7A 4HUJA 3RAGA 2CL0X 3E1GA 3IPAA 1PK8A 3GQBA 2EF0A 4E32A 3PUIA 5CX1A 5L53A 1N2EA 2C7RA 4XLLA 2OBYA 2QR3A 5I9BA 5IJWA 1E7SA 5KB3A 3IV6A 5IJ0B 4PX9A 4B3MB 1I01A 1RYBA 3HCAA 3F67A 4RD0A 4AN1A 5KZMB 4RGQA 2WM3A 3HYSA 2PUBA 3N7AA 4KXLA 3K2BA 1P72A 1R6DA 3SZUA 2R6R1 4B79A 4A8HA 3BIFA 4EEXA 5L9AA 2GDJA 2J6HA 1RVDA 1YI1A 2Z2JA 1Y34E 1WW8A 2F64A 3MB5A 4OXQA 1JEQB 4FQ7A 4YMHA 1Y6FA 1Z2AA 2P5UA 1GTVA 1KS9A 4IJWA 2FN9A 2Z2IA 1NUHA 1JLSA 3GC6A 4I6EA 4UU1A 2JJ8A 3V1NA 4CDNA 4QDZA 4KVFA 1WVMA 4KK3A 3CTPA 1V5FA 5DIFA 4BL5A 5REQA 4HEA1 2BSXA 4JGIA 4N8SA 5AI9A 4EFDA 3NS7A 5JO0A 3QP9A 3D6NB 1QSGA 2JFHA 5ALFA 5B1SA 2D7DA 5EZYA 4PO9A 3WIEA 1ICEA 2OQVA 2Q62A 2XSZA 5AKGA 3OEED 2Q3JA 1M76A 3ASUA 5DHPA 2HBZA 3V8VA 4TWBA 1QORA 4EKYA 1RKBA 4HVCA 1QTQA 2RHBA 3F96A 5CM9C 2FZKA 2N0SA 3C5EA 3OIUA 4GE3A 3T3OA 2HSWA 4X3PA 2A35A 1KH2A 1I5RA 1D7AA 2EFDB 2VDOB 2WZBA 3AI2A 1MHPA 2QRZA 3MWGA 2GBFA 4GMHA 4JDPA 2Q5LA 3VSCA 1GPYA 1ELOA 1QHHB 2VT7A 3KJQA 2H7CA 4A2CA 1U2TA 4BS9A 1L5WA 3L18A 2NQTA 2KX7A 3OEWA 2PWZA 3AJDA 4Q0MA 5HKKA 2W00A 3NNSA 3QKSB 2X8WA 1ETUA 4CEJB 2B20A 3V48A 3P0HA 1IVSA 3TEMA 3V9PA 1ZH8A 4YT2A 3B1VA 3OTHA 2ZROA 3VU9A 3WI7A 2PL1A 2QS9A 2UZ4A 3LWZA 3NPAA 1NJSA 3DDNA 1YZTA 5FNVA 1JWLA 2GGSA 4RY8A 2VSXA 1S5PA 3FLEA 3O2QB 2PGOA 4OHPA 3TTSA 4AO6A 5DPMA 1ULUA 3N28A 5BPFA 4G86A 1GUYA 1RZ3A 1IXYA 3EDRA 4LA4A 3AB8A 3HZZA 1E2FA 2ZRMA 3MWJA 3KHSA 5IT9A 1LV7A 1MG5A 4CL2A 1C50A 1G17A 3HMKA 2YOHA 1HM5A 1IHPA 3E0QA 1KF0A 2YV1A 2EGHA 3F47A 2WAAA 4XLZA 1D1SA 2HSZA 3JAMA 2QQGA 3HACA 1AD2A 3OWOA 4GPBA 4M6WB 3WYNA 1DHRA 4CM8A 3OQPA 5JCOA 4HTFA 3RTDA 1IIBA 2Q3LA 2X1LA 4UAUA 2HRBA 1MO3A 5CFRA 3BOSA 4P0PB 3E48A 1FK8A 4RMIA 4S1TA 1R0KA 5ICEA 4YQYA 4OGKA 4ARZB 1JHUA 1QOQB 1TNDA 3AY6A 3BSWA 3CNEA 1VPVA 3BXPA 4LZAA 5H5JA 2C7GA 3LDHA 3GRZA 2Q7DA 2O9JA 4R2IA 3BT7A 4DNQA 4B3SB 2DXIA 4Q01A 2P5YA 3FUCA 1TEXA 2HOQA 5EG5A 3QRWA 5B37A 1A5SB 1MB3A 1WOMA 3LGSA 3TSAA 3O9MA 2H1HA 4ZRMA 1K08A 3HPRA 2WJVA 2WPDA 1NM5C 4B75A 4MLCA 1RQNA 1E7YA 1E2IA 3KXDA 4DJDC 5ADHA 1C7IA 3EVBA 2CNNA 1ZSNA 3KU4A 3K0FB 2VUIB 2DF8A 3P0JA 4Q16A 5ALJA 3WKBA 2IYSA 5BWNA 1DMRA 2V6GA 5BP7A 3BB3A 1CNEA 4EVRA 2VR1A 3F4KA 1Z62A 2A5GA 2ZTVA 3OIVA 2X0FA 2O8CB 1QGAA 1EVEA 1SHTX 4X94A 3UW1A 3L2OB 3KPUA 3KJXA 4UM7A 1V9LA 3USZA 4RGYA 3GLFB 3W05A 2Y0BA 1XCPA 1UK7A 4R7ZA 1N77A 4RPKA 5AVOA 3LC1O 4NFSA 1KK2A 1RXEA 3NG1A 3VNUA 2W98A 3UHOA 1JR3A 4P31A 3PDJA 1OFIA 3BGSA 2I1QA 4WFJA 5EPOA 3K70B 1NJ6A 4RQTA 2XQIA 4E5SA 1DOAA 2D1QA 2R1VA 3KL4A 3L0IB 3TTYA 1O57A 3JWEA 4DKXA 5D5PA 2NLOA 3H1AA 2BI7A 1AQLA 1LVHA 1NRIA 4EABA 2XITA 3BWCA 3FNHA 1AMUA 2FPRA 5ER6A 1T0PA 1EM8A 4Y2JA 2H5JA 4P3YA 3N86A 1H2ZA 3WJ1A 2WK1A 4MRNA 4NJMB 1JLLB 1MHTA 3MW8A 5AI5A 1JPUA 1HUQA 2H65A 1RAIA 1JB9A 3KKEA 3PZRA 4Y67A 3MMNA 2YQ4A 4RIFA 5DCYA 4D56A 3B8HA 4ENVA 2XZOA 4ABYA 3SZOA 3DVAA 3I09A 3EQ9A 3U7QA 1FYDA 2C3MA 3AZPA 5BWMA 1K2VN 4KI7A 5AW8A 2ZUUA 4JCOA 2Q3CA 2BGGA 2RGWA 4CR6A 3CWCA 3MWEB 6NULA 2HWKA 3A36A 4K5QA 3A2MA 1II8A 3CNHA 3WKEA 3C5VA 4PHFA 4YUYA 3EVEA 3PTAA 2DFNA 3ONDA 5DTIA 1MMFB 5CH3A 4F3KA 4HLDA 4WUTA 2C2OA 4GPAA 3NHAA 1FFGA 1H5UA 4XARA 1E77A 3A25A 1J8QA 3HWWA 3PFNA 4HN9A 4KO2S 2DY0A 5EMKA 1QYDA 3ZY5A 5EKSA 5SV2A 7ADHA 2IDZA 1MB2A 1RXSA 1XXHE 2C20A 3D3WA 3VPSA 5T4EA 1H3EA 2PUEA 3ZZ1A 2JCBA 5C8YA 1J8FA 3M4ZA 4B0PA 1SURA 1HV8A 1X1CA 4JC8A 3LXMA 1RWNA 4J6FA 4TN1A 4RY0A 3RSSA 1P2DA 2CJXA 3KB8A 3GFGA 4TS3A 4E21A 5C8DA 1SC3A 3IELA 4BLUA 2VK2A 3COYA 4RTSA 4MGEA 1HLGA 4HAUA 1BO6A 3BH6A 3QFRA 3WLNA 4P8RA 4UNRA 4TQGA 1Z75A 5THQA 1SK9A 1IL0A 3WJAA 1R6XA 2PMWB 4J90A 5EL0A 3AESA 3O8LA 3NOQA 1T36B 1E2BA 3TRFA 5FR1A 2O23A 4YPFA 3R6LA 3UPTA 3PRJA 4HYYA 3TUZC 4RK0A 2WAOA 5C81A 5FADA 5I3ZA 1Y8CA 4IJUA 3L7IA 4JWKA 2RK4A 3SS9X 1ID8A 3JALB 3KTAA 4QU9A 2O2DA 4AMVA 2JJYA 1QDLB 5DX1A 3AMVA 2CBGA 1OLSA 4IWYA 1KIMA 4J29A 4DMMA 3PX7A 1ONSA 1Y1QA 4I5DA 3THYA 3N0VA 1O08A 4I50A 5EYPB 3ZTWA 2M6SA 2E0IA 3SMVA 2W7TA 1IG3A 4PPGA 5JRDS 3LA6A 3TCXB 3QPDA 4OB7A 1AKNA 3DAYA 1Z16A