1P4SA

Solution structure of mycobacterium tuberculosis adenylate kinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Studies on Ligand-Free Adenylate Kinase from Mycobacterium tuberculosis Revealed a Closed Conformation that Can Be Related to the Reduced Catalytic Activity.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 49
structure length 181
sequence length 181
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p4sA00
3QEOA 1YR9A 3LAWA 3Q5DA 3X1ZA 1G6OA 2AHOA 2CK3D 2VYFA 2ZU0C 3LNCA 2W2TA 4II7A 4LJ8A 2QT1A 3LXXA 1QHXA 4UXIA 2EVWX 5FBRB 1JNYA 1RJ9A 2KI5A 2WHXA 3B1WA 1GRRA 4Q9KA 2HJGA 1BH2A 3SJAA 4IVRA 4KVAA 3WYGA 2MSEB 3LQRA 4W5HA 3ZS8A 4ZIRB 5J4HA 4IFBA 4B3GA 1MO5A 2Q6TA 5SZIA 2GILA 2QL6A 3AVQA 5JI3E 2QI9C 2P5TB 2QORA 2IYYA 3G0HA 2OEPA 2OLJA 1W49A 3I72A 1T3HA 2RMKA 2FGJA 4G01B 2DR3A 3VKHA 1XJQA 3ADDA 4WZ6A 5FTLA 2HXSA 2AFIE 3GLHE 2QMOA 3RANA 1T6NA 4LPKA 3G82C 5AK0A 4M9ZA 3NHBA 4AURA 4LJ6A 1OH7A 3SBEA 2ZSBA 1F6BA 4CT5A 1E2GA 4Z8XA 3WRXC 4R98A 1KK1A 2GAOA 5F9FA 5GJBA 1AS0A 1G8YA 3I5XA 3VX3A 2OZEA 4MRRA 2VSFA 4IVQA 2F1JA 2TMKA 1D9ZA 3KB2A 3QVUA 1JALA 3QI2A 5CDFA 2DBYA 4GFDA 1KO4A 3QPVA 4PHFA 3ADBA 4LJAA 3K0CC 2HCJB 2JLZA 1F2TA 1SULA 2JLQA 3VU9B 4HAVA 1ZNWA 2B8TA 4QXAA 3T34A 3DMNA 2YJTD 3NH9A 1M7HA 5GVSA 1QHIA 2EFGA 3RS7A 4UNPA 2PEZA 4KITB 1IN7A 1FOEB 3AP2A 2ZJBA 2DWQA 4MRNA 2D2EA 2O8FB 2K5UA 1KOFA 2Q3HA 3AVTA 1GRQA 2CVHA 5FBLB 1E79A 3QBVA 1Z07A 2IYVA 3K9LA 3DKVA 1DO0A 3AGPA 2N1BA 4MA4A 3QF4B 2L0XA 1G3MA 2D7CA 3CR7A 2IWHA 4YMTA 3O8CA 1TQ6A 4DIDA 2A5GA 1W4BA 1EESA 4HZUA 4POAA 3K9HA 4A2WA 1SXJB 2W2VA 1A4RA 2PCJA 2RHDA 1FX0A 1ZD8A 3WYAA 2ZRDA 3PVSA 1OHHA 2OG2A 4G5QA 4Q9HA 5EP3A 2ODEA 3GJ5A 1OB2A 2VP9A 2OCYC 4FMBB 4LJ5A 1P60A 2OAP1 3ZVLA 2OBLA 4LJYA 3D8BA 2FH5B 2A9KA 2REBA 5CIWA 2WVJA 4DWJA 4URUR 3U44A 4C0KA 1EWRA 1L4YA 4JMPA 5BQ5A 2EWWA 2QM8A 2OSBA 1WF3A 2FFQA 3FHTA 2GXSA 4TMWA 2IYQA 4Q4HB 1EGAA 5CLQA 3W6NA 1E2HA 1TQ4A 3Q7PA 2AK2A 3D6TB 5FUVA 2QQEA 1YJ5A 2EYUA 2GCNA 1UPTA 2IS2A 3IBYA 1QRAA 3P27A 4BFXA 2FDCA 2GJ8A 3CRVA 2ZR7A 2ERYA 4M0LA 2ZI3A 4YLGA 1NKTA 3PUVA 4UXJA 3R7WA 2A5DA 4NYJR 1P2UA 5HKKD 1Q44A 1XCGB 3FKSA 5F9HA 2ZJAA 2VH5R 1DAFA 1R8QA 1L4UA 2EFEB 3FMIA 2OCPA 2OFXA 5JEDA 3GLFA 2ZJYA 4DKXA 1NMYA 5KNCA 1GKYA 4EQ6A 4DHEA 5FBVB 2ZYUX 4GMDA 1MR3F 3BB1A 5DISB 5HE8A 5CITA 1S96A 3OFNA 2QGZA 4Q66C 6Q21A 3IO5A 5C46F 4TL7A 2F43B 3KKNA 1CRQA 1XF9A 3LDAA 5CIQA 3WBJA 2PX0A 2WWIA 1NVVR 4LYJA 2VL7A 1VYVA 4R9UC 4OHZA 4MGZR 3IILA 4DLVA 1E2LA 2CMKA 2ZE7A 2G6BA 3I8XA 4LV6A 4BLQA 5KOYA 4DDTA 3RS3A 3VMFA 2C8VA 4DLUA 1Q57A 3QVVA 4V0KA 2SHKA 4JLBA 5AUQA 1SHZA 1YRAA 2YKGA 4A92A 3QENA 1N0VC 1EFTA 2FFHA 2QTHA 2ZYVX 2P65A 3O47A 1OF1A 4PSAA 2PLRA 3BFKA 1FPMA 1Z2CA 3FYHA 1E2PA 1N6LA 2WKPA 4F4CA 4YONB 1P9NA 5AUOB 4RD1A 1XBTA 3LVRE 4L4UA 3SFVA 3UK6A 3KKMA 2KSQA 5C4GB 1G41A 1X8KA 1PUIA 4W5JA 4LBZA 3T1OA 3X1WA 2G9NA 3AP3A 3E2IA 4X8LA 2ZIAA 4AYXA 5KPDA 1KNQA 1G4AE 3I73A 1GFIA 1F5NA 1CJTC 4L5BA 2V1XA 4CYMA 3SE0A 4GDFA 2DWPA 3KKOA 2AN9A 3EA5A 1XEXB 1NVUQ 5DI9A 2J59A 4DVGA 4PC1A 2A5FA 5E95A 4LHVA 2D2FA 3RRNA 4M1SA 1KGDA 4WIAA 4L9WA 3U4QB 4JJKA 3MJRA 1JEEA 5JRZA 1T0HB 1Z8FA 4OBEA 1GNRA 3PEVA 4D25A 4AKEA 5KDOA 2FJUA 2JLWA 2J0UB 2ZYWX 3HR8A 2O8FA 1Q1EA 2C5LA 2IS4A 2BBWA 1S3SA 2YNMA 5JEEA 4CZ2A 5L3SA 1G17A 2GETA 2ZPTX 4OK3A 3IDQA 3QE0A 4TLCA 2JLUA 3QF4A 1HUQA 1LFDB 1U0HC 3F0TA 5JRJA 3A1WA 4YMUA 2GWHA 4IFEA 2GHIA 4YXWA 1U8AA 5JHHB 1XEWX 4A1FA 5A0FA 2QSYA 2OLKA 3TAUA 4ACBA 2JLYA 4D2IA 1W0JA 4QNMA 5E3HA 2ODBA 2EFCB 2CK3A 2CBZA 3BGWA 4EPVA 1EX7A 2NPFA 4F4IA 1NG1A 4KFTA 4F93B 4KXFB 4AIIA 3AF1A 1AIPA 5EP4A 1GNQA 3GLGA 1F2TB 2V7QA 4FMCB 1S9HA 3KDSE 3PUYA 3IKJA 1EWQA 2XNDA 5K8IA 2LKCA 2I3BA 4GOXA 4M1KA 5GJWC 5JHGB 3MUFA 4CRWB 3TMKA 1QDEA 2IXEA 4JJZA 4QGGA 4TSFD 3GJ3A 2A5JA 4IVPA 3KQHA 4NYMQ 1TADA 2F43A 2FOLA 4QRHA 4RZ3A 5G40A 5E7JA 4OHXA 5CM9C 4QJ3A 2J87A 2VHCA 1S0UA 3DOEA 5EXPA 4A8JC 1JBKA 1XMSA 4ESHA 3EIQA 4TTPA 3UATA 3Q8XB 3C15C 1VIYA 5KNBA 2Q9AA 1NVWQ 4LYHA 2X77A 1WCV1 2IT1A 1WMSA 4HB4A 2BM1A 3TK1A 2OV2A 3S1AB 4A9AA 4A0HA 2ORIA 5TY0A 3WBKA 4NYIR 4S35A 3ZVNA 3FPAA 4BLRA 2QY9A 1GKIA 3QPWA 1WP9A 1OXTA 1Q1QA 3BB4A 2GXAA 1VCOA 3CF0A 1XMVA 4IHQA 1QF9A 3U2QA 4A0GA 2JLVA 2QMEA 2IA5A 4OI0A 1Q3TA 3TUZC 5FOVA 3C41J 1BO6A 1ZNYA 4B47A 1AJEA 5SZKB 3CH5A 1FUUA 1UKVY 4MDEA 1OYWA 1X1SA 4DUGD 3LX5A 3C5CA 4MUAA 5FUYA 1U90A 5IDVA 1VKJA 3AUXA 3TIFA 1Z47A 3GLIB 5DHFA 3WMEA 4O0MA 5FFMA 4A2PA 1Z83A 2QROA 2GAAA 3D31A 2YC2C 4FXPA 1X8JA 4DLRA 1KMHA 5TARA 4JKIA 4D81A 1GNPA 1II8B 2O0HA 2Z43A 1OV4A 1P2TA 5JWRA 1II0A 4B73A 4FMDB 1KO1A 1VYUA 2ZE5A 4HEJA 3WY9A 4FWIB 4P4SA 3VHXA 3B8HA 4AKHA 1DVRA 4U5XA 5HPYB 4QG7A 4TMKA 2CHQA 2NO7A 3U61B 1DAEA 2XB4A 2PZGA 4QBHA 4UJ3A 2JEOA 1SGWA 2ZRMA 5F98A 5B2ZA 1ZVQA 1ZYUA 1UEJA 3CW2A 3Q9LA 4LCBA 3CO5A 1CF4A 2Z5FA 2KE5A 4NH0A 1OSNA 4RD0A 1E98A 2XZLA 1E2EA 4JLDA 1YR6A 1Z63A 1ZC3A 3K9GA 2YYZA 1KI2A 5KSYA 4B3CA 5FTNA 3TE6A 1FP6A 3AVYA 1II9A 4NDZA 4CIDA 5FTMA 5E7MA 3WMFA 1VDZA 4RKEA 3EASA 4NP6A 2WKQA 4HSEA 4D26A 5JLJA 1NBME 2BHRA 2FWRA 2YZ2A 2REOA 4QL3A 2CE2X 2VIIA 1E2KA 1OFUX 1ONBA 2WMNB 1KAGA 2RGNA 2ZRBA 3KQKA 1YZUA 1T5IA 3A1UA 4N0DA 3JVUA 1J7KA 3RLFA 4HUQA 4ACAA 1P61B 1R2QA 3KL4A 2XTNA 3EW9A 1P9WA 4OHWA 3TJZA 5JZVA 1VCNA 4ZDKA 4HYYA 2LKDA 2AXPA 4A0FA 1G1MA 2GXUA 2D3WA 2QU8A 1KDOA 2YWHA 2ZJ5A 2CLSA 2ZRFA 3NBYC 4IXNA 4DC9A 3B6EA 4RVCA 3EWAA 3FOZA 1AA9A 1SVWA 2C04A 1DAIA 2I1VB 3MLEA 4C7OA 1IQPA 1FTNA 1ZINA 2NTYC 2NZ8A 1J99A 3S1AA 1IONA 3OEEA 2NG1A 2Q9BA 5DE3A 3ZGXA 3CX8A 3L0OA 1GZSA 5CYPA 3KTAB 1JAIA 4XVUA 1US8A 2QAGA 4F92B 1M2OB 2IUSA 2J0VA 2VPPA 2W6IA 4XWAA 4MGKR 3EZ7A 3LLUA 5H68A 4CT4B 3CR8A 2XX3A 4JT4A 2JDIA 1C1YA 5JECA 4QM6A 3RS0A 1E2MA 1FX0B 2W58A 3EZ9A 4DSTA 3W8NA 4KO8A 1DEKA 4IKEA 4IW3B 1D2MA 1E9SA 1HA3A 3HR7A 3U7FB 3B2EA 1W4RA 2WJGA 3VR3A 4XTCS 1P73A 1JJVA 4Q4LA 3QF7A 1HURA 2ZRIA 2J7KA 2VP2A 3QKSA 2WBLC 2DFLA 4AWXA 1DS6A 2BEJA 4Q9LA 2OM2A 3VFDA 3VTKA 4NU0A 2BIFA 1TQ2A 2UKDA 4URZR 4TTRA 1AZTA 3GJ7A 2QPAA 4EPTA 1IBRA 2G0TA 2AKAB 2AXNA 1KI6A 3AB3A 1RRCA 5ELXA 4V0NA 3A6PC 1EFRA 1KSJA 3SQWA 2G1KA 3CF6R 2GVZC 2WJIA 1Z6GA 3CX7A 2DB3A 3P26A 1FNNA 3CZPA 1KI8A 1JXOA 2ZRPA 4DEXA 5JWOA 4ARZA 4QHTA 4AY2A 3K0FB 1D8TA 4MKHA 1FL9A 4KSBA 4P4TA 3FFAA 3K0CA 2BMEA 3VR5A 2QGNA 1YHNA 4JLKA 2ZYTX 5KU1A 3THXA 4Y0VA 4BPBA 3KJHA 5EE5B 3I1FA 3F8TA 4C0JA 5FTJA 3UKDA 4YDSA 3WXMA 2ZJ2A 3EPHA 1IXZA 3MRSA 4KJZA 3ZS9A 4EFNA 1YKSA 1EK0A 2GTPA 3QKRB 3GFPA 3GMTA 2QNRA 4LOAA 4LDJA 4TYPA 2QA5A 3RS5A 2J0QA 4HLCA 1GP2A 1I2MA 5J5CA 2ANBA 4LJ4A 4UNNA 4Z1MA 1NN3A 3QPUA 2YINC 4MKFA 1ZW6A 2RGCA 1Z6TA 3LD9A 1WBDA 1JPJA 2C2HA 4KBFA 5CK4A 2RHMA 3GLIE 4RD3A 1Z0KA 621PA 3PG5A 2GF0A 3W90A 4PQRA 1LB1B 2ZI6A 4A6PA 1XD2A 4ZCLA 4R2IA 3ZJYA 2GVDC 4EPYA 3JZMA 3ONWA 2XJ4A 1CLUA 3GQBA 4DLTA 3VR1A 5JI2E 1Q21A 3DDCA 4P0TA 4LV8B 4PC7A 1HE8B 4DDVA 1WE2A 3CM0A 4B3DA 4DLSA 3QG5A 4M1TA 2Q9CA 4NKRA 2Q3MA 4WXRA 4QNRA 4BZXA 4EDHA 4JBXA 2JATA 4ZDJA 3KUCA 4JVMA 4M53A 5B30A 4CF7A 2YWEA 2C9CA 1SVSA 1DO2A 1GITA 3O8RA 2ZI7A 4CDGA 3DM9B 3ICEA 3KQNA 2DY1A 5KDDA 2O0KA 4BFWA 2ZUBA 2NO1A 3RS4A 4KV9A 2B7CA 2VLIA 2VRWA 3EIEA 1FMLA 4RZUA 5GVRA 4ZV4A 2ZSDA 3QXCA 3QOFA 1LW7A 3IUYA 4YQFA 1BKDR 1D9XA 3B60A 1AKYA 3FE2A 3R20A 1AZSC 1Q12A 2V4ZA 2MSCB 3QBTA 1NIJA 3THYB 5HTKA 4HDOB 4BLTA 2ZS7A 2OESA 2FZLA 1HE1C 1UJ2A 1LV7A 1VECA 2C95A 3RSLA 3HU2A 4DBLC 2P6RA 4MGYR 1AM4D 4NCJA 2FZ4A 2G1JA 2NIPA 3PCRB 4D6PA 5JSZA 4RFSA 2C77A 4F7WA 3ZD6A 5FI1B 5EE1A 5A4JA 1HT1E 3KXIA 2ODNA 2QAGB 3BWDD 4Q1AA 3LBNA 5DI3B 4UJ5A 1KJWA 5FPKA 1E32A 3NEJA 3L8ZA 3TUIC 2ZVQX 4F4JA 2RH5A 3OEHD 1E69A 4I81A 2O8BA 1N5JA 2DFNA 4NL4H 1OFTA 3NEYA 3L8YA 4Q1EA 1ZP6A 3LFUA 1P9RA 2O8EB 2F3RA 4Q47A 2VF8A 1W0KD 3OAAA 1XJCA 1CXZA 2WOOA 3Q72A 1PLKA 1GG2A 4QBFA 4RFVA 3U3KA 1ZM4A 1UKZA 4LBVA 2VP4A 5IRCD 1N0UA 3B9QA 1MH1A 2JLSA 3ASYA 3R8CA 4URVR 4A36A 4ZCIA 1D2NA 2G88A 3EZ6A 3U7GA 1LNZA 1OJLA 1Z3IX 2NPIA 2RGAA 3PQCA 2W83A 3AM1A 1U98A 4CEJB 5H8WA 4YDHB 1N5LA 2ZTSA 4JVSB 4E22A 4C30A 2IF2A 3L0PA 4HAYA 1XMIA 1OH5A 1N6NA 1W4AA 3KB1A 4PO1A 3K70D 2PX3A 2NO9A 4R7ZA 3L0IB 2OO7A 1E3MA 4E09A 1CTQA 1GUAA 3LV8A 2E9SA 2GF9A 1ZIOA 3LA6A 3TVTA 4OQFA 3TQCA 1CBUA 2XB2A 4DSNA 2OFWA 3BFVA 3K70B 4QGAA 1NMZA 4ZKEA 1E1QA 3I5YA 3IBGA 1OKKD 1OIXA 4MUBA 1CIPA 2EFDB 4TYWA 1DE0A 1KAOA 3REGA 3LBHA 5FR2A 2HLDD 2ZE8A 1OYYA 2VF7A 1G64A 3B82A 2O0JA 2YOFA 4M9QA 4B43A 3LW7A 3VR2A 3ETLA 1OXVA 3GLGB 3W3AA 2QENA 3Q5EA 1JI0A 4JLNA 2VHTA 5EXXA 1FMJA 5IK2D 4KI0A 3R7WB 4HAXA 3SI7A 3OHMA 1NN5A 1Q0UA 4KLNA 1S1CA 5DLQC 4EIWA 3PFIA 5F3WB 3RDPA 2D62A 2VO1A 4HLUA 4OQLA 4W5WA 4IDNA 3OAAD 4BLPA 1R4AA 1GILA 2WMOB 4LX0A 1LS1A 2C9OA 2I1QA 1MV5A 4O2RA 5H70A 2CHVA 2OXCA 4QJ4A 5C4MA 2QP4A 3EPLA 4ARZB 1KSFX 3ZZUA 4DDWA 1SZPA 1CJVC 3R9IA 1XXHB 3ZIAA 4MYUA 1TU3A 3B78A 1IXSB 5TXGA 2H18A 3H0KA 1P2SA 4FI3C 5FOTA 3SS8A 3SN6A 4ASUD 4IDHA 2ZRHA 1BOFA 2N42A 2P6UA 2O52A 3P1JA 4Q4HA 3FMFA 1GWNA 2GKSA 4H9GA 4L15A 4RZXA 4PAMA 3CNOA 3PIRA 3TLXA 1H8ED 4B2IA 4GT1A 3UPUA 3E1SA 4TTQA 5DI3A 4GP6A 4ZKDA 4M8NE 3P4XA 1G20E 2V6JA 1BS1A 3B85A 1VG1A 4HB2A 3I61A 1N6KA 3BRWD 5P21A 1UDXA 3A4NA 1ZCAA 1HEIA 3R9XA 3CZQA 4L8GA 1E94E 4YMVA 1NL3A 4NCIA 5G3YA 4JS0A 4DSOA 2NGRA 3SHFA 4AKGA 2QP3A 5AJZA 1OHHD 5JMTA 2ZXUA 2C03A 2CLCX 2X2FA 4OQMA 4B3XA 1VG9B 1O3YA 2IYZA 3GFTA 2WZQA 4NYIQ 1H8HA 3KFXA 3OIYA 4EJSA 3GLGE 3RSOA 2JASA 2CHGA 4FW9A 1KO5A 3C4JA 1OXXK 1IXRC 1P3JA 1IHUA 2O8DA 3U5ZB 1XD9A 3K0AB 4KU4A 2QSZA 1E2IA 1DAHA 1G19A 3K1JA 1N5IA 1AQYA 1ELOA 3U3MA 4N3NA 4PO8A 1T5LA 3W5JA 1OFHA 1AS2A 5KNDA 1XXHE 2OAQ1 2ZM5A 4IEIA 1TEVA 3MMPA 1KNXA 2ZJOA 3KXKA 3THWB 1JEDA 3SBDA 4LC0A 3NC1C 2IWRA 4Q1DA 2Z6VA 1FTSA 1I4LD 1N0WA 1HQYE 2ZQ5A 2R6GA 2VHUA 1NSTA 1SVKA 2CJWA 3ZH9B 4B44A 1T9HA 4BRUA 4QC2A 4NONA 4QKQA 5KHOC 2G3YA 3TKLA 4LYAA 4JL5A 2IYRA 1H8EA 2ORWA 1YQTA 1KDPA 4GPTA 2F1RA 1G3RA 1TF7A 1VHTA 2OXRA 4JL6A 5K8LA 1DARA 5CJ2A 3CRRA 3OIUA 4YMWA 2FSGA 1DG1G 2JAQA 4HLUC 4OKSA 5EXSA 1KK0A 2XNSA 3IIMA 3EPJA 1N6PA 3BAFA 4B6FA 4ZIRA 1HYQA 3CKLA 3P4YA 2N46A 3T06B 4PZYA 4J0QA 4JSTA 3OIWA 5M04A 1Z08A 3UXMA 3U4QA 2QTFA 5GADl 2BDTA 1ZUHA 3OIVA 2WPDA 2IEYA 4PTLA 5CM8B 1Z22A 5J47A 1RW4A 1IN5A 1NN0A 5KUTA 5EZ5A 1T8TA 2BJVA 3B13B 3GLHA 4WVFA 1TF2A 1W5TA 1CJMA 2RAPA 1W1WA 1E2FA 4IDPA 4C4PA 2RGNC 5A5GA 1IOZA 1TF5A 1MT0A 1NBMD 1DBSA 3KKPA 1NVXQ 5DYGA 1GIAA 1YZTA 4BFYA 4CEHB 4FCTA 1KMQA 3A36A 4OL0A 4P3YA 4PZLA 3AUYA 3W5IA 1MABA 4GP7A 4CEIB 4TL8A 2IXGA 3TH5A 1RIFA 1ZBDA 1CR2A 2F1IA 4OK5A 4PX9A 3BJIC 3GLHB 3PENA 1RVDA 4GNKA 1G7RA 1KO8A 3BS4A 4F91B 4C0AC 1E9AA 2DFTA 2W2XA 1KK2A 2Z4SA 1M1YE 1MO4A 4D4MA 3QKTA 1VG0B 1F2UA 3AF0A 1JECA 1NLFA 3W6PA 2HCBA 3RC8A 4DB4A 1KK3A 1ZIPA 4O2LA 4EFLA 2AK3A 1VIAA 4NCKA 1GVNB 3CX6A 3SQXA 4DDUA 3M6AA 2ZETA 2OHFA 1IY1A 3HJNA 1M74A 1G3IA 4E07A 4Q7KA 5EP2A 4Q7LA 2WWYA 1XZPA 2R44A 4JLMA 3PJRA 1XPRA 3CWZA 4WZBE 2ZI5A 4FMCF 3TW8B 3BXZA 2A5YB 1U81A 1BYUA 1U0JA 4KLZA 4QGFA 4G5RA 3ADCA 2V1UA 2WSSA 1Z0JA 2BKUA 1U0LA 2YHSA 4KFSA 1XU4A 3FMOB 3QIAA 3NTUA 2B92A 3R9WA 1T3SA 3IHLA 4LBWA 3U44B 4I1UA 3NDBB 3D3QA 5FPSA 3RABA 2WICA 1NY6A 1F48A 2DWOA 5EXTA 4WAUA 1E79D 2IL1A 3CNLA 1XFAA 3UG7A 5G3ZA 5EE3A 3T5GA 2OT3B 3PEYA 2ZR0A 4GMXA 4C0LA 3DHWC 4M1OA 4PPQA 5HCIA 1KDRA 3KJEA 1UAAA 4FCWA 2X2EA 5FL7A 2V54A 2Q0HA 1UFQA 3Q3JB 1HY3A 4XSGA 1LF0A 1YVDA 5FPHA 3BK7A 3C7KA 3E5HA 2ZU6A 2I4IA 3FFBA 3HWSA 2O8CA 4D0LB 3B1XA 1CU1A 4ZO4A 4PAOA 4Z54A 2QUZA 2BCGY 4EPXA 5JJKA 2WPDD 4XJXA 1DAMA 3LLMA 4UKDA 4IDQA 2J7PA 4WOPA 3W8RA 1J8MF 1E96A 1FFHA 4TQUS 2ZSAA 4BEJA 1M34E 2GRJA 2WIBA 1K5DA 4A6XA 1N6OA 1XCMA 2IXFA 1FW6A 3ZZ0A 4G3XA 2B6HA 3SOPA 3K70C 3SNHA 2E1RA 5LD2C 1E4VA 2R65A 4MQBA 3TRFA 4U02A 2RKOA 5L3RA 3SJBA 2GESA 1XTKA 3D7MA 3UWOA 1TX4B 2JGNA 5FOUA 4ON9A 3LH5A 4NPHA 4TT3A 5LBIA 1TU4A 1RPZA 3KFVA 2XSZD 1A2KC 2VSOA 4AG5A 2RGGA 4M9XA 2R8RA 4B34A 2A7QA 3ZZTA 2GJ9A 2CEAA 3KTAA 1R0YA 2PZFA 4JYBA 4GI7A 4DUGA 5B58C 4PQFA 4BGDA 5L3SB 4AI6A 2VP0A 2ZSFA 2NMVA 1XTJA 4JYCA 4OHVA 2ZAMA 4XD7D 4QJ5A 4WA7A 1OFIA 1E0AA 1OPXA 1JXMA 1QVAA 3MJHA 2J46A 4Q4AA 8OHMA 4W9MC 3GJ4A 5FTKA 1YR7A 3THXB 2WSSD 2BEKA 1IY0A 2IHBA 2ORVA 5TDHA 1XEXA 2F3TA 4CVNA 4B74A 2FMXA 3CLVA 1KZGB 1S1MA 5TMPA 3NBXX 1ETUA 1Y63A 2GBLA 3X1XA 3ZVRA 2H1LA 2ZITA 3SR0A 4Q48A 4LZZA 4IRUB 3KUDA 2HJVA 3CF2A 3KJGA 3W9YA 4BRWA 3C16C 2HT1A 4TN1A 4US2R 1YZGA 3U7EB 1ZM3A 3IQXA 1B0UA 2X8AA 4URWR 221PA 3A4MA 4TLEA 2C96A 2GEVA 2YOHA 3RWOA 4UXHA 5KSZA 3AVPA 2IYTA 2H8KA 3OESA 1OXUA 2WWGA 3WRYC 4AKIA 2IYSA 1UBGA 4KVGA 1GTVA 3RRZA 2GZDA 4M21A 2WJHA 3DZ8A 2GZHA 4IDOA 4OYHA 2ZUCA 2R6FA 4FMDF 3WNDA 4MRSA 1OXSC 2DHRA 1JR3A 4BLOA 3PITA 2QAGC 4X8HA 4JVNA 3PUXA 2ONJA 1A1VA 4CGZA 3V00A 2J41A 2WWFA 1X86B 3CRW1 4A8JA 5JS7A 3LVQE 2GXQA 4AC9A 5KSPA 1HQCA 1W5SA 4Q7MB 1S2MA 3LXRA 4LJ9A 5FOWA 2HXYA 5EJEA 4GSYA 4TT3D 3NXSA 1IY2A 4GRAA 2X19A 1IN8A 1ZNZA 3N2EA 4OI4A 1CR4A 2FN4A 4ZDWA 5HR5A 2NOAA 1LTQA 1TAGA 3EX7C 1D6JA 3EXAA 2H57A 1PJRA 4BASA 5J40A 2J0SA 1D5CA 3WP1B 2C78A 4B33A 3WMGA 5DIFA 2JJ8A 2YVUA 1EFHA 2ZRGA 1L7VC 1AGPA 1JR6A 3CBQA 5BYJA 4K81B 4WBSA 2ECKA 1ZC4A 2AD5A 2W00A 4LK2A 1KSGA 4UQOA 1WBBA 2IW3A 3AP1A 1S3GA 1Z2AA 4PPGA 3AVXA 1KY3A 1OLOA 5AUNB 4MYHA 5KPJA 1UBFA 5FL3A 1NRJB 5EUMA 3UMFA 3M1IA 5GJVC 1K8RA 1UADA 2DCUA 4RFSB 2FV8A 1XEFA 4HUQB 3RNLA 3SU8A 4M9SA 2VQSA 1NI3A 4FIDA 5K8UA 4C0BA 1UDWA 4EPWA 3TSZA 4B3FX 2AL7A 2G83A 2LCFA 4B3BA 2NO0A 4FN5A 3O8BA 1ODFA 1PLJA 5BN3A 1YU9A 1C4OA 1A5TA 5IT5A 2EYQA 2ZREA 2WKRA 2JDID 1BYIA 2J0UA 3A8TA 3EARA 3ZD7A 1JB1A 1WA5A 3GJ6A 3MAAC 3TNFA 2VTKA 3WP0A 3OEED 5FPTA 4S2EA 1IN4A 1NIPA 1KI6B 4RJLA 1RYHA 3DKPA 4P32A 3EWSA 1RZ3A 5DNYB 3K0SA 2HDNB 3VR6A 4OQXA 1G3UA 2ZRLA 3MCAA 2EFHB 3BE4A 1G7CA 3GEEA 1ZMXA 2V3CC 4E5UA 2GCOA 5G41A 121PA 2NQ2C 1E1QD 2OCAA 1W36C 1E0SA 2FSIA 4PC2A 1TPZA 3AQ4A 5H1YA 3B9PA 4ZI2A 2ONKA 5IF9A 1KI9A 3AKCA 1MRSA 4XH9B 4G0NA 1SXJC 1Z6XA 4CEHA 1DADA 3A1SA 3IO3A 4M1MA 5AWFC 1NNEA 4MKGA 3MWKA 3NHAA 2REXB 4JLPA 2C9YA 4P4UA 4PPNA 3NKVA 3KQLA 1SXJD 4KYIB 3KQUA 4K8OA 4JSYA 1W2HA 2QQ0A 1W44A 1XTRA 2BMJA 5AUPB 1IN6A 1P72A 3ASZA 2BCJQ 1G8FA 3GLFE 3FKSD 2MSDB 3GD7A 2ZJ8A 3GLIA 1F2UB 1KIMA 2A30A 1XB2A 5GJCA 2CNWD 3SYLA 4BFSA 2EWVA 4RCYA 2B21A 4G5GA 3HU1A 1GSIA 1HT2E 2ZRKA 3A1TA 1QHGA 4FINA 4NE2A 1BMFA 2FSHA 2WSMA 2GEUA 3AKYA 1P5ZB 3T35A 2WJVA 5JSZB 1KI4A 4LHWA 1GKUB 1Z0AA 3C8UA 2QRZA 1G21E 4LHYA 3X1DA 2J7PD 3A58B 3MSXA 5HZHA 2RB4A 5G53C 4M1YA 4V0OA 3UG6A 3GJ0A 5FOSA 4DJTA 2IS6A 1RFLA 1RRPA 3NDPA 1R8SA 4HAZA 2O5VA 4NCNA 4Q02A 4XTRA 5EP1A 4LYFA 5JCPA 2W0MA 4MRVA 4UNSA 4DCNA 1XCPA 2F9LA 1XPOA 1MABB 2PCLA 2PT5A 4PC3A 4TLBA 4N1AA 3CONA 1S4QA 2J3EA 4Q18A 2BBSA 4JL8A 2QRNA 2IBMA 4Q4JA 3DO6A 2WAXA 4B71A 3U3RA 4GL2A 2JJ2D 1ESMA 4ASUA 2CL0X 4Y0AA 5EE9A 1NLYA 1XTIA 2PH1A 3BH7A 1LY1A 4CEJA 1U9IC 1VTKA 3EPKA 3PUWA 4JLAA 2AWNA 3GFOA 3QQ5A 3BH6A 3TW4A 4LGMA 3RHFA 4BEBA 1N25A 2P2LA 2FA9A 1G7TA 2JCSA 4B35A 1FUKA 4PHTA 2CE7A 2ZRAA 4Q9IA 5KSOA 3NG1A 1S9DA 1XX6A 4XD7A 2QT0A 3ZQJA 1C9KA 1FZQA 3QY0A 3X2SA 3ZQ6A 2QBYA 1ESNA 2QMUA 4EUNA 1W46A 5J4LA 1RYFA 3W34A 2V55B 1XPUA 4UNQA 4DIEA 3H86A 1OW3B 4I1OA 3T12A 4TYNA 2CL6X 5C2JB 1JAHA 4HB3A 4UNRA 3OFND 2XXAA 2O8BB 3U3JA 2VBCA 3THOA 5B64A 3ZYCA 4DT1A 2ZS9A 2OBNA 3CRMA 4V0LA 4URXR 2QMHA 3KXLA 2ZI4A 2FG5A 4V0ME 2F7SA 2VHQA 4TLAA 2RGXA 1J90A 4HLQB 1RRGA 2FX3A 4RD2A 3A4LA 3MFYA 3K09A 3AF4A 5DHAA 3FTQA 1UBCA 1R7RA 4Q03A 1G291 3NBZC 3U7HB 4A82A 1CULC 1XTQA 2WAYA 5IHPA 1OE0A 2ZRNA 3EIHA 3FHCB 4RY2A 3RRYA 3TR0A 2CNWA 3I92A 1DAGA 3A37A 2V7QD 4TYQA 5BXQC 1A82A 4P31A 1YZLA 4X8MA 1ZD1A 2RGBA 4EPRA 3AVUA 2WV9A 1W2GA 1DOAA 1IM2A 5AJVB 2JJ1D 2OCBA 3CPJB 3RAPR 3FMPB 3LBIA 1KO7A 4BZQA 4R2HA 3GPLA 2D74A 4MYCA 4DB2A 2H17A 1U2RA 5C1BA 2PZEA 3GJXC 4Q9JA 1ZUNB 3OE7A 2H16A 1W48A 2ZANA 2WJJA 4PZZA 3HPRA 1W4CA 4BECA 1OIVA 1AK2A 1U99A 1G16A 3Q7QA 4QHYA 1KJZA 1DG3A 1NVVQ 3KJIA 3TBKA 3NH6A 5CYOA 3ZDQA 2CDNA 1UKYA 1G18A 1W0KA 2BVNA 1XZQA 4NBSA 2A78A 3RRMA 4HZIA 5KDLA 3SC3A 1PUJA 3AVOA 4AYTA 1JR3D 1NLZA 3CB4A 1T0JB 2YOGA 4LWZA 1DELA 1GL6A 1Q1ZA 1Z6AA 2W6JA 1GOTA 4PO9A 2HV8A 4PPFA 4C2TA 3T1VA 2OBMA 3GEHA 1QHHA 4URYR 4D4JA 3RC3A 3I8SA 1SXJE 2GJAA 1E9RA 2ZE6A 4BZPA 4AYWA 3K0EA 2PJRA 2WIAA 1XXHA 3EZFA 2PMDA 2QE7A 3BBPA 1VPLA 5FH9A 1D2EA 1E9CA 1OIWA 2DFKB 1J8YF 2V8OA 1KKLA 1Q3HA 4IOKA 3IEUA 5JBQA 3AGQA 4R71A 3A1VA 4KHZA 4Q00A 3VR4A 4EJSC 1CR1A 2GDJA 1SHKA 1P4SA 1E2NA 2PEYA 3I3SR 4PQYA 2QZ4A 1TEXA 2ZR9A 1OKKA 2JJ1A 4KFUA 3PV0A 4XWKA 4AG6A 3PEWA 1E99A 4DLZA 4NCHA 1VCIA 1XMJA 2KJQA 2PBRA 1S8FA 3SJCA 3PR1A 4Q1BA 4B48A 3BB3A 4IXMA 2BJWA 5C18A 3PUZA 1T4GA 2GJSA 2BMDA 1IJEA 1XJ0A 1QHYA 2OUKA 1XP8A 5E7IA 3SHWA 4D82A 4M22A 1MOZA 1Q1BA 1DAKA 2CLDX 3CPEA 4DEYA 1G8PA 421PA 2IHYA 3ZLJA 2A2ZA 2OFOA 2Q3FA 1TTTA 3T1QA 1X3SA 1Z29A 1AGRA 1N6IA 5TVKA 3T61A 5B57C 1Z5ZA 2E87A 5DYIA 4HLDA 3PXGA 4MRPA 4H1UA 4N0EA 3REFA 2CL7X 2BOVA 3WNBA 1QHHB 1WDTA 5JCZA 2GEDA 3NC0C 4JIMA 1QHSA 2KWIA 2UZ3A 3F5FA 3T5DA 2YWFA 3OF5A 2VP5A 5KO2A 1QG4A 4AK9A 3QNUA 5SZHB 1KYIA 2AR7A 4TQAA 3MWJA 1COWD 2ANCA 4EFMA 1PZNA 3IEVA 3AVVA 5EE0A 4BFUA 1O87A 3IPXA 1XTSA 4JBWA 3W3ZB 3GP8A 1IAQA 1I2DA 3F3YA 2AWOA 1CJUC 4B32A 4HDCA 1Z0FA 2GJKA 4ITRC 3HYRA 5L3QA 3AH8A 4RSGA 4V0MA 4TMXA 1FQKA 3CWQA 1N6HA 3GJ8A 2XSZA 1XRJA 1XWIA 2CXXA 4MH0R 5BN5A 2XOKA 1TQDA 3BERA 1JQJC 2F9MA 1E9EA 2VEDA 4DXAA 5HZKA 4F38A 2ZAOA 4QGHA 4LY6A 4O3MA 1F60A 1Z0DA 4RCZA 4ERNA 4FCVA 4OHYA 3CIOA 4KODA 3AF3A 2HEIA 4TMVA 1J2JA 5F2EA 4C7OB 3HPQA 1A7JA 2XTMA 1MO3A 3L82B 3NWJA 2FU5C 3H2YA 2HT6A 5TV2A 2X1VA 3K8YA 1JQLB 3THYA 1KTVA 2ZJZA 2P6NA 4C9BA 3J81k 2F6RA 5BN4A 3C5HA 5D3QA 4BE7B 2Q21A 5LD2B 4D4LA 2MMCA 2YV5A 3TR5A 3VQTA 4IEEA 5KYKA 1KHTA 2GZAA 4GBMA 3DEFA 3MD0A 3BORA 4Q01A 3V9PA 2HUPA 3Q85A 2QN6A 4U00A 1BMFD 1W0JD 4HUTA 4OI1A 5FBWB 2B7BA 2IF0A 3GEIA 1CJKC 5ANRB 2O8CB 2JJ2A 4KYUA 4IOMA 2V6IA 3LO5A 3I62A 3BIFA 4HI0E 4GOJA 1JJ7A 1U8YA 4LV5B 2GK7A 2GA8A 4QFMA 1W36B 1CKEA 2FSFA 1G5TA 2R9VA 5IK2A 3QEJA 4QHSA 1N3BA 2ZVPX 4A4DA 3CPHA 1EXMA 5SZJA 1EFCA 2XJ9A 2QE7D 5EUQB 4A8JB 1G6HA 1SVIA 3CNNA 3B1YA 1R10A 2R2AA 2B8WA 1UKEA 2P0EA 3V4RA 1P6XA 2PT7A 4LBYA 1CS4C 2FE4A 4ESVA 1JR3E 4H1VA 1DTSA 3BD9A 2QTVB 4ZCMA 1L2TA 2RGEA 1KI3A 3K0FA 2FNAA 3DMDA 4LHXA 1X8LA 4RD4A 4C2UA 1FNMA 4XVRA 4IJMA 2HLDA 2QAJA 2VSXA 3EC2A 5BYKA 2KB0A 4PANA 2ODWA 5LDDC 3VNUA 2XNDD 4HDQB 2R6CA 3OEHA 4Q4JB 2RGDA 1XEWY 5J4VA 1ZM2A 2IYLD 4TQ9A 1E0KA 2DYKA 1GM5A 3B1VA 1VMAA 2OE2A 2HF9A 3P20A 1K5GA 1SVLA 5AJYA 3SDZA 4B2LA 3L2OB 3SFZA 3R8FA 1SKQA 3QKSB 1KZ7B 2G0NA 1WQ1R 3FKQA 2GCOB 4BQSA 3AKEA 1E6CA 4W7SA 2Z0MA 2XOKD 5FI0B 5TB5A 1EFRD 4I1VA 1YR8A 4Q1CA 5DN6D 1NG9A 2WM9B 4C0QC 2P5SA 2BBOA 3SJZA 2WTUA 3UANA 1HTWA 4I99A 1ZUIA 3ZIAD 2ZEJA 5FBQB 3EA0A 1SVMA 3UMSA 2GCPA 5CDFE 1VHLA 2BMFA 4XVQA 4OJQA 2FEOA 4PHHA 1E9FA 2C99A 2FGKA 4JLOA 2AD1A 4P33A 1H8HD 3GCGA 3SYNA 3ADKA 3LY5A 4QBGB 1ZAKA 2C98A 3TSOA 3VX4A 3FVQA 4BFZA 4HB0A 3U6KA 4G5SA 1NBMA 2Y8EA 3B5JA 1E0JA 3DM5A 5EQTA 4PHGA 2HF8A 3E70C 5LPNA 5L8VA 2BM0A 3AV0B 3DL0A 3IHWA 1SXJA 4L16A 1TUEA 2WWXA 3UMRA 2AKYA 3HYTA 1Q20A 4RD6A 1YZNA 2FPMA 4OK6A 1LS6A 2KBFA 4BWYA 3OE7D 5CJPA 2NO6A 4TYYA 1ANKA 5FUXA 3VAAA 4DCSA 2ERXA 4DLWA 1UF9A 3CUEF 4FWTA 5LB2A 1CEEA 1E9DA 1V43A 3RS2A 4EAQA 1ZU4A 2IC5A 1P7CA 3MWYW 4K46A 3W6OA 4Q19A 5CB8A 1KI7A 3QXHA 2ZI9A 3TAHA 1OH6A 1AKEA 1HV8A 1I4TD 3HDTA 3DVLA 2IS1A 2GBLC 1N6RA 2XEXA 3NVAA 3MG9A 4HATA 4CW7A 4WW0A 2EQBA 3TSWA 821PA 1NKSA 5DO9A 2IEZA 1E1RA 4L9SA 3RVBA 1G3QA 2CJWB 2XTZA 2D06A 3MGCA 1GRNA 5CLLA 5L3VA 1G8HA 2GNOA 4NTZA 2CCJA 3VKWA 1E2DA 721PA 1OH8A 3AEZA 1G4UR 1M6NA 4XWOA 1R5NA 3K0AA 1QG2A 3LX8A 3CH4B 3IIJA 4HZUB 4DSUA 1XDBA 2W0SA 3AKDA 2F1HA 4DCUA 1NMXA 3EG5A 3IIKA 3SZRA 3UIEA 2O8EA 3NBFA 2IX3A 3PEUA 1YE8A 2R6DA 1SKYE 2CVFA 2AX4A 4JBYA 3EC1A 4US0R 5EZ6B 1W7AA 3KX2A 4DCTA 1XD2B 4ZDIA 4KBGA 1ZM9A 1VG8A 1KSHA 1J70A 4AD8A 2JIZA 3C14C 2GK6A 1Z0IA 4DT1B 4EQ6B 4JLJA 4G1UC 2J9RA 4D4KA 3N70A 4QM7A 2XXAB 2QPOA 2IUTA 1T8UA 2D7DA 2XAUA 5FPYA 2JLXA 5DN6A 1NJGA 1NSFA 3QXSA 3H84A 1GDDA 1MO6A 3QKRA 1X1RA 3EAQA 1YRBA 2P67A 5AJWA 1M7BA 5LB4A 4FD2A 4Q1FA 1Q22A 3LWNA 4PFSA 4YXWD 1VCMA 1K6MA 3QSYA 2MMGA 4D0GA 4TZ0A 2CCKA 3QJYA 4I4LA 4LJ7A 4PAQA 3WHLA 1R0WA 4Q7JB 2BC9A 2BBTA 2EU8A 2R6AA 4PXAA 2J45A 3FB4A 4C3ZA 2OILA 2UVQA 2J5XA 1UBEA 1RC8A 1VYTA 5L3QB 3KKQA 1BIFA 4M1WA 2QP9X 4TL9A 1OT3A 2H7VA 3TQFA 5JJLA 2RCNA 1RKBA 3I4LA 1E1RD 1TUIA 1T3LA 2J1LA 3EZ2A 1G9XA 1B23P 1QVRA 1X6VA 4GZLA 2AFHE 4P4SB 1N2CE 3CRQA 4XIGS 4B76A 4JLVA 4LSGA 4LUCA 2PLFA 2FFAA 3LQQA 5AJXA 2UZIR 4XOIA 1W36D 1AQUA 1G5RA 1TNDA 3BH0A 2ASEA 3BC1A 3BOSA 1XD8A 4KFRA 4OI2A 4RZ2A 4V03A 5JWHA 4PC6A 4D0NA 5J4KA 1PVOA 5BWMA 3H1TA 4D80A 1SQ5A 1M7GA 4LHZA 4BLSA 2D4HA 1SKYB 1KKMA 4DRZA 5D3MB 1LVGA 4PSVA 1U94A 1YZQA 3RWMB 1KJYA 2WOJA 5FL7D 4Q4AB 4KSCA 5BW8A 1PLLA 4TMTA 2XZOA 5JJIA 1MRNA 1KDTA 3FDIA 2XZPA 2IYXA 1R6BX 1Z28A 4IOJA 4TL6A 4C0SA 4TWZA 3U3OA 5DH9A 1II8A 4US1R 1NF3A 2ZUDA 2BKEA 2HYDA 4LI0A 4NYMR 4JVLA 4TMZA 3DZDA 5K8TA 3VU9A 5HKKA 1UEIA 1US8B 1PV4A 1COWA 3ND9A 1HH4A 1Y3AA 3MWLA 2QEQA 5JS8A 4C0HA 2HYIC 4LPSA 4Z1MD 1EFUA 3OZXA 3K53A 1FQJA 3N5CA 4QBIA 1KY2A 1NN1A 4Q21A 1NY5A 2KBEA 3AVWA 3TUJC 4JZKA 1I4DD 2PJZA 1L8QA 3IPYA 4DLXA 4BFVA 4YC7A 4B75A 1OB5A 1TMKA 2QG6A 2A3RA 3VHLB 3G5UA 5FUWA 4A15A 3DOFA 1SVOA 4ZPXA 1AS3A 4KCGA 1G5PA 4BFTA 2DPXA 5FR1A 3WYFA 4ABYA 4Z51A 3LW8A 3IGFA 1V5WA 2IUUA 2O8DB 3X1YA 1EG7A 4MDFA 4EJSB 1AN0A 3QKUA 1CR0A 2XGJA 3SYKA 2PL3A 5KTYA 2BWJA 1E4YA 3K9NA 3P32A 1RE0A 1ZNXA 3T15A 3TGPA 4U7DA 3UWKA 5CK5A 3ND8A 1P75A 3U6BA 2JLRA 1ZD9A 3BFXA 4TZ6A 3HP1A 1P62B 5CB6A 3VKGA 2FF7A 1RJ9B 2CCGA 4A2QA 1WRBA 3M0EA 1N5KA 3B7GA 3L0SA 1GAJA 3RYTC 3FGNA 2W6JD 1QZXA 3THWA 2JIZD 4NZYA 3L43A 4Q5IA 3T1TA 4KAXA 4XSHA 3ECCA 4ZI3A 3WNCA 2BV3A 3QG1A 1A2BA 1GL9B 1RRFA 3QXXA 4IOLA 1CRPA 1XNJA 3LRPA 4LC1A 5HE9A 3WHKA 4YMSA 1TL7C 1G7SA 1UM8A 4NYJQ 5J4YA 2ZROA 2FFBA 1JPNA 4M4SA 2ATXA 1DPFA 4LRWA 3ZVMA 1Z6YA 5HCNA 2YC4C 1H65A 2Z83A 1ZCBA 1EX6A 1G8GA 2V9PA 4MYTA 3B1ZA 4Z8YA 1E2JA 1U9IA 4TLDA 4EKDA 2QBYB 3ICQB 1E9BA 2EW1A 2FPLA 4V02A 3IQWA 4WZAE 3QXJA 1NP6A 1FP7A 5AR1A 3GLFB 2LWIA 3TVDA 5DSZA 4A0RA 1GL7A 1KI1A 3VNVA 3O8DA 1ZU5A 4ILEA 1CP2A 3JVVA 4GZMA 2R62A 1ZJ6A 1IJFA 2VP6A 2ZRCA 4OJKA 1W47A 4MITA 5FOXA 1R0XA 4OQNA 4NMMA 2NZJA 3H4MA 4HAWA 2FEMA 2PMKA 4MGIR 1Z06A 4B2PA 3N2IA 3M4YA 4E03A 2QM7A 2H92A 4PSKA 4GOKA 4DLYA 1U8ZA 4HAUA 3DPUA 3AF2A 3V4FA 1P2VA 2QPTA 2WJYA 4NHOA 5E4FA 4I1SA 4X8OA 1F3OA 2FPKA 4JKYA 2ZRJA 3FWYA 2WWWA 4M2LA 2IYUA 5JFGA 1NJFA 2H5EA 4MKIA 521PA 1ZM7A 1LF5A 3K09C 1QHNA 1T91A 2YWGA 3KZ1E 4CEIA 1ZRHA 2W6ID 4G5OA 5DGXA 5UKDA 1QBKC 1WB9A 2ZSEA 4QOSA 4O25A 2XITA 3U60B 2G77B 3SEAA 3FHOA 2IK8A 2WWHA 2IYWA 1R0ZA 2ZS8A 4B6EA 2Z4RA 5D3MA 2JA1A 1YZKA 1WXQA 2ATVA 2VHJA 3QUSA 4TSFA 1KMHB 3I32A 1E2QA 2F55A 4DZZA 4RKFA 3JZAA 4BUJA 2VA8A 1MKYA 2P3SA 1R5BA 4WXPA 4PR0A 1M8PA 3NIBA 1R5OA 4JT2A 3HU3A 4DCVA
chains in the Genus database with same CATH superfamily
4HN4B 1XLTA 1IUNA 1TZMA 3IP5A 1G6OA 2Q3CA 5CLIA 3ACBA 1UXIA 3N1UA 4G81A 4II7A 1PJBA 2QT1A 3LXXA 1QHXA 2Q2NA 3W05A 5BW5A 1RJ9A 3B1WA 3CZCA 1ESCA 1P77A 4HPWA 2XUFA 4IVRA 4R41A 1RMQA 4HXEB 1O6CA 3S2YA 1B8UA 1R27A 2GHQA 2QD4A 3AL2A 3WXBA 3ZS8A 4E12A 5J4HA 3GT4A 3PE3A 4FDLA 4B3GA 4CJXA 1MO5A 3LSYA 2QL6A 5JI3E 3MTDA 1NP7A 1MEJA 3UK7A 1VPWA 3COPA 2OD2A 2WSBA 2PMWB 3M6MD 1JA0A 3LE8A 4YH1A 2C58A 3MTBA 2FGJA 3BXPA 3HP4A 4RY8A 1L1FA 4BXOA 1BXGB 1T9GS 3H18A 4GXNA 1D0VA 2QE6A 3BEOA 2HXSA 3GLHE 1H2EA 2QMOA 2Q41A 1T6NA 2OGZA 4LPKA 5AK0A 3ZD8A 4F9GA 4LJ6A 3PC2A 1JA1A 2Y93A 2QRGA 1E2GA 2YIMA 4FHCA 2PKEA 2XXBA 4DXDA 1KK1A 2GAOA 4HDAA 1N0HA 4C89A 1AS0A 4WJKB 3THRA 5A9SB 2CXNA 2YWBA 2A9PA 2B2CA 3VSAA 4B09A 2VSFA 1Z8DA 3HFGA 3QEMA 1JU4A 3TW6A 2MSWA 4CPDA 4TS1A 1K7CA 3QVUA 3DNPA 3IT0A 3ZCXA 2P62A 5IJXA 2DBYA 4TXJA 1KO4A 1Y6JA 4FZJA 1AA6A 3QPVA 4XGNA 4QT4A 1CQJA 2EEZA 3LT1A 1UK7A 3PD7A 1EM8A 1VBKA 1KIFA 4J0IA 3WKAA 1HR0B 5EKXA 1QWOA 2PZLA 4FB5A 1U9JA 3T3OA 2JLQA 3FZNA 4HAVA 1Z56C 3LP6A 4HJRA 2YZ7A 1HORA 1M7HA 3G89A 3FUCA 1KETA 1L4GA 1YL6A 2HSGA 2PEZA 2VHVA 1ABEA 3F5QA 4G0ZA 1JIUA 1IN7A 4KN6A 5CP8A 1Z3CA 3GROA 1SRRA 3SPXA 4JYPA 4LRTB 1SXPA 2Q3HA 4MPJA 1JSCA 3DFIA 4F9TA 4ZVUA 4GR5A 5JD6A 1UDRA 1VP9A 2IU0A 3M2TA 3RH0A 4L5JA 2C9MA 1JYSA 3K9LA 3NOQA 3DKVA 1E63A 1DO0A 1EM8B 2AEFA 2AXEA 2N1BA 1FFBA 1YA8A 3TIGA 3G0DA 2XDWA 3GGGA 3TMYA 4YDRA 5IABA 3HKEB 4FPXA 3F3SA 4DV7B 1UZLA 1TQ6A 3AFMA 2BPOA 1ADBA 5GONF 4QTUB 1DKUA 3OJOA 4JQCA 2BEVB 3K9HA 1HETA 5LYJF 1SXJB 2W2VA 3O7MA 1ZD8A 3KYCB 5I7FA 1PGQA 2P6PA 4FYJA 5GZ6A 1T5SA 4R1PA 2RHCA 3PVSA 4RA6B 3I04A 4UVGA 1E9VA 2OG2A 4WK0B 5COQA 5EP3A 4C7BA 2ODEA 1MB3A 2VP9A 1LPSA 4FMBB 3MT0A 1GY8A 3ZVLA 4LJYA 1PRYA 2B1QA 4ENSA 2C3YA 2FH5B 2WT9A 4DV4B 4AICA 1LFAA 3GGJA 1RJDA 1PEAA 1WUYA 2REQA 3GRZA 1LPOA 2WVJA 3DYBA 3G88A 4L5CA 4NH4A 4X44A 5CIWA 4C0KA 1OYVA 4L85A 4M6WB 5ESWA 1ODTC 1EMDA 1G60A 2QM8A 3BHNA 5BSEA 2OCGA 3FHTA 1YQGA 1N8SA 3P8ZA 2QJOA 1EGAA 1I80A 3LPAA 4DIUA 1O58A 4FR2A 4G26A 5JLAA 4EB6A 1TQ4A 1XXLA 1T26A 2DE0X 2EYUA 2QQEA 2Z3ZA 2GCNA 3UTCA 2IS2A 1HRDA 4I55B 3VISA 3WMRA 3N7TA 4WUTA 3GXOA 3PD1A 3LVFO 2IHNA 4QOHA 3EG9A 2ERYA 4M0LA 2ZI3A 1INLA 1MQ9A 1UJCA 4YLGA 4S1WA 1AN9A 1JQ5A 3CIFA 3GJZA 4UXJA 4Z7OB 4TKLA 3ZK9A 4XLTA 4RIHA 2AEJA 2V98A 1SR8A 1A4XA 2GEFA 3CC8A 2D0PB 4MDYA 5DGCA 4LSZA 1TKRA 2WKWA 4OX9Y 1FSPA 3HEMA 3OE1A 4UTRA 2H29A 1PGJA 3D3JA 3AR6A 3DBHA 4OJTA 5HCUA 1WZNA 2ZJAA 4QA9A 1R8QA 1L4UA 1QC5B 1L5HA 4DCPA 4MWGA 1BWSA 2H4ZA 2PGAA 1CY6A 5CU7A 1B74A 5KNCA 4EQ6A 4ZHSA 3OZDA 3ANYB 3Q7RA 2IOFA 4FEGA 4PZCA 3FCEA 5I8PA 4G07A 4L6IA 2VPTA 4M98A 5ICMA 4RIFA 5DISB 5CITA 4YNBA 2H4FA 5T8KC 1ZN2A 1UP4A 2HK9A 3UGQA 1PSWA 4L9RA 1I7QB 2I2XB 5CFNA 3G85A 1IBCA 2GN6A 4REMA 4O4JF 4TL7A 4A27A 2BKVA 1CRQA 1XF9A 5CIQA 4JXKA 4BYMA 1NVVR 3A9VA 2VL7A 4R9UC 4YIHA 3RVSA 3TNJA 1NF2A 1A0OA 1ONSA 2XAAA 4MGZR 4DLVA 1E2LA 1RPJA 2J3LA 4W1PA 4DA6A 4IIVA 2HCRA 4OMDA 1EAYA 4QOIA 1RHJA 3ASVA 1Q57A 2I6FA 1T24A 3G8AA 2ZP1A 3HP7A 4HFJA 2VF4X 5FAKA 1HDOA 3E81A 4QYIA 3HCOA 4QWMA 4BJ3A 2C29D 4YCLA 2FFHA 2ZYVX 1V41E 1VSTA 3K1AA 4N5HX 5LP1A 5CVDA 1KWGA 1OF1A 2VPZA 3AW8A 2HRQA 1GDTA 3WZLA 4KO4S 1E6KA 2PO5A 3UJDA 1L7QA 4KUEA 4R1MA 5EHZA 5K5EA 1Z2CA 1OI7A 1ZUNA 1E2PA 2XKJE 2ZZKA 2NSYA 5FQNA 4HNGA 5TQ2B 4ARSA 4LF8B 1J00A 1N75A 2XF2A 2YMQA 3EDRA 2PBLA 4RD1A 4BKOA 3B48A 2ONYA 3LVRE 1T5HX 3FZGA 2QLLA 1S6YA 2ORED 2PZ8A 3O4FA 2CC2A 2VHEA 4W5JA 3W6UA 4C76A 3X1WA 3ZW9A 3KXPA 1TDJA 4EUSA 2JK1A 3E2IA 4BZWA 4KR2A 2ZIAA 2MIIA 2IV7A 4AYXA 3C2QA 4RBNA 1KVRA 4RABA 1K3TA 2V7TA 4HV4A 3D0OA 4WJLA 2V1XA 4CYMA 2H3EA 5DBOA 2PQ6A 2WNIA 5F4BA 4EKEA 3SE0A 4KIUA 2AN9A 3N05A 3GFGA 4HCJA 5DI9A 1YH3A 1N9GA 1XUOA 1Z6ZA 4UPVA 2QXUA 3IV7A 1D4AA 4KLRA 3ZIDA 3U4QB 1M2NA 1NVTA 3TTXA 1QM5A 1ZNQO 1XP5A 2XBLA 4ZVVA 4BAUA 1JEEA 3ROMA 1YCHA 3AKZA 2W7TA 4HYEA 1HOTA 1TVMA 3DEZA 1GNRA 1SPXA 4OBEA 2O2HA 2PZJA 5K0EA 2BGUA 2P9JA 1NXTA 2NXWA 2NVUB 5LQMA 3GNQA 2GLTA 4PPYA 5JVDF 5KDOA 5FEMA 1PJTA 3U1VA 5FTWA 2P3OA 2O8FA 1VBFA 2E6UX 2NZWA 1S3SA 2F2TA 2PSDA 4BVAA 5L3SA 1R0SA 4CZ2A 1G17A 2GETA 3B2NA 2H1HA 3PNYA 1OT5A 2H1CA 4EO9A 3IDQA 3QE0A 2HQ1A 4ZOLA 1HUQA 1QGOA 1LBSA 3GWZA 5K6AA 4MICA 1RHRA 3I5UA 4DE5A 1U0HC 3F0TA 5AVUA 4UHCA 1CJBA 2C2BA 3UJ7A 3ZDZB 4IR7A 2EZ8A 3WIVA 5AI8A 1NE2A 1XEWX 3KOYA 2VG8A 3JR3A 2XUIA 5B7QA 4G0MA 5K0TA 1G2OA 3DFUA 1SIWA 5E0OA 3TAUA 4D2IA 4MUMA 1EXWA 2G72A 3LQ2A 5ULLA 1E4EA 1NRWA 2ODBA 3LF1A 1EX7A 5ALUA 2NPFA 3UZUA 2NWQA 1ULAA 3ESDA 2BYTA 4TLLB 1KDZA 1L7DA 1Z4QA 3GCZA 3NJ4A 2Z8XA 3I39X 3KDSE 4L07A 1KH1A 3IKJA 4D4IA 4RHFA 2E5FA 3WWPA 2Y1KA 3C7CB 3REQB 2G76A 3UMBA 1DGQA 3IAUA 1F38A 4CRWB 2AH5A 3TMKA 4IDCA 2B37A 4EEXA 4AF7A 1WCIA 1A8QA 1QDEA 5K1ZA 2L82A 2ON6A 1U80A 3E48A 3I9JA 4IVPA 3S8YA 3CRZA 2F43A 2ECPA 2G1UA 5DMHA 1H1LA 4OHXA 4QJ3A 1KGSA 2J87A 4KOEC 1JG1A 1S0UA 5IASA 1E6UA 2XT9A 2Q2QA 1HPLA 4D5GA 3IUPA 3ELWA 3OZBA 1LI7A 1TZCA 3C15C 3UH0A 1A9QA 1RAIA 2Q9AA 4CCYB 1NVWQ 4LYHA 3CW9A 4P36A 3TK1A 4FUQA 3ZJVA 1T2NA 3CVWA 3VC7A 1L5HB 3GA0A 1J97A 4NYIR 1LLFA 3ZVNA 2VJOA 4HX9A 1XAGA 2O7SA 4JJAA 4ABTA 1GKIA 1W5BA 3IKMB 1PR1A 2HWXA 4PYRA 1VCOA 3CF0A 4GSKA 1QF9A 3H2KA 4Y9UA 5KWJA 2JLVA 5IU6A 2IA5A 3AESB 3CZMA 4ZYWA 1W7AA 1EEHA 3EVZA 5JAIA 1SKAA 1BO6A 3C41J 3PL5A 1U5BB 2HJHA 2VDUE 3SZLA 4UOEA 3CH5A 3F2IA 4AJKA 4EM6A 4UHEA 4H3VA 3QY9A 1F0PA 2XV1A 2ZQZA 5L53A 3LX5A 1O5TA 3C5CA 1NP3A 4R0VA 1UEXC 1T6ZA 5FUYA 3AL0C 1VKJA 3ZK7A 4BB9A 4H17A 1C8LA 1Z47A 1RD4A 2JZOA 2VJLA 4R9VA 5DHFA 3WMEA 4P7GA 4OHOA 1D2HA 4N8DA 5FFMA 5KCMA 3HJRA 2QROA 2B30A 2GAAA 4FXPA 4G9BA 4I55A 3WL5A 4YI3A 1PZFA 1KMHA 3VR3D 4JKIA 2RHOA 1NWHA 1OV4A 4HXGA 3ZNQA 1II0A 2EP5A 5HJ2A 4UHHA 3PD0A 2QUKA 2QL5A 4FWIB 4P4SA 1CS0B 2I33A 4KQMA 4NPCA 1CSEE 3LNTA 1DVRA 5KYGA 4TMKA 3WDLA 4RK0A 3ER8A 1BTOA 2XB4A 4O4JB 4TSKA 2YMMA 4UJ3A 2DBQA 1EE1A 2JEOA 1SGWA 3E7DA 3AIIA 1ZVQA 1NNI1 3NT4A 2Z5FA 2AQHA 4NH0A 5LWQA 4X24A 1YRWA 1T1GA 2G07A 2O5RA 3QOFA 4PZEA 1E98A 1T0UA 3R7AA 4B0PA 4C4YA 2Q1XA 1KAHA 4YR7A 5MN5A 1C3VA 4KC0A 1T5OA 5CVVA 2XT6A 2IH5A 2V9ZA 3FIUA 4B5KA 4Y6RA 4ESOA 3I45A 2VN8A 1EVQA 4ZP1A 3I01A 4TV8A 5AKYA 5TIIA 4D8XA 1FP4B 5ER6A 3OSZA 6CHYA 1V7QA 2FKNA 4L50A 4O4JA 4UATA 5CUQA 5LYYA 3I5AA 3A9RA 4PN3A 4JYZA 4HP8A 2QN8A 2XXJA 2J9XB 4NDZA 4WOCA 4AS3A 1XPJA 2V7EA 3WMFA 3N58A 1VDZA 1QORA 4AY4A 4RO0A 5A4AA 1GEEA 3SVTA 4GKKB 2XMBA 4HSEA 2ZTUA 3WNZA 4OA5A 5JLJA 4D26A 2IX9A 3OZ7A 3V8EA 4Y67A 4QL3A 4GEKA 3BVPA 4GF5A 2QTBA 1XK6A 5IAJA 3P97A 4ZU1X 1ZH8A 2OTCA 2O59A 1ZSNA 4XR9A 2ZRBA 4EGSA 3R09A 1M2GA 3DWGA 1Q0SA 1T5IA 2HO5A 3A1UA 4C3OB 5DRYA 2NSDA 2D4AA 5DXFA 4Q6BA 1P61B 3EGXB 1U0FA 2C4WA 3M82A 4ACAA 4DLPA 3DTVA 5B3JA 1JMKC 3TJZA 1NPDA 1QV9A 1VMIA 1PV1A 3DOUA 3G2IA 5JAMA 4OGWA 1G1MA 5BR1A 3TB6A 1Z7EA 5D84A 2ZJ5A 3FTEA 1EWYA 3F78A 3NBYC 4QGSA 2WFMA 1LXCA 1GGNA 2C59A 2B4YA 3A25A 3ABSB 3B6EA 3A3PA 1AA9A 3NT5A 3OEWA 3FOZA 2JBHA 3OU7A 3ZXUB 1DAIA 1NBWB 2DGDA 4PLCA 1R3UA 3N6XA 1ZINA 1BXGA 1JNXX 2C7GA 1LA2A 1U1CA 2VJDA 3EFOA 4ND6A 3TDKA 2FMKA 2R85A 4EEKA 2AZTA 5FLEX 5A1TA 3LCUA 3CX8A 4HYTA 1PDVA 3RUDA 1LBIA 4DMLA 2C61A 3USCS 4EGFA 3OT4A 1F5SA 4IIUA 1N8KA 1U1EA 4UOQA 1BA2A 3VDXA 1VJ0A 1ICIA 4XVUA 4ZYVA 2EZ4A 2QAGA 4F92B 1M2OB 1ZFNA 2IUSA 1DTWA 4XWAA 5AM4A 5FO1A 2IEBA 5A4MS 2HGSA 3QIVA 4JI4B 4BGVA 1XZBA 1R4NA 4V38A 2YVLA 1V3UA 2XX3A 3T7RA 2JDIA 2R1TB 1I51A 4IIJB 5JSKA 4PEVA 4UE3S 5B3KA 1CEQA 2DPYA 4UBMA 2VI5A 5EFOA 4WK2B 2JCBA 3S2FA 3LCRA 2G6TA 4KO8A 1DEKA 5ALHA 3EGWA 4LF5B 4FHEA 2ATEA 1E9SA 1HA3A 3A28A 3AG6A 4HQNA 2ZWPA 4IUYA 4YN3A 3VH4A 1AHPA 2HNBA 4GECA 2ZAGA 2BTEA 2ZUUA 3IULA 1JJVA 4Q4LA 4PX2A 3QF7A 3DBVO 1C7QA 1HURA 2ZRIA 4N01A 3VZBA 2VP2A 4DUPA 2FHPA 5CVJA 4LFBB 4WE3A 2DFLA 1NV8A 3GJSA 1EJ6A 2DQSA 3T0FA 2WA2A 2D0OB 2UKDA 3A11A 4RTOA 1I24A 5HX7A 3C87A 2G0TA 1W5FA 1QX4A 4V0NA 3OLZA 1NDQA 5E3JA 4U3JA 2CNDA 5FX2A 3A6PC 2CMFA 4TVKA 4W9NC 5E0KB 2XMZA 3SQWA 1TK2A 1B6TA 3CF6R 2BGGA 4JCCA 3K2QA 1J8QA 2WJIA 4L4XA 1FNNA 1H05A 2TYSB 5E1OA 3CZPA 5KX5B 2D0IA 3L06A 4LC9A 4ZU6X 4EFDA 4WV3A 4ARZA 3G2JA 4QHTA 1R00A 2QW0X 1CUBA 4MKHA 1FL9A 4MPDA 4P4TA 3X44A 3K0CA 1LRJA 3AI3A 4DQ0A 4H4CA 1I7LA 1TA0A 5CFMA 2ZYTX 1A69A 1P91A 4GBGA 3DHEA 2JFGA 2OORA 1FU7A 4Y0VA 4E21A 1SUFA 1Q0ZA 3I1FA 1W5AA 5FTJA 2BGKA 3IDFA 1CQIA 3B20A 1SEVA 2ZJ2A 2EHJA 5EL0A 3EPHA 1T4CA 4AN1A 1YKSA 1NI5A 2HU5A 4EY3A 4K6MA 4BRSA 1P1FA 3KYJB 1HNNA 2EP7A 2AFRA 2FWPA 4HMOA 2QA5A 2B3TA 3FHLA 4LDJA 4YACA 2PLAA 3SR4A 4HLCA 1GP2A 1M6EX 2YVQA 5CA1F 5C52B 1I2MA 3ANXA 1UM9A 4QOEA 1ZVVA 3KAPA 2W71A 1ZUWA 3OU6A 2UAGA 3R23A 4IIFA 1E5DA 2I6QA 2YINC 3C5WP 3LD9A 4V2UA 1JPJA 2EGHA 2C2HA 1SC1A 4FYHA 1DT3A 1JQBA 2VCEA 1TYBE 1I3NA 1ZESA 2H2DA 1Z0KA 3PUKA 621PA 5EJ5A 2GF0A 3OPMA 3WIDA 4AROA 5K01A 1CJSA 4R2IA 4L02A 3ZJYA 2A0KA 3E23A 1V6SA 2GVDC 4Z0NA 3TCNA 4Y2JA 2Y92A 3JARB 4P7FA 5F2OA 2HO4A 2Q1WA 1CLUA 4CEHA 4I2NA 2XNJA 2ZWIA 4F86A 4JV5B 4P0TA 2FFRA 4LSWA 2J33A 3C5EA 3M1LA 1APBA 2J3HA 3RGWS 1YI8A 4NKRA 2Q3MA 1I7SB 3ZWBA 3IESA 4EDHA 3UUFA 3OZEA 2N0SA 2FPIA 2YYSA 1YQ9A 3B1JA 3I9MA 3EYWA 4ZC1A 2P9HA 2UDPA 3KUCA 4JVMA 3ZHUA 1QTIA 1YVEI 1IAVA 1XN1A 2P6MA 1M2WA 2AN1A 3B5EA 2YWEA 3EE6A 2P0AA 1VC2A 4M53A 4RK7A 3UCXA 5EINA 1PR0A 2FK7A 2JAHA 1GITA 1UBSB 1S4MA 1WSWA 1RKVA 4FLMA 3DM9B 2YL2A 1XCJA 3Q2IA 3QELB 2O0KA 4O1MA 2FN9A 3SVLA 4YVFA 2NO1A 1DIBA 1P5RA 4RKWA 1PZEA 1Q5PA 2B7CA 3O84A 1DSSG 1K2VN 2SECE 1IUOA 5GVRA 2QDKA 3AB8A 1ULZA 1Z0ZA 3MUOA 3U4CA 3VYWA 1HLDA 1VE1A 2P77A 5ICSA 1HNZB 4J8PA 1Q12A 3TLMA 4PINA 5IDQA 3T5TA 2NP6A 3BGDA 1M3SA 3IAS1 1U3UA 5KYUA 4ND8A 1U7XA 2UZ0A 5HTKA 4MOWA 4RW0A 1EU1A 2VT7A 3PWKA 2FZLA 3CG4A 3MCUA 5CHYA 1P45A 4HNHA 2B36A 5GOTA 1LV7A 2FZWA 2O8VA 3QOWA 5ITZB 2MSNA 4X7BA 3WV4A 4BDTA 3S28A 1OXBB 1AM4D 2FZ4A 1NM5C 3HABA 3KYCA 4D6PA 4XRGA 5JSZA 4RFSA 2G17A 3PTZA 3PQ7A 1ORRA 4TOIA 2KHZA 2Z3WA 4OXKA 4RETA 5EE1A 3TLGA 1HT1E 4IJKA 3KXIA 3FOAA 2ODNA 3HNOA 4XFJA 2ID9A 3BWXA 3BA6A 1UWKA 3QVTA 4TUYA 3RG8A 3VR2D 3K6JA 2O4UX 5DI3B 4UJ5A 4ZA2A 3VBCA 4WDRA 3P9ZA 1XLTC 3FSRA 3HYCA 4DR3B 5IJ0B 1KPIA 1PFGA 2ZVQX 5BMVF 4K6CA 3OEHD 2V0NA 4WBNF 2DFNA 4FGJA 4F5YA 5IC4A 1EYZA 4MQEA 3UHJA 4Z7QB 1DBPA 4Q1EA 2YXNA 1XTZA 3OCUA 3ZGNA 3L7IA 4DLLA 2C07A 1XI2A 5HA5A 4XB1A 3OAAA 4DQVA 3CVUA 1CXZA 1I3KA 4TWRA 1HTBA 1YBHA 5BNFA 3PNVA 3QE2A 5IRCD 2R751 3UHFA 1L9KA 3WWDA 3R8CA 4URVR 4TWIA 2HSZA 4ZCIA 3J81A 1I14A 3JALB 5A71A 5KC9A 3U7GA 3IPRA 2H4JA 2NPIA 4GGOA 3E5NA 2HU7A 3ELUA 4E7OA 1IK4A 4U7PB 2HPZA 3RTGA 4CEJB 1XN4A 2G5TA 4BAZA 4DIMA 5JQGA 1O9HA 3AHGA 5EIBD 4AUMA 4PO1A 3KB1A 3SF0A 3K70D 2PX3A 3H2JA 3R6WA 4R7ZA 4PM4A 4E09A 1CTQA 4OJNA 3QLTA 1V5GA 4X00A 3C4QA 4HH4A 4U3JB 2QWXA 3LA6A 3TVTA 1KY5A 2K2QB 3DFKA 3WRVA 2WNSA 3TQCA 2QI9F 2LRHA 2I3AA 3LQFA 4BP1A 3TG2A 4KXQA 3HJUA 4WZBA 3ZWWA 5DNCA 2BL4A 1Y3BE 4CDGA 4CU5A 4MQFB 5LYJA 1UJBA 4QQFA 4CQMA 3K70B 1CERA 4LKRA 1E1QA 3LKZA 3MW8A 5FULA 1OIXA 2NV2B 3C85A 4FNOA 3D3NA 1R0BA 2DWUA 1Z75A 2H08A 4P4NA 4TTJA 4K88A 2I80A 3WGZA 2VSYA 1LLDA 1P0MA 1RQPA 3N76A 3LBHA 5FR2A 1WLSA 4P7JA 1GPLA 1ZN7A 3ZJUA 1ACMA 1G64A 2O0JA 2YOFA 4B43A 2LDBA 4JN6B 5H9VA 4GE3A 2LDXA 2G70A 3ETLA 3U0VA 3VR2A 4CLDA 5KX5F 4BCCA 1GCGA 3ABOB 4J3FA 5AD1A 2Z1DA 3Q5EA 1Z4JA 1SB9A 2AMYA 3FHJA 3NTOA 1Z16A 3H4VA 4IG9A 3R7WB 4CF4A 4JGGA 4HAXA 3SI7A 3C5VA 2VNIA 3P94A 1G38A 2BT4A 3CVJA 4IINA 4JJ4A 1WUHS 3GAMA 3V2UA 5HIKA 1GXSA 1VJ5A 1P29A 5D85A 3ZHSA 4ZAZA 1BCSA 1DV1A 1V96A 2H8GA 3HBLA 2D62A 3OAAD 4K0RA 2QM3A 5JCXA 1VIDA 2PHZA 3O8OA 3KHSA 2COUA 2Q9UA 1LS1A 1GNSA 2AX3A 2I1QA 2PRIA 2OR3A 3TZKA 2ZB7A 4AY6A 3SOZA 3NTLA 2QP4A 4YJ3A 3EPLA 2HKIA 3KYDA 4MULA 2QMQA 1E5QA 1K8QA 1KSFX 1G5FA 3RSFA 3GY0A 3SIRA 1D1TA 1Q7BA 1SZPA 5ICFA 3DG9A 1XXHB 3B52X 2PKWA 5TXGA 3AILA 2H18A 2QXYA 1P2SA 2CXSA 3SS8A 5FOTA 3IX7A 4ASUD 1DRJA 1YAJA 1UXOA 1WMFA 2DMRA 3E18A 3LDHA 4QNMA 5ECYA 3FMFA 5C5IA 1K98A 4PAMA 2BFEB 2B69A 1QFZA 2W8ZA 1WNFA 3H9EO 4RH0A 1H8ED 2F1OA 3HJAA 3M3DA 5KJCA 3SYTA 4A73A 3VSCA 1ECPA 3V55A 1T0BA 4TTQA 4IFTA 4CLOA 1P33A 1RC1A 1T9ZA 2PY6A 3L7AA 2XZTA 3BSFA 4RQUA 3P4XA 4Q7QA 2V6JA 3NATA 1V95A 3B85A 4DYDA 2QZ9A 3IV9A 4QDUA 1OCEA 3BRWD 4Q16A 5CX4A 4GR4A 4JYMA 4YAUA 2PL5A 1WWKA 5A7GA 1ZCAA 3C6QA 4FFBA 5F5XA 4D3YA 1CRPA 3GRKA 5EEGA 1QE5A 4O59O 2YJGA 4YRRA 3AEKB 3CZQA 1RTTA 4BGIA 2D1YA 5KNDH 5C35A 1NJSA 1R6DA 3DAFA 4YMVA 4NCIA 1QHEA 3HB4X 4DSOA 4WASA 4E3WA 3IVAA 5JMTA 2ZXUA 4JODA 3RT7A 2ZYDA 4B3XA 1KL7A 1JMYA 1JDZA 1O3YA 4JEHA 4NYIQ 2WE7A 1DRVA 4EG3A 4CM6A 4EJSA 3ZCRA 4LOJA 5CNKA 2C4UA 4C3VA 1A97A 1R6UA 3C4JA 4IXWA 3TLGB 4RV9A 1OXXK 1IXRC 1TVKA 2WVHA 3M3HA 4MJXA 1XD9A 2A0FA 3K0AB 2QSZA 5B58T 4RTNA 4W7HA 1H2HA 1UQTA 1DAHA 1VA4A 2B20A 3EMKA 3K1JA 3UH1A 4M8SA 3OKPA 2HADA 3D4NA 8MHTA 2PGNA 2HA5A 4HDKB 1T5LA 3W5JA 2V7VA 2WFLB 1N1EA 1KYVA 3IIEA 3MMSA 5EMJA 1UXGA 5C1DA 5HUHA 2PANA 4NX2A 5L6LB 3V80A 3DDZX 1KMNA 5KNDA 3KRTA 3CLUD 2ZM5A 3G9UA 1TEVA 2AYZA 3D02A 1OA0A 3V3TA 3VNSA 1BDJA 4UVDA 1B6RA 2ZJOA 3FX2A 1KYWA 3MT8A 4G0QA 3THWB 3CFYA 1I0ZA 2QR3A 1SM4A 3KBOA 3NC1C 5C81A 5HQ3A 4DMCA 4Q1DA 2ZB8A 1ZVJA 3BF7A 3PQ5A 1FTSA 2WP8J 4MAMA 1FMCA 2R6GA 4AULA 2IHJA 4NNOA 2LNDA 2VHUA 3EVTA 1PS9A 3ID6C 3KDAA 3LECA 4X71A 4BRUA 4QKQA 4X65B 2FUNB 2GD6A 3EGOA 4ODIA 4MQ5A 1XZCA 2ZWOA 3MC1A 4FDMA 4C1BA 1H8EA 5I4KA 1X1QA 1YQTA 3N7UA 2Y68A 4ITVA 1VHTA 1EK5A 1M2HA 1DARA 4BQOA 3CRRA 4EHBA 1YOBA 4B31A 5AVTA 4OKSA 1DG1G 2GD1O 1FRFS 4XFKA 3QLVA 1EQUA 1TB4A 1NYQA 4OCZA 4LMAA 3Q8MA 3N8GA 2B2XA 3BAFA 1ZL0A 3ETDA 4UUQA 4B6FA 1F8FA 1HYQA 4EO4A 1TJ5A 5JJBA 3ZTWA 4PZYA 3R5SA 1DDIA 2WNHA 3JVDA 2FZCA 4J0QA 1BGWA 4QVGA 4AJIA 1KMCA 4CE6A 3KEGA 4U0JA 5B1SA 1KTIA 1J5XA 1GUDA 1ZUHA 1RQLA 4G1VA 4PTLA 4CIYA 1N5DA 2VEOA 1Z22A 1D4ZA 1Z8NA 3MOGA 4W5QA 5KQRA 4FQ8A 4JAVC 5DNEA 3H2BA 4F2PA 4I9FA 4MUEA 4G8JA 1VE3A 4F9FA 3UUEA 1FDRA 3GLRA 4YAJA 5JSYA 2MYNA 4EKIA 1FPQA 4V39A 1HK7A 1Y4ZA 1W5TA 1QGYA 2OWEA 1W1WA 2G25A 1QVWA 4JIGA 4ZU3A 4JI6B 1KQFA 1TF5A 1MT0A 1GSAA 2WAAA 5HIMA 3WICA 2IYNA 3D5TA 3CS3A 4X93A 1RT9A 4QXPA 3WS7A 1L4BA 2WU8A 4PZLA 5EZSA 3AUYA 4UBNA 3HK2A 3P45A 4GP7A 4CEIB 1M34B 1UZMA 1NYLA 4FYMA 5ALOA 4DR1B 3ZJTA 3S1SA 2VSNA 5A03A 2Q27A 3BJIC 2FR8A 2HCTA 1HL3A 2OV4A 4HRAA 4MPTA 3VUFA 2B4AA 2WU4A 1HEYA 3TTYA 1DJOA 5EEHA 4F91B 1E9AA 1QANA 2W2XA 3GA5A 3OBBA 4WKPA 1KK2A 2Z4SA 3R3YA 4ZQBA 4Z4CA 4Z4FA 3WL3A 3JTEA 4LX8A 1VG0B 4MIOA 4GLJA 3OLXA 4QUDA 4DXHA 2FMUA 2GPBA 2YTZA 3AF0A 3IVGA 9LDBA 2QD3A 4Z3DA 1NPTO 2CXHA 4RM2A 1P1KA 4ENUA 1EUZA 3GGPA 4O2AA 4XYBA 5KSWB 1KWKA 3A2MA 3W3AH 1TLTA 4LXHA 3QTTA 3M6AA 4YUXA 5KQLA 1IY1A 3HJNA 1YIDA 4Z7JA 4J1QA 4E07A 5EP2A 1DZIA 3IP9A 2AVNA 1QJ4A 3CLRC 4B5LA 2DERA 3TF5A 4AJ1A 2QU7A 3PJRA 1XPRA 3CWZA 4WZBE 4FMCF 2FN3A 2P2YA 1A5BB 4JA2A 4AF8A 1Q7EA 1PFVA 3HCCA 1DDGA 2JGJA 3FNEA 1ORVA 1Z0JA 3WTBA 2BKUA 4C7XA 3WB0A 1U0LA 4LRQA 3RUFA 3ZY6A 1M2KA 2A35A 1CCWA 1XU4A 1VKZA 1ADGA 3GW8A 3D3QA 5AP9A 3BCUA 1IQUA 1QG0A 1UPAA 2BZ0A 5K8VA 1YJCA 5FWYA 4V2IA 5BV8A 1F48A 3U1TA 3K9FC 3JAKB 1YU6A 2DWOA 2HWWA 3MCTA 4HWTA 4WAUA 1E79D 5IM5A 5LL6P 5EKUA 5KQSA 5KU7A 1ZICA 3R3HA 3UG7A 4JEMA 3T5GA 1UBNA 2OT3B 5JZMA 2W48A 3RFXA 2MYUA 4M1OA 5FWAA 4F2HA 1KDRA 5HMLA 3U31A 2YN0A 2X2EA 3SC2B 5JATA 1IHOA 1SIOA 2CNBA 1T1RA 3HGMA 4QU0A 1PJAA 2ECOA 1K6JA 1THMA 3AFGA 5DTIA 1FMTA 2HMSA 2PKXA 3FFBA 3HWSA 2O8CA 3INNA 1T2UA 1ZR4A 2OPBA 4EG6A 3MINB 1GG5A 1EK1A 2X8JB 1W2WB 3DP9A 3J7TA 2EDAA 3LLMA 3NX4A 2OZPA 1EDZA 2VBIA 2Q4RA 1E58A 1BJKA 3HXLA 5JCOC 3VZDA 2GB4A 5HUJA 4LXXA 1J8MF 4FUTA 5L4LA 3D6HA 3NBQA 1X7HA 2TMGA 3EGXA 1O08A 1PJQA 9GPBA 3IA7A 3TL6A 3IPLA 1M34E 3ZHQA 7MDHA 2VWQA 4ISBA 5CDYA 1B14A 5DLPA 4K9DA 1T9BA 2B6HA 1MB9A 3SOPA 3FWKA 4DSZA 1TEZA 3V7FA 1Y48E 5LBUA 5HG0A 1U31A 1YZHA 4UBOA 4L2IB 3OLYA 4MQBA 4WX2B 5LIPA 3AB7A 3PFHA 2P27A 4UDXX 1N8TA 2BF4A 3R0ZA 5EAIA 4YR9A 2AMFA 1XTKA 5HNKA 1QZTA 4IKPA 3AFHA 2NU8B 5KTRA 1EDBA 2PT6A 3H9UA 3LH5A 3WSTA 5LBIA 2FFJA 3KFVA 2VSOA 4AG5A 4C5CA 4Z1OA 1DQPA 1JVNA 1GPKA 3LT2A 1FSFA 1V2GA 2A7QA 2C9DA 4B34A 3HO6A 4E6PA 3FF4A 2CEAA 4H0CA 1BE0A 1Q0RA 3B6JA 4JJ6A 1R0YA 2PZFA 3RRXA 4GI7A 4I8XA 4BGDA 3OLQA 3FPHA 5L3SB 4GM0A 3EBOA 1XTJA 3ZBUA 4N48A 3EZXA 3JQDA 2QN2A 4MV1A 4QJ5A 2ZVDA 1OFIA 2O07A 3MJHA 2VNJA 4X1YA 4ZZ3A 5THQA 5J2TA 1XTUA 4Q05A 4KRGA 1N5MA 2QUBA 3VGPA 4ZALA 1RRVA 1XEXA 3MM4A 1AHHA 4GYYA 5H0IA 1Z2OX 5ICGA 1QH9A 3A2KA 2FMXA 4G25A 4ETIA 2XCSB 1UDBA 4AY3A 2C2WA 2WVGA 3QFFA 1KZGB 1RLUA 5H83A 4YRLA 3UXHA 3FYUB 1ETUA 1Y63A 2GBLA 1AUVA 1CG6A 1HYGA 2ZITA 1J0EA 5E9AA 3W79A 1FDIA 4WECA 1GCUA 3KU4A 1VLVA 3VSDA 3W9YA 5FKJA 3CLRD 4H3KB 1D2AA 2H9YA 5PGMA 1QU2A 2I78A 3II6X 4MMYB 1EK2A 1YZGA 4GYJA 1B0UA 4OMUA 1SKBA 3L46A 2B94A 2ZPUA 4I9HA 2GEVA 4OP3A 3VTAA 4INZA 2ENWA 2I8CA 3WRYC 4JX8A 1S2IA 1YDEA 2FW1A 4K9SA 5EWMA 3FXAA 5K8IA 2PTGA 2Z6UA 2GZDA 3P9CA 4B4WA 1XNGA 2WJHA 5AKJA 3DZ8A 4OYHA 1V9SA 3RTCA 4LI3X 2EZTA 3KP1A 4FMDF 3O7WA 1VKOA 3I83A 4RSMA 1OXSC 1QS0B 3OECA 3C4VA 3HJBA 4B79A 4BLOA 4OD0A 1QPZA 2G5GX 2P9CA 3PUXA 1UXKA 1E1LA 4G1EB 1KARA 1JTEA 4RADA 2GZ1A 2WUEA 5DX1A 3IVXA 4ZAGA 5IC6A 3RC1A 1QDLB 1AZLA 4HY3A 3IAFA 4BEVA 3QGMA 1S2MA 1XRLA 2OHVA 4H4DA 1DC8A 3D7KA 2HXYA 1M0WA 3JQGB 4DAOA 4GSYA 2GM9A 4QYXA 4YMLA 5EIFA 2H2IA 2G80A 2IXBA 1H6CA 3ONNA 2NYAA 3LFHA 2BFDA 1C5KA 1OWLA 2PWZA 3GJRA 4XIYA 1GO2A 4D4HA 2NOAA 1LTQA 3Q8KA 3AHIA 2RI6A 5DWDA 1JG7A 3PP8A 5C8YF 3B5IA 1PJRA 4KQ6A 5J40A 3AJEA 5BWOA 5JFOA 4ZYYA 1ITZA 2XUQA 3DLPX 1Q1GA 3NV7A 5HDQA 4DCGA 3NHPA 1JLSA 2ZAYA 2ZRGA 1UBMS 3DBHB 3K94A 1L7VC 1XQWA 3OBIA 1AGPA 4C2AA 2Y1XA 5EHGA 4ZARA 5BYJA 3TZEA 1NXQA 4OXQA 4OVKA 4EW6A 3WLSA 4LS3A 4WBSA 1H85A 3C3JA 1PR2A 2C2MA 4WEQA 4ZREA 2W00A 4ZHQB 1WM1A 1IBSA 3UEOA 4PZUA 1C0IA 4B9EA 4GQIA 5DSXA 3I23A 4EYOA 4OTZA 3ND5A 1KY3A 2O19A 1OUMA 3JW8A 4HNVA 5IUJC 4PFQA 3C6YA 2FW7A 1NRJB 3AFNA 1J1ZA 3AR2A 3G2MA 2BR4A 4XOUA 3T9DA 3VVBA 1FE8A 5B1YA 1DEAA 4JP3A 4RFSB 4RUKA 5CRIA 2XGGA 2VZ9A 3RNLA 4FN4A 4M9SA 2NV6A 1NHGA 4GPAA 3G2PA 2YICA 2DUMA 4OIMA