1P4SA

Solution structure of mycobacterium tuberculosis adenylate kinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Studies on Ligand-Free Adenylate Kinase from Mycobacterium tuberculosis Revealed a Closed Conformation that Can Be Related to the Reduced Catalytic Activity.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 49
structure length 181
sequence length 181
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p4sA00
5K8IA 5DIFA 4C2TA 2NZJA 5CM8B 4GRAA 1LNZA 1E0SA 1E9FA 4BLPA 4BEBA 4C3ZA 2ZU6A 2GCOA 1G3RA 3LLUA 3CRVA 4YDHB 1E79A 4NHOA 4C0BA 3VFDA 5KUTA 1WMSA 4C0JA 1GNRA 3K9NA 3BFVA 3THXB 2FH5B 4GFDA 1PV4A 3DKPA 3UATA 4CEHB 2QORA 3P20A 4OK3A 2J5XA 1E9AA 1OXVA 1PLJA 2J7KA 3O47A 3D6TB 2F3TA 5BN5A 2F55A 2QENA 4GDFA 2FU5C 1GM5A 2F6RA 2P2LA 1ETUA 2WKPA 2QPTA 1GZSA 5IDVA 1YR8A 5JBQA 1DAGA 4OHYA 1D6JA 2WJJA 3U61B 2AFIE 5TARA 3T06B 2FPLA 2GEVA 3CWQA 1T3HA 3WYAA 4EJSA 3T61A 1PUJA 1TNDA 4QL3A 3H1TA 5DHFA 3T5GA 4C7OB 4NMMA 2FFQA 1B0UA 2IW3A 4A36A 4DVGA 3E1SA 1FUKA 2GBLC 3KKQA 2EVWX 2ZSDA 4LJAA 5DN6A 5EXXA 3KX2A 4JLAA 1NMZA 1QZXA 2VHTA 3AVQA 2R65A 2C99A 3U3JA 2VL7A 3U2QA 2Q3HA 5FOUA 5TVKA 1KMHB 3IIKA 5IK2A 2FSGA 3QXJA 2O8FB 2ZI9A 4LUCA 4BZQA 1M7HA 1DO2A 1T91A 1XEWX 4I1VA 2CCKA 2IS1A 1IN4A 4I1UA 5EXPA 5DI3A 4URVR 3A1UA 1VMAA 2C9YA 2WIAA 4DEYA 1BS1A 1CJTC 2CVHA 2IEZA 2ORWA 2ODWA 4QRHA 5JMTA 2F9MA 2OT3B 2BMFA 4KLZA 4DRZA 4ZIRA 5JS7A 4D6PA 2PJRA 1XXHE 1ZUHA 2ANBA 2IYTA 4CIDA 1R5BA 1VPLA 1QBKC 2OILA 1GDDA 1KAOA 3PUVA 5EUQB 2PLFA 1FPMA 3B1YA 3VHLB 2ZJOA 1MV5A 1MR3F 2GCNA 5GJVC 1XB2A 2ZS9A 2CL0X 3ZVMA 2O8FA 4Q9KA 2BCJQ 1E1QA 3C41J 1K6MA 2QA5A 2H8KA 4A8JB 4D2IA 4Z51A 3X1DA 1JPJA 1G17A 1Z0FA 3TVTA 2FMXA 4JLKA 2HV8A 3VX3A 1OSNA 3ADDA 1DEKA 1BKDR 1KZ7B 2CJWA 4B44A 1W0JA 3OAAD 5CK4A 1A82A 3VKWA 2ZANA 1E4VA 1Z0JA 2KJQA 4N0DA 4LI0A 1FL9A 2V1UA 2P5TB 2XZLA 2Q9CA 2DB3A 3AF4A 3SBDA 5P21A 3FMIA 4EJSB 1NN3A 2WPDD 5TXGA 3CNLA 4B32A 5HZKA 1EK0A 3QKSB 3QOFA 1Q12A 1U0JA 2B6HA 4PHGA 3PXGA 1SKYE 4TTQA 3KUDA 3RSOA 2IUTA 3RWMB 4OQXA 4UNSA 3I32A 3E5HA 2IWHA 2OO7A 4H9GA 1NKSA 2ANCA 4IDHA 1NVUQ 5AJYA 4C0LA 1MABB 4NL4H 3T35A 1SZPA 3QPVA 3BB3A 2JGNA 3MWYW 4UKDA 5FH9A 1MH1A 1KI6B 2J87A 4MRPA 1CBUA 1SXJB 5J40A 5GADl 2AX4A 5FUXA 1GNQA 1NMXA 3DDCA 1F2UB 4XTCS 1A2BA 2I1VB 1Q1ZA 2HXYA 2Q6TA 1S4QA 1T8TA 4PR0A 3B5JA 3WRYC 2CCGA 4P3YA 4ESHA 2QL6A 3HU3A 4JLNA 1KY2A 2DY1A 3T5DA 3TSZA 2EWVA 5D3MB 1UADA 5FPKA 4XOIA 1N6HA 2P3SA 4DDTA 3T1TA 2GRJA 1DOAA 3VQTA 4RKFA 1GWNA 1AKEA 1G19A 2F43A 2FOLA 3OIYA 4IXNA 4NYJR 4Q66C 4RZ3A 5GJCA 1D2MA 1G1MA 2BMDA 3UK6A 1OF1A 4M21A 2ZIAA 3QNUA 1VYTA 2WWYA 2GAAA 2J7PA 3CH5A 1TTTA 5TY0A 2N1BA 3W6OA 2CK3D 1KHTA 4FMCB 3CNOA 4TT3A 1TQ2A 4PHTA 3BOSA 4KYIB 3MWKA 1UPTA 2R44A 3CPEA 1KOFA 4A8JA 3ZIAD 3KKNA 2ZI7A 2C98A 2P0EA 3OE7A 3PUYA 3QKSA 1N6LA 3CRRA 4V02A 5KOYA 2O0KA 4NE2A 4X8MA 1P72A 4XJXA 4HUQA 4ABYA 3EPLA 1U0HC 2CL6X 2VF8A 5E4FA 4B3BA 5F98A 2D7DA 4UNRA 3IPXA 5CYOA 2XSZA 1TF5A 1Q1QA 3BB1A 4IOMA 3B6EA 1GUAA 4HAZA 2DYKA 3BBPA 4ZI2A 1CLUA 2VP4A 1E4YA 2YWFA 1OHHA 4HDCA 3PUZA 3QJYA 4C0AC 4HYYA 3KKOA 2HCBA 4QNMA 4LJ9A 1S3SA 3TAUA 2G77B 2JJ2D 2DFNA 3R9IA 3B1XA 4I1SA 2RKOA 3PR1A 4P4UA 3N5CA 4PPFA 5B30A 3PUWA 1RRPA 2Z5FA 1XMJA 4BLQA 4A2PA 4A0GA 2BVNA 1BYIA 5L3SB 5FUYA 2PH1A 2XGJA 4KAXA 1KDPA 3AP3A 4JVMA 1BMFA 3GJ0A 1NG9A 2Z4RA 3EIEA 1RPZA 1NSFA 4PC6A 4AG5A 1RZ3A 1EFUA 1ZJ6A 5JHHB 3IPYA 1NNEA 5FTKA 2ZREA 2EW1A 2CLSA 2YOHA 1ZVQA 4UQOA 3UXMA 4Z8XA 3VTKA 2OBNA 1SHKA 2A5JA 3VHXA 1KKLA 1ANKA 1JQJC 2QRZA 2JLUA 4TQ9A 1XTRA 5C2JB 2JJ2A 3B9QA 4CDGA 1E2JA 1UKYA 4HUQB 1D2EA 1P2VA 4RJLA 1E2IA 3ZZ0A 5C46F 3MG9A 3FHTA 1W36D 2ECKA 1Z5ZA 4JL5A 4QG7A 3RRYA 2QTHA 1KK3A 3ECCA 3C5CA 3WYFA 2PMKA 1HTWA 4MQBA 2QSYA 2ZRBA 1OPXA 1NKTA 2RGAA 4KVGA 3DL0A 4YC7A 1S1CA 4PANA 1WE2A 2W6JD 4FXPA 1CKEA 2FEOA 1WXQA 4A0HA 4OI4A 3T1QA 1N6KA 3ZH9B 1EX7A 1X86B 4ILEA 1VG1A 1NVVR 4AKEA 4KV9A 1E2GA 3KXLA 5A5GA 1RKBA 1GNPA 4PSKA 3GLFA 3EPHA 4M1OA 4DB4A 3ZS9A 1ZIPA 2H18A 3I72A 4BFTA 3JVUA 1HUQA 3W9YA 2WKQA 5C18A 4RFSA 2HYIC 4JL6A 2B92A 2ONKA 4IEEA 3OEHD 1E99A 5B64A 5G40A 3GJ8A 2NO9A 3TUZC 4PZZA 4TZ6A 4BWYA 3UANA 2QROA 4OI2A 4O3MA 1RJ9B 4RD6A 4P4SB 1Z0IA 2Q3MA 1Z08A 2I3BA 1UKVY 1YZUA 4TMTA 3SFVA 1SVWA 4Q7KA 5FL7A 1D8TA 3SJCA 3EA0A 5J4VA 2FX3A 2RHDA 4LBWA 1KI1A 3TLXA 1T9HA 1R7RA 4QXAA 4NCNA 4TYPA 4BLRA 4Q19A 3ZIAA 4IKEA 4DT1A 3L43A 2D2FA 3LXRA 1Z63A 1ZBDA 4Q7LA 3EIHA 4FN5A 5LB2A 4KCGA 1KI2A 2CXXA 4G0NA 3M0EA 4S2EA 2OCPA 3NBZC 4V0ME 2QP3A 4YQFA 1G6OA 5JJLA 4EPVA 1G5PA 1KO7A 3NEYA 1IXSB 4MRRA 2XNSA 2LWIA 3TW8B 4LJ6A 2CJWB 4PAQA 2GXAA 2ZM5A 2BEJA 3GLGA 3GJXC 5JSZB 1JAHA 3TVDA 4B6FA 4PAMA 2QAGC 3P4YA 2F3RA 1IN8A 1XJQA 3AVPA 4EFLA 4DDWA 5AUPB 5FUVA 5IRCD 2OZEA 4MUBA 2V55B 5JECA 3C8UA 3CF6R 3AF1A 2CNWA 3ICEA 3OFNA 2HT1A 4U02A 4WIAA 4BFSA 3LQQA 1N5JA 3NHAA 2QTFA 1CF4A 1SVIA 1YJ5A 4FMDB 4Q47A 4LRWA 4TQAA 1E1RA 4GSYA 1YZLA 3UWOA 4TL6A 3VKHA 1VCMA 1JEEA 1OHHD 1U99A 2RGCA 1Z0KA 2ZRAA 4PQRA 4QBIA 4D82A 5L3QA 1OXTA 4HB2A 2JLRA 4QFMA 4D4KA 3MD0A 1XEXA 3R20A 4JBWA 1XEWY 2G88A 2V4ZA 3ASZA 4NCJA 3BFXA 4P33A 2FA9A 4POAA 4E22A 2IS6A 4TLAA 4EPTA 4JLOA 4TMKA 2PT7A 5KSPA 4Q48A 3THOA 2BC9A 3BH0A 3NBYC 2ZRGA 1HYQA 2DR3A 1L2TA 4M53A 3A37A 2ZAMA 4F91B 3ONWA 5CIQA 3U44A 3ICQB 4AI6A 4FD2A 4QNRA 1OIWA 1W36B 4ZV4A 1UBEA 4Q03A 4Z1MD 4P31A 5FBQB 3KQLA 2BJWA 1MO4A 3ZZUA 2OE2A 1GKUB 2BJVA 2ZPTX 4F7WA 2ZRNA 1NI3A 3B82A 4F93B 4W9MC 1S9DA 3VR3A 1OKKD 5AK0A 2GF9A 2WWWA 3K0CC 1RRCA 4F4JA 3W5IA 1CR2A 4A92A 2C95A 3MWLA 1S2MA 3HR7A 5TMPA 4K46A 2CE7A 4ON9A 1I2DA 2IHBA 3A4LA 3MMPA 2NMVA 2QU8A 4EIWA 3RANA 1G8FA 3MSXA 1G41A 3R8CA 5EE3A 1ZD9A 4AYWA 1Q1EA 3KXIA 3CUEF 3QIAA 4CF7A 2F43B 4NONA 4MYTA 3IDQA 4XWAA 2WKRA 5D3MA 1QHNA 1G64A 2V6JA 1YR9A 1ZRHA 2GWHA 2REBA 2QI9C 4MGIR 3THXA 3IHLA 5LD2C 2BV3A 1U8ZA 4LYJA 2HLDD 3EW9A 5L3VA 3OZXA 5J4LA 1NG1A 2BMJA 5FFMA 4B2PA 2IK8A 2ZVPX 4X8OA 4CRWB 2IA5A 1VYVA 4ACAA 4IDPA 2OXCA 3IHWA 4DCTA 1R0YA 3I73A 4B71A 1KTVA 2GF0A 4BGDA 4A0FA 4JYCA 3HYTA 1FQJA 2ATVA 8OHMA 2R6FA 5JS8A 2YYZA 4GNKA 1CJVC 5BN4A 4QBGB 4PZYA 2O52A 3RDPA 2OFOA 2HJGA 3WNCA 2VBCA 3Q72A 3GJ3A 1YZGA 4KI0A 2XXAB 2KE5A 4WZAE 6Q21A 3LX5A 1ZUIA 4JLDA 4DLWA 2H16A 5JJIA 3MRSA 1W46A 2R2AA 4FINA 3WYGA 5KSZA 3K9GA 4LBVA 4BQSA 2QM8A 1TF7A 2R6DA 4LX0A 2WJGA 3KFVA 1PLKA 4C0HA 3BC1A 1OH7A 1G3UA 1Z6AA 3LLMA 4WA7A 4IVPA 3ND9A 2RGXA 2JLXA 1E9BA 2H5EA 1KSHA 4ARZA 1IM2A 4M1SA 3SJZA 4QBFA 3RS7A 3E70C 1KAGA 5B2ZA 4ZPXA 1W7AA 1E2FA 2IT1A 1W4CA 1XMVA 2GVDC 4RCZA 3K0EA 3NKVA 4H1UA 4LHYA 5GJWC 1HQCA 5KDLA 1KMQA 2V8OA 1R8SA 5F9FA 1JB1A 2JJ1A 1M7GA 3GCGA 4L4UA 1AM4D 2AK2A 4BRWA 2FPKA 4PC1A 4US0R 3AF0A 3HU1A 4JKIA 3GFTA 3ZS8A 4HAUA 3GLIA 1P62B 1DS6A 1XBTA 1L4UA 1DADA 3L0SA 1DARA 3VU9A 4RCYA 4HEJA 4C2UA 5J4HA 2BHRA 3MGCA 2VSFA 5IT5A 5KNCA 3ZDQA 2I4IA 4XD7D 1YZTA 2DFTA 1FOEB 1WCV1 2IS4A 1MO3A 4L16A 3TW4A 4II7A 4V0NA 3SFZA 4ZKDA 3OIWA 4PQYA 3QG5A 1CXZA 1E94E 1SKYB 5CYPA 1A4RA 3PEUA 3EPKA 5A0FA 4V0MA 4F4CA 2K5UA 1TQ4A 1ZM4A 5SZIA 2QGNA 4M1MA 4LV8B 3SHWA 4B75A 2BM1A 1V5WA 2NO1A 5E7JA 4Q7MB 1YR7A 1SVMA 1Z2CA 3NVAA 1KYIA 2Z4SA 4ASUD 2FDCA 1MRNA 2D06A 2FSIA 1W47A 2MSEB 3AGQA 3FWYA 5JWOA 3PFIA 4O2RA 2NPFA 4JLPA 4LOAA 1UDWA 2YC4C 2G6BA 2RAPA 3GLGB 2DWOA 2FFBA 1C9KA 3IIJA 2ZE8A 1VCIA 3ZGXA 2WWXA 4OQNA 3RRMA 1XCPA 3RWOA 4TLEA 1LF5A 1US8A 1GTVA 1KI7A 1LB1B 2W00A 3Q3JB 2ZRPA 3PV0A 1UBCA 4TLDA 3IQWA 4TYWA 3B1VA 2G0TA 3DMDA 3FHOA 1J8YF 1G18A 1E1RD 5EZ6B 4KFSA 2ZS7A 1M74A 1WP9A 4EQ6B 2B21A 1CIPA 5DH9A 1G20E 4HB0A 2XOKA 4LJ7A 2JLYA 3PITA 4KO8A 2O0JA 3CLVA 4UXIA 2JASA 4TL9A 1U90A 3IEVA 4BRUA 3R7WB 1KNXA 1ZP6A 4AY2A 1U2RA 4ZDWA 4DWJA 1SVKA 1SXJA 4R71A 4A2QA 3CX6A 3FGNA 121PA 2WSSA 3B1ZA 4JVNA 1IJFA 4LHXA 1N5IA 3G5UA 5KHOC 2VLIA 5H68A 3IEUA 4NBSA 4D0LB 5AJWA 2QPAA 4RFSB 2QTVB 1HE8B 4PSVA 2VO1A 1W0KA 1XWIA 2AFHE 4E5UA 1E9EA 1E69A 5HKKA 3TSWA 1QG4A 2GETA 3O8BA 4IDOA 1WBBA 5DNYB 3AVUA 4TWZA 1JJVA 2VHJA 4RZUA 4EFMA 3JZMA 4PC7A 3BK7A 3U7EB 5JZVA 3N70A 2IYRA 2QY9A 2OCAA 1HV8A 1NL3A 1S96A 3EG5A 4ZCMA 1M6NA 1ZNZA 1GFIA 3SR0A 1R10A 1OFUX 4DLZA 3HDTA 1R6BX 4URZR 2RGDA 3L0PA 4JJKA 3U4QB 5EXTA 5BWMA 4LV6A 1R0ZA 3HPRA 1Q22A 3AKYA 3VR5A 4NYJQ 4KFTA 1FMJA 2KI5A 2XAUA 1OYYA 3ZQ6A 3I5XA 1EWQA 2ZRFA 1NJGA 1BIFA 2F1RA 4PO1A 2FZLA 1JR3D 1L4YA 1NN1A 2IF2A 4TLCA 2VPPA 2Z0MA 1NBMA 4QM6A 3QG1A 4LYHA 3W6NA 4RKEA 2QSZA 3DM5A 2W58A 1ZC4A 2WMOB 2PX0A 4IFEA 4LYAA 2Z6VA 2VIIA 3P1JA 4MGYR 4QHSA 1DPFA 3C4JA 2IYQA 4M9XA 1X1SA 1KKMA 2O8CA 2GXSA 3EIQA 3F8TA 2ZRLA 5UKDA 1OFHA 3FPAA 1SVOA 3GQBA 3QF7A 4KJZA 2HF9A 4M1KA 4V0OA 1HURA 2QAGA 3B2EA 3W90A 1I4TD 4DDUA 4ITRC 1R2QA 3U3OA 2AD1A 2Q0HA 2BCGY 3V4FA 3SS8A 4I99A 621PA 4CYMA 4M4SA 3FKQA 3OESA 1G4AE 1HEIA 3QY0A 4M1TA 3RLFA 2JA1A 3K9LA 2GZAA 2ZJ8A 4FWIB 1G8HA 4LSGA 4O0MA 4PXAA 2ZSAA 3O8DA 3U7HB 3GEEA 4G1UC 2FNAA 4M1WA 2EYQA 2XITA 1Z28A 3EWSA 4B76A 1KI3A 1VDZA 2FEMA 3CNNA 5F2EA 1T8UA 1TPZA 3DOEA 2DWPA 2ZETA 3D8BA 4OYHA 2ZRCA 4RVCA 1P9NA 1C1YA 4GP6A 2ZSFA 4AKGA 3AQ4A 4X8HA 4GT1A 1R0WA 1IN5A 3LXXA 4HZUB 4ZDIA 4B73A 2XXAA 1E98A 2ZYUX 2OLKA 5SZJA 2JLQA 1Q20A 1D5CA 2X77A 4XH9B 1QRAA 4FMBB 5GVRA 1KO8A 1Q3HA 1XTJA 3CRW1 2YWGA 3LX8A 4E09A 4JYBA 2ZRMA 1VG0B 4Q4HA 5EP1A 5CDFE 4Q00A 1F48A 2XTNA 4OI0A 4HAXA 4Q1BA 2Z83A 1T0JB 3RRNA 1KI4A 3KL4A 4RD2A 3WXMA 4FW9A 1JJ7A 4YDSA 1WB9A 3QKTA 3CBQA 2AKAB 1SVSA 1KDOA 3B9PA 4XSHA 3IQXA 5C4GB 3SI7A 3TNFA 4DXAA 4TMWA 3QI2A 2J0UB 3FKSD 2H1LA 2GDJA 1HQYE 4IHQA 3LFUA 2GJAA 1I2MA 1CRPA 5J5CA 1WF3A 1XF9A 2WSMA 1DTSA 4J0QA 4R9UC 3QEOA 5FPSA 4B35A 5EXSA 1QHIA 2N42A 2D3WA 2ZJ5A 4XWOA 2QE7D 3EZFA 3P4XA 4NP6A 2HYDA 4DKXA 2W2TA 4TT3D 5HKKD 1E9SA 3QKUA 1XMSA 4HB4A 4K81B 4PPQA 2V7QD 1YZQA 5LB4A 4ZDKA 3WMFA 1F2TB 3QKRB 1F60A 721PA 4URYR 2J45A 2J3EA 1TUIA 5FBWB 2UKDA 2WWHA 2WOJA 4DDVA 3PJRA 2PJZA 1RVDA 4ERNA 4AKHA 3QENA 1IAQA 3NC1C 1KIMA 2IHYA 5E7MA 3EC1A 3EX7C 3TMKA 2C9CA 1UF9A 3I62A 4KHZA 3KZ1E 5FOVA 3KJEA 2KSQA 2GEUA 2YOGA 5C4MA 5JI2E 1OFIA 1W0JD 3OAAA 4US2R 2ZJ2A 2Q3FA 5JWHA 2ZJBA 4XTRA 4L8GA 2ZUDA 3ND8A 5FOXA 2IS2A 2A5GA 1VKJA 1KSFX 2IUUA 3LBHA 3CZPA 1IN7A 2R6GA 3CW2A 2R6CA 3LD9A 1EG7A 2W6IA 4UJ5A 3N2EA 4QHYA 4S35A 4LV5B 2GJ9A 4DLSA 3I4LA 4UNQA 4GBMA 2HJVA 1XJCA 4C0QC 1W4AA 1ESMA 1T0HB 5IHPA 5FBRB 3GLIB 4DLTA 4IFBA 3FOZA 4TL8A 1X3SA 1NBMD 4IJMA 4A6XA 2JLVA 1EXMA 3KXKA 5FI1B 3Q5EA 1X1RA 5CK5A 1E2HA 3BWDD 2DFLA 3IKJA 4LYFA 2ZE6A 3SOPA 2ZJYA 1U81A 3A36A 1AKYA 1PZNA 3EC2A 4MKFA 1H8HD 3UIEA 4A8JC 2O8EA 4XVUA 1TU3A 3A4MA 4JLMA 4U5XA 3QUSA 5F3WB 3RABA 3HJNA 5EQTA 2GVZC 1RIFA 5AJXA 3M1IA 1JBKA 2FGKA 4TL7A 4URWR 1COWD 5KDDA 1TF2A 4UXHA 1R5NA 1E9DA 2IXGA 3LVQE 3U3KA 1YRBA 4MITA 5CM9C 2WWIA 4QHTA 3X1WA 2ZRIA 3C15C 1ZD8A 5FUWA 5EE5B 1E0AA 1T5IA 2VH5R 1FNMA 4P32A 1NVVQ 4ZI3A 3VNUA 3B85A 3FE2A 4GPTA 2XTZA 1CS4C 4LZZA 2GAOA 1ZYUA 1KI9A 1FNNA 2FFHA 2C77A 3ZVRA 1A2KC 4R98A 4W5JA 2OCBA 5DYGA 4RD3A 4GZMA 3NBFA 5JEEA 1NSTA 2CLDX 3THYA 4DCUA 1F2UA 2BKEA 1LS6A 2W2XA 2WIBA 4HB3A 4A2WA 1ZC3A 4F38A 2MMCA 5JRJA 3THWB 4C4PA 1XTIA 2ZI5A 3SNHA 2ORIA 1F6BA 1VCOA 1TL7C 1VHLA 3AP2A 4JVSB 1MT0A 4RD4A 5KYKA 1BH2A 1F5NA 1Y3AA 2ONJA 3UMFA 4LK2A 3CM0A 2H17A 4K8OA 5JLJA 2PL3A 2BKUA 1SXJC 4JSYA 4OHVA 4B3GA 3IO5A 2NIPA 4NCKA 3U7GA 2ZE5A 2J0UA 1XCGB 1AGPA 2QQ0A 3KKPA 4WXRA 1Z8FA 2ZAOA 4HZUA 2J0QA 4OI1A 1P9RA 4W5HA 1N5KA 3PEWA 2CEAA 4D81A 1GOTA 4BUJA 3BERA 2GXQA 2IX3A 4OHWA 3KQNA 3EZ6A 1AS2A 1FZQA 2ZSBA 3S1AA 1YE8A 2O0HA 1IXRC 1XU4A 2D62A 2TMKA 3TIFA 4UNPA 4BLSA 1CP2A 2GILA 3CF0A 4LHWA 3AV0B 4JBYA 1G8GA 2RHMA 5FOTA 4IOLA 2QMUA 4UXJA 1N6NA 4OQMA 4Q1FA 1W2GA 3OIUA 1JAIA 1QHYA 2ORVA 2PLRA 4G3XA 4XD7A 5CITA 5EE9A 2FSFA 3CRQA 4B2LA 2VHQA 2Q9BA 2W83A 2JLZA 3UG6A 1YZNA 2N46A 1S1MA 3A8TA 5EP2A 1EFRD 2ZVQX 3ADBA 4MDEA 4PHFA 1NIJA 1OIVA 5HE9A 4PFSA 4BFXA 4ASUA 4TN1A 5L3SA 1VG8A 2A2ZA 2PZFA 5EE1A 4CEIB 4LBYA 2KWIA 4HAWA 4XVRA 2J7PD 1JALA 1Z06A 4EUNA 2BM0A 1HE1C 2ZYTX 5HCIA 4BFVA 3CO5A 5E3HA 3R9WA 2ZJAA 3SQWA 5L3QB 2NZ8A 5HPYB 1P75A 1NF3A 3FYHA 1QHSA 2GA8A 4L15A 5GJBA 3EWAA 2VA8A 4KBFA 3D31A 3ZJYA 4EJSC 4D4LA 3K70C 4YONB 1ZCBA 1XMIA 1HH4A 3A1SA 4MH0R 1EGAA 4PTLA 1GILA 1IHUA 1KJZA 4QJ4A 4R7ZA 4RY2A 3JVVA 2QZ4A 2IUSA 2VYFA 5BYJA 3CONA 1X6VA 1KK0A 4Q02A 4TQUS 5M04A 4Z1MA 4EKDA 2NOAA 4EPWA 1ZU4A 4EFNA 1EESA 3TRFA 4F4IA 5JFGA 4HI0E 4DZZA 2G0NA 4DLVA 1EFRA 1GKIA 1P2UA 4BASA 4BZXA 3VR1A 5JRZA 3IIMA 1NN5A 4QGGA 3U6BA 3SBEA 5HZHA 1II8A 2WJIA 2IYYA 3DVLA 4XWKA 1G291 3FDIA 3AEZA 3GEHA 3PCRB 2X2EA 2HF8A 4M22A 4CVNA 1EX6A 1Q3TA 1COWA 4LDJA 2IYLD 1TU4A 3PVSA 4BFWA 3TJZA 3CPHA 1AZTA 1NY5A 3AKDA 1QG2A 3OEEA 3NDBB 1G7SA 2AR7A 5CLLA 2WSSD 1KO1A 4P0TA 3MJRA 3TR0A 3RS4A 2WHXA 1FX0B 1OW3B 221PA 2RB4A 5H70A 3REFA 4I81A 4JMPA 4NCIA 4C30A 1OXSC 3SYLA 2A7QA 1HT1E 3DMNA 3H84A 5ELXA 4HLDA 3BFKA 1NVXQ 1RJ9A 1M7BA 4GOXA 1P2TA 2AXNA 3CRMA 2H7VA 4E07A 1GP2A 3THWA 4OHXA 3H2YA 3VR6A 2FF7A 4GMXA 4Q1CA 4N0EA 4AWXA 1WA5A 1R0XA 4R2IA 1RFLA 1ZUNB 2YVUA 3RS0A 1EFHA 1KSJA 4WW0A 4BZPA 1AS3A 4X8LA 2VQSA 4A9AA 4EQ6A 3H86A 2ERXA 1FW6A 1AQYA 4M9SA 4Q18A 1RC8A 4OQFA 2YJTD 4LPKA 1XNJA 3ZYCA 5AWFC 4TTRA 1NIPA 4KSCA 3KUCA 3V4RA 5G3ZA 2CLCX 3W3AA 1JQLB 3HYRA 1U9IA 1G7CA 1ZM7A 4AYXA 1SGWA 3C7KA 2OAQ1 4KU4A 1XDBA 3FVQA 5DE3A 1YQTA 1TQDA 4AKIA 2WAXA 5DGXA 4UNNA 4OQLA 1II9A 4EDHA 1GRQA 1Q44A 4JLJA 5LDDC 3H4MA 2ZQ5A 1OKKA 4A1FA 3V9PA 421PA 4DSTA 3LBNA 4GP7A 3TKLA 1OH5A 5BW8A 1S9HA 3K0CA 1ZCAA 2R8RA 3MAAC 3QSYA 1E2MA 2EYUA 5KNDA 4QOSA 5FI0B 1XP8A 1XJ0A 1FTSA 2XZPA 1P6XA 3K70D 4FMDF 5HE8A 4ZIRB 1OH6A 1GRNA 1IY0A 3AF2A 2ODBA 3EXAA 1HA3A 2CHGA 4MRNA 3A1VA 2O8BA 4TYNA 2FPMA 4QGHA 4AD8A 3GLGE 5JHGB 3OIVA 3RC8A 2AWNA 2ZRJA 2QMOA 2ZE7A 2P6NA 5TDHA 4D0NA 4TMXA 2RGNA 4NKRA 2HUPA 1F3OA 2FWRA 4TLBA 4ARZB 2A3RA 1N6RA 1TUEA 3BIFA 4LJYA 4MRVA 3NEJA 2VEDA 3BRWD 1GL6A 2V1XA 3VR4A 1G3IA 5DI9A 3PEYA 2GJ8A 2ZRKA 1N6PA 1PVOA 2CDNA 1UFQA 4RFVA 3GJ7A 4NPHA 1FTNA 4JKYA 1PLLA 4IDQA 3VR2A 4N3NA 2W2VA 2JAQA 4TSFD 2P6RA 5BQ5A 2QNRA 3B8HA 1IONA 4IOJA 3BJIC 2P5SA 4V03A 5FR2A 4LC1A 1KJWA 5JSZA 3VX4A 3HR8A 4MRSA 5AJZA 1WQ1R 2PCJA 4CEJA 1JNYA 2BWJA 4DIDA 2XJ9A 4ZCLA 1ELOA 1GSIA 3FB4A 2P6UA 1G16A 4B33A 4IEIA 1JR3E 4JLBA 4C0SA 5KU1A 3OF5A 2CVFA 3SJAA 2WAYA 3U3RA 1WBDA 1OE0A 3EAQA 3S1AB 5AUQA 2VP9A 4XSGA 4CEHA 1M8PA 1ZM2A 2QT1A 1ZAKA 2VHCA 4G5GA 3EASA 4OBEA 3R7WA 1G5TA 4P4TA 4MUAA 3P32A 3IILA 4L9WA 1YR6A 1EFTA 1XPUA 2BBWA 2NPIA 2AXPA 3FMPB 1J99A 2FFAA 1NVWQ 2V9PA 3KJGA 3NXSA 4RSGA 5B57C 3UMRA 2L0XA 1E2EA 4PPNA 4TYYA 1ZM3A 1RE0A 2CHVA 2IYXA 3CPJB 1KI8A 4E03A 1KGDA 4YXWD 3I61A 2ATXA 3LW7A 5EUMA 1NMYA 3BAFA 4GI7A 1BMFD 4TSFA 3TH5A 3QF4A 3TUJC 1T3SA 2ZR9A 3EA5A 5KNBA 1H8ED 4ZO4A 4LWZA 4L9SA 3HPQA 4WZ6A 1RW4A 4DUGD 4Q4LA 3VMFA 1KDTA 1JXOA 4G5OA 2QG6A 2VP2A 3MCAA 2OCYC 5J47A 5SZKB 4MGKR 5EZ5A 3K53A 2ZR0A 2YINC 2XJ4A 4WAUA 4QGFA 2YKGA 2WVJA 1XD8A 4ZCIA 3QXSA 3A6PC 2VSOA 2C03A 4BECA 1Z6TA 5E7IA 2OESA 4LJ4A 3GLFB 3U5ZB 5K8TA 3Q9LA 4OJQA 3SEAA 2Q9AA 3BD9A 4Q5IA 3L82B 5IF9A 3FKSA 5LBIA 3OFND 1SXJE 1H8HA 4DLUA 4DUGA 2JLSA 2A9KA 3PENA 3OE7D 5CJ2A 1E2LA 1E0JA 1M1YE 1TADA 4OHZA 2QE7A 2HDNB 3REGA 4FI3C 4FMCF 5CJPA 1YZKA 3TAHA 4Q21A 4W7SA 3RS3A 4NTZA 4ZDJA 3BXZA 1I4DD 1GVNB 2W6JA 4D4JA 2IXEA 5FR1A 4QGAA 4B3CA 2KBFA 3ZLJA 1DAHA 3I8XA 3KDSE 4OK5A 1I4LD 1ZNWA 1H65A 1E2KA 3GJ5A 3FMFA 1TEXA 3BGWA 2WPDA 4JT2A 2CHQA 1E9RA 4C0KA 5DLQC 2VP6A 1OXXK 1Z6GA 3GD7A 3CF2A 2PEYA 3QVVA 3KQUA 1E2PA 1ZIOA 4M9ZA 2QT0A 4D80A 2YOFA 3D7MA 2XOKD 4Q1AA 2ZYVX 3QEJA 2CE2X 4DSUA 1FQKA 5BXQC 3M6AA 1LTQA 3N2IA 3LQRA 4PHHA 1XEXB 2J0VA 3GEIA 2QP9X 4RZ2A 3A1WA 2DPXA 3QPWA 2D74A 4O2LA 1P9WA 5DYIA 4MGZR 2GTPA 2O5VA 1ZW6A 2O8DA 4Q9JA 4HZIA 1W44A 1GIAA 2OAP1 1FP6A 5FOSA 4B74A 2NQ2C 2CMKA 5DHAA 4DIEA 1IJEA 1OV4A 2H57A 2YV5A 3W5JA 1LV7A 4Q01A 4MDFA 2FZ4A 4A82A 1Y63A 1OJLA 2WJHA 4U00A 1EFCA 2ZSEA 4F92B 3PUXA 2BBOA 2ZYWX 4NZYA 3WP0A 1XEFA 4JJZA 1XD9A 2JLWA 2V54A 2ZI3A 5JJKA 3NBXX 5KSYA 4NCHA 3AUXA 3GLIE 4YXWA 3AB3A 4IRUB 2UZ3A 4PO9A 3OHMA 5FTMA 4DBLC 1J70A 2WWFA 1DE0A 4LJ8A 1NLFA 1MO5A 2QMEA 3K09A 4JS0A 4B47A 1DG1G 1E1QD 4NYMR 3I1FA 3UKDA 1Z83A 1DG3A 1K8RA 2RGBA 2ZTSA 1CEEA 5FTLA 2G83A 1UDXA 3QXCA 1G3QA 3T12A 4G01B 3TQFA 3ADKA 2XSZD 4Q4JB 1IY2A 2OUKA 5CDFA 4D25A 3CR8A 4OJKA 5E95A 4YMVA 1J90A 4CT5A 1JR6A 2IXFA 2F1HA 1C4OA 3WNDA 1QHXA 1H8EA 2YWHA 1Z2AA 3LBIA 5TV2A 1LFDB 4U7DA 3AVOA 3B13B 2WV9A 1XFAA 2Z43A 5FTJA 2XTMA 5K8UA 3HU2A 3SHFA 3G82C 2QGZA 2VF7A 5J4KA 4CGZA 4RD0A 3HWSA 4ESVA 3LDAA 1UEJA 4Q4HB 1KZGB 1FUUA 5FPHA 4DHEA 1DAEA 3SN6A 1T6NA 3CKLA 4Q9LA 1AJEA 4MA4A 1TQ6A 4CEJB 3X1YA 4MYUA 2JCSA 1DAFA 1N2CE 3B1WA 3W6PA 4LHVA 3GPLA 5H8WA 1PJRA 3LH5A 4HDOB 4US1R 1D9ZA 2PCLA 4TYQA 4YLGA 3F3YA 1OT3A 4B6EA 521PA 1XPOA 2J0SA 2EU8A 3ZZTA 1E6CA 2KBEA 2JDID 3GJ4A 4WVFA 2ODNA 3E2IA 2QQEA 3RAPR 5JCZA 3WBJA 1NP6A 2I1QA 2WWGA 1W4BA 3CZQA 2CL7X 2O8DB 1NLZA 3DHWC 1RYHA 2R9VA 2P67A 3FFBA 2J59A 3AVVA 2UZIR 1RRFA 3LW8A 4H1VA 2JJ8A 2VSXA 1HT2E 5DSZA 3QE0A 3M4YA 4HDQB 3MUFA 3BH6A 4IDNA 3L8YA 1MKYA 1M34E 2JIZA 2OFXA 2OM2A 1G8PA 2AKYA 3SQXA 4FCTA 1KK1A 3IBYA 5TB5A 4BE7B 1P4SA 1W4RA 3IBGA 2NGRA 4L5BA 1OXUA 4HATA 4DSNA 1E96A 1R4AA 2F9LA 5JI3E 2ZEJA 2BOVA 2QBYA 2GXUA 3Q7QA 5KSOA 1ZU5A 4NYIQ 4PZLA 4PPGA 5HR5A 4JT4A 2FGJA 1YVDA 2Q21A 1KMHA 2YHSA 2OFWA 2WMNB 1ZD1A 3RS2A 4IXMA 2MSDB 1NBME 2H92A 1UKZA 3DOFA 3K8YA 3K0AB 3QXHA 3DKVA 3CIOA 4KBGA 1GAJA 3KB2A 5CIWA 1IOZA 3EZ9A 3LV8A 3SZRA 4B3XA 2X1VA 1UAAA 1CR4A 3WNBA 3GMTA 1OLOA 2MMGA 1LY1A 4KSBA 2GBLA 3K70B 4DT1B 1AN0A 2QM7A 2F1IA 5BN3A 1SXJD 1LVGA 2C2HA 2RGGA 1WRBA 1YKSA 4HUTA 1W2HA 2EFCB 3TSOA 1DAIA 1VG9B 5AJVB 4Q4JA 3DZ8A 3QKRA 4LBZA 2XZOA 1KNQA 3KTAA 2GHIA 4G5QA 1SVLA 5IK2D 3TE6A 1J2JA 1N5LA 1KI6A 3UWKA 2OSBA 3MLEA 2IYVA 4Q9HA 5FBLB 5CB6A 5EP4A 1XTQA 2OLJA 3L2OB 2ZU0C 1CR0A 2BDTA 2GZHA 2BIFA 4A4DA 3WHLA 1ONBA 3DPUA 5A4JA 1FMLA 3THYB 3MFYA 1W49A 4DSOA 2XB2A 1K5GA 3C5HA 4AC9A 1RYFA 1W0KD 1WDTA 1VHTA 3AH8A 4YMWA 1FX0A 3C14C 2GCOB 4RD1A 1ODFA 2C8VA 4KITB 3B7GA 4TZ0A 1W5SA 2NTYC 3NWJA 2V3CC 2W0MA 2ZUCA 5L8VA 2ERYA 4OKSA 2QUZA 3AUYA 3AKCA 1P7CA 2YC2C 5HTKA 3LNCA 1LF0A 3U7FB 4KXFB 2KB0A 3RYTC 3O8RA 3VKGA 3BB4A 3X2SA 3J81k 2GESA 1DO0A 2FSHA 3W34A 2E87A 5AUNB 2PX3A 1J7KA 2IBMA 3A4NA 4GOKA 1II8B 1AGRA 1E79D 3K0AA 2RH5A 3EARA 2AK3A 3RNLA 3AVTA 3GP8A 1G5RA 4Z54A 5KO2A 2HXSA 1KJYA 1KDRA 1VTKA 1FP7A 1UM8A 2ZR7A 3AGPA 4AK9A 4YMTA 4B3DA 1HY3A 4KVAA 4WXPA 5J4YA 4LJ5A 4LCBA 4OL0A 1E2QA 2JDIA 3CB4A 4V0KA 1CJUC 3NHBA 3FTQA 4I4LA 4MKHA 1AIPA 2A5FA 4CZ2A 2GNOA 3GFOA 1XTKA 5C1BA 2GK7A 4URUR 4A6PA 3LO5A 4PC2A 1JECA 3WHKA 1E0KA 4NYMQ 4C9BA 2D7CA 3TGPA 2GEDA 2J1LA 1U8AA 1W5TA 2DCUA 5FTNA 2C5LA 2E1RA 2QAJA 4OK6A 3TR5A 2ZITA 2B7BA 2QAGB 2WM9B 5G3YA 4AYTA 1O87A 1P5ZB 4CEIA 2ASEA 2EFHB 1UEIA 1L8QA 4IVRA 3TQCA 1Q21A 4AG6A 4JL8A 3ADCA 3LWNA 3NH9A 1MO6A 2QMHA 4XIGS 2B8TA 2O8CB 3BORA 3CH4B 821PA 4LC0A 3SJBA 4QM7A 2ODEA 5KDOA 3PQCA 1RRGA 1Z6XA 4TTPA 2XX3A 1QHHA 3WY9A 1LW7A 4QBHA 5DN6D 3SDZA 2HLDA 4KFRA 3ZVNA 2C78A 3T1VA 4ACBA 2ZI6A 4MKIA 2G1JA 2NO7A 3DO6A 4DCVA 4C7OA 2XB4A 2LKDA 1U94A 4QC2A 3RRZA 3W8NA 2ZS8A 3H0KA 2NG1A 1Z47A 3KFXA 4BFYA 3AM1A 1P61B 2DHRA 4DLRA 1YHNA 4DJTA 4DC9A 2ZI4A 1N0WA 3RS5A 4PQFA 4HLQB 1E9CA 1XZQA 3SYNA 2QP4A 3KJIA 3QVUA 3EPJA 4QKQA 3GFPA 3GLHA 2IEYA 3R9XA 3B78A 1F2TA 3Q5DA 1L7VC 4B34A 4LPSA 3MJHA 1S3GA 5DISB 1DVRA 1GKYA 4B48A 2BBSA 4LHZA 2R6AA 2VRWA 1QHGA 1G21E 2RGEA 1G3MA 1XCMA 1Q1BA 3D3QA 3A58B 3IO3A 3ZD7A 1XTSA 5LPNA 1CULC 3AP1A 4KLNA 1Z0AA 2VP5A 3L8ZA 3MWJA 3V00A 5KTYA 3F0TA 1NLYA 3GJ6A 1OB5A 3NTUA 1K5DA 1Z22A 4URXR 2C04A 1ESNA 1II0A 2JIZD 3K09C 2UVQA 3RHFA 5FPTA 4BFUA 3QBTA 1N3BA 2AN9A 5LD2B 1YRAA 3SU8A 4KYUA 3T15A 1KK2A 1TMKA 3Q8XB 4WOPA 2AWOA 2BBTA 2JATA 3FMOB 1YU9A 2YNMA 3X1XA 1P73A 1MABA 2IF0A 2REXB 1CRQA 1E2NA 4W5WA 1GG2A 3KTAB 4D26A 1VCNA 4R2HA 5FL7D 1KY3A 4MYCA 2A30A 2CCJA 3I5YA 1GL9B 5B58C 5K8LA 2X8AA 1X8JA 4HLUC 1ZMXA 3K1JA 5G41A 1W1WA 4CT4B 4Q9IA 4A0RA 3R8FA 2F1JA 4B2IA 4JZKA 2NO6A 2GK6A 3CWZA 2IYUA 2XNDD 2NO0A 1IY1A 4BEJA 4M8NE 1B23P 1MOZA 4A15A 3LY5A 2VTKA 4FCVA 3TK1A 3AVXA 4HAVA 3B60A 3QBVA 2PEZA 4WBSA 1X8LA 3GLHB 3QXXA 1A7JA 3ASYA 4M1YA 2IWRA 3WMEA 3ZVLA 5F9HA 3I8SA 3T1OA 3AF3A 3ZQJA 3GLFE 1VIAA 2GZDA 4GOJA 5DO9A 3W3ZB 4BFZA 1UKEA 1S8FA 2CK3A 4MKGA 3IUYA 3PG5A 3W8RA 4BLTA 1OB2A 2O8EB 1VIYA 1IQPA 2WTUA 4GZLA 3ETLA 3K0SA 4YMSA 4FCWA 2QBYB 2A78A 4BLOA 1CJMA 2OV2A 2W6ID 4PC3A 4DCNA 2XEXA 3U3MA 1G7RA 1E32A 4DLYA 5EJEA 4DB2A 2F7SA 1SQ5A 4PX9A 4Q4AA 4DEXA 2EFGA 3U44B 1ZNXA 4HAYA 1XXHB 1AQUA 1G9XA 1NJFA 3BS4A 3VAAA 3KJHA 1KO5A 1XD2A 2G1KA 4AIIA 5L3RA 1AS0A 3SC3A 5AUOB 4LY6A 1Z29A 5SZHB 1W36C 2D2EA 1QF9A 3AVYA 2A5YB 3DM9B 4IVQA 2GJKA 1XRJA 2AL7A 4DCSA 3RVBA 4Q4AB 3LA6A 1JEDA 2VP0A 4FIDA 4N1AA 3OEHA 3PIRA 1XZPA 4QJ3A 2OXRA 4QJ5A 3DEFA 3U6KA 3QQ5A 4JIMA 4IOKA 5KPDA 1JPNA 3FHCB 3NC0C 4PSAA 2GJSA 3CR7A 3X1ZA 1UJ2A 2JEOA 4D0GA 3UG7A 3T34A 2QPOA 4YMUA 2IYWA 1ZNYA 4O25A 3O8CA 1UBGA 2FJUA 1IXZA 2ZRHA 1CJKC 4PAOA 5FOWA 2G3YA 3HP1A 2J46A 1CTQA 1W48A 1KSGA 1KO4A 1O3YA 4NDZA 5GVSA 1NRJB 4I1OA 1P3JA 2OG2A 1NY6A 4LGMA 4GL2A 2RMKA 4D4MA 3CX8A 2J9RA 3GLHE 1GL7A 1U0LA 2PBRA 2EWWA 1N0UA 2DBYA 2HCJB 4G5RA 2CNWD 2IYSA 2PT5A 4GMDA 2ZXUA 1LS1A 2WJYA 4UJ3A 1DELA 2HEIA 4M2LA 2QN6A 1GITA 3VNVA 2OEPA 1NN0A 2YZ2A 4Y0AA 1IBRA 1Q0UA 5CLQA 3WRXC 4KODA 1SHZA 1E3MA 3C16C 5FBVB 4HSEA 3NIBA 5ANRB 5H1YA 5FPYA 1VECA 2AD5A 2LCFA 2BEKA 2Y8EA 3FFAA 4WZBE 1AZSC 1T3LA 2D4HA 4FWTA 4HLUA 1FFHA 4P4SA 3NG1A 1UBFA 5AR1A 3I3SR 1XPRA 3ZD6A 1QVRA 3Q85A 2IC5A 1Z07A 2OHFA 3WMGA 3AVWA 3TUIC 3LRPA 4EPYA 1OH8A 1SULA 1US8B 4HLCA 4RZXA 1V43A 5HCNA 5EE0A 4JBXA 1OYWA 3BE4A 5BYKA 3AKEA 1IN6A 4V0LA 4EPXA 5JEDA 1P2SA 1JXMA 2XNDA 3DZDA 4KFUA 4JLVA 3U60B 2ZUBA 4Z8YA 4Q1EA 3JZAA 3UPUA 1G6HA 1PUIA 3L0IB 3P26A 2EFDB 2HT6A 2G9NA 4DLXA 1JI0A 2WOOA 4G5SA 5G53C 3G0HA 1N25A 2FG5A 3IGFA 2VHUA 1A1VA 1D2NA 1CU1A 1N0VC 1G7TA 1MRSA 1SKQA 1R5OA 1DAKA 1P60A 2V7QA 3KB1A 1TAGA 3SYKA 2RGNC 1N6OA 5KPJA 3L0OA 3CX7A 3F5FA 3KQHA 2IYZA 1ZINA 5JCPA 2JJ1D 4B3FX 1DAMA 1S0UA 4JSTA 1A5TA 1G8YA 4CW7A 1XD2B 3WBKA 2DWQA 1VYUA 2J41A 2X2FA 3VU9B 2W0SA 1Z0DA 1EWRA 2ZROA 3RSLA 1QHHB 1BYUA 2OBLA 2QRNA 1E2DA 2V6IA 3KKMA 2PMDA 2O8BB 2EQBA 2WJVA 3RC3A 4Y0VA 1T5LA 2OBMA 3K0FB 1M2OB 2BMEA 3LAWA 1XX6A 2FN4A 2GCPA 5JWRA 5FL3A 3K0FA 4M0LA 1OFTA 2X19A 1J8MF 4BPBA 4EPRA 2PZEA 1TEVA 1U98A 5DI3B 5D3QA 1TX4B 4MYHA 2RCNA 1Q57A 2WZQA 3K9HA 3QPUA 3WP1B 4Q1DA 3SE0A 1G4UR 1U9IC 1XXHA 4M9QA 2A5DA 3P27A 1Z3IX 2DFKB 3Q7PA 2FE4A 2LKCA 1T4GA 2R62A 4AURA 5EP3A 2EFEB 3A1TA 2GKSA 2REOA 3LVRE 3KQKA 1X8KA 2P65A 4XVQA 1BO6A 3EZ2A 1Z6YA 4JVLA 2SHKA 1OIXA 4TMVA 1BOFA 2B8WA 2CBZA 4TMZA 4EAQA 3U4QA 3TBKA 4IW3B 1DBSA 4NYIR 1JR3A 2ZJZA 4ZKEA 1AK2A 3BH7A 3EZ7A 2B7CA 4NH0A 2QEQA 2C9OA 1D9XA 3OEED 3I92A 1N6IA 2MSCB 2PZGA 4PO8A 1R8QA 2AHOA 1GRRA 1U8YA 2FV8A 4Q7JB 3UMSA 3PEVA 1QVAA 2WBLC 1ZM9A 2YWEA 3NH6A 3NDPA 1AA9A 4B43A 4NU0A 5CB8A 2WICA 1CR1A 2ZRDA 1QDEA 2C96A 2E9SA 3QF4B 2IL1A
chains in the Genus database with same CATH superfamily
1KQOA 3I6YA 3QFCA 1QH8B 2VRBA 3IQZA 3QQPA 1CT9A 4CCYB 4BTLA 4F4UA 2OWDA 4GRAA 3CZCA 4F5DA 1E0SA 1E9FA 1HM5A 4G89A 5THKA 5AVZA 2ZAGA 3D5QA 1L5VA 2YY6A 2BE9A 3HABA 1GHTA 4G36A 3TW6A 1FNSA 3LLUA 4L08A 3CRVA 3V7NA 4E5NA 1E79A 4NHOA 3RVJA 3GPCA 5JROA 1PJZA 1ZJZA 1G2PA 1JIUA 1WU8A 2HLPA 3FPCA 4HQ0A 1GNRA 1GY8A 3EY9A 4X1OA 1BDJA 1YOVA 1PV4A 5HIIA 5IC4A 2ACEA 2AOUB 3PFWO 1GYPA 4EMUA 5B1YA 3DDWA 1Z33A 2JKVA 3DKPA 1ISGA 1FF9A 3HDHA 1XYVA 4MMXB 2P62A 4O3FA 4CEIB 1CF4A 1JWAB 3GUUA 1OXVA 5JAQA 2F3TA 1U31A 2HRZA 2D5AA 2VG8A 5EERA 3JWEA 1GM5A 3WYDA 5CFPA 2F6RA 2P2LA 2WKPA 2RAVA 3LKBA 3K16A 4L2IB 4EUFA 5CCEA 6ABPA 1Y4AE 2QPTA 5FHRA 1YQWA 4XJVA 2G5TA 1L9KA 2VJPA 4HFMA 1KH2A 2C7RA 1QIMA 1YR8A 1ZG3A 2Q5LA 1UWLA 3MOSA 5ED4A 1A8SA 2GOYA 3HKBA 4BMNA 1D6JA 5ALZA 4BNZA 1ABBA 2J31A 1P1RA 4KR3A 2JFYA 3I30X 4A03A 3CWQA 4EJSA 2NTVA 2X6QA 4FYIA 4B5KA 1EGVB 4QUJA 5EJ2A 5KNDD 1B0UA 4ECEA 1P4AA 3LOQA 3G79A 2FRVA 4TS3A 1FUKA 2WHRA 5EXXA 5ALVA 5DN6A 1QPZA 2ZW9A 4RDHA 5JQGB 4QTUB 3AVQA 2VHTA 4W5TA 2R65A 2F4NA 2QRUA 4LOLA 2RFLA 4EHBA 1PBNA 5LMUB 2E4XA 1PZFA 3DR3A 3P9YA 5EXDA 4P7BA 5DPMA 4ARUA 3VPDA 1JG7A 1DIRA 5TVKA 1KMHB 2LZ0A 1YK1A 3IIKA 3WISA 3STTA 1C8VB 1M7HA 2LV8A 3KTDA 4MHOA 1VHJA 3VR3D 4XFKA 4I1VA 2X0KA 1IN4A 1XMPA 2EZ9A 3RKSA 3C3XA 3NFRA 4I3GA 4DEYA 3O3CA 2ORWA 3MCTA 5ECWA 1VSQA 1C1DB 2ZT6A 3KWFA 2OT3B 3G0OA 5C3MA 4KAFA 4L73A 5LDHA 4ARSA 1XK7A 3CMCO 5IUJC 4ZIRA 1TLTA 1M1NB 4PYLA 5JS7A 4D6PA 2PSHA 1WVGA 4OMUA 5EWLB 2PX6A 2PH3A 1RKXA 2UVPA 1R5BA 2YZ7A 2HJSA 3G59A 3VU8A 2II6A 4CIDA 1J1IA 2YVKA 1Y4SA 4YO8A 3SKVA 3ANSA 1ZHHA 5EUQB 4FYKA 2PLFA 1TOAA 1QUFA 3BXGA 1FPMA 3VHLB 2CNKA 4YRZA 1H93A 2ZJOA 3HUUA 1WXFA 4MVYA 4UE6A 5EWJA 3B12A 5L3ZA 3UA4A 3IT2A 4JR2A 3A26A 2GCNA 2JBAA 1XB2A 2FQWA 2BEWB 2KX7A 4NJMB 2O8FA 1K6JA 1N2BA 4XCVA 4BC0A 3O90A 1TLFA 3RGWS 3LUFA 4D2IA 5G4LA 4KXUA 2G36A 3KQQA 4YDQA 2O59A 1UJ6A 1Z0FA 4B8WA 2XMPA 4JLKA 2H2IA 1SZCA 3UT5B 3NOVA 3ETCA 3WWYA 3V8MA 1T5TA 4MI1A 2XWQA 1HFKA 1JQAA 1Q0RA 3ZCTA 4A2CA 1W19A 1FCJA 2V7VA 5IJ9A 2PH5A 3HA3A 3PC8A 3VKWA 2Y2UA 1Y9JA 2ZANA 2KJQA 3R6DA 4OM7A 5FB3A 2XA9A 1KBZA 3L1KA 1P5RA 4R41A 1NQVA 4ARBA 2P5TB 3ZE8A 2Q9CA 4RA9B 5KOHB 5P21A 5BW4A 3BQNB 3ORYA 5DHRA 1X19A 2PLWA 3EIFA 5TMEA 5LQKA 5HZKA 3R0IA 5FJJA 5JG7A 1RRKA 3LFTA 1JHPA 3PXGA 2Y71A 3DHEA 3TDMA 4QZVA 1QYWA 2PGOA 2C83A 3GAZA 4DNXA 4YV0A 5AFSA 1BQEA 1GLVA 2IEAA 2IUTA 3B1JA 2HRRA 1ODLA 4BQOA 4WK2B 3H87A 3UBMA 3I32A 1N1GA 1I5EA 2VK8A 4NJEB 2RK6A 1JT9A 3TLJA 4IY1A 5CYGA 1DEAA 3L4JA 4C0LA 1OBVA 4GPIB 4PRLA 2WD8A 4C76A 3AEYA 3NOXA 5AT1A 1YDEA 4H7JA 3JAKA 2JGNA 3MWYW 1KJJA 4IX1A 4YJFA 2J87A 5EWMB 1CBUA 1SXJB 3RUEA 5GADl 4OBBA 4H7PA 1GNQA 1ONOA 1UMDA 4MWGA 1IIBA 3VBEA 2A9JA 5IKPA 2I1VB 5K6AA 1U0EA 1KWGA 1N2OA 2HXYA 1SOMA 1P7YA 1WZNA 3RS9A 3WRYC 4MB0A 1WR8A 3GRVA 2FR0A 4FX5A 4OD0A 2PSDA 3VDMA 5GY7A 4JBGA 3BXFA 2P2NA 3IQIX 1E59A 2DY1A 4MROA 5C8ZA 3FNEA 3T5DA 4LZJA 1HT0A 1E3EA 3EGXA 3M4NA 3QMVA 1N6HA 2O0LA 3A9TA 1KAEA 3IOCA 1WQ3A 4INPA 5L7TA 3DKIA 4WUTA 1ULZA 3SHVA 2R8EA 3OBBA 3OIYA 4RZ3A 1GDTA 2WWTA 1G1MA 3ZN2A 4X93A 1OF1A 5IJ9B 1U8TA 2YR0A 1WNFA 4CUKA 1HSOA 2N1BA 3W6OA 3E9DA 3CLRD 1V16A 4FMCB 2JB9A 3CNOA 1O8CA 4TMYA 3OCWA 4BVKA 2XNKA 3T1NA 4OHRA 1RHQA 4L8WB 3MWKA 5AJUA 4QDJA 1YO6A 4NG4A 5CP8A 3ZIAD 3OE7A 1P2BA 2ONZA 3O84A 1N0IA 1PDWA 3WQBA 1B26A 1N6LA 3CRRA 4B3MB 1B14A 4ABYA 4WLEA 3TS1A 2YBEA 1U1GA 3GYGA 4C04A 1IVYA 2JAUA 5E4FA 4WJZA 3SSMA 4B3BA 1JILA 1L8OA 4XCXA 2WFLB 3E3OA 3RJMA 2B5WA 5F98A 4JY7A 5CYOA 2XSZA 3EIXA 2VZLA 5ERXA 2CFOA 2DYKA 4ZI7F 1BCSB 3BBPA 4EVRA 2J3KA 4QOIA 2IPMA 3H2GA 5AK5A 2ZXFA 5M5BA 1I1NA 5ALLA 3JQDA 2CNOA 4HADA 1A9QA 2BONA 4EHIA 1SCNE 2BMAA 3QJYA 4GGMX 3IQDB 2XDQA 1S3SA 4LJ9A 4DMUB 1NKVA 1AX9A 3DR5A 2AI1A 4LVNA 2DFNA 4I1SA 3RSCA 4KAAA 5CTJA 3HB5X 4EA7A 4P4UA 4PPFA 3D3EA 4IEFB 5H02A 5B30A 3HJAA 2QTLA 4JJEA 1RQXA 3RAEC 2YWRA 5J3JA 2IZ5A 2BVNA 2EJTA 4KAXA 2RC5A 2FEKA 3LCJA 4JA0A 4QBTA 4WPGA 2Z4RA 2QE6A 4INZA 1EHCA 4W99A 2D0IA 1RZ3A 2OBXA 2DY0A 2OHGA 3RSHA 1J06A 1L7BA 1I7NA 4D9MA 2VAXA 2OBNA 5LZ4A 4AJPA 3OQMA 1VMEA 3EXHB 4OG2A 1GFSA 1W8IA 1XTRA 2JJ2A 4CDGA 3GGPA 3C1AA 3GXOA 4HUQB 4RJLA 5C2JB 1MAVA 5ITSA 1USIA 3MXOA 4HDNA 3T3EA 2QQFA 4WN9B 4RV4A 4YRDA 4J75A 1PK7A 2AFRA 2VUSA 4BQPA 5D8DA 3MG9A 2P2DA 1U8XX 2HF2A 3DE0X 3TL6A 3VKVA 4UM8B 4UEOA 4BBAA 2AYYA 1I5RA 1KK3A 3DQPA 3C5CA 2PMKA 2B5OA 1ZN8A 2WF7A 2WZDA 2HRCA 4RF5A 3S8MA 2Q1SA 2IPAB 1JMKC 1KU0A 1K86A 1NKTA 2H5IA 5DTRA 2IOQA 2FPXA 1S1CA 2QQGA 3A9CA 4YC7A 2ZTHA 1DDOA 2J3LA 4YJGB 3QU5A 1S8NA 1WXQA 4OI4A 3T1QA 1N6KA 3SZGA 2DPHA 4ZYUA 2VWGA 3RUCA 5K5EA 4HPJB 1X86B 2Q6OA 4ILEA 1NVVR 1GR0A 3PPXA 1OLSA 4HTFA 4U0JA 3KVNA 4BNGA 1GNPA 1ZQ1A 3FNIA 3K8ZA 4FFSA 4PSKA 5I7AA 3ILXA 2CWDA 4CIXA 4BKUA 5DU2A 1W94A 4W1PA 3HCFA 3IPCA 4TKUA 1QGUA 2ACWA 2VJMB 3GC6A 1ZIPA 3H5NA 4KX5A 3ZXUB 4HEA6 4WY8A 4GR9A 2I3ZA 1EUCB 3U48A 1FFDA 2HYIC 4CN8A 4K6FA 1KP2A 1DBRA 1RC1A 1RWWA 1V11A 3OHPA 3OEHD 4MPJA 3E1GA 3TMAA 4PBTA 3LWZA 1GSAA 2G1AA 2DHCA 3FWHA 4NWIA 3WGYA 4TTJA 3D0RA 4BX2A 5CPBA 5IBQA 3ISTA 1W73A 1XZIA 4AJJA 4D9GA 2QROA 2IFTA 5DX0A 1UDBA 4W4TA 5CCXA 4RZQA 4RD6A 5TQVA 2D1TA 2VKTA 5TNXA 3TINA 4I9FA 5BQXA 1IEWA 1M2GA 2PDAA 1Z08A 2I3BA 1NC3A 2QR5A 2QX8A 3DDZX 3GAFA 5K51A 1J09A 1X1CA 2P2ZA 4D9JA 2BN4A 5FL7A 4J4BA 5GPBA 1D8TA 3TCXB 1YB4A 1LW6E 2C2WA 5AKYA 1SRQA 2QL7A 5LA6B 1HMYA 2X7HA 3EVCA 3TLXA 3L6UA 5IN5A 1W9MA 2I2BA 4N7RA 5REQB 1MQ9A 1HETA 2M32A 3KR1A 4JVOA 4DT1A 2D1YA 1BRTA 1ISJA 1F1BA 1I51A 4FN5A 4N6NA 1YCDA 3IBFA 1KI2A 2COEA 1KA9H 2CXXA 4KCGA 2Q1TA 3U0BA 2OCPA 4BFLA 4X95A 5K0BA 3NBZC 2QP3A 2L17A 3H9JA 2XE6A 1G6OA 5B7GA 5C5DA 8ADHA 5JJLA 3QELA 3GJZA 5JZBA 1IXSB 4B6QA 3IQGX 3I6IA 1M2VB 1DUSA 3AERA 4BV8A 4PX2A 4NV1A 1QYRA 3GVIA 4J0FA 4U9IS 2QUJA 4WHMA 1M0WA 3GJXC 3VVMA 2XVAA 2C9ZA 2V96A 3TVDA 1MAAA 3ZLVA 2YQZA 2F3RA 5HRUA 2NXCA 1XJQA 1H2ZA 1E3WA 4JC5A 3CLUD 3X43A 3TF5A 1LWOA 3KR9A 5IRCD 5JE8A 5JECA 1RP7A 1UDCA 3CF6R 3HDGA 4E7PA 2CNWA 1GQYA 2CL5A 2D5BA 1LK0A 1ZJ4A 4U02A 5KTKA 2IOFK 3T9BA 3HKDA 1DKMA 3DE1X 4UUQA 3HA2A 5JNVA 1GCIA 2Q4DA 5BSMA 5KJFA 3HYNA 3UWOA 1YVUA 3WKEA 1JLRA 3VKHA 2DKFA 1H66A 3A2LA 2JW5A 1U99A 5NULA 1EDOA 4CV0A 3FVTA 2Q3EA 2RGCA 4D82A 1ZO8A 2ISCA 3SD7A 4FQ8A 1JDZA 1XCOA 1DC8A 4HB2A 4QFMA 3OETA 3HBFA 2ZKIA 3LZDA 3DEJA 2O3SA 3R20A 1VBMA 4UAUA 3LYUA 2FEPA 2DH5A 2V4ZA 3FA2A 4NCJA 3BFXA 2QLTA 4IIGA 4P33A 1UK8A 1LBSA 3NBMA 3EN0A 3GFBA 4X91A 1R00A 1HOXA 3TXYA 3THOA 4Z3DA 3NBYC 3WYCA 2FRXA 3CVYA 1NQUA 1KYWA 4M53A 2ZAMA 2NZVG 5JVDB 5BNTA 4F91B 4JUIA 1PHPA 1ABEA 3ICQB 2WDZA 1UMCA 4FD2A 1OIWA 1RWMA 3S2FA 3C6ZA 3ZTTA 4ETMA 1DBQA 1BD4A 5B2FA 1ID8A 2QTMA 3O8OA 3PRYA 5FBQB 2VDWB 3KQLA 4KC0A 3NDIA 4LXHA 3SS9X 3EGEA 1ZI8A 2BJVA 3KQPA 3R23A 5FNVF 4BQFA 4QO7A 5F76A 2Y9MB 1E18A 4PBRA 3UOAB 4F2GA 1DGQA 2ZWAA 2G9RA 5AK0A 2GF9A 2BL4A 3AJ8A 1YB1A 5HF8A 3RG2A 2JAWA 3W5IA 4PQGA 2VT7A 3JQAB 2H2WA 2ZFUA 5TMPA 5IU6A 1JLLA 4ON9A 3UA3A 2PUWA 3A4LA 5EEHA 2O2YA 4EIWA 1G8FA 3AZOA 1G41A 2B8JA 3C3WA 3MSXA 4YAEA 4U63A 4ZCPA 3DV2A 3TQOA 4OGGA 3QIAA 2A0FA 3CUEF 4R1LA 1OBCA 4D41A 4D6YA 1PQWA 1CV2A 2AFVA 1PFVA 3ZCXA 2FMTA 2KM1A 1WZCA 4N48A 4NONA 1YB7A 2QV0A 4X65B 3EOZA 3RKUA 4WASA 1ZH4A 2XGOA 1PK9A 1UBJS 2CXUA 3QVGB 1CNMA 3F46A 3VI3B 1M33A 3QU7A 1CLEA 3COJA 4H77A 2J3MA 1EB8A 1ZQ9A 3L9XA 4JQZA 2REBA 4MGIR 1IRIA 4MYRA 3FDFA 3BE6A 4X1KA 5CTAA 3W8EA 4B45A 4DOMA 5AM2A 4TLMB 5LD2C 2HLDD 3R09A 4BVFA 2P3OA 3OZXA 5F77A 5HSGA 1GAWA 4IM7A 4KLCA 5BNFA 4L5JA 3IE1A 4X8OA 3KZNA 1Y9DA 4ZC1A 1ISMA 3IQEA 1U3VA 1BMDA 1VYVA 3BGIA 3BVPA 2OXCA 4ZJZA 3QVGA 1A8UA 3JYQA 4E31A 1LV8A 1UPXA 3NKFA 3HYTA 2PUFA 4J49A 1FQJA 5EIWA 2X5KO 4QWWA 2JCXA 2AJTA 2VRCA 2YYZA 2XHZA 4GNKA 4JC8A 1CJVC 1P8JA 3U26A 3R3VA 5EHZA 2I6SA 4GUAA 1MJGM 4DBLE 4DLKA 3ZDDA 2HJGA 2PS1A 2IP4A 2QUIA 5BYBA 4CE6A 2AMVA 2VBCA 1Q2XA 4BNFA 3Q72A 1V48A 2XUDA 2JNWA 2ZVJA 4KI0A 1PQ4A 2KE5A 4WZAE 4AZTA 3TI9A 5BSVA 1ZUIA 2BEUA 2MYUA 3MT9A 4TWJA 5EGSA 1T4MA 2Q1XA 3KQOA 4HCJA 1LC0A 3Q1LA 3D8HA 2A0WA 1W46A 5KSZA 3IP9A 5KBYA 1GA6A 2OECA 1C7IA 1DINA 3BBLA 2WJGA 2F4VB 3NHJA 1HPLA 3JARB 1B42A 2NX2A 2ZDHA 2YVLA 1UBOS 1O0SA 1EX9A 1G3UA 4KTTE 3SQOA 1ESEA 3ED1A 3TWOA 1O6CA 1F7UA 4XM1A 4IVPA 1M6WA 4BDTA 3GA7A 2FWPA 4QAJA 5IX8A 5LWHA 2REQB 1KYZA 5KHLB 4CMKA 1NMQA 1RBYA 1DIOB 2Q5IA 4QBFA 4ENSA 2HOQA 5B2ZA 5KWJA 3NW9A 3TXXA 1XLTC 1X87A 4GL4A 1MNAA 2PLNA 3ZHRA 3CUWA 4UBIA 4Z4IA 3F6BX 4QDTA 1W4CA 1XMVA 2GVDC 3OT4A 4Y9RA 4H1UA 5M7EA 1F06A 1HQCA 3F49S 3NFYA 4KAJA 4N18A 4C6HA 2V8OA 2R96A 1JIQA 3LY9A 5A1JA 3DT8A 3RVPA 3WKAA 3TOXA 3QMWA 3R6LA 2AK2A 1ECFA 3FGZA 4RH0A 3O82A 1G60A 3L7IA 4S2UA 5KVAA 2UUAB 3JW8A 3RFUA 4JKIA 2DH6A 3GLIA 2V0CA 2G5GX 4W9RA 1JDPA 3BJZA 1C3JA 1JI3A 2AFIB 3AI2A 3L0SA 4ISCA 2C3OA 4JGIA 3R7LA 4HEJA 5I01A 4RNCA 2BEVA 2QLMA 3MGCA 4RVDA 5AW9A 1LJLA 5IT5A 1JHUA 2I4IA 4XD7D 3LYLA 4FE3A 2VJYA 1FOEB 3ZV4A 1W9HA 2AVDA 1KPIA 1MO3A 2MOKA 1THZA 4PQYA 4FW8A 4C1BA 4E5YA 1XVTA 4U8GA 4E4TA 4V0MA 2X9LA 1P3Y1 4GVPA 2JGRA 3H42B 2B20A 2Y92A 3QOWA 4F8YA 1ZCFA 5MN4A 1SG6A 5F1KA 4Y2YA 2BM1A 4KRGA 5JATA 3SJ7A 2NO1A 1JG3A 3S8YA 5AO9A 1SVMA 1GGHA 1Z2CA 2C61A 3TD6A 3L01A 5KSWB 4UPDA 4C7VA 4DMCA 2MYTA 2I99A 5JWOA 1D0SA 1PYOA 2OBFA 2R7KA 2V97A 3HQ4O 1MIHA 3IDFA 4O2RA 4JH0A 2JGEA 1UDWA 4PEVA 5G2OA 3BA1A 2JIRA 2G6BA 1U3FA 2QUKA 4UC0A 4MIEA 2DWOA 3IIJA 1FW8A 3F8WA 1VCIA 1FSGA 2F17A 3B89A 3C6QA 1FRVA 1AHNA 2A0UA 3RWOA 4LA4A 3WAJA 1US8A 3D2AA 1BHQ1 2FKNA 1Q6YA 1V9CA 2RHRA 2PSSA 1SRRA 2Z5LA 1YS6A 4W7HA 4YRQA 3KJNA 2DSTA 4TLDA 1Q91A 3IQWA 7ABPA 1O95D 2R4QA 3CS3A 3T7TA 1G18A 2FW0A 4F9TA 1TKRA 1W6UA 2XMZA 4W1RA 1ITZA 2QN2A 2ZS7A 1WP9A 1TRHA 2B21A 1WV0A 4WZAB 3UCEA 4EO7A 5B7QA 5F2NA 3AEKA 4HB0A 5WRFA 2JLYA 1GUYA 5D7BA 2PMFA 5IN4A 5AP9A 2O0JA 5L40A 4PSUA 3HG7A 4UXIA 2JASA 1YC2A 4UVEA 4Q12A 5JLAA 3VHQA 2HIAA 3U9SA 4BNUA 2WUFA 3IH5A 4NV0A 1YIOA 3HKEA 6REQB 3UEOA 1U2RA 3KHTA 1P44A 1PG5A 1SXJA 3DXFA 3CNHA 4I5FA 2PZKA 4B5LA 3T0IA 4R71A 121PA 4JVNA 3RVMA 1IJFA 3PX3A 2P68A 3I45A 5KHOC 2VLIA 3KPVA 1C2TA 5D87A 1VFNA 5H68A 5IJ0A 2WE8A 2JL1A 4DR5B 3AJRA 3I09A 5IZ4A 3TI7A 3UV3A 5J5AA 1TYDE 4MV9A 1L7XA 3JD4A 1W0KA 2A86A 4ENRA 4HQKA 1XEAA 2AFHE 4C6SA 1X7YA 2EZUA 2ZKLA 5SICE 5AVRA 3AM3A 3ZGOA 3WQHA 1E69A 4IDAA 3JATB 2OPBA 3TSWA 5CX1B 3W7AA 5ITWA 3ZQUA 2ZPAA 5LQCA 3WNQA 4NOLA 4CU2A 2I67A 2A33A 3JZMA 2V4MA 3BK7A 4EFMA 3KLPX 4GUDA 2B7LA 4ARCA 1V5EA 1DCKA 5AM0A 1NL3A 2PX5A 1CIVA 3DONA 1BU5A 3IVRA 1IBSA 1GFIA 1MX1A 3I42A 3G5AA 3P2YA 4OEHA 8AT1A 3AYXB 1CF2O 4OHKA 3SDBA 3EJWA 4CV1A 2GCGA 4YCDA 4CUZA 1VP3A 4LV6A 1CERA 4V3CA 4BNHA 4LJLA 4K6KA 4G0WA 2Z2KA 1NR5A 2FWIA 4KFTA 4QAQA 1WP4A 1OYYA 2OM6A 2VR1A 4J7UA 1L4MA 4OUDA 2XUFA 1EWQA 3KR2A 4JYMA 1DWOA 1RXCA 1M2NA 4AUMA 4ETIA 1GTJ1 2F1RA 3FYUB 3HRHA 4PO1A 4MUNA 7REQA 4TLCA 1L4YA 2AG8A 4UU1A 2W6MA 3DZBA 3EQ7A 4HNAA 4KR9A 3TQRA 2D0OB 3ONNA 5C35A 3H6GA 1R18A 3KE8A 3W9SA 4DJFC 3PRJA 2WC1A 1Z2PX 2EBWA 3QFHA 4MVCA 2KQUA 4RESA 3ZVKA 4FS8A 1WIWA 3D6MA 3IUMA 3K7EA 2QSZA 2W58A 4HH4A 1RS0A 1DKQA 3ESBA 5AI5A 2RHWA 4JI4B 3L7DA 1BCRA 4U7WA 1BH6A 2OY0A 2LR0A 3L4SO 3L92A 4TSKA 1C3EA 4BP1A 1DPFA 1NVMB 4EZBA 1KKMA 1GGKA 3FZQA 2O8CA 3OO0A 1SXIA 2GXSA 1J0EA 4BO2A 2ZRLA 2Y9PB 4AS2A 2ALJA 3K1TA 5K9ZA 2W22A 2G80A 1SBQA 3D8TA 1SVOA 3FPAA 2C59A 3G1TA 2HF9A 1MO2A 1RRVA 2JFBA 2QAGA 3QUTA 4RS4A 2DWCA 2C2MA 4CLDA 4UARA 5LQJA 4XA8A 1WD7A 3SS8A 3BL8A 2BFBA 3QUCA 5ALUA 5LIPA 4MR9B 3DTVA 3WAKA 3RU2A 2IYPA 2CNLA 1W34A 2FMFA 3QY0A 2VJQA 4RPCA 5J2UB 1FSSA 4OYYA 4LSGA 1FTYA 3E9QA 4EG8A 4UE2A 3ZV7A 4HZGA 3O8DA 1NOKA 1YRLA 3WNZA 3U7HB 1TJ4A 2X5XA 4CKCA 2P9QA 4D0SA 2NNWB 1V5GA 2B98A 1OREA 2EYQA 4LMBA 2DULA 4Q3EA 5BQOA 4B76A 4MS3B 3SVZA 1DZ3A 5F2EA 3DOEA 4YGYA 3VISA 1YFKA 1QV7A 3OM8A 3FIJA 4OYHA 3WRWA 4XYEA 4GP6A 1NBAA 1S7GA 2FXIA 3ZY2A 3FTFA 3LXXA 1P8AA 4ZDIA 5GV8A 3HEAA 4LVUA 4AZ0A 4B73A 2PYIA 4NK5A 2ZYUX 1E3JA 2OLKA 4H15A 5CX1A 1WUJS 1Q20A 1D5CA 1AUXA 1PCXA 2PYDA 2B1JA 1R8XA 1Q3HA 1XTJA 2R1VA 4XH9B 1JUDA 2FG6C 4XRGA 3D3NA 1JFFB 2QLJA 4Q00A 1UKAA 1WUIS 2XTNA 1LI4A 2VYCA 4Q1BA 5C81A 4M83A 2GA9A 5F33A 2CMGA 5ISMA 4JT9A 3KL4A 3BE8A 4RD2A 1JJ7A 4YDSA 4C2BA 1WB9A 2EHDA 3CBQA 3E22B 2AKAB 3B9PA 1QGYA 3GFRA 1ZGZA 1D5WA 3DV0B 3O9ZA 1RYYA 2JFXA 3FWPA 4RIHA 5CFRA 1UC8A 3DLPX 3K2EA 3Q6NA 1YFLA 1PK8A 1SWVA 2J0UB 1TZBA 3EXIA 2JVKA 3HYSA 2TRSB 3MWFA 4RY8A 1HQYE 1T0PA 2F64A 3LFUA 1FRZA 1QXSA 5J5CA 1Y5NA 3PBKA 1GQFA 1DTSA 2A4KA 3CFYA 5IC5A 4QNNA 4CN9A 3H3FA 1QHIA 1RXYA 3D0KA 1RWNA 3BICA 4IQFA 1IBMB 4C06A 1EE1A 1VKRA 5DLPA 4JXJA 5DEOA 3PD1A 4AJOA 4DKXA 2EX4A 2JIBA 2RJNA 2FFJA 2JGIA 5LB4A 4TVKA 5THXA 1R0RE 2X86A 3D6UA 2ECOA 4J8PA 3GCWA 2PA0A 3QKRB 1EZ1A 1MFPA 1HL3A 3A32A 4GI5A 4IUBS 5B5SA 4URYR 4YREA 4JI0B 1PEKE 2X14A 3MINB 1LNSA 5FBWB 4X92A 5CX4A 4EHLA 1FU4A 1KFBB 1NJ8A 2WOJA 3LFHA 3M83A 1EUDB 1SJ9A 4D9HA 2B25A 5JDCA 3OFJA 3H8WA 3QENA 4M7RA 1ZSNA 4AKHA 2Z98A 5GAJA 1H4VB 1RKUA 3TMKA 3ZI0A 3KNZA 5FNVA 4HQFA 3GJYA 3NBQA 2I6FA 2AEJA 4MVJP 2I54A 2CXOA 4R1OA 5BN1A 3INGA 2AG1A 2FJ0A 3LKDA 1Y34E 3JQGA 2EKPA 2XY4A 1OFIA 1XTBA 1W0JD 4PYKA 4E88A 5JWHA 3ET4A 5JASA 2DTEA 3VNQA 5EJAA 3O8OB 4WFKA 5JXHA 2AB0A 2ZUDA 1QM5A 3O6VA 1P0QA 5FF9A 1BXGB 5FOXA 3RHSA 1T5HX 1VKJA 1MJHA 2BFCB 5G1NA 3IV9A 3QYPA 5DB4A 3U9TA 1PE0A 2E4ZA 4CWAA 2Q8QA 1GU7A 3CW2A 4UJ5A 1JJIA 2W6IA 5TS3A 3RD5A 3N2EA 3ZGLA 1E1NA 2BTQB 1NA5A 4YJ2B 3LYHA 3DXZA 4NBRA 1VBKA 1SQSA 2Y0PA 3GT7A 4O5OA 4MINA 4Q24A 4IJVA 2G4LA 1ESMA 1DI0A 4ZYXA 3A6JA 2UAGA 4FYMA 2FZVA 4X84A 3R0VA 4PTZA 1JG1A 4KJXA 4YV1A 4IFBA 3TRDA 4NQZA 1CRLA 1X3SA 3RFTA 4A6XA 2JLVA 3C3AA 1EXMA 3KXKA 4LECA 2UYCA 2BFCA 3Q5EA 2O2HA 1OY1A 5CK5A 3WGJA 1WABA 3BWDD 2DFLA 1SH7A 3EEIA 5KU7A 3SOPA 3PRHA 3SLKA 3I2HA 1V39A 4QPNA 4YJKA 1CUDA 5C1OA 3EC2A 1B8VA 1A7UA 5LQSA 1Z7GA 2XE4A 4HEA1 4CMEC 4A8JC 2O8EA 4DVJA 1RJGA 3T7DA 1VJ5A 2ZCUA 5CVCA 3VH4A 1D09A 2XZDA 4X6YA 3JVDA 2VXBA 1FK8A 2V5UA 5EQTA 3K30A 1X7GA 4W7IA 1RIFA 3IMKA 3RTGA 3M1IA 4X1IB 1CUSA 3IJPA 3DWGA 1UP4A 2FGKA 3P9KA 4CM1A 3CGGA 5JDIC 3LA8A 1E9DA 3U3KA 2F67A 5CM9C 3GJQA 3T95A 4I8IA 3D0OA 3X1WA 1FYEA 1AD2A 1M67A 1ZD8A 5FUWA 4EGSA 2GZMA 4RLFA 4ME6A 3WDLA 2VAWA 2PUVA 4P32A 1F17A 1QRDA 3K1ZA 3VNUA 5EHIA 3HYLA 1EJ2A 1R6AA 3FE2A 4ETWA 2V58A 2XTZA 3OQ6A 3PUIA 2GAOA 3GPIA 4IWXA 2FFHA 4XPZA 5GONB 1TYAE 1DTWB 2QRJA 2HWKA 2PL1A 2YJ4A 1H6AA 2QUHA 1A2KC 2BZGA 2XB6A 3AUSA 3I0NA 5CBKA 3UAGA 5AVSA 3K6RA 5F1OA 2QLLA 4FDUA 5DM0A 1GTMA 1PG0A 3MINA 2PU7A 3K5HA 3C5VA 3ONEA 4AMBA 2FOXA 4IGAA 1UIMA 3LHIA 1E5QA 2CLDX 3PFBA 2LTAA 4E08A 3THYA 5HJ2A 3FUUA 2BKEA 2VDMB 4ND1A 1LS6A 4O4HF 2W2XA 3HLKA 2X7JA 4A2WA 3WGNA 2IUYA 2MMCA 4F38A 4UVIA 5CB0A 3IL2A 5F64A 1G8KA 2ZI5A 3THWB 5G0WA 3SNHA 5DF1A 1CVLA 3DDHA 2XCOA 1XKTA 4L72A 5IWAB 4II2A 1N33B 1VHLA 1EFPB 1Z75A 3AP2A 4HPXB 4RD4A 3UXHA 4EABA 1AKVA 2ONJA 4OH7A 1BHO1 2D4AA 3UMFA 1LXCA 1QFJA 2H17A 1GLGA 1FRFS 4K8OA 3S68A 1JEAA 3PI6A 3ACBA 4TM8A 2BKUA 1KDZA 4OHVA 1CVRA 1SD5A 2P27A 3BMCA 3IO5A 4NCKA 3ZHQA 1M1ZA 2JZOA 4QIHA 1HDCA 4PG6A 3KKPA 1V6CA 3QWFA 4Y6SA 1Z8FA 5JNWA 2Y0DA 2E4UA 1JQ5A 2Q2NA 1QIGA 4O2AB 3RTCA 1EA7A 1YA4A 2GXQA 2IX3A 4OHWA 1TI7A 3LIIA 4XB6B 2OFFA 1A7AA 2ILVA 4RH1A 3T0GA 3E15A 1UH5A 3F1LA 1MOPA 3SXUA 4KUHA 3SZUA 3ICCA 4BO5A 1CP2A 1MG0A 3FSGD 2HFKA 4Z0PA 4LHWA 3LL4A 1JIXA 1MZVA 1XV5A 3PWZA 2EHJA 4IOLA 1A69A 3I9NA 1PZGA 4OQMA 2IBSA 2XUIA 3KWJA 3IDZA 1KVTA 1QHYA 4YUZA 3HN6A 4CM7A 1RAGA 2JLCA 4QUDA 4KDCA 2FSFA 4HP8A 3CRQA 2OPHA 2VHQA 2ZBGA 1NXVA 2QUAA 1ZKDA 2JLZA 3G9QA 2CXNA 2J5BA 4R31A 2CLKB 4E14A 3MTDA 4HFJA 1I10A 2Z3WA 4MA5A 5J1TB 1YZNA 2W2MA 1U6KA 3G1UA 2RHOA 1ZGGA 2B8NA 3QV2A 3RVSA 4DWOA 1M75A 2XD9A 1J2EA 3H5AA 3MILA 2C8JA 3MZ0A 1LQUA 3HC7A 3FJ1A 3JQRA 4JT8A 3HSYA 4TN1A 4I4TA 5EE1A 5ICEA 2PU5A 4HXEB 3ZBPA 4U3JA 2AOVA 2J5QA 3D02A 2KWIA 5ILGA 1Z06A 5EMJA 1PJSA 2CJXA 2KW5A 2LVBA 1TMOA 4HXGA 5IH3A 3CO5A 4EKYA 4ZRDA 3K15A 4LMPA 3RSSA 4YAGA 4Y7CA 2NZ8A 2E37A 2WTEA 1XK6A 2HRDA 4RXTA 4XYMA 3STHA 5HPYB 5GJBA 3EWAA 3V8RA 3H1AA 3UENA 1JMVA 2G6TA 1WZEA 2A9VA 3D31A 3OPNA 3CJQA 3BWEA 4DIFA 3K72B 4D4LA 1CY8A 2GTHA 3GUVA 1ZCBA 1XMIA 4YONB 3VR6H 1EM8A 4TVSA 1EGAA 1RKVA 4U7GA 4JP1A 4R7ZA 1IHUA 1KJZA 2W11A 3FMVA 2DT5A 4NBNA 4GOOD 4Y1RB 3GZNB 2GRUA 1SCBA 4DV1B 3M6IA 1B6SA 1XC7A 3MMZA 1Z2OX 4UBKA 4EFNA 5K8CA 2PK3A 5BT8A 1FFYA 1BXZA 1AQ6A 1YULA 1UMBA 2PL9A 2XDWA 1TZKA 4IHKA 5D1NA 4DZZA 4FFMA 2PTHA 4DLVA 1KWKA 2ZUSA 1GKIA 4DCMA 1W93A 1KOJA 5I7EA 1NN5A 1CQWA 3I0ZA 3Q0EA 1JDBB 1GGFA 2PR2A 2WPNA 4ODIA 3DVLA 4LYDA 1K89A 3GEHA 4RO0A 1NJ6A 2XNJA 3OVMA 4CVNA 3BMNB 4LE2A 5ENDA 5B7PA 3M9XA 3NVDA 1I01A 4LRXA 4TKVB 5F2KA 4BFWA 3CPHA 4ZOLF 5H83A 3OQVA 1ZVMA 3PC7A 4QTTB 2WSSD 5CLLA 3U4CA 3HCNA 4OXRA 1PJ4A 5E9QA 5ILQA 3QU4A 1NP3A 5M3BA 3TR0A 5JPCA 2DPGA 4NCBA 3O95A 3RS4A 1UBSB 1NF8A 4NENB 1OW3B 221PA 4JI7B 3M1YA 5FEMA 5H70A 1GUZA 5JS1A 2X2PA 1AXEA 1F4PA 5EL0A 4NCIA 4C30A 5B55A 2ZUEA 2ODTX 4FEEA 3SYLA 5ELXA 2BGJA 2CHEA 2K4MA 3H6KA 1LJ8A 1WNTA 2PE5A 4HL6A 2W2KA 3HU5A 3ZUGA 4YRGA 2XE7A 1VL2A 1WXHA 1EFPA 5KNBH 4PNEA 3F6PA 2H7VA 1Y7PA 1RZRD 2AFHA 2G09A 2Y1DA 1J25A 4Z0HO 2R86A 3H2YA 4C4OA 2WJPA 5AW2A 5TEWA 1MC5A 4LRQA 3VR6A 3EVZA 4HGYA 4RMIA 4IYRA 4EJ2A 3GQVA 1UBLS 1WA5A 2XYHA 1VJDA 3ID6C 4R1MA 1RFLA 4MWZA 4AXXA 3RUIA 3CR3C 3RS0A 4WW0A 1IY9A 1IOWA 4CM5A 4WNAB 4X8LA 1UUFA 4KN6A 4EQ6A 2C4KA 4K6MA 2A9FA 5DGHA 2ERXA 2B5VA 3EXG1 4I9UA 1SOWA 4JIGA 3LKVA 1RC8A 3P0JA 2JFUA 1DBIA 1GN8A 3RRXA 4KRXA 2YJTD 3N8KA 3R0ZA 3VRHA 2IDMA 2R85A 4I2NA 5IJZA 1Q1AA 1WKCA 1XNJA 4YRRA 1H2BA 5AWFC 2R00A 2YMLA 4B4VA 4KSCA 3V1KA 2EX0A 1NWHA 3HYRA 1G7CA 4QVGA 4AYXA 3PB3A 2ZM6B 1SGWA 2KS6A 1RQGA 3BTOA 3PX7A 3F3KA 4DQVA 2B4RO 5KYWB 1XZMA 3OZRA 1DUIA 2PWBA 3A7DA 4LMRA 1PV1A 4FGJA 4R0VA 3ZDBA 4AKIA 3R4VA 3EFBA 4CODB 5DGXA 3DTVB 3TKAA 5C7OO 2W42A 4CMIB 2Y1FA 1Q44A 3HV0A 3QPCA 4JLJA 3H4MA 1TJ3A 5LDDC 2GPWA 4U9HS 4FB4A 1NM5C 3V9PA 4PZ9A 2AFIA 1S2DA 3LBNA 4GP7A 3MMXA 3WLOA 3QA9A 4HGOA 1U2ZA