1P4SA

Solution structure of mycobacterium tuberculosis adenylate kinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
b'MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural and Dynamic Studies on Ligand-Free Adenylate Kinase from Mycobacterium tuberculosis Revealed a Closed Conformation that Can Be Related to the Reduced Catalytic Activity.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 49
structure length 181
sequence length 181
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p4sA00
2FA9A 4OJQA 2VSOA 4EPWA 1JJVA 2BBOA 2QT1A 4OJKA 3KQHA 3GLIA 3ZVMA 5J4VA 2XTNA 1XD9A 2E87A 3QKSB 4PSAA 5FL3A 3IDQA 4MUBA 4BFSA 2I3BA 4KXFB 1NL3A 2PCJA 1N6KA 2B8TA 3SI7A 4F92B 4HI0E 3K0SA 2G0TA 4Q47A 4OYHA 4V0OA 3AM1A 2Z5FA 3OIUA 3K70D 2XNDD 2IYUA 4M1YA 4ZDKA 2QPTA 4DLUA 4PHGA 1DO2A 3BORA 5F9HA 3O8CA 4ERNA 1UKEA 4LRWA 3CZQA 4R9UC 3ZIAD 2ZXUA 4B48A 2DYKA 2GEUA 2F9LA 4FMDF 2Q3MA 5JBQA 2R65A 3QUSA 2OT3B 2EFDB 3H0KA 1G3IA 3NC0C 5AJXA 1WXQA 3B1XA 3AVVA 1HT2E 2W0SA 3CNLA 3DMNA 3TH5A 4A2PA 2FV8A 1X8LA 2C78A 3HPQA 1OSNA 2A5GA 4V0MA 3U2QA 4BECA 1OH5A 3E2IA 4CZ2A 3OHMA 1U0LA 2WOJA 3GLGA 5AUNB 1VCNA 2WHXA 4L9SA 4LHYA 4BFWA 3BS4A 1QVRA 3K8YA 3HP1A 2ZETA 4TSFD 1QHIA 3QKTA 5FBQB 3H1TA 1DPFA 1DTSA 2ORVA 4GP6A 4F7WA 2QMOA 1LV7A 1DOAA 2WJGA 5CJPA 1RIFA 1UBGA 2ZVPX 4MGIR 4ARZA 2FH5B 3CUEF 4IOKA 3SQWA 3TK1A 2EWWA 1KHTA 1CR2A 4IOJA 2NQ2C 5HR5A 2RGBA 5CB8A 1FQJA 1V43A 5EE0A 2RGAA 3T15A 1UBCA 4Q9LA 2BMJA 2XXAB 5EUQB 4RZ3A 2BKEA 2JJ2D 2GWHA 1II8A 4KCGA 1ZM4A 1NJGA 3FWYA 1OPXA 2ZRKA 4XSHA 2YYZA 4JIMA 1DAFA 2Z43A 2XAUA 3CO5A 1MO4A 2ZEJA 4TQAA 5JCPA 3AKYA 4Q4HA 4PAQA 4LZZA 4QJ3A 1U90A 1E9AA 3O8RA 2OAP1 1Q0UA 1S3GA 4A9AA 1IHUA 3EC1A 3OFND 3U7FB 1G17A 4UXJA 3CNNA 1OXXK 2O8DA 3AUXA 2V54A 5KU1A 3EZ6A 1ZW6A 2QSYA 1E0JA 1R0YA 3C5CA 2Q3HA 1E2QA 4Q66C 4Z1MD 1D9XA 1W7AA 3X2SA 3MGCA 4DDUA 2GRJA 3LXRA 1WP9A 2DWOA 1GILA 4RD2A 5L3RA 4C0QC 5BN5A 4OHWA 5IHPA 1UKVY 4G1UC 4JLMA 5J4LA 4LBZA 1X86B 4UNRA 2ZRGA 3NG1A 2IHBA 4NPHA 2ZU6A 2QORA 3G5UA 4Q48A 5K8LA 5TVKA 1MOZA 2ZSEA 4FCTA 5CYOA 3TUJC 4LSGA 3PEVA 3RNLA 3TKLA 3TUIC 1VYUA 3GFPA 3KJIA 2IYRA 5JRJA 3RYTC 3GLFB 2FFQA 3NH9A 4NHOA 3DKPA 3WRYC 1QRAA 3OEED 3QENA 1CJTC 3L8YA 4Q9IA 4PZZA 3I73A 3KJGA 6Q21A 1W36D 3VFDA 5CLQA 3E1SA 3K0AA 3U7EB 1E6CA 3Q8XB 1N0UA 3WMFA 1RZ3A 3IIKA 5JHHB 3RS0A 4IOLA 1RRFA 2A5FA 4HAUA 1R0XA 4AURA 5TMPA 1IN8A 1VG9B 1XTJA 5C18A 2PJZA 1ESMA 5C2JB 4PZYA 4O2LA 4B2PA 1E9EA 4NONA 2JIZA 3TSOA 3OEHA 4JL8A 4JLNA 3A4MA 4BGDA 2WJJA 4AG5A 1Z06A 4M9QA 1F6BA 2Q3FA 3FMFA 4DLVA 2ZE6A 2HXYA 2DY1A 4MKHA 4DLTA 1FFHA 2VP0A 5GJWC 4TZ0A 2GCNA 1E2FA 4J0QA 2WKRA 4LBVA 2R6DA 1N3BA 1N5KA 1FP7A 1XMIA 2W83A 3L43A 4IXNA 2O8CA 1JQLB 4EJSB 2OUKA 4Q1FA 3N2EA 3U60B 5A4JA 4U02A 2XGJA 1GG2A 1D2EA 1F5NA 4XD7A 1Q1EA 2UZ3A 3GEIA 1H8HD 3N2IA 3PVSA 4JBXA 5SZKB 1CRPA 2C9YA 2NZJA 2YC2C 3U4QB 3A36A 2IUSA 4GPTA 2HV8A 3VNUA 3VNVA 3CF2A 1ZUNB 1ZU5A 2V55B 3MAAC 3OF5A 2KWIA 4XIGS 1G21E 1R5NA 3RS4A 2WJVA 1DAHA 4Z51A 2AR7A 1LS6A 2JJ8A 2ZSFA 1U8ZA 3IGFA 3RRZA 4YMVA 1R4AA 1XTRA 1TU4A 2AD1A 3AVYA 1IJEA 2ZJ8A 1HA3A 4OHZA 1W1WA 1KTVA 1UAAA 2I1VB 4LBWA 4M9XA 1TQDA 2J0UB 4EJSC 2WICA 2JLWA 2RGCA 4XWOA 1E2JA 3M1IA 3RS5A 2YJTD 4PPQA 5E3HA 1JXOA 2F1HA 3A1TA 3I62A 1GSIA 3KXKA 1Z6GA 2AL7A 1RRPA 1LF5A 1Z83A 2BOVA 2C98A 3B1WA 4IVQA 4LV5B 4B74A 3TQCA 4D4LA 3RWOA 1CS4C 5KDOA 2ZJAA 3C14C 3T5DA 5JMTA 1KO5A 1MRNA 1II9A 5FOXA 4NYIR 3U7HB 2OESA 2A9KA 1N0WA 3SBDA 1L4YA 1VTKA 2QMUA 1GKUB 4I1UA 4NL4H 5JEEA 4RY2A 4AYXA 3WBKA 4DDVA 1NSTA 3A1VA 5FI1B 4AKHA 4HAYA 3MJHA 5L3SB 4W7SA 1G5TA 1T3SA 1KO4A 5LB2A 2BM0A 2QAJA 1GRNA 2D74A 3RS2A 4B3FX 5JJLA 3THYB 3IKJA 2GAOA 4GL2A 1BIFA 2J46A 2ZUDA 2YOHA 1NN0A 1NBMD 3N5CA 4Q00A 2YOGA 3TQFA 5JEDA 3FKSA 3KXLA 2PBRA 3WRXC 1T0JB 4OK6A 1OFIA 3Q72A 2NO6A 4U00A 2GXSA 3C8UA 1PVOA 2H7VA 1XD2A 2ZITA 1VCIA 1MKYA 1X8KA 5FPKA 3AB3A 2CE2X 1G7CA 5HCIA 3J81k 4KFUA 2R62A 3CM0A 1J90A 2LKDA 2OCPA 4ESVA 1KI6A 2Z83A 2DHRA 5BYKA 1JXMA 1DARA 1NN5A 2ANBA 1EFRD 2H1LA 2D3WA 2DFLA 2IK8A 1KI1A 1I2MA 1VECA 2DFKB 1UF9A 3EXAA 5EXPA 4JBYA 3W8NA 4BASA 2O8FA 1E0AA 3K0CC 4E5UA 3S1AB 4BFYA 2OO7A 2RGNA 1OIXA 4UNPA 4JLJA 3QOFA 3LD9A 4LYJA 2DWQA 3SQXA 3ADBA 4S35A 5FOWA 4CIDA 4C0KA 1NIPA 3SC3A 2Q9AA 1LS1A 1P7CA 1N5LA 3GEEA 4HLDA 4US2R 1MO3A 3PEWA 5FFMA 2ZRAA 1XF9A 2WJYA 2E1RA 1QZXA 5FL7A 3EPLA 5ANRB 3AVWA 3MWKA 2YV5A 2FPMA 5FBVB 1YR8A 1E69A 1AKEA 5EXSA 3AP1A 5KDDA 3L2OB 3CR8A 1DAEA 2ZI4A 3BERA 2FN4A 5F2EA 2ORWA 4QBFA 5SZJA 4ABYA 4JVLA 2GEDA 3VR1A 3SN6A 1PUJA 3FFBA 2OXCA 3JVUA 2FSGA 3GJ8A 5DISB 3BC1A 1XZQA 2F43B 4HUQA 3ZJYA 2XB4A 3ZZUA 2J7PA 1HURA 1JALA 1R8QA 2F3TA 4KSCA 3VHLB 2ZIAA 1OXSC 2CL0X 5C4GB 3WBJA 3K1JA 1JEEA 2FSHA 2W58A 4A92A 3T1OA 2YWGA 4XVRA 5L8VA 2XB2A 1B0UA 3B78A 2P6UA 5AJYA 2VL7A 3A6PC 3BH6A 4RD6A 2UVQA 4IVRA 2GXAA 4ON9A 1AS0A 3PUXA 2YWHA 1HQYE 3LVQE 1E99A 4EPYA 3NH6A 4B76A 2REOA 1OT3A 1VMAA 4PFSA 2OXRA 2ASEA 4JLBA 1E9RA 4NCJA 3AKEA 1WF3A 2CK3D 1G291 3B1VA 2QM7A 4LC0A 2F6RA 3IBYA 3OESA 4UJ5A 4DDTA 2O8EB 1GL7A 1MABB 2QAGB 4LJ6A 4QNMA 4AWXA 4HLUA 1YU9A 1E2DA 2Z4RA 2IEZA 4EAQA 4OHYA 3IEVA 1DO0A 2D7CA 3IUYA 3WYAA 4URWR 1E2NA 1AIPA 1UPTA 1YZLA 2HYDA 2ZANA 4KV9A 4WXPA 4N0EA 5DLQC 2QA5A 5EQTA 5FPYA 3T06B 3X1ZA 1SULA 4YDSA 4A0RA 1CR4A 3TSWA 2BVNA 2VIIA 3A1WA 3UKDA 1F2UB 1YKSA 4ZCIA 3DOFA 2OILA 4Q18A 3Q9LA 1G4AE 1GIAA 2GJ9A 1KK3A 2WWGA 3HU2A 1G4UR 3ZVRA 2VHQA 2GCOB 1A82A 2GF9A 4ZPXA 2ZM5A 1NMYA 3X1XA 4Q1DA 4I81A 4DUGD 1P60A 2IT1A 4Q7KA 2IS6A 3B82A 1R6BX 5D3MA 4ZDWA 5FUYA 1W36C 2QAGC 3TR0A 2ANCA 3R8CA 3BBPA 3HYRA 3I92A 4DLYA 2B7CA 1GL6A 1KO7A 4XD7D 3ZIAA 4DCUA 4BFVA 2R6CA 4KU4A 3DZDA 3AVUA 2WM9B 1U8AA 2X2EA 1NBME 3CNOA 3C16C 4D25A 3OE7D 1EFTA 4NCKA 2IUTA 3ADCA 3LNCA 3L82B 1US8B 4W9MC 5EJEA 4M1WA 4CW7A 1GOTA 4B35A 2Q9CA 1R7RA 1OB5A 3F8TA 1E2EA 4TMXA 5CIWA 3AVQA 1W2HA 3T1VA 3QBTA 1E2IA 1GVNB 2XJ4A 5GVRA 3KKNA 2JLUA 4TSFA 4MGKR 2AN9A 1U9IC 3GLHE 5CB6A 3THWB 1H65A 3UMRA 2LCFA 5FUWA 2GILA 1DVRA 4I99A 1E0KA 5KNBA 2QP9X 1P6XA 2PZFA 4JL5A 1E9CA 1TEXA 1EWQA 3W9YA 4DT1B 1AZSC 2GXUA 2IF0A 5FI0B 2ODBA 1SKQA 3T1TA 5J4HA 1QHNA 3CW2A 1JNYA 2DB3A 2ERXA 3LLUA 3VR6A 2ZJYA 4BLOA 4OK3A 1KKMA 2JJ2A 3BH7A 3UATA 4ZV4A 3A4LA 3EASA 4P32A 3QSYA 2PT7A 1NKSA 5E7JA 2JGNA 1KI2A 1S1MA 5JSZA 1HUQA 4NE2A 4JJZA 2AKAB 2BMFA 3MG9A 4C2UA 2SHKA 5DO9A 4JLVA 4P4UA 3CH5A 1EX7A 3L0IB 5CYPA 2AXPA 3QI2A 2ZI7A 2QMHA 4F4JA 2R44A 1Z0KA 3LW8A 5CM8B 5J4KA 1MO6A 3VMFA 2F9MA 4N1AA 3OFNA 3R9IA 3BE4A 3IO5A 2ORIA 1CRQA 3AVPA 3RRYA 1N6OA 2VRWA 1OLOA 3JZAA 2RAPA 5C4MA 4Z1MA 3UWKA 4TYWA 4LJYA 2C04A 3Q7QA 2YOFA 4FINA 2VSFA 3GJ3A 2HXSA 3HYTA 5SZHB 4OK5A 5CK5A 5ELXA 1Z6YA 2C99A 3UMFA 2IBMA 1K5DA 4MRNA 4F4IA 4Q7MB 4B75A 1J7KA 2QSZA 2XTMA 5H1YA 1KI8A 3RWMB 3GLGB 2NO0A 1VCOA 1Z6AA 4LI0A 2CVHA 2H18A 4XH9B 3EPJA 3OEEA 1NJFA 3FVQA 3KTAA 5FPSA 1YZQA 2KB0A 4FW9A 1M74A 1E2MA 1BMFD 3L8ZA 5HE8A 4DSOA 1A2KC 2ZR0A 3ASZA 1AQYA 3DOEA 4ARZB 3TW4A 2H16A 3V9PA 3AQ4A 3K53A 1QHHA 1Z47A 1TQ2A 3H84A 2BMEA 1NVVQ 1BYIA 3DDCA 5H68A 3H86A 3T5GA 1HQCA 2VP9A 3RRNA 3C5HA 3EWSA 4NCIA 2G88A 3B9QA 1II8B 4RCZA 5KSYA 4CEHA 2ZRJA 3U7GA 1RFLA 4MH0R 4URUR 3BB1A 2D4HA 3EX7C 3W6NA 5FTNA 1ONBA 3SR0A 3AVTA 3VR4A 1XXHE 4IFBA 4JZKA 1TQ4A 4V0NA 3PITA 2N42A 4GOKA 1S9DA 4MYHA 4O3MA 1RVDA 3OIWA 2IX3A 3KX2A 3ICEA 1FZQA 1KIMA 1RRCA 4L16A 1MRSA 3GPLA 1H8HA 1JR6A 5IT5A 2O8DB 2QZ4A 4GI7A 1KOFA 3FE2A 5HKKD 2VP5A 2O52A 1IXSB 2RHDA 2ZRFA 4JL6A 2OCAA 3ONWA 3WHLA 4W5HA 3W5JA 1ZP6A 2WSSA 4D6PA 3VR2A 2NTYC 4QBHA 1XEXA 5TY0A 4IFEA 1Z0IA 4M22A 2Z6VA 4HZUB 3GJ7A 3TAUA 2FFBA 5DI3B 1CF4A 1AQUA 4X8OA 4DZZA 4PHTA 1QHXA 5F9FA 4OI2A 2BKUA 3CRMA 1GL9B 4HDQB 4L9WA 2PL3A 1NMZA 3WMEA 1AGPA 1JR3D 3KB1A 4L4UA 3W34A 3NKVA 3R9WA 1R5BA 2UZIR 3UIEA 2JJ1D 4DEXA 1N6HA 4OI1A 621PA 2BV3A 1OXTA 5K8UA 2JLQA 2WKQA 3FYHA 3OZXA 5J40A 2WWIA 2R8RA 1E1QD 3PXGA 1NLFA 1D9ZA 2ZRIA 2QBYB 2CL6X 2VP2A 2CCKA 1OXVA 2RMKA 3NEJA 3R7WB 4UQOA 3K0AB 3W90A 1Q21A 4HB3A 4G5RA 4Q1AA 1J8YF 2YNMA 2P3SA 1VG1A 2FGKA 5TB5A 1A4RA 4QGFA 1G7SA 3OIYA 4V0KA 3BRWD 1ZD9A 2F1RA 2HCBA 1M6NA 3WP0A 3GQBA 3L0OA 3V4FA 3CX7A 1NIJA 1YZNA 1T4GA 2B6HA 1NKTA 4JSTA 4A4DA 4US1R 1G41A 1D8TA 3MWLA 4OQXA 5DI9A 1M8PA 4KVGA 1E4YA 1IN6A 1KY2A 1NBMA 2NG1A 4LHZA 5BXQC 4DCSA 1R8SA 4II7A 3EIQA 2O8CB 4ESHA 2FPLA 1G8YA 1MO5A 1ZJ6A 5CIQA 2PT5A 3VQTA 2C2HA 5JI2E 3AF0A 1OKKD 4WXRA 4UNQA 4TL9A 2ERYA 1PUIA 4W5WA 3TW8B 1TMKA 4XTRA 4BLPA 4EFLA 2YVUA 2V3CC 1XX6A 5JI3E 1E9DA 2ECKA 5IK2D 2ZI6A 5EP4A 3GLHA 2IUUA 1XJCA 2UKDA 3F3YA 4M4SA 1G3MA 4QG7A 5BYJA 5L3QA 1OH7A 1TAGA 1GM5A 3EPKA 1OE0A 1XDBA 4IJMA 1MV5A 1G64A 1EFRA 1Z3IX 3QVVA 2FWRA 4QXAA 3GCGA 1Z6TA 5JS7A 5BW8A 2EFCB 3RC8A 1CP2A 2V4ZA 2IWRA 1E2GA 1JECA 3ZDQA 4PHHA 3RVBA 1GITA 3ZQ6A 4DB4A 1D2MA 5FOVA 4HAVA 2BWJA 1VYVA 2LWIA 1P3JA 2KJQA 2C9OA 2ZSDA 3QXHA 4ZIRB 3CPEA 3GJXC 2IHYA 5LD2C 1W0KA 2IYTA 2JDID 1G6HA 1DAIA 3FMOB 1TUIA 5FTKA 5G53C 3TSZA 2WOOA 4EPXA 3QKRB 3A8TA 2WKPA 3U44A 3LA6A 4E03A 3CX8A 2A5DA 3I4LA 1IONA 1E4VA 2XZOA 1KJZA 1X1RA 3MD0A 2G1JA 1G16A 3GLFE 2AWNA 1QG2A 1U81A 2H57A 4CEJA 2OLJA 1L4UA 4HDOB 2F1JA 4JS0A 1G5RA 4AD8A 1XTQA 4NYJQ 4RKFA 5M04A 3QXSA 1KNQA 3REGA 3QVUA 1D5CA 4OI4A 4TLAA 2OG2A 1KMHA 1NMXA 3I8XA 4FWIB 3VAAA 4BPBA 2IC5A 1CJVC 1QBKC 3GFTA 4EIWA 1AS3A 4YMSA 3D3QA 1PJRA 4MQBA 4B6FA 1XD2B 4C0SA 2FPKA 4HZIA 3T35A 3VU9B 1DAKA 3UXMA 1XPUA 1SQ5A 4Q4JB 1S3SA 1DE0A 4B34A 3MSXA 1Z28A 1ZU4A 4P0TA 3SJBA 1FTNA 1KI6B 4LK2A 1YHNA 3K9HA 1L7VC 5BWMA 2FSIA 4LYAA 2H92A 3P27A 4MDFA 1G19A 4V03A 2FOLA 2VYFA 2CK3A 1G7TA 521PA 1JQJC 1P9NA 3NHBA 4N3NA 1UBEA 2QPOA 4YMUA 1T6NA 3N70A 3R20A 4TN1A 1NLZA 3SOPA 4FCVA 5C1BA 1JR3E 3NBZC 1XTIA 3RDPA 3U61B 2F55A 1P2UA 1VDZA 2Q0HA 4OQMA 3UG6A 4YXWD 1EESA 3NC1C 1SZPA 4Y0VA 1XXHA 1QF9A 3R8FA 4ILEA 4PC2A 1IY0A 4LBYA 1ZUHA 2WV9A 1VHTA 3ZQJA 1N25A 4L5BA 3KKQA 1E1RA 4HAWA 2FSFA 1E96A 1KSHA 4G5SA 4TMKA 5FR1A 1Q44A 4DRZA 1W4AA 1J70A 2C03A 3IPXA 1OFHA 3KDSE 4GZMA 1Z6XA 1NVVR 1OYWA 4LV8B 4C30A 1TPZA 1KKLA 1ZC3A 4P33A 3PR1A 2P67A 3IIMA 4DUGA 2V6IA 3DPUA 4RFSB 4PR0A 1JJ7A 3C7KA 4OL0A 1T5IA 3UK6A 1ZCBA 2V1UA 5J47A 2Y8EA 4O0MA 2G77B 2HJVA 2RGNC 3HU3A 2J45A 5CDFE 1NRJB 4BZPA 5KPJA 1Z0JA 3P20A 4HUQB 3GD7A 2KSQA 1AN0A 1W5TA 1Q1ZA 5FTJA 1W4CA 4BFXA 2J7KA 4G5QA 3LWNA 1L8QA 4IEIA 3QPUA 1E9SA 2JLXA 3OE7A 4ACAA 2WSSD 2CL7X 3QY0A 1WDTA 2PEZA 4PC3A 5DGXA 1GTVA 5JCZA 1KGDA 3RLFA 1XRJA 2W6JA 1XCPA 3CF6R 3NHAA 3FHTA 4QGGA 2ZSBA 4HLCA 2QP3A 2GZDA 4WZAE 3KKPA 5CLLA 2GVDC 1T91A 1W44A 2A30A 1FX0B 3AKCA 4RD3A 3BWDD 4IVPA 4PQYA 5AK0A 2FNAA 4C2TA 4I1SA 2MMGA 4Q1EA 3ADDA 5JWHA 1O3YA 1XMSA 3DM5A 1SXJD 5KUTA 1U0HC 2W2VA 3AGPA 3THXA 1KSFX 3NWJA 4TMTA 1HE8B 3PUVA 3QF4B 3E5HA 2ZRPA 4GMXA 2RGEA 4OHVA 4R2HA 1J8MF 2EFEB 4Q21A 1JAHA 1MT0A 4IDOA 2GETA 3ETLA 4DIEA 4AI6A 4RKEA 1HT1E 1AGRA 4Y0AA 4NMMA 3HPRA 3SE0A 4ZDJA 1CULC 1NY5A 4TLDA 2CJWA 1Z5ZA 2EQBA 4GOXA 4PPNA 1HH4A 2ZREA 4LDJA 4EFMA 2IEYA 4EKDA 2P2LA 2EVWX 2H8KA 3U3OA 1QHSA 4D82A 5DH9A 1TL7C 1PLJA 3P32A 1LY1A 2W6ID 4V02A 1XD8A 2XXAA 2DCUA 3BH0A 3K70B 4NP6A 4Z8YA 1YZGA 1R10A 3UMSA 4HLUC 4NYMQ 2FZLA 2WWHA 3AV0B 3BD9A 5AWFC 4PPGA 1OIWA 2IS4A 1IBRA 3NDPA 5KSOA 5FUXA 1KY3A 2JLYA 1BS1A 2G83A 3EZ9A 4OI0A 4NH0A 3CX6A 5TXGA 4G5GA 4Q7LA 2NPFA 2GK7A 2VBCA 2QL6A 1YR7A 5SZIA 1E2LA 4QJ4A 4U7DA 4TTRA 5GJBA 2G6BA 4B73A 1I4LD 3SDZA 1P4SA 1G20E 1M1YE 2VSXA 5H70A 1HYQA 3AF1A 3PIRA 4HUTA 3FGNA 1KK0A 2BJVA 4HSEA 3D31A 2CNWA 5G3YA 1XJQA 3QE0A 4ZO4A 3K70C 1TTTA 3ZLJA 2X8AA 2EW1A 1BMFA 2P6NA 3DL0A 3MMPA 4URVR 4TQ9A 5UKDA 3L0SA 1Z8FA 4BZQA 1GZSA 2DPXA 3HDTA 4UKDA 1P2VA 2AHOA 2Z0MA 1OJLA 1FMJA 221PA 4RZ2A 4PXAA 3Q5DA 3FHOA 1UJ2A 2I1QA 1CEEA 3GLFA 1W0KD 1KZ7B 5FBLB 5FPTA 4XTCS 1W4RA 2ATXA 2J9RA 4DKXA 2BCGY 1P61B 2BM1A 1SHZA 2Z4SA 3CWQA 1KSGA 3NEYA 4Q4AB 5JSZB 3MCAA 2FDCA 5BN4A 4KYIB 3SU8A 2OCBA 3P4XA 3KFVA 4TT3D 4Q5IA 4V0LA 2GESA 5BQ5A 2X19A 4NTZA 3VX4A 2RGDA 3BK7A 1N6IA 5HKKA 4WAUA 1G3UA 4IEEA 4YQFA 3AEZA 1O87A 1ZNYA 4TQUS 1QG4A 4MKIA 4MRRA 3TAHA 1W48A 4JT4A 2C96A 4G0NA 4JLAA 3EPHA 1FNMA 3WYFA 3K0EA 3RSOA 3WNBA 1EFCA 4CEIB 1DADA 1NY6A 3CPHA 4WA7A 1M7HA 2CCGA 2H5EA 2W0MA 3ADKA 2RGXA 1NP6A 4P31A 3SZRA 4GP7A 2QENA 1T3LA 4DLXA 5KNDA 1JR3A 1KO8A 1XEWX 5K8TA 1R0ZA 2ZRDA 4BWYA 2JJ1A 3HU1A 4MKFA 1S96A 1LNZA 1EG7A 4TMWA 4B3BA 4TYPA 4EPTA 1F3OA 2O5VA 1E1QA 4IKEA 2V8OA 4KJZA 3KTAB 4HLQB 1Q22A 1EFUA 1W36B 5KO2A 3B6EA 2ZE7A 4TLEA 5JJKA 1II0A 4WIAA 1E9FA 4CT4B 4Q19A 1XCGB 2WAXA 5BN3A 4E07A 1JAIA 4KFSA 4PO8A 3LQQA 2J0UA 1TQ6A 1X8JA 1HY3A 2OZEA 4XWAA 1SXJE 1QHHB 3PFIA 3FFAA 3QEJA 5GVSA 2NZ8A 1J99A 2RCNA 3KUDA 3ZD7A 5AJZA 1KK1A 1I2DA 1VCMA 1OHHD 5DYIA 1E1RD 1DG3A 2O0KA 1OW3B 5CDFA 4Z8XA 4HYYA 1YVDA 3LBNA 4PC1A 3RHFA 4CEHB 2ODNA 3NTUA 4JJKA 1YZKA 4EDHA 3B1ZA 2BBWA 1FL9A 4CDGA 1G9XA 2IYVA 4LHXA 3THOA 1FNNA 4DJTA 1OKKA 3PUZA 3I72A 2MSEB 4WW0A 2BBTA 2N46A 1NVUQ 3PUYA 3WNDA 3CRVA 4XVUA 3I5XA 2V6JA 1DAGA 3P26A 2XNSA 3EAQA 3QG5A 3EIHA 3G82C 1AJEA 3THYA 2OM2A 5IK2A 2RKOA 3KUCA 3VKWA 1GKIA 3BJIC 1N6LA 4BUJA 1M2OB 2ZVQX 1XEXB 4GOJA 4PHFA 1XPOA 2GJKA 2W6JD 4DSNA 3SNHA 3PV0A 2R6FA 4GFDA 3QIAA 1ZNZA 4LGMA 4X8HA 4QL3A 4M21A 2WWYA 4HEJA 4Z54A 5FBWB 1ZCAA 3EA5A 4ZCLA 3QEOA 3QJYA 2ZJBA 4PANA 2WBLC 4YC7A 2KBFA 4ACBA 2X1VA 4AK9A 4JVSB 1YR6A 1SKYE 5J4YA 5KSZA 4M1MA 1GNQA 2ZRLA 2PZGA 5AUOB 3RABA 3ZVLA 4A15A 4BEJA 1HV8A 1KJWA 4JMPA 2P0EA 4PAOA 4A8JA 1OFUX 3JZMA 4TL7A 1LTQA 2JDIA 5EXTA 3DVLA 2KBEA 5B57C 5B64A 2MSCB 3KJEA 4L8GA 3MWJA 4MRPA 3G0HA 1U99A 1FUKA 5F98A 4QNRA 1UADA 5AUQA 3S1AA 2AXNA 2CBZA 2OEPA 3GLIB 4P4SA 2JA1A 1M34E 3A58B 1ZIPA 2ZR7A 2G1KA 2OFXA 4Q9KA 3BOSA 2FE4A 3RAPR 1ZIOA 4RVCA 4LYFA 3C15C 4EPVA 1Z0AA 3LAWA 4KVAA 4K8OA 1N5IA 1SVLA 4LY6A 3BGWA 5H8WA 1IY2A 3FTQA 2VP6A 4RFVA 3QPVA 1IM2A 1QDEA 2QUZA 4LJ8A 1CBUA 1MH1A 2ZUCA 2ZQ5A 2BEKA 4Q9JA 4I4LA 3U3JA 1YZUA 3IBGA 1XTSA 2CLCX 2Q21A 4KITB 3KQKA 1H8ED 1M7GA 1P62B 4S2EA 2IYWA 3KQNA 2GJSA 3WYGA 4JLDA 4AY2A 1SVMA 5JHGB 4CGZA 2GJ8A 2PX3A 2R2AA 4NU0A 1N5JA 3L0PA 1DG1G 1G1MA 3B13B 2ZJOA 1EXMA 5TARA 4NYMR 2QRNA 3LY5A 1AZTA 3H4MA 2EYUA 1UBFA 1RC8A 4M53A 5L3QB 2ZAOA 2QQ0A 4DCVA 1Z07A 2AK2A 4BLTA 1OH6A 3IILA 3VKGA 4B3GA 2ZUBA 5DE3A 2JASA 1IJFA 2J1LA 5DIFA 2FGJA 4URXR 1P2TA 4IDQA 2D62A 4M9ZA 2CNWD 2ODWA 2YWEA 3B2EA 5JZVA 1E9BA 3SFZA 5FOSA 1ZC4A 5LPNA 4YXWA 1CTQA 4ITRC 3T34A 3KXIA 2IYSA 4G5OA 1A2BA 4DHEA 2WIAA 1K6MA 4GBMA 3NBYC 3TE6A 2ZU0C 2GEVA 2PCLA 4UNSA 3AGQA 2BHRA 3OAAD 3DHWC 4MDEA 3SJAA 4D0GA 2O8EA 2QTFA 2QEQA 1UFQA 5JFGA 3PJRA 2ZPTX 4Q01A 3IO3A 2IYLD 3U44B 4FIDA 3B8HA 2WVJA 2A7QA 2IXEA 2GTPA 2VEDA 2J0VA 2O0HA 2ZJZA 3PCRB 4KSBA 5K8IA 2HLDD 4Q03A 4PO9A 1NNEA 1IN5A 1R2QA 1XNJA 1G3QA 1XU4A 2FF7A 1KAGA 2OE2A 3HR7A 4Q4HB 4CEJB 2LKCA 1Y63A 1OFTA 1SVIA 3FMIA 1NN1A 1UKZA 1TU3A 2YKGA 5KPDA 3TBKA 5FH9A 1F60A 2JLSA 4BFUA 2O8BA 3WNCA 2PMKA 4BLQA 2VPPA 4QHSA 1T3HA 2QN6A 3RC3A 2ATVA 2BBSA 2OSBA 2WJIA 5KDLA 4B3CA 3GFOA 4BEBA 2PJRA 1KMHB 2QGZA 4RD1A 4BRUA 3RS7A 1NN3A 3QPWA 3ZS8A 1RJ9A 3T12A 4O25A 4EPRA 1F2TA 2BIFA 1TUEA 3SYKA 2PX0A 3BXZA 4EFNA 4CF7A 5TV2A 1E79D 4QOSA 5FOUA 1JPJA 4HB2A 2IW3A 2ZS9A 4URYR 1XTKA 3AKDA 1GP2A 4PQRA 1SXJA 4A2QA 1Q3TA 3U3MA 2QM8A 4ZDIA 2W2TA 2NIPA 3TIFA 3H2YA 1RPZA 1N6RA 4MRVA 4WOPA 2RB4A 1T0HB 2QI9C 5FBRB 2RGGA 1CR1A 4RD0A 1T5LA 1X1SA 4K81B 5HZKA 2FU5C 4G3XA 4IDNA 4BFZA 1W0JD 4XJXA 3IQXA 4TTQA 2ZYTX 4NZYA 1XXHB 2GBLA 5CK4A 1XEWY 3FB4A 5A0FA 3THWA 4DIDA 3K09A 1V5WA 4LJAA 4AKEA 5EP3A 1KZGB 5CITA 4DCTA 3EZ7A 2BJWA 4NYIQ 4H1UA 3BB4A 2WJHA 2GHIA 1ZM7A 4DT1A 3CONA 2YWFA 3P1JA 3AF3A 5LB4A 5KOYA 4QM7A 1IAQA 2G3YA 1WRBA 2W6IA 3LV8A 2IYQA 3W5IA 5HPYB 4PC7A 4OKSA 5B2ZA 1NI3A 1BO6A 2XX3A 4GZLA 2X2FA 5HCNA 4M0LA 2XOKA 2ZRBA 2ZTSA 1ZNXA 3LBHA 3SFVA 5E7IA 4IDHA 4DVGA 4EUNA 2N1BA 1KI7A 3K0FA 1U94A 3TMKA 3EW9A 2WMOB 3QBVA 4LX0A 1Q57A 4PTLA 4C4PA 3I5YA 2EFGA 4DC9A 4DEYA 3U5ZB 2GDJA 2V7QD 1LW7A 3HWSA 1OH8A 1CJMA 1QHYA 5LD2B 1TF2A 3NXSA 3EARA 2X77A 2XITA 2ZYWX 5B58C 5C46F 1D2NA 1KNXA 3PEUA 4OBEA 5DN6D 1GAJA 4A82A 4D81A 3OIVA 2ZS7A 721PA 4JVMA 4R2IA 3MLEA 1IN4A 4WBSA 1ZNWA 4QHTA 3BFKA 3TUZC 4MRSA 4KO8A 1XEFA 3CKLA 3ZYCA 2OAQ1 3QG1A 2H17A 3AP3A 2B92A 4MYUA 1YRAA 4A6PA 1SHKA 4PQFA 1UKYA 2GNOA 1Z2CA 1E2HA 1GKYA 3W8RA 3THXB 1NLYA 1NG9A 2ZR9A 4LCBA 4DCNA 4TWZA 4GNKA 2BDTA 4AIIA 2VO1A 4L15A 1KMQA 3EC2A 3CRW1 2ZI5A 4BQSA 5JLJA 4P4TA 3QF7A 4MUAA 4N0DA 2IXGA 2EFHB 3Q85A 5EE5B 4JKIA 3I61A 1P72A 2PZEA 2AFHE 2NO9A 5E7MA 1HTWA 3AP2A 4MYCA 2CJWB 3F0TA 4XOIA 1SGWA 1J2JA 4LV6A 4OHXA 3WY9A 1COWD 4FD2A 4TTPA 4TT3A 1XMVA 2GCPA 4DWJA 4TL6A 3FOZA 3CB4A 4RZUA 2QU8A 5KYKA 2AFIE 3NVAA 1IN7A 3TLXA 5DHFA 3D6TB 4JYCA 4DXAA 2ZROA 3MFYA 2WWXA 2NMVA 4C0LA 3T61A 4ZI3A 1VHLA 4DLRA 3W3AA 4DLZA 821PA 2A78A 3CIOA 4AC9A 2CLSA 4M8NE 3CRQA 1XZPA 3KQLA 3R9XA 3GP8A 1XP8A 4MA4A 3ZS9A 3CF0A 1XCMA 3AH8A 1EWRA 3DO6A 3F5FA 3LO5A 1WMSA 4LHVA 1YJ5A 5DSZA 1CXZA 1IQPA 1HEIA 3QXJA 4DB2A 3B60A 4GMDA 4LUCA 4C7OA 1NVWQ 2DBYA 4JT2A 1C1YA 1EFHA 5KHOC 2B7BA 3VKHA 1IXZA 2OBMA 1UDXA 4QC2A 2XSZD 4IOMA 2FX3A 3A1SA 2XZPA 2OV2A 4JYBA 1Q3HA 4A6XA 2E9SA 3A4NA 2O8FB 2NPIA 4HZUA 4LPKA 1C4OA 3TRFA 2VHCA 5JJIA 5DI3A 4FCWA 4D0LB 4H1VA 5GJVC 3UPUA 1NG1A 4E09A 4CYMA 3RS3A 1KK2A 5JWOA 2CLDX 2FEMA 4IHQA 4QJ5A 1VG0B 1U8YA 1YRBA 3LRPA 4LJ5A 3BFVA 4KAXA 2CE7A 2QTVB 2J0QA 1U98A 2DFNA 3TGPA 2OBLA 2HJGA 2D2EA 1OHHA 2QGNA 2GXQA 1PLKA 2QE7D 2JATA 3DM9B 3T1QA 3ICQB 2MMCA 1ELOA 5GADl 2QBYA 1S1CA 1AK2A 1Z0DA 5DNYB 1S4QA 2C5LA 3DKVA 3R7WA 3LDAA 4D26A 2HEIA 3VTKA 4A0HA 3Q5EA 3EG5A 2ZRNA 1NVXQ 2OCYC 3KB2A 5EP1A 2GK6A 4F38A 1UDWA 2HF9A 2QY9A 2A3RA 4TL8A 4X8MA 2QP4A 3NBFA 4XWKA 4LJ9A 1A7JA 2J3EA 4LWZA 2FZ4A 4URZR 4A36A 3SJCA 3CZPA 4QBGB 3QKSA 2J0SA 2VP4A 1ZM2A 4D2IA 2IYXA 2F3RA 3EWAA 2HT6A 1P5ZB 3ND9A 2QG6A 3LQRA 2EU8A 4IRUB 3B85A 1T9HA 4NDZA 1IY1A 3KKMA 2B21A 3M4YA 1ZINA 4B2IA 3X1WA 3C41J 1WQ1R 3RRMA 1JEDA 3LW7A 4R98A 4YLGA 4CRWB 3ZD6A 1F48A 2A5YB 1G8FA 2JEOA 3I3SR 4LPSA 2J59A 4FI3C 4TLBA 2R6GA 1W5SA 1GUAA 3U6KA 4FMCF 2IA5A 1ZUIA 5G40A 2OHFA 3WMGA 4RSGA 4A0FA 1GRQA 2O0JA 2NOAA 1KI9A 1Q20A 2WPDD 2Q9BA 3CH4B 3IPYA 2P65A 4PX9A 2RHMA 3UWOA 4EQ6A 3PUWA 2CHVA 3CLVA 2ONKA 1SVOA 2C95A 3QKUA 4KYUA 3KL4A 3QXCA 2BMDA 3SYLA 1KDRA 5JWRA 4KFTA 4D4KA 4TYQA 3TVTA 4M1OA 4C0BA 3DZ8A 1E32A 4F91B 2KI5A 3EA0A 2IXFA 3VHXA 1ZD1A 4DDWA 4ZI2A 4G01B 4ASUD 2BCJQ 3GMTA 2XEXA 5EZ5A 5FTLA 1U2RA 5EP2A 1VYTA 4FMDB 1Q1QA 3ZH9B 5AR1A 4C9BA 4P3YA 3MRSA 4ZIRA 2MSDB 1L2TA 2ZJ2A 2P5TB 3I32A 3B1YA 5EE1A 3SS8A 2WAYA 4QHYA 5FPHA 3K9NA 1TF5A 3ASYA 5DHAA 4FXPA 3O47A 4BLSA 1S9HA 4KBFA 4B47A 1ZYUA 1CJKC 5D3MB 5IDVA 1H8EA 3KFXA 1AKYA 4UXHA 2XOKD 3QKRA 5JRZA 3MWYW 3SBEA 2QROA 2ONJA 5IF9A 2YINC 4QKQA 4ZKDA 2JLRA 1T8UA 3A1UA 4OQFA 2FMXA 2NGRA 3BIFA 1S8FA 1D6JA 1G8HA 1KAOA 2GVZC 1KDTA 2OLKA 2YC4C 3Q3JB 2HUPA 3MUFA 1W49A 3FMPB 4KFRA 3MJRA 1KDOA 4KBGA 2GKSA 3IIJA 1RYHA 1ODFA 1GNPA 1OB2A 1I4TD 1SVSA 1OF1A 2ZSAA 4A0GA 1U0JA 3BFXA 1LVGA 4XSGA 5EXXA 3ZZ0A 2G9NA 4QRHA 2HF8A 2P5SA 1CLUA 2F7SA 4W5JA 3GJ0A 4GRAA 4LJ4A 3U6BA 3U3KA 2VHTA 1AA9A 4HATA 1Z0FA 2CVFA 3VU9A 2WTUA 2VHUA 3HR8A 1DS6A 1OXUA 4Q4JA 4UNNA 3AF2A 3V4RA 4A1FA 3M0EA 2WWFA 3DMDA 1CKEA 3LLMA 5FOTA 2VF7A 4AKIA 1Z2AA 5CJ2A 2J5XA 1XFAA 2VH5R 4A8JB 3LX5A 2QNRA 4TLCA 5LBIA 3OAAA 4WZBE 3B7GA 3SHWA 1CIPA 4YONB 5KTYA 2CDNA 4R71A 3X1DA 4TMZA 4JVNA 3FDIA 1FPMA 2KE5A 5EE9A 2PLFA 1LFDB 1E98A 4YMWA 4NBSA 4P4SB 1VIYA 1FUUA 2FFAA 2ZE8A 3U3RA 3WP1B 2HLDA 2I4IA 1ZAKA 4AYTA 1WBBA 5AJVB 2ZRCA 421PA 5FUVA 1UEIA 4KLNA 1DBSA 2R6AA 4HAZA 3TJZA 1N2CE 4NCNA 3ZVNA 3SEAA 5HZHA 3K9GA 1P75A 4DSTA 1TF7A 2W00A 5FTMA 3QXXA 4A8JC 4NYJR 2IYYA 4TMVA 1Q12A 4RFSA 2WZQA 3PG5A 4EJSA 1FW6A 4JBWA 2QTHA 2J41A 2VQSA 4FMBB 1PLLA 1TNDA 1W2GA 2PMDA 2V9PA 4B6EA 3VR3A 4B32A 1E79A 1G3RA 1UM8A 3TR5A 1G8PA 2ZYUX 3FHCB 2QQEA 4NKRA 2WSMA 3U4QA 2OFOA 3QQ5A 4JSYA 1BOFA 4D80A 5F3WB 2K5UA 2NO7A 4CT5A 5J5CA 5LDDC 3CR7A 1TADA 4IW3B 3TVDA 5JS8A 1Z63A 2ODEA 1WB9A 1UEJA 3FKQA 4JLPA 1AM4D 3PENA 1R5OA 4MITA 4PSVA 1CR0A 4B3XA 1DELA 4F93B 2REXB 4HAXA 3C4JA 1JPNA 1NF3A 2QMEA 1FX0A 3HJNA 1W0JA 4M9SA 4D4JA 3NBXX 4UXIA 4YDHB 4KODA 4Q7JB 4FMCB 3VX3A 4LHWA 1B23P 2ZS8A 2P6RA 1ETUA 1JI0A 2NO1A 4K46A 2AKYA 4HDCA 1FMLA 1A5TA 2VA8A 2IF2A 2W2XA 4UJ3A 3TNFA 3QF4A 1GDDA 3JVVA 4OQNA 4MGYR 2GJAA 5HTKA 4PC6A 2AD5A 3LFUA 2WMNB 3I1FA 3K9LA 5KSPA 3LXXA 1GWNA 4F4CA 3Q7PA 1LB1B 3SJZA 1RRGA 4X8LA 4RJLA 2VLIA 3KZ1E 2J87A 1ZBDA 3B5JA 1C9KA 2JIZD 3OEHD 4Q1CA 4QGAA 4WVFA 4D4MA 4KLZA 2JAQA 5L3SA 4TZ6A 1K5GA 2C9CA 1S0UA 2O8BB 1QHGA 4RZXA 2V7QA 1KO1A 4BRWA 1XMJA 1WCV1 2IL1A 1GRRA 1Q1BA 2REBA 1PZNA 5DN6A 2XZLA 2C8VA 2XNDA 3K0CA 3GLIE 1RJ9B 1CU1A 5D3QA 3ZGXA 4RCYA 2G0NA 1F2TB 1LF0A 1KDPA 1MR3F 3P4YA 3W6OA 3AUYA 2AX4A 3LX8A 5HE9A 1G7RA 2A5JA 4IXMA 2PEYA 1OIVA 1DEKA 1KJYA 5E4FA 1BH2A 3GJ4A 4KHZA 5A5GA 4EQ6B 2D06A 4PAMA 4U5XA 5G3ZA 1ANKA 1Y3AA 1OYYA 1SXJB 2GA8A 2RH5A 1P9WA 3GEHA 3O8BA 4HB0A 1Z29A 1ZM9A 3V00A 4B33A 2QT0A 3CWZA 1XJ0A 1FQKA 2F1IA 3BB3A 4Q9HA 4RD4A 4DBLC 4QM6A 2IS1A 4M1KA 3NDBB 3ZZTA 5KNCA 4ZKEA 2QRZA 3BAFA 3AVXA 4Q4LA 3PEYA 1YR9A 2CEAA 1EK0A 1X3SA 4POAA 1ZVQA 1YE8A 1A1VA 4LC1A 1VIAA 4LJ7A 2FG5A 4QBIA 1TX4B 4V0ME 4PZLA 2JLVA 4M1TA 2FJUA 3LBIA 3GLGE 5DYGA 1COWA 2XTZA 1IXRC 4B43A 2D7DA 4R7ZA 1R0WA 5L3VA 3PQCA 1P73A 2L0XA 3WHKA 2HDNB 1SXJC 3I8SA 4LOAA 4JLOA 4DLWA 3M6AA 4US0R 1WA5A 4I1VA 2AK3A 1I4DD 2OFWA 4NCHA 3UANA 2JLZA 3B9PA 1KYIA 1P9RA 3GJ6A 3EZ2A 4Q4AA 3SYNA 5EE3A 4Q02A 5IRCD 4CVNA 1GNRA 1NSFA 2DR3A 5P21A 2PLRA 3AF4A 1RW4A 3K0FB 1RE0A 4ZCMA 2GBLC 4GT1A 4I1OA 2FFHA 3K09C 4O2RA 4OQLA 3GLHB 2F43A 4B2LA 2V1XA 1SKYB 4M1SA 4QFMA 1G18A 121PA 2D2FA 1AS2A 3FKSD 3ECCA 3RANA 1XPRA 3UG7A 2Q6TA 2XSZA 4FN5A 4B3DA 2TMKA 3EZFA 3AVOA 4CEIA 4TYYA 3DEFA 2GZHA 1W47A 4DLSA 4M2LA 3LH5A 2C77A 5CM9C 1JB1A 1HE1C 2CMKA 1E2KA 4JLKA 1XB2A 3WXMA 4BLRA 1KSJA 3NIBA 1EGAA 3REFA 2BEJA 2XJ9A 1W46A 1SVWA 5B30A 2VF8A 1ZRHA 3E70C 2EYQA 1DAMA 2BC9A 2IYZA 4BZXA 4PSKA 1QVAA 2QE7A 1FOEB 3D7MA 3LVRE 3KKOA 2CXXA 3CBQA 4WZ6A 4C0AC 1MABA 1VG8A 2QAGA 4TYNA 1JBKA 2ZJ5A 1E3MA 2GF0A 1E94E 1S2MA 1EX6A 4C0JA 3IEUA 1ZM3A 1K8RA 3FPAA 1XBTA 2WWWA 3A37A 1ZD8A 4B71A 4GDFA 1OV4A 3ND8A 4B44A 5AUPB 2YHSA 1FTSA 1F2UA 1N0VC 1TEVA 2VHJA 5E95A 5FL7D 1BKDR 1G5PA 4MYTA 2VTKA 1M7BA 2OBNA 3SHFA 1WBDA 2GCOA 5FR2A 1E2PA 4FWTA 3GJ5A 2ZRHA 4LYHA 3W6PA 5EUMA 2HT1A 3D8BA 4MGZR 5G41A 3CPJB 1YQTA 2ZI9A 3X1YA 1BYUA 1IOZA 2R9VA 1X6VA 1U9IA 2WIBA 1CJUC 4PPFA 5EZ6B 1RYFA 3IHWA 2ZAMA 1ZMXA 4PO1A 2QPAA 1T8TA 4A2WA 4BE7B 4C7OB 4D0NA 1Z22A 1KI3A 2CCJA 2IWHA 2CHQA 5GJCA 1W4BA 1YZTA 4QGHA 4AYWA 3KQUA 2J7PD 1PV4A 2IS2A 1VKJA 2WPDA 3VR5A 2ZRMA 2ZI3A 4GSYA 2A2ZA 1E0SA 4MKGA 4AKGA 4DSUA 1G6OA 4KI0A 2YZ2A 5JECA 8OHMA 3EIEA 1US8A 1ESNA 4H9GA 5AJWA 4IDPA 5TDHA 2HYIC 2ZE5A 1N6PA 2AWOA 2EWVA 2DFTA 1N6NA 4YMTA 2JCSA 4Q1BA 1RKBA 1SVKA 2CHGA 2DWPA 2PH1A 3RSLA 2HCJB 3IQWA 2ZYVX 4BFTA 4ASUA 4C3ZA 1WE2A 2B8WA 1GFIA 1KI4A 2GZAA 1Z08A 4AG6A 4C0HA 1FP6A 1XWIA 1VPLA 3IHLA 1G8GA 2FEOA 4E22A 1P2SA 3KJHA 4HB4A 3QNUA 4JKYA 3O8DA 4XVQA 2GAAA 3W3ZB 3CRRA
chains in the Genus database with same CATH superfamily
4F56A 2FA9A 1K89A 5I8WA 1NX6A 2NYVA 4AZVA 4DADA 3VR0A 3KE8A 3MBIA 1Z74A 2BBOA 2OBXA 3KOZA 4OJKA 4TXMA 4EA6A 1WOYA 1PD1A 5CCXA 3GLIA 1CY2A 3NKLA 1SCQA 1XD9A 2ILVA 5CFLA 1G4HA 4FE7A 2RAFA 3BTSA 3KTDA 3MWDA 4E4TA 1ZSNA 3RFCA 2PR7A 4KXFB 3FR7A 2CDAA 4GE0A 3T3NA 4P53A 4F92B 1H42A 1U9ZA 2E21A 4WKGA 2BZGA 3K0SA 3JVDA 4ZVRA 1XHEA 3RW9A 1UBUS 4K0RA 4PLGA 1YQWA 2PGOA 3C3WA 3PRYA 2W2LD 2XNDD 2ETXA 3FNEA 3NUQA 3ZDEA 4BNUA 1PEKE 5IBCA 5KTKA 2JIPA 4TVOA 3WMXA 1OU0A 3CISA 3ANSA 3MTDA 1MHTA 4W5RA 2A57A 5HRCA 3CZQA 2ZXUA 1XRPA 2CHUA 3PUKA 1N2OA 2F9LA 4OOFA 2Q3MA 4LMBA 4LQCA 3WJ7A 5HUJA 2OT3B 3H0KA 5ALOA 1WKCA 3DZBA 3LBFA 2QD3A 3DMNA 1SA0B 2Y1LA 5EFZA 1JA0A 3OZFA 1JIXA 3CEAA 4LY3A 2YXBA 1UJBA 5JSFA 2FV8A 2C78A 2IPXA 2RBGA 1OSNA 1ZXLA 2ONYA 4HNQA 1VLQA 3D6VA 5L7YA 4BECA 2YFYA 4FT2A 4CZ2A 4NAHA 4ZQIA 2V97A 2COUA 2WOJA 3A27A 4I46A 1XZHA 3ZWVA 2LXNA 4NFHA 2PH7A 3K0BA 2GAJA 2EEZA 5EMHA 1NT4A 4MWEA 1TD9A 4CCSA 4TSFD 5FBQB 3GVHA 2FCAA 1DPFA 1DTSA 3N0RA 2ORVA 2POQX 4GP6A 4BTLA 1MC4A 4CG1A 3JASA 13PKA 1YQGA 2WJGA 1KZ6A 1RM4A 3DTVA 4XDGA 4L0MA 2HD4A 2ZVPX 5CJPA 3RUHA 4ARZA 5KKCA 1NG9A 3O7WA 5J63A 4F85A 3CUEF 4IOKA 4CM8B 4WH0A 2P5UA 4W5QA 1W1IA 1EFDN 1QNLA 3H2SA 1GA6A 5ULLA 2YXLA 3F8WA 2RGBA 4WCFB 1HDZA 5HMLA 2RGAA 3ZCSA 4OHUA 3UJHA 2B5VA 3PC7A 1Y3HA 2C2ZA 4RZ3A 1PDVA 4G0QA 1ZW1A 3TDMA 4C87A 5L9AA 4CKWA 4Z2AA 1EUDB 1OPXA 3HKEB 1CQXA 1I2ZA 1S3FA 2G06A 3O2JA 1DAFA 1UR5A 2LBPA 2Z2YA 2Z43A 1GA4A 2XAUA 3B3FA 4BUCA 1NBAA 2ARKA 4LZOA 5AD1A 4AZWA 2A8YA 3ZJUA 3AKYA 4Q4HA 2C5AA 5JC8A 4QJ3A 5LQUA 1SBTA 3RIHA 4XQEA 3ZNNA 1F1BA 4DMRA 3V1TC 3P9RA 1WPGA 3FPLA 1IHUA 4LXUA 3SC2B 4A9AA 4I55A 4ZQFA 5EERA 2O8DA 1OXXK 2V3VA 5BUSA 4CM3A 3EZ6A 3MWEA 2IDMA 1L1FA 1QP4A 4HADA 3HBAA 1GARA 3PDJA 4WCFC 4EYQA 1T6XA 1U7OA 2Q3HA 3NJRA 2A7XA 4BN5A 3LU1A 2HKIA 4MS1A 3MGCA 4RZSA 3TO5A 4DDUA 4RD2A 4Y2XA 1WP9A 1YL6A 5E2AA 1EFLA 4YUAA 1ZI6A 3KOYA 5ADHA 1GXSB 1C50A 3M8KA 3NG1A 3Q3GE 2PH3A 3KS9A 1GL3A 1U1FA 2Y92A 2Z98A 2QORA 2G25A 4NV3A 3WYNA 3HBJA 5CYOA 3JZFA 5EKTA 5DW0A 5AKIA 2X5NA 3UKJA 2PQ0A 1P18A 1YJ8A 1JKIA 2HTEA 3UGTA 2IYRA 3CLUD 5JRJA 3UOAB 2HWYA 1XDWA 1TZKA 4FDLA 3OEED 3QENA 3I9OA 3HXTA 1DCMA 1YMVA 2O4UX 1NUQA 1SRRA 3OIDA 3C3AA 1JHRA 3OZAA 3C7CB 1V7PC 3E1SA 1ADCA 5FO0A 4U6SA 3Q8XB 1N0UA 2P62A 3EVGA 3HGMA 2R7MA 4Q0MA 1AXRA 2CNDA 3L01A 1GZ6A 1QFJA 4J8PA 5D6NA 5K8JB 4HAUA 2JFVA 4AURA 1D4OA 1FCJA 1IN8A 2BLNA 1YZYA 2LR0A 2YQ5A 2XGOA 1GGEA 4YRTA 4LFAB 3C6XA 3OFVA 3GNQA 2EG5A 4GBJA 3G1WA 4JLNA 1NU8A 1GT91 4W1RA 2IU3A 1WTAA 2IZZA 1F6BA 3S0JA 4D96A 1SRQA 5AM2A 5CFZA 3VYWA 4RHXA 1NXWA 1NMSA 1RMYA 3GDHA 2FPIB 1R0SA 2VP0A 2XCIA 2QVCA 4FK8A 4TZ0A 4J0QA 1E2FA 2I4RA 1KWKA 2NP7A 1HDGO 3LC2O 1ZS9A 1NQVA 2R6DA 2VFAA 3NDIA 4JQOA 5U9CA 4G8CA 4F9TA 5I9LA 4D0RA 2NVOA 3DH0A 4JQZA 4O29A 5A4DA 4ZJPA 3MLAA 4U02A 3J7TA 1M1XB 4Y3UA 5LC1A 2XGJA 3K1AB 1GG2A 3OLCX 4YAFA 5I5EA 3ANNA 1MXFA 3IALA 2GN6A 1F5NA 4FN4A 1Q1EA 3GEIA 1H8HD 3FX2A 2PUEA 1P9LA 1YKGA 4CG3A 2O59A 3MYYA 3OOHA 2PT6A 1DQPA 2ET6A 2O7VA 3CF2A 4H0FA 2D5CA 3OF5A 1Z7GA 1UBSB 1U2QA 4OQQA 4AF6A 2BGLA 3P7MA 1B3RA 1UAGA 3NNSA 1DAHA 2BMAA 1GZ5A 2ZSFA 1U8ZA 2WTAA 3L7IA 3IGFA 3RRZA 1YUBA 1KVTA 4R3UC 4E2FA 3IX7A 4EMUA 4YMVA 1SZCA 3RSFA 3TIVA 4TLLB 4TN5A 4XAQA 3ZXUB 2ZJ8A 1HA3A 4OHZA 1PJBA 1W1WA 2ZP1A 4TKUB 1KTVA 4UDXX 3X44A 4C0WA 4LBWA 4M9XA 1Z3CA 4LOHA 1WM1A 3TQTA 3A1EA 1GCAA 4P58A 1F8UA 2Y27A 3RS5A 3ZI0A 5E3HA 2CVZA 2HAEA 3D4PA 4MLPA 1IEXA 1C8BA 3SZMA 1E1CA 3ORQA 2WHRA 1GSIA 1UT8A 1XWWA 2AL7A 3V8PA 1LF5A 4GWKA 1YBHA 1FU4A 4LV5B 4B74A 1XZNA 3HSSA 4WV3A 5K4GA 2PZBA 5CUQA 3C14C 3T94A 1U5AA 4QVIA 3Q87B 1KO5A 4FKBA 5FOXA 3TRIA 1CT9A 4P3OA 2OESA 4CM5A 1USVA 1KYTA 1N0WA 3GAFA 2YNMD 1L4YA 5CD9A 4ENPA 3ICPA 2BDUA 3T7TA 4QA9A 1CYDA 2FPOA 1O97C 1L5QA 3CMMA 4I1UA 4NBWA 4UVDA 2OXIA 4E5DA 1WP4A 3PNSA 3UEOA 5C53B 5TRTA 1YI0A 4BMPB 2XA1A 1VDMA 3A1VA 2QM0A 5B6IA 4H6PA 1U2SA 4IJKA 4FSXA 1I32A 1T3SA 4J07A 2AXEA 5LB2A 3RS2A 1LD3A 1YU6A 4HHEA 3THYB 2V7VA 2VYNA 5TIIA 5K0ZA 3MERA 3FZNA 2ZUDA 5DHSA 2FRVA 3N5CA 3ZWMA 3F3SA 5JEDA 4XB6B 4MVJF 4EYKA 1EVEA 3NX4A 2PBRA 2P9BA 3CXUA 2YVLA 1E7WA 1LVUA 2P3QA 4OK6A 1SEPA 1WCWA 2Q1SA 3BWXA 4XWGA 4BX8A 3L8DA 4U00A 1K7FB 2FFJA 4R6XA 5FD8A 4ZV9A 2VHZA 3AB3A 4YACA 2CE2X 3SF0A 3J81k 4KFUA 5DWVA 2V9ZA 3CM0A 1J90A 3VU8A 3M9LA 1WSDA 2LKDA 3EXEA 1GD1O 2DHRA 2BGKA 3IDAA 5BYKA 2HA4A 4RTNA 3X1KA 4PAGA 4D5EA 2DT5A 2P27A 1LSJA 3RV4A 1B41A 3CLTD 5EKUA 4AP5A 3BD8A 3G6WA 3ZBQA 3QW4B 1JNXX 3EXAA 2BGTA 4IXDA 5EXPA 1I7DA 4BASA 1AURA 4LY9A 3K0CC 5EQJB 1U63A 4G23A 1VLZA 3LUJA 3S1AB 3WA7A 3HJAA 4Y9UA 3HJRA 3H17A 1CS0A 1RMTA 2OO7A 2PMCA 2G0AA 1OIXA 4LCJA 4JLJA 4QLOA 2ZSHA 5BR1A 3K0KA 3MWFA 2CYBA 4L9AA 4NG5A 4L8WB 2DWQA 4UUPA 4PNZA 3ADBA 2EBWA 2MTBA 5ICGA 4RGQA 3SC3A 4F9GA 2EX0A 3TEMA 4OGGA 3KQPA 1U31A 2R1VA 2FETA 3IH5A 4FQ5A 2ZRAA 1XF9A 2VPXA 2WJYA 1QZXA 4GMKA 4HX5A 1TYCA 1FS6A 3GRKA 2NXNA 4O02B 4YK7A 3LQKA 1X7WA 4UM9D 1FYFA 1E69A 1A9TA 2QYSA 5EXSA 4H60A 3AP1A 1SG9A 4WUTA 1JIJA 4CI0B 1W9MA 1KFKB 2R8BA 2CEKA 3CR8A 1BU8A 2Z2XA 5ALHA 4H3HB 1JBQA 1ZVKA 2JGLA 1AXEA 5SZJA 4B7ZA 4ABYA 1PG0A 3GWZA 3VR1A 1ZA2A 1XP5A 2QT9A 3DNPA 3NRJA 4IWYA 3PSHA 5EEGA 5HIIA 2W6OA 1G8SA 3ILHA 3ZXXA 1PNRA 4FEGA 2BE7A 3E9MA 2CY0A 2FSGA 3OCUA 1NUSA 4MUIA 2W37A 4O33A 4UAJA 4DR7B 2CZCA 4KPYA 1WW2A 4O3FA 1E66A 1XZQA 2F43B 4GWGA 1KR2A 1EGQA 4IJ5A 2EERA 3ZJYA 1RM0A 3PXCX 1YWGO 3M70A 2XB4A 3KB6A 4E5KA 4NECA 1HURA 2HMTA 1JALA 3VU0A 3I01A 3NHPA 5D86A 4LZPA 5JAHA 1F9AA 4YRAA 3MTEA 1KBQA 4J94A 2ZIAA 1FS5A 1EUCA 4YPOA 4WINA 4ZEOA 3E5RA 3K1JA 1N5RA 1JEEA 4RLQA 4A92A 5GPBA 1BN7A 2QTZA 5JPDA 5COQA 2W2KB 4XVRA 2WSLA 4I8DA 2VJYA 4RENA 5HM6A 1I2CA 2P6UA 4L28A 3O84A 2FWMX 2C5FA 3PVZA 1Y89A 4KIJA 1KBZA 1PYOA 1TTHA 1U7UA 1UJ4A 1QTQA 2YWCA 1FQOA 2QMYA 1QLJA 3LBYA 4DNPA 1GPJA 1HYBA 2A9PA 2REQA 5CLGA 2NTVA 2X8LA 3W2GA 1ESCA 5FIUA 2QRQA 3IAAA 4JI5B 2REOA 5KTRA 3MJ4A 3NU1A 5KYTA 1D1PA 2I6SA 3H42B 3HJCA 3L6RA 4MP6A 4JLBA 1ZICA 1E9RA 4NCJA 3GW8A 5EJIA 2VKTA 3B1VA 4U2BA 4DDTA 2O8EB 3DT6A 4DDMA 3D02A 2QAGB 2A5LA 3JW8A 3D6NB 2YUTA 1YU9A 1E2DA 1GLVA 3ROPA 1Y7IA 3N2ZB 1QUFA 3GH1A 1NPTO 3Q7EA 5J9FA 3WDSA 5CYGA 5JXHA 4OHYA 4FX5A 4URWR 5LKAA 3T06B 2E55A 2QA5A 3X1ZA 1QQ6A 1RSZA 2NYAA 4IX9A 1NASA 5AW1A 2VIIA 1LZLA 1N1EA 2I03A 3KAQA 4X7MA 5TQ0A 5DNEA 1RQRA 2YUIA 1XDGA 3CLHA 3DOFA 3FPJA 3BMOB 4ZCIA 1A76A 4HNUA 1Z2NX 1J0XO 2C31A 4BP8A 1TO1E 1KK3A 1JKXA 5ED0A 5AVJA 5CD1A 3CKYA 3P0JA 3ZVRA 2E82A 4F6CA 3GNSA 2GCOB 4DGSA 3VVCA 3KHSA 4QVGA 4TV9A 1LTHR 2GZ1A 1GSAA 2L69A 3QUBA 4I81A 2IT1A 2Y4OA 4E3WA 3B82A 1R6BX 4E7PA 2W2LA 1IUNA 3S40A 2QAGC 1J2UA 2PXCA 1JW9B 2BELA 4TUYA 1CZUA 2HHJA 2ZYGA 3R8CA 1N5DA 3BBPA 1UBOS 2QRVB 3I92A 1JFFB 1H2WA 5JG7A 3EMKA 2K87A 3EQ6A 3WVNA 4ADSG 4DLYA 1ZH0A 4M86A 2A86A 4RMJA 5DWDA 1E5LA 4DCUA 2OLEA 1PE0A 1LUAA 3FDZA 2NTJA 2L19A 2WM9B 1WL8A 2A35A 2I8LA 5ALGA 2POCA 1YH3A 1HK7A 5D7NA 2XQVA 3AEXA 4NU6A 2QQFA 1N2HA 2H4XA 3LNCA 3L4EA 4A03A 5KJ6A 4W9MC 2R4UA 5CW1A 3AINA 3KR1A 1GOTA 2WE7A 3EVTA 3KEMA 1STOA 3MM4A 3ZE0B 2CGEA 4JHLA 1IBMB 1E2EA 1P1JA 2J09A 4TMXA 1SVNA 3VPFA 5JR3A 1W2HA 2VWPA 4OF4A 3ID6C 1GVNB 1UPXA 1AY0A 1SCNE 2IHUA 1I1NA 1Z4OA 2ZWMA 2Y6VA 4TSFA 2H2GA 3HDHA 4MGKR 4ZGWA 3I30X 3BTOA 4F72A 5CB6A 1L3CA 3GLHE 1TTPB 4ZI7B 5IF3A 1V5EA 4GG1A 1J20A 2JFQA 5IM4F 2GFIA 1C4XA 1JKJB 3E9DA 2GILA 3E7XA 5CNJA 1DVRA 3JWPA 1MB4A 3OT1A 2QP9X 1P6XA 3NZEA 3ND5A 4OQYA 1EWQA 2AEJA 4QE3A 4WPGA 5AO9A 4EHIA 1LSUA 2C54A 1AZSC 1K68A 5LXTA 5CHYA 2ODBA 1JAXA 2G1AA 3HI6A 3A26A 3CW2A 1BWQA 1WVMA 3O8QB 4DBVO 5IX8A 1C5KA 4J6FA 4MKRA 3FAZA 2GYWA 4BLOA 1DCTA 4ZV4A 5JS1A 3OJOA 5ARDA 3EASA 4XYLA 5C52B 5EHQA 3SS7X 4ZZ2A 2YY6A 3QSYA 2XKAA 4FHDA 4HGYA 1M6WA 4DCOA 1VE7A 4JJZA 3BXFA 4MWTA 2XWJI 3F9RA 3VDXA 1SR8A 1UWLA 2RGUA 3EE6A 1L5LA 2PRKA 4NOLA 5LIPA 2V7WA 2BUAA 5HKOA 4TRRA 1ZWKA 1U4NA 2AZ4A 3FH0A 3S8YA 5HXAA 3EA4A 2Z56A 3G2LA 1Z0KA 3KTOA 3M82A 4D9GA 4F4JA 3VMFA 1KS9A 1SOAA 2DH5A 4JUBA 5G4LA 1I1QB 1DUSA 3WJ1A 5HRUA 8MHTA 1XLUA 1CQIA 3BE4A 2IJGX 5JNLA 3W8DA 1F0YA 2BP7B 3AHHA 1BVUA 3N59A 2YV4A 3JZAA 3KELA 4Q7EA 5E2BA 4BMNA 2BT4A 3UWKA 2Y0CA 4RF2A 3SYTA 1N33B 3EVBA 4BQIA 4LJYA 1IBCA 2GPAA 2C04A 4UD6A 3HNOA 4AUKA 3DWIA 4OHKA 3DLCA 4PVCA 5EIBD 2CLOB 3SKVA 1USGA 1DC8A 4KWIA 1UK9A 1F6WA 4BNZA 1VPTA 2AFVA 1Y3BE 2QUBA 5EIAA 4PHCA 4BMOB 4ZCRA 1C8VB 1OXMA 3QE3A 5BV2P 3DV0A 3EFOB 1S89A 3PGLA 1D5WA 1NW9B 1PGQA 2I78A 3SS9X 2HA6A 5KKNB 4F4IA 3BE6A 5TT1A 1FLNA 2ST1A 1F4LA 2BN4A 2PSDA 3B48A 5ADUS 1JIUA 5H1YA 1KI8A 1QIJA 3C3JA 3HGTA 5BT9A 1VCOA 3GLGB 2EX1A 2I34A 3LRXA 3OEEA 4F2HA 1ZIXA 4NS1A 5KNLA 3ZE9A 3KTAA 2QX9A 2HPVA 4EJMA 4UDNA 5ESWA 4FW9A 4EYSA 1W7AA 3OQIA 3R5TA 3S8MA 4EZBA 4N5IX 1UC8A 4G5HA 4AXBA 4B31A 3IAXA 1QKJA 1W4ZA 3EQ9A 2EJVA 3R5SA 1O7JA 5HE8A 1UBNA 3RM3A 4J16A 2JCYA 1NBEA 3DOEA 3M4ZA 1J8QA 2Y0DA 5HCUA 3G2PA 3WWCA 4EL0A 3V9PA 2OZVA 3ZWCA 3EISA 3QLVC 4OQDA 1I9GA 5BNIA 4L08A 4MI1A 1NF9A 2ASVA 3SSOA 3T9CA 4D9FA 1TQ2A 2HK7A 3AY0A 3H84A 3EQZA 3N2KA 4QNNA 3ANLA 3DDCA 4H7FA 3EIFA 5H68A 5LA6F 3H86A 1C3VA 3T5GA 3OU7A 3T3IA 2H07A 2IKSA 1HQCA 3RRNA 1GYRA 7MHTA 3Q6IA 1ID1A 4JU8A 4NCIA 2Z30A 5A6SA 3B9QA 1X92A 2P0YA 4QTTB 2AOUA 3SOZA 4G1EB 3HBFA 5FTNA 1SVUA 3AO0B 3S7TA 3MELA 4IFBA 4TS1A 5AVWA 3T1NA 2GPTA 2XZDA 1Y33E 1QYDA 4O5OA 4QYSA 2C5SA 4KZPA 4MYHA 4RSHA 5IBRA 4MYSA 2NPOA 3OIWA 1JSZA 5K0CA 1SBCA 3DTTA 4ARCA 4D79A 3OZRA 4HDSB 1MRSA 3PTZA 1H8HA 1UT6A 3MILA 2P2ZA 1FU7A 1TFRA 4GI7A 5JAQA 4C2AA 4UCXA 3ROKA 1KOFA 1Y4SA 1U1EA 3LOQA 4RVOA 4LIPD 4W5TA 2VP5A 4ECAA 5ICCA 2C9DA 2XT0A 3WHLA 3ZU4A 1JIQA 1ZP6A 4RA6B 3N86A 4D6PA 1MENA 2NTYC 2VCEA 2JRLA 4QBHA 3VZQA 4JEUA 2VH2A 4ZV7A 4QPJC 5JQWA 4LXXA 1UQRA 1JQAA 3FHJA 5BN5B 3QLUA 1A69A 2CC2A 3LP6A 3X3HA 2J9XB 5LMUB 4DZZA 4MOWA 4PHTA 2GRUA 4B80A 4MV9A 4HDQB 2OHOA 3CCFA 3U0BA 3LPNA 4BTEA 1YQ9A 5KNDD 1BEUB 1JR3D 3UGQA 2AS0A 3BQMB 3KQMA 4OBXA 3X1JA 4D9EA 1N6HA 2VTBA 4QECA 3D59A 3ZV4A 3EZXA 1E1DA 4OI1A 621PA 2QN8A 5K8UA 1R50A 3LY9A 3FYHA 1TAHA 4R1OA 1UXJA 4DXHA 2WWIA 4K86A 5IU6A 2R8RA 1E1QD 1ZHFA 3PXGA 3KOOA 3RHSA 5KYGA 4KGZA 5EWMA 3SSMA 1EHCA 1VSBA 2YCLA 1Z39A 3MD9A 3OQBA 1NULA 3O9MA 3R7WB 3WDMA 4IIEA 2E4YA 4HB3A 2DWCA 3T9FA 2YVAA 4I8XA 1AUXA 2YNMA 4MLDA 1VPDA 2ZBVA 3TXXA 1KJIA 2JVIA 5U4XA 3X2EA 2JVJA 1YBVA 3NKFA 5IMBA 2LDXA 4G5FA 3PKJA 4MEBA 3E84A 3RT7A 4NHEA 3VZCA 3HA2A 1OAOC 3GQBA 4TSKA 3OKCA 4URHA 1YZNA 1AUQA 3D64A 4ROSA 5FA5A 1T4GA 1Z56C 2B6HA 1LI5A 2W2OA 5G4KB 1NKTA 1DBVO 4O8CA 3W5CA 4A4DA 1G41A 2DAPA 4R01A 1M8PA 3BUSA 1M8FA 5KVAA 4KVGA 4FR2A 1E4YA 1IN6A 1P8JA 4F12A 1ZLXA 4HO1X 2HLHA 1R8SA 4II7A 2O8CB 4ESHA 1R15A 2Q6OA 1MO5A 2WU4A 2R6R1 2Q4OA 5DBFA 1YRWA 4PNHA 3VQTA 5EPEA 2R97A 3BIOA 3V2IA 3D5QA 3WWEA 2MWMA 3HI4A 4WXRA 4XCVA 3T99A 4TL9A 4W5WA 1M75A 2GPSA 3D7LA 5THXA 3UA3A 2QMZA 1TMKA 4CMEA 1JFVA 3LIPA 1QIEA 1SHUX 2DP4E 3IKLA 3KQYA 1XX6A 4IXTA 1GG8A 5JI3E 1T5HX 2J5RA 1ZCJA 3ODPA 4EQ6B 2F8LA 4QG7A 3O4RA 2C57A 3JAKA 3ZHQA 4L72A 3EPKA 2J48A 1Y1PA 4J4BA 4ZK2A 1Z3IX 4PPYA 3FRJA 2HDOA 5INTA 1IULA 3GCGA 3KYBA 1B1AA 2N47A 3FNBA 1JZSA 1N5OX 3EBPA 2IV7A 3LCVB 2ZPAA 2BSXA 2R96A 2IWRA 4CM7A 5AM0A 1JECA 3IA7A 3TXAA 3E53A 4PHHA 4PRYA 5AVXA 1APBA 5J2TA 3MJFA 1UIRA 1D2MA 4HNAB 4DB4A 3DBRB 2BWJA 1P3JA 3AR6A 2BM8A 3VKFA 2BFDA 1BHO1 3QXHA 1Z2OX 2RK3A 4NFLA 5K3CA 4ZIRB 1RQXA 3I0ZA 3L93A 5JO0A 1ZN8A 1GG9A 4CR8A 2ZSUA 3AG6A 3GJXC 4JAVC 3WYDA 5LD2C 2OGUA 3EPRA 3AM4A 3WV5A 1J42A 1G6HA 5F7JA 3EUAA 4RVSA 3TSZA 3NUZA 3TQOA 4JLUA 1YS7A 4EPXA 3FZYA 3ZU3A 2ACWA 2HIAA 2Y9PB 1JN0A 1BXGB 2BTQA 3CTPA 1XKXA 3DBLB 1JU4A 3AEKB 1V47A 1Z5VA 2ISQA 3CJTA 1X1RA 3DZHA 3H5VA 4KMMA 5CTJA 3VPDA 3W9BA 4ECEA 4EBFA 4P3NA 4MRMB 4IO1A 2H57A 4CTJA 3QUCA 2OLJA 1T8YA 2X6QA 1N8NA 3DEJA 2XKKA 3OHPA 2IEDA 3OJWA 1G5RA 1H22A 1MC5A 1WG8A 2W71A 3QITA 4BNKA 2XDWA 1XTQA 4NYJQ 4BMDA 1QM5A 1Z6PA 3L7MA 2H4HA 2ZATA 3QXSA 5JIBA 3MEQA 5M04A 1VPWA 1KEEB 4Y2HA 2UDPA 3P2MA 4Z5XA 3QYFA 3DMTC 2DBRA 3KKKA 3AYZB 3CR3C 5EIEA 3I8XA 3HYNA 2DTDA 2J5KA 4BPBA 1CJVC 4EIWA 3W5DA 2WQ6A 4YMSA 4JI6B 3D3QA 1WLYA 2DBZA 3E7FA 3LG2A 4YJ3B 5T4FA 3T35A 1OGJA 1D4ZA 2ZBFA 4OFWA 1FVFA 2F90A 3UXMA 3VU9B 2PE5A 1IY8A 3MQ2A 4GKBA 1S3SA 1DE0A 2X5KO 4KQFA 4D5GA 5C7YA 2BFAA 4RDCA 2CB9A 4BO6A 1UMBB 3DOCA 4F3CA 1YHNA 2OVBA 1WJGA 3RQIA 4CTMA 2GS9A 5BWMA 2XPCA 5DM60 1CB7A 3L5OA 3P27A 3LL4A 4KN8A 4MDFA 4RHUA 2QG4A 5B3AA 1L7RA 1LGYA 5HFJA 1G7TA 1QHEA 1JQJC 2O2JA 4MR9A 1PTJA 5TS3A 5J23A 4BOYA 5E1MA 3HWWA 3N70A 2RBEA 2X86A 3T3HA 2IPNA 1MAVA 3VR6H 4TN1A 1X42A 4BMSA 4KWHA 3QU2A 2CWDA 2C1EA 3RDPA 4EYOA 1VSUA 4OQMA 3DZCA 4CI9A 2Q46A 1C3LA 3FLBA 1XTUA 1SZPA 3NC1C 4R1QA 4Z9XA 3TFQA 1HE2A 1QF9A 3R8FA 4ILEA 4WLNA 3ZU6A 1IY0A 3JQAD 1YIOA 3HZHA 3VOAA 1VHTA 2I6UA 4KQXA 3A9RA 2ALJA 1KXJA 1YRLA 1B74A 1E1RA 1Q0RA 5ALWA 3UGJA 1VJCA 4TMKA 4AXXA 1DIRA 1Q44A 2Q8QA 1DTEA 1W4AA 2C03A 1RAHA 1OFHA 2NYUA 2Q5EA 3SEZA 5LQAA 1PV1A 4NF2A 4C4YA 3E7DA 3ANMA 3I4CA 5EIOA 4R6WA 2ZB4A 4ZN6A 1NQXA 1DB3A 2ZYAA 3GA5A 3P0HA 4X20A 3ZCTA 3HSKA 4PR0A 1SUPA 1QP7A 2IBTA 5IAEA 4WKBA 4QTXA 5DN9A 1HSZA 3G0CA 5LOVF 2MU1A 3U3DA 2RGNC 1K66A 2AB0A 3WL8A 1NRJB 2P9FA 4MMXB 1NRIA 4O6VA 3FY4A 3RYHB 3MUOA 3PQEA 1ONSA 3ZU2A 2KSQA 3VO9A 3EBLA 1AN0A 3I9LA 4YN3A 3LWNA 1L8QA 3GMIA 3QSGA 2BI4A 1A96A 3I9KA 4M36A 3OQJA 4LOKA 2EGUA 3ND6A 3FKJA 2NSYA 4PC3A 4TZKA 5DGXA 2Q5QA 1NDUA 3TYXA 2PNFA 4R1NA 1XRJA 3NHJA 3W6UA 1DEAA 5AI6A 1SUWA 3NHAA 3KL2A 1O77A 2K2WA 3KUKA 1M2HA 1Y9ZA 2QP3A 4FDUA 1CNMA 4GS5A 2Z8ZA 4XIYA 2Q3DA 3KKPA 2I6XA 5CLLA 2DQYA 4QUHA 2XGGA 1C41A 2A30A 4YAUA 1RWQA 1HDRA 1OPRA 4PQYA 2FNAA 4EG3A 4UMFA 1PR6A 1FNSA 5JWHA 3DOOA 1O3YA 1XMSA 4V1CB 1XVUA 1V25A 2O8VA 4YP0A 1J9EA 4HVAA 3VISA 3LCJA 4FE4A 5A3QA 1U0HC 3Q15C 5TQ2B 1B43A 1JEJA 1Y4DE 3FTNA 4O0LA 3QVSA 4D8WA 4DLKA 3R24A 1M6EX 2P1ZA 3E5HA 4HCJA 1TEZA 4ZYWA 4OHVA 1WCXA 4MVJD 5ESXA 1CUEA 5LL6P 3QPCA 3KZXA 2ZTLA 1C8KA 4IZOA 5IBQA 1Y4UA 1YI8A 2GETA 3TPCA 3MQFA 1CDEA 2QLNA 2Q0XA 4ND2A 2QTCA 1KRHA 3HPRA 1NX9A 2B8JA 4JP3A 3V4SA 1L7AA 1NQUA 3GJQA 1M8KA 4JELA 5G0SA 4BO3A 3HZRA 4WEOA 4GKKB 1NY5A 2FSVA 4P7JA 1Z5ZA 2GHQA 5E2IA 4GOXA 4PPNA 1KDZA 2PUWA 1QV7A 3GA0A 4LDJA 1Y7LA 4X1YB 3VMMA 2YV2A 4RV5A 3FCYA 2XMCA 1ENOA 2EVWX 3KEQA 1HKHA 1HDOA 5GM2A 3RVJA 3ZE7A 5CA0F 1RCTE 2CLEB 1W29A 2X0JA 3OUZA 1PLJA 1TJ5A 3L05A 1LY1A 1BKSB 2XXAA 1T9GS 3OP1A 2CUTA 4UE2A 4HGNA 3K70B 1C4WA 3DE2X 4J3FA 4Z8YA 2Q49A 1R10A 4JNCA 2FW1A 2GZSA 4LDRA 4HLUC 4DQDA 1XVTA 1P7VA 4RO0A 4M7OA 3H1BA 4MWDA 5JVDF 5K0BA 3BD9A 1C30A 1YQUA 4RW0A 5ESRA 1R5JA 2WZCA 5AWFC 1FSGA 2W11A 2QE6A 3HL4A 2Q41A 3NDPA 4O4HF 4A0SA 1KY3A 4F8YA 1JG1A 3MXTA 1DIGA 3NR2A 3CX6A 4CR7A 2VBCA 1YR7A 4TTAA 4CQJA 4JJGA 4JR2A 5SZIA 4QJ4A 4CM9A 3PRJA 1QGUB 4WLUA 1L5VA 2VK2A 3SDZA 3BEDA 3NTVA 2PKXA 1M1YE 1N2IA 5ECDA 2FMTA 4FOSA 4JB0A 1AQLA 4IV0A 3HY3A 3USCS 4C07A 3QE0A 3K70C 3CZ5A 4DC0A 1XDSA 2YXEA 3C3PA 3IR5A 3PKZA 4R8LA 1E9VA 1GZSA 1JEQB 1U1GA 1JDPA 2WHPA 3CE6A 3L7KA 3WK4A 2W2NA 1OJLA 4TV8A 1VI5A 1DKOA 4FZ3A 3SIRA 1JDTA 1EKXA 1F8GA 3KWFA 4J2OA 2MINA 4RGYA 1YZHA 4PXAA 3TB4A 3LYLA 3Q5DA 4OP1A 1UJ2A 4HVCA 5JQGA 4NY1A 2I1QA 1U7PA 3OM9A 4JC0A 5K8VA 5HJ2A 4KNVA 5KQGA 2HBYA 1W6RA 2I7CA 2IY9A 2R0QC 1AK9A 1YOVB 3DBVO 1UBKS 4S1WA 4XTCS 1W4RA 5EGSA 2J9RA 2R6JA 5D01A 2ENUA 1Q0QA 2C0QA 5DKFA 3GL9A 2PV7A 4DAOA 4Q4AB 3A9VA 1PI3A 5ALFA 2FDCA 3WYBA 5BN4A 3MMXA 4KXYA 2PGXA 3SU8A 1GQQA 3EFBA 1XMXA 3K8OE 3NM6B 4FYWA 1G60A 4QJIA 1Q0SA 5FWAA 5FULA 4Q5IA 4G9BA 1JLKA 3GFSA 4Y1GA 3A7EA 4J0FA 3F5SA 3JARA 1L7BA 5T3YA 3KZKA 4M0DA 4WFIA 4EB0A 4ZYYA 3SIWA 3NHMA 1FB5A 1N6IA 4N4AA 8GPBA 3SF8B 2BGWA 3CLRC 3CZ9A 4IEEA 3WOVA 3AEZA 2JGDB 1V48A 4TQUS 4BMZA 4MRRA 3G5LA 2HH9A 2DQSA 3I9NA 2FQWA 2PN1A 2QVZX 4JT4A 4MSUA 2IY7A 2O7QA 3EPHA 4D9NA 1ILEA 1DADA 5FO1A 1I94B 4E2XA 3W2IA 4WA7A 3UZUA 3L7OA 3CUWA 3V2UA 3P2YA 5C5CA 1ARZA 1EG2A 4DLXA 3IIIA 4DLAA 5IWAB 1P0MA 2IQ5A 2GERA 3CF4A 4ZHQB 1CUWA 5KNDA 3EC7A 1JR3A 4B81A 2WJ4A 1YA6A 2IH2A 3KHUA 5ETJA 2P9JA 3UFXB 4CQMD 4FYVA 3BILA 1EG7A 3D6FA 4R68A 3VHQA 2ZIVB 4B3BA 5AM1A 5I4BA 5YASA 1AF7A 1E1QA 1W1UA 3L8MA 4IKEA 2DLCX 4HLQB 4URFA 1EFUA 5D5HA 4E5PA 5KOJA 3L5KA 5E4TA 4EYGA 3FPFA 2FG7C 3A32A 4C7XA 1XCGB 1N8TA 1R8YA 1X7ZB 3E8XA 4KE9A 1JAIA 4PO8A 3I45A 4KKVA 4N0MA 4NIMA 5KWVA 3FR8A 5JCJD 1AUOA 1W88A 1TQ6A 2PSJA 4FOOA 4PYOA 5KQLA 4XWAA 3DE6X 4AUNA 1T3TA 5I9MA 1J99A 2RCNA 3FWKA 1M2FA 4FYYA 4GOLD 5AJZA 3TM4A 2I54A 1MJ5A 3GRRA 1VCMA 2VYQA 1QTNA 5DYIA 4B83A 1W73A 5A06A 4J0CA 3C6ZA 3G3EA 7REQB 3FOWA 4HYYA 4PC1A 3ZZMA 3RHFA 3RJZA 3V2HA 4QO8A 3JWGA 3QKWA 4EKEA 5LQRA 3VGJA 4CEHB 5K0FA 4XM1A 3GFRA 3KQSA 4J75A 4Q3OA 2DLDA 1KMMA 1FFGA 2ZB7A 1TB4A 1YZKA 1CFZA 1SC6A 1XKTA 4DLLA 1RYDA 1L6IA 3A9CA 1PFQA 4BJ5A 3OI7A 3DWGA 1O03A 2EFJA 4JYZA 3JY6A 4BUZA 1LRKA 4Y1RB 1GDHA 2YBDA 5K0JA 1YCHA 5DBHX 3HB4X 4AP9A 2EKBA 2ZTVA 3T5CA 3SX4A 5BNZA 5BYAA 1AX9A 5T3UA 2MSEB 4EO4A 1CZRA 2BBTA 3PUYA 3ZCVA 2X9GA 4ALLA 3ZDAA 3F97A 1A88A 2V6JA 4LXQA 4QPNA 4L78A 3TGWA 2AFRA 5SICE 3R5HA 3BD6A 1RXEA 3W4IA 3I04A 3KT8A 4PU0A 4UDYX 5D84A 3R7LA 2C7VA 2GVNA 2PMFA 1M2OB 5GMOA 2ZVQX 4KLRA 1XPOA 1ZH6A 1E3IA 1FIUA 4QOEA 4ENTA 2HC9A 5CURA 4LGMA 4R2JA 4X8HA 4LYGA 1T6ZA 5BW4A 1E1LA 4QL3A 1L5MA 4M21A 4X90A 4JA0A 2ADOA 4ZCLA 2HV9A 3UC5A 3DB1A 3L6BA 3KDPA 5ALYA 1GFZA 1Z5OA 2FVXA 4PANA 2EAUA 2HA0A 3E9QA 1K4MA 4BTVA 2UYHA 3D3WB 1OLUB 3KEGA 1ZHOA 1SKYE 3LPDA 2MYUA 3JPYA 2BI7A 1XDDA 3H0CA 2FPWA 4S1PA 1Q6YA 1DU4A 1XOIA 2IHKA 1W85A 1Z26A 1KJWA 1QWSA 4X64B 4A8JA 2NQ8A 4Z0HO 4TL7A 5BV8A 4NQZA 5B57C 2QL5A 3OCXA 3KJEA 1Z4QA 2QN2A 3MWJA 1ZK2A 2OORC 3VPCA 1V37A 2JF0A 3GRPA 3DVRX 4K6GA 3CV3A 3TS1A 1RHKA 3URKA 4PSDA 1RQNA 3RTDA 3GLIB 3ZHVA 4BNDA 4EHHA 5AM3A 4MUKA 2P78A 3R09A 4XDZA 3U5TA 2H1HA 3BOSA 1RI3A 4UUBA 4LQDA 1NJ1A 1ZIOA 4PGMA 1Z0AA 3MWDB 4BNFA 1C7QA 1N5IA 2H7XA 3U56A 1IY2A 3GNTA 2RE8A 2VP6A 2PXHA 1SPXA 2BAGA 2R1TB 1MH1A 2R60A 4HYTA 2ZQ5A 4PYQA 3U3JA 4I4LA 1E6LA 4XGKA 2J8ZA 1WY5A 3LTNC 4KITB 4PCLA