4IGAA

The crystal structure of an activated thermotoga maritima chey with n-terminal region of flim
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
b'KRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
molecule tags Signaling protein/motor protein
source organism Thermotoga maritima
publication title The crystal structure of an activated Thermotoga maritima CheY with N-terminal region of FliM.
pubmed doi rcsb
total genus 41
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4igaA00
1DBPA 1W9HA 1GLGA 4KQCA 4QYMA 3OQOA 3HM9A 2PUCA 4LDZA 1CHNA 4MR9B 5DCLA 2IPNA 1S8NA 1YK0A 1JH9A 1ABEA 1U8TA 2JCGA 4UHKA 4XARA 4YR7A 2E4WA 3N53A 4RKRA 5I4CA 2FEKA 4DQDA 2PUFA 2ZWMA 4D6YA 5T3YA 3QLUC 4MRMB 1LBHA 4HYEA 1R8JA 3H1GA 2NUBA 2TMYA 4RY0A 3HCWA 1PEAA 1DRKA 4PICA 4XAQA 4LE1A 3IPCA 2L17A 2H0AA 3H5WA 3T95A 4MS3B 1VRVA 4DN6A 2MSWA 3H5VA 3CU5A 1E6LA 4HNSA 1P2FA 1XHFA 4EVQA 5KQMA 2AYXA 4QPJC 5JNTA 3HZHA 4S05A 4MQFB 3CNBA 1SXIA 5JS2A 2KYRA 5JS1A 4RY8A 1QKKA 1RXIA 3H1EA 3BILA 4JB2A 3HVRA 1DBQA 1GCAA 4OG2A 4Z4CA 3TB6A 4Z4GA 5IEJA 2IYNA 3M6MD 4CBVA 3IP6A 1J56A 2CHEA 4IMJB 5EWJB 3C97A 4ZJPA 4RZSA 3LUAA 5CNIA 5HKOA 3F7NA 3K4HA 3O1IC 1SXGA 4Z9AA 4RKQA 3EGCA 4LRQA 4MR8A 2IOYA 1EHCA 1USGA 3O21A 5T7BA 5EWJA 1ZY2A 2HQRA 1EFAA 3OLWA 2O20A 4RK6A 2YHAA 4MGEA 5TQ0A 1YS6A 3EJWA 3F6CA 2F8TA 1Z2EA 2FQXA 3OO1A 3SY8A 4MRMA 3QK7A 2QU7A 5EWMA 5IULC 3T38A 2JK1A 4MS1A 3H1FA 2MSKA 4RV5A 3EULA 2R47A 3A10A 4G0QA 2GKGA 3QELA 1U04A 2LUOA 3LFTA 3RVLA 5CNMA 3SQNA 3O75A 3HXMA 1BA2A 1QO0D 3GBVA 4KVFA 4YO7A 1ABFA 2HQBA 2BGGA 3LUHA 2HPHA 1YTUA 4G0OA 4KREA 4W5OA 6CHYA 1D5WA 4H3KB 2CWDA 4RXTA 3QELB 2WMYA 2ZAYA 2RJNA 2CD7A 4RK4A 5EWLB 1LK0A 1QP0A 4Z4EA 4JA2A 2PMCA 2L19A 1Z18A 1SD5A 4RXMA 2PLNA 1FQWA 1JF8A 4KNYA 4RSMA 1ZAYA 1Y1LA 3FFXA 1Z13A 4MYRA 5KQLA 3QLVA 8ABPA 4E7OA 2FSPA 5DTEA 4LE2A 4FB4A 3HUUA 5JNWA 1RZRA 3KHTA 3CG4A 3Q7RA 3JS5A 1LJLA 4MS4A 1YMUA 1ZH4A 2OQRA 5CNKA 1TM2A 2E4UA 4D6XA 4W5QA 2ID9A 3ROFA 5CNJA 3I42A 4PEVA 1DRJA 3H6GA 4JOQA 4YWHA 4Z99A 3GT7A 1USKA 3O2JA 3O74A 3RVQA 1P8AA 4IRXA 3MIZA 1AB6A 1D1PA 2JVJA 4KK4A 4DADA 5KWSA 3OLXA 3BRQA 4ZYLA 3K9CA 3LOPA 5JNVA 2WY2D 1MAVA 3A0UA 3DLBA 1D4ZA 2OENG 2W42A 1SRRA 2L18A 1RZRD 4ETNA 2PJUA 2P4UA 3CLKA 2WJAA 3HV2A 3LUJA 2GI4A 4G0XA 3QEKA 1NTRA 3LTEA 3N0WA 1NXXA 4N0PA 5TE9A 2FW0A 3RVMA 5C5CA 7ABPA 1Z2DA 5FWYA 4L4UA 4IILA 3RVPA 2HJ9A 2NZUG 4W5RA 3OQNA 3I09A 1QP4A 1JBEA 3Q41A 3L49A 2PKXA 4MLCA 2RDMA 1ISRA 3D02A 3NHZA 2FEWB 4MS3A 2A9OA 4ETMA 2I6FA 3OM0A 3NNDA 3RVRA 3KCNA 2R4QA 2H3HA 3I5AA 5IX8A 1ZH2A 1BDHA 3P9YA 3CS3A 1U2QA 3IPAA 1QQBA 2QXYA 4LZLA 1L5ZA 1JLKA 4WUTA 1Z17A 1ZESA 4YRZA 1LBIA 1MB0A 4MQEB 2FMFA 3EQ2A 3QEMB 4OLBA 2IDMA 2VK2A 4D74A 1I3CA 2LPMA 4UHJA 1IIBA 4EGSA 1PNTA 2WJWA 1HEYA 4LX8A 1URPA 2QSJA 2VYCA 1FFGA 1Z15A 5HM6A 4G0MA 4KRFA 3QLVC 1CYEA 2B1JA 5B3JA 3QX8A 1PNRA 2NT3A 1KGSA 1FFWA 3HUTA 3LUFA 4WXMA 1DCMA 2NT4A 4S04A 2LIVA 4NCBA 1NY5A 4FE7A 2WB4A 5BRAA 1ZHHA 2E4ZA 3C3MA 2FMIA 5BRJA 3LUCA 4H60A 2HQOA 5JNRA 4EYKA 1DJMA 4YS6A 3CTPA 4NV3A 3RQIA 3JVIA 4KZKA 5BQ3A 1JX6A 5HQJA 1BDIA 2GWRA 1P6UA 3KLOA 3L6UA 4KV7A 5C5EA 4N76A 3O1JC 2PE5A 2FVYA 4PYRA 5IC5A 1FSPA 1UDRA 2IPMA 3DZDA 3KLNA 3KTOA 3QLUA 4F8JA 3F6PA 4RXUA 2FXIA 3HDVA 2R25B 3RVOA 1GCGA 3VNAA 2QW1A 3HO1A 3Q7TA 4Q6BA 3UUGA 4RY9A 2XDYA 1QNLA 4P98A 1ISSA 2V0NA 4L85A 5F64A 1JDPA 3F73A 3M9XA 1E6MA 2YHBA 1KMIY 4ML3A 5ED4A 3CZ5A 4JAVC 4FE4A 5EWLA 1M5UA 1Z26A 3GBPA 2PUEA 5CHYA 3MYYA 2MSLA 3B2NA 4Y9TA 4XXHA 3TMYA 4JASB 3E3MA 2FLWA 5IUNC 5FWYB 1KRXA 4QICA 3HEBA 4G0PA 4KMRA 3H5TA 1JFTA 2VUHB 5DKFA 2IKSA 2PUGA 4KQ9A 2M98A 1QPZA 3KYJB 4ETIA 3LUGA 4IF4A 5KI6A 1TJYA 3BRSA 1DBWA 3A3KA 3CZCA 3JPWA 2DRIA 5FBHA 4F06A 4OLAA 1C0EA 1JDNA 3OMXA 3DLHA 1M5TA 3C3KA 3ROTA 3MM4A 2PUBA 3EDCA 3CFYA 4MPTA 3N0RA 3Q7SA 3NNNA 4OBBA 4EVRA 4ZMSA 2F8SA 2QVGA 2QR3A 3QX9A 1QO0A 1D2AA 1TMYA 4NCAA 3UK0A 4N03A 3CG0A 3IP7A 1E2BA 2AYZA 1T34A 4G0YA 4F11A 4EVSA 4TN5A 4XASA 5JNSA 4KFCA 1RPJA 1EWVA 3RVSA 4H3HB 4KPYA 3LUKA 3SG0A 4HNQA 3N6VA 4IGAA 2MYTA 4RK0A 4RK1A 5IEBA 3Q9SA 1APBA 2JBAA 3O1HB 3GYBA 4MR7B 4Z9BA 1Z25A 5BR1A 3FGZA 2R48A 3LKVA 3E61A 4MR9A 1YVUA 3GA5A 1DG9A 4XFKA 4Z4FA 4MAAA 5DGCA 1U2PA 3ILHA 4LE0A 2FLKA 3OLZA 5D2CA 3D8UA 2VUIB 3HS3A 3O2QB 5TQ2B 1F4VA 2WWVD 1RXEA 3OM1A 1OXKB 2ID7A 1ZVVA 4OATA 4EYGA 3JVDA 2WRZA 5IUJC 1JWLA 3C6QA 3GL9A 1NXVA 4PE5B 4N0QA 3I45A 3OO0A 2PUDA 1TVMA 4IMIB 5KQGA 3SM9A 1ZDMA 2LP4Y 2FQYA 3T8YA 3RH0A 1BVHA 1RNLA 3A0RB 3H5OA 4JB0A 1B00A 3MA0A 3JY6A 5E3JA 1F51E 3QEMA 2A9PA 1H9CA 4MQEA 3KJXA 1TLFA 2CHFA 3DGEC 3GWGA 1D1QA 2FMHA 4HNRA 2E4YA 3HSYA 5IUKC 1XHEA 4XLTA 4YLEA 5GOTA 4Q7EA 1E6KA 1GUBA 4N47A 2PL1A 1JFVA 4YP9A 5KC9A 3OMWA 2N9UA 1AB5A 2PAFA 3CRNA 1K68A 4MLDA 2E4VA 1ZITA 1Z12A 1QP7A 4TMYA 2MYUA 2A9QA 1L5YA 2FN8A 2IPLA 5FWXA 2PUAA 1PEYA 2MYPA 3O2SB 1JL3A 1EAYA 3FMVA 1EWKA 3FDFA 4M88A 4G97A 1DCFA 3SAJA 5TQ2A 5TPZD 3FFWA 2FMKA 1VLZA 3TX6A 4YGXB 3Q15C 2RGYA 3N75A 3FFTA 1MB3A 2JB9A 2PL9A 4O5AA 5PNTA 5TQ0B 5HSGA 4GPAA 1OXBB 4YV7A 3HDGA 1ZGZA 1DC7A 2JBAB 2QVCA 3LUDA 3JPYA 3SNKA 3RVJA 1YIOA 2P9HA 4WWHA 5DLEA 4P1ZA 2M1ZA 4TLLB 5EWMB 3N0XA 4Z4IA 1XWWA 4YCSA 3BBLA 3VNBA 4EUKA 3JTEA 3C3WA 2JVIA 1DP4A 3MF4A 1JHZA 4B09A 3LMKA 3G85A 5JNUA 4N41A 5TPWA 1CEYA 4LDAA 4F12A 3EODA 2GX6A 3EAFA 3H5IA 5FBKA 1KRWA 2FN9A 4GNRA 2GBPA 1NXOA 1MVOA 4WT7A 2E4XA 1LJUA 3OLVA 1EWTA 4NICA 1NXTA 1YS7A 5TPZA 3CHYA 4W5NA 5KC8A 3DGFC 1NXWA 4MQFA 1P6QA 3KSMA 1A2OA 3URMA 1YK1A 4O1IA 5TPWB 4QYWA 4TLMB 3IP5A 1GUDA 1BAPA 1WETA 3KYIB 4Z4HA 1M2EA 1MIHA 2FEPA 3TO5A 4G86A 3OLYA 1U0SY 1Z16A 5GQSA 4RK5A 1ZGGA 2QV0A 3RVKA 4RDCA 1VPWA 1VKRA 1DC8A 3H75A 4RU1A 5KQPA 1JYEA 1SXHA 1W25A 3H5LA 3MQ4A 3NBMA 4JP1A 4RS3A 3M9WA 2IPAB 4G0ZA 4PZ0A 2RJOA 3RVNA 4E7PA 2X7XA 4NQRA 4KK3A 3TD9A 4WZZA 3MMNA 3GRCA 3KS9A 3QLTA 1DCKA 2NZVG 1NXPA 1M2FA 3LKBA 4ZPJA 3GV0A 1A04A 3OQMA 5ABPA 2MYNA 3NHMA 2FKAA 2JRLA 4RK7A 4MS4B 4EY3A 3CKMA 1DZ3A 1BDJA 3KG2A 4EYOA 4ZMRA 1FFSA 3IP9A 3NNSA 1K66A 4MS1B 3UKJA 1PHRA 5IBQA 3HJFA 3G1WA 4EYQA 6ABPA 4O1HA 3N8IA 3IDOA 3ILYA 1YMVA 2FTKE 2Q5CA 4Q6WA 3EQZA 2HSGA 3DBIA 3T6KA 3S99A 3W9SA 1JFSA 3BREA 3KKEA 4OTZA 1NATA 2A9RA 4MR7A 5FWXB 4Z0NA 2L2QA 1NXSA 1ZN2A 5B3JC 2J48A 1A0OA 3H6HA 4WXEA 9ABPA 1QQAA 1USIA 1C4WA 1QMPA 2QZJA 3R0JA 4W5TA 4MR8B 5TQJA 2JVKA 3HK2A 2B4AA 4RWEA 1PUXA 1JYFA 2LBPA 4F3TA 2FQWA
chains in the Genus database with same CATH superfamily
4RAQA 3Q3VA 1Z45A 3ZXIA 7MDHA 1JIUA 4CN9A 5LDDC 1MFPA 2ZANA 2ORYA 2Z5GA 3K73O 5HJ7A 4QJ4A 1VYHA 2VTVA 4X9XA 2BYTA 2Y6UA 1U98A 1M2GA 1VJ0A 3GP3A 4PWYA 3RAFC 4M0UA 3PK0A 2F00A 5ALFA 2X86A 1C9MA 2FEKA 3CZRA 3SSNA 1VXOA 3KXKA 4EYEA 3KQHA 4LV5B 3CNHA 4MRMB 1LBHA 1XLWA 2GPJA 2IYZA 2XUOA 1RJ9A 3INYA 3L4BA 4Q7JB 4UM9D 3WBJA 1D6JA 3U56A 4EHHA 4RH3A 1Z7BA 4C08A 2WD9A 1SVUA 3N2ZB 2EWVA 3IPCA 4FNGA 2GO7A 2OO5A 3H5WA 4ARCA 3W2EA 1E7MA 1EAMA 3QKTA 5J4HA 1YZQA 4G5RA 221PA 5HS6A 5KOHA 1A9ZA 5L6LB 4TV9A 3C7CB 4OU5A 4EVQA 2I33A 4ARBA 4LF9B 2R5FA 4WK4B 4S05A 4L8VA 4RELA 3FRJA 4U2EA 4WASA 3S2YA 3DQPA 5LQMA 2KYRA 3GH3A 5DP2A 1BCSB 1TI7A 4B75A 3KJIA 2A4KA 1E3WB 4C89A 2C59A 1TF5A 3KQYA 4PF1A 1JHQA 3ETJA 2YV3A 2ODAA 1QZ3A 4IFBA 4JP8A 1N75A 4K2AA 1TIBA 3LBHA 3EY9A 4HWGA 4YRRA 3PLAE 3THYA 1QCDA 4X90A 3S27A 3ETLA 1SOMA 1NE7A 1QVWA 4TKVA 5A4AA 1ZJZA 2F1OA 1QXSA 2ZAOA 3DAFA 3EVBA 4GXQA 5CNIA 2B78A 3D5EA 4BJ3A 4F97A 1K8RA 3C7DB 3GFFA 5D6NA 5GVSA 3FPAA 1ZM2A 1O57A 1ZY2A 4Q4HB 2IS1A 2I7TA 3E9QA 2O20A 4CMAA 3VYVA 3LL7A 1GAXA 1H2ZA 3B3GA 4PXYA 5F7OA 5M29A 3H5AA 1VMEA 1A4IA 4CCWA 2K7ZA 1OFIA 1EVIA 5H4GA 3TNFA 3OO1A 4KQMA 5DN6A 2QZ9A 4HTFB 5LDHA 1KMMA 5I51A 4M0LA 4KXVA 1PR9A 2P6NA 3MPUA 1P7PA 1XMXA 3K09A 4PC6A 3HYTA 3MELA 1NBHA 3FNFA 3IMCA 4DEVA 2R47A 2GN0A 3AF6A 3P52A 3BZUA 4MAFA 1DAOA 5E38A 3WV5A 1QKIA 1U04A 3CIOA 3OTWA 1C0IA 4CTJA 1V35A 2GJAA 1JDBB 1SKYE 2PMWB 2WU1A 3NBKA 1D07A 2IV7A 1ECFA 2CZQA 3QYJA 4EPRA 3GY0A 1GJRA 5KJ1A 3GD7A 4WXHA 4YJKA 5EMHA 4B31A 4LMPA 2DBYA 4DIUA 1ZD5A 1I94B 5CW2A 5B3KA 4NYMQ 5FR1A 5KWIA 4B76A 1GHTA 3GIDA 3CYFA 2CWDA 2EX4A 3L7KA 4KPFC 1WABA 5LP6A 2W83A 1U3UA 2EEZA 2JJQA 5FP0A 3RRFA 1QOZA 4E32A 5IZ4A 5KMGB 2QN7A 1VL2A 2OHGA 3LXUX 1MRNA 2VR1A 4JENA 4EJSA 2BM0A 3TFWA 2IH4A 2PMCA 3HXPA 4L16A 3NU1A 1F1JA 1PL7A 3DDZX 3WLTA 3UG6A 2LR0A 1UPCA 4ERXA 3I9NA 1DIOB 1ZMTA 3ZCVA 2UXDB 4KXFB 1XSEA 4IO0A 4IVPA 4JR2A 1LBEA 2JFVA 2R6AA 3QPVA 3T9AA 3KSRA 3ZVMA 4EZIA 1T0JB 2YYAA 1RZRA 3BL6A 1EYZA 1O89A 2OHHA 1FDTA 1G7SA 2BLLA 3IMKA 3SQOA 3R9WA 4I3HA 4LVUA 3G49A 4D6XA 3N5CA 5LZ9A 2YN0A 4KHPB 4EMUA 3A4MA 3CV3A 3KXDA 4M0DA 2B5OA 1I5OA 1L3BA 4R9SA 5DJ5A 3TZEA 4DCGA 3EYWA 2BFOA 3DLAA 4NCKA 4PEVA 3OWOA 2OL4A 4L3WA 3OQJA 2V7QD 4H77A 4RMHA 5KYYA 4HXYA 3D6VA 2JASA 1MHPA 2HHCA 1Z4JA 1GVHA 3WJ1A 1FYFA 1XF1A 1OX4A 2I2DA 2XE6A 2R8BA 4DLRA 4XRGA 5DNUA 1XPRA 1WBJB 5M3BA 3VO1A 3OLXA 3BRQA 2PX6A 3RIHA 1VC2A 1UC4B 3L01A 4DNFA 2OXIA 5JNVA 3N07A 4CQJA 1JR4A 3ZNNA 3WMFA 3FETA 3HBAA 3H97A 1E8NA 1LWNA 2BLNA 4M0EA 1RZUA 3NVMB 4TYQA 4XTCS 4O4IF 2W37A 4R05A 4IIHA 2Q6VA 1MX3A 1GNSA 1VP9A 2UUAB 4PZPA 2WKWA 1O58A 2H0QA 2V58A 2WWRA 3AUFA 5LC1A 5A1TA 4NF2A 1WUJS 4QSHA 1KVQA 5C1BA 4IHQA 1MFZA 4J49A 4JYBA 3UC9A 1VE7A 4H6VA 1CC1S 3AVUA 2DU8A 3DWGA 1UXIA 1ICIA 1ADYA 3TMAA 4W5RA 3U5TA 2ZITA 2ATCA 1E5VA 3JYQA 4XYLA 3GHYA 4ZI7A 3GGSA 2BGRA 3AUJB 1X1DA 1FYEA 3R5SA 4OHWA 1QK3A 2WI8A 1K2VN 3TDMA 2PZMA 1XOIA 4L4YA 5IASA 3CH4B 1HE3A 1ETHA 2JGRA 1LDEA 3IKLA 4W82A 4EJ0A 3A37A 3NDRA 2QUZA 5EIAA 2JJ1D 4Z4QA 3IERA 3K92A 1CUDA 2C42A 1JLKA 1Q91A 4QARA 3T54A 1JNXX 2QUIA 2REQA 5GINE 4G01B 4HDKA 2J33A 1PI3A 2ATIA 2N1BA 3BCUA 5AOBA 4BFZA 3A31A 1LRLA 4FP9A 4N39A 4OLBA 4KO4S 1LTHR 3LNCA 3W5IA 2O8EB 1F3LA 1S2IA 1HFKA 4NR0A 1PNTA 4CVNA 1H0HA 4WESB 3STWA 3B1VA 4CYMA 4D9CA 1GUZA 1KIAA 2IZ0A 4KIGA 4LX8A 3W5DA 3AGQA 2GYVA 4PQRA 1WDMA 3U4MA 2VF2A 3DKVA 2FWPA 1IQUA 4QREA 5JASA 4KGDA 1XDSA 5GJBA 1M1YE 3RSSA 2HO5A 3EW9A 3PEEA 4A15A 1CUVA 1AA9A 3PNYA 2IYQA 2QX4A 2R3SA 2VRWA 3OZEA 3NGLA 4JKOA 4JP2A 4WX2B 4BMDA 4NENA 2QAIA 3EVFA 4V0ME 4NY1A 5LSAA 2CC2A 4GEKA 4QECA 3ITKA 3I12A 4IWNA 5E6RB 1Y3BE 2YWFA 2NSJA 4BLPA 1FX0B 4O5OA 4F45A 5JQGB 1BDIA 1ONSA 4OSOA 5I5EA 4ZAFA 1RYNA 1Y1RA 2H52A 3I3SR 2FVYA 4TKZA 1UDRA 5B37A 3KLNA 3EZLA 2VUTA 2P69A 2DKNA 3F6PA 1IZ9A 3L1IA 3NJ8A 4I9NA 4ZOEA 3AETA 4WLFA 3EUAA 1ESNA 2MINB 3TOZA 5CX4A 1GZDA 1N6KA 3DFKA 5B7PA 2OGSA 1VLQA 5EXEA 3N74A 2PKYX 3PQFA 3VR5A 3F6YA 3W78A 1NUQA 1CR6A 1BHO1 2EFDB 4WBXC 4Z7QB 5HIKA 3ZJVA 1PVVA 1LLFA 1GGVA 1O7JA 5DX1A 8ADHA 1KMIY 2AEFA 4TYPA 1PS9A 4UHFA 5EI5A 2PPLA 1JQBA 3ILXA 4HFMA 5J47A 4OXQA 4QTYA 4DCUA 4NYMR 4GO1A 4LJ5A 4RESA 3HB0A 4BZQA 5MDHA 4X93A 3IL2A 1N78A 5K6AA 2J59A 3SBOA 2JNWA 3IAEA 1M6NA 2VHVA 2B3DA 5FAKA 4IZOA 1B6TA 4URWR 4RJJA 1KZ9A 1G98A 4EO7A 1YB1A 1K1EA 5IAGA 1UK7A 3PC3A 2ZI7A 1T5DX 2WJIA 1EDBA 2LGJA 3DEAA 5LQCA 1JFTA 1QFZA 4IV5A 5BQPA 3VU1A 3BAFA 3OA0A 3TZKA 3FLBA 4XLZA 4CV2A 1QPGA 5BVHA 1FRFS 4C04A 4GMKA 4HUQB 2WIBA 3CMMA 1TJYA 4M49A 3RS9A 1E96A 2WM8A 3P9KA 4J7XA 4RM3A 4P32A 4HNTA 3FTQA 1X1TA 2O4CA 3AK4A 3OMXA 3PVSA 4K87A 4J7CA 1E9SA 2SKDA 4PS1A 2IQIA 3CF2A 4U2DA 3T7TA 4EIWA 5KYWB 1SVMA 4E31A 4C78A 2XYVA 3GGCA 3DL4A 3A4NA 1PG0A 2VEDA 3I6BA 4TRMA 2F8SA 1QO0A 2WYUA 3RYFA 2ES4A 1PV2A 1RD4A 2JHGA 2PQMA 4BP1A 5BMVA 3GFPA 3PI7A 3H9EO 2YMLA 3NT5A 3QE3A 2KWIA 3O5AA 7REQB 4XX1A 10MHA 4XWWA 1RPJA 4UAUA 2E6UX 4QPNA 1U1FA 1XC7A 1IY8A 5C3UA 5AJTA 3EXIA 4R2IA 3S2EA 3GYGA 1BKYA 4KPYA 1H94A 4M0KA 4NNPA 4ZREA 2CDRA 4BLSA 2MYTA 821PA 2IUFA 5DN6D 4E3ZA 5EZYB 3N2KA 5JY1A 1IB0A 5HG0A 1APBA 1MMFB 1KRHA 1Y42X 5D3MB 3C8DA 3D8TA 1TUGA 3B6JA 4AZSA 3FI0A 1DV2A 3L9XA 1T2FA 4PLFA 1L4HA 1OGJA 4GEGA 2GZRA 1NVXQ 4OYYA 4C7JA 4KSCA 5THXA 1OTXA 3O3OB 4U7FA 3GCWA 5K01A 2QYSA 3STYA 4JXKA 5DIFA 3OQVA 3E7DA 1OC4A 2B4RO 5DHRA 2WAMA 2AKAB 5ADWA 4HQLA 2PLWA 3R1IA 3GL9A 1T1GA 1WRBA 4C5AA 3B6ZA 1IU9A 2CLMB 1Z0SA 2FRDA 2ZRCA 2WUGA 3EDYA 3WHLA 1NVAA 4DLSA 2PUDA 1SOAA 5EMJA 3WL7A 1ZDMA 1N2OA 1NVFA 2A7QA 1BVHA 5GWXA 4A26A 4GKJB 1YS1X 2IP1A 1CDEA 2QUHA 2RKWA 3A0RB 3LVBA 3WK9A 421PA 2CXXA 3O8NA 2JI9A 1AQJA 3FHOA 2Q27A 2Q5IA 2XKBA 3UGKA 4BCDA 1F51E 3MCAA 3NHAA 1IY0A 1QDLB 2FEAA 3CONA 3BMNA 4ZEXA 2YW2A 2CBXA 4ZO7A 5FA8A 4B2LA 4IDNA 4BO8A 5LP6B 4U8GA 1E2EA 2H11A 4QC2A 3FYUB 3NALA 4QTUB 5E6SB 5K0GA 4U02A 2QUJA 1TCAA 2OT3B 3BSFA 3C6BA 3L7YA 4KC0A 4M1MA 2PKQP 4XLTA 3F4BA 2XRYA 1CQIA 3C4QA 1K98A 3RT7A 4R2MA 3VAZA 2G4CA 2ZZKA 1PD0A 2FZWA 4FNMA 4N47A 2FCRA 5THKA 5KIAA 4P34A 3T1HB 2I34A 1M6EX 3ZXYA 2VDKB 1K68A 1N2CA 721PA 5EJAA 2INGX 1JG1A 1SXPA 4OKIA 2VF8A 1P5JA 2YZKA 4FWBA 4RLFA 4LHZA 4DBVO 2CDBA 4HTFA 1HORA 2HWKA 3BWDD 3ISTA 3RQSA 2BSQA 1I2DA 3JWEA 2QD1A 4QO8A 2O8DB 2V9ZA 4P0TA 3QMVA 3WLAA 3QG1A 2R7AA 2XDAA 2Y0CA 3FFWA 4O2BB 4BNTA 1C1HA 2HWYA 4K9QA 4LHYA 2OOKA 2IDJA 3HVKA 5GADl 2A59A 1WX1A 1ULHA 4RZUA 4O4IA 2P8JA 2H08A 3HY3A 4AN1A 2CYBA 1G6Q1 1M8JA 2PA0A 1YR7A 4FHFA 2G28A 2VPXA 2YZNA 2R7KA 4Y9RA 3ZCSA 1DG1G 1PJTA 1FBNA 2BP7B 2AH5A 1SQ0A 1TA0A 1Y7LA 2AR9A 4H4CA 4KN6A 3SHVA 4GI5A 1EVJA 2PH5A 2C96A 3EIXA 3C48A 3ZVLA 2GF2A 1YZHA 3R0QA 3T5CA 3WGTA 2Q1UA 1CLUA 2FRVA 1DJNA 3I8SA 4IUCS 3IAM1 4P08A 1PGNA 4B79A 4PYNA 4DJDC 1SWVA 3WGMA 4JUIA 2WQ7A 1C1DA 2VHUA 1I4WA 3OY2A 4U9UA 2CDAA 1XL0A 2J67A 4JC8A 2C3MA 4U5XA 5HOEA 3W7AA 3SQWA 5HIIA 5JJIA 2WF5A 4C7BA 1YK1A 5HF5A 3EDQA 1V2GA 4H7IA 4UUOA 3V7UA 5HW0A 5AIBA 2P9BA 3NKFA 4ZWNA 1SIBE 3MW8A 2WYOA 2V4UA 4P54A 5K3FA 3D8NA 2HV8A 2W2MA 2BC9A 4RD3A 4ZYVA 2CKDA 5AW1A 2QV0A 4NHOA 3FNGA 3DFIA 3PXUA 4MI3A 1WMBA 3H75A 4XDHA 4EI7A 4X8LA 2KM1A 3BERA 1MOPA 5FOTA 3RB8A 1SVOA 3RVNA 1K86A 4Z3KA 5FOXA 4F9GA 3GJ6A 3W05A 3RTGA 1QSGA 1YHYA 3O4VA 2X9QA 2WA2A 2KLHA 3FAZA 4LNHA 4QFBA 4U3JA 4IX1A 4WCDA 2HA5A 2ZRNA 3B3JA 3DZJA 3GV0A 4ITRC 4M76B 1SOUA 2Z58A 1GPMA 3V2HA 2XOXA 2ONJA 3QJGA 2PXXA 5LIRA 1LTKA 2DH5A 3SJZA 1Z6ZA 5DK4A 4ZT4A 1FK8A 4MP3A 1Y1QA 3ZJTA 1HLPA 1A4RA 4HKTA 3JQFC 4X91A 4ZAWA 4JOCA 3LKZA 4JYCA 1G8GA 1ZISA 3G1WA 1H6AA 2C8VA 3DL0A 1LVGA 3O8LA 4C03A 3NP7A 1YMVA 1YZYA 4BAGA 2I62A 4HPWA 3SJAA 3C24A 4P80A 1GQ2A 4H35A 3LQFA 3PHJA 1DEAA 4HAWA 4NL4H 4PINA 3BIJA 3I9JA 4MR7A 4R0MA 1HL3A 1H4QA 1VXRA 3K70C 1GU7A 1KYXA 1TMGE 1W0JD 4Y6RA 5D3QA 5TQVA 1A0OA 1CQXA 3H6HA 4TTRA 2QZJA 2Z6VA 2QLMA 3A2LA 2ZJOA 5FPYA 4INPA 5IVIA 2ZYHA 4L8WB 1DBPA 4IY1A 3BG5A 3IOEA 4PSVA 5ELLA 4OU4A 1KJWA 1SELA 2D1YA 3AR3A 3PC7A 4KYVA 2FUEA 2I2BA 4MUJA 5DCLA 4DPMA 3W6NA 1S8NA 2HIMA 1KFJB 1XNRB 2PLAA 1MABB 2ECPA 3GLQA 4DF3A 1ZC3A 2JGDA 4G8CA 1JH9A 3VNQA 2YVAA 2Y77A 1U2TA 3PC4A 1IY1A 4YP0A 3ZYZA 1NQAO 4M83A 4OMDA 1XVVA 1ZEJA 2GN8A 3KJQA 2P67A 2CGEA 4DJEC 5FTWA 1A69A 1H2EA 4QU9A 5B53A 3ZDEA 2FP4A 3FTCA 3I64A 3QHQA 5DMHA 1HGXA 3F2VA 3HP7A 2XGGA 4AJPA 5BN4B 1GNTA 1RM0A 3VAAA 2XUHA 3AR9A 4EKEA 3WGIA 3EF1A 2GD2A 3TGWA 1VCIA 1II8B 3NFYA 2DFNA 1LSSA 1NYLA 3PXDA 4AI6A 4BFSA 2YNMC 2G80A 2ZTUA 3H11B 4I9FA 3ZDRA 1VL8A 2WHRA 2RONA 3RVDA 3B13B 4GQIA 4L5BA 1D2EA 4L0MA 1ENZA 4BUZA 4Q1CA 1PZFA 3CGGA 2XXAB 1DU4A 1HTBA 3K0AB 3ISVA 3C4JA 1Y82A 2VPTA 3DB2A 3R3ZA 4QUDA 5F1YA 4IFIA 5DX8A 3RIEA 2C2MA 4Q05A 1N6NA 4P93A 1E4VA 1ZOIA 5I45A 1JAYA 1AKRA 3FIUA 2QHXA 4LWPA 4BU0A 4BECA 4KWTA 3IALA 2P1ZA 5CM2Z 4Z9AA 3S0JA 4C0AC 3HA2A 4D3YA 3ZUPA 4YXWD 4R2WA 4NYJR 3L7BA 4IDCA 3M33A 4OGWA 2ACKA 2CKMA 3DDOA 1N7HA 1EEHA 1X0XA 4DMKA 4RSRA 4YRCA 4W1PA 4UU1A 4EFDA 5EMKA 3UOWA 1SKBA 3VC1A 3MJVA 3BORA 3TLKA 2YYZA 1E62A 1TA9A 3BWBA 4JKYA 3D6JA 3HJGA 3VGPA 1OBCA 3W5BA 4IDOA 3ME5A 4C3OB 5JOQA 2OZEA 4OK5A 5AH0A 1GDDA 5JI2E 1W4CA 3ES9A 1ONOA 3UAGA 3UHAA 4I1PA 1W5AA 4CQLA 2V5VA 1WKVA 1WV0A 3FPFA 3LC2O 5AFSA 1DCTA 1UP4A 1C9EA 3ORHA 2F90A 3RJMA 5CG1A 2LUOA 3LFTA 2W2XA 3VISA 4BMCA 2QZ4A 2G71A 5JCOC 4YR9A 1I1OA 3OOHA 3P9RA 3FPCA 2HNAA 3BA6A 4RZ3A 3F96A 5C0OE 2C83A 2VNSA 4ON9A 2C95A 1MCZA 1EE9A 1WEHA 1KAOA 3I61A 3TQFA 4G0OA 4U63A 3LLSA 4GX1A 2CCJA 2Y0BA 3OM9A 3OZDA 1Z4PX 3T3EA 5B3AA 3HB9A 1GILA 2Y1WA 3VHQA 2ZJ6A 1I7NA 1SUBA 1ETUA 4BPBA 1N77A 3K1TA 1EFUA 4CI9A 1V5WA 1KI2A 4Z4EA 2QG4A 2L19A 5CBPB 1LV8A 2G72A 4NE9A 1QAMA 3HR4A 1ZAYA 3U49A 5MHTA 1P0CA 2Q4RA 1S3FA 4UUMA 3U7JA 2UVDA 5I9IA 4LZJA 5G4KA 3G5UA 1ST2A 2C77A 1J90A 2QL9A 3SQMA 4EPXA 1PYOA 4EB8A 4FB4A 3C7AA 5JHHB 3VQTA 1V3UA 1E0DA 5EYPA 1DKMA 4LZOA 4F96A 5CFNA 3ONNA 1DWUA 1Z39A 1CIPA 2OBLA 2OV3A 1Y6RA 3STVA 1QX3A 4BWFB 4P3YA 1QUEA 2EU8A 3UQYS 1EBBA 3H6GA 3TE6A 2JIMA 2DQYA 2C54A 4IM7A 3C16C 4DBLC 1KF0A 1UJCA 1G2QA 4D92A 3MTAA 1ZG3A 2HBYA 1LWOA 3TRJA 4WVFA 2C61A 3ZY3A 3LF1A 3VAYA 4JBYA 1ANKA 2JI7A 4NV0A 4L8GA 4EL0A 2J32A 5IWAB 2Z57A 1TT5B 4DKJA 1TPZA 3LOPA 3LXRA 1QONA 2AFIA 2C7GA 1TA4A 4JBGA 2OENG 2EBWA 3MHPA 5CVVA 1JAZA 1N9ZA 1W59A 1F5NA 3G68A 4B40A 1NGSA 1C7RA 4CUKA 1G8KA 4EI8A 6Q21A 2VQFB 1SM4A 4JI4B 2BZSA 4ACAA 1U2RA 1ZEMA 4Y67A 4EEKA 4CEIA 3O8QA 5K8LA 5JFGA 3RVMA 1T2NA 2NU7A 5M5BA 3ZJ5A 4BMOB 2C7OA 3A6LA 4M53A 5EJ2A 3PRYA 4OQ4A 4JXXA 1I5RA 2AF3C 4ZVRA 3W0LB 3HADA 1EWRA 4C6RA 5G0VA 1J1ZA 1P0MA 3GLGE 2C4VA 1CERA 2XSZD 4YMWA 1TTTA 1KL7A 3PHGA 5ICGA 3FPHA 1L4BA 3MJFA 3TI7A 4FGJA 1PG2A 1I9CA 3W3AD 4J1NA 1LK5A 2YY7A 1QB8A 3S8EA 1P4GA 2OV4A 1UBTS 3FOCA 1B74A 4AM8A 2ADFA 3I5AA 5IX8A 4NBVA 3KQKA 2G8LA 4RTNA 4GI2A 3FNHA 1QH1A 5FPTA 4R2LA 3GFTA 2OK7A 3R5JA 2BKAA 4DAEA 4QOIA 2H4FA 3IV7A 3CVVA 2D1SA 1HQKA 1YULA 4JLJA 1HFJA 3AEKA 4WHMA 1FOEB 2WAYA 5EZYF 3QTBA 3AR6A 2R7MA 2OGZA 2D2FA 2ZTHA 1N25A 4JHXA 4OBXA 4UVEA 1OFHA 1UJBA 1X7WB 3I8OA 3WQQA 1ZJ6A 3O8OA 1NYRA 1V96A 4UFNA 3UFXA 1MKYA 3G0CA 2HNKA 4ZT5A 3NDJA 3NEPX 5ILOA 1GG2A 4P4TA 2OCGA 1U8UA 1L7VC 4F2GA 3KB8A 3Q85A 2C9CA 3CPSA 2ZBUA 2D2IA 3QVGA 2R00C 1C3VA 2EZ8A 2ZRJA 2R4TA 5BUQA 4KYUA 4RPCA 3WGHA 5JBQA 4KE7A 4NV3A 3MN1A 2F3SA 4F5WA 1SQSA 4IQGA 3L1KA 4KYIB 4UNRA 3ET5A 3PUYA 4P3OA 3OKAA 4KV7A 4ROSA 3TYXA 5C5EA 2BGTA 3B7PA 2FZLA 4YCCA 4L51A 4GHWA 2X19A 4FGSA 3IELA 1NX9A 3PFHA 1Z33A 3HSKA 2H00A 2CL7X 2P9ZA 5HS4A 4AX4A 2VS1A 3JQAB 1KI6B 2WWFA 4O29A 5D5QA 3T9FA 1NASA 5JQGF 4RY9A 2YNMA 1YGYA 1SXJB 3D3EA 3G23A 4QQ8A 3T12A 3PC6A 4FFMA 4QTXA 3U31A 1MENA 2E89A 2P7HA 2HT1A 1E4EA 1E6MA 2CW5A 3PPYA 1XHLA 4ML3A 4JYZA 4RQUA 5DGIA 1T0UA 4FDTA 5BWOA 5HRAA 1P9WA 1Q1ZA 1NVMB 3CE6A 3HN2A 5E7QA 3ZIDA 2PCJA 5EUQB 1MRZA 5CVTA 2OQIA 4RSGA 4IEFB 5H8WA 4TQUS 3N0TA 1DFIA 2XCOA 2N0SA 4AX8A 3S70A 2HMAA 3K96A 1LNZA 1NG9A 3W3AA 2PKEA 1PJ2A 3HQ4O 4RTKA 2PH7A 3FCYA 4DR7B 3LDHA 2BPOA 4ZI3A 2OXEA 3X1JA 2VUHB 4M54A 5K0NA 1O77A 1O95A 1UWLA 1WB6A 4FBLA 4M1KA 2NXJA 4MV6A 5LU9A 2PUGA 2QJOA 5AM3A 4B4OA 5BN1A 2YJ3A 3E9CA 2OP1A 1ZMBA 3H19A 4OAPA 5D51S 1UADA 3UKOA 3C3KA 2VRCA 3U80A 2C9BA 3Q3GE 5GP1A 4LFCB 5B36A 1OX5A 1Z8HA 4GI3A 3IO5A 3VR3D 4XD7D 2NPOA 1TMYA 3AUSA 4NKRA 4YXWA 5A5VA 4U2KA 4KGVA 3QWFA 3LQ1A 5CTJA 1UBHS 4H3VA 5DEIA 4DR4B 2Q07A 2AYZA 1KK1A 1W5EA 4HR7A 1GG5A 3DCIA 3VPHA 2WG1A 3PPVA 5JZVA 3IEVA 4C0XA 1TUEA 1PHPA 1R6DA 1SULA 2ZTVA 1JA1A 2H6EA 1AHNA 2PWPA 5DW0A 3SG0A 3I01M 4WBNB 4D4MA 3O47A 4R71A 3BFKA 3E5HA 2C5BA 4CE6A 4J4BA 5LQSA 2I4NA 3P9IA 1Z0KA 4N6GA 1Z25A 1K8QA 5SZIA 3KUUA 2COKA 1GNPA 1HT3A 4AZ0B 2JJMA 3JXEA 5ITZB 2AN9A 2ZIXB 4MYUA 3BHMA 4PAQA 5DGCA 2EATA 5FBLB 3IEUA 4OCZA 2X9NA 1P4HA 3JQ7B 1JHAA 4TROA 5DNDA 5TQ2B 1ZX1A 5FKJA 1QCCA 2B9EA 4PTZA 2HJWA 3RF7A 2ID7A 3MWYW 2WF9A 2R6JA 3DJYA 3E7PA 3E84A 2WQ6A 4WUVA 5FBWB 3C6QA 5ESDA 4PCUA 2B6NA 1EKXA 1Z5UA 5KOIA 3JAKB 1GZHB 2Q1TA 5HOQA 5IKXA 4F93B 3ZNPA 1XCLA 2XD4A 1QHNA 1XQ9A 3S4YA 2F48A 2X6RA 3GNSA 4ABYA 4H2DA 1RNLA 1GRQA 4XQCA 1RWWA 4YAKA 4RVUA 5B2ZA 2GPSA 1ZLXA 4C14A 4FNAA 4F04A 1E4OA 2ZB2A 1KPHA 4KOAA 3K70B 5HEKA 2HLDD 5CA1B 1Z0DA 4XQGA 3KUDA 6YASA 3WO0A 1H9CA 3T34A 4CT4B 4RTLA 3PXEA 5G2OA 2GVZC 2VP3A 3PDUA 4Z2YA 2C03A 1FFEA 4ARSA 1M9NA 1QB7A 1UIMA 3BEOA 4YT4A 1TADA 3NM6B 4MKZA 3KJZA 1X87A 5I9MA 1T8PA 5AIAA 1GOTA 1X9IA 3L0YA 1DAGA 2A0WA 2ATEA 3O8BA 1W6RA 4WNAB 1TM3E 2CLIB 1UIRA 2EFYA 1OFUX 1NBWB 3CRNA 3E1SA 5JI3E 1K4MA 3KALA 3TE7A 2ZSKA 3EVDA 2A9QA 3H9JA 2UVQA 3I4FA 5TRTA 1K89A 2FFHA 5FWXA 2I2CA 4R69A 3ZI0A 1ND5A 1OAAA 5LLDA 4ILEA 3JASA 1D2MA 3EMBA 3O7WA 1RACA 4H18A 4Q3BA 1BH2A 2A1UB 3EVEA 3H6KA 4X1KA 3V8RA 4B45A 4ER6A 5KOHB 3GP8A 4AO8A 3TX6A 4BCBA 4UU8A 1EE1A 1O4VA 1U6KA 5L40A 3H4IA 4HX2A 4NXMB 4A0HA 2C2YA 1NVDA 3AP1A 3OOYA 2CSUA 3G2PA 1VCOA 3BRWD 4B8ZA 1DMRA 3C5VA 4FIZA 4MMXB 4JBNA 3PNKA 4D3DA 2GERA 3NOOA 1PAUA 3BJEA 3D3WB 3QVVA 2V7QA 3MF4A 4K1LA 4RKWA 3R7DA 2WSMA 2NZYA 1EM8A 3DTVA 3I4LA 1PTJC 4YRQA 1JHVA 4TMZA 4DIBA 1IWOA 2Y71A 1P9LA 3A26A 3EY4A 3KHKA 2HJSA 4I5EA 1L5KA 5IYZB 3BFPA 1DPGA 1FMTA 2Z2IA 2O2YA 3OD5A 4H31A 2FN9A 2WJGA 4PBSA 3TZLA 4ZALA 1EIZA 3C3YA 1GQOA 4XWYA 1UPUA 1V5EA 2YFHA 5C53B 2AFVA 5J2UB 2Q5OA 1DEOA 6AT1A 2UZAA 2AFHA 3VTFA 3TFOA 3QVSA 2PKCA 3DGFC 3DMDA 4F46A 5JRZA 2FB9A 2JKYA 1LX6A 3KSMA 3NKLA 4G9EA 3O4GA 4GZMA 4MCAA 5ALHA 2VP9A 4M7WA 4MWBA 3IP5A 1PW7A 2GS9A 4M46A 1IOLA 3G2MA 4ARUA 3TG8A 4QVKA 2VZ8A 5F3WB 2VPQA 4XUGB 1ZSNA 4ZVNA 5DM0A 5F3RA 3LQRA 1U0SY 1V9CA 3NHLA 5EGSA 2X0KA 1R0ZA 4V0OA 3IB3A 5DSXA 5K6TA 3DDNA 2ESRA 4PM4A 3H5LA 2QRMA 3LX4A 2H63A 4FOLA 4HXFB 3RV3A 3OC0A 4O2AA 2VHJA 4ZEVA 1SIWA 3L07A 2GBLA 4Y6LA 5FR2A 1X38A 4H7DA 2I7XA 3WLPA 2M6SA 2CLFB 5K05A 5LXTB 1U1IA 2FWRA 2G5TA 1H1TA 2JI6A 3AW9A 4QGFA 3ADCA 1N92A 3TOXA 3CMCO 3E8MA 4L28A 2R2GA 1NN5A 1C80A 5CP8A 3C5EA 1R0LA 1L7XA 4DGSA 2WKQA 3H17A 3I52A 2A5YB 3AOEA 1NF3A 3C1UA 3WL4A 1MO3A 2YC4C 2OZLB 5AW5A 3ZZUA 4DV5B 2XCQA 1KDYA 3VGJA 5A4IS 2Z3WA 1U3FA 3AB8A 1U8AA 4FYHA 3ZZMA 1LW6E 2OHJA 2WJ6A 2CNDA 5E6RA 4EYQA 5BOSB 8MHTA 5C46F 2NUPA 3KM0A 1BQEA 1SCUB 2PWAA 1BS2A 2FWMX 3CF4G 4AF8A 3DBIA 3MWEB 4XE5A 4ICIA 4CM5A 3HE3A 3HO6A 4KMMA 1Y3HA 2I1QA 3VSAA 3PHLA 4BCCA 1E89A 1IZYA 1HNNA 3U9TA 1GARA 3WDLA 2J46A 3TOCA 3J7TA 4JXZA 3MTJA 2J41A 5E6UA 2Z4TA 2QROA 1GCOA 2CNKA 2FQWA 2ZU6A 3U7EB 4D4HA 1N9GB 1P4RA 4JR1A 4YDHB 3BHNA 2PGXA 1B8NA 4CF4A 4INOA 3W06A 5HJEA 1QZTA 1QF9A 2B36A 4CLRB 4QYSA 5CDUA 3SHQA 2DSTA 2ZZMA 5JE8A 1ABEA 2JCGA 1IHPA 2XXBA 1E7SA 1U63A 5U9CA 1EVYA 4PPQA 2POQX 1RC0A 4IGEA 4WKPA 1C3XA 2C7BA 3ZKWB 5C1PA 3EX7C 1O95D 3M70A 3QLUC 3B36A 4NPHA 5J43A 1ZJYA 3WX0A 4YRMA 1Y48E 4O2LA 5IBRA 1H0RA 2GAAA 3FDZB 3NTXA 5GJCA 3V4PB 1IPFA 2Y27A 4EJ2A 1Y1TA 2ZTLA 2C4TA 3E5MA 2ID8A 3UA3A 4DILA 5BUZA 2YXDA 3AHIA 3E5RA 5B58C 1S2OA 4WLNA 5KEIA 3GUYA 1L4MA 2VZ9A 2WNIA 3H5VA 4ZJZA 1UDWA 2VIIA 4OPMA 5DWDA 1P2FA 3CE9A 4GW3A 1F6BA 2CXTA 4IH4A 3OPMA 1MT0A 2GTIA 2IDZA 4WBNF 3CNBA 1QRAA 3IUMA 2F43B 2WFZA 2A5FA 2JFBA 4P4GA 3STHA 2ZVQX 3Q9UA 2DPMA 1M34E 1OT5A 3LF2A 4BVJA 4LHSA 3UOGA 1CHDA 1B1AA 3E9ZA 4EJSC 1GGMA 1TVCA 5FPQA 4BBJA 4AS3A 4LXGA 4QUBA 2OYSA 4A91A 5I3CA 1RM4A 3L7OA 2H9IA 2IZ6A 5CRIA 2VEOA 1LFAA 3NO4A 3OTQA 4YWJA 3UH1A 2NO5A 4GOJA 5LIPA 3O1IC 2VDUE 8OHMA 5HKKD 1FS5A 4LWOA 4O4JA 3ZOZA 5DTIA 2O8FA 4DJJA 1C0PA 1EHCA 4OI4A 2GK3A 1JB9A 1TEVA 2HFJA 3GH1A 2D6FA 1RW4A 1KKUA 1X1QA 1CQJA 1A2KC 1Q92A 3MBIA 4HB3A 4M55A 5FJJA 5KTSA 4Q18A 3PR2B 2A58A 3R4CA 2M6RA 1KBOA 4MGEA 4TKUB 5AQ1A 1IUPA 4O8ZA 3PITA 3BE4A 1UKZA 4NMMA 2VJOA 3UMYA 2ODEA 1U3GA 3HU2A 3NDBB 1U65A 3FKQA 4C2UA 1N9GA 4FR0A 2BFCA 4HBZA 2JBHA 1HDIA 5E6UB 4DSZA 2XNKA 1P18A 3VOAA 1JIJA 4LY0A 3GDHA 2Y4OA 4AAYA 2O06A 1BN6A 3EULA 3FG9A 3KTAB 5BR8B 1XA0A 4UC0A 2X7HA 4G0QA 3RRNA 3ZGXA 1I51A 4Q4JA 4M0MA 1J23A 4DDVA 1XRPA 3RVLA 4F91B 4DPKA 3GRPA 1BMQA 3DH0A 3EUFA 4M8NE 3TNYA 1AUVA 4DRXB 1EESA 1ISPA 2ZSJA 4NMLA 1CF9A 1XZCA 4YT5A 5EE9A 5KDLA 3FRHA 2M9MA 4RYLA 1A1VA 2C94A 2QRQA 4TMVA 1OLXB 1YE3A 2Z2ZA 1T3SA 3RU3A 4AMBA 2HCRA 3SQXA 1D5WA 1H8ED 1PT9A 3QIAA 1BXRB 3UVEA 1KY5A 3JYHA 3QELB 2BUAA 3WZLA 4KGXA 3V5NA 2CD7A 1TW2A 1ZM4A 3RS4A 1IHOA 5B7GA 1GTSA 1D8AA 2F9LA 3M3PA 2IUYA 2XYPA 1YMQA 4D6PA 4B3FX 4H7JA 3TPZA 3ELWA 4GYJA 2Y99A 3IT1A 4ENWA 3EDMA 1EDOA 5DBGA 2OXTA 3GLFB 1U7OA 2PT7A 3L0SA 3AF0A 3QLVA 4PX9A 2FSPA 2IYVA 2R751 5SZHB 2QP4A 3TNDA 4LYHA 1LUAA 3JD3A 3SCZA 4PYKA 2QTMA 1Y8CA 4JVSB 3L8ZA 1YMUA 4GE0A 4ZJPA 1PTJA 4GH5A 3CF0A 1TC2A 2XDQB 2ZIFA 3FCAA 4JI5B 2VH2A 1RQ2A 4R8RA 2CNWD 4D3SA 1Q15A 3HDJA 1NR5A 1W1UA 3DZKA 1FDRA 1G21E 1T1SA 2ZUVA 2PS9A 2BHRA 1TQ2A 4TWAA 3RTBA 4GM0A 1BJRE 3RLIA 4PZAA 1GRRA 2G9QA 1XEAA 4X1YA 2H1SA 4YUAA 4TT8A 3PIIA 1P8AA 3AEUA 3CR8A 1V11A 1AB6A 1KI7A 4YRJA 2BMVA 1Z0AA 3IH5A 3NWBA 3VR1A 3IEIA 4UEKA 4A0SA 4EJMA 5YASA 4CHGA 3OE1A 3WSVA 2ZPUA 4GWKA 1CPYA 3KB2A 5AKIA 1XRJA 1Z06A 1AIPA 2FN3A 5JJLA 4WZAB 2FETA 2O7SA 4DDMA 4W8HA 1OGIA 2WVGA 4MKGA 4ZN6A 3SJUA 2PGOA 2R87A 4JB3A 1GXSB 3OEWA 5JZBA 1CZKA 1IDOA 2XNJA 4KITB 4MQ5A 3O9MA 5IBPA 1XLUA 4M89A 1SKYB 5JY6A 1E66A 4J0IA 4M1TA 1N8TA 4W6QA 1DLIA 1SVIA 1WD7A 3D0QA 1DAPA 3BFXA 1QP4A 4HG2A 3IAHA 2RDMA 4CJXA 5KKCA 4ZZ3A 4KLNA 4G1CA 3K2BA 3Q11A 2BI4A 1H2WA 5JD4A 5LM3A 2VDOB 3G02A 3GI1A 3ULKA 2XI4A 3IA7A 3SX4A 1EFLA 2A94A 1UJ4A 2NO4A 1LCIA 1U2QA 1BDHA 1GEGA 4FCTA 5HIMA 2Q6IA 5F7XA 2R9VA 2RGXA 4WUTA 1PE0A 4HT3B 3IT0A 4KQ2A 2XT0A 1JJBA 1LBIA 2PAAA 1TB4A 1R6TA 1VSUA 4Y6GB 3X1DA 4N0DA 1MQ9A 3AVPA 3TJRA 1QRTA 1FFYA 3NZEA 5C18A 1SEPA 1Q5PA 4MVJH 5ANRB 4CFSA 1H3EA 2IX3A 2I29A 2J45A 1RLUA 2JARA 3FZYA 3SSAA 3WDMA 3KYCB 4CLRA 3EPRA 4J2OA 3QFSA 2GN6A 3QLVC 3DE5X 2AYYA 2ZB4A 3JD1A 3PWZA 4MPJA 5IFKA 1OTHA 1P72A 1FFWA 3UUFA 5MN6A 3ROKA 1VYVA 1T0BA 1LLCA 1RAHA 5L7TA 3NBZC 3MQ2A 3UA4A 4EX7A 1XKQA 1Y34E 2VPZA 2NUTA 5KX5F 2KQUA 5T8KA 1U9JA 4ZKDA 5AESA 4NZ9A 5LOVB 4MKRA 5SY6A 3ZYCA 1I01A 1TMOA 3IAAA 4YS6A 1YQXA 2IXAA 2BM8A 1U81A 4HAXA 2JZNA 1I80A 3F1LA 4MVJM 3VKFA 3RT1A 3AVTA 3WRWA 1PK9A 2ZJ3A 3R5HA 4IFTA 1JR3E 2F59A 2CMFA 4YFYA 2QRVA 1FSPA 2YV1A 2LE0A 1QQ6A 2O3SA 3GCGA 4HLUC 3RSOA 4FGLA 2FXIA 1PQPA 2QP3A 3OPYA 2W9XA 1IAVA 4K9OA 3UOAB 4D7AA 4P0PB 4JLNA 5IT4A 2QGFA 2Q2QA 2P6UA 1CUGA 2BR4A 4RD2A 1A8QA 3FBGA 4GX0A 3ZS9A 4CKXA 3C7TA 4DV4B 4P4LA 4UDNA 1K5HA 3TLBA 1E69A 4F9FA 1M0TA 3AM3A 1F2DA 4BO1A 2Q99A 4D9JA 4X6LA 3B7WA 1RRCA 4FFSA 2C9ZA 1N6IA 3V55A 3IV9A 3EYAA 5AVOA 3GVIA 4UM9B 3U3JA 5DEOA 3TAUA 1KHTA 1Z26A 1SA0A 1G9SA 1SG6A 2J7PD 1JG4A 2ZW9A 1QUFA 1PJ4A 2EQ5A 3G5TA 1PFGA 2HZ7A 4UHCA 3P9NA 3BMCA 4O4LA 1J0DA 4ZCQA 4DA4A 1TQ4A 1R5JA 3CZ9A 3P0FA 2FPWA 1MORA 3NR2A 4OI1A 4AJNA 2FLWA 4G09A 3DE0X 3A9CA 1K6MA 1N1MA 3FOAA 3IBFA 4M37A 3BB4A 2C97A 1XNJA 2FUG1 4XJXA 2ZPAA 5LD2B 2AG8A 2NU9B 4GYWA 2M98A 1Y7IA 5CFMA 1ZW6A 3LUGA 3OZUA 3P8ZA 2ZSDA 2O6HA 1HTTA 1HA3A 4PZLA 4EQ6B 5BP7A 4X66B 2C58A 4FEGA 1QMGA 2QTHA 5AKKA 1UBFA 4MA5A 1R8QA 2CMHA 3FM9A 1J7JA 3V8NA 1GPDG 4QULA 4B6RA 3UV3A 2O1SA 1UWCA 3QX9A 4NCAA 2QMHA 2ODNA 4C7KA 1Z4MA 1SCKA 1O97D 4Q7QA 4N03A 4Q4AA 3T7RA 1Q21A 3SVTA 1UQRA 2H0RA 2QQGA 1F0YA 3A6PC 2A9KA 1X7YA 2PYZA 2DPXA 4RWZA 4H3HB 3BXZA 5EHXA 1G8PA 3PD0A 4GAEA 4JBWA 4BPRA 1E3LA 5HF9A 3V7YA 4LI3X 4RK0A 2RAPA 4G1EB 4L57A 4G4SP 1DLJA 4Z6KA 3VC7A 1Y80A 1IRXA 1YI0A 3VR2A 3T3OA 2KPOA 4MH0R 1DI0A 2VSNA 3FDJA 4UXIA 5FBVB 5CLQA 4EFLA 3TXXA 4XFKA 2FX5A 3QPBA 1QVAA 2EKLA 2QSZA 4HH1A 2I91A 2A9JA 4WZAE 1SBHA 4BNKA 1E9DA 1N5MA 2H59A 1H93A 2H7YA 3B1FA 4XDYA 4HD8A 5FTJA 3ZHYA 1R6BX 3DP9A 4KGZA 1AF4A 1NPDA 2ASVA 4EHKA 4IIYA 2R1ZA 1JWLA 4TMWA 3CNNA 4NHEA 3TM5A 4OHYA 4S0ZA 3WAJA 2BFMA 4OJYA 1E2KA 4AJLA 4UTXA 2D5CA 1N57A 2J5RA 4IZ6A 1G64A 2HLNA 2JD1A 4Q9HA 4R8KA 4ENSA 1BOOA 5CM9C 3AR7A 4K26A 3P4XA 4DEXA 4GC9A 3E18A 3LOQA 4HEA6 4PYIA 2ZB3A 4ZVVA 3CF4A 5HF8A 3U5ZB 3VZBA 2DCMA 2D3TA 2WZQA 2XJ4A 2N1MA 3M89A 4MCJA 4YALA 3AHEA 4P4NA 4DLBA 4UOZA 4ESVA 5ICMA 4RVHA 1JHMA 1MT3A 1P39A 4WFIA 3FVTA 3G59A 2GD0A 4YLEA 1FVHA 4FS8A 2ZWVA 4Q7EA 5FULA 4EHNA 5DHFA 1VI5A 2PJDA 1KR2A 4U7WA 2ZJYA 3OMWA 5KC9A 2GLXA 2NWQA 3NYQA 3OQBA 3PTLA 1CNMA 3DUFA 3LT4A 5EIBD 5IZCA 3SN6A 3A7EA 1VJGA 2GR9A 1Z83A 1QG0A 3WNCA 1X9HA 1AS2A 1EBFA 3A1CA 3AV3A 2L0XA 2PIDA 3FR7A 4I36A 4N1AA 4NAHA 3X1WA 1ZK2A 4Q7MB 1TDJA 2VN8A 3LDGA 2QMZA 4C0BA 1NBMD 2WK1A 4HF7A 2IYOA 2PUAA 2OORA 3S29A 1U5BA 3HDTA 3CR7A 1YACA 3VPAA 1AT1A 4GMXA 5TQ2A 3OHPA 2QMEA 1FTWA 1YO6A 4UNNA 3MAJA 4ARZB 3IODA 1IHXA 1LQTA 1N3LA 2VPPA 4ECEA 4BFYA 2WQZA 1IBRA 1LPAB 4LOJA 5LOVA 2ZIWB 2VLBA 3CRVA 4QHYA 4YCNA 3BC1A 2B69A 1CQZA 3WKCA 3RWMB 1Z5PA 3HDGA 3ENZA 1ADBA 2Z8XA 4X61A 4ZO6A 4M2LA 3SNKA 3WGUA 5EE5B 1WF6A 3WOHA 2Z98A 2D0PB 1KDPA 4YRPA 3DZBA 3R2JA 1UBOS 3VNBA 1RTTA 3MGBA 4G07A 3G9UA 4LKRA 2NU9A 4QYIA 4QU0A 1EP9A 3ZLBA 4XEHA 4Z53A 1PEDA 1YZFA 3ZDXB 1NW7A 1DOHA 2WJPA 2F4NA 4KN5A 4LBWA 3K5HA 4MVJA 4WN9B 3KWFA 3TMKA 4CEIB 1LZKA 3FPSA 3P94A 1J97A 1BS1A 1G60A 1UF9A 1XCMA 2WTBA 4QPCA 4DXAA 1T36B 4EPTA 1W44A 2XT6A 4LRSB 3BMCB 4MI6A 2AFIB 2G1JA 2H3EA 1NW3A 2QY6A 5BWLA 2ET6A 4HDRB 4R3UC 3QOWA 1AVTA 1ZA2A 3D59A 4Q3AA 1UAAA 4UU0A 4AO6A 3DD1A 1YRWA 4JI8B 1ZRSA 2XUPA 1LS6A 1YS4A 2D1RA 4QYTA 5JPIA 1G16A 1PVDA 2JLQA 1C3EA 4QEKA 1RBMA 4ZO9A 4CR8A 1M2EA 6REQB 3MWFA 4HRYA 4G86A 2AXEA 3GAMA 2DPGA 5FADA 3HKBB 1M34B 4MDEA 3EXFB 4RDCA 4IJQA 3RHFA 4XM1A 1I10A 2ZI6A 1JYEA 4YLGA 4ALKA 3CPEA 5LA6B 3L8CA 4I8XA 4CMBA 2ZYAA 1LJ8A 3EARA 1C4KA 5DI9A 1GGKA 1W88A 1YV9A 5EKDA 1EH5A 4E7PA 2HHLA 5IJ0B 1S3GA 3TD9A 3UG7A 4M1WA 5KX5A 2NACA 1E4EB 3DCNA 1MAHA 2W6MA 3KPJA 4IHJB 1I3OA 1NUUA 3HVUA 1SXJA 3R3JA 4KB5A 3H8JA 4B2YA 1NIJA 2FKAA 2JRLA 3CZPA 3JWGA 2ZBFA 1THGA 4OJQA 1LSOA 3D6HA 4XGRA 3SC3A 3LBYA 5IKPA 1KEUA 1BDJA 2MHCA 1I0ZA 4XWAA 3VOTA 5JXWA 3QW4B 3ROMA 3FSEA 4E1AA 5ALUA 2EKBA 1JJAA 3OTGA 4IEEA 4CCSA 4MMYB 2KE5A 3GZNA 4J2HA 3S28A 4N8EA 1U0OC 2YVLA 3MTDA 2CMKA 4NBTA 4COKA 1JFSA 3KWJA 3B1KA 1ZWLA 3ADKA 2FQQA 1V0JA 2A9RA 3EZYA 3KRTA 3UBMA 1R2QA 1QIMA 1AV6A 1C8LA 3U4IA 3UPTA 2FI1A 2PGNA 2BGUA 1HV8A 4WXEA 3DBVO 4WY5A 1PR3A 2H65A 9ABPA 1E0KA 2AZMA 5G0UA 1IEQA 3GLFA 5MGBA 1Y8RB 1NLFA 1R3DA 2LBPA 5IZCC 3FFBA 4KE6A 2QRUA 3NEAA 2DFTA 4FYIA 4TQGA 4X3OA 1MJ5A 4BNUA 5E3IA 3LLCA 1HWYA 3PX3A 3NETA 2TMGA 4PGAA 2Q6TA 1XPJA 2GBCA 1UK8A 4YRNA 2VNIA 1X15A 4RJ2A 2J1LA 2BW0A 3AVOA 4MEJA 4UHKA 2FSUA 5EPOA 5K3BA 3RYCB 4D25A 1N8KA 5IRCD 3OH8A 3R6TA 2XTAA 4JB8A 3FCUB 2GJSA 4EI2A 3UMMA 2XE4A 4GXRA 1R0KA 3PC2A 3PGVA 2PRSA 1KFKB 1I36A 4P8RA 3NC4A 1OAKA 4BMNA 4IUYA 1OVMA 3PXCX 1MX5A 4IS3A 4F1JA 2IIQA 3AUKA 3CLVA 4RQAA 2ORWA 4HZUA 2EWMA 3C5CA 2VTDA 5CPBA 5FO0A 1DNPA 3QG5A 1JE0A 4IAOA 4ER3A 5KBYA 1JAXA 4HB2A 2FG7C 2IOFK 4IF6A 2PS3A 4R1MA 2ZM6B 5FWDA 4FHDA 1UPFA 4QPPA 4EY6A 1GFIA 4NCJA 3V8VA 4AJIA 4C29A 3JQPA 1TCBA 4FFOA 1Q3TA 1BOFA 4JY7A 2JD2A 4V3CA 4WFKA 5BSRA 2IIPA 3A6ZA 3RFCA 2O2HA 3H11A 3GFSA 3UJBA 4NLLA 3HM2A 2P65A 4RPHA 3R74A 2IYNA 3M6MD 1XJCA 4OK3A 1J56A 4CM8B 4N8SA 1UMCA 1CQJB 4NCHA 4QRDA 4IVQA 4HEA1 2QIPA 1C7JA 1U2DA 2HY7A 3P2JA 1YBAA 3IT2A 2RBKA 3KKZA 3G0DA 3O3NB 5ECDA 4ACBA 4Z1OA 2ZRKA 2ZJ2A 3TB4A 1P4SA 4LRQA 1HF3A 2IOYA 3NRBA 4FWIB 3RSCA 2P2SA 3TD6A 5LKRA 1R0YA 4JJ4A 5F33A 5T7BA 5DHQA 2C31A 3AHFA 3D64A 3GA0A 1O6CA 1FW8A 1S0UA 3ABRB 1IZ7A 4NZYA 2UUCB 2V97A 4M9QA 2OPBA 4RE6A 4A82A 3TVTA 2JGFA 2C20A 1LC3A 2CJXA 2QEQA 1O8BA 3LUPA 4WY2A 4AP6A 1JEYB 3OTOB 3NONA 2OFOA 3HB5X 4J94A 5EWMA 3ZJUA 3RK0A 3NIWA 3FLEA 4MS1A 3NEYA 4W9NA 4FYKA 4MQ6A 3QU4A 4OH7A 1YBMA 3QELA 2YL2A 3OPYB 4PSAA 5HUQA 3QFHA 2GXSA 3B8EA 2H8GA 2IEYA 2Q1SA 3O9VA 5DK6A 4X20A 4XGIA 3PXGA 5K7SA 1QO0D 4Q3EA 1PL0A 4KVFA 2C9MA 1J2YA 1IATA 2F3RA 3EK2A 4IXNA 3T5AA 3K8YA 2ZAMA 3BE6A 2DECA 2J3MA 1I1QB 4KREA 4G1VA 4ZYXA 4EBBA 1WM1A 4RS4A 2DVMA 3T7CA 2WMYA 2IP4A 5FCDA 4RGVA 5I7FA 1LXCA 5ER9A 2YXEA 4JA2A 4P92A 4ZAYA 1E77A 2HA4A 3W34A 2J5KA 2WUEA 4E94A 2J9FA 4HWRA 2GZMA 3KT3A 4QGGA 5HIAA 3RYHB 2X14A 3R5XA 4BTVA 3T0IA 3B60A 4HZGA 5EZSA 4DIFA 1ISHA 4ZYUA 5FUYA 4B32A 4DBLE 3EMVA 2Q3FA 4X24A 1KHHA 4LNAA 4LE2A 4LCBA 4MRVA 4R9VA 3TBFA 3ZW8A 4YK7A 4CCYB 4DA6A 1LLQA 5K8JB 4MUKA 4J0EA 1ORVA 1GZVA 2OFXA 3EWAA 1BU5A 1G18A 4M0PA 4NEHB 4YCMA 1EUQA 2XMGA 3OJOA 4I46A 5CNJA 3A36A 1WY5A 2E6KA 3WJ7A 1VFPA 1XL1A 2GNOA 2XUJA 1QANA 2QD3A 1G6KA 3CT4A 4NC9A 5I01A 5JO9A 3S55A 5LQRA 3D2CA 3QU7A 1USKA 3CX6A 4NU5A 1LS1A 1XD9A 2GF9A 3FUXA 3H2IA 1IAQA 2HJRA 4LYYA 5G40A 1UT6A 4JLOA 2A78A 1N2XA 4JEUA 1JLMA 1WKCA 2P9GA 1AC5A 2VNHA 5F1PA 2QMYA 4HNGA 5KWSA 3SR0A 4PYJA 1VIVA 2XCUA 2Q3HA 4NNJA 5DTQA 1XZPA 2IOHA 4QE3A 4HAIA 2HPAA 5BT9A 3JQFA 1BWSA 1A9XB 1VCMA 1RZRD 1Z2AA 3O83A 1WSAA 1SUSA 1ZAKA 2JFWA 2QTNA 3N0WA 3IOCA 4HQ6A 1MZPA 3AL0C 3PQCA 4M6WA 4URXR 3WMGA 4D8TA 4W7IA 2MCFA 1MX1A 3R9KA 3L7AA 4ER7A 1BKSB 3U6KA 3GEPA 4LI0A 3H65A 1W36B 3D4BA 1LPSA 1OVGA 1E20A 1MX9A 1K2WA 3TW4A 5LP6F 4HS9A 2I3ZA 3G2HA 3ZOKA 2CL0X 2FEWB 3GDGA 4BLUA 2XAAA 1QE0A 2RH8A 3OM0A 1L5OA 1T1RA 1Z3IX 1DKNA 2QUBA 5TS3A 1X7XB 1R18A 4WJZA 1GPH1 2Y0DA 5EP2A 2HRRA 3PHIA 4DHEA 1NR1A 3OFJA 5ESRA 3RAPR 2X9VA 2X1MA 1RIIA 1Z17A 2DGDA 1J8DA 1H2HA 2FP4B 3L7IA 5DGDA 3VYRB 1MB0A 2VQDA 1U0GA 3HXKA 3KOMA 1UINA 3ND5A 4AYWA 1P3Y1 1QGUA 3LLUA 2V3WA 3U13A 4IS2A 1I3CA 4M36A 1FNBA 3UW1A 4LQLA 4UHJA 3EOZA 1KNQA 5FTNA 3ZNOA 2ILTA 5FL3A 2R8RA 2NOAA 5T4HA 1SUCA 3ED1A 1L7PA 1MAWA 1Y3DE 2P4EA 3BCHA 2X3FA 1TFUA 1XRQA 3DHNA 3OICA 1G3MA 2FPKA 2PRKA 3V34A 1Y8ZA 5CYGA 2EJUA 3AEQA 1AUXA 3QKRA 3W8NA 3K9QO 4IKOA 2NYVA 1N32B 2I78A 2GFQA 5E0OA 1T13A 2LIVA 1QH9A 3M82A 2H4ZA 1OZ0A 3U62A 2O54A 1CULC 1LF0A 1P9NA 2W11A 2P79A 4Z8XA 4I4TB 5L8VA 4CQNA 1PT8A 4Y2XA 1ZL2A 1U28A 3N2LA 3TAHA 2GB4A 5JAQA 3TUZC 1F8YA 1JEYA 4NWIA 3B3QA 1DL5A 5CLJA 3S8MA 2C5SA 5MN4A 1BEZA 3OM8A 1QE5A 1RVDA 2QAGC 4XI9A 2C4MA 2JJ2D 4J1TA 1B73A 4OP1A 4RC9A 2XLBA 1DWOA 2DT8A 4TMXA 2GSDA 4CKEB 4ZVSA 5KREA 3QVTA 2FFRA 1FLVA 3DMTA 3ZHTA 5I9SA 1CF2O 1OAOC 5TEWA 3DDSA 1NULA 5KVVA 1JB1A 1N5JA 4NH0A 1ECLA 2FJ0A 5BWNA 3E9RA 4ND8B 4YJ3F 1YQDA 3DAGA 3WWDA 3AERB 4LRYA 1BVUA 5IG2A 3VNUA 5DE3A 2C5LA 1YT5A 3MLBA 4DXHA 4DV1B 2IEDA 1SEVA 3NMUF 5C37A 4JYAB 1OUMA 4G0VA 5IKOA 3OIDA 5CM8B 1ORIA 2PX3A 1KYIA 2CUZA 1EQ2A 3O31A 3NUQA 4YRSA 2EV9A 1N6LA 2WLTA 3WYEA 1CZNA 1T5OA 2C2KA 4RNDB 5JCOA 1T2UA 3DDHA 1JHDA 5D85A 4D0GA 3ACCA 4FVTA 4RH1A 4KQ9A 3ESQA 3KYJB 3A4VA 5GZ3A 3BRSA 1O2DA 4N3AA 3WRYC 4DA9A 1NI5A 3IE0A 1EDDA 3RNLA 3ZD7A 1S3IA 1CUBA 1KC1A 2GZHA 4N6OA 2F3UA 2BBWA 1W8IA 2A1IA 4YJGB 3QV1A 5FLKA 3CFYA 5A6VA 2YIJA 4B2PA 1DT3A 4UEQA 3M4JA 4QXPA 1DO2A 5KVCA 2DUJA 1N6HA 5LVAA 1F0NA 2E4AA 2KBEA 4ARIA 1XCPA 1H9BA 1D9ZA 1OI7A 2ZYUX 4HEHA 4Y2QA 3WJ2A 1ODFA 3ETEA 5DLQC 3CR3C 4UVDA 3KAQA 4KFCA 5CBKA 1QIEA 1TOAA 3HJBA 3UC5A 5EJ6A 1FX1A 1YZUA 1SOVA 4R1PA 3REQA 4DHWA 1IXYA 3RKRA 3EEFA 3LHFA 4EHDA 2DPLA 3HLKA 3IJ5A 3A9UA 2YMMA 5I3ZA 3MSCA 4X8HA 3ZKWA 3QXHA 4OGFA 1E3QA 4D4GA 1AK1A 1E60A 3O1HB 3UANA 5JC8A 4DV0B 5ICSA 1CNFA 4AMYA 4Z49A 3GFRA 3EGDA 5KTMA 4FZ3A 3ZPXA 1BO6A 3F6BX 4U7TB 5CA0A 3X2SA 2ERYA 3GOQA 5EIHA 3TQRA 1KOLA 1ORRA 3EUWA 2FE1A 5E4YA 5ILQA 4U7JA 2X5NA 2WT4A 4UZSA 1FFAA 1OXKB 1KK3A 1E61A 4DCMA 1QRUA 3RHSA 5TNXA 3PEUA 4EYGA 3RSHA 1PN3A 3VJMA 5IUJC 1DAHA 5FLEX 4DCVA 1T5TA 3AONB 4E2XA 4AS1A 1E1CA 4GOKA 4IHJA 1L7DA 1FQKA 4OX9B 3A05A 1TE2A 3QE4A 1BW9A 2JGIA 1QRRA 1P3JA 1BRMA 3T8YA 5LQNA 2FX3A 3E9EA 2ZYGA 3OP1A 4JB0A 4YRTA 3JY6A 5ELXA 4I1UA 1FA9A 3T7IA 4N5LA 3JAKA 4GMDA 1V3TA 1J0EA 1W85A 3NUZA 3OE7A 3P9SA 2JH3A 3A3NA 2I67A 3BIXA 3MT0A 1NVWQ 1OJLA 5DM4A 2CLEB 3VYSB 2G5GX 2O3RA 1R37A 2V8BA 2J6CA 4JWTA 3MWGA 4HX5A 4MSUA 3IDQA 4NATA 5A5DA 3O03A 3WWOA 5KTKA 1XV5A 2XUZA 2O5VA 5AXAA 3FUUA 4EGAA 4TS1A 3Q5DA 1I2MA 3DZFA 3HJTA 3K9BA 3V7NA 1E9FA 2MYUA 4GRDA 4XCVA 4QM7A 1GDHA 1GTG1 1RDFA 2OCKA 2HA2A 2GZ1A 4L73A 4B84A 5JYCA 3OOWA 1PEYA 3AG6A 3ESZA 4N18A 2IYUA 3VOSA 3DXFA 3CLUC 2JS7A 3OUTA 3HUEA 3M5CA 4JWKA 3JQGB 1MEEA 3V4RA 3RODA 3A4IA 3KYDA 1R6UA 3AOGA 1CD5A 1R8SA 1XXHA 2IDKA 2NSYA 4ZCLA 3RLFA 4N7JA 1K97A 4I1YA 4QYIB 1H22A 3O82A 2P2CA 1J5EB 2AFHE 4A8PA 1Z6YA 2DLNA 2QSYA 1BSVA 2ZB8A 3EIQA 3GGPA 3LXMA 2A2ZA 3QVGB 4GBGA 4KX5A 4UFOA 4IDDA 5ALTA 4AJHA 5FTLA 5K3CA 1WXIA 1YIOA 1BDMA 2XYGA 2XOKD 2M1ZA 3VH2A 4TLBA 4G5FA 2XR1A 1ABBA 2FEXA 1RXSA 1XWWA 4U7PB 4U9HS 3C6ZA 5J2UF 3FIJA 1D2NA 1AK2A 5COBA 2GEUA 1DP4A 1GD1O 1X7WA 3EOBI 2HCBA 3UWKA 2QW8A 1HLGA 4MLZA 4EW2A 4KFTA 5KNCA 4B3TB 2EGHA 2WG0A 5JNUA 2HAEA 2FZCA 1KQNA 2VT7A 5JVDB 1T5IA 2OV2A 1Z63A 4XKJA 3TX2A 5L7YA 3M83A 3U7FB 2DYKA 4QM6A 1WD5A 2F1KA 2Y6VA 1CDOA 4W63A 1ECCA 3UAOA 2XA9A 4OP2A 3D3WA 1I32A 1WNTA 1FP2A 1JHOA 5ALXA 5E9WA 5K51A 1BS9A 1EWTA 1KYYA 4LMBA 1MW9X 4LOLA 4DLUA 3R7FA 3RS8A 3HTXA 3VYUB 2G36A 4B34A 2SCUB 1NXWA 5C8XA 1W34A 1ECGA 1DBIA 1UJ6A 3MT7A 2FOIA 3PGXA 3P9PA 3DUFB 3INTA 3R7WB 5BYBA 1QGOA 3SC4A 4A27A 4D02A 4ZFNA 2CJFA 5DGHA 4ZT3A 1F8UA 2NU8A 2A0XA 1UJ2A 1TRKA 1VSTA 2PZLA 1YQTA 4ENTA 1AKMA 1W2HA 3WMWA 2CK3A 5CMLA 1U0JA 5EQTA 4S35A 1W5BA 2VDJA 3C87A 4OHOA 3L4SO 4KQGA 2Z2KA 2BJVA 3COSA 2IZ1A 4XEUA 4Y6SA 3SU8A 2OCLA 4PLHA 1HM5A 2P4HX 1KO7A 5BSGA 4O3FA 5HKAA 1VPWA 1DZIA 2P9FA 3FYTA 5CD9A 4HWSA 4MULA 1GFZA 2HBRA 3HXOA 2JLUA 3DZCA 4J0JA 3D2AA 1N3YA 4OGLA 3TRIA 1K75A 3KQTA 3KYDB 2VSFA 1HNWB 3D7NA 3O8QB 2OQVA 5KCZA 5KNBD 2HC9A 1I6MA 2LVBA 4RQTA 2B8WA 4IIGA 4JBHA 1M2FA 1TUIA 3S7ZA 3BMQA 2QN3A 3DMTC 1NSTA 4G5HA 3DE4X 4WLOA 5G53C 5ABPA 1JQEA 5BV8A 4UE6A 4J0GA 3LCVB 2R6ZA 3RUHA 1SZCA 2Q9UA 5K0LA 3BJMA 1M10A 4LXQA 3IP9A 2FPUA 3AETB 3HCNA 3HEMA 4PHHA 4S1VA 4AJ9A 4D45A 5HKKA 1U8FO 2UYHA 3H1BA 3ZJYA 1Z0UA 1TIKA 2BBSA 1RCUA 1ZN7A 2FTKE 4YRKA 3HWX1 1A7UA 3CSDA 2ZUEA 2V5UA 2NTEA 3TJMA 4E5DA 3AFGA 3ZU6A 4Y7DA 3MJHA 2CNBA 1IBSA 1L8LA 2WD7A 1DSSG 1XA3A 2J48A 2ZR8A 3B6IA 3DLIA 3M9LA 3NLLA 1C4WA 4IPTA 4IXTA 3VDNB 1FLDA 5FDFA 5LMCA 3ADOA 1JTEA 2HA7A 4RW0A 1ISJA 5IT9A 2QT1A 5P8WA 2WMNB 5GIPE 4OP3A 1XNHA 5ED0A 1H05A 3CEJA 1Z4OA 1W4RA 2ZCUA 5CFQA 2GAFA 2XHZA 4FC7A 3ZE9A 3EPKA 3QVWA 5CFLA 3B6EA 3I0ZA 3ENVA 3RUAA 3DLTA 4BNNA 2QJFA 1QG4A 1AHPA 4CKCB 3SYTA 1CQPA 1DEXA 4NAUA 4RKRA 3PTAA 4DQDA 1IIRA 3QF7A 5J40A 1Z8DA 3AHHA 1TK3A 1J8MF 1JFLA 2JFGA 3NYRA 3RCBA 2HXGA 1UQUA 3OSZA 1A9RA 4PICA 3M2TA 4D9FA 2FR8A 3JD0A 4I3GA 3BIFA 4XQ0A 2L17A 4MKIA 1Z36A 4OQEA 4RL4A 1P62B 1Y5MA 2JGKA 4IHJF 5SZJA 1T1IA 4V3BA 3ADBA 3GRRA 1Q7BA 3LGSA 5LN1A 3O26A 4JLKA 2O2ZA 4JMPA 4NFSA 3HJAA 1T6BY 3PNSA 4FI3C 4TRJA 3HZHA 1OSNA 2XQIA 3S2ZA 2C5FA 2H4JA 4LKOA 3PD1A 5JS1A 1QCZA 4RY8A 4EABA 4AULA 2JF0A 4UOQA 4TT3D 5JCZA 1U2ZA 1ZYUA 2ZS7A 3AXTA 4R8LA 1TTHA 1KAGA 2D8AA 5GJWC 5L4NA 4MNTA 1GY8A 3ICWA 3VVBA 1SGWA 4FFBB 4U39A 4JBXA 2CHEA 3L40A 2ZROA 3BRWA 3EZ2A 3NT2A 4JKIA 5KHAA 3MT9A 3T3GA 4DMHA 2VPYA 1VLHA 3LUAA 4IGIA 3L5KA 3LTNC 1P33A 4R1SA 4HUTA 4WOPA 3A14A 4AG6A 4DLPA 1LNQA 4IGFA 3HCOA 3OT5A 4IXMA 1HYQA 3CCFA 5K3AA 4MV0A 1M33A 3L6BA 2VCEA 2YNMD 1WPGA 3I72A 3C14C 3OLWA 2V45A 5FFNA 2BF4A 4B46A 3T9CA 1QLHA 3FKSA 5HK8A 4DCJA 3PT5A 1MOZA 3VUEA 4EGQA 3AU8A 4FTWA 5IMSA 4H7PA 1FTGA 3BXHA 5I4BA 2WF8A 4TKLA 1M1YA 1RWMA 2A5DA 2DERA 5LZ4A 5A05A 3BIOA 1I3LA 2XMQA 5H59A 1YQGA 4IFEA 3G82C 4DSNA 1KH3A 4G5XA 4MVCA 1CSEE 4Z0PA 3LECA 4CM4B 2P9TA 4D1YA 1E79A 1F48A 2ZJZA 3KQWA 5A71A 4X65B 1MJHA 1YVDA 2QY9A 1ZI8A 4ITVA 1D4AA 1WTAA 1T2EA 1V11B 4LA4A 3G2OA 3QRWA 4AROA 3EQ6A 5AUOB 3NDPA 3L05A 1II8A 3SQNA 2JIDA 1NVBA 1X6VA 1Z6QA 3WS7A 3TLGA 3A1WA 4MLPA 3ORYA 3G9ZA 2HK7A 3T5MA 4YO7A 1V5GA 1ABFA 4NG4A 4R1QA 2HLDA 2PRYA 3TRHA 1FVXA 1JTVA 3KU1A 4F5DA 2HPHA 4DM4A 2XNSA 1R9GA 2ZYWX 2VSXA 1PT5A 2ECOA 4OYHA 3ZV4A 4BMPB 3ZXSA 4YACA 1G7TA 4BKMA 3OOEA 4YPVA 1B14A 1J20A 3FOWA 4RK4A 5F5NA 4BKQA 2PKQO 2KI5A 1Y9EA 1IRIA 3Q7QA 2Q3DA 5E1MA 3IESA 4CIAA 3CRRA 2IS2A 3CNLA 4FLEA 2B7BA 2FPSA 1WCXA 2QVZX 1RWOA 1TAQA 3MGAA 3MCZA 4RSMA 1AKVA 1XTQA 2KX7A 1NM5C 1R5BA 1EFRD 2QS9A 2F62A 3D8RA 3OCXA 1XDGA 1A9OA 3ZCTA 2OOSA 5JT1A 5KQLA 3D5TA 3E0QA 1VZ2A 5EMLA 4A2WA 2X5JO 4WCFC 4G8DA 1FUUA 1WP9A 3G89A 3KT0A 4OL0A 3TQOA 2HV9A 3ROFA 3IMFA 4N8DA 1YOBA 1S8AA 4QASA 4AZWA 3TW6A 1V4VA 1Q3HA 2BZ0A 3LCRA 5CDGA 4YEDA 1NBME 2QG9A 3DEHA 4YRAA 3K05A 4QTZA 4TL6A 3IRUA 3H2KA 4NABA 5J2TF 4IRXA 2EL7A 1SKQA 4Q4JB 4KQFA 1AXRA 3NHUA 2WSBA 1FSFA 1MC1A 5IAAA 5A4KA 1QIJA 2XQKA 2WU3A 5LDGA 2IXFA 4H1HA 1UDXA 1YAJA 2VDNB 4C2BA 1RHJA 1ADGA 1E2PA 1GPYA 1G55A 2NAFA 3VPCA 2WJAA 4TKVB 2GBGA 1VPLA 2K5UA 3TQIA 1ZR2A 2N3ZA 4EENA 1XTVA 3GG2A 3K1AB 3LT5A 3QF4B 4QYXA 1VBMA 4QUGA 3HY6A 3JCZA 3L18A 1FSZA 3ZHZA 2FPPB 4IQ4A 1FVFA 1NC1A 2Q9AA 3P97A 1XCBA 3VBEA 5KYNA 4FCCA 4FFNA 2ID4A 2UKDA 1CY2A 1JKFA 2PV7A 2ZAIA 1UZUA 2QORA 1L5QA 4HFNA 3GN2A 4OHBA 3DOEA 4RABA 2O59A 2RK4A 4M6WB 1SUIA 3NHJA 4BMYA 1H8EA 2ZSBA 2P1RA 2XNHA 2JDID 2GZDA 3CXUA 3E9DA 4A0FA 1I6LA 5HZKA 2WWGA 1KYVA 3LYAA 2J0EA 4KJZA 1HURA 4MKXA 1G1AA 4NBUA 3V1UA 5J4YA 5ELMA 4PGMA 3B1ZA 4F4IA 2BVNA 1M2VB 1QJ4A 1SPXA 3CS3A 3IPAA 3ROZA 3SEZA 3CLUD 3QQPA 1XQ1A 1E99A 1QCYA 4MAMA 3ETCA 3W8FA 2XRFA 1X1RA 2IEBA 1MXFA 4HADA 1PZMA 4U4AA 1YR3A 1RYFA 2J6HA 4FCWA 4MQEB 3GLVA 3Q3CA 1E1KA 5ALGA 4J3FA 4QGAA 1OCEA 1UKVY 3HBLA 2ZTSA 4YUXA 4R1LA 5CURA 1YCGA 1J70A 3QU2A 2C0PA 2GPYA 2GJKA 4FPXA 3DOFA 3IEKA 2OPHA 5CT9A 5L3ZA 3SHTA 4LSWA 3V1MA 3NATA 5B3JA 4DRXA 1WB4A 3TSAA 4X41A 1R66A 2Z1NA 3K35A 4JFAA 2WM2A 4GMHA 4EJ6A 4UTNA 3DS8A 4D9EA 4N5HX 3AKCA 1KZ7B 3SZGA 4AY5A 3KUCA 3IUJA 1SKUA 2BGKA 2WB4A 4KWCA 1QORA 1O6GA 2D0DA 3DEYX 3H0EA 5CLHA 1T8UA 2UVPA 1A7KA 3M6LA 3T4PA 5HQ3A 2V59A 4HLCA 3EPHA 1LDGA 2X8JB 4ZCRA 1JHXA 4KZKA 4UXJA 5DHPA 2IZZA 4GZ6A 4JEIA 1OZGA 2R1VB 3BDAA 4JROA 3N28A 5I8WA 1GDTA 2WJYA 1HDZA 3A6EA 3BJRA 4F8JA 1AS3A 2FH5B 4B3IA 3RVOA 2V54A 3IQEA 5HWSA 3K6JA 5ICEA 2W43A 4Q6BA 4BNIA 4D99A 2AUTA