4IGAA

The crystal structure of an activated thermotoga maritima chey with n-terminal region of flim
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
KRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/motor protein
molecule keywords Chemotaxis protein CheY
publication title The crystal structure of an activated Thermotoga maritima CheY with N-terminal region of FliM.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 41
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4igaA00
4FE4A 3TD9A 3DBIA 4Y9TA 4LX8A 3O74A 3T8YA 2RJOA 3Q7TA 3NNSA 3HO1A 4RK4A 3CTPA 1H9CA 5TQ0A 3LOPA 3Q15C 3RVRA 4W5OA 2L19A 3KKEA 3RQIA 4YO7A 1Z13A 9ABPA 1DBQA 5EWLB 3H6GA 1U04A 2OENG 4N03A 1FFGA 3H5TA 4CBVA 2JRLA 3DLHA 1YMVA 1PUXA 5TQ2B 3EJWA 4YRZA 4EY3A 3VNBA 2QXYA 3HS3A 4YLEA 1NXPA 5FBHA 3SG0A 1NXXA 3TB6A 1DCKA 1SD5A 3O21A 5GQSA 4IGAA 4EVSA 3I09A 3C97A 1RZRD 2YHBA 2CWDA 3DZDA 3EGCA 3H5VA 1R8JA 2PL1A 3MMNA 4MS3A 1TLFA 4Z9AA 2NZUG 3VNAA 1QQBA 2R25B 2QZJA 3DLBA 1ZVVA 5BQ3A 1ZH4A 3CG0A 5DCLA 4YCSA 2A9RA 2CHEA 3N0WA 4F8JA 3RVLA 5B3JA 1OXBB 4G0YA 2PUDA 1P6UA 2IPLA 4HNSA 4ETNA 1M2FA 2MYUA 4RK6A 5D2CA 4OBBA 1BA2A 1DP4A 4F12A 5DGCA 3IP7A 5KC8A 1QNLA 1YK0A 2NUBA 3C3WA 4OLAA 1JFVA 2JCGA 3H5IA 1FFWA 3A3KA 3N53A 2HSGA 3QX9A 5T7BA 2RGYA 2MYPA 2MSLA 5KQPA 1FQWA 4JASB 4P98A 4N76A 2NT4A 5DTEA 4RV5A 4E7OA 3O1HB 4N41A 2FLKA 1TJYA 3OLZA 3KG2A 4XAQA 5CNJA 4H3KB 5ED4A 4Z4IA 1YK1A 2E4YA 3LMKA 4IMIB 2FMIA 2WMYA 1ZAYA 4S04A 1YS7A 4N0PA 3GYBA 1JFTA 5PNTA 3LKVA 5IEBA 4Z9BA 5FWYB 3MF4A 1EWTA 2FQWA 4D6XA 3CG4A 2FMHA 4LRQA 1DCMA 3EODA 4YGXB 1ISRA 5C5EA 3JY6A 4LDZA 3IPAA 4B09A 3I5AA 3O2QB 4MRMA 4WZZA 4ZPJA 3ROFA 1RZRA 3H1EA 1L5YA 1DRJA 4EYGA 7ABPA 1MB3A 5IULC 1VKRA 4QPJC 2QSJA 4KV7A 2FLWA 4Q7EA 3I45A 3KLNA 3LTEA 3HDVA 3FDFA 3CKMA 4KZKA 4IILA 1GCGA 2IPAB 4LZLA 3QELA 3OMXA 4LE0A 4E7PA 2PAFA 3NHMA 5ABPA 2IYNA 1P2FA 2LUOA 3QEMA 1LK0A 3NNDA 1L5ZA 2PJUA 1E6MA 2LP4Y 1EWVA 1YVUA 3H5WA 4O1HA 1GLGA 1PNTA 4O5AA 1NY5A 5FWXA 3JPYA 1DBPA 5HM6A 3JPWA 2HPHA 1AB6A 1W25A 2LPMA 5TQ0B 3NBMA 1D2AA 1Z15A 1KGSA 3HEBA 2FN8A 1PEYA 2P4UA 4XFKA 4Z4EA 4Z99A 3GBPA 4KPYA 3MQ4A 5DLEA 4GNRA 4RU1A 3BREA 3K4HA 4PZ0A 4MR8A 3HDGA 5JNRA 3N6VA 3MIZA 3O1JC 1DG9A 2VYCA 3MM4A 4KK3A 5DKFA 4MLCA 2R47A 4O1IA 1M5TA 4WT7A 2P9HA 4RY0A 3QLUA 4PEVA 4JAVC 2QV0A 1NXWA 1NXOA 2QVCA 4P1ZA 4QICA 4RXTA 5BRAA 3D8UA 1FFSA 2IPNA 4MS3B 3SAJA 1JFSA 3CNBA 4EYQA 4MQFB 1K68A 4EUKA 3MYYA 6ABPA 3RVQA 3KSMA 4KFCA 4MR9A 4ETMA 1DC8A 2FMKA 2JB9A 3FFTA 1U2PA 4LE2A 3GV0A 1BDIA 4RK5A 1Z16A 3CFYA 5JNTA 4H3HB 4UHKA 3JS5A 1F51E 3CLKA 2X7XA 4ZYLA 2FQXA 1QKKA 5JNVA 5KQMA 1P8AA 1E2BA 3H5OA 4L85A 1BDHA 2H3HA 5CNIA 5HKOA 1MIHA 1YS6A 3SQNA 3EAFA 1Z12A 4DN6A 3F73A 2FVYA 2A9OA 4TLMB 4XARA 4MR7A 1C4WA 4IMJB 2PUCA 5TPWA 5KQGA 4ML3A 4RS3A 1M2EA 4JA2A 3FGZA 3SY8A 4RXMA 1YMUA 1E6KA 5IC5A 4YR7A 4RDCA 2L18A 3QX8A 5JNSA 2CD7A 5B3JC 3H1GA 2B4AA 2IKSA 5I4CA 4RY8A 1Z17A 3HK2A 1JF8A 3FMVA 3UUGA 1D4ZA 3A0UA 2PL9A 3BILA 5IUNC 1MAVA 5JNWA 2JK1A 1DC7A 2GI4A 3T95A 3CZCA 3M9XA 1AB5A 2J48A 1SXHA 1MVOA 4MQEA 1DBWA 4OTZA 1QQAA 4W5QA 3CZ5A 5T3YA 8ABPA 3O75A 3A0RB 5IX8A 1SRRA 1GCAA 2WRZA 3Q7RA 3QK7A 4Z0NA 2GKGA 4MRMB 1OXKB 3O2JA 1DCFA 3T38A 4DQDA 4G86A 3OQNA 2LIVA 4KMRA 2PUAA 1B00A 4HNRA 3HXMA 1JDNA 2MYTA 4JP1A 1NXVA 3GWGA 5KI6A 2FMFA 3N0RA 3Q7SA 4D74A 3BRSA 2R48A 3QELB 1URPA 1BAPA 4MS1A 4RXUA 1Z25A 2N9UA 3EULA 3C3MA 3QEMB 4XXHA 5F64A 2PLNA 2O20A 5IUJC 3HUTA 6CHYA 2ID9A 5IBQA 3KTOA 1A2OA 5GOTA 2WWVD 4Q6BA 5FWXB 2F8SA 1QMPA 4MS4A 1CHNA 2L2QA 4ETIA 4IF4A 3T6KA 3IDOA 2QW1A 3E3MA 1ZGZA 3HUUA 2KYRA 5CNMA 1JX6A 2FEKA 2RDMA 1USIA 3OLXA 4WXEA 5EWMA 4NCAA 2FEPA 1Z18A 4HYEA 4JB2A 3KHTA 3LUFA 4KRFA 1QP7A 1VRVA 4MR8B 2PUEA 3M6MD 1ZH2A 4ZJPA 5CHYA 1USGA 2FQYA 3OO0A 2E4VA 3GT7A 4F3TA 4G97A 2PUBA 3EDCA 4HNQA 4XLTA 2BGGA 2JVJA 1DZ3A 4TMYA 2HQOA 1ABEA 1ZESA 3QLVA 3C6QA 1D5WA 1NTRA 4MYRA 3L49A 5TE9A 1QO0A 3EQ2A 3F6CA 2M1ZA 2PUGA 2JVIA 4KNYA 4MR9B 1D1PA 3EQZA 4OATA 3LUDA 3M9WA 2GX6A 4KREA 2VUHB 2FKAA 5FBKA 3O1IC 2DRIA 1QP4A 4PYRA 2QR3A 3C3KA 2GWRA 3N0XA 4L4UA 4PICA 4FB4A 1QPZA 4D6YA 3QLUC 2A9QA 1IIBA 3GBVA 2WB4A 2E4UA 2NT3A 3CU5A 3UKJA 3GL9A 4RKRA 4G0XA 5TPZA 3RH0A 3OM1A 4YP9A 1E6LA 4MR7B 4KQCA 1NXTA 3RVKA 1HEYA 4OG2A 3OLYA 2MSKA 4H60A 5TPWB 1FSPA 1Z2DA 2ZWMA 1LJUA 3OM0A 4YS6A 4DADA 4Z4CA 4NQRA 3G1WA 2MYNA 5EWJA 2ZAYA 1PNRA 3OLWA 1Z26A 3CHYA 3H5LA 3ILHA 3TMYA 1ZDMA 2JBAA 1KMIY 3Q9SA 1TVMA 1CEYA 2FSPA 2GBPA 4QYMA 1WETA 4G0OA 2IOYA 2OQRA 3RVOA 4OLBA 3LUCA 1LBHA 3QLTA 3LUKA 4MQEB 2ID7A 4MPTA 1UDRA 1ZN2A 1ABFA 4EGSA 3SNKA 2TMYA 3JTEA 3KLOA 1ZGGA 1JBEA 4KQ9A 5BR1A 1K66A 4YWHA 1RXIA 3IP6A 1ZY2A 2FTKE 1XHFA 1F4VA 1S8NA 2MSWA 3BBLA 3LUGA 4NV3A 4UHJA 3I42A 1DRKA 2LBPA 2FN9A 3K9CA 3RVJA 3N8IA 2PKXA 2QU7A 1EAYA 1JL3A 3FFWA 3OO1A 1SXIA 4MS1B 3GA5A 4Z4GA 3N75A 3DGFC 2FW0A 5C5CA 4QYWA 2FEWB 3BRQA 3S99A 3DGEC 4MAAA 1NXSA 1Z2EA 1QO0D 4MQFA 4RK7A 4IRXA 4MS4B 1TMYA 1NATA 1QP0A 2HJ9A 3F7NA 3LFTA 4Z4HA 3NNNA 3URMA 3OLVA 1A0OA 4G0ZA 3HZHA 4G0MA 1U0SY 1JWLA 4FE7A 4Z4FA 5EWMB 3F6PA 4RKQA 3D02A 1P6QA 1JLKA 3QEKA 4RY9A 2E4XA 1RXEA 3NHZA 1BDJA 4RK1A 3RVPA 1MB0A 5HSGA 3A10A 4KK4A 5EWLA 1YTUA 3MA0A 4GPAA 1EHCA 1JHZA 4WWHA 2YHAA 4RK0A 2F8TA 4NICA 3IPCA 4RSMA 1KRWA 2IPMA 5TPZD 5TQ2A 2NZVG 3OQMA 1Y1LA 2PMCA 4TN5A 5KQLA 4EVQA 2V0NA 1GUDA 1APBA 1EFAA 3LUAA 1VLZA 3OMWA 3HSYA 4EYOA 3OQOA 1VPWA 3R0JA 2E4ZA 3H1FA 1USKA 1ISSA 3ILYA 2L17A 4M88A 3TX6A 4G0QA 2JVKA 3SM9A 5BRJA 2R4QA 4EYKA 4MGEA 4XASA 4F11A 5TQJA 1EWKA 4W5TA 1GUBA 4KVFA 1D1QA 4LDAA 4JOQA 5JS2A 3IP5A 2XDYA 4G0PA 3QLVC 3KS9A 2E4WA 1KRXA 2VK2A 4W5RA 3GRCA 4EVRA 2CHFA 3B2NA 3JVDA 4F06A 1JYFA 2I6FA 1PHRA 1XHEA 5IUKC 3RVMA 5JS1A 4W5NA 2AYZA 4N0QA 3KYIB 4WUTA 1RPJA 3KJXA 3CS3A 3RVNA 1YIOA 3ROTA 3O2SB 5EWJB 3RVSA 3E61A 4RWEA 3H75A 2JBAB 3CRNA 1JDPA 3JVIA 4TLLB 2WY2D 1ZITA 1T34A 3LUHA 4WXMA 2B1JA 3IP9A 4LE1A 3G85A 1M5UA 4Q6WA 2AYXA 2Q5CA 2M98A 2WJWA 5E3JA 2A9PA 4NCBA 4S05A 3HCWA 4YV7A 5JNUA 1PEAA 1LJLA 4JB0A 1U8TA 1BVHA 3Q41A 1JH9A 5KC9A 1LBIA 1JYEA 1ZHHA 3KYJB 4N47A 1TM2A 2HQBA 2VUIB 1W9HA 1CYEA 5IEJA 1J56A 5FWYA 3FFXA 3KCNA 2PUFA 2IDMA 3H6HA 1I3CA 3HVRA 1XWWA 1U2QA 3W9SA 4RZSA 5CNKA 2H0AA 2QVGA 3HM9A 3HV2A 3P9YA 3LUJA 1SXGA 1A04A 1C0EA 3HJFA 4PE5B 1RNLA 2WJAA 3LKBA 4ZMSA 1DJMA 5HQJA 3UK0A 2W42A 4ZMRA 3TO5A 2RJNA 5KWSA 4MLDA 2FXIA 2HQRA 3L6UA 2PE5A
chains in the Genus database with same CATH superfamily
4LDRA 2D0DA 1Q11A 2G4LA 3VU3A 5KOJB 3EH1A 1JAYA 4QVGA 1OB2A 1HTWA 1LZLA 1QS0A 4CTJA 2ZTVA 2HMVA 1QANA 1T1IA 1Z7GA 2IE8A 2ZSHA 3GA0A 2PZMA 2PLFA 4HKTA 4ZU3A 3HO1A 5IT0A 1H8HA 4RLSA 3EC7A 5AK0A 2DQ4A 5AO9A 1G18A 3FLBA 1YUNA 5TQ0A 1DL5A 2QZPA 2R4TA 2GM3A 3KB8A 4REOA 4F71A 1FNCA 1O6ZA 2AMVA 1XRNA 4GOND 3Q3VA 2NO9A 2QY9A 1CUBA 4DSUA 1UJ4A 1ELOA 2Q99A 3S8MA 2AFHB 3ZS9A 1SQ0A 5EPOA 4DV2B 5BSHA 2DFVA 4UARA 2Q46A 1EFTA 4M1WA 5ED0A 3ZWKA 4D8WA 1E1YA 5K05A 1KEEB 1BS1A 1XD2B 3SDSA 2XGMA 1N9ZA 4ZU6X 3RS5A 3FNHA 4QATA 4BX2A 4CHGA 4NMWA 1NG9A 1PYGA 1VLLA 3GGSA 4G8DA 4K9RA 1I01A 1OXUA 3QMVA 5A9RA 2DPGA 4G1UC 5TJHA 1B15A 2HRCA 4JDPA 5FTNA 5B4TA 3EXG1 1H6AA 5DNWA 3MOIA 1JWBB 2WNHA 1NLYA 3EISA 4HB0A 2AJ8A 4WA7A 4IZ6A 2R8YA 1UJBA 5FPPA 2BP7A 4RKEA 4F21A 3TAXA 2H85A 1TYZA 3A4TA 3N5KA 3VPBA 5AKGA 2BMAA 2WVAA 5H1YA 2IH5A 2JGJA 1C3OB 2I99A 3GT4A 4R1UA 1AKRA 3M34A 2AH5A 2IPLA 4FDUA 3DE5X 4PRKA 3BFXA 3ELBA 4DV1B 2CSUA 3LP8A 3WL5A 5WRFA 1ODKA 3M4YA 1DADA 1YMQA 5JAOA 3E58A 1G7CA 1SOVA 2FFAA 1YIDA 2D1YA 1YCDA 2OZVA 2A0YA 2PWPA 1PT6A 1SZJG 2ALJA 1Z2PX 2VKTA 3PXUA 2J5KA 5TXGA 3KETA 5DW0A 1ZP6A 4YQZA 2O8DB 1HRDA 1V6AA 3WKDA 1XZKA 4EJ6A 2ZSFA 3UM9A 5MDHA 4FYVA 2MYPA 3GAAA 1DPGA 1FLVA 4GQAA 4CV0A 4LYHA 4CLEA 2VJQA 3PRJA 1ICEA 2E5LB 4Q9AA 1TJYA 4JN6B 4H7JA 4WZAA 3HB5X 4ABYA 3OCJA 3EVNA 3MN1A 4MIYA 1CUZA 13PKA 3SM3A 5DGTA 1E2FA 3ER6A 2RB5A 4FHZA 4FHDA 4C06A 2KLHA 3G13A 3GQBB 1SVIA 4IUCS 5FUQA 3FHOA 1U3WA 4DXAA 2X8JA 2ZSEA 4EH1A 1LJ8A 2JLRA 3HA2A 5DHQA 4YGXB 3WL6A 2AX3A 1ORTA 1F38A 4DR2B 2DBZA 1YXMA 2FZ4A 4CG2A 2ZRIA 4DDWA 1XZIA 3ORFA 4F04A 2BSQA 3Q9LA 2NLOA 1B1AA 2Q2NA 2C97A 3QOWA 3VZSA 2ODNA 4EYSA 3GAZA 4Q7EA 3LTEA 4OQFA 4F56A 5BURA 3X1XA 3PRYA 3RWOA 2Y1LA 3SVTA 2J9YB 1FC0A 2IXTA 3ZJVA 2ACKA 2ANBA 1A9SA 1JQEA 4FQ7A 4HWGA 1LK0A 4N5IX 3K1TA 4RC9A 1LDYA 3LLCA 3KXPA 4U2BA 4AMYA 4BWFB 3IJRA 1SCUA 3BWYA 1GLGA 2AW3A 3A6KA 4FOTA 5B37A 4BQEA 3AHGA 5LKAA 1NHGA 2CXXA 5ALIA 4OJMX 3RJMA 1HLFA 3JPYA 3O8DA 4I1SA 5HX7A 3BE8A 3L1IA 3KAQA 4PWZA 3WGJA 1RXYA 4EHLA 1LQUA 3MLAA 4QIHA 1O96A 3W7BA 2DX7A 3K73O 3N9IA 5JYCA 4C4PA 3USCS 3TVTA 4Z99A 5C31A 3SZGA 3A6EA 1YCHA 4KPYA 3HU5A 3FKSA 4UU8A 3VR3D 3E1GA 3SDBA 2IYXA 2XA9A 5HBGA 1OBOA 1DKUA 3NM6B 3E2IA 3PI6A 3Q0EA 2RBGA 2DHRA 5AW9A 3WJAA 3F7MA 4ESOA 2VYCA 3ZCXA 5A62A 1MV8A 1QRAA 2G82A 3AJRA 1TT5B 1U2ZA 1PLJA 3IEVA 4BL5A 3VOAA 1E6UA 4O4LA 3ACDA 1VPLA 2C07A 4QYSA 3NVKI 2QRGA 1NXWA 1AKVA 2ZSIA 5BRAA 5KTOA 3GFTA 2F3QA 1WX1A 2EFDB 2F4VB 3TFOA 5AW0A 3DLCA 2AUTA 3KOUA 1KOLA 3OZWA 1FUEA 3M5CA 3IALA 3S7ZA 3TZBA 1XXLA 1ONOA 1GGHA 2O8BA 3IMKA 3QE3A 3DMPA 4COOA 2GD2A 3A11A 1PKEA 4F72A 1CQIA 1OZ0A 4TXNA 2CNLA 5EL0A 1F0YA 2C2ZA 5AVWA 4FLEA 5B2ZA 4JJGA 3CE9A 2DLNA 3OCZA 2P8SA 2R2GA 1BXZA 2YUIA 4U0JA 2IEAA 2QAGB 5J63A 8AT1A 3CW8X 3OZAA 4KUEA 4PNPA 2BH9A 3DLTA 2H3HA 1G19A 1XJQA 3GUUA 4I5DA 1HDGO 5EZYA 3UAZA 3ZWCA 2E18A 5EZ5A 3EEQA 3PDIA 3H4IA 1Z12A 4IVPA 3GOQA 1DE0A 1N5OX 4L6CA 5KJ1A 3UW3A 2I2AA 4N6GA 3Q8MA 2R68A 4IOKA 4KAFA 2V0GA 4D3ZA 2IHZA 3U2QA 4UQPA 4ZHSA 4ID3A 3WFZA 3WLKX 3A6PC 5DIFA 5JCJD 4XA8A 3DDNA 2BR3A 4U7PB 3LK6A 4DDMA 4DA4A 1Y34E 2E49A 4GIBA 3VDNB 3VKFA 1NRXA 2G9RA 3ZE2B 5IYZF 1NP6A 4LWOA 1OSNA 2RAVA 3MGKA 4MW2A 3DT6A 3LHSA 3J81A 4R3NA 1ZM9A 5CEFA 1JEQB 3KOWA 4L4ZA 4UD6A 1QOPB 2Y9MB 3NTUA 3ZIAD 2J48A 3THRA 3OEWA 3VNUA 1FUUA 1E5QA 1N6LA 1Z7EA 2NZXA 4CM8A 1ZOPA 4ZQBA 3AEUA 3WAGA 2QIOA 5FOVA 3TZCA 3O73A 5K4GA 2GSWA 2JFVA 3MJTA 1GUZA 2Z8ZA 5SV2A 4B4OA 4F3CA 1UPTA 1FFXA 1VMEA 2DFLA 3O90A 2IS4A 3CWQA 2ZR7A 5FLXA 2C88A 3RTCA 2GN0A 3SFZA 4AJIA 3HR8A 3D7RA 4AP6A 4N8DA 4KMRA 3ENNA 3AKCA 2YWFA 2OZEA 2FG7C 3B6ZA 1FE8A 2KS6A 3WLTA 4HLUA 1ORHA 5HUJA 3RUCA 3DTVA 2QN3A 1BAPA 2BHLA 4OAQA 1A8SA 1BS2A 1FLNA 2FP3A 3LF1A 4RMGA 1WDMA 3CSDA 1N1EA 1LLCA 2IXAA 3A4IA 3AFOA 3HUTA 3I23A 3TH5A 1CUGA 4EKGA 3EGDA 1IMOA 3BCUA 2DERA 5LD2B 2B2XA 4HNTA 1MC5A 5LXTB 1GT6A 1WCWA 5KYUA 1QC5B 4G1CA 1H4SA 3KFVA 2OTCA 1TJPB 3CLRC 4S2EA 1AS2A 2ZS7A 1MJ5A 2WYUA 3TLGB 5SZKB 1LC0A 3UHJA 4CKWB 2IVFA 2FEKA 4NCAA 4NZOA 2GZDA 3F5QA 1ZICA 2CK3D 1C1HA 2QP4A 2X4GA 2OLJA 3L7AA 2V6BA 5M3BA 5C8YB 2HHCA 4R2LA 1G8GA 1EE1A 3BWVA 3L0BA 4J2HA 4KMSA 4M99A 4Q9JA 4YMVA 1O94D 4P0TA 1NR1A 3WX0A 2JFFA 3PA8A 1NW9B 3LT4A 3C5HA 1UBNA 4TOIA 3G68A 2FUEA 2W4IA 1GXSA 1A3CA 5E95A 5TS2A 5AKHA 3LI2A 4X1KB 1JEDA 1O54A 1XZGA 1HSZA 4C1BA 4DCGA 3PUKA 4XE5A 4PPYA 1ZLYA 4ZGWA 2V54A 3W5JA 1V2GA 3U3ZA 4H3VA 2P9FA 4C5CA 4DHEA 3X1ZA 1JJ7A 1V26A 4Q7JB 3E03A 1UQTA 1Q0HA 3UHAA 1G5RA 4PYRA 2H18A 3DBHA 3I01A 1IUNA 4IWXA 2FE4A 4OHUA 3ACBA 1FTWA 4D1YA 3SZRA 1HNZB 2EWVA 3GBVA 3OAAD 1M2OB 2E4UA 1XOIA 1MO2A 3ZVLA 1M2HA 2I1QA 1PIWA 2GM5A 4HSEA 2R96A 3RVKA 1BFUA 1D5CA 1GSHA 3UGKA 3WGZA 2J9FA 4D3SA 1Z5NA 4AVYA 2RHDA 2O3SA 1K98A 1QV7A 1YL5A 4KXXA 5FFNA 1U9CA 1SVUA 3RO7A 4B79A 3EG9B 5BNZA 1KNQA 4EABA 3G1WA 3GEBA 5JAQA 2YYYA 3H5LA 1GQSA 4I3HA 3V32A 1UC8A 3FCEA 3O4JA 4J76A 3E15A 2NAFA 3OQ6A 4URWR 3ZGYA 1VYUA 1CEYA 4E70A 2PUVA 5FQOA 1R0XA 3MEQA 4QDOA 1XZAA 4QQKA 3YASA 3UBTA 4KN9S 4TUYF 2Q5IA 2XBLA 3NW9A 1ZUNB 5T41A 4ZREA 1UDRA 4NEGA 3GARA 4K6CA 3M5WA 1HG0A 2I3ZA 5A2GA 1AN0A 4LOHA 4JI5B 1FDUA 1K0UA 3CJTA 3NYWA 3FDZB 2G77B 3PYXA 5JROA 3PCTA 3OZUA 2AG6A 3ORQA 4M1KA 2I5PO 3JZDA 3OT1B 3PG5A 3Q11A 4OREX 1LI5A 4NY1A 1WHTB 2AN3A 2Z2KA 2YCLA 3AI3A 4C3UA 1IB6A 1CY6A 4EF5A 2PX0A 3MB8A 4S0ZA 2VCYA 3HXLA 2FSGA 1VLJA 3L0SA 4DUGA 4PU0A 4BFSA 2X3UA 4MQLA 3WHKA 3P9RA 2CUNA 2GR9A 4MS1B 4I55F 3GA5A 3GFFA 3N75A 4NAVA 3SGLA 2BM0A 1W29A 5AKKA 3WGHA 2CE2X 1Y7TA 4NAUA 3MFQA 5LA6F 3S99A 5HUQA 3HB9A 3U7RA 1X3SA 1UM8A 4GAEA 3VYTB 3NIDB 3F46A 4WECA 3JQFC 5KWJA 3D6MA 4JNKA 3SJZA 1XZHA 3FAKA 3PHCA 1A0OA 3HYRA 4ED9A 4V0KA 2NUAB 3ZI7A 2WU3A 5EKDA 3WJ1A 4WNIA 4JUIA 5FT9A 4RKQA 3TCKA 4DY6A 4Z4FA 4X1YB 1HEIA 2BIFA 4FFVA 1UZUA 3KV1A 2BGWA 2P62A 4QSMA 3NIWA 2YIMA 3K35A 1UADA 621PA 1ZD9A 3ORHA 4D9NA 1R8YA 4WWHA 5LZ5A 4YAJA 3DOJA 3LQ2A 2FDRA 4FN5A 5TC4A 4CG3A 2D59A 4CL0A 2VHZA 2C5SA 1I5OA 3F96A 5A3RA 3SZ3A 1MABA 4G65A 2FCAA 2YFHA 4KBGA 1NV8A 2ZYHA 5I4IA 2J0SA 1AF4A 1NBMD 1IN7A 2CCGA 3LUBA 4JLSA 1CR6A 3PL1A 4UBMA 4Q4HA 3GCZA 3ZWBA 1Y80A 3PDJA 3IEPA 3RNLA 5JJBA 2OAP1 3ILYA 1M83A 4RL4A 1U31A 4DMCA 3ASUA 1QVVA 2XE6A 1TO2E 5A4AA 4WZBE 1EFLA 1YTLA 5TQJA 1WKBA 1JTVA 3E35A 3WFJA 4MUFA 4ZCRA 3BFJA 5K01A 1XRMA 2OWEA 4KVFA 4MVJA 1XPUA 1ES9A 4HDCA 3RAFC 5EJ4A 3IP5A 3ZU3A 2I4OA 3RUIA 1XD9A 2VK2A 5IKOA 4F5EA 5HRAA 3LH5A 4B2PA 4ALIA 3FROA 3CF4A 2H9AA 2QD3A 2Q3DA 2V7QD 1PS0A 3NZEA 1XJCA 2NPIA 1F60A 4JUFA 1UOEA 1Y4AE 4C7KA 1S7GA 4M8IA 3H2HA 3TOCA 4ID9A 3RROA 5ALVA 2VIIA 5JS1A 2AYZA 1YQEA 2ODEA 3IDZA 1XCPA 4V0NA 2OKCA 2GBLC 3Q7PA 3RSOA 1I13A 2E48A 1SZDA 3LA8A 4J4TA 1IHOA 1KJZA 3HKBB 3FSGA 2QAIA 3OKAA 4GR5A 4OUKX 5IG2A 1E1LA 2JAUA 3NAQA 1YWGO 1PX2A 4TGLA 1A9XA 3EUEA 2C8VA 1Y5LA 3K15A 3ZJTA 1XVLA 3QFSA 3S7TA 3D7MA 4LE1A 5GONF 3HB1A 3KIPA 3M4JA 4PQYA 3ZZUA 1OX6A 1YACA 4UFOA 4DIDA 4F38A 3VM6A 2XIQA 4CLHA 4DA7A 3FCUB 3WJ2A 4E30A 5ICSA 4YCNA 2C58A 2C9ZA 2QLBA 3ITKA 3LUPA 3N1UA 3TW0A 3AF6A 3R8FA 1PZGA 5AVTA 3KOYA 1VCOA 4PZAA 1WPQA 3VOSA 1WAMA 3EXHC 1CQJB 1QYRA 2RGRA 1V16B 1W9HA 5SZJA 3OJ0A 2DH5A 5BUSA 2ZYRA 4DXHA 2FEXA 1RJ9A 1U2EA 2BFDB 1N36B 1AKQA 2I1VB 8MHTA 3H6HA 3OPYB 4DCNA 4MV6A 4CT0A 2MOKA 5D3MB 5F21A 1A69A 2FSIA 4QYIA 3W9SA 1U1GA 2P6PA 3G88A 4M53A 3DNFA 4H7HA 5FTJA 2HBQA 2CLOB 4EPTA 5AI9A 1E0SA 4HX5A 2PGOA 4P80A 3GRYA 4O4JA 2LCQA 3OIDA 4LHEA 3DQZA 3AUYA 5HE8A 1KSGA 3U7JA 4E46A 2VJAA 5A3QA 1ID8A 1RRVA 5HVNA 3INRA 5BSRA 4F1JA 2HQRA 4NZPA 1JHMA 4FYPA 2FJ0A 2LGJA 2SNIE 4QL3A 1HE5A 4RULA 1BWPA 3HMQA 4RA6A 4DLBA 1K97A 3Q5DA 4Z3DA 4C1NA 3CONA 4DKJA 2D4AA 3P52A 4LUCA 5K8IA 3GVHA 4FKBA 4HH3C 4RIEA 4PYOA 2D2IA 3U4QA 5L3ZA 3ZK9A 1H2YA 2F59A 3NETA 1RYNA 3QOFA 3RYHA 1AGYA 3RREA 2OENG 4B3IA 4Q1FA 3LDHA 4S24A 1Y3IA 2VK8A 5FUWA 1CF4A 1RXSA 2MHCA 2IHKA 1ZIOA 4YP6A 1TZMA 3EJWA 3HS3A 4J7CA 2VDWA 1N3BA 4QDKA 5D01A 2EYQA 2FSSA 1JHYA 3LQRA 4GSLA 2ZIFA 2YFKA 2ZRHA 4JLJA 4KACA 2XZDA 4ZVSA 3CR7A 3RT9A 3TQRA 2JJ2D 5B57C 4C7OB 1FDIA 4C6HA 4HVCA 1V1RA 3B6JA 3CUEF 5HIAA 5JARA 1NDHA 2FZ5A 3I09A 4CM5A 2EZ9A 2C4NA 3RIXA 1KU0A 1M2GA 4FSXA 3GVXA 5T6BA 3W3AH 1HT1E 3DZCA 1E0KA 2EX1A 3JQPA 3UUWA 4AWBA 1DJNA 5JFTA 3TVDA 4DJ5X 2DXIA 3WSTA 5TMPA 2HGSA 2IGTA 3V5NA 3MK31 3DLBA 3V7UA 1GR1A 3UV7A 2WKRA 1Z75A 1DCTA 2DETA 3QE2A 2OG2A 4QLOA 3NC1C 1NQAO 1JKFA 1PFUA 2GHTA 3PFCA 4OFZA 4HS4A 3TBFA 4DZZA 4JI0B 2NXWA 2FWJA 3KZXA 3GXOA 3L01A 4FHFA 5ADHA 2WTNA 1LBSA 2AQ8A 1UZNA 1J4AA 1YRBA 1IBSA 3BVPA 3T7DA 2V7TA 3U7EB 1X7ZB 4IKOA 1Q1GA 2J3IA 4NEQA 4PHHA 4KFRA 2O7SA 1B0UA 5M2QA 2ZIXB 1X74A 2BFBB 1I2BA 2JCGA 1DKPA 1TTPB 1DWQA 1R5JA 4IHAA 5P21A 1AKMA 3SQDA 3VRHA 2E1PA 4EGAA 4BFYA 3I8SA 4XYLA 1N0IA 3JASB 1ICIA 2GNPA 4J29A 2V5VA 2PXAA 4IJQA 4DGQA 2R1ZA 4EIWA 5FV4A 2X1VA 4R2KA 4I4TF 1DFGA 3ELDA 3TSZA 2WOJA 4AKIA 3KG2A 4JLUA 4HDQB 2NVUB 1QG4A 3R3ZA 2ECOA 3MZ0A 3CKYA 2F3SA 4FOLA 5A4KA 3C8ZA 2IODA 5I5EA 2QN2A 1R4AA 1UZAA 1JZQA 1SHJA 3AIKA 3IP3A 3T4XA 4LNUA 3RVDA 1U63A 5ITZA 2NQTA 2BD0A 4X7PA 3RS7A 4LRQA 3H65A 4JSRA 1NBAA 2ODAA 5T8KC 3AOEC 2WU8A 4FEGA 1IPHA 3F4LA 1A7KA 2XDQA 4PLWA 1MV5A 4NJMB 1L4GA 1KY2A 1FFAA 2A1TR 1R8SA 3PWSA 3ND8A 2G9QA 2XE7A 3NOXA 4FZRA 3ZR4B 4DIOA 2WFAA 5EUMA 2UZ0A 3RB8A 2HU8A 4LE0A 3TYXA 3WWCA 5ADVA 1M9NA 1TO6A 4IIJF 3WLAA 1L5NA 4YX9A 4CUKA 2PSDA 2LP4Y 3H5WA 1KAGA 1UDCA 1JIKA 1ZEMA 2IOHA 1TC1A 2JCSA 5E9QA 3ZIAA 4H77A 2I6GA 2AR9A 3H0CA 3JWIA 1MTZA 1RHJA 2YQZA 2P4HX 3L7BA 3TUIC 5BMVF 5HM6A 1Z6GA 4FR5A 3DDZX 3WOHA 3M3HA 3CH5A 2C59A 2I3AA 2O4CA 4JOCA 3T3HA 3WYCA 4MAMA 5DYWA 4AKGA 2Y92A 3WLLA 2I6QA 1O2DA 2GETA 2SKDA 1BCSA 1NJ8A 3ADPA 3ES9A 3RK0A 2CLSA 4JLKA 3S5JA 4UVGA 4J16C 1BE6A 1GKIA 1S2DA 2A4MA 1K8RA 2D2XA 3DPUA 3QF4B 4RU1A 3BERA 4HRYA 1PK9A 4G5OA 4C4AA 5JC8A 1YT5A 1THGA 2D3TA 1DAPA 2Z6VA 3NIGB 3MM4A 4U3JA 1IJEA 3VC3A 3AUTA 4MLCA 1FW6A 2GN8A 2D5CA 3OTQA 3OEYA 3JZAA 4JLPA 5DX8A 4QKQA 1N9GB 4PEVA 1F48A 2AG0A 1II9A 2HM7A 3TW4A 1IM8A 1UXIA 1TE2A 3KTAA 4D79A 4JP2A 4NVRA 2XDWA 4EFLA 2PV7A 5K4HA 5E9WA 3FF4A 4RADA 1GCIA 2IEDA 3CNBA 5D3ZA 4OHOA 3SJCA 1K68A 2ZWOA 4OQDA 4BNJA 4A1FA 3ZVRA 1MO4A 3RVQA 1SUDA 1JNXX 3C24A 3KNZA 1CUXA 1WVIA 5KOHB 4NU5A 2BR4A 3KC2A 4TLCA 1KEVA 3AY0A 4J03A 4PQEA 5SICE 2KE5A 3WL3A 2QTVB 3QLEA 4LE2A 4RE5A 3T5AA 1SULA 4ZU1X 1CUYA 1ESMA 3ZI4A 3U44A 2CK3A 4QUBA 4YJ2A 1N2JA 1E1DA 1DGQA 2I8CA 5B7QA 2OOKA 2Z8XA 2C96A 4L22A 5HF9A 3IMGA 2IWRA 3Q9NA 1RQNA 4A26A 4J0QA 1O94A 4K87A 4KIUA 5CEEA 3EIQA 4H17A 4X45A 5KTPA 3OX1A 2BY4A 1L7AA 4LYGA 3VVMA 2A9OA 4A6PA 5I4BA 3VBEA 1USVA 1UMBA 4PLVA 3AR4A 1P5HA 2R1TB 3SY8A 4Z3OA 1V8BA 5IXSA 3KZVA 3MUNA 3DXYA 3KUUA 1CWUA 4ZKDA 3B1JA 4PCLA 1E5TA 3FHJA 4X6LA 4NBTA 2M9MA 5DK6A 2V0CA 5B3JC 2VF7A 1K92A 4GI5A 2HR1A 1EB9A 4XDHA 3R76A 4ZWNA 5JBIA 4X3PA 4RY8A 1Z17A 4BO1A 3SQMA 3UAYA 2WJVA 4JB8A 1D2MA 4K9QA 4LZPA 1RTKA 2GZHA 4Q9DA 2NO5A 4MNTA 3V8BA 4G81A 3M9XA 1ITZA 1AB5A 5JISA 1P2VA 2WT4A 1PR1A 4G1FA 4X54A 1EESA 5EE5B 1IBCA 2LXNA 4F4IA 3VR4D 3OFVA 1RCUA 5IJXA 4LIPD 5B36A 4Y0NA 4M8KA 5HFJA 3TJRA 1G291 2VATA 3O2JA 4HN4B 1N5DA 1U2DA 2BV3A 4J7AA 1EVEA 3STUA 1I4LD 4I6JA 4ERNA 3Q6NA 2PUAA 5AYVA 5AQ1A 1QV6A 4KPUB 4B48A 1JDNA 1UMCA 2AN1A 4HQKA 3FRHA 3W2FA 4RVGA 1FP2A 1MAWA 5ETJA 5J2UB 1E1RD 2YVKA 5MGBA 3TPCA 1Q0SA 1U7UA 1Z4QA 2I4LA 2WFZA 3CR8A 4P4SB 1PFVA 1JHRA 4J8PA 3CVYA 2CDRA 2OXTA 3V4OA 1WB6A 2PLNA 3KVOA 2PXHA 3IVGA 3AG6A 3UXMA 5F3RA 2B7CA 6CHYA 2IY7A 3O1LA 1VLVA 4KQMA 4BECA 4W9MC 1GDHA 1DJOA 5EQTA 1QMPA 2XB8A 1E8MA 2HN9A 3MIIA 1LVUA 3N39C 1GPWB 4P3PA 4RYLA 2O8CA 1DC5A 2GPBA 3CKKA 3FVVA 3PPIA 4LG1A 4N39A 4MTLA 5CYOA 4J0IA 2GN2A 3QW2A 3K53A 2CFSA 1UJ2A 1Z56C 2WFMA 2NU8A 1AVTA 3DVQX 4HYEA 4N6NA 4PO1A 2C9MA 2GTIA 2AT1A 2IOQA 2QPLA 1YKFA 2VBIA 5A02A 2PUEA 2W9XA 3KELA 2QTWB 1UIMA 1MIOA 4RHFA 3RV3A 1KOGA 2QRUA 2WMDA 1WNTA 2YIVX 4FMCF 2GB4A 1RC1A 1LPOA 2BGGA 4QULA 4BU1A 3BL5A 2VDMB 3GRZA 5CB4A 2JEYA 1NW7A 3EZYA 1CFJA 1MH1A 1CS0A 1ULZA 1ZFNA 3L49A 2NTVA 2QL5A 3M5PA 5TE9A 4F6LA 2YC2C 1GZSA 2JVIA 3C3DA 3M81A 4D9GA 3TOZA 2C5EA 1HDCA 1T26A 2B36A 1F0NA 2X4IA 1G21A 2UZAA 3HN7A 3NCTA 1E3WA 3JW8A 4L4SA 3WNVA 4IYJA 1DB3A 4IVQA 4BZXA 1M1XB 3R9XB 1E3MA 5K4AA 3VNVA 3CZ4A 5L45A 2HF8A 4KHZA 1AKNA 3NWEA 3PSAA 3MVEA 3M5DA 1WMEA 1GWNA 3AM3A 3RC8A 4HH4A 3A26A 4LF7B 1X1BA 4Q66C 3KE9A 1P7WA 1SVOA 3WK7A 4ZTZB 1YQUA 2FWAA 3STVA 1G8HA 1QFMA 2P30A 3CU5A 3LBIA 3OCVA 2P6NA 2GARA 2I78A 1K8QA 3RH0A 3UXYA 3WMWA 4DWOA 2Q8QA 4OSEA 3RT1A 1AXGA 5TPWB 1NBMA 4UVIA 2XTMA 3E7XA 3HO8A 3IKTA 1W4CA 4MW7A 4U2CA 1J0DA 4OLFA 4J0DA 2WKWA 2VRWA 2O8EB 2PMDA 2YWCA 5KYVA 3W8RA 2GUWA 2H4FA 3K9GA 1YBVA 2QW0X 4P32A 2NO1A 2OWDA 4RKYA 5DTJA 2IJGX 3TMYA 4YQFA 3UANA 3K9HA 5HJ2A 2OG1A 3WZ2A 4C03A 1P2BA 2GUGA 1KFJB 3U39A 3RRFA 1EIWA 2DB3A 5LYYA 2R7AA 2OXCA 5JNLA 4L8YA 2FGKA 4GE0A 4PZPA 2RHTA 1ZN9A 4DEXA 1WZEA 2WYHA 5BWOA 3HHEA 3JX9A 3UJDA 1DARA 4YHBA 1U6JA 4BO0A 2IE0A 4PIVA 1E2IA 2MSEB 1U3CA 3R3WA 3ZHRA 2CXHA 1NW8A 2J30A 2V7QA 3FUCA 4HGQA 4UTZA 4U7JA 1VXRA 2QBYB 3QV1A 4EPVA 3FNRA 1N6IA 4EJSB 2HIMA 3IP6A 5F2KA 5K6RA 1X13A 4RD2A 2VSFA 5JEEA 1F4VA 1S8NA 1FS5A 2HNBA 5EQFA 1ZCBA 2MSWA 3ZLUA 2WAOA 4UAVA 2VHYA 3EXEA 4CWAA 2LBPA 2V5AA 3P0IA 1Y5NA 2YW9A 3KJZA 4RCYA 3FFWA 4LJ5A 1EVYA 2FAXA 3A9SA 1TDJA 3VKVA 4KE7A 2Z95A 5FQNA 3D3NA 4DR3B 5LQDA 3PDWA 4HXYA 1PQYA 2H2FA 4I9HA 2QORA 5G4KA 2C29D 2YWBA 2BR5A 2RK3A 1S1MA 3DKKA 1NATA 1NVWQ 5EESA 5AOCA 3JD3A 4XGKA 7ADHA 2P7IA 1NRJB 1GPMA 1YHYA 3QFHA 10MHA 3X2SA 5DTMA 1UBFA 4B6GA 4G0MA 5CM8B 4OXNA 1KZ7B 2OBLA 3TFWA 4JQZA 2Y66A 5KYYB 1JV2B 1KJNA 2DGDA 1JS1X 3B3FA 3I73A 4RY9A 2HPAA 5EHNA 2NSHA 2WMNB 4IPTA 1N2HA 1RYEA 3EQ7A 1KQPA 3CW9A 2P69A 4W99A 4ZJZA 4O0LA 1SQ6A 5AW3A 4QG3A 2D3WA 3OOWA 3PE6A 2FUCA 2GF2A 4L08A 4JVLA 5TQ2A 1DQPA 3QYAA 1NKTA 4O08A 3U4GA 4BLTA 1VIAA 3MG9A 4ND3A 1SN7A 3BIXA 3PGA1 3QEBZ 3IJEB 4BGIA 5A3VA 3OQOA 1JLLA 2IQIA 1X7YB 2W2NA 3D0QA 5C1IA 4PVDA 5A9SA 1EP1B 1FVOA 4U1RA 1NIJA 2H4WA 2WFLA 3AHJA 5CDFA 2G4VA 4RV4A 4TKMA 1GG8A 2OK8A 1P0IA 2PANA 3LL7A 3KVYA 4W5TA 1BU8A 1IZZA 1A8IA 3QEAZ 1KJIA 1JRLA 5I9NA 3AVXA 1XYYA 2VJLA 1XAJA 4KOAA 3TDKA 2GVZC 1XR3A 4G2TA 4I4CA 1RMTA 2X58A 4FCWA 3DXZA 2XLCA 3WDLA 3I72A 4R41A 1JPUA 1KBQA 2HHJA 4P35A 4CDGA 2IUSA 3IAS1 2YN4A 3GRCA 4GPBA 1R2QA 3TSYA 2WJHA 4K6HA 3ZNQA 2C84A 4I9GA 1VPEA 2X9NA 1JYFA 1PNVA 4YDSA 2JAWA 1NULA 3T1OA 4EHIA 1YRLA 1JJFA 4UBOA 3WBJA 1H2FA 4F4UA 1U0TA 3KJXA 4OXQA 3OIYA 2V7EA 1PL8A 2FZCA 3OZIA 5CB8A 3STXA 4D9KA 3QWHA 3GFSA 4UBIA 1IQUA 2JGKA 1RFLA 3FNFA 3QEOA 1NQXA 1SHUX 1K6IA 3PGKA 3OH8A 1J2YA 4NNOA 4U7FA 3I9JA 3V46A 1GPDG 3D6UA 4UC0A 2ZYTX 3INYA 3KFXA 2X7JA 4IEEA 2P6MA 5FOTA 3HCBA 1PNOA 1XN4A 3KPUA 2QWXA 4GBJA 1O89A 1ZIDA 3FCYA 1D3AA 4GKBA 2Q5OA 4YY3B 3CWCA 1KJYA 3RJZA 3KYJB 4M0LA 4MQ5A 5AHWA 2RHBA 1BU5A 3TE7A 5COBA 2ZM6B 3FAZA 2VAMA 1CYEA 4J6FA 3VTAA 5KHOC 4DQXA 1SKUA 3BXHA 3PGMA 1PGOA 3MJHA 1LBTA 2MSCB 5KTKA 1J2UA 1E3EA 1H22A 3C41J 4R1SA 2CF5A 2ZQYA 3P2EA 4A1OA 2PRIA 3TJZA 4CMIB 1S0UA 2COUA 2ZB8A 2XX3A 3OJXA 4IFBA 5FJJA 4KXLA 3HJGA 4CT4B 5J58A 2GXUA 3D81A 4LYJA 5JFGA 5JADA 2OC4A 4RDXA 4Q03A 3QY0A 2PA3A 2YJ6A 1JR3E 1KJWA 1NY6A 1P2TA 2ASEA 2OM2A 2R00C 2DWPA 4RACA 4OQZA 4ARZA 2FQQA 4LSWA 4KQ2A 2DBYA 5GJVC 3I5YA 2DSTA 4DNOA 5DH9A 3BTVA 4AZSA 2D7JA 1I6WA 2AOTB 1EJBA 4TKLA 1H9CA 5MN4A 3LJKA 1CIPA 1L4KA 2VBFA 2OV1A 2QE7D 2W5UA 3FMOB 4ZC8A 4B3BA 4F3YA 5IAJA 5AH0A 5BWBA 4QO7A 3TZKA 1ZQ9A 5E2BA 2BF4A 3O91A 2Q5JA 5H82A 4E15A 1TF7A 2Z2JA 2BKXA 3JAWA 4Q3AA 1FYEA 4IF6A 2R65A 3K70D 1U6IA 3VNBA 2O19A 5A7HA 1E1MA 1EGHA 3HZOA 2G7ZA 2E9SA 1ACLA 4F6RB 1ZIPA 3T1VA 3FPCA 2ZDHA 1P1BA 3IHLA 4JOSA 5AR1A 3SIWA 4QGSA 4R9RA 4Z3KA 3LA6A 3REFA 3ET5A 4F60A 3RS0A 5AXAA 4UZFA 4WX2B 3ER8A 1E8NA 2OUIA 1RPNA 3DWGA 3KVVA 1GPBA 2QRNA 2XAAA 3KR1A 4HOYA 1FBNA 3VO8A 4D8XA 2FQ1A 1OQAA 2A59A 2QS9A 1KPHA 3NOVA 3IUBA 2F62A 2OBXA 3LF2A 4WY5A 5EHIA 5E4JA 1QWOA 1OFTA 1TQHA 2P3QA 1OZFA 3RE1A 5AW7A 5HQTA 1RYYA 4D5EA 5LUAA 3DJYA 1IG0A 3HRKA 3K5IA 2XWBF 3IAM6 3GY0A 4EEZA 4JJAA 4Q1DA 3HHPA 1ZK1A 5FL3A 1QB7A 4DIFA 1LPPA 1MF7A 1PHPA 2E7ZA 3A3YA 4O25A 2C8JA 4D80A 2BHTA 4GZ6A 1QCCA 3M6XA 5JG7A 3NX4A 1B0PA 1XGKA 4JQCA 4QXPA 4ENVA 2A30A 4OBBA 1DP4A 5F2NA 5KC8A 1PE0A 5CBPB 5L6LB 1G1MA 2K6GA 1Y9EA 3C3WA 4QGBA 1Z5WA 4UZSA 5CVTA 1JFVA 4GMKA 3RFFA 1SG0A 4O3FA 3AY6A 4YDRA 5C5CA 2VRNA 3G1UA 1CW2B 1LXCA 1DBRA 2IK8A 4YYZA 2J5RA 1SUAA 3TM5A 5EHXA 3HVHA 3O8BA 4FCVA 2GTHA 1A1SA 3P26A 4WV3A 1T4MA 4TM8A 1ODLA 1TJNA 3T1HB 4E7OA 4H16A 1MJGM 2Q6TA 2CVHA 2QUJA 1QO7A 4FI3F 5AI6A 1UK9A 5CYPA 3VHLB 4XAQA 1X3LA 4V39A 2OZLA 1PS8A 4CKBA 5K0LA 4BP3A 1IBMB 3WSWA 1FYVA 4FEEA 2CKDA 1Z6TA 2RH9B 1AZTA 2WZBA 2PWZA 4N0PA 4RIHA 3SZOA 1SU7A 1DAMA 3GYBA 4R68A 2FRDA 2WF8A 1BROA 1U8YA 3H5AA 1V25A 2PQ0A 3OZXA 1ZONA 4YPFA 3VVLA 3PIIA 5JAUA 3AUUA 2FQWA 3OT4A 4ATNA 5K0SA 2XCIA 3GJ7A 2XWQA 2JRCA 2YIDA 4HEJA 2ZRKA 3FNEA 4P7GA 1ISRA 3GGPA 3JY6A 3N2YA 3VQTA 1ZM2A 4MRSA 4TV9F 2AYYA 4YJFA 2Y3IA 4ZICA 4BS9A 1MB3A 2JD1A 4FONA 3R5XA 4KN8A 3AHCA 1XEAA 1P9OA 1XFAA 5F7JA 4PHGA 3TAUA 3GYGA 4RJTA 2IBMA 4Q47A 4E5YA 4FDTA 2V3WA 5JE8A 3WB9A 2FF5A 3LPAA 3RTBA 4JBYA 4MB0A 2AZTA 4TRJA 2UYCA 1Q7BA 4E7PA 2I55A 3NHMA 1DUVG 1OPXA 1V37A 5DN6D 5I7FA 3THSA 3D4OA 3V1LA 2ORED 3KWMA 2BFPA 1B8UA 3LD9A 4TN1A 2NO0A 4RESA 1QS0B 1DHTA 1LTHR 5LKRA 3GLFE 2PZLA 2UUPA 1UBTS 1R5BA 1ZNWA 3C3AA 3IPLA 4S1NA 3A4LA 1QYXA 1KQFA 1QCYA 5CA1A 3VR4A 2D1TA 2ZTHA 1UKAA 3OJWA 5TQ0B 1RI2A 3PFKA 1X86B 2JLAA 3W7VA 3S1SA 3P2KA 5IT9A 1QAOA 4AKHA 1ZH0A 3EVBA 1M2VA 3K7EA 4ZRMA 3SLRA 3UMMA 3FCOA 1UKCA 4K0RA 4CNBA 3PYLA 4MUGA 4IFEA 3S8EA 3AVUA 1WLYA 1T9GR 4PZ0A 1PVVA 4MWBA 4UM9D 4XWKA 2WKSA 1E1RA 1JSRA 1MOZA 1ODFA 2Y4OA 5AJXA 5F7ZA 2HHLA 2GRJA 2PRZA 2LD4A 2I80A 3C7CB 5EKXA 4IX1A 4TQGA 1DAFA 4D96A 1EX7A 2R7KA 2YWEA 4JAVC 5BUCA 1NFQA 2X0JA 3MOGA 4II3A 3KKNA 2AEFA 2PSEA 4AJOA 1IE3A 2IELA 1ODTC 2ZAIA 3AEYA 2AJCA 1BDBA 4ND2A 3MYYA 4QWWA 5D87A 5AKLA 4ZKEA 5L7WA 4DARA 4Y2GA 5JCOA 1S2NA 1C9JA 2H1SA 1KIFA 1BMDA 2BP7B 4JLOA 1CJVC 4IUDS 4PLHA 1VBMA 2DFKB 4YAFA 4J0HA 3ZBPA 1P2SA 2DTEA 1RRFA 1KE2A 3MXTA 1H3NA 1CU1A 4AAYA 4EF6A 3N2EA 2FWNA 2ZRDA 3HN2A 4I5GA 1KP2A 2VDPB 3E9EA 3ZW7A 3PUJA 4RS4A 2QAJA 2VOJA 4JC4A 2X7XA 5JWRA 4BEJA 4QUGA 4OA8A 3B6KA 1CPYA 2PU7A 3F4KA 4EO4A 1SWVA 3VZBA 4BMSA 5EJEA 4FEYA 1NUQA 4DCOA 1BEEA 3IIEA 4RH0A 1DTSA 1KEPA 3IDAA 2JGNA 2ATIA 3IS3A 2Y1FA 3VAYA 4UTVA 2DOKA 1OH6A 3LWZA 4IMJB 4MKZA 4QOEA 3GCXA 4RZUA 2NTJA 4KQIA 1XF1A 1ZI8A 4BKUA 3B1KA 3SNHA 4G5XA 1JZTA 3P2IA 1XA0A 2NZJA 4BGVA 3LO5A 2B2NA 4C2BA 1IEVA 3TLZA 1YB1A 5G3ZA 3IMFA 1UKVY 3OE7A 4M0PA 1P4JA 2VLBA 4QXAA 3RSZA 2FP4A 1P80A 1Z83A 3BCSA 3H1GA 1XTQA 2DKNA 1QM5A 4MTCA 4TTPA 4WZAB 5BQPA 2N75A 3KB6A 3UB4A 3ZJ4A 5F52A 4MYDA 2FX2A 3H3JA 1NQVA 1CHDA 4YH1A 4BBPA 4MP3A 3NRCA 3K1ZA 1LLFA 3I5UA 4MWDA 1NVXQ 2RCYA 1DBWA 1EK1A 1NGSA 1VRCA 2PRSA 2TYSB 4HQ0A 1BCRA 4LYEA 1SBYA 2X8JB 3MWFA 1NBEA 4WCFC 3G8BA 2RGUA 2VHVA 4OJNA 4F3NA 2D0OB 4BO7A 3E9RA 1UJCA 2Q5HA 2VHTA 2G6BA 1YO6A 5E6RB 2XMSA 3RDPA 1IQ0A 1HTBA 1KPGA 2OPBA 4AIRA 1DCFA 4EG0A 1U5CA 4FU0A 3BPSA 3Q9UA 1OAKA 4FZ5A 4G86A 5HCNA 4MUMA 2HXGA 5F35A 3F5SA 1HWYA 2JCVA 5KYXA 1C7ZA 2BUBA 2QQ0A 2F17A 5EG5A 2RH5A 3OPNA 3LLVA 5IAKA 4HATA 4CMEC 5JFOA 4P58A 1I1NA 1URPA 2Z08A 3UGQA 3D8HA 3ZD7A 5E7JA 4KL8S 3BT7A 4OP2A 4ENTA 3BXOA 2FNAA 4WD3A 3NDIA 5HK9A 1L7PA 1SCUB 2XB2A 2AWNA 2G5CA 4OGGA 2YRWA 4MPJA 3L1KA 3OSZA 3NG1A 1VGVA 1IOZA 3GDWA 3PEWA 5E1DA 1FMTA 3OECA 3NGLA 1LX6A 5LOVF 2I3GA 5C37A 1O96B 2IDJA 1FEZA 1MW9X 3BFPA 4QTXA 2Y1GA 1GNSA 2YV1A 3IP8A 4M9SA 4BLWA 2C7OA 4OQLA 5CBKA 3O03A 4WXEA 3KJEA 3DBRA 5EWMA 1E2KA 3C4JA 2JFHA 3TTWA 3ZGXA 1EFCA 4KSBA 4YUZA 3PB3A 3E9ZA 5CYFA 2G9NA 4U2FA 3UHPA 4PBRA 2QZ4A 4OY3A 1IY1A 3W2TA 2HF2A 1AK9A 3DF7A 3GT7A 3AY3A 1TPZA 1J2JA 4H7KA 1O8BA 5JBNA 1KZ9A 1XCMA 2JD0A 2WTBA 2YNMC 3A37A 4O4LB 4R7GA 2F7SA 4AW9A 2Y71A 2CZQA 5A6SA 4XOIA 3PGXA 5DHPA 2AG1A 3NBUA 5AVVA 4CXMA 1WZCA 3UWDA 2COKA 4Z1MD 4UNQA 5KDLA 2IOFA 1EJ0A 1QRRA 2AQIA 3GUVA 4DQKA 1D1PA 3WYBA 4CLXA 4A27A 1CQIB 3ISJA 2Y0CA 3SS9X 1O1YA 3M6LA 5CH3A 5AOBA 4CEHA 5HFAA 3HPQA 4JYMA 2Y2VA 4R98A 5AKZA 4CU2A 5MFZA 2GYUA 1NVBA 3N0XA 2V59A 3DFMA 2QVYX 3NU1A 4C7MA 2EBWA 4BTEA 1F9AA 4HRAA 1TMKA 5EZYB 2GQ0A 3L06A 1N6RA 4KI7A 3KK0A 3PDIB 4G0XA 3ZIDA 1VL1A 3ND5A 4YRJA 1KWGA 3OJLA 4NU0A 1M6VA 2BONA 4PFSA 4C6RA 3H2GA 3LT2A 3MPUA 5KIAA 1H69A 3NKFA 2JGEA 1NUPA 2PPVA 4AX8A 2KJQA 1KAMA 2ZWMA 2C0QA 4UVDA 4YROA 4BLRA 1G5FA 4GQBA 5CA0A 1DXQA 2HBYA 3FCXA 5JPIA 1W87A 1C4OA 3U17A 1B0AA 4N5NA 1JDVA 4L3OA 4W8OA 5J4YA 3JRNA 1ZDMA 4OH7A 4G4IA 3RUDA 4D02A 1VYVA 1CNMA 2IVZA 2YYAA 1G8MA 3OM9A 4OSOA 4A73A 2FXVA 5AJTA 1UDWA 3AB8A 1XU9A 3NHUA 4P38A 4OOEA 2JGLA 4WY2A 3LUKA 1TYCA 4NOMA 2PFSA 3AP1A 1Q3HA 2WJ6A 4CM8B 4CMGA 3AEUB 5GV7A 3DTNA 2GDJA 4JIMA 2BBWA 4BRWA 4OFWA 3R0VA 3H4TA 1ULSA 1FFXB 4EUHA 1EUQA 2Y9PB 4QPCA 4NHEA 1T0BA 2LNDA 4X63A 1KQ3A 3QBJA 4Q93A 1CIVA 4EMSA 2P2DA 1T9GS 5GINE 3BUSA 2H7VA 3AILA 5AVJA 1BXGA 3RPEA 4I1PA 2J3LA 1GNLA 3N8IA 3DTVB 4XYEA 3A6LA 2CJXA 1Q1EA 2EC5A 4P5EA 1GAEO 3SD7A 4CW7A 1MFZA 1K6EA 4IV0A 2FW0A 2IYUA 4NONA 4ADSG 1OB5A 2QN6A 1JILA 3EGDB 1KK2A 3IT0A 4PSCA 4WFIA 3GDHA 1GQQA 4P3XA 5IC4A 2G1KA 4XWWA 5KYUB 4EJSC 1S1CA 1WD5A 2JKZA 3RS4A 4GGPA 1HT2E 1KBZA 3EFEA 3KQYA 2ZJ1A 2P3LA 4XJTA 1HI9A 3HGMA 2HO5A 1E69A 3V9PA 4ZZIA 3PEYA 1J1UA 2W2PA 3B85A 4GX0A 1TADA 2R5WA 2WB2A 1F0KA 1P6QA 2VHJA 5EMHA 3RADC 3CISA 1WCV1 1XMVA 3C14C 3KCQA 1TYEB 2VAPA 4BWVA 4YRAA 1QKIA 3S1AA 1OGYA 2Z2ZA 4ZYTA 3CH4B 1Z33A 2DQSA 4R69A 5B2FA 2YBEA 2YHAA 2ECKA 3IPCA 4TKVA 3ENQA 4CF7A 2V7BA 4D44A 2IU4A 2NZVG 3U44B 1GXSB 3OQMA 4LSMA 4V0QA 1CJTC 1QGZA 3QWBA 4GP6A 3S2FA 4OX9B 2V0NA 1GUDA 1VGRA 1AZWA 3OI7A 4N76A 3U4AA 3ZNNA 1USKA 2ATXA 2VDRB 2C3YA 3NHWA 4YECA 2HIGA 3DFKA 2I76A 4IG4A 3TX6A 4Y2UA 1CZHA 1D7AA 3ZHBA 2ZW9A 1AJEA 4F3RA 1IL0A 2MIIA 1XK6A 3I52A 5NLLA 2F8LA 4DWWA 5F1YA 2O7VA 2ZDGA 3PXGA 3DBHB 3R3XA 2YZ2A 3NAGA 4YJKA 1TT7A 4AO8A 4G0PA 3D7KA 5C7YA 5DBHX 4HWOA 3WGKA 4X66B 4MRPA 2A35A 1PFYA 4CR8A 3ODGA 3A70A 5I3CA 2PD3A 2Q0SA 2WJJA 4WEOA 4E4YA 5LR6A 1J99A 3ZYCA 4BEVA 3WYFA 1G98A 1STOA 4YAOA 1NASA 1EM6A 2OCYC 3BWEA 4EVRA 2AI3A 2J9FB 1NW5A 1ZXXA 4N12A 4LOAA 4Q1BA 5TS3A 1X70A 2C78A 1YASA 1N75A 5KKNB 1VPVA 3GZJA 3X43A 1SKMA 3KYIB 3ZQ6A 5KNBA 5A0VA 3IBTA 4C7OA 1XCLA 2BELA 2DYKA 2Q4OA 4JIGA 3U3XA 4EW6A 2WAXA 1BSVA 3L8EA 3C1OA 5GTDA 4HWKA 5L8VA 3A1EA 4PQRA 4EY7A 4EAAA 1PJBA 3U3DA 1QZ3A 4BO4A 4MWGA 3PX2A 3J7TA 2QSUA 2YL2A 5H02A 2IS1A 5DZSA 4YV7A 4FYIA 1WPRA 1O8CA 1AK2A 5U1PA 4I7EA 1NJ1A 3V80A 1WBJB 4JJEA 4C78A 1RPAA 5C7IO 3H2YA 4E2XA 5BV8A 4IM7A 5J1SB 4C0BA 1T6XA 4R2HA 5CM2Z 3K0BA 1L7RA 1RAHA 3FFXA 3QPCA 3HBMA 1Z6ZA 5GJCA 5DHTA 5HF6A 2WTUA 4C3VA 4XUGB 5JD3A 2ZRGA 1IVYA 2QV7A 2ZBDA 5BUZA 1NLUA 3QF7A 3BF8A 2B8EA 2GS9A 3OE4A 4TSRA 3H7AA 1V3UA 3SXUB 5CNKA 2V6JA 3THOA 3KQWA 1QFZA 1UFOA 4A8JC 1TCBA 1FNNA 5CFMA 1SC1A 2ZBFA 1C7FA 3HFSA 2KBEA 3LWNA 4JBWA 2OA0A 3ZY5A 4E3ZA 2Z09A 4TMVA 1RXUA 1BH6A 1M7HA 3PNVA 5CT8A 3L6UA 1ZUIA 3ITNA 5FLKA 1EE2A 4ZO6A 4E2YA 1HYEA 3SZUA 1I2MA 2B1QA 4MQ6A 5LP6F 4YUXA 2XTNA 4RK4A 5FBQB 4BX8A 2JKVA 5KQRA 3T7RA 5AQEA 3CSSA 3AZPA 3TTSA 4M1YA 2ZRCA 1Z4KA 4KQJA 2PUJA 1D04A 1QVZA 1W30A 5KDDA 3OICA 2ZGVA 2BFWA 3GT0A 2XUZA 1LX7A 1MO3A 2HD4A 3DO8A 3ZY2A 5LQKA 2RBEA 4UMEA 1SCJA 1YOBA 4N3GA 2JAQA 1J20A 2JRLA 2YR0A 3HCCA 1YMVA 1G7RA 1C1DA 3HJCA 1MABB 1N1MA 4INAA 4X6UA 5CMLA 1DX4A 1JN0A 1H9AA 4NI5A 1QSGA 4UJ5A 4RZXA 3K09C 1OBHA 4J2TA 4NWIA 4TTTS 5KWIA 2WF6A 2Q1SA 2ZUVA 3IJ5A 3QI7A 4Q4HB 5DN6A 1FSZA 1YAHA 3GLTA 2Y99A 5COQA 3UKOA 5KJEA 1SEVA 2Y1WA 3DCYA 4DJTA 4R0NA 3GPDG 3V4FA 1R8JA 3VNAA 5CW2A 4R51A 3A6FA 3H42B 5IC6A 2ARKA 2JL1A 1HF3A 1AX9A 1NURA 2NXJA 2W8BA 3QJ5A 2C42A 4E03A 4FC6A 1YV9A 2O5RA 2VHUA 4YCSA 4ARVA 1SQ5A 3BICA 4OU4A 2BCEA 4P81A 3K94A 4M21A 3PFHA 2JAOA 4X0EA 3EZ9A 1P9RA 2QTRA 4QARA 1PJTA 4XB2A 1BMQA 3TR0A 4D4JA 1F6BA 2QVLA 1JR2A 3AV0B 3E48A 3KR9A 3TTVA 5KYNA 1HO3A 1WUKS 2P3OA 5EN4A 1QLWA 3MW8A 4WNCA 1U1EA 5IVKA 1MPTA 1W19A 1R00A 5AIBA 1KY3A 3UG7A 3U1TA 4M76B 2E21A 3EHDA 1PL6A 1YK0A 1XZ8A 1Y1RA 4R8SA 5CLIA 4UD2A 3NANA 1JDBC 1TGYA 3PXCX 3C3YA 4NBUA 1A9XB 5BW8A 5JH7A 1EXVA 2ZIVB 1USUA 4HUJA 4E5DA 2AA3A 4LPKA 3W2HA 1IONA 1KI3A 4B4UA 1LQ2A 3MWLA 4RV5A 1XDZA 2N42A 221PA 5LZ4A 1NL3A 4KO4S 5DPMA 3WISA 4IMIB 2G5TA 1OXSC 2PL5A 4TT3A 3O83A 2WAYA 3JRXA 4TXLA 1ZAYA 3B5JA 1S2GA 3D6HA 4JLBA 2ZI6A 3FUVA 2XYVA 4JMPA 5IEBA 5THKA 5IAAA 1RJ9B 4EBFA 3VU1A 3OWHA 2BTEA 5E1OA 5AXCA 1DCMA 4X6XA 5TR9A 5LLTA 3RT7A 1H6BA 2RSLA 3IPAA 4QYIB 1OA1A 1VDZA 2ZAOA 4URFA 1C3EA 3AJDA 3MMPA 5CUQA 3EIOA 5TRTA 1ADFA 2HNKA 3F5MA 4NXMB 1DAKA 3IOCA 2DT5A 4O4JB 1NQTA 3I45A 5HZKA 2BKAA 4IOLA 4UDYX 4FQ5A 3NQ41 1KQGA 2EL9A 2FDCA 3H8WA 3IUMA 2ID8A 5LDGA 3AU8A 3IQZA 1N5RA 4KXFB 1EYZA 2QN8A 2Z1DA 1MDFA 4RHYA 3PKZA 1KEZA 3KP1A 1DEKA 2INGX 2PX2A 3TINA 3DMGA 1EWVA 1YVUA 2KWIA 2VXBA 1C7IA 1QAQA 4KG7A 3NKVA 4RA6B 4UNSA 3BE5A 2D1QA 1PT9A 1PUIA 1ZBQA 1T4DA 1RZ3A 3LCMA 1OLOA 3B6EA 3P5SA 5FL7D 2P4SA 2AD5A 3U4QB 1KO8A 1Z06A 2ZAGA 5BW4A 3WKEA 3RYHB 2I29A 3QU5A 4DA8A 4GNRA 1JMVA 1G60A 2Z30A 1NVMB 2IXEA 3BMQA 2QLNA 2C57A 4CQNA 3D6VA 1H2ZA 4N9WA 1CY7A 3D6TB 3PUXA 4PIMA 5K0ZA 1E9SA 3KJHA 1RI5A 5AKXA 2VDWB 1V3VA 3NTRA 3OY7A 3M3PA 1U11A 4WT7A 1GTG1 4JZYA 1V1RB 5B6IA 1PR0A 3MMXA 1XP8A 2WBLC 4LAFA 4P1ZA 4LEIA 4RXTA 2GESA 5KQSA 3GH3A 3ETGA 4XWGA 4BNYA 2G1AA 4BN0A 3L8FA 2O2DA 1DPFA 2VQSA 2HFKA 4IFIA 4M83A 3V2IA 1SC6A 1DC8A 4E5KA 4YXWD 2C0PA 3FFTA 1XMJA 4IDQA 3GH1A 4KKXB 4EG8A 1Z8HA 1OF1A 1R9GA 3L18A 4AFNA 2C4UA 4B6EA 4XCVA 4HCJA 4H3HB 4K7JA 1GAQA 1UR5A 2O2YA 3R09A 3AB7A 4WZBA 1EHIA 1X9IA 3MOSA 4KPEC 4PR0A 4MV3A 1JKIA 4Q3DA 2ZUBA 1ZEJA 5IPFA 1WBBA 1IDN1 3PKIA 5B1DA 2R60A 4D0RA 3SQNA 1PR6A 4HVTA 4E32A 5JJIA 2HMTA 4FJ1A 4C6TA 4I1OA 5CPFA 4TLMB 3HI4A 1C4WA 1V71A 4DLLA 5IH7A 3T3DA 1FUIA 4BZWA 3MT9A 3DMRA 4JU8A 4QAJA 5CVEA 1YVEI 2BE9A 3WLSA 1HDOA 2J32A 4ZEVA 4R05A 2Z0MA 4I50A 3CURA 2FEMA 3E2PA 4HJXA 3IMCA 1UOOA 3X0DA 2B8JA 2F43A 1QP8A 1RKXA 2HI0A 3IYLW 4DWJA 1XWFA 2WUGA 3COSA 3A3OA 3G6WA 4ZHQF 1Y0BA 4O2AF 2W2VA 1I6MA 1JALA 3KQTA 4CLRA 4JA0A 3PVZA 4PPGA 3GMDA 2VR1A 3WMGA 1PWEA 1E62A 1JIJA 3EA5A 4RDIA 3CZCA 3B7WA 5AUOB 1B16A 1N3YA 2WIAA 1LV8A 4DDTA 1KFEB 3PX7A 3UT0A 2AWOA 3A1CA 4LNUB 2VP0A 4OB7A 1PG5A 2J41A 3L7YA 1B43A 1AY0A 1DKQA 3VSEA 3W5HA 4ZVMA 5ITZB 2XKKA 1RQ2A 4TV8F 5GPBA 1HT3A 1DIBA 3T38A 1FDSA 4RVSA 5KO2A 2SCUA 4E5MA 2XDQB 5J2TA 2FRVA 3L1UA 1ZZEA 4FBMA 1CT9A 2FPGA 2FPPA 1ZKMA 4N3NA 1B00A 5L6MB 1YA8A 1OYYA 4AJJA 2MYTA 3DZJA 1XALA 3NJRA 3F67A 2F1KA 4ZEMA 4PXSA 2P3SA 3BRSA 3G8AA 4ZZ3A 1B42A 1QUEA 1ZXBA 4IIUA 5JY6A 2B37A 4WK2B 4RGBA 1SHZA 1YRWA 5IUJC 4KCGA 2GDZA 1YR6A 2B2CA 4CV1A 2OGTA 2IHBA 3C15C 3GLSA 4BZQA 5IXYA 2ID9A 2V8BA 1JLRA 2CWWA 3HNOA 3KQOA 4LXTA 1EUCA 3WQSB 4MS4A 1X42A 2J3MA 2Z57A 4G5FA 4PNZA 5FF9A 2GJKA 5G1OA 5LM3A 2P5SA 1K7CA 3FYTA 3GGDA 1BCSB 1H3EA 4IZIA 1Z18A 3QSGA 3GPBA 4KR6A 3H1PA 2QMZA 5EXTA 1K8ZB 1EPUA 2ZJZA 1I2AA 1K6MA 2RG7A 3TQTA 2J0UA 1CS4C 4YJ2F 3ZNPA 3P9KA 3ZGZA 4U3JB 5IHXA 3D3WA 1QE0A 4GX5A 2DUUA 1GZVA 3OZCA 5DM60 3EH2A 3G89A 3GEIA 2BHSA 3HY3A 4DXDA 1WWKA 3IQFA 4FGUA 1FX0A 3KTAB 1T3SA 5E8RA 1OYVA 2REBA 4X61A 4JKIA 3T9EA 1Q91A 2VQ6A 3AH8A 5EUQB 5DOZA 4G5HA 4KNYA 1UINA 5LWQA 2G8LA 2WHRA 4LBYA 5DCYA 1SVWA 2CN1A 1YDMA 1D6SA 1Z07A 2DUNA 2DPHA 3QU2A 2Q5QA 6AT1A 5CCBA 2QMOA 2QUBA 5ERYA 4FB5A 2ZI5A 3PZBA 5FBKA 1E5VA 2BKVA 2HEIA 1K8XB 2FLVA 3DP9A 1FFBA 3DZIA 4YJ2B 4OJQA 3TRHA 3W5BA 3V97A 2R8ZA 4V38A 4ARCA 1R27A 2WEKA 4R16A 4P4UA 3U48A 1JKMA 421PA 2WYWA 2JLZA 3IQIX 3N86A 4DUPA 1DRWA 1WDTA 3SBDA 2R6ZA 4RJJA 3VAAA 4ER6A 2Z6AA 1UDBA 3WK5A 2X86A 3V2UA 1K9SA 3M2PA 4DIEA 3GJ6A 4RSHA 1RXCA 1UMBB 3MGBA 2W6IA 2A0XA 4H60A 4L0MA 4AQYB 2PGLA 2XMBA 3OIWA 1PR2A 1OX4A 4Y1FA 2XYHA 1ZA1A 4C14A 4NQRA 2Y1OA 1G0OA 3TD9A 1HRKA 2A5JA 2NV2B 1EX1A 3IUYA 3IUPA 4TYWA 3C4VA 3KQKA 1LU9A 2HCFA 1KSJA 4PX3A 1DG1G 2BN4A 3GGJA 3WP0A 4M1OA 2WM3A 4EUSA 5JDCA 1XD8A 4JODA 4O8ZA 1QHHA 2ZK7A 2CB0A 3TIGA 3INNA 4BX0A 4CODB 4V0LA 2C2MA 3A1TA 4DAOA 4DMMA 3HC7A 1U6KA 3L8GA 4BE7B 1WXWA 4E2FA 2VJKA 3KJNA 2IHTA 1G8FA 1ZJWA 4H7EA 1CUWA 1JDJA 1QIDA 2HDWA 3ZWQA 4BNIA 3EZXA 4LX0A 1QMGA 3KWLA 4ZXFA 3WZLA 5K45A 4KWCA 1OJLA 2XHEA 3ZE0B 1JR3D 1TK2A 4RA9A 2Q3FA 4GQIA 4DCJA 2WP8J 1XE3A 1QGYA 1Y5RA 4D9FA 2O8FA 3EPHA 1G55A 1CZNA 1U3VA 2AS0A 3D4NA 4YI5A 4GLFA 3WNCA 2WF5A 4O2BA 1KDTA 1MO5A 3AI2A 1KDVA 5I8WA 3EPLA 3AF2A 3KKOA 3RRJA 3BHJA 4LTNA 1YR3A 1BJKA 1J1ZA 1T2VA 1N7IA 1UMCB 3G2QA 1KMNA 1BVYF 2ZBUA 4KLZA 4Z1OA 4CIAA 3H3XA 4RPIA 1R5OA 1ISPA 2DCUA 1VSUA 3AEXA 2GD0A 2WT8A 4XZ3A 4CNQA 1KAQA 4Z4GA 1FSFA 3TEJA 1QG6A 5BW6B 1NE2A 2Q1UA 1Y9JA 3BRQA 5KCZA 5B58C 3E8MA 3H16A 3ZDAA 1FP7A 2G40A 2XYQA 3R3JA 4I9FA 1WQ4A 3WIOA 4AUKA 3S2IA 2H48A 3BXFA 2R97A 2VWHA 1MHPA 3NDRA 1B8PA 4Q12A 3MRXA 1Q6YA 2O1SA 4HLUC 2NU8B 3ZGNA 2P9EA 1JLKA 3CIFA 4ZQFA 2OLKA 5J59A 4JHXA 5K8UA 1H23A 4RGQA 4RL6A 4D4KA 3V42A 5F7XA 3FSEA 1TIKA 3KEOA 3WO0A 1T6NA 1MIOB 3S6JA 4C05A 2ZXEA 1R9NA 4LRYA 1U8AA 3DBLA 4U8HA 1YBMA 1OI7A 1VJRA 5BO5A 4JWKA 3D6NB 4NICA 4EHBA 4LXHA 4K26A 4LDJA 5CB4B 3TG2A 4A03A 3CT4A 4TN5A 4O0MA 1CS0B 3FOCA 3LT1A 2OYSA 3HP7A 4EYOA 2IBSA 1P6XA 3SIPA 4DRZA 3TX2A 1YI0A 3PLRA 4HEQA 1JW9B 4GEGA 2PKYX 3P4XA 1G21B 2VDJA 4JC8A 4MOWA 1E3WB 4H6XA 4QX6A 2NSYA 3ZHOA 5DNVA 3R2JA 1GPJA 3BHNA 3JTMA 3T7IA 4EKIA 4BMZA 3SJAA 1YQGA 5IVIA 2CT8A 4I6GA 5LSAA 2ZCVA 3AEKA 4K28A 4QLBA 3H18A 5BSUA 2FETA 2VPZA 4UEKA 4MEAA 1YZLA 2I54A 1OFUX 2ZYWX 4UDOA 4EAQA 3D4PA 4MW1A 3GRVA 4F85A 4FMBB 2I7DA 1FS4A 3DAOA 1U8ZA 4Q02A 1DQSA 4YJ3A 4EGFA 4YRRA 1L8QA 4Y6QA 3BGIA 5IUKC 5JYBA 2ZWAA 5AHKA 4ZOEA 4DJDC 1GZ5A 4FBGA 1PQPA 1GPUA 2W93A 2XNKA 4CMHA 3DVSX 4FILA 2ZULA 5D7NA 5GJBA 3MD0A 1Z5OA 3RVSA 5LJIA 1JSLA 1NN0A 4KHPB 1G8SA 1MG5A 3EG5A 1D4FA 2PZ8A 721PA 1PT5A 4L4RA 4B85A 2B8TA 2QUAA 4FMDF 1VCIA 2P9ZA 3MTEA 2IYTA 4FEAA 4H4CA 1OI4A 5FAXA 1QHNA 2IRWA 3UK2A 4HF7A 4D45A 2NTEA 1S8FA 1IPFA 4Q4DA 3FBWA 3C7TA 3V8MA 3W5IA 4WNYA 3LS2A 4ZOLF 4ND8A 1XNGA 2YHSA 4S1TA 3RGWS 1ZHHA 3DEYX 3UICA 3FVTA 4UMVA 3AF5A 1PX0A 1VECA 5DM0A 1QWSA 3A04A 4WOPA 4PTZA 1XA4A 1Q14A 4OKIA 3GP8A 3JRWA 2XEDA 1MQSA 2VZ8A 1I3CA 1NMQA 1TD1A 3HBAA 3W6UA 1QXSA 4FS8A 3HVRA 3EXEB 1KH3A 2F9LA 1KMHA 1M6WA 2QVGA 5AVZA 4R83A 3P9YA 1TC2A 5DLYA 3MBKA 4X00A 4Q16A 3F3SA 3LC2O 5EKUA 1JKXA 4ESHA 3L7CA 1F7UA 2BGJA 2WJAA 3LKBA 3A1NA 1Z35A 2DHDA 3UHFA 3NR2A 3AL3A 4D57A 1O9BA 5B12A 3WDMA 2NTNA 2RJNA 1UANA 5G4KB 4ZZ1A 4HAWA 2HIHA 2QF7A 1U0HC 2VP2A 2YJGA 1UBJS 3EARA 4U9UA 4ZQCB 2C92A 3C87A 1WE2A 3DBIA 4FR0A 2XUGA 4JI1B 1PV2A 3VDRA 4KR9A 3K0EA 2ZI4A 2BCGY 4LCEA 3W6OA 4BVEA 1TKRA 2VJYA 3AR7A 3T8YA 2QGFA 1YSCA 3HYLA 1MC4A 3LQQA 1RSZA 2NYRA 1PBTA 1S3IA 3RSLA 2W70A 2ZUDA 3I2FA 2OXIA 4GFDA 4JGIA 2EW1A 4W6ZA 4K6KA 3VU0A 1P8JA 1Y4UA 4J0KA 1MT0A 4B3GA 5AVYA 1IHUA 2VC2B 1IEWA 2VAVA 2Y6VA 3G6KA 4PSKA 1E3TA 2H54A 5E2IA 4CBVA 4DRXA 1EA7A 2A5LA 5TQ2B 2JIQA 3JAKA 1QE5A 3IBFA 1F20A 4BZPA 4DQ0A 3KX2A 1HH4A 2XUPA 3HCAA 3RRZA 3PNOA 3DR3A 4F4DA 3MCVA 1T2DA 5A9SB 2EZTA 3H11A 3R7BA 3TUZC 3FD8A 4AQDA 4DDVA 3DZDA 1ZVKA 4LC9A 4EPRA 4P4LA 2WFLB 4ZK2A 2EEZA 2V6MA 1J8QA 1N2ZA 1U2GA 4OXYA 4Y2HA 2R25B 4I99A 5FL7A 4EGJA 3MJSA 1ZVVA 4KBFA 3ZEIA 1KC1A 3QFRA 1Q83A 2OD2A 3MHPA 3OLQA 1L5WA 3K1YA 3H8JA 2AUMA 1GZHB 5JXHA 2QPAA 3R6TA 4Q4CA 1OXXK 2HCTA 4P7JA 5ELMA 3OQ1A 1RYZA 1NAIA 4ZAVA 1QGOA 2D4HA 3O8QB 4DDHA 5EMLA 4M60A 5FPSA 3ZWDA 5EQDA 2AKEA 3QA3E 1LK5A 1G17A 5LMUB 2I8LA 3P0EA 1NOIA 1Y3HA 3B8HA 4AY5A 1K5HA 4IVRA 4OHKA 2Z4SA 3PUWA 1FU7A 1QNLA 1ZRMA 4QDJA 1X0XA 3C3PA 5ELLA 3WYGA 4F2DA 3DONA 4JSTA 1QIKA 4AMBA 1I94B 3N53A 2BGTA 1GADO 2HSGA 2GXAA 2ZJ6A 1X14A 1J6UA 2B20A 3TJMA 5B6JA 5BSWA 4JYCA 1S4MA 2CL7X 1VI2A 5BOSA 1XA3A 4QC2A 3H9BA 1KH2A 2OMKA 4B2IA 3MS2A 2ZE6A 4H3KB 2ACVA 1ECCA 2Q4RA 2E4YA 2C8LA 3LMKA 4TKZA 4BKRA 3IR6A 2ZJBA 1FU4A 2ORYA 3CLHA 5F9HA 4I1YA 5A5VA 1GSIA 2PNFA 3EOAI 4CCWA 1SIWA 3ZX4A 1AC5A 2GVDC 2PKEA 3DOHA 1DXOA 4UW9A 2FUKA 1T9ZA 3SEQA 4WBNF 2BFFA 3EPPA 1HSOA 2ZSUA 1F12A 3IQGX 4ZCQA 2JFGA 3JQ8A 3NRBA 2PT5A 4QXMA 2ZBPA 4ZEXA 2GZ1A 2QUIA 2IYPA 4MB6A 4RIIA 2IT1A 1Z9BA 2I65A 4L16A 5H4HA 3KLBA 1RXVA 5HYVA 1DRJA 2XGOA 4OI0A 2Q0XA 4NBSA 1PL0A 4WFKA 1UAYA 3JD4A 4MK4A 4L5CA 3URKA 2UZ4A 2EFCB 5C4IA 4KXMA 5JZSA 1U7ZA 5GIPE 5J23A 3I2KA 1GQRA 5CD9A 3K6SA 2F1JA 5LIRA 2UDPA 1GRVA 1UP4A 3ZOKA 1GGJA 5JS8A 2SHKA 1N7HA 4O1HA 1NI3A 3H5NA 3SIXA 1VCHA 4F7DA 3SYRA 4KTTE 1RIFA 4O5AA 5FWXA 1CEXA 2RHGB 2XA2A 3HCOA 3OPMA 1MZPA 2R1UA 3I64A 1AB6A 3ZCVA 2NZ2A 5GOZA 4J0JA 5T4BA 3LPLA 1LD3A 4YPOA 3HEBA 4DV6B 1ZGHA 1PEYA 2FN8A 3K9QO 2PTHA 4NKRA 3OQJA 4FNAA 1DRUA 3WGMA 1W49A 1VE7A 3NKLA 1UBOS 3UW1A 3I1IA 5BT9A 3JAWB 5AESA 1BE1A 1CEQA 1Q74A 4RMIA 4QXRA 5IT4A 3AI1A 5JNRA 4RD4A 3VMFA 1M2JA 2V7WA 1VIDA 1EA5A 2OFXA 1D0VA 1JDUA 2Q62A 4IIHA 4G37A 3THWA 5CFLA 3G7SA 3MB5A 4AULA 2D7CA 2LDBA 2WQ7A 2HCRA 1GEGA 2J08A 3BA1A 3D8TA 2ABWA 4QBGB 1SK9A 3GEGA 4HDKA 5K8JB 2ANCA 5KTRA 2OCDA 2IYZA 4GOXA 2V55B 4MUIA 3OZFA 4IQ0A 4OL9A 1ZK0A 3PQEA 4S1WA 2XYRA 1I51A 5E4YA 2JZOA 1GLVA 1LW7A 5DP1A 4LHWA 1QAMA 3UJ8A 1NDQA 3DE6X 1E7YA 1XMPA 3UJ9A 4F1KA 1VSQA 2CSXA 3P2JA 3C3BA 5AUQA 2HF9A 5GMOA 5KREA 4FGKA 2IHJA 1UZMA 1X80A 1BFDA 1HLDA 4RV9A 3SPXA 3U37A 3PQ4A 5CVJA 2G83A 5KX5F 3MT7A 2PIDA 1YDHA 3H97A 5CNIA 4G8CA 2Z5VA 1P1KA 5HKOA 1A9RA 4LJYA 1A96A 4K2AA 2GXQA 4N3CA 2VLIA 3LX4A 3ZEAA 5EIXA 5KTMA 1KKLA 2CDAA 4B5KA 1RQGA 1ZN7A 2PD6A 4UEOA 1NW3A 1Q7GA 3DSRA 4CE6A 2FF7A 1M10A 1Y9DA 4I36A 1C8VB 1Z8DA 5FBZA 2RGGA 2X22A 4RXMA 3TOSA 4MICA 1GEEA 3N28A 4BAZA 3HADA 4FIDA 4US2R 2PSHA 2X76A 3I58A 1UBHS 3RM3A 5I4CA 3R4CA 5J5AA 1QH8A 2VG8A 1LNSA 1YIAA 2FW9A 2OZLB 3AKDA 3FMVA 2PL9A 2ZAMA 3LC1O 3UUGA 2VQEB 4BCBA 4BMXA 3E5NA 4DQUA 1UP6A 2C5LA 3BSFA 1M1YE 3KZNA 4U2EA 1Q19A 1KDYA 1HR0B 2E55A 2JW5A 4NR0A 5FD8A 5T3YA 4RAOA 3U4DA 1TAHA 4KE6A 1G3UA 4XCQA 2H1VA 4L4YA 2I34A 2CW5A 2JJ8A 3LCUA 4MW6A 2YVLA 1V9SA 2HPZA 4RPHA 4CLDA 1FQKA 3VC1A 4ZIRA 5C8ZA 5CA1F 4YJFB 1K89A 3P0HA 1AKTA 3IP1A 2H3EA 3GJQA 1M2NA 1OV4A 2LIVA 3FB4A 2YX1A 4YLGA 1KC3A 1TIPA 1VM6A 2HJHA 1HE3A 2G0NA 3IOMA 3OKPA 2R6R1 2HK9A 2FMFA 4ZPXA 3HQ4O 3N0RA 1P3JA 4LMAA 3UWSA 4C21A 5IZ4A 4K3VA 5JDIA 5IDVA 4RXUA 5T3UA 2QX4A 4F5YA 3ZJYA 4ZVNA 1US8A 2O20A 5JXJA 2O6LA 4KYIB 1VIMA 4QT4A 2RHLA 2CFOA 4EG3A 1F14A 1JQJC 3WB1A 4QTYA 4GS5A 4C29A 1QGAA 3HXQA 3WIUA 5CA1B 1JR3A 2IDZA 5F1OA 1BHQ1 4KMMA 1T9BA 1PL7A 3AFNA 3W3AA 5IWAB 2XF8A 1JX6A 3C8MA 3FPJA 4XM2A 4UPDA 1OC4A 1UK8A 2H5IA 2PQ2A 5DISB 4EA7A 1FIUA 2G0TA