2WIAA

Crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
253
Chain Sequence
MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Structural Fold, Conservation and Fe(II) Binding of the Intracellular Domain of Prokaryote Feob.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
total genus 73
structure length 253
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wiaA01
3T5GA 2ZRDA 1FPMA 4Q4JA 3A37A 4RD4A 4B71A 3MLEA 4L8GA 4TT3A 4DDVA 4JL5A 4YDHB 3A1VA 1PV4A 1TF5A 3THYA 2QGZA 2VA8A 3NIBA 4HEJA 2QRZA 4KJZA 5C46F 1CTQA 5BW8A 3QENA 4Q01A 2ZM5A 2W2XA 1Z0KA 5L3QB 4YMSA 2NO9A 2RGNC 2ZRKA 4OHWA 3WMFA 3KFXA 4IKEA 3BH6A 3C41J 4O2LA 2QORA 3RS0A 5DISB 1OB5A 4MQBA 1Z47A 1G7CA 3OAAD 1E1QA 2VP6A 3EASA 1ZUHA 1VG8A 2RH5A 3CRVA 5FH9A 2OG2A 1OJLA 5FPYA 3Q8XB 2A30A 2I1VB 4C30A 3VU9B 3W3ZB 1R2QA 1M34E 2IYWA 3QXXA 4OQLA 4GDFA 2WWWA 3CR8A 4NE2A 5EP1A 5CB6A 5IK2D 2ODBA 1Z3IX 4XVQA 1BO6A 2W6JD 3RS3A 5DYGA 2HLDA 4UNSA 4TYNA 2ZI4A 2NPFA 3AV0B 1XD8A 1ZD1A 5G3YA 1JPNA 2ZRHA 3U3MA 1Z6YA 2JLXA 3AVOA 2KI5A 2IWRA 4B74A 1YRAA 3OIYA 4TMVA 2TMKA 2ORWA 2HCJB 4M9SA 2FMXA 1XTIA 4JLVA 1E6CA 3I5YA 4QM6A 4MYHA 4HAXA 4LC1A 1U0HC 1JJ7A 4IVPA 3SJAA 1DAIA 4EUNA 4FCWA 4D81A 2RGGA 4A0HA 3FE2A 4K8OA 1X8KA 1TQ6A 4MA4A 4X8LA 4CIDA 5FOSA 5CB8A 5IF9A 2W58A 4M4SA 3MWKA 3U7EB 1GKUB 2QMEA 4DDTA 1H8ED 4DLYA 1ZC4A 3VKWA 1GKIA 1UBFA 4KU4A 4DRZA 1OXXK 5HTKA 2G0NA 4JLPA 3TLXA 4KO8A 4C0QC 4JSYA 1ZVQA 4BE7B 4EAQA 4IXNA 1QHNA 3SBDA 4NYMQ 3CNNA 3JZMA 3GJ4A 4MYUA 4R9UC 3GPLA 4B6EA 3FDIA 1GNRA 3OE7A 1KDOA 3THWA 3CPEA 2I3BA 2ASEA 1X8JA 3GQBA 1IY2A 3GEHA 4HLDA 2OUKA 4QG7A 1M6NA 3T5DA 2XJ4A 2P3SA 5AJXA 4FIDA 4M1TA 4OI2A 3FMIA 4PC7A 4FMDF 4B34A 4LRWA 3RC8A 1M2OB 1O3YA 3C4JA 2NTYC 2NPIA 4HAYA 3QG5A 2PZEA 2D3WA 5AUOB 2ZE8A 1EFRA 2Z83A 3B85A 3NBZC 5F9FA 3W90A 2ZRGA 3K8YA 3DOFA 4ZCMA 1GZSA 3T35A 4A36A 2ZETA 3AP1A 4NBSA 3EG5A 1G21E 4UNQA 1YZLA 3C5CA 1F48A 1E9EA 5FL7A 1OFIA 4PHHA 3CRW1 3UIEA 3AB3A 4ZDWA 1X8LA 2C96A 1Q3TA 2OAP1 2ZR0A 5H8WA 3VQTA 1A7JA 1S1CA 4QHSA 2JA1A 3K70D 1NNEA 3BH7A 4MGIR 3HU2A 2VHQA 3I62A 1P60A 4IVRA 4Q4LA 1HURA 1R0WA 1UADA 3M0EA 3NWJA 3PEUA 1Z5ZA 1AK2A 1TQDA 2DFNA 2DR3A 4EPXA 4Q9HA 1XTQA 1BYUA 1E0SA 1U9IA 2IBMA 4UKDA 4KVGA 4Q9IA 4D4JA 4B44A 2GJ8A 3FKSD 4L4UA 4ZV4A 1A1VA 1G5PA 4JMPA 1KI8A 5FUVA 3W8RA 4FCVA 1QHSA 2PEYA 1XDBA 3AUXA 5BYJA 1YR7A 4LYHA 1U8ZA 3JVUA 1F2UA 1E2FA 4IDNA 3AVXA 2YNMA 2AR7A 3GLIB 3SEAA 2B92A 1DAGA 4B73A 3KKNA 1P61B 3IO3A 4P0TA 5DGXA 2OBNA 3PCRB 2IXGA 2GZHA 1J7KA 1UKZA 3KJHA 4P4SA 3R8CA 2HEIA 1UBCA 2IEYA 4YLGA 2VP5A 3U7FB 4LYAA 1EWQA 2ZIAA 1MV5A 2V6IA 3RRYA 3H2YA 5AJWA 1YZGA 3N5CA 2PX3A 2AFHE 4KHZA 3UMRA 1PLKA 2FU5C 3H84A 3CRQA 1XCGB 1DO0A 2ZJBA 2F9LA 1EX6A 3BWDD 3DPUA 3FTQA 1TUIA 3A4NA 5BWMA 2P65A 5A4JA 2B8WA 4B6FA 2J45A 1AA9A 4BZQA 1AZTA 1SHKA 2PJZA 4B32A 2D06A 4C9BA 1H65A 1XMVA 4KBGA 4B3GA 1KDRA 1CJTC 1VCNA 1LV7A 1NJFA 5TB5A 3GCGA 4JJKA 2P67A 1MRSA 4W5JA 5IT5A 1D2NA 2VH5R 4P4UA 1T8UA 1JR3D 4RCZA 1GNQA 1NY5A 2A7QA 2IYQA 4JLNA 2V1UA 5EQTA 1EG7A 3GFTA 4IW3B 4BLSA 3WNCA 1KMHB 1OV4A 4GP7A 3SU8A 5JRZA 4TTRA 1GM5A 1KI6B 2ODEA 1OXUA 5JBQA 1LTQA 3FHOA 2RAPA 5FI1B 3KTAB 3A1UA 1XPUA 1FP7A 1IN6A 1MR3F 1NVVQ 1Q57A 3UANA 4D80A 4D0LB 4XTCS 2ZRIA 4OK5A 1P2VA 5HZHA 4CEHA 2WIBA 1G8PA 1NMZA 3N2EA 2BKEA 5KSOA 4AKGA 4JLDA 2OCYC 2HCBA 2NO7A 2FDCA 3SFVA 5C1BA 1EXMA 4LJ5A 2BEKA 2WTUA 2V8OA 2VP0A 1N5KA 2OESA 5FOVA 2GWHA 2F1JA 2JASA 5AJVB 3PUVA 1DG3A 1WF3A 2WOJA 3NEYA 2ZRBA 3L8YA 4NYJQ 3AKYA 3SJBA 4A15A 3LRPA 4ZPXA 3OIUA 1TU3A 4YDSA 5EP3A 4A2PA 4CW7A 2P0EA 2ZRFA 1HT1E 1S9DA 4DDWA 3EA0A 5BN3A 3FFBA 4HUQA 4ILEA 1T0JB 4XTRA 2ATVA 4V0KA 1IN8A 4KITB 2G6BA 3OIVA 4YONB 4GT1A 1IHUA 2R8RA 4E22A 1S0UA 3TR0A 1P9NA 1DPFA 1IAQA 4XD7D 2W00A 3VR5A 3LXRA 3TSOA 1VTKA 4II7A 4MYTA 2NOAA 2GESA 1N6KA 4JVLA 4Q4JB 1G3MA 1ZCAA 1UBGA 3EIQA 4PZZA 3S1AA 2NQ2C 4JKYA 3B1WA 5DYIA 3THYB 2F9MA 3FMPB 2WKRA 4PPGA 1ZU5A 3NKVA 2ZJ5A 2FWRA 2QTHA 3QIAA 2CCGA 2GF0A 1ZRHA 2GJ9A 5FBQB 2J41A 3T1QA 4LWZA 3ICEA 1K8RA 2WWGA 2OFOA 2ZYWX 3FOZA 3QSYA 3QBTA 5IDVA 4JJZA 2JJ2D 3KXLA 1F6BA 3EWSA 4KBFA 3JZAA 1VHLA 4LBYA 4LPSA 4R71A 2DY1A 4LZZA 4DWJA 3O8DA 2F3RA 4PQYA 1N5LA 2MSCB 1VG0B 2C78A 2XJ9A 1TTTA 1PLJA 4CRWB 3GLIE 5TARA 1P72A 1XTRA 4DLUA 3BK7A 5E7IA 4XVUA 3PV0A 1P9WA 1SVLA 4PAQA 4WZ6A 5FUWA 5H70A 5KSYA 3C5HA 1V43A 1SKYB 2JATA 2GA8A 1UKVY 2R9VA 5FFMA 5K8UA 1CJKC 2FV8A 4HLQB 3V00A 3SC3A 1SKQA 4BUJA 1NLZA 2BKUA 4XD7A 4MRRA 2FNAA 1GILA 1SXJE 3Q7PA 3IQXA 4EKDA 3IIMA 2C99A 2DFLA 2G3YA 4WA7A 3RSOA 1ELOA 4PX9A 4B3CA 4B3DA 4DIDA 1OFUX 5AUNB 2F1HA 4ACBA 5FPHA 1HT2E 3K1JA 3QY0A 5HR5A 2YWGA 4Z51A 2ZI7A 1GVNB 3W6NA 4CDGA 4O25A 3TSWA 3WP1B 1JBKA 2ZRNA 3REGA 4HB4A 1FQJA 1GNPA 1HYQA 2FG5A 4DDUA 3QBVA 3D7MA 3CR7A 1QDEA 4TL8A 4A6XA 3BS4A 2J9RA 4NCIA 4PPFA 2AKAB 3ZD6A 1G20E 2A3RA 5HZKA 1F3OA 1UDWA 2MMGA 1E94E 1SGWA 1QHHA 1FL9A 2OBMA 4PC3A 1T0HB 5F2EA 5FTKA 3WXMA 2ZPTX 2JLYA 1N0UA 1TQ4A 1W2GA 4I99A 3C16C 1QRAA 3U4QA 4DSTA 1GL6A 4IOJA 4W5HA 3THWB 2GKSA 5GJBA 4TMXA 2ZAMA 2LCFA 5FTJA 3B13B 3SS8A 5EXTA 2C2HA 2XZOA 3CNOA 3AF2A 3AF4A 2CE7A 4A2WA 2CK3A 3GLHE 4RD6A 4N0EA 4S35A 3LY5A 1E0AA 2FF7A 1LS6A 5KDLA 1II9A 2BM1A 5TXGA 1XJQA 2QEQA 3FPAA 5EZ6B 5CLLA 3MWYW 5E95A 3EX7C 2VPPA 4M0LA 2GXSA 4G5SA 5G3ZA 4D2IA 4CT4B 1UKYA 3IHLA 2IW3A 2AXNA 1U9IC 2OAQ1 3BXZA 5JMTA 2NO0A 4LGMA 1VYTA 5EZ5A 3L8ZA 4DCVA 1AKYA 3SFZA 3K0CA 4MKGA 2IL1A 3AP3A 2BVNA 2X2FA 4PAOA 4QNMA 1II8A 2D7CA 1ZC3A 2RB4A 3QOFA 4PZLA 4BFXA 1OXTA 1Z07A 4A82A 4D4MA 1Z28A 1E1RD 4Q66C 5FOTA 4C0HA 1KK0A 2GAOA 1Z83A 1ESMA 2VIIA 4TN1A 2JDID 4LC0A 4DHEA 1KK3A 4ACAA 2WZQA 4Y0VA 5KO2A 1TNDA 1DO2A 2ZS9A 4IHQA 2NZJA 4GOJA 1E2LA 5CLQA 1W46A 3CB4A 3GEEA 4PSVA 2GCPA 4QGGA 4L9SA 4TQUS 3RAPR 1W0JD 4B43A 3LLMA 1VMAA 1HH4A 5EP4A 2IYYA 3U3OA 4M9QA 1IN7A 3T06B 1W48A 4B2IA 1S3GA 1KI1A 1G19A 1U99A 1VCOA 4G5GA 4JVNA 4QC2A 4OHYA 2ZYVX 1CRQA 1UBEA 4ZCLA 1OKKA 4URVR 4C2TA 2G9NA 1P7CA 1PJRA 3WNDA 1KK1A 1TX4B 1F2UB 1N6LA 2IT1A 1SULA 3LW7A 2EVWX 1DAFA 1S1MA 2GNOA 3LX5A 3ZIAD 3PUZA 3UWKA 4NCHA 4QJ3A 1ZM3A 3PUXA 3PXGA 4URWR 4BZXA 3DZDA 1MRNA 4JT4A 4V0MA 4EPYA 3ASZA 1E9DA 2EFGA 4CGZA 2QM8A 4NU0A 4JLMA 4HATA 4D25A 2XOKA 4OHXA 1UEIA 3DO6A 3GLGA 3KXIA 1E0KA 4Q1CA 2QU8A 2E87A 4RZUA 4NPHA 2DFTA 3RWMB 2VRWA 1IXSB 1YZQA 2WJHA 5JWHA 1Q1BA 1T3SA 2ZU6A 3GJ7A 1AGRA 3BFVA 1Z6TA 4D6PA 4GSYA 2JDIA 4D4LA 5CM9C 4H9GA 1FW6A 2CL7X 4ZDKA 2P2LA 3TE6A 1ODFA 4FMBB 1NBME 1NN3A 1CBUA 4KXFB 1WBDA 1XCMA 3KUDA 4UJ5A 3VR2A 2Q9BA 4AC9A 1HV8A 3QI2A 1KIMA 1DAKA 3NHBA 421PA 5C4GB 1FMJA 2PBRA 5FR2A 4DZZA 3E70C 3CX7A 2LWIA 2JLRA 4RZXA 1N5IA 4A1FA 2YINC 1Q20A 1W1WA 2BHRA 4B47A 4LPKA 4JL6A 1W5TA 3B2EA 4TYPA 2ZS7A 4GFDA 5EUQB 4UNRA 3NC1C 2AD5A 2PLFA 1F60A 4JBYA 1YQTA 1PLLA 3IHWA 1AS3A 4C0JA 2XXAA 1GFIA 4OQXA 4URYR 3RNLA 4EFMA 1E9BA 1DAMA 4CEHB 1Z0IA 2V54A 4TT3D 3B9PA 2G1KA 5JZVA 3T15A 3ZGXA 1HQYE 2ZUBA 3AVUA 2ZREA 4LBWA 1WBBA 2ZI5A 4C0BA 1OYWA 2WKPA 5E7JA 1NVXQ 3TUJC 2ZUDA 2EW1A 1JJVA 1KY2A 2C03A 3O47A 3DKPA 3W6OA 2A78A 4QJ4A 1NN1A 3RS5A 2HUPA 5JJLA 2FFHA 1T9HA 2H17A 2QRNA 2BOVA 1X1SA 1FUKA 2AWOA 2ZVPX 1E1QD 1WCV1 4MUBA 4LYFA 2GETA 1M7GA 3G5UA 2V6JA 2QNRA 3WMGA 3HJNA 1AS0A 4HUQB 3EZ7A 4XSHA 4ABYA 2J7PA 1L8QA 3L0OA 2QAJA 1E2KA 2BJWA 2GEDA 4LOAA 1IJEA 3ZVLA 4YQFA 1E9AA 5FPTA 3T1VA 1XB2A 1XXHA 4FN5A 4LX0A 1DE0A 4Q1BA 2ZJYA 1FOEB 3N70A 1P3JA 2J0QA 1QHXA 3A4MA 1E99A 2O8DA 1II0A 5CDFA 1E98A 5GVSA 4QHYA 4B33A 1BMFA 3V9PA 2W83A 3RS4A 2WV9A 2ZSDA 5G53C 3S1AB 4XWAA 3P26A 1UFQA 3G82C 1R0ZA 2KB0A 1HEIA 1VCIA 4NKRA 2ZJOA 3BOSA 1EWRA 1VKJA 1G7TA 2Q3MA 3TBKA 3K0SA 4B48A 1DEKA 3EWAA 1NIJA 3K9GA 3H1TA 4R2HA 3VR6A 4BFZA 4YMVA 3BAFA 1AGPA 4UNPA 4XOIA 3O8CA 2CVHA 2AWNA 1WRBA 3DEFA 2JLQA 4V0NA 3AKEA 1XWIA 2WVJA 3VAAA 2Z5FA 2REOA 1E2HA 4PHGA 4RFSA 1ANKA 3KL4A 3TNFA 3SJCA 1XZQA 2AFIE 2YKGA 2OEPA 3TUIC 2F3TA 3T1OA 3IPXA 2H8KA 2J46A 3ZZUA 4UXJA 4BEBA 4OHZA 2EWWA 4TTQA 1NSTA 1NVVR 3KX2A 1M7BA 4QBIA 2FFAA 1SVIA 2ZYUX 4LBVA 1CF4A 1TAGA 2ZROA 3HDTA 3EPLA 3OE7D 1EFHA 1YZUA 2IF0A 2LKCA 4BFSA 3KQNA 4JLKA 1S96A 2IHYA 2WMOB 4W5WA 2XSZA 4FINA 2EFHB 2ATXA 2ANCA 1MO6A 1NI3A 2PT7A 2IYSA 4QGAA 3HP1A 4M9XA 3L0SA 4AWXA 4PHTA 2JLVA 1G18A 4LV8B 2ECKA 4KVAA 3GLFA 4KFSA 1U0LA 4M22A 1S3SA 1YZNA 1HUQA 4BLTA 2ZUCA 4NYJR 2FPLA 3MCAA 1EFRD 1SVSA 2FA9A 2GZAA 1WQ1R 5L3RA 1OYYA 3BORA 3SI7A 5DH9A 1R0XA 1G3RA 4URZR 1W36C 1Z08A 3F5FA 1HTWA 1YR8A 2ODWA 2JEOA 1XD9A 2ZSFA 5FL7D 4PQFA 4L16A 5KPJA 3ZYCA 1QHHB 3Q5EA 3VTKA 2N1BA 3A8TA 4CVNA 2IF2A 2Q21A 4IDPA 3K0CC 3U4QB 5C2JB 2ZS8A 5FR1A 2QMOA 3GJ5A 2IUUA 2R62A 4YMWA 3KDSE 3CIOA 3QKUA 4GMDA 4WIAA 4ON9A 3ZS8A 3U2QA 4BQSA 1XPRA 2O8FA 1KI3A 2Q3FA 2ZRPA 4TLEA 5LB4A 2KSQA 2CVFA 2WJVA 3EPHA 4RD1A 3WMEA 3G0HA 5JEDA 3H0KA 3IDQA 2REBA 1JEDA 2BBWA 3V4FA 1W36B 4M2LA 3ZQJA 5K8IA 1P6XA 4NL4H 3U6BA 1CXZA 4KSCA 3EIHA 2ZE6A 3B9QA 2DYKA 3EZ6A 3H86A 3I73A 3LV8A 3SNHA 4M1SA 4DCUA 1JQLB 2QI9C 1FUUA 3B60A 1LF0A 221PA 3W3AA 5M04A 3AVWA 3AUYA 2ZI6A 4BFUA 5CIQA 4XJXA 2G0TA 5HE8A 1FP6A 1II8B 4KCGA 4EFNA 1KDTA 4AK9A 3RRNA 2NZ8A 4G5RA 4IEIA 2HJGA 1L4YA 1XCPA 1BOFA 1KO5A 2N46A 4A4DA 2C77A 3VMFA 2XZPA 2A5FA 4OI0A 3WHLA 2R6AA 3OZXA 3AVQA 3SN6A 2X77A 1QG2A 4K46A 1JR3E 4OQMA 5J4YA 2Z43A 4BASA 5ANRB 1Z22A 4TZ0A 3QPUA 2WJJA 1IY0A 3R20A 2YC2C 2YZ2A 1OXSC 2AX4A 4GMXA 1KO8A 4CEIA 2VF8A 1KNXA 1AZSC 4KLNA 4JYCA 2CL6X 4Q5IA 1EESA 4QRHA 2PJRA 2OILA 4Q7LA 1DAEA 3CX6A 2QL6A 5HE9A 2UVQA 2VP9A 5FBRB 1E4YA 3CRMA 1Q44A 2GCOA 2QT1A 4AKHA 2EYUA 5F3WB 4C7OA 5GVRA 1KO7A 2ZRLA 3CBQA 4HLUA 3MGCA 4JLBA 5KU1A 3HU1A 4MUAA 5P21A 3WRXC 5AJZA 5TVKA 1Z06A 4Z1MA 1QHYA 1YVDA 2CDNA 3W5JA 3TW8B 3KQKA 2QUZA 1U90A 3W34A 1G6OA 1QHIA 5HCNA 2RGXA 1VYVA 2QE7A 1E2PA 3AF1A 2O52A 3C7KA 5J4KA 1G5TA 3GLGB 1AS2A 2GXAA 2QBYA 3EC2A 3HPRA 1T5IA 4C0KA 4Q1EA 1AIPA 5JCZA 1Y63A 5G40A 4R98A 3NDBB 1KGDA 1WMSA 2DWQA 3CZQA 4OQNA 3NEJA 4Q47A 1KKMA 2BCGY 2NO1A 4TSFD 3VX3A 5J40A 4LYJA 1V5WA 3U44B 4US0R 2AL7A 5UKDA 2J59A 4D0GA 2BV3A 2CLSA 2OZEA 1CU1A 1XEFA 3SHFA 2PMDA 2YOHA 2KJQA 5KYKA 1E2QA 4D4KA 5CYPA 1VIYA 4H1VA 4MGYR 4US2R 3AKCA 1GWNA 1T3LA 3RC3A 3WHKA 3UXMA 2FN4A 2GEVA 4QXAA 3ADBA 2FE4A 1US8A 2BBSA 3AP2A 4OI1A 2GCNA 1GSIA 2QPOA 2A5YB 4N1AA 5KNDA 2H1LA 4Q00A 4PHFA 4BFYA 4DC9A 3RHFA 1H8HD 4L5BA 1GP2A 2D2FA 1B0UA 4QKQA 2XXAB 1D9ZA 3CF2A 4PQRA 1S2MA 2ZRMA 3BFKA 4QL3A 3OEEA 3DKVA 4DSUA 4E07A 3VX4A 2FFQA 3ZZTA 1RKBA 621PA 5FUYA 1TL7C 3X2SA 4F7WA 4ZDJA 4NTZA 1HA3A 1NIPA 2GVZC 3ASYA 4I4LA 4P4TA 4K81B 4KFUA 3FWYA 3I8SA 1KJZA 3TVTA 2BMFA 1N6HA 2GBLA 3L82B 3ZS9A 2RMKA 1KJYA 3BH0A 1L7VC 1BYIA 1DAHA 1KSFX 4EQ6B 2C9OA 1J2JA 4LJYA 1AQYA 5DNYB 1AQUA 1U0JA 2PZFA 2H5EA 3U60B 2OCBA 4OJKA 1G3UA 3CONA 1CULC 4TSFA 1N0WA 1KAGA 2OBLA 4JKIA 1OIWA 2XEXA 1JNYA 1Q12A 4JLJA 3L43A 2B21A 1A2KC 1E2DA 2RHMA 1CIPA 3KB2A 4D82A 1XXHB 4DEXA 1OH6A 1JPJA 5LBIA 4O3MA 2ZSAA 3VNVA 1CJMA 1G8GA 5FI0B 3L2OB 4G3XA 1FMLA 4EFLA 4HUTA 4KFRA 1KI9A 2O8DB 121PA 4DLWA 4F4IA 1JAIA 3P20A 4QOSA 3OIWA 1MKYA 1XBTA 4IXMA 4BFWA 2JIZD 4XVRA 4TLDA 4WW0A 4JS0A 2QZ4A 1AKEA 4GRAA 2C9CA 4HYYA 1OLOA 4MKFA 4TQ9A 1H8HA 2ZITA 2CLCX 1ZU4A 3IILA 3AF3A 1XMJA 1A4RA 2QMHA 2Z6VA 5DN6D 3WYFA 3ICQB 3GJ6A 2ZEJA 3WNBA 3I8XA 3SDZA 2BMEA 1G4AE 4FI3C 4LHZA 3KUCA 4JSTA 1DBSA 4Q1AA 4HDOB 2IS1A 4HSEA 3UK6A 3SQXA 4LJ4A 3IKJA 2R65A 1S4QA 2VEDA 1DELA 3KFVA 4RFSB 2O5VA 5D3QA 5GADl 3NH9A 5SZHB 3NBYC 4LI0A 2DWPA 1GKYA 3DZ8A 4HI0E 4TLCA 4BLQA 4PR0A 2FGKA 5FPKA 1P2SA 4Q18A 5KNBA 2GDJA 4CT5A 1Z0DA 4Q9LA 1T4GA 1DADA 2FX3A 2IXEA 4KLZA 5CK5A 3MG9A 1F2TA 2UKDA 2VYFA 2IYUA 2FZ4A 1Z6GA 4PPQA 3QEOA 4M21A 1Z63A 3EA5A 3RRZA 1CR2A 2CHGA 5EJEA 1MO3A 2G77B 2WAXA 5H1YA 3A36A 4ZI2A 1SZPA 2X1VA 4LY6A 1X6VA 1ZD9A 3RSLA 4M9ZA 4WVFA 2CK3D 2F1RA 3I1FA 2VHJA 4RSGA 3EC1A 4PFSA 4PTLA 3KKMA 1OFTA 5SZKB 1W36D 3PIRA 4DLTA 1Y3AA 3GLFB 2IS6A 2JIZA 3T1TA 2ZRCA 3QVVA 2FSIA 3OEHA 3NG1A 1D8TA 2RGAA 3QJYA 3DOEA 4OK3A 4EDHA 2Y8EA 2ZI9A 5AWFC 2VP4A 4CYMA 2OV2A 2UZIR 4US1R 2ONJA 1Z0FA 2J5XA 3ZDQA 5DN6A 2WWYA 1NKSA 4DT1A 1AJEA 1N6PA 3TAUA 2YOFA 4JLOA 3THOA 1OFHA 1N6IA 3VHLB 2OXRA 2ZVQX 3LO5A 3TGPA 3DHWC 3MAAC 5BQ5A 1JXOA 2WM9B 1ZMXA 4HAUA 1YR6A 4HDCA 2QPTA 1Z6AA 3TAHA 4ARZA 1P75A 1D9XA 1BKDR 3QXSA 2O8FB 5A0FA 2IC5A 1KHTA 2C8VA 1G3IA 3X1XA 5JHHB 2WSSA 3QPWA 1MOZA 1IN4A 3T34A 1VIAA 2OCPA 3FYHA 3BFXA 3MD0A 1Z2CA 4QM7A 4ZCIA 3SYKA 4GI7A 2H18A 2FZLA 3HWSA 1OKKD 2X19A 4HLCA 5HKKA 4S2EA 1XD2A 2QY9A 1G5RA 2IHBA 2QPAA 5CJPA 4BLRA 3CZPA 3PG5A 3ECCA 5TV2A 2W6IA 4B35A 3CW2A 4DLVA 5FOWA 3U7GA 4KSBA 5D3MA 1KDPA 1P4SA 5A5GA 4O2RA 2C9YA 2H92A 3HR8A 4LJ7A 3RDPA 3U3RA 1QBKC 3J81k 3IO5A 3K09A 3TSZA 2I4IA 4NDZA 1XNJA 3LWNA 2ANBA 1E32A 1UEJA 1ZIPA 3U6KA 2QP4A 2IUTA 2XOKD 4LJ8A 4OKSA 3QKSA 1U8YA 5L3SA 3UMSA 2ORIA 4HLUC 1SVKA 1YE8A 1ZM9A 2AXPA 1L4UA 3LA6A 4M1KA 5JSZB 1MO5A 5CJ2A 1XEWY 2EWVA 3P1JA 2ZAOA 1R5NA 2CNWA 2V4ZA 2D74A 3EZFA 4RY2A 3VFDA 2Z4RA 2VSXA 1ZCBA 4U7DA 4MGKR 4URUR 4HB3A 1Z0AA 2F1IA 2EU8A 4CEIB 3LVRE 2IYXA 3R8FA 4PO8A 1FFHA 4E09A 2B7CA 4M1WA 1CJUC 1JALA 5F98A 3TK1A 3FFAA 2QN6A 1ZNYA 3OHMA 2PCJA 2WWXA 4QBFA 2O8EA 1K5DA 1NVUQ 5ELXA 3K0AA 4NCKA 3MMPA 4OJQA 3LX8A 3PUWA 3LH5A 2GCOB 3IUYA 5FBWB 4GL2A 1YU9A 1O87A 2J1LA 1R4AA 4Y0AA 4C7OB 3K9NA 4NHOA 2CL0X 4A8JA 1D2EA 4MDEA 1OHHA 3F0TA 1ZNZA 2Q0HA 2ZTSA 1P2UA 2VQSA 3EW9A 3DVLA 4IDOA 2XB4A 2P5SA 4MITA 2J87A 3L0PA 2PLRA 2QBYB 4BGDA 5JEEA 4E03A 4BLOA 1KZGB 4IDHA 3VR4A 2V7QD 4RVCA 4A6PA 2R6FA 4FWTA 4QNRA 1GOTA 2RGEA 3RS2A 2RGCA 2X2EA 2XTZA 1UDXA 5SZIA 1YKSA 2XITA 3QF4A 4GP6A 5EUMA 2WAYA 2OO7A 2E1RA 1E79D 4NYMR 2ZJ2A 1NKTA 821PA 1EFTA 3D31A 1ZBDA 1IXRC 5KDOA 4HZUA 4FCTA 4DLXA 1KNQA 3AF0A 4QJ5A 4GPTA 4M1MA 4ERNA 5GJVC 5JRJA 1W44A 3K53A 3B6EA 1ESNA 5JECA 4TMTA 3ZVMA 4Q19A 1Q21A 5AJYA 1KI4A 1AM4D 4B3FX 1SKYE 1I4LD 1Z0JA 3GLFE 1T91A 2C04A 3D3QA 3ONWA 3LQQA 2J7PD 1NMXA 4DUGD 1XRJA 3U44A 4LHYA 2GBLC 1US8B 3K0FA 2QT0A 4JYBA 3P32A 5LPNA 4R7ZA 2IYLD 4BFVA 4NCNA 3THXA 1E2JA 1CJVC 5AR1A 3LDAA 1QHGA 2O0HA 3RYTC 3LBHA 1N3BA 1BMFD 1TMKA 4YXWA 1RRGA 1NL3A 1T5LA 2D7DA 3P27A 5BYKA 4P3YA 2W0SA 4IDQA 3CNLA 1MO4A 1N6NA 2XNDD 3QQ5A 4F38A 1ZM4A 2QP3A 3FHTA 1Z29A 2W2TA 4UXHA 3GFOA 4A0FA 1AN0A 1FX0A 1RJ9A 2YWHA 1HY3A 1J70A 1ZAKA 3LBNA 2AK2A 4PPNA 2V7QA 4Q7JB 2Z4SA 5E4FA 3RABA 4PC2A 4BWYA 2FH5B 5JWOA 1ZM2A 3QKTA 2UZ3A 2ZE5A 1C9KA 5DI3A 4ZIRA 4FMCB 5FTNA 1T8TA 3CRRA 4MRPA 3OFNA 1E79A 2A5DA 4Q7MB 4URXR 3CO5A 3MUFA 4AKIA 4AKEA 4F91B 1GUAA 4G0NA 4WAUA 1RW4A 1TEXA 2IS2A 4KI0A 1G9XA 4OBEA 4MKHA 3I5XA 1FTSA 4NZYA 2V3CC 4JZKA 3TH5A 4EQ6A 1EK0A 4C3ZA 4M8NE 3GFPA 5L3VA 1D5CA 1KO1A 1SVMA 2RGDA 2G1JA 4YMTA 1KK2A 4D0NA 4DUGA 2HDNB 1R10A 1HE1C 3LVQE 3UMFA 2OFWA 3EXAA 3KJGA 1W49A 3GLHA 1LF5A 5K8LA 2XSZD 2RHDA 1E69A 2WMNB 3UPUA 2BJVA 4DIEA 1E2EA 2GILA 1RVDA 1DOAA 3B1VA 3B1ZA 4TL7A 1XX6A 5EE3A 3WP0A 3NBFA 4QGHA 2P6RA 1BIFA 4C4PA 2GJKA 3PEVA 2QQ0A 4TL6A 5EE1A 4Q03A 2OXCA 4LV6A 5J5CA 2CEAA 1VDZA 3ZVNA 1TF7A 2ZYTX 3W6PA 1Q0UA 4GOKA 1CS4C 1A2BA 1G6HA 1RRPA 1SQ5A 2XNDA 3A1TA 2VSFA 3ADKA 3QPVA 1K5GA 2HT1A 4AG5A 2W2VA 1ZJ6A 1KMQA 1W5SA 2X8AA 3ZH9B 2YHSA 2WJGA 2ZQ5A 1XMSA 3KQHA 2FOLA 1Q1QA 4WOPA 2HF8A 2HJVA 1KTVA 1XZPA 2K5UA 5JWRA 1W4CA 1RE0A 3IEUA 1ZW6A 5JCPA 4GBMA 1WA5A 1TPZA 1UF9A 1F2TB 2OFXA 4LHVA 4DEYA 2F43A 3ZQ6A 4JBWA 1I2DA 4C2UA 3OESA 4V03A 1G16A 4IJMA 3FHCB 5AK0A 3B82A 1CR4A 4F4CA 1OT3A 3QG1A 3MFYA 1E3MA 4BPBA 1TU4A 3AH8A 2OLJA 4UNNA 2BMJA 2ZJ8A 2FSHA 5GJCA 3O8RA 3NBXX 5IRCD 3TW4A 2HT6A 1G64A 5FBLB 2BCJQ 1OIXA 1KSGA 4B2PA 2SHKA 5FOUA 3DMDA 3LXXA 2F55A 1G8YA 2OSBA 1ZUIA 1XTSA 4C0AC 2AD1A 2YYZA 4TQAA 1GG2A 1X3SA 1R5OA 4NYIQ 4O0MA 4CF7A 4RCYA 2ZXUA 1MH1A 2BBTA 4DT1B 5J4HA 2MSDB 2D4HA 2WWHA 4ZKEA 3HR7A 5FOXA 3I61A 4HAWA 1UM8A 2WIAA 4RFVA 2G88A 1XTJA 2OM2A 1ZINA 5B30A 3NH6A 1NMYA 2I1QA 4JIMA 2GEUA 2CBZA 2NO6A 2IYRA 3K09C 3UATA 1XTKA 4ARZB 2NG1A 1WDTA 4KYUA 3CF0A 2PH1A 3IBYA 2BIFA 3PVSA 2WHXA 3QXCA 2OHFA 2DWOA 3AKDA 3KJEA 3WBJA 1CR0A 2IWHA 1NBMA 3TKLA 1HE8B 1E2IA 3KKPA 2ODNA 5DHAA 3I92A 3TQFA 5JJKA 4PAMA 4PSKA 5B57C 3EPJA 1XD2B 3DDCA 4DSOA 2ZANA 3QXHA 3BC1A 2YJTD 1WE2A 2FGJA 2GF9A 2HV8A 3BD9A 2J0SA 3Q7QA 4NCJA 5C4MA 1WXQA 2BBOA 1W4BA 3C14C 5D3MB 4OQFA 2GVDC 1ZNXA 4Q9KA 5FTMA 1EFCA 3NTUA 1C4OA 3W8NA 1DS6A 3EZ2A 1N6OA 4Z1MD 1IQPA 4B75A 3MSXA 4OYHA 5KSZA 1G7RA 2MSEB 4BRUA 1S8FA 4AIIA 2IA5A 1OF1A 5IHPA 4D26A 1P62B 2QE7D 3QKSB 3LBIA 3AVYA 5J47A 5L3SB 1ZM7A 4A8JC 1QG4A 1NG9A 1IM2A 3OAAA 3FB4A 4V0LA 2QROA 4GNKA 2NMVA 2PMKA 4CEJA 1N5JA 1OPXA 3HYTA 4LJAA 4PANA 4Q21A 2GK6A 2QP9X 2XTNA 4Z54A 1TF2A 5J4VA 1ZYUA 4FWIB 2QTFA 3PENA 2QSZA 5IK2A 5JSZA 2W6JA 4AI6A 4LHWA 3TRFA 1GIAA 3FGNA 1A82A 1XF9A 3RRMA 1VCMA 2G83A 3KJIA 2WICA 2O8EB 3R9WA 1DVRA 3K0AB 3TJZA 3GP8A 1E9FA 4DLZA 2GK7A 4MYCA 2YOGA 2WWIA 5DI9A 4GZMA 4A8JB 1YZTA 2EFCB 2ZR9A 2HXYA 3P4XA 2VHUA 5HPYB 2H57A 2XGJA 4F93B 2JJ8A 3NVAA 1ZIOA 1KY3A 1XJ0A 4U5XA 4EPWA 1U81A 3A1WA 2O0JA 1Z8FA 1KZ7B 4GOXA 1CP2A 5C18A 1I4DD 2VHTA 4DCSA 5LDDC 2JLZA 5FUXA 2IYTA 3QF7A 4TYYA 2CLDX 3IPYA 2QTVB 2QG6A 4HAVA 4JT2A 3ZVRA 2CJWA 2WWFA 4X8MA 3WBKA 4BEJA 1N2CE 3RVBA 4QBHA 4DCNA 2PT5A 4Q48A 3I3SR 3OEED 4PO1A 3SBEA 2LKDA 1SVOA 4RKEA 1OE0A 3QF4B 5AUQA 1VPLA 4EPVA 3QUSA 1H8EA 1RRCA 4DVGA 4HZUB 4G1UC 1R5BA 4HAZA 2VSOA 1OIVA 4MH0R 2FSGA 5DE3A 1E2GA 3B1XA 3E5HA 4IEEA 3LW8A 3E1SA 1YR9A 2P6NA 2GJSA 2ZJZA 3FVQA 2Z0MA 1SXJC 1OXVA 1TQ2A 4UJ3A 1R8QA 4H1UA 1JXMA 4P33A 1PZNA 5EE5B 2CCKA 1G291 3EZ9A 4A9AA 2NIPA 1W4AA 4MRNA 4G5QA 5JS8A 1Q1ZA 5B58C 3CKLA 1RRFA 1KOFA 3VHXA 3K0FB 3QKRA 3GEIA 1RFLA 4JL8A 5JI2E 1R7RA 5TDHA 3IBGA 2DFKB 2A9KA 2VHCA 3IIKA 1J8YF 3THXB 4V0OA 1NRJB 2O8BA 2GXUA 3CF6R 1G7SA 1CLUA 2WOOA 3CUEF 1QVAA 1PVOA 4L9WA 4KYIB 3ZD7A 2CE2X 1FTNA 1K6MA 2ZR7A 2W0MA 2YC4C 3B5JA 3EAQA 5LD2C 1SXJB 1VG9B 3GJ3A 3R7WA 2FJUA 5DHFA 1I2MA 5B64A 1IXZA 1NLYA 1FNNA 4OL0A 1FX0B 1RJ9B 4EIWA 5SZJA 1YJ5A 2FSFA 1NY6A 4M1YA 3BERA 4DB4A 3GMTA 1DTSA 2D2EA 4RZ2A 3Q3JB 2GXQA 4XIGS 3Q9LA 5DI3B 1XFAA 1FNMA 4ZIRB 5JFGA 2WSMA 4TTPA 1D2MA 5F9HA 1CEEA 1F5NA 5G41A 3C8UA 2JAQA 2C98A 1G17A 1YHNA 4TYQA 3BE4A 4MKIA 5JJIA 3KB1A 2EFDB 4IVQA 3RANA 4HDQB 3PJRA 2XB2A 3CWQA 3LNCA 3CPJB 4QHTA 1T6NA 1T3HA 5HCIA 3AVTA 2QAGA 3FMFA 5LD2B 3OF5A 3FKSA 2ZE7A 3TIFA 1TEVA 2JLSA 2P5TB 1JB1A 2IUSA 2ONKA 1U2RA 2RKOA 4B76A 2GRJA 2O8CA 1P9RA 2L0XA 3TQCA 1JI0A 4IFBA 2CMKA 1PUJA 1G41A 4WXRA 3QE0A 3GLHB 1W0KD 2RGBA 3A4LA 3KXKA 4Q9JA 4DKXA 2PEZA 1UKEA 3M6AA 2JGNA 3W5IA 3H4MA 4IOLA 3LD9A 4RKFA 4TZ6A 5B2ZA 3PEYA 2GHIA 2FPMA 3K9LA 3CM0A 4OK6A 3MJHA 3MJRA 4TWZA 4P31A 5DSZA 3SE0A 4IOMA 4Q02A 1KAOA 4OHVA 2D62A 2V1XA 1IY1A 1E96A 1P5ZB 3OEHD 4I1OA 4BRWA 4I1VA 2C5LA 3IGFA 3ETLA 1NG1A 2JJ1D 1X86B 2IK8A 3WY9A 3LQRA 1IONA 4TL9A 2BM0A 2VL7A 4W7SA 3WRYC 3HU3A 5CIWA 1XP8A 3VNUA 3GD7A 1OW3B 3BIFA 4IRUB 3NC0C 2OLKA 1NN5A 4PZYA 3U61B 2WKQA 1XEXA 5E7MA 1RPZA 1LW7A 3AVPA 4HB0A 4EJSA 4CZ2A 1YRBA 3GJ8A 2F43B 3GJ0A 4E5UA 1MABA 4FMDB 4Q4HB 1GTVA 1JR3A 2CHQA 1YZKA 4PC6A 3L0IB 1RYHA 2QSYA 1DARA 4Q4AA 4ESHA 3EIEA 4WZAE 2JLUA 3EARA 5CITA 4POAA 2WSSD 3ZLJA 4Q1FA 2J0UA 4I81A 2QGNA 1JQJC 1RYFA 1P2TA 1VECA 4F92B 1SVWA 2F6RA 3CX8A 4V0ME 4LBZA 1SHZA 2IEZA 1BS1A 3I32A 5E3HA 2GJAA 5HKKD 3IEVA 4AY2A 3X1ZA 2WPDD 1KSHA 3PUYA 4LDJA 3SYNA 1EGAA 2EYQA 5CK4A 3GLGE 4DXAA 3QXJA 2XX3A 1GRNA 1W0KA 3BGWA 4IOKA 4A2QA 3U7HB 2HYIC 1RIFA 2W6ID 1BH2A 4FD2A 3F3YA 2VO1A 4IFEA 1E0JA 2FFBA 2YWEA 2GTPA 3B8HA 1GITA 2EQBA 2FEMA 1KI2A 3ZZ0A 2C95A 3IQWA 4BECA 3TUZC 1M7HA 3CH4B 4PSAA 4DBLC 5L3QA 4YC7A 4KFTA 5DIFA 1LVGA 4BLPA 2JJ1A 4QGFA 4XH9B 4W9MC 3GJXC 2HYDA 4Q7KA 2XNSA 2B7BA 3K9HA 3A6PC 2A5JA 2GAAA 2WBLC 5DO9A 3T61A 2ZU0C 2IYZA 4Z8YA 4A92A 4QBGB 3NHAA 1PUIA 4AYWA 4EPRA 1EFUA 1M74A 2PX0A 2CNWD 2OE2A 3PITA 2KWIA 3VU9A 4YMUA 1ONBA 3AM1A 5EE9A 3AVVA 1COWD 2J7KA 1JAHA 2ZJAA 4RJLA 2R44A 3BB1A 4C0SA 3BRWD 2HF9A 4FMCF 2A5GA 3PEWA 4QFMA 4XWKA 2FEOA 1N0VC 5KSPA 1EX7A 2V9PA 4WZBE 1NP6A 2AHOA 2VBCA 3UG7A 1E2MA 1M8PA 1LS1A 3FMOB 4UXIA 2RGNA 3SHWA 3SOPA 3D8BA 6Q21A 5JS7A 2VF7A 4G5OA 1I4TD 1C1YA 1KSJA 1KI7A 2WJIA 3E2IA 4B3XA 1UAAA 1OHHD 2O0KA 3B7GA 1Q1EA 2ERYA 1G1MA 3R9XA 1ZUNB 2QMUA 2KBFA 4N3NA 3IIJA 2H16A 2WPDA 5JI3E 1G8FA 2BMDA 1Z2AA 5L8VA 2CXXA 4LK2A 3U3KA 1A5TA 3AGPA 4A0RA 3UKDA 1GRRA 1KJWA 1UPTA 2JJ2A 4JVSB 4MRVA 5FL3A 2IX3A 3SJZA 1B23P 1IN5A 1GAJA 4KODA 1Q22A 3BB4A 721PA 1OSNA 5KUTA 4CEJB 1UJ2A 5KHOC 1TADA 1XMIA 2F7SA 4FXPA 3SQWA 5AUPB 3M4YA 3DL0A 1G3QA 3WYGA 3ZJYA 1ZP6A 2QQEA 1P73A 4M1OA 4U00A 1KYIA 5H68A 2H7VA 1OH8A 4TYWA 4HB2A 1XXHE 3FKQA 3U3JA 3TMKA 2DBYA 2BDTA 3JVVA 3B78A 3A58B 3KKOA 1Z6XA 3CWZA 3MRSA 4XWOA 5CDFE 1VG1A 1X1RA 3KZ1E 4LSGA 1COWA 2A2ZA 5KDDA 5GJWC 5LB2A 4NYIR 1D6JA 3LLUA 1CR1A 1U94A 4XSGA 5EXPA 5EXXA 2VTKA 1J99A 1XJCA 3DMNA 1WB9A 4WXPA 2HXSA 2YVUA 1G4UR 2R6GA 2ZI3A 4TMKA 3VKGA 2BEJA 4TLBA 2NGRA 2V55B 2CJWB 1IJFA 2VLIA 3D6TB 4MRSA 4TMWA 1R0YA 4YXWD 1FQKA 3SYLA 1WP9A 3Q5DA 4L15A 3QVUA 3BJIC 3W9YA 1GL7A 1N25A 1SXJD 3SR0A 1GDDA 3RS7A 3NXSA 1E4VA 4LHXA 3QEJA 4TMZA 3HYRA 1JECA 4PO9A 2MMCA 1E9CA 2DPXA 2EFEB 2PZGA 3RLFA 3V4RA 3MWJA 2XAUA 5CM8B 521PA 1ZD8A 3PFIA 4ESVA 5FPSA 2N42A 1OH5A 3ADDA 4AD8A 2IS4A 5JLJA 2ZSEA 4X8HA 1E9RA 2R2AA 3OFND 4F4JA 1W47A 4MGZR 4OI4A 1NJGA 5EE0A 4A0GA 5FBVB 1IOZA 3R9IA 5KNCA 3A1SA 4AG6A 2PCLA 4ZO4A 2CHVA 4M53A 1LFDB 3QKRB 4RZ3A 3K70C 4RD0A 5EXSA 1FZQA 3TVDA 1NVWQ 1RZ3A 2ZRAA 3KQLA 4NONA 3VR1A 4P4SB 3Q85A 3BB3A 4ITRC 4U02A 1RC8A 2O8BB 1VHTA 1U8AA 3CH5A 4FW9A 4GZLA 1JEEA 2IYVA 2QENA 3K0EA 3LFUA 3T12A 1JR6A 1KKLA 1W4RA 4LUCA 3EPKA 4KAXA 2GZDA 3GLIA 2QAGC 5J4LA 3NDPA 1E9SA 3R7WB 1XPOA 2DB3A 4NMMA 3KKQA 1ETUA 1W2HA 4BZPA 3ADCA 2Q3HA 4P32A 1E1RA 2B6HA 4AYXA 5TMPA 4RD3A 3WYAA 1NSFA 3X1WA 2R6DA 5BN5A 3F8TA 3RWOA 4LCBA 2E9SA 3K70B 3X1DA 1LY1A 1E2NA 2Q6TA 2XTMA 2ZSBA 4ASUD 1MT0A 1SXJA 1QF9A 2AK3A 4DJTA 1Q3HA 1TUEA 3REFA 4DSNA 3ND8A 3N2IA 1U98A 2PL3A 3ND9A 2DHRA 1W0JA 1L2TA 3AEZA 3X1YA 5CYOA 3VR3A 2QM7A 4LJ9A 1R6BX 1IBRA 1R8SA 2QAGB 1CKEA 2YWFA 2ZRJA 4BFTA 1J8MF 2OCAA 4Z8XA 5K8TA 4G01B 4TLAA 1G8HA 2J3EA 3C15C 1GL9B 4DLRA 2OT3B 4MDFA 2O8CB 4HZIA 2IXFA 3LAWA 3I4LA 3QNUA 4R2IA 2JCSA 1J90A 1XU4A 3ZIAA 3PR1A 4PXAA 4C0LA 3KQUA 1M1YE 2KBEA 4ZKDA 1KMHA 3CLVA 4EJSC 4ZI3A 4J0QA 4I1SA 3PQCA 3TR5A 1ZNWA 1KI6A 3VKHA 2VP2A 3HPQA 3KTAA 3M1IA 1LB1B 4AURA 3DM9B 5DLQC 4EPTA 1CRPA 4NH0A 3I72A 1KO4A 1GRQA 3CPHA 5KOYA 1DG1G 1N6RA 4X8OA 4LJ6A 8OHMA 2Q9AA 3O8BA 3MWLA 1OB2A 2B8TA 5KPDA 5JHGB 2BWJA 2JLWA 1XEWX 5EP2A 2CCJA 2AN9A 3B1YA 1XEXB 3P4YA 2ORVA 2R6CA 1VYUA 4PC1A 4B2LA 5TY0A 3BBPA 4ASUA 4EJSB 2QA5A 2REXB 1NF3A 3U5ZB 1NN0A 4ZDIA 5BN4A 3AQ4A 1MABB 1QVRA 2BC9A 2RCNA 4NP6A 4B3BA 1HQCA 2P6UA 3DM5A 3AGQA 3SZRA 2HLDD 4RD2A 5BXQC 1LNZA 4Q4AB 5FTLA 5KTYA 4DLSA 2WJYA 2YV5A 4V02A 3UWOA 4I1UA 4Q1DA 4JLAA 4KV9A 3Q72A 2DCUA 2J0UB 2KE5A 2ERXA 4JBXA 4UQOA 1W7AA 4DB2A 1NBMD 4WBSA 4JVMA 3UG6A 1S9HA 4Q4HA 1QZXA 2AKYA 2J0VA 2FPKA 4LV5B 4AYTA 4DCTA 4N0DA 2Q9CA 2XZLA 1NLFA 1OH7A
chains in the Genus database with same CATH superfamily
3WZMA 3JSXA 4MUIA 1J21A 4GPD1 5HF9A 4EZBA 4UUBA 5HUQA 4ND5A 3HVHA 3HCPA 4IG4A 1XQ1A 4I1IA 4GO1A 2AEFA 4DDVA 3GAZA 3NAQA 3O8NA 5IM4F 3A1VA 1X1AA 5KQSA 1Z2DA 1TF5A 4XGIA 4ZZ3A 1ZCJA 2VA8A 3QVMA 4GVXA 2QRZA 5C46F 4LF4B 1XAIA 3TQTA 4JYZA 3QENA 4R8RA 1QYVA 2ZM5A 2CXPA 2GARA 2W2XA 3VU3A 1XQXA 2RGUA 2NO9A 2ZRKA 3WMFA 1K3FA 4CF5A 3KFXA 2NUAA 4OGLA 5CXXA 1N9GA 2I2DA 2B20A 4UM5A 1WV0A 4KQHA 4MQBA 3SEQA 1Z47A 3FAZA 2QVYX 3OAAD 4ITUA 2VT2A 4TM8A 2WMDA 2BDUA 1E7MA 1ZUHA 1VG8A 3OU7A 3RYIB 4YALA 1U1GA 3BMNB 1PIWA 2OG2A 2PN1A 4WY2A 4AP9A 5IBPA 3RJTA 2WINI 3SZGA 1M2VA 1OWMA 3AJEA 4P83A 3SS9X 5IAOA 2PZLA 2XB9A 1N57A 3QXXA 3P52A 4BKUA 4HDSA 2HBYA 3AL0C 5J23A 4OQLA 3OICA 2ZCJA 5EP1A 1P2FA 3U26A 3RS3A 1Z3IX 4OH7A 2GN6A 3EGEA 3FNQA 4R4JA 5DYGA 5CGQB 4YCLA 4QPCA 2HLDA 3QNMA 3OLZA 4XYEA 3EJ6A 5DNWA 1RLUA 1U0GA 3JRNA 2ZRHA 4FFMA 5HVNA 3THRA 1QU2A 2YVKA 4GGPA 4JUCA 4G0XA 1UWVA 3AVOA 2PDAA 2MTBA 3WLIA 4Q3DA 2KLHA 1HOXA 3WGVA 4EHBA 4B74A 1YRAA 4BV8A 1LEHA 1MJGA 4L22A 3N6XA 4NZPA 1Y3FE 5F4BA 5I8WA 1H94A 1V2HE 2ZAGA 1PV2A 1KYTA 2FMXA 1XTIA 4TQGA 1U80A 1G55A 4JLVA 4YGXB 3TLMA 2WU4A 5HKAA 1VKNA 1N1MA 5FULA 1XT6A 3LCUA 3LKZA 3GH1A 3W4IA 3BHMA 1U0HC 4GKJB 4MQFB 3T52A 3DE6X 5AKGA 1DAIA 2X15A 4EUNA 1S2LA 3L7AA 4MHSA 4RFLA 4JDPA 5EL0A 3U3ZA 4ZYVA 3ZWBA 4F72A 4A0HA 3N1UA 4M9RA 4E4TA 3L7LA 4HNAA 4K8OA 5HJ5A 2A7XA 4MYRA 4X8LA 2FPOA 4LW8A 5ALEA 3H9QA 3NCHA 3UJ9A 3O75A 4XD2A 5IS2A 4DLYA 1ZC4A 2FVYA 5JATA 3KALA 4YV1A 1V3TA 4DRZA 1YB7A 5EZQA 5ICMA 5HTKA 4YS6A 5BQXA 1UQRA 4C0QC 3ONFA 4JSYA 2IVFA 4IXNA 1QHNA 3SBDA 2IEIA 2FN7A 1QH8B 1JSRA 2A35A 3L7NA 3KR9A 1ABFA 4GVLA 5JASA 1GNRA 4MR9B 3NHRA 5CT9A 3BXEA 1RJFA 4I4NA 1PJ8A 4INOA 3S68A 3THWA 4K0RA 1X8JA 4AJIA 3D1LA 3GQBA 3GEHA 2IOQA 2L82A 4QG7A 1AGYA 3AHIA 1RPNA 1M6NA 3CZ4A 5JVDB 4BJHB 3T5DA 1DIGA 1PU2A 5BSUA 2I3GA 2P3SA 2XJ4A 4UPVA 4CLRB 4EELA 4RPLA 1GRCA 4MVJH 4RAOA 2CD9A 5IN4A 4S24A 4FMDF 5T67A 4NSNA 5DFAA 2XUIA 4LRWA 5JCXA 1PFGA 2B8NA 3RC8A 1C9JA 1M2OB 1O3YA 3C4JA 2NTYC 3BFJA 3FR8A 4R41A 4WK2B 2EJWA 1BHO1 4XIIA 3EGIA 4LXUA 3TE7A 1TA9A 1VLMA 3LDFA 3N2GB 5K0SA 1OBCA 1JE1A 1ZOLA 5JFOA 5F9FA 1MOQA 1RWBA 3UTCA 5D86A 4K9LA 1QGAA 3RVKA 1GGEA 2X5NA 2H85A 4HDRB 5GAJA 4Z0TA 4J0FA 2IV7A 3RUEA 5KMGA 2UUAB 5C52B 1G21E 2P79A 3DLAA 3Q8KA 4X6YA 4BVFA 3O1HB 5FT9A 3AHGA 2W37A 1DUIA 4AS1A 4EGQA 5EA2A 4FS3A 5GMOA 4ZGBA 2N1MA 5LA6A 3ER6A 2OAP1 3ONNA 4JT8A 3ZDFA 1A7JA 1S1CA 4QLAA 3RC9A 1DDIA 1T3TA 4DTCA 1Z7YA 1NNEA 1K2VN 4MGIR 1PF7E 4YB8A 1HNXB 1P60A 3TPCA 3ZI4A 1D4FA 1H1LB 1HXHA 1Z9BA 4K2AA 1RZRA 4M0EA 5DOZA 5ILQA 1TZMA 2DR3A 3AM5A 3RK0A 4DXDA 4LMRA 1TO1E 3GA5A 2RGRA 1U9IA 4U2BA 2E37A 3JQAD 2G67A 4NZNA 1M76A 2PRKA 2OCLA 1AKWA 4KVGA 4D4JA 3DWFA 3NS7A 4B44A 2GJ8A 4L4UA 3RVLA 1KVTA 4R05A 1G5PA 2O48X 5EKUA 1KI8A 1Q0QA 3Q0EA 2CEKA 1QHSA 1UJBA 1XDBA 4IDEA 2BMVA 1H2XA 3RVMA 1U8ZA 5KBYA 1L5RA 1ZMRA 2Z8YA 5C1OA 4R1QA 4EYEA 1F2UA 2R5WA 4ND8B 3PBKA 2AR7A 3X1KA 2B92A 1PHRA 2EC5A 2WWTA 1JEOA 2BGTA 5ERXA 4ODIA 3KKNA 1Z5WA 4LZLA 1QDLB 1ZI9A 3G0BA 1ZA2A 3PYMA 5DGXA 3IUPA 3N9IA 4M55A 2ZZMA 2GHQA 5BVHB 4P4SA 1O96B 3PWZA 1H4VB 3VPBA 1SH7A 1VC2A 3ZK7A 4AY5A 4ZPJA 2VP5A 1B73A 2WSYB 3DS8A 1CQJA 3OX4A 1RHRA 4WI1A 1BFDA 2ZIAA 1K89A 1M6YA 2V6IA 3RRYA 3H2YA 1JFFA 1YZGA 2Y1OA 4O4IA 4X60A 4Q82A 2ZJBA 2OPHA 1WXEA 2HI0A 1BCSA 1SELA 1GTG1 3L8MA 4YO7A 4Y1RB 2RH9B 3B36A 3UAXA 2RD2A 4EK9A 4B6FA 5D2CA 4H60A 1CW2B 4FYJA 4BZQA 1AZTA 1KEKA 2QW8A 4B9EA 3EVAA 3LBFA 3RFXA 1XPJA 5JYDA 1LXCA 4FHZA 4B3GA 1KDRA 1VCNA 1LV7A 1ISFA 2NLOA 4PN7A 2GR9A 3KZVA 3GCGA 3Q4GA 4JJKA 2B9EA 4W5JA 4B40A 4MQLA 3W2HA 4C3UA 4EY8A 3KAPA 4P4UA 1XR3A 3TOCA 1LLDA 2A7QA 2Y66A 1M2GA 4JLNA 4XFDA 3G85A 3NBMA 3BQMB 4U5QA 2DPMA 1EG7A 4ND3A 1T9AA 3ZCVA 4JUDX 3QU7A 4RACA 1FBTA 3BSWA 3RRFA 1NI4A 2NVOA 3VNSA 4KAJA 4EP1A 1KMCA 1EP3B 1HC7A 2EG9A 1KEPA 4YRJA 3UT5A 2C58A 4KUHA 3SU8A 4FEEA 5A2GA 1I32A 3CLRC 1PEKE 4QXRA 5LZ7A 2JGJA 5JBQA 1QH1B 2IEBA 1GFZA 2XUJA 4PZAA 1ZEMA 3QBDA 4OPMA 5FI1B 2DBRA 4C78A 1FP7A 1P1CA 3ZWQA 2SCUA 3DBHB 2CMGA 3V2UA 1MR3F 4C4XA 5D84A 3JATA 1W29A 3UANA 2R47A 2VT7A 2YJ6A 1UT5A 3AR2A 4IDCA 3VC1A 4D0LB 4CEHA 2XF2A 5DDIP 2WIBA 1NMZA 3N2EA 2XAAA 1UMCB 5BN1A 1X7ZB 1YBFA 3O0TA 3GUHA 2FDCA 3SFVA 4EUSA 1PVVA 4N9QA 9GPBA 4YXFA 1O0CA 2FX5A 1VPEA 4AMVA 4UVEA 5AI8A 1H66A 1ZJYA 3DV0A 1MG5A 2OESA 4DQVA 3QX8A 2BGUA 2V9ZA 1XZJA 2F1JA 6REQB 2PTGA 1G8JA 3PUVA 3IKTA 2F8TA 2BGIA 2YZKA 1DG3A 1HI9A 4EKNB 4KN6A 1U8TA 3A10A 3AR8A 3DZCA 2YMLA 4A15A 3U31A 4ZPXA 1JDNA 2DUMA 4NV0A 2P0EA 4J1NA 1HT1E 1ORIA 3EBPA 5J5VA 2ZSHA 4ILEA 3ZKWB 4EJ6A 3DBRA 2F17A 3J81A 1IN8A 4KITB 1MQAA 3BJRA 1T2DA 2I4RA 4P7BA 5C8VA 1BZYA 2YYYA 1ARZA 1K97A 1GZ3A 5EFZA 2R8RA 4ZYWA 2Y67A 4MW6A 2A8YA 4LQLA 4U7GA 1DPFA 1IAQA 2R97A 3VR5A 3EC7A 5AVOA 1YDHA 4RMIA 2H29A 4II7A 3ADOA 1W8IA 3LGXA 1M2NA 1X9HA 1LQ2A 2NOAA 1EK5A 2IELA 1N6KA 4GPBA 3Q2OA 4LSWA 5IEJA 2PKCA 2BRUA 1NW9B 3H99A 1ZCAA 1B93A 3S1AA 3EUEA 4BNIA 4RHXA 1AB6A 5DYIA 3ZK8A 1P0IA 2F9MA 2VSNA 5HYVA 1USIA 1BGXT 4YDRA 4HNSA 1Z88A 3R3WA 5KKAA 5EVJA 2MHCA 1BS9A 1F0KA 1LPBB 1ZU5A 4LVUA 3T7TA 1XL1A 2ZJ5A 4R69A 4C4TA 3QIAA 2CCGA 4K9NA 1S89A 3F7TA 3ZWAA 2IPLA 4D56A 1L5KA 3PJDA 2NUAB 3NNDA 3BSFA 1OLSA 1N9GB 3GUUA 2Q7XA 4XDGA 3QSYA 1FJXA 3IEXA 3QBTA 4P5PA 5IDVA 1ORRA 3KXLA 3V97A 1XC7A 3DCYA 3E3OA 3EWSA 5ALLA 3BXPA 1S8NA 4L8WB 4J6EA 3VBEA 3O8OB 5BV1A 3O94A 2ORED 5I8PA 2Q8NA 3A6FA 3NASA 2CDBA 2DY1A 2FPSA 1M2VB 2R1UA 3ZGZA 4HQFA 3W8EA 3LY7A 4EENA 4LZZA 1ISPA 2JGMA 3KPYA 3ZCXA 1MC8A 2QRHA 2LIVA 4B3IA 4HDSB 1Y8RA 2MSCB 2C78A 2XJ9A 2NSLA 4ZVLA 3AETA 4NWIA 1PLJA 3EGDA 3NANA 3I9LA 1P72A 1K5PA 4ILKA 5EIAA 5T4EA 3BK7A 5E7IA 1KEZA 5BRNA 2IPXA 4G9BA 1NZFA 1JLKA 3EEYA 4WNCA 4ZEOA 3ZXXA 4PAQA 5FUWA 3TZQA 3Q2IA 1VI2A 1LBQA 3E2PA 3PVCA 4EARA 1CJBA 2JATA 3N8NA 2GA8A 4XB1A 1UMBA 2R9VA 4QO8A 1ZN9A 1CJKC 5E3JA 4ZQCB 2EAUA 4X6UA 3I9NA 1TTQB 2G36A 2P4HX 1PD0A 5E3IA 4F2PA 5LLDA 5F3DA 3ZDCA 1GILA 1SXJE 1ZN8A 2JCVA 3IQXA 3L7JA 1IWPB 3I6MA 3L1UA 1F20A 2C99A 4WA7A 3RSOA 1ELOA 4M87A 4B3DA 4DIDA 1T2EA 4BLVA 2R1TA 4MCHA 1TKBA 4N82A 3C6MA 2VJDA 3E7XA 4ES6A 3Q3CA 5HR5A 4Z51A 3I01A 5HGJA 2OAEA 2ZI7A 3EGXA 2BGMA 2ODPA 4FGWA 1Y8QB 2D54A 3IOBA 4MI6A 1JG6A 1J06A 1H0KA 3P4UA 4HNAB 4O25A 4XEHA 5EG5A 3WP1B 2QDXA 3D5EA 4HB4A 3JQ8A 1H23A 3DVSX 4DDUA 2I65A 2NT4A 4GX2A 4K9MA 1QDEA 4A27A 3V32A 1K4YA 1JBQA 1HSZA 1OCEA 4TL8A 2J9RA 2REQA 1K7XB 3PDUA 4NCIA 5BSFA 1BJKA 4CLDA 3CEPB 2D0DA 2W6NA 1G20E 3G8YA 4FYWA 5A3VA 3GFRA 4BNMA 5HZKA 5LN1A 1C2YA 4RX1A 4KQXA 3EZNA 1NBEA 3DFMA 5F2EA 2D1TA 4CGYA 3K96A 2I55A 3BN3A 1NBIA 1N0UA 4Y1GA 5D01A 3GRCA 1TJYA 4CDMA 2DUJA 4HQKA 3CSUA 1V9SA 3M34A 3BJZA 1E1NA 4OK5A 3NHLA 3THWB 2GKSA 5ALGA 2ZAMA 2LCFA 4N48A 3DLBA 5A71A 4I46A 1YVRA 2WP0A 3SS8A 4I5FA 2IZ5A 4KKVA 4ZEMA 4OFBA 3E9MA 3AF4A 1XQ6A 2CE7A 1XZMA 3P9IA 1W94A 4G97A 5CMLA 4AJKA 3KQTA 3QUAA 3LY5A 3T3IA 2FEPA 4FDTA 3GUYA 3L7DA 1II9A 5KDLA 3OPNA 4GG1A 4LDPA 3ROEA 2I91A 2PUDA 5TQJA 5CB4F 2CFOA 3DHVA 4U6SA 4WLVA 5EZ6B 2O9JA 5E95A 3QE3A 1I3KA 3NCTA 4KP7A 3TLCA 4D2IA 3MT7A 4CT4B 2IW3A 2PUVA 1U9IC 3BXZA 3ECSA 1LK0A 1Z5GA 2NO0A 2RG1A 3I2HA 1SQSA 3QSGA 3BWXA 2PH5A 1SVUA 5EZ5A 1VMKA 2FLKA 3Q98A 1AKYA 1DIHA 1I2ZA 4H6XA 3K0CA 4IHKA 3Q7EA 1PSDA 5KMGB 1KKUA 2JKVA 4MWCA 3WTCA 1T5BA 3FMGA 3I64A 2X2FA 3ET4A 5ENDA 4R2JA 2PV7A 3UQZA 1ACMA 1ZC3A 1YOVA 2I1WA 2R68A 1OXTA 4HQOA 1Z07A 1XDUA 4LEIA 2BE9A 2WSBA 4X64B 3ML1A 5KHLB 4Q66C 3QA9A 1BXZA 4GBED 1T29A 3KEOA 4FNGA 3PICA 1ESMA 2VIIA 1YHZA 1WMBA 2JDID 5LA6B 3SAJA 4UDOA 1BXRA 4IM7A 4LYEA 3IESA 1KK3A 5KO2A 4WT7A 3VXKA 5KWVA 1DO2A 3V6MA 1T13A 1W5BA 2FP3A 4WH0A 3VR2D 1RI4A 2LUOA 3SR3A 4E14A 5TLSA 4M7PA 1V45E 1AKQA 1VLJA 3NO4A 3OSUA 2GCPA 1CE8A 2H8GA 4L9SA 2PKQO 4EWLA 1GG5A 1I5EA 2YY5A 1T1RA 2C2YA 3FUVA 3ORRA 2EBWA 4QREA 4UU1A 3RIXA 2A0KA 2G6TA 1QVWA 2V6MA 3U3OA 1IN7A 5JXHA 5BV0A 1W48A 4IWNA 1NQXA 4B2IA 1G19A 3KKEA 2NSJA 1QYRA 2ASVA 4FU0A 1OKKA 4KQEA 1L5LA 3T94A 4DANA 2EW2A 4ONEA 4EZIA 1PJZA 1ZS9A 4BP9A 4R84A 2G9NA 2HM7A 1P7CA 3ISJA 3WNDA 1GPAA 1F2UB 1Q6ZA 1T15A 3LW7A 2FUNB 2JPDA 2X3FA 3HVIA 4WZAA 4KX5A 5AW8A 1YQDA 3PNLA 4CI0B 4QJ3A 1ZM3A 5TMEA 1BS2A 3KVYA 5ALHA 4BZXA 4EBFA 1N78A 1NFRA 3DZDA 3R5HA 4JT4A 3WK6A 1BDBA 1GZUA 4F60A 3TI9A 4Y6OA 2EEPA 3T9DA 1IQUA 7AT1A 1CQJB 2VQ3A 4UTVA 4CGZA 2A88A 2VT6A 4JU8A 1X1BA 4RVNA 1JFFB 3QEMA 2QUIA 1D1PA 2XOKA 4FFRA 4ITVA 4IUBS 3MPOA 5DBHX 3VKVA 2Z1NA 1NZDA 5FWXA 2Q49A 4TRMA 2DFTA 4B6OA 1BCSB 2XHEA 1IXSB 3H8WA 4C06A 1VJ0A 1A77A 4WJLA 1UXOA 1JFLA 4F3KA 2RIPA 2H4YA 4Q7QA 2IV3A 4D4LA 1ZJWA 3TCNA 3C3PA 4PNZA 3I9V1 5CGZA 1V5FA 1CUFA 5DLEA 3EULA 3ES9A 3L6UA 1BKSB 2VHYA 1Q7GA 2WIGA 1WBDA 3KUDA 4JR0A 1DIRA 5CCEA 4Z7QB 1DWQA 2Q9BA 3QI2A 5AK6A 2CNNA 1Y1TA 1GARA 2FLVA 3OLVA 4PYQA 3UK0A 3WGLA 4DBLE 1A2QA 3C3KA 4ZAYA 2PBRA 5FR2A 2PUBA 2JLRA 4UMDA 1N5IA 1IG3A 1NI4B 4MVJI 3DT9A 2YINC 1W1WA 1HFEL 3UT5B 1MX1A 4E4YA 2VF5X 1OZFA 3ND6A 1OAKA 1E5VA 5EUQB 4BC1A 4DCCA 3NC1C 2AD5A 2AYXA 1UKBA 1V2GA 2QD5A 3ITNA 3N39C 3A1CA 3UQYS 3IHWA 4YAKA 3EVGA 2SCUB 2HU5A 1C14A 3ZW7A 1BX3A 3MWFA 3PHLA 3E4DA 3VSCA 4ER7A 3JATB 2AN4A 4EY5A 1GLGA 2X0IA 4C0JA 1CRWG 5JVDF 3EWIA 3VR6D 3RNLA 4BJ3A 3KTDA 4BL5A 2X7JA 4CEHB 1YMUA 2P30A 2C7VA 1JEAA 3DQQA 3Q5GA 4TT3D 1UFKA 2BEVA 3ABRB 2G1KA 3RREA 3F6SA 3V48A 4YYZA 4RE6A 1JZTA 3HYLA 3AW8A 2UZAA 4C0BA 5JD3A 4KL8S 1NVXQ 4XYGA 2EW1A 1IZ7A 1UK8A 1B0AA 1KY5A 3EFOA 2PBZA 1TVMA 3WSTA 3IOCA 2A78A 4QJ4A 1NN1A 2QRMA 2VFAA 3DV0B 2BRUC 1OREA 3HDGA 1OYOA 3DC2A 4YP9A 2FFHA 3DEYX 2IPAB 2JFBA 2P91A 4CV3A 2AWOA 1AMUA 2P2GA 2GETA 4FYKA 4OSOA 4O5OA 5AVWA 2QNRA 4XAQA 3DBRB 2PD3A 3DLTA 4MGHA 3WK4A 2J7PA 3L0OA 3M6FA 1L5VA 3F98A 4ABYA 4LOAA 1J24A 3ZCRA 1V26A 3IQGX 3OQBA 3GEDA 5JW6A 1SD2A 1XB2A 1FDRA 1XEAA 1P45A 2B5VA 3DLCA 4HUJA 1PP4A 4K0KB 2PFGA 1VMIA 3DEAA 1B1AA 3PT5A 2G06A 4L0QA 4MCIA 2AOXA 3KPVA 3K35A 3KOXA 4AO8A 5JYEA 3R0JA 4EMTA 1Z4MA 5KVCA 4C4YA 4OHBA 1SU7A 1K8YB 4JV5B 4QHYA 4B33A 3O4RA 4RJKA 2O7RA 1BEUB 2CBGA 1XAGA 2ZSDA 3S1AB 2G82A 4OB8A 3EODA 3DW3X 3H2HA 1Y9ZA 5K3SA 4L1KA 4Y7CA 3GAFA 1EIZA 4GRDA 2ZJOA 5EINA 3R7LA 4ANFA 3E23A 4GWLA 1G7TA 2JARA 2Q3MA 5HCUA 1HT3A 3K0SA 3LK6A 2W5UA 2ZDHA 4YMVA 4R2HA 3PT9A 4MULA 4R2XA 2BHSA 5A02A 3ORHA 2IU0A 3ZV7A 3ROPA 1NW5A 4WRRA 2NQ8A 4UNPA 4XOIA 4CJXA 4CLHA 5CW1A 2EKQA 4LQ4A 2IKQA 4Y0NA 3PGXA 3JQ6A 5EQJB 4V0NA 1VDMA 3AKEA 4GR9A 5DXJA 1QC5A 1M1NB 4YCDA 1E2HA 1EBUA 3RYFA 2E2WA 4PHGA 2P75A 3BCSA 5IWCA 1K66A 2HU2A 3TNFA 1LSJA 1U0NA 2CXQA 4FTWA 1Y8RB 1SK8A 1YCHA 3AETB 4J8PA 3JQPA 3JASA 2BFDA 4QULA 3EGDB 1O7JA 3IPXA 1DGQA 1KMNA 1MB2A 2GS9A 1YKGA 3GX1A 1KH3A 1N1EA 1U2TA 1NAIA 3KX2A 3NHPA 4FT2A 4QBIA 5CM2Z 1SIOA 2ZYUX 2PWZA 3OX2A 3UXYA 1D2HA 3HDTA 5EESA 3OE7D 1YZUA 1UMBB 1M8FA 1UM9A 1KC3A 1NXQA 2IF0A 2GRAA 3ITEA 1SHJA 5CVCA 2AV6A 4KWIA 4BP1A 5HOQA 3KQNA 1VXOA 2P9YA 4I9NA 2AJDA 2AQHA 1QK5A 3K15A 4YT2A 5BUSA 4W5WA 5K5EA 1NNUA 1BWPA 2EFHB 2PU7A 2J0EA 3EGOA 1MO6A 1HFKA 4QGAA 3HJAA 1AK1A 2EX1A 2X5JO 3Q87B 5DM1A 4PCLA 1ZVJA 2R1TB 3W5SA 4CMAA 1W0CA 2JLVA 1G18A 3OFSA 4LV8B 1CQXA 2GPAA 2NAPA 3WYEA 2IIVA 2ZUCA 2XCOA 3EGXB 3GEMA 3LUCA 1V8PA 1J00A 2FPLA 3C8MA 6NULA 1EFRD 4RTJA 1N77A 3LF2A 1KL7A 2XD9A 4XWGA 3Q3EA 1YV9A 1VZ2A 1QUFA 2Q0SA 2I6SA 2G5CA 1N2BA 3DUFA 3BUSA 1G3RA 2REQB 4URZR 1W36C 3FLBA 3FNHA 3W0LB 1FFEA 1HTWA 3IDZA 5HZMA 2GBFA 2ZSFA 3WQBA 1REQA 1E5TA 1XTBA 3U39A 4L16A 3VGPA 2IZ7A 3VTKA 4LF8B 1NXOA 3A8TA 4CVNA 2IF2A 4KQIA 3K0CC 2ZZNA 2N75A 4GZ5A 5FR1A 1W34A 4GW3A 3GJ5A 2IUUA 2R62A 5CT5A 1S4MA 4GPAA 3BWVA 1XZDA 3ZS8A 2YQ5A 4HD8A 1CJCA 1LPMA 1NBOA 1KI3A 2TMDA 1E2BA 2O7SA 3KQWA 4WGGA 1S2NA 1MEEA 1FFWA 2B0JA 2CVFA 2QF7A 4RD1A 3WMEA 5FEMA 5AQEA 4D9HA 1RBYA 1CZLA 2O07A 4OHUA 4MW0A 1JEDA 1AUOA 2BBWA 3UJ8A 1Y3DE 1S2GA 4KXVA 4M2LA 1XMQB 1W36B 4KO2S 4NL4H 2WJ4A 2XQFA 1GUFA 2BHNA 3EIHA 4RY9A 4BVAA 3EZ6A 2DYKA 3G0OA 2Q5LA 3J7TA 4UQPA 2HMWA 1GFWA 2B30A 2W2LA 4ZU6X 2Y27A 4AJ1A 4DCUA 1FUUA 1E5DA 1IRIA 1E58A 4N8EA 221PA 3CCBA 2YNMD 3AVWA 3ICCA 3BWEA 5FUMA 1M1YA 4UM7A 3PYLA 4EKIA 3DKIA 1YOVB 1PWEA 2PTHA 2NZ8A 1LUAA 4ER5A 2C4WA 3B2QA 3FBGA 1KBZA 3DDHA 2H2DA 2Z2XA 2NP6A 3TR6A 2IP4A 1DX4A 5L95A 3NWPA 1M83A 2CXTA 4BO0A 3VMFA 2OGSA 5LBTA 1R6XA 3N5KA 2XZPA 4R1SA 4GE3A 2YHAA 2R6AA 2VSQA 3PIDA 3BE5A 3V1TC 3OZXA 3UM9A 4CG0A 4W8HA 2X77A 4B0OA 4C03A 5JY6A 4K46A 2AJLI 4C14A 5C0OE 2Z43A 2ZB3A 2NTNA 5TJ9A 2QTAA 3O2NA 1CE8B 1Z22A 3LHFA 5E6UA 2CMDA 2WJJA 4IGIA 1IY0A 3R20A 4ZICA 3U4QB 1U2GC 4GMXA 2P7HA 1KO8A 2V7UA 3NEAA 2OCIA 4NAUA 2JKYA 5EWLA 3RE1A 3WL6A 4G1VA 1UDRA 1UZAA 1TW3A 1YB1A 2RFLA 2UYGA 2VJPA 4QRHA 4F6CA 5J2TA 4Q7LA 1DAEA 4FGSA 3FH0A 5FBRB 2QL7A 4MPJA 4KR6A 1BRMA 1I14A 3CRMA 4MOWA 4WZAB 3WICA 1SHTX 1OV6A 2WU0A 4MHTA 2EQAA 2Y9MB 3BAZA 3JTEA 2JCBA 1NPTO 5GVRA 1LQUA 2ZRLA 3RBVA 4JLBA 4HWTA 3WJAA 4GI3A 4MUAA 5K01A 2Z58A 1RYMA 2CVQA 4JP3A 4XR4A 5TVKA 4ZV7A 4OY3A 4U7FA 4U8HA 4Z1MA 2DJIA 1E7WA 4OLBA 1U6KA 4L95C 4NMXB 3DOCA 5B1HA 1WOYA 1SEPA 3DR5A 3W34A 3KQKA 1QHIA 4J91A 4TV8A 3QEMB 5JDCA 4RQUA 1Z4NA 1NLUA 2O52A 5J4KA 4JKOA 5FWXB 2IOHA 3TOXA 1T5IA 2M6LA 5BW5A 5B3KA 5HFAA 5JCZA 1QTIA 3ZNPA 4DEVA 1P6UA 5G40A 4M7RA 1VMDA 4KH0A 4IL5A 4RJTA 1PK8A 4AQYB 1M54A 1SVNA 1MVOA 2DUNA 1ZQ9A 2VZ8A 5EPOA 4EG7A 2P2DA 2P41A 2Q6LA 1V8ZA 3EMDA 4TSFD 3VX3A 2XYVA 3AYZB 3PHIA 3QELA 2AW3A 4LYJA 5B4TA 2LW7A 4N5DA 4QTUB 2E4WA 2FMTA 1OUMA 4N6NA 2E5LB 2WJZB 4KH1A 4F5DA 4D9BA 1CQIA 1CU1A 1O6CA 2PZBA 4FEGA 1KDZA 1EVIA 1QIFA 2MR5A 4LGCA 2Q41A 2RJNA 2FZKA 5AVTA 2DTXA 1JBEA 4JX9A 2YW2A 3VTAA 4R1NA 4EI8A 4US2R 1OX4A 2XKKA 4P6VF 3UJBA 4WA8A 1LLQA 5L7YA 1QRDA 2ZIFA 4QPZA 4AJHA 4LFCB 2H2WA 3ADBA 4RGBA 1US8A 2BBSA 1OYVA 3PD0A 4IWXA 4MWSA 2ZBRA 3CNBA 2QPOA 3K9BA 4N1AA 5ECGC 1TJNA 4OI1A 1U3TA 4XX0A 4M7OA 1VZ3A 4Q00A 1V5GA 4NK5A 1H8HD 3L79A 4L5BA 3OECA 4IG9A 4BV2A 2D2FA 2XCUA 4LZAA 1B0UA 1O54A 4FYXA 2JFGA 4PQGA 3ICVA 3RB8A 1C30A 4JFAA 1QU3A 3LX4A 5G0SA 2Q0QA 2PXXA 5JARA 1IOVA 2P4QA 1OXMA 3DKVA 3GXOA 4QYTA 3ZHUA 4CT0A 2HADA 3IELA 1E63A 3JQ7A 3T7RA 2FFQA 4DSUA 4B17A 621PA 1DCFA 3GZJA 4QFDA 3EIFA 3U0VA 1TL7C 5D6NA 1DBVO 3Q7IA 5DMXA 3E53A 1YZYA 2QVXX 3N6VA 1HA3A 4NTZA 4P4TA 2FCAA 4K81B 3H7IA 1FJGB 2GEFA 3DMFA 4LXYA 4UTRA 1GQSA 5K03A 2YUTA 4B3HA 3BH0A 4FCCA 2PKQP 1DAHA 4KWTA 5IZCA 3OA2A 4R1MA 5A6SA 1AQUA 1U0JA 2XA2A 3SC2A 7ABPA 5DNYB 2C0PA 4OQEA 5F73A 4BEVA 4F97A 3DTYA 3A9VA 1CULC 3HBMA 1N0WA 2CSUA 4JKIA 1OIWA 2O0MA 4JLJA 2F64A 3PQ2A 4MINA 5LA6F 1U7ZA 3HCEA 4LRXA 1QK3A 1E2DA 1M1UA 4BMDA 2YY7A 4E30A 5FJIA 5CJJA 4DEXA 3DEZA 1OH6A 1SCNE 4WQMA 2D5AA 1YJAA 2ZSAA 2F9FA 3H2BA 2MCFA 2Q4DA 5BWNA 4EFLA 4DZRA 3RYCA 3JAKA 4E4RA 4EATA 2VH1A 3RV3A 4QUEA 1KI9A 3RGWS 2FI1A 121PA 2Q3BA 1DBIA 5JSKA 1TEHA 3DTTA 2CXUA 3P20A 3EF3A 3F5DA 3OIWA 3PNKA 4N54A 4UZEA 5D3ZA 4BCBA 4JC4A 2FZ5A 1F6WA 3JZIA 4PYIA 2JIZD 5AW2A 5KYTA 4NBRA 1G8MA 4XVRA 2N47A 3RU2A 1G1AA 4OSPA 1UT6A 1GTL1 4WDQA 1W4ZA 2GASA 3BULA 1PVDA 4F8JA 4ZYYA 3O0DA 3M89A 4HYYA 3WK8A 5HW0A 3Q6MA 1PUXA 4MKFA 5COAA 3SXUA 3EDCA 3IILA 5EHGA 1IIBA 2HO5A 3AF3A 3IUJA 1MFZA 1A4RA 1TIBA 1XMJA 2A0FA 2Z6VA 2C2ZA 3G6KA 5DN6D 5KYXA 2FFJA 3B5IA 4BEWA 3GJ6A 2GKOA 5A4KA 3WNBA 3VZDA 3KSAC 2FMUA 4U8GA 3RJZA 3UCFA 1ISHA 4JSRA 4JB0A 4HNHA 4LHZA 1LCIA 1OT5A 1YA6A 4XOUA 3KUCA 4MUXA 4Q1AA 1F38A 1Y8CA 4LJ4A 3GMSA 3IKJA 2R65A 2MOKA 4X54A 3RYFB 3QTLA 3VPHA 2O5VA 5ALSA 3HXKA 1CETA 3LL4A 5D3QA 3WLSA 5GADl 2B1RA 3Q9UA 1SUBA 3FSGA 1GKYA 1X80A 4OCZA 3JASB 2BFDB 2GUWA 4PR0A 3WS7A 1XDGA 1ZRSA 2GDJA 3LY9A 1Z0DA 4Q9LA 4CT5A 1DADA 1RSZA 2IXEA 4KLZA 1U7DA 1CUUA 1F2TA 4YJGB 3QEOA 1Z63A 3RRZA 1UM9B 1YE3A 1D4ZA 2GLTA 4XFKA 4Y9DA 1GPYA 3OKPA 1NYLA 5LQSA 3OLQA 4RHEA 4ZI2A 1HFJA 4L7VA 1YQWA 1SK9A 1ZD9A 3O4IA 4OMUA 4QELA 3CMCO 1O08A 4YJFB 4OM7A 1PO7A 4B1FA 3ULKA 1YAJA 2C2KA 4PTLA 2O3JA 2H1VA 1OFTA 1BDIA 1Y3AA 4KIJA 4MVJM 3OZWA 3OWOA 4U7PB 1WS6A 1YD7A 3T1TA 1UBNA 5P8WA 3KHKA 1YS1X 4DARA 1VLZA 1RC1A 5U4XA 3QVVA 2VJQA 4J4BA 2QN3A 4D80A 4Q4CA 1U3UA 1D8TA 2RGAA 3O3NB 5FLKA 5CB0A 3K20A 2Y8EA 2ZI9A 1KQNA 1IMJA 3G1UA 3ELBA 1R18A 3MERA 3ND7A 1PWZA 2O2CA 3DUFB 3HCBA 3KOWA 3DE2X 3JWJA 3ET5A 3KJQA 3LDGA 4HFJA 5JH7B 4DT1A 5J43A 3EISA 1MAVA 1WCWA 2P5YA 4YJHA 2GTHA 1REQB 3PSHA 3I42A 3K73O 3D8TA 3ELDA 1O95C 2OXRA 3LO5A 4KPUA 3D4BA 3DHWC 3MAAC 4BNJA 3RRBA 2IGTA 3N87A 4HAUA 1XZEA 1YR6A 1JTFA 4B6JA 1PI3A 2QPTA 3R5KA 5U4QA 2I6QA 3TAHA 5GZ3A 5HMMA 4D3ZA 2YHIA 3LOUA 3V3TA 1YFLA 2IC5A 1KHTA 2Z04A 3KLBA 2XKAA 2EHJA 3UOWA 3UXHA 4AMZA 2WSSA 1MOZA 2BN4A 4AJJA 4KQ6A 3T34A 3UGQA 3N3BC 1VIAA 1CDOA 2JK1A 3SIWA 4QM7A 1XNGA 3D4NA 5KQRA 4OM8A 4GI7A 3MRXA 2H18A 3RQIA 1RCUA 3F49S 4HLCA 2QJOA 4S2EA 5AW7A 1J20A 1N2EA 2VTVA 3RS9A 4D42A 4AZ3A 4BLRA 4IV0A 3CZPA 3ESQA 2FQWA 3TGLA 4KYVA 5CDHA 4Y2RA 3CZ5A 5AKEA 4A3SA 5TV2A 3DXYA 4JOSA 3DB1A 3ESRA 1M1YB 4BO8A 1N9ZA 1P4SA 3D3JA 3EUWA 3IE2A 2C9DA 2PANA 3VR4D 5A5GA 2C9YA 2CVPA 2H92A 2IE8A 3EVEA 4OA8A 3LZ6A 3J81k 4HX9A 3TSZA 1FVOA 3HVUA 1CV2A 4O63O 1XV5A 5JOQA 3VI4B 3NTVA 2EZTA 1XNJA 3IR5A 2HRDA 3VZBA 1UBUS 4LXTA 1XNRB 1UEJA 3MLAA 1RYYA 4RPIA 3JZFA 4LJ8A 4ZRNA 3TGWA 3S2EA 1AHIA 3R7DA 2HDHA 4AUMA 3N76A 5HK8A 1B7GO 4LOJA 4MJXA 2WHYA 1WUKS 5A62A 2H1SA 1CY6A 1MO5A 1XEWY 3G0GA 4I9FA 1R5NA 2CNWA 5IBCA 2V4ZA 4RY2A 3EZFA 3ZJTA 3I2JA 4YRBA 1R0RE 3VFDA 5ED0A 1EM8A 2G0AA 2H4XA 3DOUA 5E6UB 2J09A 5EOVA 2P62A 4FFDA 2XGMA 3QJ5A 5JDCC 4HB3A 4PZPA 3P7MA 1Z0AA 3VISA 4EG8A 5EQDA 2OVBA 1G9TA 3E03A 3W8DA 2IYXA 1P1FA 4PSUA 4U3JB 5EWLB 1AU9A 4E09A 5LKAA 3R8FA 1Q84A 5B1DA 4UBIA 5HEKA 4EO7A 3NPMA 1JALA 1R8XA 1YIDA 2PX8A 2W22A 1ECJA 3FFAA 1C0KA 3GCZA 5HOEA 3SM3A 2WWXA 4NECA 4TTIA 2FPWA 3U7IA 4NEGA 5I51A 2AX3A 3ENKA 5ELXA 4NCKA 1TUBA 4OJQA 2J3MA 2VDVE 3LX8A 4IUYA 4RA9A 3JXEA 3PUWA 3CO0S 4ND4A 5IM5A 1YRLA 4F6LA 2GSWA 2J9ZB 2OHHA 3GJZA 4LY3A 5DHPA 2I6GA 1JU3A 1L7OA 1D2EA 3FIJA 2EWMA 1NUHA 3DP7A 3R5TA 4UUOA 3F0TA 4RZIA 4Q39A 4UAJA 3RM3A 3VTFA 2AYZA 1N8NA 1R5JA 4LY0A 3T7DA 3UC5A 2ZTSA 1GTJ1 1P2UA 4WKGA