2WIAA

Crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
253
Chain Sequence
MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Structural Fold, Conservation and Fe(II) Binding of the Intracellular Domain of Prokaryote Feob.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 73
structure length 253
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wiaA01
2IC5A 1A82A 2FG5A 1KI1A 3RRNA 2FE4A 3TQCA 4D4MA 4L15A 3AKDA 3EZ6A 3U4QA 2VH5R 1B23P 3WY9A 3ZDQA 4UNQA 1EFTA 4OYHA 1GKYA 1N6HA 3CF2A 1S0UA 2GEDA 4Q9HA 3PEYA 4JVSB 3SBDA 4QXAA 1VHLA 1IBRA 4TL8A 3KXIA 4Q1FA 5CJ2A 2VHUA 4LV5B 1W4AA 2F1IA 1ZC3A 3RANA 3KQHA 3M0EA 4EDHA 4KFRA 4JL8A 1DAFA 4HDQB 2P2LA 4UJ3A 3LVRE 4B75A 3MWYW 4DC9A 5DNYB 5KSYA 3R9IA 4JLKA 1RRPA 2RHMA 2Y8EA 3RS5A 3X1ZA 4A6XA 2QPAA 3FMIA 2FF7A 5KTYA 3X2SA 2VL7A 4HUTA 3CX7A 3IIKA 2WHXA 4RFVA 3EZ7A 1Z0DA 2RKOA 4ACBA 3W8RA 1VIAA 4HSEA 4TYYA 3HU3A 1WP9A 2F43B 2RGAA 1RYFA 2AFHE 4M8NE 1NLFA 3ONWA 4PO9A 2QSZA 1N2CE 2FFQA 4ZCLA 1NLYA 3IHLA 1G9XA 2BMJA 2EQBA 2W00A 4IOLA 5DGXA 3SHFA 3BERA 1UEIA 5B64A 3QOFA 1GKUB 5E95A 3N70A 1HUQA 1KSFX 3GMTA 2YWFA 4C0JA 2W0MA 2ZJAA 1PJRA 2YC2C 4F7WA 2CJWA 1AQUA 4LI0A 5EE9A 4GL2A 1Z3IX 3MJHA 3CLVA 1NY5A 4FMCB 1OHHA 4HZUB 1WQ1R 3LXRA 2JLUA 4AI6A 3FOZA 1AS2A 3N2IA 1KK2A 4LJ8A 2Z5FA 3QXHA 3ND9A 1CR1A 1E32A 1M1YE 2OCAA 4Q48A 2HEIA 2AD5A 1GRRA 3K70D 2QT0A 5GJVC 1YQTA 1A5TA 1N5KA 3RWOA 1ZMXA 4O2LA 4QJ3A 2O8DA 3RS2A 3B9QA 1E9BA 2EFGA 3VMFA 1KK0A 3JZAA 2ZJ8A 3OESA 3FKQA 1OIVA 1OHHD 2UVQA 2OFXA 1RKBA 4QBHA 1IY1A 3E70C 3VQTA 4DDUA 1GZSA 3VR2A 4ITRC 1J8MF 2VP4A 4LJ9A 2W6JA 4N0EA 2PJRA 4CT5A 1X3SA 1UBFA 2OXCA 3C5CA 4DCVA 4JLMA 1P61B 2O8CB 4RZXA 3E1SA 2WTUA 3SFZA 1ZD9A 2BCGY 2C9YA 3UMSA 3WP0A 1ZCAA 3KKQA 1MO3A 2D62A 5LB4A 4ARZB 2W6JD 4OK5A 2KSQA 1MO6A 3UPUA 4JZKA 4CEHA 3AF2A 3I72A 1AS0A 4PSVA 3K09A 1S3SA 1T6NA 4LBZA 4D25A 1A4RA 1TNDA 3LX8A 4EJSC 5K8TA 3V4RA 2IS6A 2KJQA 5KDDA 4RSGA 1M7GA 2H92A 3V00A 4QG7A 2IS4A 3SQWA 3ADCA 3RLFA 1AKEA 4NCNA 4A0FA 1W2GA 4MYTA 1XTQA 3RSOA 3VR4A 4R2IA 3M4YA 2GVZC 4WZBE 2REXB 5CITA 4IXMA 2QTFA 1SVSA 1XB2A 4D4JA 1RFLA 1T8UA 2Q3MA 1S1MA 1E94E 1Z83A 2Z4SA 3W3AA 4B3GA 3KB1A 3LY5A 1AK2A 3T5GA 4MGKR 1I2MA 4OJKA 5A0FA 2XZLA 4URVR 1NBME 1G6HA 1IN5A 4LCBA 2FSHA 1TPZA 4QHYA 1GSIA 4DIEA 1P9NA 1Q3HA 3C5HA 1XD2B 4PO8A 1COWD 3QKUA 4BZXA 8OHMA 4RD1A 3I8XA 4YQFA 3REFA 1GOTA 1GL9B 3L0IB 4Q4JA 3VX4A 1XU4A 2GXSA 1EG7A 4NZYA 5CM9C 1A2KC 3QKRB 3CRMA 2GJKA 1IN8A 1ELOA 1YHNA 4JLOA 4JLDA 2RB4A 2Q9BA 1BYIA 3K0CA 4OHZA 4DLRA 4UQOA 4PFSA 4IVPA 1MABA 1DTSA 2WWGA 2RAPA 5HPYB 1G4AE 1SVOA 1W0KA 1DOAA 3OEHA 2F3TA 3OAAA 1QVAA 5K8UA 4JLNA 4JLJA 2WJGA 1S8FA 4QM6A 4HAXA 3TSWA 3KQKA 1C1YA 3J81k 3ZD7A 1SHKA 3QEJA 2C77A 3F3YA 1N5IA 1R2QA 3SJBA 2J9RA 3TUZC 2C98A 2ZI9A 4B71A 1KGDA 5GVRA 2GA8A 1II0A 3P4YA 4M0LA 4CT4B 3C15C 3OEHD 1LV7A 4LPSA 2ZYWX 3OAAD 1OB5A 1KJYA 2DWQA 3BWDD 3NIBA 1E9CA 5HCIA 1HY3A 2RGDA 2A30A 5D3MB 2IWRA 2FGKA 1ZYUA 4TL9A 3W5IA 4EPYA 1U8YA 5TV2A 4TYNA 1E0KA 2O0JA 4AG6A 1F2TA 2W6ID 3K53A 4F4CA 5FH9A 5FR2A 3KQUA 2XX3A 1D5CA 3THXA 4JKYA 4PXAA 4KBFA 4DCTA 3R7WA 1U9IC 2GESA 2V54A 1NKSA 2CCGA 4M53A 4MITA 4EFNA 3UG7A 2ZI3A 3OIYA 2GBLA 4NCJA 2AL7A 2H5EA 2VIIA 2BCJQ 3FFBA 4RCYA 3LBHA 5EXPA 4YDSA 4NYMQ 5AUOB 3TGPA 1UDWA 2RGGA 2XEXA 4YONB 3X1XA 4Q00A 2AKYA 1RZ3A 5JI2E 1E1QA 3K0EA 5AK0A 5C46F 1XP8A 3RHFA 2QN6A 2FFBA 3KJIA 4UNRA 2DWOA 3AGQA 1U0JA 1W5TA 4KV9A 2BDTA 2WWXA 4DB2A 4F93B 2P5SA 5BXQC 2AR7A 2ODEA 1JPJA 1OFTA 3TJZA 1WBDA 2H17A 3MRSA 4KLZA 1LS6A 2QRZA 2J1LA 2B7BA 4TTPA 2PZEA 3UG6A 1E1QD 4IFEA 4QBFA 2ORWA 5SZJA 1NRJB 3DOFA 2J7PA 2FA9A 4FMDB 4PSKA 4BRUA 4RY2A 1MRNA 2J0UA 3TQFA 4P0TA 4C0SA 4BE7B 2ODWA 3I4LA 4PTLA 1QHGA 1E99A 5A4JA 1KI3A 2UZ3A 4RFSB 2CVFA 1W1WA 4YXWD 1VPLA 2PL3A 3EG5A 1G7SA 2FOLA 4S2EA 5H1YA 3HYTA 4PC1A 5FBVB 2J3EA 1E2HA 4C0BA 4HAWA 2NGRA 2ZR7A 1HQYE 4TYQA 2P6RA 1G8FA 4GT1A 1VIYA 1OXVA 1XNJA 2ZANA 4M9ZA 2OZEA 4BPBA 4BFWA 1ETUA 1HE1C 4HYYA 3ZZ0A 3I5XA 4HLCA 3R9WA 4WOPA 3PG5A 4Z8YA 2DFKB 2BEKA 3EX7C 1XCMA 1KZGB 2QP3A 1P7CA 2AHOA 1M7BA 2VRWA 3SZRA 4AC9A 2TMKA 2ZU6A 4I1OA 3GJ3A 1TX4B 1MO5A 1KO1A 1Z8FA 2WKPA 4FMCF 3NC0C 1E2MA 2A9KA 2WOOA 3UWOA 1I2DA 1G3QA 3QXSA 5JECA 3GLGB 3B5JA 3ASYA 4LJAA 2ZRMA 5GADl 3OEEA 1DAMA 1HT2E 1K8RA 2B8TA 1V5WA 2R6CA 4IVQA 3A1VA 1YRBA 4L9WA 1W49A 2ZS9A 5L3SB 4IDNA 4Q03A 1BKDR 4JSYA 4IDOA 1E4VA 1E2JA 1QBKC 3FWYA 2J41A 1F3OA 4C9BA 2CNWD 4HLDA 1SULA 3VAAA 4NYMR 4RCZA 3L2OB 1UKEA 1KNXA 4AKGA 2ZRLA 2Z83A 1SVIA 4A9AA 4WZ6A 2OXRA 3TE6A 4B2LA 1EWQA 4DEYA 4KAXA 2CBZA 2LKDA 1UDXA 4Q9LA 1KSHA 1Z22A 1T9HA 1N5LA 2QEQA 3Q5DA 3RWMB 2NZ8A 2C9OA 1M6NA 4EPRA 4EPVA 3ZH9B 1E96A 4M1TA 3R8CA 1G41A 3KJEA 1E1RA 1Z08A 3QEOA 4AYWA 1OXUA 5LBIA 3MCAA 5H8WA 1ZNXA 1XFAA 2GJAA 3IIMA 2IHYA 4LX0A 4OKSA 3U4QB 2QAGA 3ADDA 2J0QA 1VG0B 4EIWA 2VP9A 2HCBA 3BFKA 2PX0A 2JLQA 4JS0A 4AYXA 1XEXB 1OH6A 4ZI2A 1GVNB 4M1MA 4CIDA 1LY1A 5E7MA 2O0KA 4QOSA 3B13B 3U7EB 3K0AB 3THWB 3B78A 1OKKA 1E1RD 2F9MA 4PAMA 2QQEA 4PPNA 5K8LA 1HH4A 2ZRPA 3O8CA 2IYXA 4IEIA 1TF2A 2ZUDA 4MRVA 5JS8A 1M74A 2UKDA 4M1YA 1YZKA 4D0NA 1U81A 1GDDA 3S1AA 3DPUA 4A82A 5FOUA 2O8EB 4G5QA 1NP6A 3GLFE 3ADKA 1BYUA 3T35A 5JS7A 4OL0A 4B6FA 1RPZA 1OKKD 4OI0A 1WRBA 4Z1MA 2ZI6A 5HE9A 4EFLA 2W2XA 4TQAA 4YDHB 1JECA 2DFTA 1WBBA 4LJ6A 2IWHA 3AVPA 4P31A 2NO1A 1EFRA 3T61A 2YVUA 3NBXX 4LHYA 5JJKA 4OI1A 4CDGA 2QTVB 4M1SA 1X8LA 2ZJ2A 3QKSA 2R62A 1MV5A 1NVWQ 4L4UA 2CL7X 2I1QA 721PA 4HLUA 4DLSA 2JLRA 3E2IA 2JGNA 2ZU0C 1GL6A 4Z1MD 3W5JA 4G3XA 1OXTA 3QKTA 3K70B 2O0HA 4IVRA 1TADA 1E79A 1E2FA 2SHKA 1EFRD 3DEFA 2OFOA 2NMVA 3LBNA 5FL7A 2DCUA 3NG1A 1KI2A 3SE0A 2W58A 1KDPA 2HJGA 2PLRA 5CJPA 1E2LA 4TYPA 3QBVA 2WKQA 2JIZD 1GITA 1FQJA 1R8QA 3FMFA 1CTQA 4CF7A 2A2ZA 3CNOA 4BLTA 1GIAA 1N6RA 4A0RA 2GCOB 4QHSA 3JVVA 2NO0A 1V43A 2GF9A 1G3MA 5DN6A 2O8DB 5FTMA 3VU9A 5FL7D 2JEOA 4LSGA 3A58B 1N0VC 1QRAA 3GCGA 4TZ0A 3Q5EA 2IXEA 3T1VA 4ZCMA 1G64A 1D9XA 3CX6A 2DBYA 4WAUA 1XTKA 3EZFA 1JAIA 1CS4C 4KU4A 1KKMA 4V0ME 4OI2A 1UBEA 1CLUA 4RZUA 5DN6D 1VYUA 2PMDA 1OB2A 2ZS8A 3QIAA 1DVRA 1TF7A 2QA5A 1YR8A 2CVHA 2ZE8A 5SZIA 4PQFA 5DLQC 3FHTA 1US8B 4MDEA 1L2TA 2OCBA 3SYNA 2IA5A 2ZE5A 3PUXA 5BW8A 2GTPA 4KXFB 5FBWB 4N1AA 4RD6A 1LB1B 1GNQA 3QG1A 1T0HB 1XBTA 1F2UB 2DHRA 1YR7A 4I99A 2ZXUA 4DT1A 1W2HA 1AZSC 1L4UA 2WV9A 1L8QA 3BE4A 2YOFA 3NBYC 2LCFA 1JBKA 2ZI7A 4BZQA 4LJ4A 5L3RA 4CEHB 3FGNA 2QTHA 1D8TA 4A8JA 3QF4A 4OHVA 5C18A 2WKRA 1WCV1 1ZW6A 3AF3A 4F38A 4ZIRB 1Z29A 4B3CA 2QENA 1JR3D 2G0TA 2VA8A 3IHWA 4J0QA 4GDFA 1YR9A 3E5HA 3RS7A 2EWWA 4B74A 1E2QA 1CJUC 3I1FA 2IX3A 4R7ZA 4KFTA 4OQLA 1IY0A 3VKGA 1X86B 4FINA 1PLJA 3WYGA 2O8FA 5FUWA 2NQ2C 1CR2A 3UATA 2OLJA 4NMMA 3D6TB 1TU4A 2BJWA 3H1TA 5KUTA 3VKHA 1ZCBA 1ZNZA 2O52A 3I3SR 2XB2A 2QORA 3PJRA 2G3YA 2VO1A 2ZE7A 3B85A 1M34E 1ZBDA 4JT4A 5FPYA 2WWYA 5JHHB 2RMKA 1RYHA 3ZZUA 1QZXA 1SVKA 3BFXA 4FMDF 3VNVA 3LWNA 1FFHA 1KO8A 2HF9A 2AX4A 4NE2A 2V7QA 1CIPA 1N25A 4PHGA 4W5HA 1IN6A 1C4OA 2XNSA 1QHYA 1KO4A 2J46A 3I32A 3QY0A 3GJ6A 1SXJA 3ZVMA 1U99A 1T91A 5AJYA 3ADBA 2ERYA 4DLXA 2GAAA 3W9YA 5FTNA 1MOZA 4EFMA 4R9UC 2FPLA 3M6AA 5KNBA 4HEJA 3BC1A 4AY2A 1IOZA 1M2OB 1MABB 2BM1A 3GLIE 3KUDA 2GILA 3SHWA 4QGGA 2G0NA 4P4UA 4BECA 1P2VA 1Z0IA 5AWFC 521PA 5JEEA 1F6BA 1Z2AA 1N6KA 3OHMA 2ZUCA 1F48A 3EC2A 3AVXA 1Z6AA 4GSYA 3N5CA 2C04A 3U6KA 1WXQA 1IXZA 3B1XA 3VNUA 2NOAA 3AF1A 2YWHA 4BFUA 3K70C 1G18A 3CRQA 1UM8A 4LHWA 4Q4HA 4TLAA 5CB6A 5E7IA 4GMDA 3UXMA 4B35A 2CL0X 4US1R 1NLZA 1DAEA 1S1CA 4YMWA 4PSAA 1BOFA 4QKQA 5JZVA 2ANCA 4K46A 3THYA 3H2YA 3CO5A 2VYFA 2WSSA 3AKEA 3IDQA 1G7TA 3MMPA 4F91B 2BMFA 4DIDA 4WA7A 3B2EA 4DBLC 1F2TB 4NTZA 4Y0AA 1YZUA 2VP6A 1DAIA 1TTTA 3F8TA 2P3SA 1XZPA 2BC9A 5J4YA 1BO6A 2WWHA 4Q4AB 3PENA 1OIWA 1KIMA 3NWJA 5HZHA 2HCJB 2YYZA 3AH8A 3OIWA 2QM7A 4NBSA 5F9FA 3K1JA 2IUUA 1XD8A 2WSSD 4MYHA 2A3RA 2D74A 3CW2A 3LX5A 2F3RA 1TMKA 5E3HA 3PUVA 3AGPA 3G5UA 4Z51A 1VYVA 1IN4A 2CEAA 1KI7A 4HAYA 2ZJZA 3UMRA 4KYIB 4CEJA 2Q0HA 2R9VA 3GLHB 4RD2A 5EE0A 1TQDA 3TBKA 4PHFA 1Q21A 4B3DA 1G8PA 5AJXA 4PPQA 3KKPA 4XD7A 1DG1G 1PZNA 1XMVA 4CYMA 2GZDA 5KSZA 4ZPXA 3RRZA 2IBMA 3EA5A 4YMTA 2R6AA 2ZRFA 4US2R 4R71A 4IEEA 1K6MA 2HXSA 5ANRB 3LLUA 2QE7A 1GILA 4DLUA 1U0HC 5J47A 4Q1BA 1KO5A 4UNPA 3OIVA 4RKEA 5E4FA 1G20E 1NBMA 3TUJC 4BLSA 2DFNA 4CEIB 4DVGA 2X2FA 3ECCA 2AK2A 2IEYA 4URUR 1R4AA 4WBSA 4LV6A 4DLZA 4XWKA 3ZD6A 2LWIA 4PX9A 2ZR0A 3FMPB 1VYTA 4GP7A 1Q57A 1IJFA 3NBFA 4NDZA 3B1ZA 1Z5ZA 1CEEA 1Z0KA 3MWKA 4U5XA 3C4JA 2QE7D 3EASA 4DJTA 3I62A 4A2QA 5TARA 2ZRBA 1T3SA 1NBMD 2R44A 1XEFA 1KI6A 1ZRHA 4A2WA 2GXQA 2QBYA 1NVVQ 1SXJE 2HT1A 4KLNA 3W6NA 2XXAB 2QZ4A 3U3RA 4PZZA 2Z6VA 5LB2A 2QUZA 2RH5A 5HCNA 5EP2A 1XJCA 2IXFA 4G5OA 3RS3A 3A4MA 2AN9A 2FFAA 2EYQA 1KO7A 1N0UA 2QMHA 4Q01A 1DO2A 2AD1A 1ZINA 4GRAA 3VFDA 3CIOA 3NHBA 4LRWA 2YC4C 3BH6A 3IIJA 2ZEJA 4BLPA 1RW4A 3F5FA 3V9PA 1NKTA 1U2RA 2BBWA 2NTYC 1E2EA 5IDVA 5CLLA 1RRGA 3P20A 4I81A 5G3YA 2OBNA 4FCTA 1J90A 4IOJA 3RS0A 2PEZA 3QUSA 2ORIA 2OBMA 2O8BA 4IFBA 1P9WA 4RD3A 2JDIA 3Q7QA 4C2UA 4LPKA 2HF8A 5DYGA 2GEVA 1Z6GA 3EXAA 3K0CC 4DCNA 3AF4A 3GLGE 4LYAA 1GP2A 4LYFA 4BGDA 2F55A 1P2UA 5DYIA 4TSFA 1UKZA 3NEYA 2X1VA 1AQYA 3SC3A 4WZAE 3QNUA 1QHHB 2ZJYA 1XWIA 4XOIA 3NC1C 5KO2A 1AGPA 2JDID 3GFPA 3NH6A 3HU1A 1UBCA 1II8A 3ETLA 4C3ZA 2QY9A 4N0DA 1XDBA 3I8SA 2OV2A 3ZGXA 2VSOA 1DPFA 4KVAA 4TSFD 4BRWA 5KNDA 2V8OA 2RGNC 4OBEA 2XTZA 3ASZA 2QL6A 3CZPA 1RJ9A 2BMDA 1Z6XA 2QQ0A 4DLYA 2OAQ1 1F5NA 3D7MA 3LV8A 5L3VA 4OQXA 3B8HA 3C41J 1A2BA 4BEBA 4DCUA 4MYUA 1XMSA 4PHTA 2JLXA 3ND8A 1XMIA 3S1AB 3ZIAA 4Q66C 4RVCA 2D7DA 4HAZA 3A4NA 2I4IA 4GI7A 3H86A 1YZTA 1NVVR 5EXXA 2AWOA 3L0SA 421PA 3KDSE 2YOHA 3I5YA 3BFVA 3HR7A 4QGHA 2E1RA 5JBQA 3IBGA 4EUNA 1N0WA 2G88A 3BS4A 3CPJB 1CF4A 2RGCA 1SKYE 5CK5A 2JLSA 4V0KA 2X77A 1Z47A 2GBLC 3QXJA 3TSOA 5HR5A 3VX3A 5B58C 1N6PA 5C4GB 5JSZA 1EXMA 3TLXA 3EPLA 5EE5B 5JEDA 3W3ZB 4PO1A 1NJFA 2WAYA 1P3JA 2HYDA 1NN0A 2ZJBA 3QKSB 4GFDA 4JYCA 5F2EA 1G3UA 2XTNA 3MD0A 4PZLA 2V6JA 4TLBA 3AB3A 3DMDA 1KI9A 2ZITA 4ZDKA 1R6BX 1HT1E 1KI4A 1NMZA 3L0PA 3W90A 2D7CA 2VP2A 1SZPA 5KSOA 2P0EA 2V9PA 2VTKA 4IKEA 4CGZA 4UNSA 1LW7A 4W7SA 1P6XA 1ODFA 3CUEF 4L8GA 1IJEA 3SN6A 3QE0A 2B21A 2XNDA 5LD2B 1XXHB 4ZCIA 1RIFA 4NP6A 4E03A 5EUQB 2ONJA 4P33A 1LNZA 5BYKA 3WBKA 1U8ZA 1U98A 4B76A 1XJQA 4Q4LA 3EAQA 1Z0AA 2QGZA 5GJCA 3IEVA 4FCVA 1RE0A 3EIHA 4TMWA 2OG2A 3IEUA 4EPWA 4AKHA 2V3CC 2AWNA 5L3QA 1FUUA 2XNDD 3MSXA 4R98A 1W0KD 3GD7A 1IXSB 1P2TA 1VG1A 4HDCA 1FPMA 1D9ZA 3B1WA 3C8UA 3U60B 1R0WA 1GNPA 1OFUX 1KMHA 1SKQA 4H9GA 1EX7A 5JWRA 3F0TA 3IILA 4OQNA 4R2HA 1PLLA 4JBYA 3SI7A 2IT1A 4FD2A 2B6HA 1ZP6A 2QPOA 3I92A 4Q21A 4DZZA 3CR8A 3B6EA 2IYZA 4OQFA 3RS4A 3KX2A 3VHLB 4JL5A 4GNKA 1Y3AA 4JSTA 4F4IA 3ZQJA 4B44A 4D0GA 4F92B 3EPJA 2PH1A 4URXR 4WIAA 3HPRA 1P60A 1CR4A 4D2IA 3EZ2A 1LF5A 5F9HA 4DCSA 1E69A 2FGJA 2AXPA 4MRSA 4GBMA 3SYKA 3KTAA 5GVSA 1OXXK 3U3JA 2OBLA 4X8OA 5DI3B 1OYYA 3QI2A 1NSFA 5ELXA 1XPOA 1NL3A 2EWVA 1XTRA 3REGA 1NIJA 2J87A 2N1BA 2VP5A 4TT3A 1GRNA 2R6FA 5JCPA 1KYIA 5J4LA 1MO4A 5JWHA 3TKLA 2BBOA 1G5RA 3GLFA 4FCWA 3MLEA 2HUPA 4Q19A 5EE3A 3A36A 1E98A 5FPTA 4G0NA 5C2JB 5FPKA 1K5DA 2KBFA 3GPLA 1MR3F 2GK6A 4G1UC 4BLRA 4D81A 1ZUNB 1P5ZB 1I4LD 1VKJA 2IUTA 3T1OA 2WMNB 4LHZA 2C5LA 1G5PA 4DUGA 4P4SB 1XRJA 3BRWD 3CRW1 4GPTA 1YRAA 1WDTA 3QBTA 4AIIA 5JJLA 2D3WA 4FMBB 5HE8A 3A37A 1KK1A 2IXGA 3W34A 1YZQA 1AS3A 1XZQA 3L82B 5FI0B 1EFCA 1S96A 1C9KA 2VP0A 2CMKA 3T15A 3KQLA 2A7QA 2WJIA 3U44B 1KNQA 2J7PD 1OYWA 3A1SA 3CNLA 4C0AC 4EPXA 1KJZA 4ESVA 2Z43A 4IRUB 1H8HA 1CRQA 1P73A 1ZJ6A 2BEJA 1AA9A 2G1JA 2KBEA 1WB9A 1ZAKA 5FBQB 1XX6A 3TRFA 2C8VA 1KDTA 2WOJA 5FUXA 2BKUA 3BAFA 5SZHB 4OQMA 1VG9B 3ZVLA 2PJZA 1AJEA 2Z0MA 3PQCA 2XOKA 2QSYA 5TVKA 3U3OA 1H8HD 1RRFA 2CXXA 2D2FA 3DM5A 3PXGA 2VQSA 2EW1A 4GOJA 3I73A 4LYHA 4DDWA 2ODNA 2YOGA 1CULC 2VEDA 1G7CA 4HZUA 4BFYA 4D4KA 2MMGA 2KB0A 2ZSFA 2GETA 3PCRB 4V0MA 5FBRB 4D4LA 1KY2A 2ERXA 2V1UA 2JLVA 2Q9AA 4JMPA 5J40A 2XOKD 2XJ9A 5DHFA 4GOXA 4Q4HB 2OLKA 5HTKA 4E5UA 1FMJA 2GRJA 1TU3A 2NIPA 3BJIC 4TWZA 1WMSA 1DO0A 4AG5A 3ZS8A 3THYB 3OEED 2H16A 3Q8XB 4FW9A 2GF0A 1M8PA 3TAUA 3O8RA 3T12A 4CRWB 2CL6X 3WXMA 4A92A 1DADA 4DWJA 2JASA 1FP6A 5LD2C 1UEJA 2AXNA 3GFOA 2ZRDA 1YKSA 4ZDJA 2YZ2A 1MT0A 3SDZA 2BKEA 5FBLB 1R5NA 1D2MA 1D2NA 2L0XA 4GOKA 1EX6A 5C1BA 4MUBA 5DI9A 1ZNWA 2XJ4A 4HB0A 4LC1A 2REOA 2IYUA 5FR1A 4YMUA 2O8CA 1W4BA 1TF5A 4DDTA 1LTQA 4IHQA 2ZSDA 4B33A 1N6LA 4EPTA 3JZMA 4ARZA 1W47A 3QENA 2ONKA 4NKRA 4CEJB 2QM8A 2QPTA 3O47A 3W6OA 1NVUQ 1GAJA 3VR6A 1UJ2A 3TUIC 1YZNA 5EXSA 1G5TA 1NSTA 2GWHA 2WBLC 2G83A 2CLDX 4KO8A 5IRCD 4PAOA 5FTJA 1S2MA 2I1VB 1T3HA 1T3LA 4M9XA 2IYSA 2MSDB 3TVDA 3NBZC 4L9SA 4QGFA 1EFHA 3SOPA 3WYAA 1J99A 1UKVY 3NDPA 3SBEA 3HP1A 1VDZA 3IO5A 5G41A 4BLQA 3CWZA 5IK2A 3AUXA 2HLDA 3CWQA 5JJIA 1R0YA 5IHPA 4PQYA 4MQBA 1TEVA 2WZQA 1A1VA 3QPWA 4A0GA 2W2VA 2GJ9A 1S3GA 1ZUHA 5KYKA 2D2EA 4YC7A 1JNYA 4UXHA 3TNFA 4FWIB 1Q1BA 3SEAA 1Z0JA 2ZRKA 2G1KA 4M2LA 4DLWA 2ZAOA 3JVUA 4ABYA 5HZKA 2NO6A 1L4YA 3O8BA 4NCIA 4FWTA 3VHXA 1EFUA 1FL9A 2HLDD 4TTQA 2CJWB 3AUYA 5AUPB 1B0UA 1L7VC 5FOSA 1YVDA 1HQCA 2ZAMA 3BH0A 4RD0A 3GLIA 2V1XA 1IXRC 2Q21A 1BIFA 1EGAA 3QF7A 4PZYA 4TMVA 4UNNA 2Q9CA 1Z28A 2QG6A 4LHVA 1E79D 2E9SA 4QBIA 4ZDWA 4B3BA 1HURA 1T5LA 3Q85A 3QKRA 4AKIA 1IN7A 1UPTA 2C99A 2WIAA 4FN5A 4G5RA 4XSGA 2C78A 1NJGA 4BEJA 4IDQA 4E22A 2BJVA 3G82C 3TMKA 1UBGA 2FSIA 4M9QA 2DY1A 4POAA 5EP1A 2H18A 4A1FA 4KODA 4QJ4A 1NMXA 2BBSA 2G77B 4TTRA 3AF0A 1XPRA 1H8EA 1DBSA 1R0ZA 1R0XA 4TLDA 2RGBA 4O25A 2O8BB 1KDOA 2ATXA 5G3ZA 2IYWA 3KUCA 1EWRA 3QPUA 1ZD8A 5D3QA 3TR0A 1DAGA 1Z07A 2W0SA 4LOAA 1W7AA 3ZLJA 3L0OA 3TW8B 4OK6A 3GJXC 3DZDA 3KKMA 4Q1DA 1NN3A 2PEYA 1HV8A 2IHBA 1E0SA 2ORVA 3DZ8A 4HAUA 2OT3B 2OAP1 1ZNYA 1LVGA 3QJYA 5D3MA 2PCJA 4LBYA 4XSHA 2PX3A 1H8ED 4XWAA 2C03A 1R7RA 2ZRAA 4ON9A 2JCSA 4IDHA 2P6UA 1ZU5A 4URZR 4ZKEA 3SNHA 4ASUA 1N6IA 2H1LA 2FPMA 3H4MA 4MKIA 3RNLA 2KI5A 2E87A 4MA4A 2VHJA 1N6OA 5DO9A 3DL0A 2C95A 2JJ8A 1R5BA 3RC3A 1O3YA 3OFNA 5KOYA 4DKXA 2YWGA 4QBGB 2F1RA 3AV0B 1DE0A 4CVNA 2ZI5A 3ZVRA 2ZRIA 3LW7A 4LGMA 3U5ZB 2XAUA 2R65A 3VKWA 1QF9A 3ZS9A 3ICEA 4XJXA 1QHIA 5AR1A 1X8JA 2J0VA 2P6NA 3QVVA 4NYJR 221PA 3UKDA 4XWOA 1R5OA 5CYOA 3THOA 4RZ2A 2DWPA 2GXAA 1FNMA 3G0HA 1UAAA 4W9MC 5FUYA 1NNEA 5FOTA 3AVYA 2IYQA 1KZ7B 1G7RA 2ZRHA 4HUQA 4Y0VA 4AYTA 1W36D 4NHOA 1BS1A 1Q1EA 3NXSA 4Q47A 5EZ6B 3MWJA 3X1DA 5A5GA 1W5SA 4X8MA 2ZR9A 3BIFA 4HATA 1KK3A 4JL6A 2QI9C 2DR3A 1VTKA 3D31A 1YJ5A 5DH9A 2FH5B 3TH5A 3SJCA 1OLOA 2Z4RA 3AVWA 2QT1A 4TN1A 1G8YA 4Q4JB 4AWXA 2JLWA 2HXYA 2GZAA 3LA6A 4B3XA 1XEWX 4C7OA 1JEDA 5UKDA 2A78A 4D80A 4M9SA 4RFSA 3K0FA 2IEZA 3AKYA 5LPNA 3FDIA 4PC6A 4MH0R 2V7QD 4JIMA 2IL1A 2ODBA 4NONA 4Q7MB 5AJVB 4EKDA 5JWOA 2XSZA 1NY6A 4A15A 2QP9X 3ICQB 2F9LA 1SXJD 3CZQA 4TMZA 2D06A 1ZIOA 2WSMA 4C0LA 1OE0A 3SFVA 3CM0A 3R20A 3WMFA 1G291 1ESNA 2CE2X 2YKGA 2CK3A 3K9HA 4M21A 5FI1B 3LW8A 2ZRGA 5L3QB 1Q12A 5CIQA 4ZKDA 1K5GA 3TAHA 2F1JA 2PZGA 1XXHE 1LFDB 5TB5A 2FV8A 3AVVA 2XZPA 2ZYVX 3B60A 4HAVA 1RRCA 3KJGA 1OIXA 2JJ1A 3GLGA 2CK3D 4Q18A 2ZM5A 4M4SA 4LYJA 4HB2A 3B82A 1KOFA 3GEEA 3EZ9A 2ZRJA 1PUJA 1D2EA 5L3SA 4HI0E 2GXUA 2IK8A 4PQRA 2H57A 3U3KA 3THXB 3TSZA 2N42A 2D4HA 4UKDA 5KDOA 1MKYA 3DKPA 2IS1A 3R7WB 3LBIA 2CDNA 4BFVA 1X8KA 4US0R 5CK4A 1D6JA 4MGIR 2JJ1D 4TZ6A 5EP3A 4BFTA 1JPNA 3K9NA 2QMUA 1NG9A 2FSGA 1KSJA 4JKIA 4LJ5A 3HWSA 2MMCA 1J70A 4ZI3A 4MKHA 4EQ6A 1S9HA 4A36A 1OFIA 3BOSA 2FZLA 3UMFA 4AURA 4IW3B 2EVWX 4JBWA 4IXNA 4L5BA 2NO7A 2KWIA 2OILA 6Q21A 1Q1ZA 4IDPA 1FOEB 1X1RA 4TMKA 2GK7A 3MAAC 4X8LA 1GKIA 1TAGA 1XEXA 3GLFB 2ZPTX 4K8OA 4QFMA 1W46A 2XITA 1P2SA 1H65A 4LV8B 4B73A 3WMGA 3THWA 3K0AA 4P3YA 1FTNA 2R8RA 2JLZA 1NVXQ 5M04A 1OFHA 4B2IA 1GRQA 4TYWA 4XD7D 1DG3A 1HE8B 2I3BA 2X8AA 1T8TA 2J0UB 2IS2A 3K09C 3AVUA 3DM9B 2BV3A 2F6RA 1FZQA 2A5JA 3P1JA 2F7SA 3PEUA 4M1OA 2O8EA 2V4ZA 1EK0A 1OPXA 2OM2A 3W8NA 3T5DA 1CJKC 1N5JA 4I1SA 4P32A 4PPFA 2CHGA 3IO3A 1OT3A 1Q20A 1XTIA 2AKAB 4WXPA 2EFDB 2IF2A 5J5CA 4IJMA 2DPXA 3GJ4A 4NL4H 2ATVA 1Z06A 2OFWA 3EA0A 3A6PC 1W44A 3C14C 1CKEA 3B9PA 5TXGA 3ZJYA 2ZUBA 2WIBA 2RGEA 2JA1A 2X19A 4LZZA 1GL7A 4HDOB 3AQ4A 3KJHA 4QC2A 4D6PA 1G19A 1AGRA 1F60A 4Q9IA 4ERNA 3GQBA 3GJ8A 2YHSA 2IYLD 2XB4A 1E2IA 4OI4A 4YMVA 5LDDC 2PMKA 3WNBA 5C4MA 1NG1A 4KI0A 2VSXA 1I4DD 4AKEA 4ZO4A 2HYIC 2J5XA 4NH0A 3UIEA 3PUYA 2PBRA 2UZIR 3FB4A 2GEUA 2QRNA 3P26A 5L8VA 3D3QA 2BWJA 1KSGA 4O3MA 1NN5A 1FX0A 2C2HA 1SGWA 3AP3A 1JXOA 1JXMA 1E2DA 2GCOA 3CH5A 3AVQA 3WRXC 1E4YA 1X6VA 2ZVPX 3EPHA 4DSNA 2ZE6A 5BWMA 5KPDA 2OE2A 3AVOA 4BFSA 5F3WB 4GZMA 4D26A 3TR5A 1GTVA 2W2TA 4DDVA 2OCYC 4Q9JA 1E9DA 2QROA 4JT2A 5H70A 4KHZA 3SR0A 2NG1A 4K81B 1GFIA 1FUKA 3SYLA 2FJUA 1ZM9A 1P72A 3GEIA 4XVRA 2OEPA 3KFXA 4G5GA 1PUIA 2IYTA 4U7DA 5KNCA 1OF1A 4MRPA 3WRYC 4NPHA 4BUJA 1OJLA 1GM5A 4BWYA 1PLKA 1YZLA 4IOMA 3WMEA 1PV4A 2ZJ5A 1GG2A 3C7KA 4PR0A 1W48A 4O2RA 1US8A 3DO6A 5CM8B 2QAGB 5DSZA 4KBGA 1KMQA 3MWLA 1G17A 1PVOA 5CYPA 4BFZA 3CBQA 4DEXA 1F2UA 3PEVA 3KL4A 2VHCA 3LLMA 1XMJA 1E9SA 4E09A 1Z6YA 3D8BA 1ZU4A 3IPXA 3ZQ6A 3KKNA 3Q3JB 1FW6A 4YMSA 1T5IA 2IYRA 1TEXA 4MRNA 4MDFA 3BORA 3Q7PA 4XH9B 4IOKA 1G8GA 1KAGA 2HV8A 4H1UA 4NU0A 3RSLA 3LO5A 3LDAA 4ZIRA 2C96A 1T0JB 5AUQA 3H84A 5JHGB 4LJYA 3HPQA 2FFHA 1JQJC 1XTSA 1E9EA 1Q44A 1RC8A 2RGXA 5EJEA 2ZSAA 1JEEA 3R8FA 1VCOA 1QHSA 1S9DA 3FVQA 3TVTA 3ZIAD 4RJLA 2ZSEA 2QNRA 2BOVA 1IQPA 1KY3A 3DDCA 2BBTA 4ZDIA 4LY6A 4TQUS 5JI3E 2IW3A 1COWA 2QMEA 2GAOA 3A1WA 2WM9B 2PLFA 1ZVQA 2GCPA 2ZVQX 3LFUA 4I4LA 3NDBB 1Q3TA 2FX3A 3DOEA 2R2AA 1GUAA 4LDJA 4LUCA 3AVTA 1NMYA 1NI3A 1VHTA 1OSNA 1KTVA 1QG4A 1ZM4A 2YJTD 4UXJA 3BD9A 3GLIB 3I61A 1JR6A 5KU1A 4PHHA 5FPHA 4P4TA 1U90A 3R9XA 1ZIPA 5GJWC 3NTUA 3SS8A 2FMXA 4G5SA 1IAQA 2EYUA 4G01B 2OHFA 2FEMA 3VU9B 1OH5A 1ZM2A 2PT7A 3EARA 4Q1AA 4PC2A 4Q1CA 4PC3A 1TQ4A 1XEWY 1CBUA 2GHIA 1SVWA 3PEWA 4LBVA 3P32A 3LRPA 1Z63A 5JCZA 3KKOA 1ZM7A 2WWIA 3TIFA 2A5GA 2ZS7A 2XGJA 2H8KA 4B2PA 1IHUA 4X8HA 621PA 1JB1A 2VLIA 4MUAA 3OIUA 1W0JA 1G3RA 1G6OA 4V0LA 3AP2A 4URWR 4EJSA 2ZTSA 4C30A 2OO7A 3CKLA 2J45A 4OHXA 1OH7A 5IF9A 4DT1B 2W6IA 1KDRA 1G4UR 3EC1A 1M7HA 821PA 2IF0A 2CCJA 2A5FA 2RGNA 3ZVNA 2VF7A 3HYRA 2J7KA 1VCMA 5BN5A 4NYIQ 1W0JD 4DLVA 4A8JB 3QF4B 1J2JA 3BB4A 3K8YA 2ZJOA 2ZIAA 4DB4A 4JBXA 3ZZTA 4B6EA 2XTMA 1CR0A 4QGAA 3C16C 2IYYA 2GNOA 2WPDA 2EU8A 2QAJA 121PA 1Q0UA 2A5YB 4A6PA 4F4JA 2ZRNA 2OUKA 2XZOA 2ZI4A 4Q4AA 2RCNA 4ESHA 1E3MA 1W36B 3IGFA 3NKVA 1AN0A 3KXLA 4MKFA 4JVLA 1YE8A 2WJVA 4NCHA 4B43A 4XVUA 1QHNA 4DSUA 4URYR 2DB3A 3FTQA 4EAQA 4V0NA 2O8FB 3U7FB 2WPDD 3L43A 4Z8XA 2FSFA 1G16A 3GLHA 2AK3A 1NIPA 3M1IA 1T4GA 3PV0A 2P5TB 3CB4A 4HUQB 4TT3D 2VHQA 5TY0A 1E2KA 4U02A 1E0AA 2QAGC 4JVMA 4C0QC 4A4DA 3WHKA 4I1VA 3X1YA 4AD8A 2P65A 1GWNA 4B48A 1FQKA 4WXRA 2ZROA 4HB4A 4YXWA 1AKYA 3BGWA 1WE2A 1U0LA 1KHTA 3LD9A 2QMOA 3HR8A 5DISB 4NCKA 2JJ2A 5EXTA 2NPFA 4CEIA 3UWKA 2QP4A 1XF9A 4M22A 1SXJB 4DUGD 3CF0A 4MKGA 1JQLB 5HKKA 4C7OB 1LF0A 2REBA 1AIPA 1RVDA 3NHAA 2F43A 3EWSA 4C0KA 2V6IA 3MFYA 3PIRA 3K0FB 3IBYA 3LVQE 3PR1A 3HU2A 3H0KA 1E9RA 1BH2A 1II9A 1JJ7A 1KJWA 4QNMA 4HB3A 4PANA 3KZ1E 4C0HA 2CCKA 4JLPA 4KJZA 2JJ2D 3BB1A 1P75A 3BXZA 4PAQA 5G53C 3T34A 4GZLA 1LS1A 5HKKD 1E2GA 1YR6A 2XXAA 2WWWA 3B7GA 4KSCA 4OHWA 3W6PA 1GNRA 4V0OA 1UADA 1UFQA 2Q6TA 3BBPA 4ACAA 2WJYA 5DE3A 2GJSA 2WMOB 1WA5A 4QL3A 4HLUC 2PZFA 3LH5A 3EW9A 1AZTA 2C9CA 2N46A 3PITA 3QXXA 4U00A 4B3FX 4NYIR 1UKYA 4DHEA 4HZIA 3PVSA 1FMLA 2QU8A 3T1TA 3GEHA 3QXCA 5G40A 2FEOA 4LJ7A 3B1VA 1KI8A 3CF6R 4W5WA 1CRPA 2CNWA 3QPVA 2J59A 3LAWA 3GFTA 1U9IA 2VBCA 2ZSBA 3IKJA 1JALA 5CLQA 1VG8A 4DLTA 3IPYA 2GKSA 1JI0A 2GZHA 1XCGB 1ZM3A 2EFEB 1VMAA 3WBJA 3B1YA 1QDEA 3OZXA 4TL7A 1G21E 4Z54A 3SU8A 1MRSA 3RRMA 2R6GA 4MRRA 4D0LB 2HT6A 3AM1A 1E9FA 2WAXA 3FPAA 4M1KA 1YU9A 2LKCA 3WP1B 4W5JA 3MGCA 3OF5A 4MGZR 5JFGA 1P9RA 4OK3A 3WNCA 2CHVA 1AM4D 2GJ8A 1U8AA 1W4RA 1R10A 1W4CA 4EQ6B 4S35A 2IYVA 2OCPA 4OJQA 4WVFA 5EE1A 4JLAA 1QHHA 2H7VA 3QQ5A 1CJVC 4DRZA 3FHCB 1O87A 3EWAA 4CW7A 4Q7KA 5TDHA 2JLYA 1SVLA 4Q7JB 3DKVA 2AFIE 4LWZA 1WF3A 3N2EA 4QRHA 3LXXA 3VR1A 3MUFA 3SJZA 3P4XA 4B47A 5K8IA 4JVNA 1Q22A 4C4PA 2G6BA 1G3IA 4QM7A 2ZYTX 5EZ5A 2GDJA 3GLHE 3FFAA 4JYBA 4A2PA 3CONA 2DFLA 1SKYB 4XVQA 3U7HB 2ZRCA 3DMNA 4I1UA 4A8JC 1ZC4A 2BVNA 3RC8A 2VF8A 3L8ZA 1E2NA 4KITB 3Q9LA 3V4FA 4L16A 2ZQ5A 1QG2A 1DAHA 1E0JA 3LQQA 4DXAA 1ANKA 1TL7C 1CXZA 2ANBA 4LHXA 4KSBA 3A1TA 3WHLA 5P21A 3BB3A 1N3BA 4NYJQ 1KI6B 5CB8A 1W36C 3OE7A 1G8HA 4UJ5A 5EQTA 5IK2D 4N3NA 2X2EA 2QBYB 2RHDA 1X1SA 5FOWA 4TLEA 2JAQA 5H68A 4GP6A 3CH4B 1XD2A 4RD4A 4E07A 5BN4A 2B7CA 2JIZA 5FOVA 1FNNA 2WWFA 3WNDA 3L8YA 4QHTA 3U2QA 3AP1A 3U6BA 3K9LA 3CX8A 1XPUA 1A7JA 3FKSA 5BN3A 1IY2A 3OE7D 4Q5IA 1SHZA 2EFCB 2FU5C 4TQ9A 1HYQA 3RVBA 3T06B 1E2PA 2FPKA 3KFVA 2GVDC 3A4LA 3CRVA 3HDTA 3RABA 5FOXA 3SJAA 4D82A 3RDPA 2GCNA 2YV5A 1P4SA 2YNMA 3VTKA 1XXHA 3FKSD 1CJMA 1DELA 1FX0B 1Z2CA 2P67A 1XCPA 3MJRA 4DSTA 1SXJC 1E6CA 1CP2A 1XD9A 4FIDA 4II7A 4Q1EA 1ZUIA 3CNNA 3RRYA 2FN4A 4LBWA 1HTWA 5KPJA 3TK1A 4O0MA 4UXIA 3CRRA 4GMXA 3RYTC 2ASEA 1DS6A 2WVJA 4ILEA 5CDFA 5E7JA 1E9AA 3CR7A 3U3MA 5BYJA 5IT5A 3QSYA 2PT5A 2FNAA 4BASA 1HEIA 3CPHA 4CZ2A 4V03A 2VSFA 2A5DA 1TUIA 4QJ5A 3P27A 4LK2A 1II8B 4XIGS 3X1WA 3NVAA 4Q02A 3LQRA 4M1WA 5AJWA 4KVGA 1JR3A 5B30A 3K0SA 1KAOA 1ONBA 1QHXA 1RJ9B 2W83A 1VECA 4MGYR 4BQSA 4WW0A 3QVUA 3ZYCA 3QG5A 2BHRA 5SZKB 3AEZA 4ASUD 5EUMA 1TUEA 2B8WA 4KCGA 4XTRA 2Q3HA 3GJ5A 2HDNB 3GJ7A 5DI3A 3TW4A 1N6NA 4BLOA 3SQXA 3IUYA 1P62B 2NO9A 1I4TD 4A0HA 4B34A 5EP4A 1IM2A 2WICA 3OFND 4AK9A 4LC0A 4BFXA 2KE5A 5DIFA 4RKFA 2FWRA 2O5VA 4PC7A 1DEKA 4QNRA 5JSZB 3VR3A 1J8YF 2K5UA 4FXPA 3UANA 1NN1A 1OV4A 2WJJA 1EESA 2ECKA 2HJVA 3HJNA 1VCIA 1ZD1A 2EFHB 4XTCS 2FDCA 4MYCA 5FFMA 3KQNA 2R6DA 3EPKA 3NEJA 1JJVA 2OSBA 1IONA 2CE7A 1DAKA 1Z6TA 1FP7A 2NZJA 2NPIA 2ZETA 5GJBA 3IQWA 4P4SA 4JJZA 2BIFA 5FUVA 3T1QA 3DVLA 5AUNB 4H1VA 2J0SA 3KB2A 4OHYA 1Y63A 3GJ0A 4KYUA 1OXSC 5F98A 1YZGA 5DHAA 3PFIA 4PPGA 5KSPA 1UF9A 3U44A 1HA3A 1CU1A 1S4QA 4Q7LA 5CIWA 5FPSA 4HLQB 2WJHA 4RZ3A 1NF3A 5FL3A 2F1HA 1XJ0A 2IUSA 5B2ZA 2G9NA 5FTLA 4C2TA 4YLGA 5JLJA 2Q3FA 1MH1A 5KDLA 1VCNA 4V02A 2ZREA 5KHOC 2B92A 3EIQA 3PUZA 4Q9KA 5AJZA 3IQXA 2XSZD 3EIEA 1JAHA 1FTSA 2QGNA 1QVRA 1U94A 3FMOB 4TMTA 2CHQA 2BMEA 1OW3B 4BZPA 3FYHA 3A1UA 2VHTA 3UK6A 5J4KA 5TMPA 1KMHB 1BMFA 1G1MA 4B32A 2PCLA 3GP8A 3K9GA 5FTKA 5JRJA 1ESMA 4FI3C 4JLVA 5JMTA 3U61B 2MSCB 1SVMA 5JRZA 2JATA 4EJSB 3PUWA 3MG9A 1Z0FA 2FZ4A 2CLSA 4TL6A 2V55B 1TQ6A 3AKCA 4DSOA 2YWEA 3KXKA 1SQ5A 3LNCA 3VR5A 5CDFE 3U7GA 4ZV4A 2CLCX 2MSEB 4JJKA 4JLBA 1CJTC 1J7KA 3FE2A 2BM0A 3NH9A 2OESA 2ZYUX 1BMFD 1Q1QA 3BK7A 5J4VA 2DYKA 1TQ2A 1OH8A 2VPPA 3KTAB 3WYFA 3RAPR 4KFUA 3DHWC 1XTJA 3Q72A 5B57C 3FHOA 3O8DA 5BQ5A 3A8TA 3CPEA 4TMXA 5J4HA 1KKLA 4KFSA 1JR3E 2YINC 4TLCA 1R8SA 3BH7A 1DARA
chains in the Genus database with same CATH superfamily
1A82A 5CNKA 1RKQA 1KI1A 1PBTA 3PHGA 1Y5MA 3GT4A 3PGKA 2ZUSA 3JQAB 4A2CA 2HUNA 1FRFS 2ZJ1A 3FLAA 3TTSA 3BL5A 1GKYA 4EFKA 2AOXA 3SE7A 3IOMA 1HNNA 2BHNA 4RC9A 3WJAA 4RVGA 4F12A 4XIYA 1KA9H 2GEDA 3TRIA 1QGAA 4Q9HA 4DR6B 3SBDA 3EVNA 2PLAA 2V5UA 5BOSB 1EM6A 2VDWB 4M8KA 1GTMA 2WJ4A 4XUCA 2PWZA 4D9HA 3ABQB 2PWPA 5JYDA 1QCZA 3FSRA 2RIPA 1RPNA 4UHHA 5FO1A 5AICA 3KQHA 3KHKA 4E1VA 2Z3ZA 4ZOLF 4EO7A 4BP9A 1L6IA 2P2LA 3BRQA 5BUQA 2ZB2A 3R9IA 3T3DA 2RHMA 5IX8A 4R4JA 2FRVA 5TQJA 2VL7A 2YWDA 3X2SA 2PH5A 3IIKA 4HUTA 1OZ0A 2FW9A 3E4CA 2DY0A 1Z0DA 2PT9A 2RKOA 4KAAA 4X84A 4ALNA 5ALUA 3SF8A 3W8RA 4LJLA 4BMPB 3ER8A 1VIAA 3FJOA 1RCFA 2IIBA 1T8SA 3HU3A 1XNGA 3LGSA 1SBCA 4K2HA 4YRNA 1VSQA 1Q3KA 4UPDA 1FTGA 4L95C 1Z37A 2WNHA 3PYMA 4ZCLA 1G63A 1AGXA 3JD2A 4HDNA 3NDRA 1WDKA 1N9GA 1U4NA 2BMJA 4JUFA 1FFGA 1GZHB 2EQBA 2W00A 2IOFK 3NDJA 1UEIA 1GKUB 3UMBA 3EH2A 3U7IA 1H0HA 1KSFX 1DB3A 2VF5X 2YWFA 4FOPA 2ZJAA 5IHXA 3U9TA 1PJRA 3QMPA 4WKOA 4F7WA 3CZCA 1L5VA 2CJWA 3KR1A 5KVVA 4GL2A 2X8JA 4DV0B 4AI6A 1WQ1R 2JLUA 4L02A 5BNTA 1AS2A 2PSHA 4WGFA 2Q6OA 4XGNA 3V7YA 5GP1A 3KQWA 3J7AC 2AD5A 2YWCA 1Z15A 3NPAA 1B74A 1W85B 1ZMXA 3WLOA 4YRFA 1OZAA 3RS2A 2O8DA 4OH1A 2WFZA 2QUHA 4Y9UA 1KK0A 2FZ5A 2TSYB 4E5KA 2ZJ8A 1KFEB 1W581 3FKQA 3D1JA 3LOUA 3LT1A 1W5FA 3VM6A 3ZBTA 1LX7A 5CB0A 4Y6LA 2NQ8A 2QL9A 1C8BA 5F51A 3R7FA 5CT5A 4A10A 1QONA 3VR2A 4PO3X 4BO2A 1OAKA 5IBPA 4DA4A 1KEPA 3LY7A 1RRVA 4KGZA 3MT8A 5EZYB 4CTJA 3SG0A 2H1VA 4ZN6A 4DCVA 3PL5A 4R2XA 4MQEB 3FXAA 2DPLA 2VZ0A 3GLSA 1Y4DE 4IWXA 3HSKA 3Q15C 4RZXA 5LUAA 3UZUA 3I53A 1ZD9A 2BCGY 3B89A 1T1RA 1CF2O 1B73A 1DQSA 4HTFB 1ZCAA 4R69A 3KKQA 3TW8A 3UMSA 4DJ5X 1JZQA 2D62A 3BHNA 3HLKA 3N3BC 4L6IA 3GH1A 3VNAA 2JAOA 5KJ6A 1ID8A 1PR3A 1LZLA 1MO6A 2BEWA 4OJYA 3KPVA 5DT9A 5GMOA 3JQEA 2JFFA 4CEHA 2ZGVA 3PC8A 3QBDA 4MW0A 3ROQA 4TV9B 1V5EA 1FFYA 4MRAA 1QHEA 2JAXA 4PSVA 1QGUB 2Y1KA 3FWPA 3MTBA 1JV2B 4AM8A 1D0VA 1VBKA 4EMSA 1P1JA 3LYAA 3QLUC 3AQIA 1TNDA 4B0PA 3NYWA 2Q7XA 2KJQA 1FQOA 3UMVA 3RVMA 1M7GA 2H92A 4AN0A 1GGJA 5EN4A 4DV5B 3SQWA 2Z3VA 3OCXA 4GDMA 4PICA 3AFOA 3QEMB 1AU9A 4A0FA 3UA3A 5CDGA 3QI7A 3NV7A 1PI3A 2CY0A 5JOQA 2ILTA 3V3KA 2GVZC 5CITA 1Z0SA 3TLCA 4D4JA 1WZ2A 2QW1A 1C9EA 1HZJA 3OPNA 5MDHA 3HEMA 2BPOA 1RP7A 1MHPA 3NOOA 4B3GA 3OY7A 3Q4GA 3KB1A 1AK2A 4MRMB 1K63A 4MGKR 1XQ9A 5LNK1 5ICSA 4JEUA 4C0XA 2HA0A 1I2MA 2DECA 2IKSA 5A0FA 1MGOA 4WBNB 2OGWA 1NBME 1PVVA 4MW7A 4CLHA 5LMUB 2F8MA 1IN5A 3GMDA 3VHXB 1UWLA 2AKEA 1D1PA 4G1CA 2BI4A 5HMLA 4F11A 1P9NA 4UOZA 1Z7YA 1DGQA 3HDYA 2W90A 5AIAA 1E3DA 1J8DA 2OAGA 3H2HA 2E4YA 2XDWA 3I8XA 3L77A 2NTEA 3MPOA 4I50A 3REFA 1QXSA 3ERCA 3ZE9A 2GRUA 1XU4A 1Q1GA 1Q7GA 3BMQB 4FE3A 4N49A 2C7VA 4P7GA 2W2KA 1HT0A 5CM9C 2IU0A 3WIEA 1BDIA 3BF8A 4BVBA 3QKRB 3EK2A 4RTJA 1J5PA 2VC2B 5C34B 3MOSA 4HJRA 4KQGA 3T9BA 1MB2A 2PSDA 4RSMA 4E32A 4JLOA 4JLDA 1FUYB 1U7TA 1MOSA 1BYIA 1JLHA 4RLHA 2HO5A 4J2HA 4JYPA 1K98A 1NPDA 1TTPB 3OLYA 1K75A 4IIJA 4MUGA 2RAPA 4UEKA 3GRVA 5HPYB 1FTWA 1RJDA 3EGXB 3OAAA 3HN2A 3QLJA 1GAWA 3NHSA 4ZQGA 3SIRA 4FLFA 1C14A 2V6GA 3GL9A 2GD0A 1I13A 4J76A 3TZLA 3I9V1 4ZOBA 2X0EA 3QX3A 1NP7A 5IG2A 4QM6A 2ILVA 3OOJA 4PVCA 1C1YA 3J81k 3H97A 1N3YA 3KQKA 1BVHA 1UC9A 1VKNA 1V1RA 5CLFA 1N32B 2C77A 3F3YA 2HQ1A 2J9RA 1DEOA 2EFJA 1FX1A 3H17A 3O9ZA 2PJUA 4XGIA 3GUZA 4RGYA 5GVRA 4B6JA 5JAHA 1XZLA 3P4YA 4NK5A 3JVIA 2XYVA 1QV6A 2BLNA 2IZ0A 2XBLA 2DWQA 2XMPA 2ZYWX 3ME5A 3OAAD 2F9FA 3ZE2B 2CLIB 1QPZA 2RGDA 2A30A 3AUFA 5DTJA 4X0EA 5D3MB 1EVJA 3RYIA 2V6BA 3V8NA 3IP8A 5T7BA 1ONOA 4F1WA 2FR8A 5EG5A 1MH9A 3AILA 1YGYA 4ZEXA 2JAHA 2HHLA 5T4EA 4I4IA 2HGSA 1E0KA 1UBLS 2O9JA 3HXMA 4NS4A 5AKKA 1U02A 3L7BA 2W8BB 3OOSA 3U9LA 4PXAA 3WMRA 1XU7A 3N76A 2QB5A 1MJFA 1QH8B 1VP3A 3Q3VA 5JPIA 3R7WA 4NXMB 2V54A 1NKSA 1GEEA 2OHHA 3F5MA 4C5CA 1DQZA 2X1HA 2AFIA 4LWPA 4KXXA 4LQ4A 2H5EA 2VIIA 4LHSA 3EIUA 1X7ZA 3LBHA 2QRQA 2AJLI 2R8BA 4YONB 5FPQA 3X1XA 5CXSA 1JQ5A 2AC7A 3GH3A 3TEMA 2X7XA 5LYJB 1I2CA 4ZPJA 3RHFA 3QVKA 4DZTA 5CBPB 1TK9A 3KJIA 3VZRA 2DWOA 1L7PA 3R0VA 3TZBA 2C2XA 3ORQA 1J4AA 5D85A 5T4FA 2BDTA 2WWXA 1ZQ9A 5DXFA 4DB2A 3DTYA 5F9MA 1E58A 1K3TA 2SCUA 4HQRA 4L5JA 4RADA 1TM2A 3TJZA 4HVLA 5JCXA 3MRSA 1L5FA 4KLZA 3ZV3A 1WBDA 1P7PA 2QRZA 3PE4A 5BWBA 3Q9NA 4JI1B 3AV3A 3IAHA 3SHTA 2WF7A 2VTDA 4LQDA 4QXOA 4RIEA 1EWKA 1H2HA 2FP4A 2WK1A 4AXBA 4DV3B 4J0GA 1OX6A 4FMDB 2P9JA 3EB9A 1ULUA 1ZCJA 2OPBA 3E22B 4BRUA 8ADHA 1Z82A 2J0UA 3ZQKA 3I4FA 4MS1A 4OXKA 5E6UA 2IDKA 2J3IA 3I4LA 4R5HA 1QHGA 3RSCA 1E99A 3HMKA 2VHEA 4ZVUA 2PUAA 4OVKA 1M8FA 4ALKA 4F1KA 3LBAA 1VPLA 1G7SA 2BDEA 4S2EA 3DFFA 5FBVB 4EFDA 5LOVA 3CS3A 2J3EA 3C6ZA 4C0BA 1LNSA 4WEOA 1AMOA 1AKQA 4RXTA 2VJCA 5CTAA 4G37A 1ECPA 2BF7A 1MOQA 3R3WA 2JLBA 5H02A 5FNVF 1JIJA 1X2BA 2KHZA 1O94D 3H6HA 5LZ7A 4HLCA 3IESA 5LZ5A 3SHOA 4F4HA 1V8OA 1P4RA 2L2QA 1YZFA 2ZTHA 1K86A 4JJFA 3GNSA 4IYJA 1P7CA 2AHOA 4D43A 1M7BA 1BG6A 2OBFA 4CDNA 2D6FA 2YTZA 5A5EA 1NASA 2VJNA 2HJWA 4OFBA 1UK8A 2ZU6A 1JKXA 3G17A 3OQJA 3OZTA 3D6UA 5T57A 3TRJA 1GNLA 1L1QA 2HREA 1TX4B 3DP7A 4FMCF 3OA0A 4RF2A 3TTUA 3NC0C 2I0FA 2HZBA 5CLJA 3L06A 2QVBA 4XJVA 3TM4A 5CGQB 4WT7A 1I2DA 1SHLA 5AVZA 1G3QA 3QXSA 5HX7A 5CUQA 3ASYA 2ZRMA 5GADl 3OEEA 1DAMA 2RHOA 3BD7A 1NRIA 1I6KA 2B8TA 3CZ5A 5EA2A 5DEOA 1OI2A 3VPXA 1KJNA 1PGOA 1W49A 4YP6A 2ZS9A 2BGIA 1P1KA 2QL7A 3DZCA 2PRZA 1ZZGA 2J6BA 1V9CA 1WL8A 1KH2A 1E4VA 1E2JA 1QBKC 2B5OA 4IMIB 4JSYA 3I1IA 3KCNA 4RVSA 2CNWD 2C3OA 4HLDA 5F78A 4NYMR 1QVWA 2PSJA 1UKEA 3AB7A 1KNXA 2WWRA 3L2OB 4NZOA 2ZRLA 5G4KB 1UBTS 1SVIA 2B5WA 3TZHA 1IWPB 4ZHSA 4IUBS 1NUTA 4DEYA 2VYQA 4ZT2A 4FS3A 1XJ5A 2WB4A 5LKRA 1WDWB 4FYKA 4H31A 1M1XB 4HQOA 1KSHA 1S8AA 1T9HA 2WU0A 5AOAA 1STOA 2NZ8A 2C9OA 4EPRA 2Y0PA 2BONA 4ATNA 1P6QA 2XUOA 4JQYA 3U7QA 1MIHA 2GVNA 4HSGA 3PPXA 3WO0A 1IFXA 1YDFA 5BVHB 4LMPA 4AYWA 4QSMA 2O07A 2B3DA 3MCAA 4KXNA 3A2LA 4OKIA 1RLUA 4TUYF 5H8WA 1FJGB 1FP1D 3VGPA 2IVZA 1KU6A 1VOTA 3O83A 2OQ2A 3OFJA 3WBFA 3EDMA 5JCOA 3ELYA 1IL0A 1ULTA 3HCFA 5E4TA 2QAGA 2AJ8A 2ZR8A 1VG0B 2G4CA 3CLTC 2HCBA 3OZSA 2JH3A 4CMIB 3BFKA 4CUJA 4AYXA 1O0BA 1PGJA 3WL5A 4U2KA 4ZI2A 3ZWDA 3IE0A 4U7GA 1GVNB 1MLDA 4C76A 4DLNA 1IWBB 4CODB 4DMCA 1KYXA 4N8EA 4E46A 4PG8A 2DJIA 3B13B 3C3AA 4GECA 1UZLA 1PZMA 1T2CA 3AHFA 4RW0A 3IHTA 3A3PA 4UBLA 5EPUA 3I0MA 5CA1F 4S0XA 4CL2A 1MEEA 3DAGA 5JS8A 4FQ5A 2B0JA 3E4DA 3V3TA 4D0NA 1U81A 1XZNA 4H0FA 3IOEA 4LF5B 3I28A 2I67A 5EY5B 5F5LA 1J22A 1SA0B 3U62A 1E7YA 3TSAA 1BYUA 3F71A 1CC1S 1YQWA 5JS7A 1KQ3A 3NM6B 4B6FA 2Q3EA 2HEGA 1RPZA 3KFLA 1WRBA 2F3SA 3LF1A 5IAEA 2C4UA 3G5AA 2C2WA 1UPAA 2W2XA 4FYMA 1JECA 2DFTA 1WBBA 1E1LA 2EC5A 4ONEA 1TT7A 3HJFA 2EKPA 3NBXX 3EYWA 1KJ9A 3ICPA 3JQ9A 1S01A 1BCRB 1MJ5A 2QTVB 1T3TA 1UBMS 1GLGA 1SN7A 4FILA 4H7JA 1ZR2A 2PYZA 2HY7A 1MV5A 1NVWQ 3RHZA 3ZLTA 2I1QA 2MYTA 3WGIA 2XCOA 3FWKA 3V2IA 2BGKA 2D0PB 2JGNA 1HDIA 1C9MA 2PUTA 3PFKA 3PNLA 3PR2B 4WLNA 4RTNA 3BRSA 4KRFA 4IVRA 2WQ7A 1E79A 5B6JA 1CYEA 3WOVA 2NMVA 2DCUA 2AR9A 1KI2A 3NG1A 1U28C 2YIMA 2Q7DA 1KDPA 2HJGA 5ALJA 1Z2OX 1CUBA 5JARA 3EVZA 2WKQA 4JGBA 5F52A 3D59A 3ZKAA 1NVDA 3ZHVA 3N39C 1M8KA 4EKNB 1CRWG 3QA9A 2P6PA 1NR5A 1EB8A 3PRYA 1N6RA 4M55A 1QBGA 2GCOB 1NQVA 5JVDA 1DKLA 1VHDA 1ICEA 2PQMA 2YWRA 4NMXB 3I2YX 3PP8A 5DN6A 1Q19A 2O3TA 2NVBA 4NRDA 5B7QA 5BPFA 4AU1A 3CEPB 4BMVA 1Z7EA 2WF6A 4G4SO 3DAPA 1T26A 3A58B 1N1GA 5KWVA 4KKVA 3T1TA 1YWGO 2I3AA 3PTAA 3G0CA 5H81A 2C2OA 2IXEA 5JTTA 2NV2B 4O5AA 4QOGA 3K20A 3URKA 4WAUA 1NW9B 2YNMD 4MA5A 4MXDA 3ENQA 4ZI7A 3N2KB 8LDHA 1K7XB 3NHFA 1O5IA 2FJ0A 3M4JA 5E38A 4F7DA 3ELUA 3FAKA 5DN6D 1MX1A 3O4FA 3QMVA 2A1TS 4I9GA 1OB2A 5E2AA 3HDQA 1EFLA 2CVHA 2ZE8A 2VNIA 4PQFA 4RHXA 1U3CA 1F0KA 1SH7A 2XTAA 2OCBA 3HKEB 2IA5A 3A3KA 1I6LA 3AY3A 4DGQA 3CUVA 3GVXA 1FSGA 3I5UA 4FFRA 1XBTA 3OJOA 1X70A 1YR7A 2CUNA 4HCJA 1A8IA 4I99A 4OHUA 2O2ZA 1KL7A 3WDKA 3L8DA 4YI3A 1AZSC 1L4UA 1PQWA 1L8QA 2BFOA 2FUG1 2WV9A 2YOFA 4Z86A 3UPTA 4O4IA 3JQFC 4W5RA 1AOXA 1Z4PX 1PRYA 3FGNA 3GEMA 2QTHA 4OL9A 2YZKA 5DT2A 2I6FA 4D8XA 3HV0A 5IJ0B 1OXMA 3R3HA 3OM8A 2XHZA 1ZW6A 3AF3A 4F38A 3H04A 2AA3A 3NGLA 4B3CA 3MHTA 3JQRA 2QENA 2HM7A 4MQ5A 4YB8A 1DFIA 3MWGA 1RS0A 4M9CA 3RTDA 4GDFA 2QLMA 3DD5A 3DL4A 5KTSA 2WSBA 1WB6A 13PKA 3K2IA 3RS7A 5ITSA 3DO5A 4B74A 4CQLA 1XYVA 1HK7A 5I6DA 4IIVA 1ZN9A 4R7ZA 1NW8A 4Y18A 2Z58A 4KFTA 1Z45A 1EBUA 4DJEC 1BDMA 4FVTA 2CDRA 2R6JA 5KOJA 1QC5B 1Z18A 3H2GA 1CR2A 4R9RA 3F5SA 1GV1A 4GIBA 1Q0PA 2BJWA 2VUIB 3H1TA 2D1TA 4LGYA 5KUTA 1ZNZA 4G09A 3I3SR 2GARA 1LJLA 4EY4A 3CT6A 4I3HA 3PJRA 2XB2A 1T9DA 3A9CA 1LV8A 3BGIA 4JT4A 2OCGA 1M34E 4XFDA 3SVZA 1K68A 4K1LA 5JHHB 1WTCA 2OP0A 2RMKA 4I0WB 4UZFA 3OCJA 3ZZUA 4HKTA 1UAYA 4M98A 1QZXA 3BFXA 4PYJA 1WOYA 4XE5A 1N2CA 3EAGA 5ILQA 2AX4A 3D7KA 3O9MA 3DTNA 4N3CA 3DHVA 3IJ5A 1IN6A 2XNSA 1DC4A 1XHEA 3QY0A 2ZATA 4WJLA 1OD6A 3DYIA 2XCRB 3GJ6A 4X00A 1X1DA 4L73A 2HDWA 2G40A 2MYPA 3E03A 3JSAA 1E6UA 5AJYA 3V8VA 3ADBA 3BL8A 4KPYA 2GAAA 3HS3A 5KNLA 1ORRA 1MOZA 4HH1A 4EFMA 1VKRA 1Y6JA 4B4OA 5C37A 5KNBA 1JHYA 5K0CA 2XUJA 3PFBA 4Q3AA 4Y9SA 1MABB 4IDCA 1NURA 5AK3A 1DEHA 3VJMA 4YAIA 1O97D 5JS6A 3KUDA 2FN9A 1ZIDA 5I9MA 3PF8A 3PICA 2DETA 4KPUA 5AESA 4QGGA 2G0NA 1HNXB 1MD9A 1Q0QA 1HLFA 2XMCA 2H31A 3FPKA 4V0RA 1F6BA 3R5SA 1N6KA 3BQ9A 3OHMA 4II2A 4KXYA 1L5SA 2EZ9A 3EC2A 4V2IA 3T7CA 1T3ZA 1XZAA 4MVJI 3MINB 4RY8A 5KNBD 4EUKA 1Z6AA 5H7XA 2NUBA 4JODA 5IH7A 3GOQA 2B78A 3P9XA 1DCKA 3U6KA 1NAHA 2NOAA 2G5PA 2YWHA 1KZ1A 4QNNA 1QV9A 1JQKA 1G18A 3CNEA 3CRQA 4LHWA 5L7YA 3WLAA 1IZ9A 2VKQA 3AXSA 4GMDA 1KQNA 3UXMA 2MJLA 4OM7A 1D6NA 4CI0B 1EJ0A 1Z6PA 4YMWA 3H2YA 3CO5A 2QD4A 1LI7A 3AKEA 3IDQA 1H4SA 1JG2A 1A76A 2D1YA 2ZBPA 3MMPA 5AO9A 5IYZF 1JS1X 4NENB 4JI5B 4DIDA 1F8UA 1X7DA 3AHIA 4WA7A 4DBLC 1JHVA 2X1LA 3DNMA 5M2QA 4MGHA 4JASB 4YASA 3G89A 2YJNA 4ZZ0A 1TTTA 4HYEA 1DAIA 1TECE 1C0PA 3ODPA 2F4VB 1FP4B 3SPXA 5J4YA 5HZHA 1JI3A 1OIWA 1RTKA 3NWJA 4PQGA 2BZSA 2HSGA 2XE8A 5JROA 1GDTA 5E8JA 5EKXA 1OLUB 3W7VA 4BFCA 3PC6A 3FH0A 1TMKA 2X5NA 5FI5A 3D5TA 4G1BA 3G5UA 4D3DA 4Z51A 3JQGB 4K2AA 5T4HA 2CEAA 1FFXB 4HAYA 4KYIB 1SWWA 2PSSA 1RKVA 5LL6P 4F8YA 4UTOA 3DGEC 4PHFA 1QH1B 3MAJA 5HG0A 4PZ0A 5ERGB 1CUYA 3EEBA 4J03A 2EFYA 4MS3A 4KRXA 4QODA 5HP4A 3BL6A 3AI7A 3YASA 4QT4A 4IPTA 1L5ZA 2QJRA 3HGMA 5KSZA 3E9CA 5CNJA 2HWXA 1OA1A 3EA5A 5F1YA 2ZRFA 3KEQA 3I37X 3P2OA 5KI6A 4OUDA 1M0TA 3K05A 1IQ0A 2HXSA 4NFLA 3KAQA 4UMVA 5ANRB 4AF7A 4OUKX 3E53A 1U0HC 1Q2XA 2C8LA 3L0YA 3WGOA 1Q7RA 2B69A 5AVWA 4CEIB 4BLSA 5FUQA 1IHYA 5F21A 1XCJA 3GBSA 2AK2A 4CM4B 3O8QB 1J9GA 1C0IA 5GQSA 4XWKA 5I9IA 2Q99A 1YVPA 2YFKA 2ZT8A 5AW6A 4XDZA 1FFCA 4NAHA 1PX2A 1EHCA 2OORA 2YJ3A 3NBFA 3B1ZA 2YRFA 4EG5A 2XVMA 3KWJA 3WLEA 4U5XA 1YHZA 3C4JA 4ROTA 3P2JA 1UJ5A 3EASA 4DJTA 4DY6A 1YS7A 4OQPA 5TARA 2I2FA 2P79A 4LGCA 1XZJA 3LDFA 5BYBA 2GPBA 2UZAA 3DOCA 2J33A 3P9CA 1TGYA 4TVBA 1FQWA 4L2IB 1XHFA 5CD1A 1D1SA 3G6KA 2QBYA 2EX0A 2PA3A 2QMYA 1L5HB 2OCIA 3JASA 5HYVA 4Y1FA 5DRTA 4ZP1A 5FAXA 1ABBA 3U3RA 1MFZA 1TCBA 3PQ6A 1CQPA 2Z6VA 1BD3A 4Q3KA 1X15A 5DEIA 1GLNA 2RH5A 1IHDA 4HEA6 4TV9A 5LB2A 5EP2A 2O7SA 5KYWA 4AJKA 3P0FA 3RS3A 3H5TA 3ESYA 2AN9A 3R4VA 4J16A 4KDRA 2NT3A 3SXUA 2EYQA 1QIKA 1KO7A 2ZSHA 3OPMA 1Y5RA 4AY6A 3V6LA 1U3UA 3LRTA 4Q01A 3TX2A 4CCWA 2II6A 1JLRA 1N7IA 4GRAA 1ZINA 4F5DA 3IX7A 5GOTA 3VFDA 3CIOA 3NLLA 9ABPA 1NR1A 3VVLA 3DTVB 1DXHA 2J07A 2X9VA 3S2SA 1Q17A 2ZZNA 4HBGA 4K9OA 4U7JA 3TOXA 1WU8A 1ZL0A 3A6KA 1HYBA 4F3KA 2GM3A 2GF2A 1RR6A 5DM1A 4MCAA 1ZGAA 1VSVA 3P20A 4I81A 4ADSG 2QZ9A 3HBFA 4KNVA 2Q4RA 4FCTA 3N7UA 2P1RA 4MQFB 4RMNA 3RS0A 2CXNA 2PEZA 4B4KA 1J1IA 2ORIA 1J20A 4BNKA 5C8YB 4NCAA 4GQAA 2DP4E 1QQ7A 2GEVA 2JPDA 3AF4A 4ENTA 2A1UB 4Z53A 2CDCA 4H17A 4O4HB 4BGDA 4LY0A 4JBGA 1E4OA 2IYPA 5DYIA 1CETA 4N01A 2GBGA 1UKZA 3LT0A 4ZGGA 2X1VA 5FYDA 4K0KB 2ZUWA 4GXNA 3QNUA 3FTEA 3V2UA 3DMGA 1XWIA 1G2OA 3NC1C 3T7SA 2JRLA 3U4IA 3LQYA 5EMNA 3LGAA 3N0VA 5IJZA 1E5XA 1IH8A 1II8A 2XXJA 3DOUA 3LT5A 5T4BA 4CTKA 4U2GA 5JRDS 1JLMA 1WULS 3IXMA 4XGRA 2OD2A 4YT5A 4MO2A 3ZGXA 3ROKA 3DZGA 1DPFA 1PWEA 4C5AA 1JTEA 2PL5A 1CZLA 4GLJA 2PFGA 2V8OA 2RGNC 2ZK7A 4OBEA 5KNDA 5FX2A 2AF3C 1RJ9A 5K09A 1Z6XA 4QEZA 5MN5A 3Q5GA 4D46A 5L3VA 1PNVA 4OQXA 2W4QA 2WFMA 5AI4A 4BQQA 4BEBA 5B6PA 2PFKA 3KEOA 3I12A 1YTUA 3O1JC 1ZMTA 1WZNA 3G23A 1XMIA 2CUKA 3S1AB 3ND7A 1M66A 3CUTA 2YV1A 4IICA 5D86A 5LA6F 1WD7A 2XQKA 3GPCA 2D7DA 4HHEA 3NMUF 2I4IA 5JC1A 4JWKA 1YZTA 1NVVR 1U04A 3L0SA 3T3IA 2P91A 2ACKA 4AJIA 4M87A 3GDFA 4QGHA 4EA9A 2PRIA 1NDQA 4IAOA 4TVOA 5ALKA 4ZHQA 2Q5OA 3SBOA 2F4NA 3L8EA 3MAGA 4Q12A 1SKYE 3IT3A 2JLSA 5DSTA 5JAQA 1M54A 1Z47A 4RK5A 3ZLBA 1M2HA 3AM1A 2X0RA 4COOA 1H6BA 1EXMA 4F4UA 3TLXA 3W3AD 4BMYA 4MEJA 3DW3X 3W3ZB 4BFLA 1NJFA 4QDXA 1P3JA 3UC9A 1NN0A 4ES6A 3C1UA 2YMPA 4G85A 1G3UA 2FTKE 1WAMA 3GAZA 3F47A 3DMDA 1S8NA 5A05A 3CE9A 4Z3OA 1QM5A 4H7HA 4IJQA 1KI4A 1NMZA 3L0PA 3WNQA 3W90A 2CVOA 3OQ1A 2D7CA 3EMDA 1XALA 2WHQA 1SZPA 4HGZA 3RG2A 2WIFA 3TLYA 4B79A 5L51A 3H1PA 4CGZA 5IT9A 1JQAA 4HDMB 2V5VA 1P6XA 1H69A 4J0KA 4QECA 2XUFA 1T3GA 2PBFA 2B21A 2GTHA 1VI5A 1UPUA 1MZPA 4E03A 4NP6A 1GPYA 1YI1A 3HO6A 1LNZA 4L5AA 5ALSA 1RAAA 1I80A 4YRRA 1S2LA 2AJCA 3LXMA 1XJQA 1O94C 1ZH4A 2R7NA 3QA3E 3VU0A 5AM2A 4EGSA 2GPYA 5EJIA 3SFTA 3KSRA 3K5WA 5CT9A 3S68A 3WR5A 2OG2A 3ZJVA 4AKHA 2X6RA 2A58A 4B17A 4HQNA 1XFDA 4FHDA 3JYNA 1E92A 4R98A 3KR9A 2E2WA 4GP9A 1IXSB 2ZJ0A 3I09A 5K99A 2F67A 2X76A 4F2WA 2PM8A 2GMWA 3X0DA 3VC3A 3U60B 1R0WA 1GNPA 1MX3A 1K6EA 1SEVA 1SG9A 4JOSA 4KN8A 4PCLA 5AVYA 3H5LA 4H9GA 3RADC 3LC1O 2A9RA 4PSDA 1LEHA 4C05A 2XOEA 4GZ5A 4I55F 3D3EA 4OQNA 1EX9A 4P93A 1OLSA 4R2HA 3HNRA 2B6HA 3I92A 2J4DA 5SYNA 5CA0B 1NVKA 2QIOA 3TW6A 1HWYA 4OQFA 5AXBA 5ER6A 4ZVKA 3VHLB 3OVMA 3JX9A 2C5GA 3ZQJA 2NTNA 1BCSA 4JY7A 2XE7A 1V5GA 2G5GX 4OCZA 1P2BA 1Z25A 3HSSA 3WX0A 2Q1XA 1RYDA 1RM5A 1R9MA 4D2IA 2J5KA 4AZ3B 1K9SA 3OPVA 2DAPA 2FGJA 3KG2A 1HG0A 5L45A 4MRSA 2Z30A 3KTAA 5DBOA 3HKDA 4KDFA 3WAGA 3LBYA 1EVYA 4X8OA 1TO2E 3WGHA 1V9SA 4FT4A 1NSFA 3ZU6A 2H1IA 1ZA1A 2JD0A 1XPOA 1PZGA 4B4DA 3A1CA 2EWVA 2IPLA 4UASA 3HLTA 2HQRA 5IM4A 2J87A 2N1BA 2VP5A 3FTDA 3KAPA 1U2QA 2RKBA 4JVOA 4RPGA 4TT3A 1GRNA 2R6FA 4Z9AA 5HF6A 3V4ZA 3TB6A 2G04A 5JWHA 3KQQA 1G5RA 3MC1A 4FCWA 1D4ZA 2B99A 3MLEA 2YY6A 1GTRA 5IN5A 2QR3A 1E98A 1YBFA 2Q3JA 2ZT5A 3G1WA 4G0NA 5FPTA 4YPFA 5C2JB 4G1UC 4D81A 2MR5A 1O0CA 4ESOA 1GA6A 1I4LD 2FPWA 4YVFA 3T1OA 4XUGB 2KLBA 4MI3A 1YUNA 1J97A 1BVYF 2GEBA 2HJHA 3U4MA 4P4SB 4FD3A 1XRJA 2PIAA 2XCQA 5JCOC 2KLHA 3QBTA 2JGLA 3V7UA 2FX2A 2Q28A 2ZB4A 4XLZA 2AFHB 1Y4AE 4BQRA 3W34A 1Q0TA 3MYRA 1XZQA 1ZD5A 2MINA 3LS2A 2E4AA 3C98A 4GLBA 1EI9A 4NZNA 1NBEA 3UWDA 2AS0A 3ILSA 3KQLA 1T25A 3HCEA 1A71A 4X90A 5A5VA 1KNQA 1DQNA 3A1SA 5JUWA 5SICE 2NTVA 3GCXA 4PXYA 4WY5A 3ROGA 4CV0A 2VCYA 1KJZA 4ESVA 4EH1A 3T5CA 2HWUA 5FWNA 4BJHB 1VE6A 3K0BA 3KLPX 1YOVA 2BEJA 4Y3UA 5IS2A 3L6CA 5IWAB 1KOGA 1AA9A 1IM8A 2Y4OA 2P90A 3KTDA 1J5EB 2W9XA 5FBQB 4O2AA 2G28A 1W5BA 3KUUA 1WKBA 3NXKA 3O1HB 1GSAA 4QOFA 2GD1O 2FSVA 3G68A 4RU1A 4XCXA 3ENVA 3DT8A 3L79A 1UK6A 5BVGA 2RHLA 3GU3A 3BSWA 3TRDA 5FFFA 4UMEA 1UFVA 3KDPA 1AJEA 4CTOA 5KCZA 2QSYA 1PZFA 2GBFA 4RV5A 4O8ZA 3U3OA 4EW1A 1TAQA 3CZRA 1E20A 2EKQA 3OT5A 1A7AA 4PF1A 5D7NA 3JQ9C 4CMGA 4AMYA 4F5WA 5AVUA 4DDWA 4XKJA 3NGMA 4NK4A 4G1VA 4EY3A 4PWZA 2ZM6B 2KB0A 4M9UA 3IFSA 2GNPA 5JMPA 3ZNOA 4JUDX 2OVFA 2ZYHA 4V0MA 3N1UA 4TKUA 5FBRB 1QIMA 1KY2A 3IAAA 4MVJA 4NV3A 1L5LA 2JLVA 5EHNA 2ICAA 4WXHA 4B4UA 2XDQB 5DHFA 1OTHA 1FDIA 2BR3A 1FMJA 4BCDA 3BJIC 3KVVA 1U7ZA 4TWZA 1DO0A 2BKVA 3FSEA 1OX4A 3FUCA 3JR3A 3QP9A 3ZS8A 9LDTA 3THYB 2IHJA 2G9RA 3CSSA 4WZZA 3QELB 4RTKA 4GBGA 3W5HA 3O8RA 1YAJA 3KQMA 2CL6X 3WIDA 1DADA 5ENZA 2JASA 2YNMC 4BVFA 1RBMA 2EGGA 2AXNA 3FG9A 4BX3A 5ICGA 2H07A 3W5SA 4CXMA 2I2AA 2WMYA 3EPRA 4ZGBA 4UULA 3T7TA 3KE8A 4K3VA 2BKEA 3PRHA 1D2MA 1EHIA 3PB3A 1SB8A 2L0XA 4GOKA 3OE5A 4IDFA 3UXYA 2O4CA 3JYPA 3ZQ4A 4MWOA 5DI9A 3H65A 2XJ4A 1AKVA 3N6RA 4HB0A 4M46A 4LC1A 2VT2A 5IZCC 3D4PA 4L4YA 5FR1A 2QG9A 3D0KA 3F3SA 1YCHA 3MQ4A 3N28A 1S2NA 5FJJA 1G6KA 4ZU3A 3BXFA 3H2JA 2XGJA 2XUDA 3L1HA 5DTIA 1N6LA 4B33A 4EPTA 2GO7A 3TFOA 2DFVA 2A9QA 4HDRA 1DDGA 1YAHA 1ISMA 4INAA 3W6OA 1C4WA 1GAJA 1JT2A 4F3TA 2KX7A 3P2MA 3TUIC 1BFUA 4FFBA 4LG1A 1G5TA 4ZVTA 2GWHA 2NXWA 5ENVA 4Q05A 1MP0A 2CLDX 2X40A 2R66A 1U7UA 3F4KA 4PAOA 5IRCD 3DMFA 1NC1A 3H19A 1T3HA 1Y82A 4N9WA 3RBAA 1QLHA 2D13A 2IYSA 5K0ZA 4C78A 3ZDEA 3LFTA 4LNUB 5JBNA 1CG6A 3NBZC 4MUYA 3W4JA 5IM5A 3PR3A 4BMOB 1Q14A 1J99A 1PJTA 1WV1A 3NDPA 4OAOA 5EERA 2V7UA 4B3MB 1ZKDA 1WXGA 1YQEA 3IR5A 2ADOA 3G5MA 2ECPA 3EFOA 3EQ2A 1GXSA 3AUXA 1FW8A 1Y6QA 2PAFA 4N65A 3CWQA 3MRXA 2AG5A 5KWJA 3L8GA 2V0GA 1UPXA 3OOHA 5IHPA 4MQBA 4OJNA 1TEVA 3P0JA 1CK4A 4XQCA 4G8CA 3LPMA 5ITZB 5ALTA 1ZUHA 2A0KA 2OYSA 2PPVA 4YREA 2D2EA 5A9RA 1U4SA 1H2EA 1CUWA 1AKWA 1JNYA 1UIMA 4UXHA 3G9TA 4X7BA 4YP9A 2YVAA 2O48X 1FK8A 2G1KA 3DYBA 3I5MA 1VZ3A 1PZXA 2RJ3A 4NBUA 2J4CA 3OQIB 1AMUA 4BN5A 2NO6A 1L4YA 1UJNA 3CUSA 1RJFA 1EFUA 2GYVA 4HX5A 4OY3A 4J3FA 4TTQA 4YJ2A 2DPMA 4X54A 4NEHB 3Q7RA 3GR6A 1BQ4A 4I9NA 4M8SA 2BH9A 2ZAMA 5IF3A 1YJCA 2K2QB 2OMEA 2CNDA 4FHFA 4Z4GA 1JT9A 3X1MA 4LHVA 4QBIA 4LFAB 1CDEA 2C3YA 4ZDWA 4B3BA 4KQFA 3HA2A 5DNUA 4J49A 2D1FA 4IX9A 1HURA 3EAFA 1IN7A 3LECA 1F2VA 3FDZA 3L4BC 2WIAA 4FN5A 3NU1A 3TQIA 4BEJA 1NJGA 3K4HA 4E22A 3ZCVA 1W19A 3IKMB 4U9IS 1XL1A 4FKMA 3KHSA 3U4CA 5ITVA 3HKCB 4R8KA 3VNQA 5EHIA 5TX7A 1RI4A 4MYSA 1O97C 1WO8A 3O4RA 4G23A 2H63A 4KODA 3DUFB 1QQBA 2M6SA 2FZKA 3DBVO 3C4QA 1V4BA 1H6AA 4TTRA 2HPHA 1NNUA 3G2KA 4TLDA 3KELA 4F3RA 4IXTA 3B3AA 1GYQA 2IYWA 3CYFA 3KUCA 3STHA 5JTUA 5LU8A 1JMYA 2EP7A 2W0SA 4LOAA 4ZVQA 1WS6A 3E3NA 3ZLJA 3ELBA 4X20A 4YAOA 2HZ7A 2ZWVA 4EI7A 3OU6A 3CW8X 5I5GA 1S4MA 1R15A 2PEYA 3C8ZA 4YMHA 1E0SA 5J2TA 2PZBA 2ORVA 1M2EA 3LKZA 2OAP1 3QHPA 4N8DA 3BEDA 2AG0A 4BJ3A 3W8DA 2VPQA 3QWBA 1E3EA 1BE0A 2C03A 3LCMA 2Y1GA 3MS2A 3UUEA 4NC9A 4YR9A 2V7WA 1K08A 1T4CA 3OT1A 4H7KA