2WIAA

Crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
253
Chain Sequence
b'MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Structural Fold, Conservation and Fe(II) Binding of the Intracellular Domain of Prokaryote Feob.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
total genus 73
structure length 253
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wiaA01
2IBMA 4CDGA 2J7PA 5GVSA 1G4AE 3F8TA 1YZQA 4YMUA 2UZ3A 2QEQA 3LY5A 3RSOA 4GZMA 3FKSD 3QF7A 3OFND 1NSTA 4RY2A 3BB1A 4IEIA 4EKDA 1R8SA 3NVAA 3GEEA 5AJXA 4OI0A 4GZLA 5DIFA 1Q3TA 2NPIA 2QRNA 5KSZA 2JJ2D 4TT3A 4BFZA 1IY2A 4ERNA 5C4MA 1UKZA 2JGNA 3JVVA 4YC7A 3TNFA 4ESHA 1CJVC 5JS8A 4OHXA 1D5CA 1A2KC 2HF9A 2ZPTX 3OF5A 2CL0X 1ZYUA 4LJAA 3MJRA 5KUTA 1TQDA 4Q4AB 1ZP6A 1KMHB 3CF0A 1QHXA 1Z0IA 4Q9IA 1RC8A 3TAUA 2JLWA 4PANA 3T1OA 4AI6A 4DLSA 4DCUA 4DLXA 1N5IA 3GLHE 4HAYA 4EPYA 1PVOA 4XSGA 5AUQA 2IS2A 5HZHA 1UBFA 1ZC3A 2EFDB 3LBIA 2KB0A 4M9XA 1E1RD 2C9CA 2J45A 3DMDA 2IUSA 3ZD7A 1P7CA 4A6XA 2O8CA 3X1DA 4LHVA 1FOEB 1M7HA 2PLFA 3QKRA 4P4SB 5FTMA 2HT1A 4PC1A 1AJEA 1E9FA 5AJZA 4A92A 3VNUA 1DVRA 2OAP1 2WSMA 4LDJA 4EQ6B 3CIOA 3FMIA 2CCKA 1ZC4A 1SULA 2YNMA 1KKLA 2R8RA 3TR5A 4RZ2A 1Z8FA 1KI6B 2QBYB 1W46A 5EUMA 1OFIA 2OCBA 3HU2A 1KI7A 2WMOB 2B6HA 4FMDF 2RGAA 1NJFA 3ONWA 4C7OA 1VHLA 2QG6A 3EC2A 1S2MA 5LD2C 2CXXA 2D4HA 1AA9A 2WWYA 2JLUA 4E07A 2JJ1A 1NJGA 1N6KA 1XU4A 4OJQA 3SJAA 1E0JA 1TF7A 3L0PA 1VYUA 2YWGA 2B92A 4QBGB 2CNWA 4AWXA 3KDSE 2ZJZA 2BMJA 4KI0A 4DHEA 4JYCA 2OAQ1 1NIJA 1YHNA 1DAFA 1GSIA 4PQYA 1QHSA 5KO2A 4HAXA 1E0SA 1XTKA 4D81A 1M7BA 1SVWA 2FG5A 2H7VA 1KMHA 4Q4AA 3EZ9A 4MUAA 3TJZA 1WP9A 4B3XA 2QPOA 4LRWA 1EFCA 2GEDA 2EWWA 1N6OA 3L8ZA 1H8EA 4RKEA 1KAGA 1OFTA 2IYTA 4C0BA 2YZ2A 1R10A 3MGCA 1KZGB 1OXXK 1W0KA 2HF8A 2ZRDA 2ZYVX 1D9XA 2FNAA 3L0OA 3VR2A 1BYIA 5DN6D 1T3SA 2RGGA 2MMCA 3LVQE 4DWJA 1KJYA 4W5WA 3DVLA 2BIFA 4P4SA 3RS7A 4BWYA 1UFQA 3A6PC 4EQ6A 2C78A 2GDJA 1OFHA 5LPNA 2CMKA 2PBRA 4YMVA 5CB6A 3Q5EA 3UWKA 4LYJA 1WF3A 4Q4HB 5AK0A 1JXOA 2H57A 2OCPA 1KI6A 3SU8A 5IHPA 3AVVA 4BE7B 3FTQA 1U99A 1FMJA 1CXZA 4P32A 1VIYA 2ZRLA 1L7VC 2LWIA 4V03A 4A0RA 2AHOA 4GBMA 3K70D 2JLYA 3CM0A 1YZKA 4DSUA 3U4QA 1QG2A 2VH5R 2A30A 2B7BA 2YJTD 3DDCA 4PC2A 2D7DA 3QXSA 2O8EB 2OUKA 4LC0A 1CR1A 5DLQC 4UNRA 1E2MA 3RWOA 2GJAA 1S8FA 2Z4RA 3DKPA 2HLDA 4XJXA 3EW9A 2FMXA 4A6PA 2G9NA 3FMFA 3GJXC 5H1YA 1GNQA 3QEJA 1M7GA 2QMEA 5EP1A 4M9SA 1OIWA 1TNDA 4G5GA 1VCIA 2BCJQ 1YJ5A 2BBWA 5CLLA 4LCBA 3GCGA 4JT2A 2DB3A 1TEXA 3A4LA 3B9QA 4LJ5A 5SZIA 2ATVA 3CZPA 4BLOA 3LRPA 4G1UC 4YQFA 4WOPA 5TXGA 1G4UR 2V6JA 1Q12A 3LX8A 2Z6VA 1OXUA 2OXRA 3FGNA 4L5BA 1X6VA 4W5JA 2ODWA 5DO9A 2V1UA 3EZ2A 4M8NE 4GI7A 2O8DA 4JLDA 4YONB 2XOKA 1ZD1A 1GOTA 2WWWA 1P72A 2IYSA 1EESA 3C5CA 2R6CA 2ZUBA 4HDOB 3OAAD 2R9VA 4Q4HA 4DC9A 3TW4A 3KJEA 2F1RA 4QHYA 4O25A 1KJZA 4M1KA 2NO7A 4HUTA 5HCNA 2ZIAA 2I4IA 3H2YA 4NBSA 1P9RA 1N0WA 1BKDR 3ECCA 2VP4A 4AY2A 1FUUA 4DEXA 4Q1DA 1RJ9B 1Z47A 3C4JA 1OHHA 5KTYA 5LDDC 1UEIA 4EIWA 3K9NA 4HLDA 4KU4A 1W47A 4KFUA 4URZR 5B64A 5G3ZA 4NONA 2O8EA 1AKEA 1H8HA 2HT6A 4TWZA 1YQTA 2CE7A 4HLUC 2PH1A 4OQFA 1S9HA 4UXJA 4D2IA 2YWEA 2C99A 2JJ8A 4GNKA 4PHHA 1CRQA 4HDQB 4PAOA 4P3YA 3EPHA 3CWQA 1E9AA 4ZDWA 5JJLA 3SQWA 1XMVA 1OXTA 4V0LA 4V0KA 5EE0A 4B71A 4TTRA 3N2IA 4LHWA 3T12A 2BJWA 1A1VA 1ZNYA 4EFMA 1E2NA 1U8AA 1NY5A 2GXQA 3KFVA 4PX9A 3SYKA 3HDTA 2C2HA 2ZU6A 4AYWA 3NBFA 1D9ZA 3B2EA 1SXJD 3O8CA 4XD7A 1RRGA 1B23P 4B6EA 4KVAA 2W0SA 1RFLA 4IOKA 1Q1BA 2D62A 1PUJA 1G5TA 4JZKA 1HTWA 3S1AA 4AKGA 3RNLA 1QRAA 5AWFC 2BDTA 1E9BA 3THYB 2WHXA 1Q21A 3IUYA 2JIZA 3FMOB 3A58B 2GBLC 3KXKA 4QM7A 3AM1A 1E2DA 4PPQA 1GDDA 4AURA 4GOJA 5BXQC 1KNXA 2HJGA 5AJYA 5BWMA 5JCPA 5AUOB 3IO5A 3AP1A 3EWSA 1TQ6A 1E79A 1NN1A 2JA1A 4Q47A 2QTFA 1RJ9A 4QRHA 2PZEA 2OFXA 5IT5A 1VECA 2AK3A 2WPDA 4UXHA 1GTVA 4WXPA 2H8KA 3RS3A 3SHWA 1J8YF 4Q18A 4Z8YA 1NMXA 2GAOA 2CL6X 1JNYA 2DFKB 1XEXA 3TVDA 3GFTA 3MG9A 3RC3A 3B1WA 4D4LA 4OL0A 3OIVA 4NCKA 2PT5A 2X2FA 5K8IA 4KYUA 1KI4A 1LS6A 2PEZA 2VPPA 2V1XA 1Z6GA 1KDRA 2PEYA 1KNQA 2VSFA 4EJSB 2Z43A 4JT4A 2W6IA 5IK2A 5FL7A 1NLYA 2VEDA 4C9BA 2DPXA 2CLSA 2HDNB 1ZRHA 2DFLA 5KDDA 2BBOA 4D0LB 2CLDX 4NYIR 5KPDA 1Q1EA 1XTSA 4G5SA 3B7GA 4BECA 3P32A 3O8BA 3I73A 1NBMD 2AKYA 2KBEA 4PXAA 1FW6A 2C5LA 1VG1A 1W0JA 2QPAA 3WRYC 2W6JD 4GP6A 4KODA 2XSZA 2ZR9A 2AWOA 2AR7A 2GVDC 2QA5A 1KTVA 5CJ2A 1SVMA 3EZ6A 4JVSB 3W8NA 5E4FA 1P2TA 2YOGA 1T91A 2B8WA 1NG1A 3KKOA 4LJ9A 5FTLA 4KHZA 4BEBA 4OKSA 2WZQA 5KSOA 2F1HA 3AKDA 3T35A 2C03A 1R0XA 2ZEJA 5SZKB 3Q85A 3VFDA 4ZCLA 2R6AA 3T1VA 4DLVA 2ZM5A 2QENA 5EXSA 3P4XA 3MWLA 4LBWA 1OB2A 3BD9A 2ZRPA 3ND8A 1W4RA 2OO7A 1NL3A 1RRPA 3AVWA 4GMDA 2GK6A 2VP6A 3QG5A 4WZBE 1S9DA 3FDIA 1J90A 2G3YA 4TZ6A 1G6OA 5FOVA 1TEVA 2ZE7A 1G3IA 1ZM2A 3T61A 2OFWA 5DNYB 3BH6A 4LBZA 1A82A 2IS4A 2IWHA 4ARZB 3BFXA 3CRW1 3HR8A 5TARA 1UBGA 1NMZA 1OXVA 3NWJA 4OYHA 3SZRA 1W36D 1DELA 1NN5A 3CX8A 3K9GA 3KKPA 2H1LA 1QG4A 2VHUA 3REGA 1XTRA 2Q9AA 1VHTA 1BH2A 4XWOA 3U7HB 5FBWB 5J4VA 2ZRIA 2PX3A 1XB2A 4IDPA 2ZITA 3CF6R 4CF7A 2GWHA 4A4DA 1Q57A 2BVNA 1U81A 1D2MA 2GCNA 3ZVLA 3FKQA 4DLRA 2O0KA 2FN4A 2RGNC 1G5RA 1KDTA 3I61A 4MRNA 3QI2A 4XVUA 2OEPA 1C4OA 1YKSA 3IILA 4N1AA 4Q1CA 4QNMA 1DAIA 4Q1BA 2F3RA 5ELXA 3CB4A 3Q7PA 5HPYB 1G18A 2JJ2A 2RAPA 1Z06A 2ZRMA 4QG7A 1RYFA 5HTKA 4A0HA 2R6FA 6Q21A 2EVWX 3QENA 1N25A 821PA 4MYCA 5DSZA 4QBIA 1KO7A 1E2FA 4ZO4A 4B43A 1XPUA 5FPHA 4QC2A 4DLTA 5FOSA 1CR4A 1R0YA 3JVUA 4EPWA 1CJTC 1P9NA 1YR6A 1OKKD 2Q3FA 4QGAA 2IS1A 2WAXA 1GWNA 4ABYA 4QGHA 1E2QA 5CITA 1CULC 2CK3D 3MAAC 2G0TA 1S3GA 1U8ZA 1W5SA 2XJ4A 4F38A 1E1RA 3IQWA 3PUYA 1HQCA 4JSTA 1NKTA 1C1YA 2F43A 4BRUA 5JWRA 3KL4A 3OEED 1CIPA 1WDTA 4IVQA 5DE3A 4EJSC 2WJVA 1P2SA 4TMTA 1E4VA 3SFZA 4AYXA 4QFMA 4JL6A 1GRRA 1DEKA 3R9XA 3THWA 3LXRA 3QXXA 4HUQB 4BFXA 4JS0A 3B85A 4QNRA 3U61B 1R4AA 3MFYA 4DUGD 1DADA 3KQKA 5FR2A 3C16C 3VR5A 1VCNA 3K70B 1SVSA 4ZI2A 5KU1A 3I5YA 1EWRA 1DAKA 1GG2A 4RJLA 1XXHA 4UXIA 1VKJA 5FH9A 4OQXA 3NEYA 3HP1A 3GLIE 2FEOA 2VSOA 2ZI3A 1YZNA 2JLQA 5FOTA 3DL0A 1E9DA 3U60B 1E9CA 1UPTA 5HR5A 3U6BA 4JMPA 1U94A 2IF0A 5SZJA 3P20A 1ZUHA 4XIGS 2RKOA 1J7KA 4X8LA 1E6CA 4DDUA 4HZUB 4URXR 2E87A 3TMKA 2N46A 1UKYA 2AD5A 2RGBA 4Q02A 4Z1MD 2EU8A 2WM9B 2CL7X 2QM8A 5DN6A 3HU3A 1L2TA 8OHMA 2C9OA 3M6AA 1WQ1R 2IYVA 4YLGA 2QN6A 1PV4A 2JAQA 1DAEA 4TLDA 4BZXA 1D2NA 1Q22A 1VG8A 3IDQA 2ZU0C 3VU9B 3PUZA 3FOZA 1BO6A 1NKSA 4HUQA 3W9YA 1NN0A 2WOOA 5LB2A 4B2LA 1EG7A 1OE0A 1II8A 4B44A 2A5GA 4DDVA 1Z6AA 3ICQB 4LUCA 4LBYA 3BAFA 4MGIR 4TQAA 2NG1A 4IXMA 4C2UA 4ZPXA 2XZLA 1VYTA 4CEJA 4JLPA 1JALA 1X86B 4LPKA 5FL3A 4OBEA 2UVQA 2IUUA 2VP0A 1AIPA 4A2QA 1P62B 4Q9JA 2GESA 2Z83A 5GVRA 2FSGA 1WA5A 2ZRHA 4DB2A 2JLSA 3QJYA 4I1SA 4QOSA 3A37A 1W4CA 1W4BA 5EE1A 3DZDA 4DJTA 2XX3A 5DHAA 3QSYA 3GJ8A 3AUYA 1BMFD 1YR7A 1ZUNB 3EPKA 3WNBA 4D4MA 1GKUB 2ZE5A 1NRJB 2IXEA 4F92B 2G6BA 3BH0A 1DPFA 2GNOA 3QNUA 2MSCB 3NHAA 3UMSA 1N6HA 2OE2A 1AS0A 3ZDQA 1P6XA 2EYQA 1HT2E 1TPZA 2WOJA 4DIEA 1EX6A 2FF7A 1NVVQ 4EDHA 2GVZC 5E3HA 4Q9LA 2GF0A 3ADBA 2JDIA 3K0CC 3B9PA 1I4DD 2QAGC 4LHYA 5AUNB 4EUNA 2YOFA 4TYPA 3LW8A 3RS0A 2ZREA 2QSZA 1RZ3A 4YMWA 1ZBDA 2AL7A 3CONA 2DWOA 3VU9A 4A8JB 3EA0A 1KI8A 2VIIA 3A1WA 2XZOA 1Z6XA 3OAAA 3QIAA 2Q3HA 4OK5A 1KI1A 1VG9B 4LHXA 4PC7A 2ZI4A 5IDVA 3SYNA 4XH9B 3UPUA 3WHKA 1VMAA 3RSLA 3X1WA 2V9PA 2O0JA 3RWMB 1XJQA 4TYNA 3DEFA 2J5XA 3ADKA 1X8JA 4G01B 1MO4A 1IONA 1D8TA 2IUTA 1EFUA 1E96A 4ITRC 4LZZA 4ZKDA 1B0UA 2FSHA 5LBIA 1M6NA 3ZLJA 2A7QA 3ND9A 1XMJA 4PC3A 1W2GA 4YMSA 4XWKA 3NG1A 2C95A 2ZANA 2YKGA 3KXIA 3KJGA 3NH6A 4PZYA 2GEVA 3I32A 1I2DA 3SBDA 3HPQA 2FZ4A 2Q21A 4MYHA 3IBGA 4DLWA 2Q9CA 3DM9B 3FB4A 4C7OB 1AQYA 4EFLA 1GNRA 2ZR0A 5P21A 3NIBA 1R0WA 5K8TA 4DLZA 3PV0A 4GPTA 5GJVC 5KNBA 1RRCA 3U6KA 4LK2A 4R71A 4ZDJA 1ESMA 4BFWA 4D0NA 4MDEA 1T0HB 4PFSA 1IY1A 1SXJA 2ZAOA 4IOJA 2EFEB 2J87A 2BMDA 3MSXA 4JLBA 4JVMA 4KCGA 3D3QA 1U9IA 1II0A 1R5BA 3A4MA 4TQUS 4RKFA 5JMTA 1XFAA 2G0NA 2DFTA 2FPMA 1DAHA 2ZJ5A 4FN5A 3U2QA 4U7DA 1P9WA 1SVOA 4II7A 4A8JA 2YWHA 1W49A 1MH1A 4DBLC 2QI9C 3N2EA 3IEVA 4MKGA 4TL8A 5CIWA 2ECKA 3KKMA 4XWAA 3I8SA 1QBKC 2X2EA 5HKKA 2VF8A 1EFHA 1TF2A 1Z6TA 2JATA 3UXMA 1YR8A 3U7GA 3C8UA 2IYYA 3W6PA 4TLEA 4IKEA 3PVSA 2YYZA 1XRJA 1K5DA 4PPNA 4MQBA 3ZQJA 2IEYA 3LH5A 4IFEA 1T8UA 4I1UA 4M1YA 4XVRA 4FIDA 1DTSA 3B1YA 3FWYA 2WJJA 3C14C 3T5DA 3PUWA 5EXXA 4KVGA 2IYZA 2QY9A 3LQQA 3TLXA 4TL9A 4QGGA 2OXCA 2IHYA 1CJMA 1KI3A 3W3ZB 4EPRA 2ZVPX 4BPBA 2YC2C 4EPVA 4ILEA 1CKEA 4N3NA 1FTNA 1YE8A 4B32A 4B2IA 5A0FA 1Z0AA 1NVUQ 1X1RA 2IYWA 1HY3A 2GAAA 3ZYCA 4PAMA 3TIFA 2QE7A 3U4QB 2MSEB 2QSYA 2ZUCA 4KFSA 1JQLB 3VKHA 3VHLB 3G82C 2JLRA 1KAOA 2R65A 4QJ5A 4AD8A 1E0AA 4RD4A 3GJ7A 5L3QA 3SOPA 1XD8A 2WIBA 4PPFA 4AYTA 2P6RA 1R6BX 1Q1ZA 1ZNWA 1NBMA 4BLQA 4BRWA 2DR3A 2VTKA 1E9RA 1NG9A 3DPUA 1E2HA 3NBYC 4KSCA 2ORWA 2G77B 2W6JA 4HAWA 4DXAA 1I4TD 4M1WA 2OILA 3B1XA 1Y63A 3LWNA 3TE6A 621PA 3LBHA 4HAUA 1XMSA 1XEWX 4FMCB 1ZVQA 5GADl 1M1YE 2OSBA 4MYUA 3KQNA 4IVPA 2KSQA 2A5YB 2I3BA 1PLJA 2FJUA 1U0HC 2CDNA 1OSNA 2KBFA 2O8DB 1VCMA 1IXRC 3P27A 1R5OA 4W7SA 4DIDA 3NKVA 1DO0A 4C0KA 2GJ8A 4DCNA 1NI3A 1PUIA 2YHSA 4LC1A 4LI0A 1OIVA 4K81B 4GDFA 4Q19A 5JWOA 2Q3MA 1ZIPA 2CJWB 1KY2A 3EWAA 2ZAMA 5KNCA 2EFHB 4RZXA 4TL6A 3WMFA 3KTAB 3UK6A 1U8YA 4LV8B 2QRZA 1RKBA 1JAIA 2BKUA 2P5SA 3IQXA 2GETA 1G8YA 2QP4A 5CDFA 1WXQA 4RZUA 2JLVA 1ELOA 5CM8B 2QQEA 4NPHA 3REFA 2BC9A 1CS4C 2J1LA 4ZCMA 3QEOA 1AN0A 1EFRD 2FGKA 5EP2A 3AF4A 3X2SA 1DG3A 2ZRBA 2OBNA 3WBKA 1AKYA 4M21A 2HXYA 2BHRA 1AM4D 4NZYA 4URUR 4NKRA 5H8WA 4TTPA 3K09A 4V0OA 2RGCA 3OESA 1W7AA 1T5IA 4GOXA 5FPYA 4RCYA 3SR0A 5B57C 4UNNA 1HH4A 2SHKA 4WZAE 3PR1A 3AEZA 1Z6YA 2CE2X 2G1JA 2AXPA 2FFAA 2V54A 2W2VA 2RCNA 2WWFA 4IDHA 2ZS7A 4KYIB 3QPWA 4TMKA 2OBMA 2Y8EA 4LHZA 1IQPA 3ZVMA 3EARA 2DFNA 3H4MA 3QY0A 5EJEA 3BE4A 3U7FB 3A1UA 1IXSB 3PENA 1KSJA 3B82A 4HB0A 4UJ5A 1R0ZA 1G8FA 3FE2A 3AGPA 1TUEA 1KSGA 4URWR 4M22A 2O52A 4MKHA 5FOUA 4OHWA 3SI7A 4D4JA 3AVXA 1KZ7B 3S1AB 2BBSA 2ZJYA 2WVJA 4EFNA 2WJHA 1G64A 4S35A 4FINA 1JR3D 1OKKA 2ZRFA 2CJWA 3P26A 3RS5A 3TQFA 3KTAA 2R6GA 2CK3A 5CK5A 4P33A 4AC9A 4C0HA 3FHTA 1PLLA 3MJHA 4V0NA 1TQ4A 3EIHA 2ZJOA 2BCGY 3VMFA 4D6PA 3OEEA 3V9PA 2VLIA 2A5JA 5CYPA 1CU1A 1T8TA 4PHFA 1N6PA 4LJ6A 3U3OA 5M04A 3CX6A 1YZUA 1DBSA 2R44A 3GFOA 1N6LA 2ZJBA 1XEXB 4KJZA 3KX2A 1ZAKA 2J0SA 3M4YA 2CHGA 3MLEA 4KLZA 3VQTA 3GLGB 1Z08A 2FOLA 2VF7A 4DUGA 3VR3A 5F9HA 4ZCIA 3N70A 2CHQA 3NH9A 1E2EA 4ASUD 1RIFA 3K09C 3SJZA 4U02A 4KO8A 4BLTA 2XEXA 2HXSA 4FWTA 4TMWA 2FFQA 2D7CA 5J4HA 4IW3B 2D06A 2GRJA 2WSSA 2WJIA 3KQHA 1E1QD 5HZKA 2DWQA 1LY1A 3TSOA 3HJNA 1JEEA 2F55A 1JECA 2W0MA 1KKMA 4QBHA 1I2MA 4PHTA 1VDZA 5JRJA 2ZR7A 1UEJA 2HUPA 2WWGA 3VNVA 4DT1A 1GKYA 1TL7C 3O8DA 3I1FA 4PHGA 4BLRA 1TUIA 2EFGA 2F9LA 2OLKA 3QBTA 3F5FA 4C30A 1E2JA 1Z5ZA 4NH0A 4QL3A 4IEEA 2JLXA 3H1TA 3OE7A 4Q7JB 1Z2AA 2VQSA 2VHCA 4E5UA 3AP3A 3B5JA 2IXGA 4FD2A 3IEUA 2V6IA 2YVUA 1F3OA 2WJYA 1NVWQ 4NHOA 3NDBB 1KO4A 5UKDA 4CZ2A 4Z1MA 1Z3IX 2QP3A 1GL7A 2CHVA 3U3MA 4B34A 4RFSA 4CRWB 2ERYA 4WW0A 5CIQA 5EXPA 2HCJB 3B60A 5B58C 1QZXA 1AQUA 2ANBA 1GRQA 2CVFA 3ETLA 4IOLA 2BKEA 3BJIC 2F1IA 3X1XA 5FBRB 2FPLA 2QPTA 1G8HA 1FPMA 1L4UA 3FMPB 3GLGA 3MWYW 3NC1C 1WCV1 4R98A 4JKIA 2IYUA 3R9WA 1Z63A 1F2UB 2Z0MA 5B2ZA 1DS6A 5FUXA 3K0SA 1T3HA 2ZYWX 2RGEA 4JL8A 3WRXC 3ADCA 1SKYB 3IGFA 3VR1A 4JYBA 1DOAA 1OH5A 1E69A 4KXFB 1E0KA 4JLKA 4R7ZA 3GFPA 1DO2A 4ESVA 2AN9A 2QGNA 1BMFA 2D3WA 1DG1G 1QDEA 4P4TA 1TU3A 3T5GA 2TMKA 1G21E 2QMHA 4NMMA 3H86A 3HPRA 3C15C 1RYHA 5FOWA 4B3DA 4DDWA 3FFAA 3NTUA 4B75A 4KBGA 1EXMA 1OIXA 5D3QA 1VPLA 5JECA 1HUQA 2DCUA 3BIFA 5HE8A 3PEWA 4TSFD 4NYMR 4QHSA 1BOFA 1K6MA 3UKDA 1J99A 2PT7A 1X1SA 5DI9A 2AFIE 3VX3A 4H1UA 1NVXQ 2F9MA 2BV3A 2WKQA 3W5JA 1N3BA 3DOEA 2REOA 4MGKR 1UADA 2BEKA 2XAUA 5EE9A 4RSGA 4C3ZA 3GEHA 4NTZA 4K46A 4Q7LA 1GILA 4HB2A 3SJCA 3CX7A 1E2KA 3WYGA 3TGPA 3W6NA 3AF0A 1WMSA 1SGWA 4DKXA 1QHIA 1XZQA 3B1ZA 5BN3A 1MABB 4B47A 2L0XA 1V43A 2GZDA 3CW2A 4X8HA 4C0JA 3RC8A 1F2UA 1UM8A 1ZCBA 1OPXA 1QF9A 3IBYA 4PO8A 2P6NA 4E03A 1KIMA 2OBLA 3AB3A 3C5HA 2OG2A 2F43B 4PQFA 1GP2A 1NY6A 2P0EA 2FA9A 2ODBA 2GXAA 1TQ2A 3LO5A 1UF9A 4I1VA 4O2RA 1UJ2A 1TU4A 1KK1A 2ZS8A 4Q03A 3UWOA 4BFSA 3A1TA 3THWB 3WXMA 1P75A 5DH9A 3SNHA 1G7CA 2QNRA 2AXNA 3CR7A 4JKYA 4PR0A 3LW7A 2ZUDA 2OESA 3FKSA 3EAQA 3AF1A 3OFNA 3IPXA 2CCGA 2A78A 3O47A 4IVRA 2WKPA 3BXZA 1P4SA 1XXHB 1MRNA 1SZPA 1T5LA 3K9LA 1CTQA 2IYQA 2ZVQX 4LY6A 2J41A 3NBZC 5JFGA 3AP2A 5FTNA 1ETUA 4C0SA 5J47A 1OF1A 2G88A 5E7JA 2G1KA 2KWIA 1QHYA 4Q00A 4Q4JB 1HYQA 3IO3A 3K53A 3QF4B 4B3BA 2UKDA 3BC1A 3UIEA 1G6HA 3KUDA 1U0JA 3CKLA 1XXHE 4LGMA 4YDHB 1XBTA 4AKHA 1MABA 3QKSA 4GFDA 2I1QA 1LV7A 5GJCA 4OQMA 1ZM3A 2ASEA 2HCBA 5AR1A 3QPUA 4KFRA 5DI3B 2G83A 3ZVNA 1MO3A 1OH7A 4OI1A 1C9KA 1X8KA 2FFBA 3NEJA 2PL3A 2RGXA 2K5UA 2Z4SA 3WBJA 4LJ4A 4OK3A 4CT5A 4D4KA 4AG5A 1IN4A 1VIAA 3WYFA 4MRVA 221PA 4DVGA 3VKWA 2WWXA 3DO6A 3LAWA 3MWKA 1HA3A 3GJ0A 1F60A 4BQSA 2ZROA 4LYAA 4TYQA 3AVUA 1UKVY 4BFUA 3W34A 2C96A 1II8B 4A0GA 4D26A 4JBXA 5JHHB 1XTQA 3FVQA 4MKFA 3U3KA 5L3VA 2FV8A 3PITA 2H92A 2IT1A 2BM1A 1CJKC 1FQJA 4CEJB 4X8OA 5FUWA 5FBLB 5J4KA 1EK0A 1L8QA 4WZ6A 3ZGXA 2V7QD 1E9SA 1ZIOA 4TQ9A 4CW7A 2EYUA 2V8OA 4H1VA 1NLFA 1XTIA 1YZGA 2NZJA 3CBQA 4XVQA 4WA7A 2H17A 5CB8A 4ZIRA 3EIEA 2B7CA 4G5RA 3D8BA 3PEUA 1CR2A 2A5DA 1Q0UA 1FNNA 3LLMA 3H0KA 4JLVA 5FUVA 1P60A 3B13B 3PIRA 2HJVA 4OQLA 2XNDD 3QVUA 4Q4JA 1G5PA 5FBQB 4ZI3A 3QF4A 1E9EA 1S1MA 3CRMA 2R2AA 4RD3A 5TVKA 3TW8B 3KQUA 2IA5A 3C41J 1NIPA 4EPXA 1IN5A 4HDCA 1RPZA 2MMGA 1N0UA 2CCJA 4G0NA 3K8YA 4MH0R 1SQ5A 3T1TA 5DI3A 2O8BA 4LBVA 1Z2CA 1JR6A 3KQLA 1T6NA 1GUAA 5L3SA 1KDPA 1E2PA 3DKVA 4RFVA 4O3MA 1G291 2NOAA 2QTVB 4M0LA 1LF0A 3I3SR 1CF4A 2H16A 2VYFA 4LOAA 4F4JA 1JB1A 1KO5A 1SVLA 4QHTA 4Y0VA 1IY0A 4P4UA 4BGDA 4B6FA 5C46F 5DGXA 2F1JA 4G3XA 4ON9A 1CRPA 1FFHA 4OHZA 1WE2A 4FMBB 2NQ2C 1M8PA 2RGDA 2A2ZA 3TUJC 3UMRA 2XITA 3R9IA 2ANCA 3A4NA 1OT3A 3RS4A 3KKNA 4YMTA 1EFRA 3Q7QA 2JEOA 1XTJA 4TLAA 1XCGB 2QT0A 3AVQA 2BWJA 3TSZA 4MUBA 3ZQ6A 2GILA 5BYKA 1FQKA 1OH6A 4M1OA 4WIAA 1S0UA 3AKCA 4DLUA 4UNPA 3OIUA 1X8LA 3UG6A 2E1RA 1IXZA 1OYWA 2AX4A 2O0HA 3TKLA 2ZXUA 2QP9X 2ZSBA 4O0MA 3TVTA 5J5CA 1BIFA 4IXNA 3HWSA 1PJRA 3GJ6A 4RCZA 4GT1A 4UNSA 1GL6A 3G0HA 5H68A 3E70C 1E94E 4L15A 4TTQA 4NYIQ 2DBYA 4Q66C 4L8GA 4Q7MB 1GNPA 5TMPA 2VHQA 3QG1A 2XB4A 5A5GA 1YZTA 4Q7KA 1CJUC 5E7IA 2B8TA 4GOKA 1SXJB 3PQCA 2QUZA 2VP9A 2IL1A 3THXB 4Z51A 1OLOA 3W90A 1N5JA 1KSHA 2W2TA 2DYKA 3RRNA 1L4YA 1J8MF 3UG7A 1W0JD 3SJBA 4B33A 1ZNXA 1M2OB 2KJQA 2QORA 3NC0C 3W3AA 3WYAA 1VCOA 2A3RA 2GJSA 2ZYUX 4YXWD 4URYR 1TTTA 1N6NA 2PX0A 4NCIA 1JR3A 4DSNA 3AQ4A 2WV9A 1A7JA 2ZSEA 2XXAB 1SKQA 1COWD 1M74A 1YRBA 2CLCX 4PZLA 2P3SA 3M1IA 1SXJE 1FZQA 2WMNB 4I4LA 3TR0A 2VO1A 3AF2A 4HAZA 5F98A 2Q9BA 2REBA 3T34A 1R8QA 2ATXA 2PMKA 1EX7A 5EP4A 3OIYA 1RE0A 2ORIA 3K70C 2AKAB 2QT1A 3AH8A 5KSPA 3P1JA 1HE8B 3TSWA 1XCMA 2ZI9A 4MYTA 3EPJA 3NBXX 3EA5A 3U44B 1US8A 3A36A 2OLJA 2WAYA 3PEYA 5F9FA 4TYYA 1ZD8A 4IOMA 1Z29A 4B73A 5FI0B 1W2HA 2NO1A 4ASUA 4PSAA 1D6JA 2N1BA 1G8GA 1KSFX 2X8AA 5CK4A 3I92A 5JRZA 1NSFA 3QXJA 3Q9LA 5B30A 1LW7A 4KITB 4FI3C 4RVCA 2OHFA 1DE0A 5AJWA 1E1QA 3Q72A 2GEUA 4JVNA 1KY3A 3WY9A 1K8RA 2GJ9A 4OHVA 2CVHA 2FX3A 3PG5A 4HSEA 5L3QB 3THXA 2O5VA 4J0QA 2OT3B 3T1QA 5EQTA 4IDOA 4L9SA 4US0R 1W5TA 2RMKA 2NO9A 3ZH9B 2NZ8A 4LV6A 4F4CA 4HI0E 1CR0A 3GD7A 5J40A 3EG5A 1M34E 3EZFA 1G7TA 1P3JA 2EQBA 5CM9C 1AGRA 3T15A 4JL5A 3RVBA 3TAHA 1A5TA 2XXAA 1F2TB 3Q8XB 4AKEA 3LBNA 2GCPA 3LXXA 1MO6A 1ZM7A 2CEAA 2WIAA 3GLHB 2D2EA 3AKEA 3SS8A 1S3SA 2REXB 5JCZA 1NBME 1GM5A 1E2IA 3CO5A 4B74A 4EPTA 1LB1B 1W44A 1CP2A 4Q48A 1LTQA 5JWHA 3K1JA 2P6UA 3TQCA 1HE1C 3BFKA 1G1MA 3IIJA 5JJKA 4IDNA 5ANRB 1EWQA 5G53C 1KI9A 1YZLA 1AS3A 2J9RA 2PCLA 3ICEA 2AD1A 4FWIB 1LVGA 4JBWA 3VX4A 4FMDB 4ACBA 3U44A 1G3RA 3R20A 2F3TA 1OFUX 3OEHD 5FBVB 2UZIR 2H18A 3KJHA 2DHRA 1P2UA 2IS6A 4LSGA 3QXHA 2VL7A 5KOYA 4GL2A 2ZRAA 4DSTA 2FU5C 3TRFA 3RAPR 3C7KA 4D0GA 1KO8A 1NMYA 2VA8A 1FUKA 1LNZA 2J0VA 1R7RA 1T9HA 5JJIA 4XSHA 3TUIC 3N5CA 1KMQA 4Q21A 5AUPB 3BK7A 3WMGA 4WBSA 4QM6A 1GVNB 2ODEA 1W36B 3L2OB 4CYMA 1E3MA 4Q1AA 4MKIA 1VYVA 1N6RA 1JPNA 4G5OA 1SXJC 1DAMA 1HEIA 5FI1B 4QJ3A 1JI0A 5CDFE 1U9IC 2GCOB 3HR7A 3LX5A 2ZETA 4HZIA 4MDFA 1T3LA 2YINC 3CNOA 4HB4A 4MITA 5BN5A 4TYWA 2Z5FA 1N6IA 1T0JB 1XD9A 1F2TA 4JJKA 4PC6A 2IWRA 4A15A 1KGDA 4TSFA 4A8JC 1ZJ6A 3ZIAD 3GLHA 2ZRNA 5TDHA 1Z28A 4JVLA 3W5IA 1GL9B 3DM5A 3RANA 4B2PA 1O87A 1RRFA 3QE0A 4M2LA 3QXCA 5FTJA 1P73A 4JLJA 1BS1A 4BEJA 4DZZA 1TF5A 5EP3A 1IOZA 2ODNA 3GQBA 4P0TA 5K8UA 5DYIA 1Z0JA 1XJCA 2P2LA 2MSDB 3DOFA 1KDOA 3GLFB 5LB4A 1N5KA 1W48A 2FGJA 3QVVA 3F3YA 4TN1A 3RHFA 2V3CC 3VTKA 3GJ3A 4A0FA 4B3CA 1AK2A 4FMCF 3IHWA 4O2LA 2QROA 1KOFA 1QVAA 4LYFA 4NDZA 2VP2A 4B76A 5DYGA 3BS4A 3CF2A 4MGZR 4B48A 3EPLA 1NN3A 2C9YA 5SZHB 2NMVA 3BBPA 1IAQA 5JSZB 3BB4A 4W5HA 4FCVA 2O8FB 3SE0A 3GLFE 1TMKA 1ZW6A 1IJFA 4JIMA 2OFOA 4L4UA 1FTSA 2XGJA 5D3MB 2QBYA 3SC3A 2JCSA 2D74A 1Z07A 1ZINA 1E4YA 4P31A 3J81k 3GJ5A 1Z0DA 5GJWC 1G7RA 3U3RA 2VHTA 2ZJ2A 2GCOA 1QHGA 3E1SA 4JBYA 4URVR 2QTHA 1XZPA 3CNLA 1RW4A 3HYTA 5FPSA 3IKJA 4DRZA 3IIKA 3X1YA 2NGRA 2X19A 2ZI7A 4HLUA 4GMXA 3VAAA 1KO1A 5BW8A 4HAVA 2D2FA 3SQXA 5J4LA 3FHCB 2YWFA 3KZ1E 3B6EA 1OV4A 5KYKA 3GMTA 2E9SA 4Q5IA 3ZZ0A 3HU1A 4KFTA 3RYTC 2IYLD 1SHKA 2F7SA 2Q0HA 4LJ8A 5JI2E 3SN6A 2FSFA 1KHTA 3K0EA 4IDQA 2FH5B 3SHFA 4DT1B 1CBUA 1IN6A 1KJWA 3EX7C 1W1WA 2ERXA 5EE3A 3SYLA 4M1MA 1MOZA 3LLUA 1AZSC 3GLFA 5EXTA 3U3JA 3I72A 3SEAA 1SVKA 4OHYA 2ONJA 4D80A 1ZUIA 2KI5A 5KHOC 3GJ4A 1GIAA 1U90A 2ZRGA 3UANA 3CRVA 4KBFA 2HYIC 1DAGA 2J7KA 2IW3A 4UQOA 2ZTSA 1ZNZA 2JDID 3KXLA 5K8LA 521PA 4U5XA 5BYJA 2W2XA 3FYHA 4PSKA 2VHJA 4R2IA 4JSYA 4W9MC 2GBLA 4RFSB 5JSZA 3MWJA 4FCWA 2O8FA 4A1FA 2JLZA 1LF5A 4NCJA 4Q01A 5EZ5A 3LD9A 4NL4H 2QM7A 2IC5A 5D3MA 3LA6A 3RS2A 2QU8A 3ZD6A 4TL7A 1W36C 5C18A 2LKCA 1N2CE 3RRYA 1GZSA 1KK3A 3AV0B 1MR3F 2IK8A 3G5UA 4NCHA 2QL6A 1G3MA 4LPSA 1PZNA 1JJVA 4HYYA 3BWDD 3D6TB 1XNJA 2V7QA 3I8XA 2IYRA 3BORA 3SBEA 3CRQA 2GHIA 2NTYC 4E22A 1G41A 4DCVA 4HLQB 3HYRA 5C4GB 2PLRA 1MKYA 3QBVA 3GLGE 2AK2A 3GP8A 2IX3A 2ZJ8A 1XD2B 5E95A 2J7PD 2VSXA 3BERA 1UBCA 2XNDA 3M0EA 5L3RA 1J2JA 3MCAA 2WICA 3NDPA 1ANKA 3LQRA 3PUVA 3AVOA 3ZVRA 2IEZA 1JPJA 1E2LA 4TZ0A 2AWNA 3ZJYA 1TX4B 5G40A 3OIWA 1GAJA 1JQJC 4N0DA 3QKUA 1UDWA 1QVRA 2W83A 5G3YA 4POAA 1XP8A 4HB3A 5CYOA 4QKQA 3L0SA 3L82B 5IF9A 1FP7A 4TT3D 2JASA 1ZCAA 4C4PA 4M1SA 5EE5B 4CEIB 1FX0B 1T4GA 4PSVA 5E7MA 1EFTA 2LKDA 5CJPA 1CEEA 2VRWA 4JLNA 4MRSA 2BMEA 3P4YA 4C0QC 1E99A 1NP6A 1PLKA 3NHBA 1Q44A 2A9KA 3ADDA 3ZZUA 1OW3B 1G9XA 2LCFA 4PQRA 1WB9A 4F7WA 5BN4A 5KNDA 5HKKD 4C2TA 2VBCA 3IIMA 5F3WB 3EC1A 3X1ZA 2BJVA 2GXSA 3KUCA 3CPHA 3MRSA 2OM2A 4MRRA 4C0AC 1R2QA 4MRPA 3QKTA 2RHDA 2ZSFA 4XTCS 4BUJA 3AF3A 2QZ4A 4OI4A 4RD1A 4WXRA 2C8VA 1TADA 2J0QA 4NE2A 5DHFA 2J46A 1UKEA 3CR8A 4NYJR 4TMZA 3R8FA 2QMOA 3I4LA 1QHHB 4TLBA 4PZZA 5EUQB 2FZLA 1LFDB 1XD2A 4I81A 4U00A 4QXAA 2WBLC 1NF3A 2XTMA 3IHLA 421PA 3ASYA 3BB3A 2ZE6A 4BFYA 5FPKA 1G3QA 1IHUA 4JJZA 4R9UC 3H84A 1S4QA 2NIPA 1ZM9A 2FE4A 3LFUA 3DZ8A 3QPVA 5CLQA 5FUYA 1MRSA 1SKYE 2QE7D 3AVPA 2PJZA 5J4YA 2JJ1D 1F6BA 1NLZA 1H65A 3AVTA 2X77A 2VP5A 3CH4B 2CNWD 4CEIA 5JHGB 3Q5DA 1Z22A 1JJ7A 1FX0A 1HURA 1N0VC 1NVVR 1OH8A 1KYIA 2ZSDA 1WBBA 3UATA 2WJGA 4Z8XA 2RGNA 3QUSA 2EWVA 3THYA 3ZS8A 4YXWA 2WTUA 2YC4C 3B1VA 1YRAA 4F4IA 4DCTA 1AZTA 2OCYC 1COWA 5TB5A 1UBEA 4N0EA 1H8ED 4AKIA 3QKSB 1P5ZB 4TMXA 1ZU5A 2PMDA 2ZRJA 2ZSAA 4G5QA 3CWZA 2N42A 1W0KD 4KV9A 3LDAA 3CLVA 4IJMA 4NU0A 4DSOA 3RRZA 4KSBA 1E32A 1U98A 2C04A 1SVIA 1I4LD 2XB2A 2DY1A 2GA8A 4ZV4A 1QHHA 5FPTA 2BEJA 1XF9A 2C77A 2PZGA 2ZRCA 3EIQA 3QOFA 1KI2A 5L8VA 3AVYA 4A9AA 1OJLA 2J3EA 4H9GA 1X3SA 3T06B 1R5NA 1GITA 4ZDKA 3WNDA 1Q1QA 2V4ZA 4L9WA 1ODFA 4FW9A 4Z54A 3KFXA 2XJ9A 4EJSA 2HV8A 4GRAA 1IJEA 4AG6A 1YU9A 2AFHE 3AUXA 3FHOA 3MD0A 2GZHA 3VHXA 2XNSA 3DHWC 4XTRA 2RB4A 4PPGA 4PO9A 3PEVA 4QJ4A 3B8HA 4UKDA 3PCRB 4BFVA 4ZIRB 4B35A 3VR6A 2EFCB 4Q4LA 2HLDD 2ZJAA 3O8RA 1JAHA 1E98A 1ONBA 1Z83A 2R6DA 4LV5B 1F48A 3A8TA 2W00A 5IRCD 2IXFA 3KB2A 5EZ6B 3PXGA 3SFVA 4NP6A 1ZMXA 4HATA 4LJYA 4PAQA 4XOIA 5G41A 1MO5A 4ACAA 4GSYA 1Z0FA 3SDZA 1Q3HA 1XDBA 2ZRKA 1LS1A 1O3YA 4RD6A 5TY0A 121PA 1XJ0A 4JLAA 1VTKA 2XTZA 1IN7A 4OK6A 2A5FA 2O8BB 1OB5A 5A4JA 4CGZA 1XCPA 3VR4A 2GK7A 4DB4A 2GJKA 5L3SB 1JBKA 4R2HA 4AK9A 3ZZTA 2FFHA 4LJ7A 2XOKD 4A2PA 3JZAA 4M9QA 4M1TA 2WWIA 2H5EA 4IHQA 3EZ7A 1V5WA 1XPOA 3EXAA 3AGQA 5JEEA 4QBFA 5JBQA 1P61B 5FTKA 2BOVA 4Q1EA 5FOXA 5JI3E 3OEHA 4KLNA 2QAGB 3TH5A 3WNCA 3DMNA 4F93B 3E2IA 721PA 2FPKA 1ZU4A 3CZQA 1FP6A 2F6RA 4NCNA 2WKRA 1ZM4A 3KKQA 4Y0AA 4RD2A 1OHHD 1AGPA 1SHZA 4ARZA 1J70A 1G17A 4IFBA 2ONKA 1OYYA 2QMUA 1QHNA 4TLCA 1H8HD 3A1VA 4BZQA 1G3UA 1VG0B 3D31A 3W6OA 1FNMA 1D2EA 4ZDIA 4BFTA 3GLIB 2BBTA 4F91B 4FXPA 5C1BA 2XTNA 3D7MA 5HCIA 2WWHA 3E5HA 1MT0A 2RHMA 3CRRA 4JLMA 1HV8A 4YDSA 2YOHA 3ZS9A 2HEIA 3UMFA 2NO0A 4CIDA 2IF2A 3L8YA 2OCAA 3V4RA 2WSSD 2HYDA 3L43A 5KDLA 2PJRA 2P67A 1IN8A 1JXMA 1MV5A 2V55B 3LNCA 1G19A 2GKSA 3BRWD 1TAGA 3ZIAA 1XEFA 1A2BA 3AKYA 1G8PA 4A2WA 3VKGA 1GKIA 1UDXA 4XD7D 3CPJB 1II9A 2FEMA 3FPAA 2XZPA 4BLSA 1E2GA 3EASA 5DISB 3LV8A 5KDOA 2NO6A 3JZMA 4B3FX 2IYXA 3WP1B 1G16A 2GF9A 2JIZD 3Q3JB 4CEHB 3GEIA 1IBRA 2OZEA 2FWRA 3OE7D 1OXSC 3K0CA 1K5GA 3PFIA 4FCTA 3TK1A 3NXSA 4I99A 2QAGA 5BQ5A 3L0IB 4I1OA 2KE5A 2FSIA 2P5TB 1FL9A 2RH5A 2J0UB 1E79D 5JS7A 4OJKA 1KK0A 4DLYA 3BFVA 4V0ME 4OQNA 3WHLA 1UAAA 1A4RA 3K0FB 1XX6A 2WPDD 4UNQA 3TBKA 2FDCA 3B78A 1YR9A 3R8CA 2GXUA 1XPRA 1ESNA 4MGYR 3I5XA 1EGAA 3K0AB 5F2EA 1JR3E 1DARA 1N5LA 4D25A 4WAUA 1ZD9A 4DDTA 3WP0A 1G7SA 4HLCA 3GLIA 1JEDA 3K9HA 1U2RA 3R7WB 1US8B 1WBDA 3THOA 4A36A 2QGZA 4TMVA 3W8RA 1XEWY 1CLUA 2ZS9A 4NYJQ 1P2VA 1XMIA 4PTLA 2W6ID 2ZI5A 5IK2D 5JLJA 1F5NA 2ZI6A 5FL7D 4X8MA 2EW1A 2QAJA 4A82A 3MMPA 3BOSA 2IHBA 3V00A 3KJIA 1S1CA 2YV5A 1KK2A 5FFMA 3BGWA 1XWIA 3ASZA 1G20E 3A1SA 1GFIA 1GRNA 4AIIA 4E09A 5JZVA 1Q20A 4LX0A 1AS2A 4RZ3A 4IRUB 4OI2A 1HQYE 4V0MA 5LD2B 2J59A 2PZFA 4PO1A 4RD0A 1BYUA 3I62A 4LWZA 1W4AA 3LVRE 5AJVB 2I1VB 2Q6TA 2ZYTX 2BMFA 2XSZD 3RDPA 3TUZC 4B3GA 2B21A 4NYMQ 4US2R 4CEHA 4S2EA 4M4SA 3MUFA 4CT4B 4JLOA 2DWPA 4KAXA 4GP7A 4UJ3A 3GPLA 4EAQA 4HZUA 3OHMA 3BH7A 2ORVA 3OZXA 2ZE8A 2R62A 3PUXA 2J0UA 2QQ0A 3RLFA 1HT1E 4ZKEA 1Z0KA 2NPFA 2OV2A 3K0FA 2BM0A 1NNEA 4Q9KA 2GTPA 1FMLA 4BLPA 4QGFA 3CH5A 4M9ZA 1RVDA 3F0TA 3CUEF 3K0AA 1Y3AA 5C2JB 1S96A 3RRMA 4Q1FA 1YVDA 5KPJA 4K8OA 5FR1A 3PJRA 3R7WA 2X1VA 5H70A 4CVNA 2C98A 5JEDA 2PCJA 4BASA 5KSYA 3V4FA 2P65A 4BZPA 4HEJA 4Q9HA 1IM2A 4D82A 3KB1A 1WRBA 3FFBA 3IPYA 3WMEA 5GJBA 2CBZA 2O8CB 2GZAA 3CNNA 3QQ5A 2ZQ5A 3QKRB 4L16A 4US1R 3RABA 4M53A 5HE9A 4DEYA 3U5ZB 4LYHA 4V02A 4WVFA 4C0LA 4DCSA 3U7EB 4MA4A 5TV2A 1U0LA 3CPEA 2W58A
chains in the Genus database with same CATH superfamily
1F8GA 4E33A 2J7PA 2BFFA 3F8TA 2WK1A 3C43A 4AY4A 5I8WA 3TL6A 2F4NA 3RSOA 4MP6A 2YBEA 3HGMA 3QF7A 3OFND 1Q84A 3BXPA 3I1IA 2E5WA 1GPH1 1QHEA 1U6JA 3BB1A 1G5IA 1QQTA 4D0SA 4M36A 4RTNA 3PRHA 4PFQA 1OI2A 2BMVA 3I6ZA 2IZ7A 3HB9A 4HNRA 4OHBA 4WOBA 4GXQA 2PL5A 4O4HF 2JGNA 5JW6A 2O1WA 4CMAA 1J42A 3Q3HA 4AJLA 3AHHA 2B3DA 1OCEA 3R5KA 3D5EA 1NW5A 1TFUA 2Q6VA 3B51X 3ESXA 4N5LA 5AICA 1UPAA 3H5IA 2AB0A 3OF5A 1L5FA 4D9GA 3BWBA 1ZYUA 1GSAA 3E22A 4L95C 5CNKA 5JECA 4Q4AB 1ZP6A 1KMHB 5JAQA 1JU3A 4UVGA 1Z0IA 3I2FA 1BWRA 2BFAA 4PCUA 4CETA 3DT8A 3T1OA 3QVSA 2B99A 4XYBA 3UM9A 4DCUA 4DLXA 1IEWA 4R16A 4DLSA 5BP7A 4GBGA 3IMEA 2BAGA 5CVCA 4XSGA 3A2NA 2IS2A 5HZHA 1Y98A 2JGDB 2B37A 3O75A 1PBTA 4J75A 3LBIA 2P40A 1T5SA 4M9XA 1C4WA 5BVGB 2J0EA 2D6FA 3TMYA 4EJFA 3DC7A 1PQ4A 2TS1A 5AXCA 3NETA 1J21A 3X44A 1RPNA 2PLFA 4FR5A 1JA1A 1UK6A 2A58A 4GPIB 5HBGA 3HXQA 3VNUA 1DVRA 2HFJA 4LDJA 3DMRA 4ZEXA 5IX8A 4UU1A 1K75A 3CIOA 2H9AA 3DEJA 2O6LA 4IV5A 4XQEA 4ARVA 2Z2JA 1A0OA 1B26A 1SULA 1KKLA 2R8RA 3GBVA 3N3AC 4WK4B 1KI6B 1OWOA 4GI5A 3UTDA 2X0KA 2OFFA 3CFYA 2HBZA 2B4YA 2OCBA 1D0VA 2RGAA 1J9EA 4AP9A 5AW3A 4CLRA 4C7OA 4TTIA 2C3YA 2BFMA 3EC2A 3JASB 4MUNA 3HKCA 4RLSA 1KH2A 2CXXA 3IBSA 2BEVB 4PGGA 1JH9A 4E07A 3K1TA 2PD3A 1RNLA 1NLMA 1AUXA 4R9VA 2G1UA 1R64A 2NUAA 3MS2A 4GH5A 4OJQA 1TF7A 2KS6A 3UPTA 4X3CA 5C8YA 4DPLA 3I6BA 3DEKA 5IUKC 4YCNA 1F12A 1V2GA 1N8NA 4P53A 3QMMA 1L5WA 1D3AA 2GPJA 2RSLA 5LVAA 4DHEA 2OAQ1 1RYBA 1M8KA 1NIJA 3UUEA 5J2UF 2OVFA 1DAFA 1GSIA 2B4QA 2D0OB 2Q28A 3K32A 1A96A 1O94C 1QS0A 1VFNA 1XTKA 1M7BA 4FZVA 1BXRA 1HLPA 4HAXA 5T6BA 4H27A 3VH4A 3LNTA 5EUCA 1BQ4A 1X8XA 2YYAA 3FTPA 5F7OA 5HXAA 1GT91 3OOEA 1F0NA 4LRWA 3RVLA 3U4CA 2GEDA 1LTHR 1WD7A 2FWAA 2EWWA 1N6OA 1PS9A 4MS1B 2AYYA 4ZU1X 1H8EA 3PYLA 4RKEA 3VPCA 2FX5A 4DR1B 1O5IA 4YY3B 2WUGA 3I58A 1SOWA 1XL0A 2P41A 5CW2A 4ZJPA 2ZYVX 3K7EA 1IUKA 1D9XA 3ZCSA 2ZVDA 3ZWVA 2G25A 2WTNA 3L0OA 1UJBA 3OZTA 4IX9A 4PRKA 1NTOA 3LVQE 2XOEA 4ZC8A 3SEFA 5EUBA 4CFYA 1M6VA 2PQMA 4DWJA 4W5WA 3R7LA 2R47A 2BIFA 4P4SA 3REOA 2IEGA 4BX8A 3H2KA 5IZCA 1RXUA 2C78A 3NYRA 3UH0A 5LPNA 1KYWA 2FQYA 3QKIA 4BATA 1GUFA 4DTCA 2Q41A 3CUWA 4FFPA 3UWKA 4DEVA 4CI0B 1WF3A 3UCFA 4NENB 3NEPX 4TKUA 3SU8A 4ZGWA 5HKAA 3WWZA 1YI1A 4BE7B 4RHTA 1U99A 3HU5A 3KVOA 4R3UC 1FMJA 3JVIA 2W8ZA 3GFRA 2ZRLA 2B69A 4MW7A 3E7WA 5CCDA 4XPZA 1XZMA 4EZIA 2JLYA 2V74B 3HGTA 2O7QA 1QG2A 5HF5A 4MV6A 2BSQA 1MT3A 1EPUA 2D0PB 3NKFA 4MRMA 1V1MB 1JRLA 1U1CA 1K7YA 1PWZA 1K63A 2QSUA 3LQ4A 3Q10A 2XAAA 4M0MA 1C7QA 1E2MA 2JH9A 4S1NA 1E2UA 2Q1XA 2B3TA 2XQKA 2Z4RA 3AERA 1T35A 3DKPA 4ALLA 2HCFA 4N4AA 1A8IA 3EW9A 2FMXA 4RXTA 2G9NA 5H1YA 1XWWA 3TTSA 3ZC3A 1GNQA 1MPTA 3FOEC 1RCTE 4UMDA 2Q1UA 3L6RA 2BCJQ 3OM0A 4FZ5A 5B7QA 5HVNA 4HP8A 1HC7A 3FFXA 4JT2A 2X1HA 1TEXA 3A4LA 3ZTYA 1KFBB 3HDGA 4IUDS 1PR5A 1UPUA 1UC4B 3LRPA 5BQOA 4F85A 4YQFA 3PBKA 4U8GA 2R7NA 3RNOA 3HZOA 4BV3A 1GFZA 4UHDA 4EHIA 5A5DA 3GX1A 4IIGA 2Z6VA 1JMYA 2ZTVA 3F5SA 1DL5A 3MQ4A 3FGNA 3MTEA 3MUOA 1L6IA 1Q2XA 2PHZA 2FN8A 3RI3A 2O8DA 4CF6A 3AUJB 5GTDA 4YRGA 5DTJA 2NZXA 4DUPA 3U16A 3SAJA 1R9JA 1SD5A 4E0BA 3NAGA 2CYBA 1EESA 4HDKA 4ZAYA 3MPOA 5HJ2A 4MB2A 3ZW9A 2RC6A 1YQ9A 2ZUBA 5DGIA 4EJMA 1MVOA 1FDTA 4R51A 3HY4A 3IDZA 4P0PB 3AHEA 2R6HA 1DOZA 3I2IA 3ZKWB 1LGYA 4DUYB 2JGRA 2PWYA 2HF2A 1LX7A 2XKBA 2NO7A 3ILSA 1XL1A 2DUWA 5HCNA 4ID3A 5K0EA 1N0WA 3S5JA 2XIQA 3ECCA 1WZCA 1QIIA 1WUHS 2GO7A 2VP4A 3AESB 1FUUA 4MUYA 4YI5A 3TIVA 3C4JA 3KQOA 1UZLA 3NVMB 4IIEA 4S1WA 5LDDC 1I7QB 3CF4A 3O6VA 1J0EA 5I9TA 1LUAA 4ER6A 1L8XA 3PNLA 4JJ7A 2JI8A 4OQDA 4URZR 3MJTA 2W71A 5IHXA 2O8EA 1AKEA 2XA2A 4X62B 2NQ8A 1BHO1 4TWZA 3CWCA 1YQTA 1OTHA 5FWNA 3LY7A 4JI0B 5ALXA 4MKZA 1S9HA 4OQFA 5H4GA 3N28A 5JXJA 1KFKB 2CBGA 1SO8A 5EQDA 2VH2A 3V8VA 3QBDA 1E9AA 4ZDWA 1NF8A 4A0SA 5JJLA 4UBKA 1XMVA 5EINA 3RKUA 1XN4A 4GYWA 5DX0A 3D2CA 3N2IA 4PIPA 1ZNYA 2XB6A 3A6DA 2DMRA 2QRUA 5KVQA 4TQGA 3W2EA 2DEUA 1U8AA 4IWNA 4UDNA 3LG2A 1U5BA 2GXQA 2YW9A 3SYKA 1DHRA 1SRQA 3A1CA 4DM4A 1Y8RB 3W5HA 2Z8YM 1AGNA 1GU7A 2I5PO 4Y9RA 4G5FA 3CEHA 4PEVA 5FORA 4I3HA 3U3XA 1JFTA 1HE3A 5FQOA 2FW8A 3BGDA 4YROA 1QU2A 1RFLA 3QVGB 3H11B 2D8MA 4I14A 5M34A 5HMMA 2F1KA 3NRBA 2O7RA 1C3OB 5TVGA 1JWBB 4CKBB 4LJSA 3VAZA 4AKGA 3RNLA 1J0XO 5ESDA 2XYVA 4D0RA 3RYCB 1QRTA 2NLOA 4HCJA 3ZV4A 4ZEWA 3FMOB 2GBLC 3MRTA 3WKCA 4QM7A 1E2DA 4PPQA 4TUYB 1GDDA 4AURA 1LPMA 1TJPB 3KZOA 4R2WA 1XT6A 3T7IA 1YMUA 5BXQC 3ID6C 1KNXA 2HJGA 5AUOB 4GW3A 2PT9A 4FE7A 2I03A 3BSYA 3AP1A 3EWSA 1TQ6A 3IMCA 4TM8A 3RUEA 2H1WA 3HA3A 1NN1A 5KJ1A 2XLCA 2XUFA 2QTFA 4QU0A 2A9OA 1O94D 1V7CA 4DAEA 1Y4SA 1ND6A 4QRHA 1NXQA 2OFXA 3I6IA 5IT5A 3CUSA 4C14A 1F8FA 4BMSA 4E3WA 4IQ0A 1HYGA 3L41A 3OU7A 1PWYE 1E0DA 2XUPA 4YJ3F 3RS3A 4Q18A 1XOIA 3E3LA 2GAOA 2CL6X 1XEXA 3MG9A 3JAWA 4D4LA 5JSKA 1QRUA 1BE1A 1OXMA 3DAFA 4C6SA 2PT5A 4RE5A 1QGAA 1AQIA 3INYA 4H7HA 4R5MA 1FIUA 3HJUA 2PE5A 3U37A 1H1DA 1ULBA 5LSAA 3UHJA 4ZZ3A 1CF2O 2PEYA 4N3CA 3WA7A 2VSFA 3WGGA 3G5MA 2DM6A 4EJSB 1LK5A 4ADSG 4EVRA 4F9GA 1NQWA 4DEYA 1WAMA 2PSJA 2C82A 4MVXA 2DPXA 5J63A 2C7GA 5EHGA 3R76A 2HDNB 4RQTA 5HMLA 3VSAA 1ACMA 3EODA 3JQ8B 5KDDA 2BBOA 2KYRA 4NYIR 2O3UA 4GECA 2XMGA 1PGOA 3K6JA 4IO1A 1DOHA 4FP9A 4HDNA 4X1YA 4PXAA 4LSMA 1ISGA 4B4KA 2C5LA 1VG1A 1AMOA 1K3UB 4QTUB 4D3FA 1IPEA 2W6JD 4GP6A 4C7VA 1PG0A 4I4TF 2XSZA 1O95C 2DLNA 3TTTA 3KU1A 2GVDC 2EC5A 1QJCA 1QGUB 2H1CA 2QA5A 2PRSA 3BMCB 2VXYA 1SOVA 3G1UA 3DE7X 5HJEA 4LMAA 1SVMA 4TPKA 5CDGA 3S1SA 1H93A 2R8PA 3AQIA 3PFFA 3W8NA 1U0FA 4GLLA 4COOA 1UQUA 3KNZA 4Z1OA 1FJXA 5KQPA 3DHVA 4OKSA 4BEBA 2I8CA 2I6SA 1JHAA 3DMTA 1WCXA 2HMVA 3COPA 3OPQA 4LFBB 3T35A 5SZKB 5ULLA 3U1VA 2BEUB 4X92A 1GRCA 4Z9FA 1U0EA 3GRRA 2I9KA 2H2GA 3FZNA 4DLVA 2ZM5A 1E7WA 4DR3B 1DDIA 5CCXA 3LGSA 4WKOA 3LUBA 3T6KA 1JIIA 1VOTA 4E5SA 4YT2A 4LBWA 2CUTA 4KQXA 4DW8A 4JI7B 2C7VA 1PEAA 2IHVA 3TZQA 3MEQA 3C3KA 4KKXB 5FKJA 1E1YA 1ZY2A 4RTQA 5KNCD 2AC7A 2XUGA 5CVEA 2VP6A 3ASVA 4PFKA 4ZU6X 3NUZA 5AHWA 3FNFA 2C7RA 4G9GA 3NAQA 4XX1A 3PJGA 3UWPA 2J9ZB 3TNJA 1GPKA 1G6OA 2P75A 2A88A 3RQSA 2QIPA 3RTBA 3BFJA 3BH6A 3P9ZA 2ZATA 4C4OA 1ZRSA 1IB0A 3CRW1 4ARZB 5KBYA 5IT0A 1UZUA 2FE1A 3DS8A 4TMFA 4JLWA 3KYCA 2PM8A 2PY6A 3LP5A 1W36D 3FNBA 8MHTA 1DELA 1DQNA 2AFIA 1F51E 1PT5A 1A2OA 2P8SA 3KEFA 1QG4A 3IEXA 4ND5A 1OFVA 1FFXA 2Q9AA 1VHTA 3MOGA 3U31A 1ZJJA 2I6QA 2ZRIA 2ZITA 4IDEA 5DW0A 4F5EA 3BJEA 2COUA 3FDFA 2UU9B 1FK8A 1U81A 3JQ9A 4WXMA 2OK7A 4YCBA 1ETHA 1QP8A 1C0EA 1HKUA 2YZGA 3TLYA 5ADUS 2PD6A 1G5RA 1RM0A 2ZAGA 3I61A 3B48A 2BZ1A 1C4OA 3IILA 2XMBA 3KOYA 1WZIA 1EI9A 1DAIA 5ELXA 1DX4A 3Q7PA 1DJLA 1G18A 2W2OA 1F3LA 2JJ2A 2LVBA 1Z06A 3DNPA 1RYFA 1V5EA 1GY8A 1BDJA 3S27A 1T10A 3WYFA 1SBTA 2OQIA 1N25A 1WKVA 821PA 3ITKA 4BKPA 3ER6A 3IB6A 1KO7A 1RJGA 1E2FA 2ASVA 1JQAA 3KZNA 3TSCA 4B43A 5L9AA 1TDJA 5TGZA 3G7UA 5AVRA 1CR4A 2ZKLA 3F6EX 3JVUA 3SZGA 3LDUA 1CJTC 2CYCA 2K2QB 3M83A 3R5FA 4PLCA 3G8BA 1HQDA 1EK1A 4B8ZA 3TRHA 2WAXA 4ZTZB 3RKRA 4QGHA 4P34A 1E2QA 1XIVA 4J0HA 5CLFA 1LI7A 2ZZKA 3WSVA 3QFHA 1H22A 2IBSA 1YV9A 2FUG6 2XJ4A 3B9RA 1OA0A 4WXYB 1E1RA 3IQWA 1YL5A 2IXAA 1W5FA 2HJRA 3L8GA 3RFTA 3RYFB 4DQVA 2UXDB 2F43A 2RGUA 5JWRA 3IPCA 3KL4A 3OEED 4YUXA 9LDTA 2FZWA 5HRCA 1K88A 2HNAA 4EJSC 2V97A 1J23A 1ODSA 1P2SA 4TMTA 5HYVA 3P5SA 3FGOA 2E21A 5CYGA 1BC5A 1U80A 1DEKA 1W6RA 2XUJA 3LXRA 3PICA 2NSHA 3SC2B 1Q0ZA 2FLKA 1YDMA 3V1TC 1MAHA 5JLAA 1X87A 5EKDA 3IBFA 3B85A 1RC0A 3EVZA 4QNRA 3U61B 5JQGF 1DADA 1CUVA 1LJ8A 3WFZA 3BZBA 3ZN2A 1KQOA 2VJQA 4M54A 3VR5A 1I7DA 1Z18A 4CR7A 5DM0A 5LKAA 3TDNA 5KU1A 2IOFA 2J67A 4W7IA 3KR2A 4TN5A 1OX5A 2BHNA 1TK9A 1C3LA 2Q3DA 1J1ZA 4RJLA 5MHTA 4UXIA 1NJSA 1VKJA 3NBKA 3Q8LA 2LCIA 4P7KA 5K9ZA 2FXIA 5DHQA 4N8EA 1LLCA 3X2FA 4NFLA 3FCYA 3OIGA 4WN9B 1FU4A 3IJEB 3OF3A 4YJ2A 3AEKB 2ZI3A 2OWEA 4KIFA 1P31A 3CN9A 3U48A 4UZSA 1FU8A 2WSBA 4J8PA 3D3NA 2CJPA 2GN2A 3CLTD 1H4VB 4Y2SA 3CLUC 3PHGA 1EVIA 2CDBA 2QRGA 1NULA 2VP3A 3PUKA 4BBAA 3SVTA 5I45A 2D59A 1Z36A 1MGPA 2HIHA 2NZUG 4H77A 4Y2TA 4ZZ0A 2PRIA 2P9FA 1PL6A 3BWMA 4CV3A 3IA7A 1E6KA 5FADA 4BEWA 3FOFC 4DR4B 1R3DA 3W6ZA 1GTMA 2HQSA 4HQOA 1NW3A 3UHFA 1SKBA 2DFPA 4E31A 3KAPA 4M1EA 5I5GA 1E5TA 3P2IA 3TMKA 1GFWA 3VZCA 4CKXA 5ITZA 2NQTA 2UVPB 1J0BA 3CUUA 4QOJA 1FRQA 2AD5A 3DNMA 2RGBA 2YVLA 4H6WA 2NVUB 4RA9B 2QM8A 3NHFA 3OQBA 5DN6A 3IE1A 1Z2NX 1L2TA 8OHMA 1F2VA 3OX2A 4REMA 4YLGA 2QN6A 3FOCA 2I55A 4QARA 4EKYA 4WKPA 2BZSA 2JAQA 4I9NA 1DAEA 1C3XA 1BN7A 1UQRA 1Y9EA 1UWCA 4I66A 1E3IA 2ID8A 3GROA 1K5HA 2ZU0C 4QNNA 5AW9A 5KNDH 3ETCA 2DG2A 4JB3A 1NKSA 1MG5A 1W52X 3CUTA 3FPEA 4LZJA 4HUQA 3W9YA 4H4EA 1B0ZA 1D5WA 4Q12A 2HK7A 4HNUA 4ZZ1A 3TN7A 2HMYB 1EG7A 1IJKA 4B44A 5LP1A 4GKKB 1PFQA 1XN1A 1ZRMA 2H63A 1CW2B 3C3CA 4XR4A 3V8MA 5C35A 3IUBA 1O57A 1PRYA 1FW8A 4IXMA 4L5YA 4W99A 1QANA 4ETWA 2XZLA 4FOLA 3AINA 1MQ8B 1JALA 2VH1A 4LPKA 4A2QA 4NULA 1FQOA 2NT3A 3QA3E 1THTA 2IITA 1U4NA 4RVUA 4ZTBA 3FWPA 5TSDA 2VHYA 3BL8A 3F7OA 2HPAA 4F3RA 2FSGA 1AUOA 1WA5A 3K4PA 2JLSA 2JC3A 4LKOA 4I1SA 1PZXA 1W4CA 2IYOA 2N75A 1UXJA 1WSDA 4Y1RA 1N2BA 2VBGA 4MNTA 4U63A 2QRJA 5DHAA 2DUJA 3G9QA 1YR7A 4HZGA 2FZEA 4TTSA 4NNPA 2IXEA 5BORA 3O03A 4OQEA 2GD1O 4F92B 2ENWA 2FPXA 3KZCA 2X0FA 4EARA 3DXFA 2HSJA 5AM3A 3ZGNA 3TW0A 4ENRA 2C7PA 1WVIA 1P7ZA 1XHLA 3F67A 4YGYA 3V4PB 2EYQA 4G4GA 4AO7A 1HT2E 1Z35A 1MOPA 2PSSA 4MR8B 2OP0A 1W25A 1S8NA 1EX6A 4D02A 4KPUA 4TV8B 1DTWA 2GVZC 1CNMA 2X9LA 2WTEA 3M8KA 1EHYA 3K0CC 1UFRA 4MWEA 1RLIA 3O4VA 4M55A 3QM1A 5IBPA 3LW8A 1PJLA 3RS0A 4FR2A 2V7WA 1ZBDA 4XDZA 1WIWA 1G6KA 3GJYA 4JX9A 3KTFA 2BFOA 2R8YA 2VIIA 2XZOA 4ES6A 1Z6XA 4YLEA 3NCHA 3NALA 4ZAVA 1KI1A 3W5DA 3IUQA 2LNDA 4PC7A 2R7AA 2FEXA 4MVJG 5IDVA 4J4HA 4B3MB 3R1IA 5LQSA 3VPHA 3UPUA 1VMAA 2VSYA 3X1WA 1UH5A 1HETA 1V6SA 4OA8A 2W2MA 3PEFA 3ZK8A 2O0JA 2AOUB 2XUHA 1SK9A 3G5LA 1VIMA 2WJ4A 3FUCA 3RWMB 4PE5B 2I54A 3B1JA 4LZOA 3VJMA 2OV6A 3RIMA 4FUQA 3DUWA 1MO4A 3H3JA 3RGWS 4BVFA 1VDMA 2FY8A 2IUTA 4ITRC 3CR3C 5LBIA 3H8WA 3H16A 4NU6A 3ZLJA 4OB8A 3SGLA 4PC3A 2VJYA 5BNWA 4TWJA 2GHRA 2XEDA 1E63A 2OMEA 1BROA 1D2CA 3HYSA 3NH6A 3T3EA 3FY4A 3I32A 4N5DA 5B3KA 1QP7A 4MYHA 3S8YA 3TQOA 3COJA 1WOYA 3DM9B 3P9CA 4RS4A 4II3A 4YYEA 1Z34A 4CU2A 4MWTA 2XT6A 2OO5C 1BXGA 1CUWA 1FRZA 3P9NA 1XVVA 1R0WA 2YY6A 1ZWKA 1HE2A 1XP5A 2PLWA 2Q99A 1SQ6A 2Q9UA 2Z04A 4YQYA 5KTPA 2UVDA 2PUVA 3U6KA 3VR6H 4KPEC 1IK6A 4R71A 1AK1A 1OTXA 1YTLA 2B25A 2OBXA 1N2IA 2Q3LA 3IHTA 2OG1A 3SYMA 4ZOQI 3KALA 1SXJA 4KCGA 3PQEA 2BMDA 1N9GB 3M5CA 5AKGA 3D3QA 1IUNA 3H2BA 4HXEB 3QELA 3WYDA 2Z8YA 4Q0MA 3WADA 1FRFS 3JZFA 3KE8A 1R5BA 4TQUS 5IVDA 2IOFK 4RKFA 2DPHA 5LZ5A 3KRTA 5KYUA 1M2OA 4MV0A 3ZBPA 1DAHA 3U2QA 1DC5A 1VI5A 4G8JA 1P9WA 4C22A 3BE8A 3LKZA 5JAHA 5J2TF 1Q50A 4RK4A 1NQ5A 2YVKA 3DEZA 2QI9C 1L7MA 2ON6A 3IEVA 3KQMA 5CIWA 3LOUA 4DR2B 2GTHA 4ZK2A 4NCAA 2PG3A 2X2EA 5HKKA 1C9EA 1ONSA 1GL3A 3ABOB 2JATA 3GJQA 5D8DA 4ZALA 5ALJA 5TQ2B 7MHTA 5SV2A 2IYYA 3VI3B 2HGZA 2GNPA 5AKYA 3PVSA 4K2AA 2YYZA 1QF7A 3L4EA 1XRJA 1TIPA 1WVMA 2WD7B 1K5DA 4PPNA 1DIHA 4O29A 4YJHA 3PTZA 5H3CA 3LC2O 1WCIA 4C5CA 2CD7A 2DUNA 4ZVQA 1DTSA 2UZ1A 3VM6A 1AZLA 1J2YA 1ESCA 5CHYA 2P69A 1VJ0A 2A1IA 3T5DA 5CB0A 5A4KA 4Y2VA 3PUWA 4YRSA 2AUNA 5EXXA 4WN3A 1SUDA 2IYZA 2VT7A 5GZ6A 2E18A 4TL9A 3NBAA 3SICE 2PKRA 1RMTA 3Q12A 3PLRA 3ASUA 3DXXA 2QRMA 2YC2C 4HH1A 4OUKX 1XNQB 3EDRA 1EVEA 4B2IA 4CHGA 2XGGA 2IYWA 2PXXA 1T5BA 4I4CA 4PAMA 4RVDA 3R0QA 3TIFA 1PN3A 4PYLA 2MSEB 2OZLB 2V5AA 4NS4A 2QSYA 3KK0A 3TDMA 1WXDA 3W9BA 1JQLB 2PPLA 2ZB3A 3VC2A 3VKHA 3G82C 4QJ5A 5EJ6A 3I2HA 4PLZA 4F4HA 1XKTA 1L5LA 3N8GA 4OFXA 5JXHA 4OXXA 4LQLA 4AXXA 5L3QA 4NIMA 3SOPA 2WIBA 3QBJA 4AYTA 3NHJA 2EJCA 5AHXA 1ZNWA 1NBMA 3O8NA 1Q0PA 2DR3A 2VTKA 1E9RA 3IQIX 3DPUA 1GR0A 1FNBA 4HAWA 1T13A 4K6KA 2PGAA 4QTXA 3BQMB 5EIHA 2RGRA 1L9XA 3JWJA 1D4AA 3OCUA 1W4ZA 4TRNA 621PA 4FMCB 3VJRA 1WW3A 1X13A 4RSMA 1P1IA 4L02A 4E2XA 5HJ5A 1B0AA 3OSUA 3UUWA 3II6X 1K8QA 2AS0A 1GTG1 4TS3A 2Q4RA 1BCSB 1Q91A 1VQ1A 2FI1A 2NTVA 1S6YA 2I3BA 1ACJA 2IVZA 2RHJA 1E6MA 3D3EA 4JOBA 4CW7A 5KVSA 5DBFA 1IC6A 1H6AA 2XCIA 4NV1A 2F9FA 4MKRA 3Q9UA 4MV4A 5ALGA 1PFWA 2CDNA 2KBFA 2DHQA 1NRWA 5TQ0B 4B4VA 4U6QA 3FDZA 4NJMB 4QSHA 2IOQA 5GQSA 4DIDA 3NKVA 1DO0A 3Q11A 3T9CA 1HFEL 1ECCA 4I08A 1NI3A 2HH9A 2YHSA 4LC1A 4DCNA 4Z7NB 3HABA 4YNBA 3B2QA 4Q19A 1U8CB 3S8MA 4GDFA 5SICE 1VKHA 1Z9BA 1NURA 1SUEA 3BF8A 1KIAA 4BP3A 4CDMA 5LQUA 3KPJA 3JD0A 5EI5A 3R6DA 3B6MA 4MEBA 4R83A 3RSCA 3Q6MA 1U8YA 4WH0A 5JEDA 4DCGA 5JNWA 3J81A 2VKQA 1JAIA 2BKUA 3QVLA 1FFYA 1XTBA 4QDZA 4M0KA 1BU8A 4Y2YA 1G55A 5CDFA 4GX1A 3TRKA 4CCWA 4KGZA 1MX1A 3BE6A 3REFA 3UHOA 4C03A 2J1LA 2VDLB 1SC3A 2IUEA 1GLVA 3UNXA 3DLTA 4L5JA 4HN2A 2NSYA 3AEUA 4IRMA 2BSAA 4HF7A 1QLJA 4ZPJA 1LDBA 4M21A 3SXUB 3T3GA 5AW0A 1OZAA 5AM1A 4RVOA 3IKLA 3T5TA 4URUR 1XA3A 4I6GA 4BNIA 2XTJA 3A3NA 4L75A 2JAWA 4ZRNA 1ZI6A 4QDUA 2P5YA 4TTPA 5H8WA 4X94A 5IJAA 1HDGO 2V6GA 1HYHA 1SOAA 1YMVA 4JENA 1AKQA 4WZAE 1C41A 3PR1A 2NU9B 4IDHA 2FFAA 4KYIB 4TMKA 4GICA 4HDSB 3T7AA 2VJPA 5KTMA 2Y8EA 1FNSA 3GJTA 3IOMA 1QH9A 4RHCA 1FVOA 3HA2A 1Z7YA 3GLVA 3UKOA 1L6RA 1KQPA 3G7NA 1I13A 4DLLA 1ZGCA 3PENA 1BVYF 4FGWA 4GC9A 1ZD3A 1LSSA 5JS1A 5E9QA 4ZVKA 4K9DA 1KSGA 3LPMA 2Q45A 4OJNA 1M2JA 1SEPA 1TYEB 2VDVE 1LDMA 2RONA 1JVNA 1QOZA 1LV8A 1Z4NA 3A9VA 2BLNA 1SKUA 3GEDA 4P3OA 4YECA 3TQRA 2PRYA 1T29A 2H2IA 1VL5A 4OXRA 3S1AB 1UP7A 4OBXA 4BO1A 4Q7QA 4KXVA 1G64A 1H85A 4FINA 1JR3D 1OKKA 1ORIA 4S35A 4TSKA 4RAQA 4V1CA 3P9PA 5JNSA 1ATIA 3RRXA 3TQFA 1YJAA 1XTVA 2R6GA 5ADVA 3PQ7A 3F98A 1K27A 3NPMA 3FDXA 4AC9A 1EQUA 1JKIA 3TZBA 4PGHA 1PLLA 4RV5A 4RCVA 3WO0A 5COQA 2OLEA 4J91A 5LNK1 1DQRA 5LP6A 3ZVKA 5TF4A 3PT5A 3OOSA 2VLIA 3CZ5A 2A5JA 4LDZA 4FWBA 3K72B 3BZUA 5DCWA 1BA3A 4R6XA 4DG9A 2P0YA 1JDSA 4LJ6A 3U3OA 1OY1A 4PNPA 5A06A 1PE0A 3CX6A 3KB8A 4NX2A 1CP3A 1BE6A 2OYSA 2VHWA 4YRDA 2IP2A 2D5BA 5FULA 3T5AA 3IEMA 2HUNA 3OT1B 3CURA 1DWOA 4OG2A 5G1OA 4KLZA 4OJYA 2FOLA 1WZ2A 3HVHA 3KTDA 5F9HA 4WXHA 3GW8A 1QRDA 2W6PA 3TLGA 3VPGA 1E2EA 1MOQA 4IZ6A 2XUQA 3IH5A 3P0JA 1P1FA 4DXHA 4BBZA 2XEXA 1KQGA 3PXBA 3ZWKA 1ILWA 5BSMA 1GN9A 2V59A 3KQHA 2WM2A 3EHDA 2Z6UA 4MVJM 2HA4A 4J2OA 5U4XA 1LY1A 3TSOA 2UYQA 1LLQA 3HJNA 3WWOA 2QN1A 3H5WA 4JXKA 3VTAA 1KOLA 1P1BA 4IY1A 5A3RA 2UUAB 2AJBA 3VDRA 1ODKA 1WDMA 4FX5A 2FEKA 3M9XA 4ZARA 3H5RA 5K09A 2ZR7A 1UEJA 2WWGA 3WGIA 1GKYA 3O8DA 3I1FA 4K1LA 1FYFA 2XCOA 2F9LA 3VDXA 1WXIA 2OLKA 3QMVA 3F5FA 1GZ4A 1E2JA 1F2DA 1Z5ZA 4ML3A 4NH0A 4C30A 4MB0A 2V5UA 3G0BA 4IEEA 4MS4A 3E0XA 4IF4A 4M9RA 3RJ5A 2PUFA 1FNCA 2QWXA 1EE2A 2GPWA 3IT0A 3Q6IA 4U2CA 4CMGA 5KTKA 2JLXA 1WV0A 3EIXA 3AR6A 1DIOB 1XK7A 2VQSA 3R0IA 3FVWA 4E5UA 1P4JA 2IXGA 3PWZA 2YICA 5IBQA 2V6IA 2WJYA 3AB7A 3NDBB 4PRZA 5UKDA 4WUVA 3HP7A 4G25A 4Z1MA 1N7JA 2BKAA 1GL7A 3PI6A 4JB8A 4HFNA 4I19A 5H9VA 3D8UA 4RFSA 3KT0A 3PC7A 3TIGA 1SHTX 3MJFA 1PSDA 1PQYA 1PVVA 2GFQA 2YV2A 3AIMA 3B60A 3L01A 5IULC 2ANBA 3GCWA 3ETLA 4IOLA 4EHJA 1WHSA 2X6TA 2F1IA 1YJBA 1QO0A 3X1XA 2CFRA 2IKSA 5FBRB 3NGXA 2P90A 2QPTA 2X4LA 4BOYA 1G8HA 4M0DA 2DU8A 3NTOA 4TYMA 3VC7A 1P2BA 1AO3A 2JGLA 1D4ZA 1QSGA 4NK4A 3T8YA 4MUXA 3FVTA 3K5IA 4MPDA 4PLHA 4UUPA 5I51A 1QR2A 3DDHA 2Z0MA 2XUIA 4EY5A 1NXSA 1E62A 4L3WA 1QONA 1DS6A 1V3TA 3K0SA 2R6JA 4XDHA 1A95A 1HM5A 2ZYWX 4Z3DA 3WRXC 2WP0A 4H15A 1EWKA 1M5TA 3F3MA 3I0MA 4L6IA 1UC9A 1DKQA 1MJHA 1RAGA 3VSEA 5CD1A 1E5XA 1F7VA 4FFNA 5MN4A 1EP9A 3GYBA 5IYZB 4ESVA 1T36B 3RRJA 3AEQA 5AFSA 2QGNA 4L8YA 5DOZA 4P3NA 1QDEA 3EY4A 5CT5A 3EUFA 1YB1A 1RBYA 1INLA 1G21E 1XHFA 2TMKA 1MOSA 4RWEA 1L5GB 3PRJA 3STYA 2D7JA 3AHGA 1RYHA 2A1UA 4EX6A 3RT9A 2Z8XA 3PGXA 1AKVA 4CM8A 3NTUA 1T1JA 4UVIA 1JF8A 1VPLA 2D00A 3BSWA 3PEWA 1EIWA 3B70A 4XB6B 3ADPA 1J99A 4UZEA 2WSYB 3VYWA 4LZAA 4N9QA 2F8SA 4CG0A 4AJOA 1RHMA 4PX5A 1SA0A 3VX3A 4JDPA 4IIHA 2IPAB 3MB5A 4E1BA 3NT4A 4NEGA 2Q7DA 3VAYA 1W8IA 3DOEA 2RHGB 4PYIA 4EF4A 1UADA 3I4FA 1Z62A 5I7EA 6CHYA 2AG6A 2FUEA 3AOEA 3GEHA 4NU5A 4RSGA 4ZV9A 1GILA 3ZNQA 1I10A 3OCJA 2O2ZA 3WYGA 1A69A 2J6CA 3TGPA 2K7FA 3D7KA 1SCBA 3FDJA 4LTMA 3JQ7B 4R8LA 3B1ZA 1I0IA 1MABB 3EFHA 2EBWA 2L0XA 2GZDA 3CW2A 4P7BA 4ZCQA 3FNQA 3M3DA 4J49A 5EJ7A 1UMCB 3KZVA 5HJ7A 1BDIA 1ZIDA 5ILOA 2B0CA 3LSYA 3VR2D 2QXUA 1NP7A 2P3QA 3G79A 1GP2A 3IALA 3EG9A 2OZKA 4EVSA 2ODBA 5KNCH 5IJZA 5JD6A 5KNLA 4DY4A 1Z5UA 4O2RA 1UJ2A 3DT9A 3TLAA 4Q03A 2ZS8A 3LSTA 1Y81A 4RH0A 3CVOA 1ZICA 5DX8A 3DVAB 4GZ6A 3JRXA 2P1DA 4NBUA 1IPFA 2QYTA 1KJNA 3SNHA 1EINA 2QNRA 4MV1A 4AZSA 2CUZA 1VJ1A 2ZUDA 3WK9A 4IPTA 4LNHA 1K4KA 3EAQA 4WACA 3AF1A 2FWBA 1YR1A 3OFNA 3IPXA 4N5HX 4IG9A 2SCUB 1GZ7A 4ZVUA 4D4JA 2J3MA 2OV8A 3BXZA 3DLHA 1Q95A 3OQJA 1P0PA 1P4SA 2C3OA 1AN9A 4FSHA 4LSZA 3RWBA 3ZCRA 3K9LA 4WERA 2OM6A 4LY6A 4Y2QA 3FCOA 3NBZC 5ES4B 3O0DA 1KHHA 3V4SA 2VTVA 5JFGA 1G63A 2Y0PA 3QKWA 4UTPA 3GT7A 2FTKE 2ID4A 1YA6A 1QPZA 2HEGA 1UP4A 2V7EA 5E7JA 4B31A 4XDYA 2BGGA 1E5QA 1W1UA 4UARA 1UIRA 5KEIA 2E5FA 4Q4JB 3IO3A 1NUUA 1ODJA 2OPBA 4BGUA 4EG7A 4KXUA 2XCSB 2QD3A 1AH2A 1Z0SA 1G6HA 1CUHA 1U0JA 1SU4A 1E3EA 2VZEA 3CKLA 2HA5A 3CEJA 4G5HA 4LGMA 5JCJA 4JXZA 2P1ZA 3NGLA 4EG3A 5EHXA 1HWYA 1HOXA 4LN1A 1BWPA 3Q3EA 3BF7A 3QPUA 4V38A 4F1WA 3ZVNA 5F3RA 1ILEA 4NJEB 4N01A 1NFRA 2KM1A 2CF5A 4QJBA 3NEJA 3DJYA 1QM5A 3C6XA 4PLPA 4R8RA 3WBJA 1UFKA 4CT5A 3M6VA 2XQJA 3AR3A 221PA 1K7SN 2GT1A 2H0AA 4PZDA 4NAUA 2GAFA 4PYQA 4BJHB 3UJ7A 1ADYA 3DWEX 4ARSA 3MWKA 3LAWA 4IQGA 3X0DA 1HA3A 2G09A 3RC2A 3DF7A 4PONA 1R3UA 1XR3A 4TYQA 1T3GA 3ULKA 3AVUA 3AU8A 4OXIA 1Y48E 4BFUA 3HB7A 4Q3AA 2CD9A 4KX3A 4AXBA 4DCCA 2C96A 1M1ZA 2V7BA 1YT5A 2GZRA 3UGTA 2GJ4A 3G88A 1XTQA 3U3KA 2FV8A 4JJ4A 5DNUA 1MAUA 4XUCA 4IS3A 2XMPA 5HIKA 1CJKC 4PSCA 2IBTA 3FW1A 1GXSB 1EFKA 1QIJA 3E9DA 1T6YA 5J4KA 1L8QA 3ZGXA 2G17A 2EYUA 2YWBA 4YYZA 1DBQA 5C32A 4IDDA 5CB8A 1RDFA 4ZIRA 2O3QA 4OLFA 4Z9AA 3GPIA 3D8BA 4GSLA 2G04A 2JFFA 4WFIA 1CR2A 2I3GA 3AHCA 1O6CA 4BCBA 3WV5A 5IJ0A 1FNNA 4JLVA 3H0KA 4YUAA 4FDAA 1BFUA 2XNDD 1G5PA 4LDQA 5FBQB 1E9EA 4HEQA