2WIAA

Crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
253
Chain Sequence
MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Fold, Conservation and Fe(II) Binding of the Intracellular Domain of Prokaryote Feob.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
total genus 73
structure length 253
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wiaA01
2BIFA 3TR5A 1E0KA 3GLGA 3LBIA 1B23P 2VLIA 3DVLA 2CHQA 2QI9C 2H18A 1NG9A 2C2HA 2DB3A 3LLUA 4B75A 4OJKA 2FWRA 2Q21A 2AN9A 1UKEA 1ZYUA 2XTNA 4XJXA 1H8EA 4K8OA 4ZDJA 4DSOA 2QENA 3A1SA 3RRZA 5L3VA 2FSFA 4BFSA 2P67A 2X2FA 5E3HA 2PMKA 1DAEA 1RC8A 3EA0A 1WB9A 3GQBA 3NC0C 2QE7D 2YOFA 5DYIA 3H86A 2AL7A 3R20A 4CYMA 3EZ7A 2GCOB 3GD7A 2NOAA 1M7BA 4EAQA 2XITA 3KFXA 1GRNA 3LDAA 4MUBA 4LRWA 4DDVA 2BJVA 3I72A 3WNCA 4DT1B 4WVFA 1EWQA 1WMSA 4KSBA 2J46A 2FEMA 1AS0A 1FP6A 3QVVA 2XXAA 2HCJB 2Q9AA 1G64A 2QBYA 4LBYA 1N2CE 1PUIA 3R9XA 2J0VA 1Q21A 4PSAA 2D2FA 5JCPA 1XJCA 5JS7A 3W3AA 1NBMD 2D4HA 3O8BA 5FTMA 1Z6TA 4UNQA 1KK0A 4AKHA 1XDBA 1D2MA 3E1SA 3EX7C 2V1UA 4NMMA 2HF9A 4DLSA 3BBPA 2REBA 2W6ID 3MGCA 1G8PA 1E96A 1UPTA 4P4SA 2FMXA 3ZZTA 5EJEA 1OYWA 2DPXA 2QPOA 3WRYC 3PEUA 4RKFA 2JJ2D 3LAWA 4KODA 3G0HA 4U7DA 4PC6A 3Q85A 3U3OA 1G6OA 1ZD1A 2ONKA 3EW9A 2KI5A 4PPQA 1CS4C 3LH5A 4UXJA 5DSZA 4LC1A 2VP4A 1GUAA 1HQYE 1XTSA 2QN6A 3KQUA 2GF9A 1HUQA 4POAA 4WOPA 3I32A 3CR8A 3MJHA 4O2LA 3KKMA 3RS7A 4N0DA 3TVTA 2F43A 2Z6VA 3AF1A 5BQ5A 121PA 4LV8B 3FHCB 2XSZD 3N2EA 1I2DA 4KSCA 1KHTA 4G3XA 3N70A 4TMVA 2DFTA 5GVSA 4WZBE 1F6BA 4NCJA 3QEOA 3RRMA 4URWR 2WSSA 4BZXA 4RKEA 5JJIA 3PEYA 2F1JA 2W83A 1J7KA 1AK2A 4AG6A 4EIWA 1F48A 1SKYE 2PLRA 4Q19A 1ZIOA 3X2SA 2OLJA 2ANBA 4JLMA 4QBIA 4UNNA 5CK4A 4BGDA 4PPNA 2YC4C 4V02A 1KGDA 1G3IA 1WF3A 1VIAA 5E7JA 2A30A 3LLMA 2OFXA 1RRFA 2ONJA 5AUQA 3GLHB 2AR7A 2WWWA 3NHBA 3TUIC 3CH4B 1KI9A 4JVNA 2ZRNA 3W90A 3TVDA 2QA5A 1E3MA 4M1YA 4B47A 1E9RA 4V03A 4C30A 2C77A 1CBUA 1VG0B 4P33A 4QGHA 3THXA 2G83A 2WJVA 2DFLA 1JJVA 5TXGA 4BLOA 1OT3A 4MGYR 3RC3A 3WBJA 3DMNA 4DT1A 4YMVA 5KO2A 3R8FA 1DS6A 1W5TA 2QRNA 2B8WA 2J87A 3IIMA 4Q7KA 2O8EB 3PUXA 2OBLA 3CH5A 4Q00A 2ZS9A 2ZIAA 5FI0B 1P2SA 1L7VC 3SYKA 3U7FB 2HT1A 3TK1A 3VR5A 3RYTC 2HLDA 2ZI7A 3W5IA 4PAMA 2OEPA 5J40A 4QJ4A 5LB4A 3U5ZB 3K70C 1AS2A 2R6FA 1MR3F 3F0TA 4A0HA 2VQSA 1HEIA 1G3MA 2VBCA 4Q9LA 3ZVMA 2G6BA 2AHOA 5AJVB 3DO6A 1GITA 2BM1A 1XCPA 3GJ6A 3C5CA 4M1TA 1Z06A 2B92A 4U00A 2W0SA 5H68A 1SVMA 4RD0A 4URZR 4EFLA 2X77A 4N1AA 1YU9A 2VYFA 1G3UA 5EE9A 1XEXA 2ZM5A 3U61B 2Y8EA 3IHLA 3M4YA 1OIXA 1ZP6A 5FOUA 1WQ1R 5SZHB 3U3RA 2LKCA 4ACAA 4ASUA 1G18A 1ZU4A 2F9MA 2WWGA 3P4XA 2JLUA 5EP4A 1A2KC 2OV2A 5JRJA 3FYHA 4FXPA 1FX0A 1ZM2A 4V0ME 2I4IA 1GZSA 3QKTA 4HATA 4MRNA 4D25A 4ESHA 1PLKA 3OFND 3VR2A 4TLCA 3M6AA 5KHOC 4B6FA 4NYIQ 5CYPA 1YRAA 4LHZA 3SZRA 3FE2A 3ZIAD 3I5YA 1SKQA 3QY0A 2ZI5A 4IXMA 3CM0A 4LYJA 4LJ9A 3RS0A 1J70A 4BFTA 2J59A 2ZYVX 4M53A 3PCRB 1S0UA 3HR8A 3C14C 4MDFA 4BE7B 4HYYA 1GL7A 3CB4A 4EFNA 3GMTA 3LXRA 2IS4A 2GJ9A 4TSFA 1G41A 4TL6A 4DBLC 4P31A 3NC1C 3AV0B 3UG7A 5KU1A 2VH5R 2GZHA 3IBYA 4RD4A 1KNXA 4AYTA 2FV8A 2XEXA 1XRJA 3CZPA 1K5DA 1NJFA 1UBGA 2WJIA 3EZ6A 1G8GA 3TNFA 1F5NA 4BEBA 4YMWA 3THYA 1MO4A 1Y3AA 3RS3A 4HDCA 4BLQA 4DDUA 5HTKA 3CF2A 5BYKA 5AK0A 4B43A 1IQPA 4JKYA 3KUDA 1LW7A 3RS4A 1XFAA 2O8FA 3L0OA 4PHHA 2NO7A 4IOMA 1KI4A 2B21A 2UZ3A 3OEHD 4PHTA 2IT1A 3RHFA 3Q3JB 1KOFA 2IYSA 1N6LA 2V54A 5FR1A 2IS2A 1M74A 2ZJOA 3GEEA 4GSYA 1ZU5A 2WKQA 1E2KA 1NSTA 3X1XA 2CE7A 2ZTSA 3IQWA 4EPRA 3QUSA 2H1LA 4NU0A 5FPYA 1W44A 1S9HA 1TF5A 1N6OA 2QSYA 3QVUA 4FWTA 2O0KA 3ZVRA 4W9MC 1XEFA 4DSTA 1XEWX 4TL7A 4TSFD 1YZQA 3QG1A 4A9AA 3IKJA 4CEIA 4BWYA 1JJ7A 4OI1A 3B82A 3SN6A 1LS1A 1Z6AA 2WJJA 4QHYA 4JSYA 4BRWA 1E0JA 2QROA 2V7QA 3MJRA 5JFGA 4YDHB 1DOAA 1E2DA 2P0EA 1MABB 3F3YA 2ZSDA 4OHXA 4JLAA 1T8TA 1IJEA 2RKOA 1U99A 3EZFA 3A1TA 2CXXA 3G5UA 1Z83A 4BFWA 2XTZA 1CR4A 1OFTA 1S4QA 3ZQ6A 1EFRD 4DIEA 1Q3HA 2A5JA 1YR7A 2WWIA 1YRBA 1BOFA 2GETA 3ZVNA 3FMFA 1XB2A 4Q1BA 1BYUA 1CTQA 4C0SA 1OB5A 2AFHE 3FHTA 3TH5A 1MOZA 2QT1A 3FMPB 1M34E 4H9GA 1XCMA 3FKSD 2EFHB 3U2QA 1GG2A 2WHXA 721PA 1KSHA 1P5ZB 4KYUA 3GFOA 2WMOB 3CW2A 1SHZA 5GJVC 2RAPA 1CP2A 1FNMA 1U98A 3EASA 2X19A 2MSCB 5FPKA 3T34A 1U8AA 2ZR7A 2AFIE 4M9SA 4BEJA 5CLLA 1CR0A 1E0SA 1H8HD 1VCNA 1HH4A 4JBXA 1JAHA 1ELOA 3CWZA 2F3RA 4TYNA 3MCAA 2QAJA 1ZC3A 2GDJA 1MV5A 5FOWA 4B2LA 3CO5A 1G4UR 2FOLA 5AJXA 4B3BA 4A4DA 3ICEA 1IN8A 4QNRA 4TWZA 5E95A 3AF3A 1Z28A 2CLDX 4H1UA 1E2HA 1E79D 2VA8A 3BC1A 4YMUA 3K70B 3MWJA 4M0LA 3NIBA 1R0ZA 4Q1CA 4OHWA 3FPAA 2QTHA 1UDWA 1MRSA 2V1XA 3IPYA 3CKLA 1XTQA 4QJ3A 2CE2X 4CT4B 4GZMA 2A5GA 3QPVA 1RJ9B 4JLKA 1NVUQ 2P6RA 1ZVQA 4E22A 1RYHA 2CK3D 1E2FA 2A78A 4IFEA 1G291 1P2UA 1T6NA 1D2EA 3BXZA 4IXNA 3U7EB 3SFZA 1ZUIA 4BFUA 4C0BA 1OE0A 1BH2A 1ZC4A 3DMDA 1GL9B 4D4JA 3EPLA 3RRYA 3OESA 4DCNA 1CR1A 1E2LA 1OYYA 2ZE8A 4JJZA 5D3MB 1II8B 2GA8A 2V7QD 3AQ4A 5JEEA 3I61A 1KY3A 2FPKA 3TUZC 3WBKA 1Z07A 3PUWA 3TW4A 2EFEB 3D31A 3CR7A 3SDZA 5CIQA 2ZEJA 3KDSE 3NBXX 3TGPA 2A3RA 2V3CC 2WSSD 4Q02A 1PV4A 1XX6A 3MRSA 4EJSB 1OIWA 2ZRBA 2WTUA 3C7KA 4YMSA 2J0SA 4OKSA 1C1YA 5BWMA 4KU4A 1NMXA 2DWQA 2PMDA 3R9WA 2YWFA 2HCBA 1XNJA 3AGPA 4PC7A 2ZITA 1DBSA 1N6KA 1F2UA 2V8OA 2ZE5A 4IOLA 4LDJA 1M7HA 4B32A 1JNYA 4A1FA 3AP2A 3BH7A 1JXOA 4MQBA 4D0GA 3K0FB 3NWJA 2O8DB 3RVBA 5G40A 1R5BA 1C4OA 5TV2A 1QZXA 4C0AC 4WXRA 1QHYA 3SOPA 2AKAB 4M4SA 1P7CA 3IO5A 1LF0A 3UIEA 5JJLA 3EXAA 4UNPA 1JPNA 1QHHB 2J45A 4OQXA 2YOGA 1VG1A 4AYXA 1UF9A 3ADCA 1W4CA 2G1KA 4C3ZA 2GAOA 1RKBA 5DI3A 2CHGA 2YVUA 4Q66C 1Q20A 3LFUA 2LKDA 1XTRA 1CLUA 3CLVA 2WWHA 4F4CA 3EC2A 5BYJA 1IONA 2BMDA 4M1MA 2R6DA 3CF6R 4KLNA 2RGGA 2IWRA 2CBZA 3QF4A 4KV9A 3B8HA 4FIDA 1OXUA 4RJLA 5G3ZA 4Z54A 4LBZA 5KNBA 1TAGA 2EYUA 2ZRLA 4BFZA 2QMEA 5HKKA 4QM7A 4HB0A 2H5EA 4PAQA 1I4LD 2YC2C 3GLIB 3QQ5A 4NCHA 1BMFA 4I4LA 1V43A 2OESA 2QBYB 2OUKA 1JQJC 3E5HA 3SHFA 1NN3A 3SBDA 1FOEB 2NQ2C 4NDZA 2BEJA 1SVOA 2O8CB 3AVTA 1W0JA 2ZI3A 2ZI9A 3QENA 2OM2A 3D8BA 4R2HA 1D9XA 2GCOA 1CR2A 4GZLA 2Z0MA 3BWDD 2J5XA 4Z8YA 3TE6A 5L3RA 2VP2A 2ZR0A 3VMFA 4XWKA 2B6HA 2FSIA 3PENA 4OI4A 3VX3A 1YQTA 3GLFA 4RY2A 2CLSA 3AKCA 3KKOA 5A5GA 4US2R 2FSGA 2WMNB 2JAQA 4HB3A 3IO3A 2J7PD 1X8JA 4QBFA 4B44A 5A4JA 2C96A 3DPUA 2BBSA 2IUUA 2ZROA 1QDEA 5KSYA 5E4FA 4RD6A 2GK6A 1GOTA 5E7IA 5J4HA 2FJUA 5CK5A 3VFDA 4HUTA 5J5CA 3V9PA 4KFTA 4GP7A 1KZ7B 4DC9A 3PUYA 2C5LA 4RZUA 1G21E 5L3SB 4KBFA 2VSFA 5FUYA 1B0UA 4Q9HA 3ZQJA 4ZI3A 4DCVA 1QHXA 5EE5B 2BBWA 2VF7A 4D82A 2JASA 4C9BA 4LV5B 2KBFA 4GOJA 4JL5A 1GRRA 2QTFA 3P4YA 1HV8A 1T0JB 2VHJA 4JLBA 2H7VA 4KBGA 3IILA 4JLNA 1BIFA 3PEVA 1VMAA 4MYCA 1XEWY 3VKGA 1UEIA 1UKVY 2B8TA 5FBLB 3TBKA 2XJ4A 2JGNA 1M6NA 1E9FA 1JXMA 2I1QA 3KJGA 4P4UA 4Q21A 1SXJB 2IYUA 1NKSA 2OHFA 1DAIA 3VHXA 5CB8A 3LD9A 5DH9A 4RVCA 2IYXA 2N46A 4MRSA 4H1VA 5LD2B 3M0EA 2QMUA 4B74A 2YV5A 2ZSEA 3QKSB 5E7MA 4V0OA 5FFMA 5DNYB 2WM9B 4TQUS 1AGPA 1ONBA 1FL9A 3P1JA 1GFIA 2FZ4A 1T3LA 1Z2AA 4HUQA 3ND8A 3AB3A 5FPHA 2ZREA 4HLUA 1IN4A 3RS2A 4AWXA 1QHIA 5CLQA 2KJQA 3AF0A 4IOJA 5AUPB 1GL6A 4KFUA 3KJIA 4B3XA 1P75A 4M22A 2QQ0A 2WJGA 2Q3FA 2AXNA 3F5FA 3HPRA 4Q7LA 4NL4H 4LJ4A 4KITB 2DY1A 4OI2A 3DZDA 2V6IA 5K8IA 3AVPA 5EQTA 1W47A 4JLJA 3U44A 4OQNA 3JVUA 1RW4A 3Q5DA 4PZZA 5AUNB 4LPKA 4L9WA 4OK5A 3CNLA 1E1QD 3A8TA 2FU5C 3DOEA 1MO3A 3PQCA 3TAHA 1XZQA 4C0KA 1NVXQ 1SVIA 2GJKA 2F1RA 1E9EA 3THYB 4JKIA 3KQHA 1P72A 2FGJA 2FA9A 4FMDF 3BJIC 2JJ8A 3LBHA 1GRQA 4HAZA 1A2BA 4MYHA 4NP6A 4MKFA 4DLXA 1HURA 1IN7A 2BV3A 1QHNA 1W1WA 2R9VA 1BKDR 5KOYA 1AQUA 3CX6A 1J8MF 1OFHA 1T4GA 5CYOA 4ZV4A 1I4TD 2L0XA 4C4PA 5BN4A 3L43A 2PCJA 3U4QA 3GJ8A 3IUYA 2F6RA 2IK8A 3FMIA 4L4UA 1P2VA 3J81k 4BASA 2GXQA 2GAAA 2IA5A 3RDPA 2QPAA 4DCTA 1UBEA 1TMKA 2Q9BA 4JVLA 4E09A 3WMGA 3AVYA 3CONA 4OQMA 4D81A 3RNLA 3UKDA 1L2TA 3CRVA 3PUVA 1ZD9A 5JHHB 1IOZA 1F60A 2O5VA 3I92A 1Z0KA 4Q5IA 4B3DA 4GRAA 1P62B 5M04A 3GLIE 2BDTA 4JT2A 5G41A 4Z1MA 1AJEA 1TF7A 4Q01A 1KI6B 2IC5A 1OH8A 1VKJA 2GEVA 4Q03A 5JCZA 2UVQA 2VRWA 4A2PA 1KIMA 2QQEA 4ACBA 2PZGA 4DB4A 2XXAB 4FINA 4JZKA 1HY3A 1T3SA 3WP1B 1RFLA 4JLPA 2P6NA 3MFYA 5FL7A 1ZNXA 1L8QA 1G17A 1ZUNB 3U4QB 2RGNA 2VHQA 4RSGA 1KI3A 2W6IA 3S1AA 4W7SA 3EC1A 2YKGA 3IQXA 1FQKA 3FKSA 2BMFA 5CJPA 3A37A 1VECA 1SULA 2YHSA 4JYBA 4MUAA 4K81B 4OYHA 2O8BA 1E2GA 4LPSA 3AEZA 4Q4HB 2ZQ5A 2W2TA 4EQ6A 4ARZB 4LJ6A 1HQCA 1ZCBA 3ETLA 3B85A 1ZNWA 1HA3A 4TMZA 1A5TA 1JR6A 3DZ8A 1JR3E 4WBSA 1R4AA 1JALA 2DHRA 2N42A 2ZVPX 2AWOA 1XJQA 2DYKA 2GJSA 3WMFA 4Q1EA 4HAVA 1J90A 4MYUA 4AI6A 2ODBA 3P20A 3NEYA 4A8JC 3OEEA 2J41A 3K0CC 4F4JA 3ZVLA 1U8ZA 1FUKA 2FGKA 3GFTA 1E9AA 4GT1A 2OAQ1 1EFUA 4C0JA 1XPRA 2WPDA 3H2YA 5EZ6B 3AVUA 4KVAA 1SKYB 3RLFA 4DLZA 2ZJ8A 4Q9IA 4XVUA 4BLTA 1R5NA 4G1UC 3EAQA 3W6PA 3LRPA 3ZD6A 3KJEA 1IXZA 3GJ0A 3N2IA 4J0QA 1S8FA 1W36D 3T1VA 2OFWA 2ORIA 2ZUDA 3B9QA 4MDEA 2D7CA 3BFVA 3GLHE 4U02A 1DAFA 1G5RA 1GDDA 4CVNA 1KI2A 4NKRA 2FDCA 4NCIA 1RVDA 4PC3A 2HV8A 4LBVA 4I1OA 4TT3D 4ITRC 1Q57A 4MKIA 4URXR 2OILA 4C7OB 3NH9A 3MWKA 2QPTA 1CF4A 1SVWA 1TQDA 1GNRA 1ZM7A 3CRRA 4NHOA 3ZS9A 5TARA 5FI1B 2VSOA 4C7OA 1E2NA 2JLSA 4KYIB 1WBBA 2BOVA 2J0QA 2VL7A 4L5BA 5SZIA 3BS4A 3SNHA 1RYFA 1R8SA 4LCBA 4DCSA 1QVRA 1Q1ZA 1S2MA 1O3YA 2PT5A 3UMSA 3CRMA 3LQQA 4ZKDA 2EWVA 4PQFA 4IFBA 1XMVA 3RSLA 4F91B 4I81A 1H65A 1U94A 4URUR 4DUGA 1Z0AA 3IEUA 4JLDA 4OBEA 3BH0A 4XVQA 2FFBA 1E1RA 1W2HA 2RCNA 3I8XA 4JIMA 5J47A 2WBLC 3PG5A 1YZNA 3QXJA 4URYR 1P9RA 1R7RA 4CW7A 2BC9A 2O8DA 1JR3D 4PC2A 1KK1A 4CEJA 1KMHA 2RGEA 4ESVA 3RABA 1U0LA 4Q7JB 1NBME 2F43B 4M1SA 1WA5A 2W58A 5EP2A 4OJQA 2ZRPA 5CITA 1P2TA 1YZTA 2F1IA 4PSVA 5TMPA 3T5DA 3UANA 2Z4SA 1XD8A 3ASYA 2N1BA 1R0WA 2H17A 4US1R 4EFMA 4HLDA 1ZJ6A 1US8A 3WYFA 1NP6A 4HAUA 1SXJD 3T35A 1D9ZA 1Z08A 3IGFA 4KVGA 4C0LA 3I62A 1S3GA 1US8B 2D7DA 3CNNA 3GCGA 5JBQA 4IHQA 2ZRHA 1DAGA 1EXMA 1N6PA 5LD2C 1LNZA 4DLVA 5KDDA 1AKYA 2ZRMA 1W4RA 1SXJC 2F7SA 4OHYA 1KMHB 2GXAA 2R2AA 3LA6A 1C9KA 2BCGY 1FFHA 1SHKA 3OEED 1ZMXA 2WPDD 1OXSC 1WE2A 1JAIA 3QG5A 1P4SA 2REOA 3FB4A 3KX2A 1GNPA 3RS5A 3BORA 3Q5EA 2GBLC 1QVAA 4MGZR 4DLRA 2QP3A 2VP5A 3NH6A 3TW8B 1UAAA 1YZKA 2CJWA 4ZDIA 3RWMB 1G7CA 3I8SA 4BLPA 4N3NA 3VTKA 4A8JA 1FMJA 3Q72A 3KB2A 4AURA 4EPXA 1UFQA 3CNOA 1NIPA 1VG9B 5KSZA 3I3SR 4P4TA 2IX3A 5TB5A 4JL6A 4KJZA 1R5OA 1XJ0A 3P26A 4DIDA 1EWRA 4MYTA 5ANRB 2KB0A 1F2TB 4DSUA 3Q9LA 2XJ9A 1RE0A 5UKDA 2HYIC 2OCAA 5EE0A 3L0IB 1PLLA 1XF9A 3WNDA 4QJ5A 3D7MA 4Q1FA 1FNNA 1G5TA 4YDSA 4A2QA 3EPKA 5F9FA 5IK2A 1UDXA 2A2ZA 3OIUA 2NGRA 3QPUA 4P32A 3I5XA 2P5SA 1N5KA 1Z3IX 1DG1G 1QHGA 3AKEA 3DOFA 4JSTA 4L8GA 4D2IA 4E5UA 4WZ6A 1H8ED 3GPLA 4B33A 2ZRJA 1FUUA 3BFXA 4PPGA 2ZE7A 4CEHB 1H8HA 2WOJA 3FVQA 3GLGE 1NVWQ 4RD3A 1A82A 4AKIA 2XZPA 4L16A 2NO1A 1DEKA 1UBFA 1ETUA 3A4MA 3SHWA 1CJKC 1KK2A 3Q7QA 1N5JA 4UKDA 3AVQA 2FFQA 3C16C 4HAXA 1NY5A 3K1JA 1N5LA 4GBMA 4F38A 2CMKA 1AQYA 1XPOA 2GCNA 4BZQA 4KCGA 4UXIA 1KI6A 1OB2A 3B1ZA 3QXHA 4GOKA 3GLIA 3A58B 5EP3A 4P4SB 4W5HA 5TDHA 2DBYA 2QP4A 2ORWA 4CIDA 3PFIA 2F9LA 4IEEA 2F1HA 5K8LA 2WOOA 2JJ2A 5IDVA 3BB4A 4F4IA 1E6CA 2D74A 4ZCIA 5BXQC 4GMXA 3UMFA 1TQ4A 2R62A 1E79A 4OQLA 2RGNC 3AP3A 4XTCS 4AIIA 1U0HC 1OIVA 2RGXA 3E70C 3L0PA 4Q4LA 4QHSA 5CM8B 1KJYA 3B1YA 4HB2A 5BN3A 2R44A 1ZAKA 4ZDWA 2YWHA 4XD7A 5A0FA 5FTLA 3BRWD 3SJCA 2RMKA 5FOXA 1DO2A 2YJTD 1R0YA 2C78A 3EIQA 3NBFA 2OBMA 2V6JA 3NBZC 4K46A 5DN6A 2BWJA 1Q3TA 3WHLA 1XBTA 2IW3A 4NBSA 3KQNA 1JR3A 2JA1A 2C8VA 1VTKA 1DAKA 3OZXA 3EPHA 3PXGA 2ASEA 1DE0A 2EVWX 1FTSA 1K8RA 4EQ6B 2ZRDA 821PA 2P5TB 1IY0A 5C18A 3G82C 3HYTA 4WW0A 3WMEA 1II0A 5JMTA 4BFYA 2ZJBA 2DWPA 3A4LA 3KTAB 2C99A 3MD0A 3T1OA 4DLTA 2Q3MA 3Q7PA 1Z5ZA 1S9DA 2WKRA 1CRPA 1TU3A 2OE2A 2ZJ5A 4LHVA 1EK0A 4EPWA 4Y0VA 3S1AB 1AZTA 1AGRA 1OXVA 2JJ1D 3QBVA 3B9PA 1KI8A 1T0HB 3QKUA 3WYAA 1X8KA 4DDTA 3AGQA 4G5GA 1XMSA 1JEDA 2ZRIA 4HLCA 2IHBA 2H8KA 3KJHA 5TVKA 2EFCB 1WDTA 1KZGB 2ERYA 3OIVA 2WAXA 5LPNA 2OXCA 2PCLA 4FCVA 4Z1MD 1JBKA 4HB4A 4JS0A 3QXSA 3K9LA 5EUQB 5JLJA 3OFNA 2C98A 3HU2A 4LUCA 3B78A 1QG2A 2SHKA 2HF8A 2YWEA 3BE4A 3SR0A 1XU4A 2NPFA 3QKRB 1YJ5A 4TLDA 2OSBA 2FFHA 4Q47A 3JZAA 1TUIA 4DVGA 1D6JA 4DRZA 3C41J 3WXMA 3R7WA 4DJTA 3FOZA 2IYQA 4G5OA 2OCPA 2NIPA 4KI0A 4XWAA 4A6PA 4PX9A 3VU9A 5GADl 3I4LA 4RFSB 4TLEA 3LX8A 4DZZA 4PHGA 3U3JA 4ZPXA 3QF4B 1QG4A 5GJCA 1TADA 1OKKD 4DEXA 4E07A 3DDCA 2JLXA 5HZKA 1R8QA 1E4VA 2OO7A 3HP1A 4CDGA 5DIFA 2GXUA 1DELA 1LFDB 3RWOA 2WSMA 4BFXA 1Y63A 1HE8B 2CHVA 3L8YA 2Q0HA 1BMFD 2FPMA 3AVWA 1OW3B 4B3CA 1AZSC 1E32A 4IJMA 1UBCA 3IPXA 5HCIA 4HLUC 5F98A 5SZJA 5L3SA 3Q8XB 3GJXC 1KK3A 3IDQA 2NMVA 1KSJA 2VIIA 4HZIA 3VNVA 4GI7A 4FWIB 3LV8A 2QM8A 1JPJA 4G0NA 4A0GA 3OIYA 3UWOA 4B2PA 1DG3A 3MSXA 2IEZA 1XP8A 4YMTA 2CCKA 1OH7A 4BECA 3ADDA 2FX3A 5CB6A 1N0WA 4RFVA 1ZIPA 4YXWA 1E2PA 3BAFA 4IW3B 1NL3A 3SJZA 2O8FB 3HYRA 4PR0A 2QRZA 4W5JA 5KDOA 4DSNA 3GLFB 4IVPA 3U44B 1Z8FA 2CVFA 2BM0A 4LI0A 1KO4A 3RC8A 2J7PA 4TTQA 4GMDA 1QHHA 1VCMA 2HXYA 2DWOA 2R6AA 3TSWA 2KWIA 2QL6A 1D5CA 4X8HA 1Q22A 5GJBA 3BERA 1LTQA 2JLVA 4KAXA 4TMTA 1T3HA 1PLJA 2RB4A 3SU8A 5DYGA 2ZSAA 3NG1A 1VCOA 2D06A 4PC1A 3TRFA 5FH9A 2G0NA 2FE4A 1J99A 4TYPA 2CL6X 3CPHA 2ZUCA 4TYWA 2CEAA 5D3MA 4IVRA 5HE9A 3TKLA 3PV0A 1IY1A 2IUTA 1X86B 1KKMA 2A5YB 3A36A 1X3SA 4LC0A 3X1YA 5K8UA 3W6NA 3X1WA 2WICA 1JB1A 3LVRE 4AKGA 2GEUA 2XNDA 1KSGA 3BB1A 1U90A 2ZSFA 4TT3A 1KYIA 2RH5A 2Z4RA 4LK2A 2HYDA 4FMBB 3EG5A 3IIKA 2BKEA 1RIFA 4ZIRB 1NKTA 1M8PA 2ZR9A 2MMGA 3RRNA 3W5JA 4QOSA 4Q9KA 4M9QA 3GLHA 3M1IA 4RZXA 4DB2A 2O8CA 5H70A 2H57A 3AM1A 4V0KA 2H16A 4MGKR 1NN0A 5P21A 3W34A 1TX4B 1N6IA 4HI0E 4O3MA 3HU3A 1RRPA 1IN6A 2PJRA 3AKDA 3PUZA 5CDFE 2CL0X 4ZCLA 3VR1A 1NMYA 2FNAA 4OK6A 2OCBA 4XTRA 2VO1A 3SJBA 3QXCA 4D4LA 1G7TA 3QJYA 2OT3B 4IEIA 2WWXA 3FFBA 1XMIA 3MWYW 1NBMA 3BFKA 1NSFA 3GEHA 3LVQE 1F2UB 1I4DD 4AYWA 4HEJA 4EKDA 2FPLA 1G7RA 1R10A 1A4RA 1SGWA 4PO9A 5KDLA 3VR3A 5CIWA 1U0JA 2JDID 4B73A 1ZUHA 2XAUA 2Z5FA 4LY6A 5JSZA 2GJAA 4LZZA 2GILA 5FBQB 5AUOB 1SXJE 3P27A 2B7CA 4TMXA 1W4AA 4JT4A 4M1KA 5B57C 3TQFA 4UQOA 4D26A 3AF4A 1Z0JA 4DDWA 4YONB 1VG8A 3HU1A 3THWB 3KB1A 3VQTA 3GP8A 2TMKA 4LX0A 5C4MA 1ZNZA 3V00A 3SS8A 3IHWA 1U9IA 5EXPA 4QNMA 4V0NA 3ASZA 1GNQA 4TTPA 2QY9A 1E1QA 1KO8A 5JWHA 4HDQB 1JQLB 1G7SA 2J3EA 2WZQA 2ZJ2A 5FBWB 3KXIA 3R7WB 3QKSA 1UADA 1KDOA 3PITA 4ZO4A 3BD9A 2WJYA 4CEHA 1GM5A 4PAOA 1UEJA 3L0SA 4YC7A 5GJWC 5EXXA 2Q3HA 4B71A 2QGZA 3KXKA 4G5RA 4II7A 2QP9X 4RD1A 3QF7A 4XSHA 2CL7X 1DAMA 2ZYUX 4MKHA 1N0UA 1I2MA 3LW8A 3UG6A 3T1QA 1ZNYA 4R98A 2GK7A 1UJ2A 4B76A 2AD5A 2BMEA 1ZM3A 521PA 1RRGA 1WRBA 2HJGA 4LSGA 4LGMA 3ONWA 1ZBDA 2PX0A 1FMLA 3ZZUA 1AM4D 2GVDC 2IYVA 1KO5A 2GHIA 1S3SA 2GXSA 1KJWA 1TNDA 621PA 1CJMA 2IS1A 1NN1A 3HJNA 4EPYA 4P3YA 1IM2A 3PEWA 1CXZA 5C2JB 1XD9A 5J4YA 1FW6A 2WVJA 4XOIA 1TQ2A 1X1RA 4CEJB 2ECKA 4FMCF 3NKVA 3P32A 4B3GA 3H1TA 3LBNA 5B2ZA 2V4ZA 3VKHA 1W49A 3ZYCA 1Q0UA 1R2QA 1P6XA 3L2OB 3SFVA 1NLFA 5DGXA 2P65A 2E87A 1G3QA 2RGDA 1MKYA 3OIWA 5KSOA 3ADBA 2IYLD 1KO7A 2R6CA 1KDTA 3X1DA 3GJ7A 1AA9A 4QG7A 2C9CA 5IRCD 2JLRA 3AKYA 5KTYA 5B58C 4RD2A 2KE5A 2CLCX 4UNRA 3DKVA 3B7GA 4DKXA 1Z6YA 4NYMR 2XGJA 2O0HA 4GDFA 4M2LA 1G1MA 2ZS7A 4I99A 2ATXA 3O8DA 4HDOB 1X6VA 2NTYC 5KSPA 1GP2A 2BMJA 5FL3A 4DEYA 1E99A 4BLSA 4PXAA 3U6BA 1LS6A 2QE7A 1CULC 4AKEA 1ODFA 1V5WA 2HEIA 1GKUB 1E2IA 5HCNA 4CEIB 4MKGA 5IK2D 3OAAD 3BOSA 3FDIA 2C04A 2C9OA 3KZ1E 1IJFA 3NDPA 2AX4A 3SYNA 4A6XA 2J0UB 2OG2A 3VR4A 1M7GA 5C1BA 1RPZA 1W0JD 5BN5A 1P9WA 4F93B 2MSEB 2NZJA 2XNSA 1J2JA 2GVZC 3TLXA 2OLKA 3PIRA 3NHAA 4OQFA 1ANKA 1ZM9A 4U5XA 1A1VA 2G0TA 4DWJA 1YVDA 5L3QB 2QSZA 1Z47A 1LY1A 2R6GA 4BLRA 1Z0DA 5SZKB 1DARA 1W36B 3ZIAA 4Y0AA 2PEYA 5C4GB 3C15C 3KUCA 4FCTA 2W0MA 2IL1A 2W2VA 2D62A 4B48A 1HT1E 1II8A 1UM8A 2OZEA 2GNOA 1NF3A 3K9GA 4HSEA 4RZ3A 2QAGB 1P61B 3VAAA 1TTTA 4M9ZA 5HR5A 1CU1A 2XOKA 4F7WA 1XWIA 3CRW1 1R0XA 4WAUA 2QGNA 3NEJA 1N5IA 4A8JB 2XZOA 2NO0A 2ATVA 1VDZA 3B2EA 5EP1A 2IHYA 3K0CA 3KKPA 4TZ0A 4CZ2A 1OH6A 1IY2A 1OSNA 1LVGA 4KXFB 4TL8A 4E03A 2A9KA 4Q4JA 4A0RA 3T61A 1TF2A 2AWNA 1Z63A 4EJSC 3OE7A 3TR0A 1UKYA 2JATA 3AVVA 1T91A 3AVOA 4GP6A 4MA4A 3O8RA 2E9SA 3NVAA 4TL9A 2BBOA 1GIAA 1WCV1 4FN5A 3AH8A 2OAP1 3K0EA 5J4VA 1XTJA 2QMOA 2XZLA 1U81A 5AWFC 4DCUA 2QT0A 3FHOA 2C95A 4JBWA 4D4MA 4M21A 5JECA 2DR3A 2VP6A 4NTZA 3WY9A 1VYTA 3K0AB 1M1YE 4MRRA 3TAUA 1SVKA 5FUXA 3JZMA 1NJGA 3VR6A 4XVRA 1W4BA 4GPTA 1QBKC 4BUJA 1OH5A 2A5DA 1KY2A 2JLWA 2ZI4A 1NIJA 1G16A 1GSIA 2JEOA 3E2IA 4S35A 1GTVA 5L8VA 3T5GA 2QNRA 3CX8A 5FTKA 5J4LA 4KFSA 4UNSA 1IXSB 2P6UA 4Z8XA 1XPUA 2VPPA 1II9A 3QOFA 1PVOA 2GZAA 3K9NA 4RCYA 3MAAC 1DAHA 1XEXB 2IXGA 1KTVA 4ZKEA 2ZYTX 3B5JA 4NYMQ 2XSZA 3SQXA 4RZ2A 3EWSA 3A1WA 1P60A 2G77B 3GEIA 4QL3A 4A36A 4QGFA 4MGIR 3OAAA 5JI2E 2NO9A 3U3KA 1OKKA 1Z0FA 4EJSA 1G4AE 2PZEA 3PVSA 5FOVA 1VYUA 2LWIA 1VHLA 2FF7A 4LJAA 4CRWB 4TMKA 4UJ5A 4I1VA 3SQWA 4FD2A 1LV7A 2QAGC 3ADKA 4ZIRA 3EARA 1FP7A 3F8TA 1YR8A 3ZZ0A 5TY0A 6Q21A 2FZLA 3WNBA 1FTNA 2BHRA 4C0HA 5KNDA 2GWHA 2ZJAA 1CKEA 1W2GA 3K0FA 3CPEA 4DXAA 2G88A 4GFDA 5JWRA 4AC9A 2WWFA 4CT5A 3ECCA 1OV4A 4URVR 5IHPA 1XMJA 2CVHA 3V4FA 3B1WA 5B64A 1E0AA 4IDQA 4LYAA 1G5PA 1AS3A 1SQ5A 1U9IC 1FPMA 2VP0A 5DI9A 2JLQA 2RHMA 2ZAOA 3TIFA 2NO6A 4PFSA 4DLWA 4BRUA 3EA5A 2WV9A 4HLQB 1YR6A 5DE3A 1QRAA 4M1WA 2BBTA 2J7KA 1S1MA 2ZU6A 1P3JA 2DFKB 4BQSA 2J9RA 5DO9A 2QM7A 3QPWA 3QEJA 4O0MA 4FCWA 2FH5B 2QTVB 1T5LA 3UMRA 1W48A 1RRCA 2PL3A 2ZRCA 1HTWA 1W0KD 3EZ2A 2HLDD 1DVRA 1HT2E 4IOKA 4XH9B 4I1UA 4UJ3A 3QNUA 1LF5A 3CUEF 3NBYC 4JL8A 4XIGS 1Q44A 4HAYA 4V0MA 4AD8A 1S1CA 2DFNA 2ANCA 2H92A 2YYZA 3N5CA 4MH0R 4TN1A 3UWKA 1T8UA 3QSYA 1U8YA 3K09A 2MMCA 3C5HA 4PPFA 5HZHA 1KNQA 3KXLA 4C2UA 4ABYA 4Q4AB 1K5GA 4I1SA 4JBYA 4PO8A 2K5UA 4TLAA 1EX6A 3C8UA 3LX5A 1W5SA 2XB2A 1ZW6A 2NG1A 4MRPA 3H4MA 3HDTA 1ESMA 1DADA 2J1LA 4W5WA 2ZYWX 1RJ9A 3WYGA 2HDNB 1CEEA 2WKPA 1KKLA 1OHHD 2ZAMA 5JZVA 4A92A 4OI0A 4IDOA 2O8BB 4ZI2A 4QGGA 4ERNA 2R8RA 2QAGA 2W00A 3MG9A 3LW7A 3DL0A 3KQLA 4QXAA 4IDPA 5JS8A 2IYYA 3GLFE 2MSDB 1N6NA 421PA 2FSHA 4MITA 4Z51A 4LBWA 2UZIR 2BCJQ 2EWWA 2PZFA 5K8TA 1E9CA 2VSXA 2HXSA 4A2WA 1NVVQ 2X8AA 1BS1A 1NG1A 5D3QA 2ZJZA 2Q9CA 1SZPA 4QBGB 2X1VA 4Q4AA 5JWOA 3EPJA 2QEQA 1NRJB 1P9NA 2AK3A 4TYQA 1N0VC 5EE3A 1EESA 2AKYA 1YHNA 5KPDA 1GKIA 5C46F 3PR1A 1CRQA 2XNDD 1E2JA 5F2EA 5LB2A 1GAJA 5FTNA 3OEHA 3ZS8A 1LB1B 3QIAA 1XXHB 2IF0A 4M1OA 2A7QA 2E1RA 1Z6XA 1TL7C 4TQ9A 3T06B 3MLEA 2CNWD 3HR7A 2QUZA 4AG5A 1Z22A 2GTPA 4HAWA 5G3YA 1EFHA 3TJZA 2WAYA 2XB4A 3KL4A 1NMZA 1COWA 1W46A 2ERXA 4NONA 3SYLA 1AKEA 3FFAA 3LQRA 4D4KA 3ICQB 5EXTA 3BH6A 1L4YA 3KKQA 1S96A 2IBMA 3I1FA 4IRUB 3BIFA 5DHAA 1MO5A 1FZQA 3CRQA 1N6RA 2C03A 1KO1A 2PT7A 4Q7MB 5DI3B 2LCFA 3SI7A 1GILA 2PJZA 3GFPA 2BKUA 4LJ7A 2W6JA 3UXMA 3VKWA 5L3QA 2OFOA 8OHMA 3TMKA 2JDIA 2ZE6A 4YQFA 2OXRA 3O8CA 2F55A 2ZRFA 3FGNA 5LDDC 4ASUD 1RZ3A 1SVSA 3CX7A 4Q48A 3A1VA 2V55B 2ZETA 1Q1EA 4QFMA 4X8LA 4DLUA 2V9PA 3VHLB 3NXSA 2PH1A 1QF9A 3K70D 2RGBA 3R8CA 5JHGB 2IF2A 2NPIA 4LHWA 4R71A 3TSOA 3UPUA 1HYQA 1NI3A 3CBQA 1GKYA 1YZGA 2KBEA 4X8MA 2IEYA 4QHTA 1F3OA 1NY6A 2BJWA 2IUSA 1NLZA 2FEOA 1EX7A 5EZ5A 3K0SA 4EPTA 3SE0A 3T15A 5CJ2A 4G5QA 4D0LB 5KUTA 2ORVA 3CF0A 1SVLA 4G5SA 2GZDA 5CM9C 5FOSA 4B34A 4B3FX 4LJ5A 3AP1A 4WZAE 4C0QC 2ZS8A 4BFVA 2RHDA 3I73A 2C9YA 4IDNA 3DKPA 1VIYA 3KKNA 4JJKA 3UATA 1T5IA 3W8NA 2EU8A 1G20E 1KAGA 3GJ5A 5FR2A 4JLVA 1EFRA 4FMDB 1KI1A 5JSZB 1Z0IA 2OCYC 5GVRA 1NN5A 4ILEA 2PEZA 1NNEA 1MO6A 1G8FA 1GVNB 1DPFA 3WRXC 3V4RA 1EG7A 2VEDA 5JJKA 2OBNA 2P2LA 4S2EA 1CJUC 1OPXA 1DO0A 5BW8A 2ZI6A 5H1YA 4DHEA 1EFCA 1Q1QA 2FFAA 4DLYA 1G9XA 1JI0A 1M2OB 4R9UC 1VYVA 3VX4A 1E69A 3BGWA 1E9SA 4PQRA 3R9IA 3W8RA 1ZD8A 3AVXA 2PBRA 2VHCA 4JLOA 2GBLA 3KQKA 2VHTA 1ZINA 1E9DA 4A82A 3REFA 4AY2A 1X8LA 1NVVR 2X2EA 5DLQC 5FOTA 2F3TA 5FPTA 2IYTA 2QZ4A 2WIBA 3B60A 4YXWD 4IVQA 4WXPA 1XD2B 2ZANA 1VPLA 4L9SA 4BPBA 3QE0A 2AD1A 2JJ1A 3U7GA 3W6OA 1D2NA 2GF0A 5AJYA 1SXJA 3EIHA 2ZUBA 2UKDA 2RGAA 3D3QA 4M8NE 1E2QA 4A0FA 2ODNA 4PHFA 3ZD7A 2ZU0C 4Q4JB 4O2RA 4PZYA 4QRHA 1GWNA 4RCZA 1N3BA 2EFDB 1XZPA 4G01B 2GEDA 3GLGB 4V0LA 4GOXA 2D2EA 1R6BX 2EW1A 5F3WB 1YE8A 4D0NA 1TEXA 2Z43A 1PUJA 4JVSB 3B1VA 1KI7A 2IYWA 4A15A 4ON9A 4QM6A 1G6HA 1TUEA 2NZ8A 4NYJR 3B1XA 2G9NA 2PLFA 3EIEA 3ZDQA 5HPYB 3H0KA 3ND9A 4TYYA 2W6JD 5F9HA 1T9HA 3U6KA 2YWGA 3B13B 5FTJA 4KHZA 2PX3A 2WWYA 3K0AA 4UXHA 1IXRC 1JEEA 4Q4HA 1XTIA 1KMQA 3AUXA 1TQ6A 2HT6A 2CK3A 1D8TA 1KDPA 3QBTA 1E9BA 1AIPA 4LHYA 2EQBA 2Z83A 2CNWA 3K8YA 3THXB 3K9HA 1YKSA 3IBGA 4LV6A 2FG5A 4PQYA 4LYFA 1CJVC 1G8HA 2AK2A 3KTAA 3QKRA 3MUFA 3OF5A 3U3MA 1ESNA 1XXHE 3FKQA 1N6HA 3IEVA 1XTKA 1ZM4A 2REXB 4WIAA 1XXHA 2BVNA 2FN4A 4R2IA 4LJ8A 5JRZA 1MT0A 4TMWA 4XD7D 5H8WA 3X1ZA 3SBEA 5JEDA 1FQJA 3GJ4A 4AK9A 2CCGA 2GJ8A 3MWLA 2WJHA 4EUNA 1UKZA 2IYRA 1JECA 2B7BA 1WP9A 1Z6GA 2JIZD 1E94E 3K53A 1XCGB 1Z2CA 1IBRA 2GKSA 2QMHA 2VP9A 3CPJB 1VHTA 3A4NA 1HE1C 1Z29A 3AUYA 3DM5A 4NCNA 2JCSA 5FL7D 3ZLJA 2ODEA 3ZGXA 3T1TA 1YZLA 1U2RA 4OHVA 3QI2A 4Q18A 3W9YA 3CWQA 1N25A 1Q1BA 4MRVA 1MABA 4OL0A 3O47A 4KLZA 5EUMA 3KFVA 4D80A 1KSFX 5IT5A 3U60B 2YOHA 5DN6D 4NZYA 3LNCA 4WA7A 1AN0A 2VHUA 1OLOA 4RFSA 5HE8A 4TLBA 1DTSA 1XD2A 2I1VB 5B30A 3IIJA 1WXQA 1W7AA 3RSOA 2IXEA 4QBHA 5DISB 1OFIA 4P0TA 4CF7A 2RGCA 2YZ2A 3THOA 5CDFA 1BYIA 3UK6A 2GRJA 4LOAA 4HZUB 4NE2A 2DCUA 2VTKA 3LO5A 3JVVA 4Q1AA 4US0R 1E4YA 3DEFA 2QORA 4OHZA 4FW9A 1TU4A 3LWNA 2CCJA 5DHFA 1G3RA 1W36C 3BB3A 1OHHA 4M9XA 1O87A 4IKEA 2HJVA 2W2XA 3NDBB 2G3YA 5FBVB 4F92B 1F2TA 2VF8A 4PZLA 2R65A 1OJLA 2HUPA 1ZRHA 2QG6A 5KPJA 1TEVA 3A1UA 3WHKA 2ZRGA 4LJYA 4N0EA 1J8YF 5AR1A 4XWOA 2IYZA 4NYJQ 4TTRA 2O0JA 2XTMA 5FUVA 1ZCAA 2ZXUA 2JLYA 4NH0A 2JIZA 2JLZA 1K6MA 3RAPR 2IXFA 5JI3E 4KO8A 4GNKA 2A5FA 3SJAA 3TSZA 3LXXA 1Q12A 2Q6TA 4NYIR 3DM9B 1CJTC 4B35A 1OXXK 3TUJC 3PJRA 2ZSBA 3MMPA 1W0KA 3WP0A 1G19A 4NPHA 3T12A 2D3WA 4PSKA 3A6PC 3SEAA 5KNCA 2WIAA 4TQAA 1X1SA 5EXSA 2ODWA 3K09C 4NCKA 1CIPA 1E2EA 2XX3A 3VU9B 3ZH9B 4C2TA 1EFTA 4PTLA 1OF1A 5ELXA 2CDNA 3LY5A 3H84A 3CIOA 2O52A 1MRNA 1P73A 1KDRA 5FBRB 1IAQA 1FX0B 2ZJYA 1YZUA 3QXXA 1PZNA 2YNMA 3HPQA 1IHUA 4JYCA 4QC2A 4Q9JA 1NLYA 4FI3C 4JMPA 4DUGD 1BO6A 1MH1A 3D6TB 4KFRA 3C4JA 2AXPA 2ZVQX 3REGA 3FTQA 2QU8A 4HZUA 2J0UA 4TZ6A 2GESA 2EFGA 2BEKA 2XOKD 3CZQA 4B2IA 5HKKD 3AF2A 2YINC 5EE1A 3U7HB 2GCPA 2ZRKA 4PO1A 4L15A 3W3ZB 3HWSA 4D6PA 1E98A 4XSGA 3FWYA 3EZ9A 4QGAA 4IDHA 3L8ZA 3DHWC 4EPVA 1G8YA 5AJZA 4EDHA 1IN5A 1TPZA 4Q1DA 4HUQB 3RANA 2P3SA 1YR9A 3NTUA 4CGZA 5KYKA 4O25A 5FUWA 3OE7D 4ARZA 1QHSA 3TQCA 2G1JA 2I3BA 3BK7A 1PJRA 2IS6A 1VCIA 1E2MA 4B6EA 2ZPTX 3ZJYA 3GJ3A 4GL2A 2ZRAA 1A7JA 2IWHA 3VNUA 2O8EA 3B6EA 4OK3A 4YLGA 1COWD 4R7ZA 4PANA 3SC3A 5IF9A 1KJZA 1KAOA 2EYQA 4LYHA 1EGAA 4FMCB 4ZCMA 1L4UA 5J4KA 4JVMA 4LHXA 4LWZA 1OFUX 3EWAA 4X8OA 3FMOB 221PA 5G53C 2KSQA 1WBDA 4BZPA 3THWA 3L82B 1E1RD 5AJWA 5LBIA 5FPSA 4QKQA 4ZDKA 1OXTA 3OHMA 2CJWB
chains in the Genus database with same CATH superfamily
1D1QA 4TLMB 3VOBA 3UFXA 3GLGA 4DC1A 3ZD9A 3C98A 3LBIA 4JBGA 1HLPA 1C3OA 3DVLA 1Y81A 3RBZA 5CG2A 5H4GA 1NG9A 4WGGA 3EXG1 1MRZA 4A7PA 3G8CA 4ZD6A 3OZIA 3MT7A 4TXMA 4YJFB 1R15A 4NBRA 2XV1A 5ALVA 3K2QA 1V9LA 2QENA 1KXJA 2VDWB 3RYFA 5L3VA 1BDBA 2I2WA 1W9MA 3PF8A 3R7NA 4BFSA 2VDUE 4DWOA 1RC8A 1WMFA 5BN4B 1CUZA 1WB9A 3NC0C 1DT3A 3DYIA 1JQ3A 1K7YA 4BNMA 1SUCA 1CZUA 4JQCA 1D8AA 5TEWA 2O2SA 3H86A 5DYIA 1ZJWA 1BE6A 1U2GC 1E1NA 2IPNA 3IUJA 3EZ7A 5EXEA 3WLNA 4CYMA 1M7BA 3FYSA 2XITA 3KFXA 1Y6JA 1SIOA 4YT4A 4UMVA 3UCFA 1H6AA 2NYUA 2JGDB 3WGLA 4BO6A 3OCVA 5E6UB 5BWOA 3WL6A 1LC0A 2J46A 4D0SA 3L04A 1FP6A 1N33B 1GUDA 2G80A 2F67A 3BWXA 4OLJA 5LMZA 4XARA 4FFDA 3Q1KA 4EZEA 1LBHA 1C2TA 1K75A 2E5WA 2GPTA 4ZT2A 2YS6A 4GEKA 3PNYA 4A16A 4KX3A 1J25A 1Q21A 3OUUA 2Q46A 4G1EB 4WKOA 2V6FA 2H11A 4B6OA 1EM8B 3GRRA 1Z6TA 4AKHA 5THKA 4RIHA 3CVOA 3KUKA 2AUMA 3KZNA 3SSMA 1D2MA 2QYOA 2V1UA 5A2QA 3VDXA 4NMMA 1WWKA 4FEEA 3O7WA 3GEDA 2P0YA 5A4DA 3MGCA 4DQUA 4D3XA 2XLCA 4JEIA 3LY9A 1E96A 1UPTA 3HKDB 1I7QB 3H9BA 3ZZTA 1FDRA 1FP1D 4QYTA 3OQNA 4X1KA 2QPOA 5EA2A 3VAYA 1LPAB 3U39A 3LKVA 3LAWA 4KODA 3EVNA 3BJRA 2BFMA 2B3TA 1XDWA 3UAWA 1VMKA 3I05A 1B16A 3Q85A 4UM5A 1P81A 3U3OA 4C43A 1G6OA 4HX2A 3DQQA 2DKNA 3QM1A 5LU9A 3ANTA 1YNSA 2KI5A 4BMDA 1CS4C 4C1BA 3OIGA 2Z09A 4X95A 4LC1A 4PZDA 1KYXA 2HIMA 3OPYB 3LCUA 5AQ1A 1JWLA 2QUBA 2DJIA 1FMTA 4RL6A 1XTSA 4WKBA 4TKVA 2IPOA 2GKOA 2QN6A 2ZDQA 3IVXA 4KO4S 3NPAA 2GF9A 4CQLB 4QUEA 3I9FA 4HKTA 4IXWA 4EHKA 5TQ0B 4YCLA 5KOJB 2R6HA 4WOPA 2F1KA 2P6OA 1RXVA 3CR8A 4O2LA 2WSIA 4N0DA 2Z6VA 4HGNA 1DIBA 1SEVA 3AT1A 4LV8B 1J49A 4XDHA 2ZG6A 2XSZD 4ZC8A 1I1HA 1G0OA 1E7MA 2DOKA 4KSCA 2A1UA 1FDIA 2C5BA 2QIPA 3HJAA 3OPXA 1GU0A 1XMPA 1PSZA 4G3XA 4LRUA 1EFDN 3F47A 4WZBE 1YZ3A 1SC3A 2C8KA 3F3SA 3G2HA 1IN1A 1Y0BA 2I2XB 2PKCA 4URWR 2WSSA 3EEIA 5JJIA 1NSYA 4FYJA 4MMZB 3X2SA 2Q5QA 3MIIA 1FDWA 4J1SA 2BKAA 2P5UA 2EBFX 5CD1A 3FGOA 4QBIA 2FN3A 4J7AA 2IYOA 5CK4A 3Q87B 4M49A 5A1JA 1G3IA 2H1IA 2Q2QA 5E7JA 4Q12A 3LLMA 3WRVA 3AU9A 1RRFA 5F77A 2ONJA 3EGEA 1LK0A 4RAQA 3UK0A 2Q3BA 3TUIC 1XTZA 1A71A 3CX4A 4DEVA 1M8KA 3PHJA 3V80A 1JDPA 4L0CA 1B2RA 1H42A 2ZRNA 3U81A 4PINA 1I2AA 2ONZA 4RMJA 1I01A 4M1YA 2WTMA 3OT4A 1TFRA 5HF9A 4KR3A 3WZ2A 2QMQA 4Z1OA 1A9RA 1P1RA 4EFKA 5A3SA 5KOHA 2QQFA 1ULAA 4RTQA 1PK8A 4AL4A 2G83A 5IVHA 3DFUA 2DFLA 1JJVA 4N40A 5KO2A 4MGYR 5IM5A 4RE6A 3PX7A 4CKCA 1W5TA 4DA9A 4UHEA 2QLJA 2HFJA 2J87A 1ECCA 3T9DA 2IHVA 4EYSA 1W6RA 3N76A 3CH5A 4Z7NB 5JJ5A 4EJ0A 2ZIAA 2I9PA 4M86A 1AMOA 3IBFA 1LUAA 1L7VC 4J75A 4BNJA 2VZEA 1P6UA 2QKYA 2VJLA 4A8HA 4H3VA 4E7PA 1U80A 5IBPA 4EMBA 5JAIA 1C1HA 1EX9A 2QG9A 1ZR2A 1I5EA 1F6DA 4EGSA 4M8LA 4PAMA 3U5ZB 4QYMA 5CMLA 2R6FA 3K70C 2QVGA 1QJ4A 4YAOA 1MR3F 4ENVA 3PFNA 1A9OA 1YV9A 4H7FA 2QT9A 4M7PA 4MWGA 1CUHA 3W3AD 1G3MA 1X7WB 3DO6A 1GITA 3GJ6A 1CZOA 5I7HA 4U00A 5H68A 3CW8X 3GLUA 1SVMA 3GK3A 3UHPA 2X77A 4EFLA 3O4GA 4ARVA 1R0LA 3PPIA 3DEAA 1BFUA 3MA0A 1XEXA 3FR8A 1U7OA 3GLSA 5EHQA 4ZARA 3Q9NA 5I47A 2ENWA 1JQEA 1FRQA 1ZP6A 3WWPA 1WQ1R 3AB8A 3U3RA 2LKCA 4MWSA 1Z7WA 2NU9B 3SICE 1ZU4A 2F9MA 4ASUA 3I2YX 1YC5A 3G13A 3P4XA 2WK1A 4FLMA 4DRXB 5EP4A 1A2KC 1SBNE 5CJJA 4AKSA 3L1UA 4JB8A 2RHGB 4HNHA 2VXCA 4AUEA 1ZM2A 3GXOA 1FB5A 3T0FA 1Z2DA 4PTZA 3FETA 4YECA 3QKTA 1IVSA 3TXYA 4X6YA 3RYHA 3FFWA 3W2IA 1W0CA 1E1KA 2W2PA 4XWWA 2IE0A 1QMGA 1JQAA 2FVYA 2MSLA 5LC1A 1HM5A 4L8LA 3UJ9A 2IRWA 3I5YA 1V3VA 2J07A 3L1IA 1L7BA 1X77A 1J70A 3GYGA 4N8SA 5KQPA 3PCRB 1Q6ZA 3DVSX 2M6RA 4HYYA 5DBFA 4KWCA 4LW8A 3U13A 3OJEA 3QEAZ 2Q07A 3CB4A 4AZWA 4BC1A 1KFEB 1K3FA 2WNSA 3N2GA 3NM4A 1N5MA 4EFNA 4BXOB 3GMTA 3I9NA 3T9EA 1JKJA 2GJ9A 2IS4A 4RSHA 3D6NB 4S24A 3AV0B 3UG7A 3QE3A 2QQGA 2GZHA 4BX0A 5HW0A 4PGHA 3ZJVA 3H16A 2CZQA 1XRJA 4E5VA 2CHFA 1E92A 5C8YA 4X00A 1F5NA 1FPQA 4Q3DA 1V7CA 4BEBA 3W2TA 1BJKA 2AJLI 2DQKA 3THYA 3MTGA 3GP5A 3ORHA 4QU5A 2EKPA 1Y3AA 1V3TA 4IGAA 2GN8A 4E88A 4BLQA 5CCEA 4G5YA 2TMGA 2WINI 5AFSA 5BYKA 5KNCD 3QYPA 1IQPA 3EZNA 4KQIA 3GZTB 3ZLVA 1LW7A 4RKQA 2V7GA 4RGBA 1Q95A 3C3KA 3VJLA 4NZZA 3ISVA 3WL4A 1L1RA 1P19A 2PUVA 3NAZA 2AEFA 4JU9A 4H60A 3CYFA 1WSWA 1KI4A 3QITA 2OPHA 4HQOA 4WT7A 2IT1A 5E9WA 2XRZA 3H9QA 3RHFA 1LLDA 1RI1A 4H3KB 2B2CA 1C1XA 3Q3JB 2DT5A 3KTFA 2H54A 3HV0A 2V54A 3PXEA 1MVOA 1M74A 2EGUA 2FWJA 3GEEA 1W87A 4GSYA 3REQA 1KPGA 4FOPA 1AOXA 5FAKA 3M34A 3O7MA 4W8GA 3W2EA 4F21A 1A77A 1NSTA 1EHYA 3IQWA 4PYRA 3LHKA 4EPRA 1J56A 1K88A 3QUSA 4BO0A 4NU0A 2NYAA 3VNAA 1S9HA 2CXPA 4QUDA 1QS0B 2ZJ7A 2R6ZA 4HEHA 1NUPA 3PFFA 4JQOA 2QSYA 2A1UB 2XBUA 3B6KA 3IHKA 3MPUA 3QVUA 3RC7A 3TCKA 3ZVRA 4H7IA 4M7RA 2ZUFA 3HZRA 2FP3A 4LE2A 1XEWX 5A6VA 4TSFD 4WLVA 4QU8A 1EFKA 3QG1A 3A6KA 3IKJA 5HIAA 4OI1A 1Z6AA 4AF7A 5CVCA 2YJ4A 1HFEL 1RYDA 2QROA 4L4RA 4TYMA 2ZJFA 1E8NA 3M1LA 1Q7BA 4X20B 5PNTA 1IJEA 4PE5B 3VYRB 1MB2A 4DLAA 3EZFA 4BL5A 2XD4A 5KREA 2CXXA 3F6SA 1V9SA 3G5UA 2RAUA 1WTAA 1S4QA 4GZ3A 3ZQ6A 4YIKA 5AKYA 4M6WB 2J6HA 3VVCA 5IZCA 1K5HA 3ILHA 3ZVNA 2A5JA 1VCHA 1YR7A 4GMKA 4ZYYA 2JKYA 5EFOA 1LRLA 3H5VA 3DL4A 4JBNA 2FXIA 4OFWA 4O0LA 4Z2YA 2VOJA 3NHSA 3VSAA 3WFJA 2QM3A 3I6BA 1XZBA 1OB5A 3FHTA 1ZSVA 4K6HA 3U5TA 1PX2A 2QT1A 3OF2A 2CGEA 1ESDA 1O9GA 3FMPB 3KTDA 1XCMA 3FKSD 4AZ0B 3L01A 1GG2A 1MIOB 4GC9A 4HXEB 4CLRB 4AWAA 1QK4A 2C7VA 5AMXA 5CBKA 4O4IA 1IQUA 1CP2A 1FNMA 1U98A 1SHTX 4E5SA 3UUGA 1I7PA 3DNPA 3L0ZA 4FILA 3DDHA 3V46A 4ND8A 3ZOZA 3RJ5A 2HSDA 3P71T 3SC6A 1U0OC 3ZJ4A 1H8HD 4ZOLF 1HH4A 2C4VA 1JAHA 1ELOA 3VAZA 5CU7A 2OV8A 2VSYA 2COUA 4XRGA 2NSHA 2NVOA 2OV1A 3UA3A 3LI2A 5F52A 3ZWBA 1ZC3A 1NVGA 4UFNA 4Q9AA 4B2LA 4HDRA 3CO5A 4XPIB 5AJXA 1SN7A 4A4DA 4BOYA 1JSXA 4EG8A 2CMFA 4QNRA 3CLRD 5J2UA 5E95A 4MWCA 3RSCA 3ICEA 1CUFA 4H1UA 2CLDX 2EKLA 1E79D 4Z0NA 3K70B 4X66B 2DECA 1Z5OA 4WXHA 3NIBA 4COOA 4LSZA 10MHA 1MRSA 3B9RA 4KLAA 2ENUA 3H8WA 4QJ3A 5D86A 1QAQA 4NU6A 1KFBB 2A5GA 3CN9A 4IYJA 3B3JA 3BXEA 3LUJA 3WSWA 1K6XA 4U1RA 5C1DA 1G5IA 4I0WB 2EG5A 1C3OB 3T9FA 4E22A 4X94A 1VFNA 2A78A 3LPLA 3ROGA 2QSUA 1T6NA 1IK4A 1EJ6A 2GN9A 1ZUIA 2ZDGA 4U7PB 1OE0A 1BH2A 1LPPA 4XCXA 3RW9A 1GL9B 4IFIA 2YYSA 4PO3X 1F0NA 4Y3UA 4DCNA 3MAJA 5EVCA 2B6NA 5EY5B 4KQJA 3BBLA 2HCRA 2BFCA 2D2VA 2BGGA 2BFFA 2V7QD 2QIOA 2BZGA 4G8JA 1VHWA 3WBKA 1U1DA 1HL3A 1Z07A 1TYEB 4UFOA 4WI1A 2O20A 4QQNA 2QTZA 1I6MA 1MA3A 2EFEB 2NQ8A 3IPCA 4FNGA 1P0IA 4QDXA 3TW4A 1K6EA 4HRAA 3TQSA 5B7QA 1V47A 3DG9A 1V9CA 3KDSE 4DG9A 4FOSA 4N5HX 1VDMA 3OZDA 1JMKC 2HWWA 5HQJA 1NOKA 3S2GA 2XA1A 1N8KA 1ODKA 4AECA 5H7XA 1SIUA 1PV4A 1EA5A 3ISJA 2VDOB 5DW3A 1O0CA 1LLFA 2WTUA 1S5PA 3C7KA 4ABTA 1VJ5A 1C1YA 5BWMA 2JZNA 4KU4A 1NMXA 3G2LA 1LEHA 4LDAA 4XYEA 4URFA 2W71A 5AT1A 4EB6B 1LDEA 1SC9A 4FS3A 4PU0A 1FRNA 3HP4A 3JX9A 3ZKWB 3AGPA 4PC7A 3TNLA 2ZITA 1DBSA 1N6KA 3WOVA 4E2WA 3ZY3A 4D6XA 3QW2A 4IYRA 2ZE5A 4LDJA 4CMIA 2VDJA 4D9FA 2FFRA 1JDUA 4WL0A 5BSUA 4BQNA 5AW6A 1WHSB 2X5JO 4RPKA 2VXOA 3NWJA 3COSA 3VZDA 4HNAA 1R5BA 1V5GA 1Q74A 3RV3A 1H0KA 2WTNA 2AA3A 2H4WA 4PQGA 2YUIA 1MDBA 1QHYA 5FUBA 2AKAB 2Z5VA 3BWYA 3MINB 4M4SA 1P7CA 4TLLB 4WCFA 5KWSA 3RF6A 1BQ3A 3UIEA 3IALA 3ET5A 4U7JA 3EXAA 5I8ZA 2ZAIA 1JPNA 1QHHB 3IP1A 4OQXA 3SMQA 2YOGA 1VG1A 4QEZA 2PNFA 1Z62A 3E9YA 1XQXA 3FDZB 2GAOA 3VH3A 5JNVA 2FZ5A 3DMFA 2CHGA 3L1HA 4PFJA 1UPXA 1CUDA 4JXKA 4YJDA 3KVOA 4NV3A 1O8CA 3KOXA 2BGKA 4FYHA 4OMCA 2WWHA 3HGTA 4MVYA 1IONA 1YJXA 1RJEA 3KKZA 3E9CA 3M5DA 3QUBA 4P2BA 5L45A 1JIVA 3WMXA 4QTTB 3NJRA 4BLUA 4YMHA 3GZ4A 3HNRA 3F9IA 1UOQA 3SS9X 1AQ6A 2CBZA 1M3SA 1ZONA 3W2GA 4UM9B 1W36B 4HLNA 3B8HA 4YCJA 3N7UA 4B3JA 1OXUA 5TQ2B 4AMVA 4ICIA 4UOZA 5AVVA 4EEXA 3HTXA 3DOUA 3MWFA 4AMBA 4MUHA 1JH8A 3CB2A 1E59A 4FR2A 5DOVA 1DKLA 4GQBA 2W43A 3NTQA 1XZMA 4WSOA 3M83A 5HKKA 4PAQA 1UUFA 5BQXA 3GLIB 2QK4A 2QMZA 4LQLA 3ZWCA 1D1TA 2PZ8A 3OQIB 4PIVA 2ORED 3ZGVA 1DL5A 3QQ5A 1RYNA 1W581 1IPEA 3SZMA 2JI4A 4BJ3A 2OESA 4P7JA 1J9GA 4TTSA 1N3IA 3TGLA 2A0UA 1JQJC 4MIKA 4KUEA 3SHFA 3DR5A 1OGJA 3SBDA 2HRQA 1NX9A 1D5WA 1E5XA 4NDZA 3FUTA 2PSDA 4IIXA 4O59O 5BY2A 1L5HB 4C6TB 4PF1A 1SVOA 2QHXA 1U8FO 4IHJF 1W0JA 3QENA 2ZI9A 3GRAA 1GQFA 2OM2A 1GPDG 1PBTA 1UKBA 1YOVA 4OX9Y 1CR2A 1UFRA 2ETXA 4GZLA 2Z0MA 1K3UB 4F84A 3DWGA 3TE6A 1NDUA 1CY1A 1GRCA 3FNGA 1EXDA 3VX3A 3R4CA 3JQPA 5SYAA 4JXZA 2CLSA 3FFTA 3WHIA 2ZBEA 5A5GA 4WFIA 2FSGA 3QOYA 5MN4A 4HB3A 1M2VB 4F96A 1UDAA 4DCMA 4JOQA 4O2BA 1JG3A 2JRCA 3G1TA 3WB0A 1R6TA 4MI6A 5E4FA 4RD6A 3AFHA 3AR8A 2CL5A 2ICAA 1OLXA 5J4HA 4DV2B 2BEWA 3CTPA 1OWLA 3M6MD 1GAXA 2AG6A 1XZLA 5J5CA 3HVKA 3C7CB 4GP7A 1D04A 1ACMA 4RZUA 2FETA 1G21E 4EY5A 1H2AS 1QS0A 2X22A 4QICA 2Z2XA 1O94C 1LLCA 5FNVF 4JI8B 1N2ZA 1T15A 5A4AA 3ELUA 4Q9HA 4JMLA 2XDWA 3EGOA 3A4IA 2L19A 1Q7CA 2FJ0A 2PWYA 1IE3A 2BBWA 2VPIA 2VF7A 2XMBA 2ZTVA 1L7DA 4HN2A 5HKLA 3MHTA 1AVTA 2JHFA 1D2AA 1T0JB 1M83A 4JLBA 4HDMB 2GERA 3IILA 3KKEA 1BIFA 5B55A 3PLNA 4U6NA 4YRRA 1GKLA 3VNSA 4XKJA 1YE5A 3HADA 1B43A 1UEIA 4R1NA 2OOSA 4TOIA 5FBLB 2IV2X 4DIUA 2JGNA 5IAGA 1NVKA 1GRVA 3GLVA 2I1QA 4A3SA 2J0EA 4IZOA 1QBGA 2YQ4A 2FQYA 1XJWA 3R3XA 1PL7A 1ZHHA 1O5OA 4BU0A 3VHXA 1BWSA 2C2OA 1TLLA 3KOYA 4BCDA 5DH9A 4RVCA 2N46A 4QULA 1MIHA 3E7XA 4EYKA 1SOVA 5LD2B 3O94A 2QMUA 2IHKA 2ZSEA 3DAPA 5CR9A 4V0OA 2WQ7A 3ZH2A 5DNYB 2RC5A 3HGMA 2WM9B 5EL0A 4DDHA 1AGPA 1E3QA 1ONBA 4YAIA 1GFIA 2B78A 3BRWA 3K9CA 4R6WA 3ND8A 5CPFA 1E60A 1NXOA 1SOMA 2F8MA 1UPCA 2PRJA 2W4IA 2ZREA 4HLUA 1K98A 1YL7A 5FPHA 1T3GA 3WBFA 3ANXA 2FJPA 4RJTA 2B1IA 2I71A 1GARA 1UWKA 3BWCA 4BMNA 4CM7A 2PUHA 1JYFA 1M0EA 2Q3FA 2WFMA 1WXHA 3FGZA 5EINA 2YIDA 1N2EA 1Y1TA 4Q7LA 2QQ5A 2ZB8A 5TMEA 4JC5A 4WK6A 4ZU3A 2XA2A 4KITB 1V26A 1RMQA 2DY1A 4OI2A 4PWYA 4LXHA 1ATIA 1M10A 5EQTA 3LLSA 1MQAA 3O91A 2HHLA 3WGNA 5LXTB 4PZZA 1B4DA 4JX8A 1NJ2A 3PQFA 4OJYA 3SLGA 2Q8PA 2EKQA 3L06A 4Q3CA 5JE8A 5AW9A 4FOLA 1T4CB 3A8TA 8ADHA 5CDYA 3G1UA 1SB8A 2GN4A 5AI4A 3TAHA 1JHYA 4OSPA 3GLKA 4C0KA 3DNMA 4KXXA 1EFVB 1M1NB 2GJKA 2F1RA 3C1AA 1RZRA 1H4TA 4JKIA 2AT1A 5DOZA 2FSUA 5IAEA 1YGYA 4AMYA 3SKVA 4UUQA 1GKKA 2I87A 4HWKA 4RH1A 4MKFA 3SF8B 2BV3A 3DXYA 4JJGA 3EIWA 4JA2A 1W1WA 4ZMSA 5AHWA 2AKEA 1J23A 1AQUA 1LPNA 1Y3FE 2VUTA 3EGDA 3IEPA 3CX6A 1SUSA 2YYAA 2NU6B 3TD9A 5A5DA 6PFKA 1WXEA 2IY9A 3OSUA 3PDCA 3LS2A 5AKLA 3RRXA 3WQQA 4C4PA 3CWCA 4I50B 4BQFA 1IYZA 3J81k 2XB9A 1KH2A 1RBYA 4N5DA 3JSAA 2QPAA 1L5KA 1UBEA 4JVLA 1ZD2P 3OZGA 5BT9A 1CQXA 2QYTA 1Z5GA 2WRZA 3AVYA 3Q0TA 1MJFA 1W6UA 3DV0A 3OKPA 2DXIA 2P91A 3PGVA 1ZD9A 3PUVA 3C6QA 1GT6A 1U8TA 2W4MA 5JHHB 1YU6A 1Z0KA 1RJGA 1VBFA 1P62B 2N75A 3HCOA 4GRAA 4X6XA 5G41A 4Z1MA 1AJEA 1TF7A 4GZ6A 4Q01A 2IC5A 1OH8A 4X6LA 1VKJA 2BGMA 3AY3A 3OZFA 3OQHA 4LVNA 1QC5B 3HLKA 1CCWA 5JPCA 3OOHA 1WHTA 4OQPA 2QQEA 2GX6A 2PZGA 2QD1A 4ETMA 5JJCA 2GASA 3OFVA 5JVDF 1JKJB 3AJ8A 3FWKA 4QYSA 4E1BA 2BEUB 4A73A 3WJAA 4UOQA 3FJOA 4CQMB 1SKMA 3MFYA 1ZNXA 2WHRA 1G17A 2WAOA 2Y1EA 3UYLA 4WNYA 2VAXA 7GPBA 3S1AA 4W7SA 2YJ5A 1ECGA 2G08A 3EC1A 1I3MA 4PZPA 2H1WA 3IQXA 1JWBB 1TAQA 2IX9A 2RJ3A 4OM8A 3KJXA 2N1MA 1NXPA 1TRKA 2ZCVA 4JUIA 4BNIA 1Z7GA 3KU4A 3P0JA 1P4AA 1P7WA 3UKJA 4BTVA 4DSAA 4AP6A 2HOQA 4MUKA 5EIAA 3TLGB 5KZMB 4LXYA 1J97A 1T2VA 3FW1A 3N58A 1UJ5A 3B85A 1ZNWA 3MCVA 4TMZA 5GOZA 3DE0X 1A5TA 2YHIA 5I6DA 3DZ8A 1JR3E 1R4AA 4QA9A 4XCVA 3RFFA 2DHRA 3HSKA 4LQCA 4UREA 1ILEA 2XQKA 2G9UA 1NR7A 5KQRA 1NXWA 1RWBA 4HAVA 4GMGA 4BNXA 2ODBA 4Q9DA 5LLTA 4AI6A 5BV7A 3OTGA 5JANA 3KJFA 2WUGA 4MHOA 3NEYA 4KIFA 2WY2D 3I6YA 3OEEA 3V8VA 4A8JC 5I4CA 4BMVA 4QPJC 4B3HA 1THTA 2HPAA 3ZVLA 4A0SA 2FGKA 4DPMA 1E9AA 3NQ41 5LP6B 3PJDA 1VP9A 2IYNA 4WH0A 2WPDA 3ZN2A 1ZGGA 5EZ6B 3T1YB 1KJNA 2A9QA 2I6SA 3Q10A 5J2UB 3L4EA 4D96A 4DLZA 5A05A 2JAHA 3H9GA 3H2IA 3BRCA 1R5NA 3JARA 4L9AA 3C8MA 4E5MA 4EF5A 3LRPA 3ZD6A 3LX4A 2H1HA 2KS6A 3JWIA 4LOKA 4UE3S 2NPOA 1S8FA 1DFHA 1FVHA 5JCXA 3IIIA 1V3QE 4ZVUA 1C29B 2OFWA 2WVAA 3T1VA 3VHQA 1RT9A 2D7CA 4WN9A 3U4CA 3NOVA 4PBTA 3PQ8A 3U7IA 5DXFA 5BV1A 4D8UA 3CCFA 2FDCA 3ULKA 4NCIA 1RVDA 4N9QA 1Z74A 5DM60 1OXMA 4LBVA 1USWA 2IYEA 4KQ1A 4ITRC 5JROA 1Q57A 1VB3A 2XQGA 4F6LA 4MWZA 3QWFA 4C7OB 1XU7A 3NOOA 3WJ2A 1TQDA 1JVBA 1GNRA 3JAMA 5ADHA 5THQA 1Q92A 1RKQA 1H69A 3ZV6A 5FI1B 4RWZA 2EKZA 4RVGA 2YVKA 1E2NA 5CNIA 3R5KA 4D3YA 3AINA 2CHEA 1HXHA 3K94A 1WBBA 2BTQA 2H2GA 2YN0A 2J0QA 1J0BA 3IBCA 4NDNE 5SZIA 3RUIA 1ISSA 2NO5A 4DCSA 1R8SA 3K32A 3NGXA 1QVRA 1Q1ZA 2H4XA 4LCBA 4LYJA 4OHBA 1NT2A 3LXUX 2VNJA 3CRMA 4J3NA 1XYYA 3UMSA 1BDHA 4PQFA 3SDBA 2ZXEA 3AHHA 3SYTA 4WXEA 2ZZNA 4F91B 1ZKMA 3EF0A 4LJLA 4KW7A 2X1HA 4QPDA 3SVLA 5E2BA 1H65A 2GUGA 3IMGA 5BMVA 3UK7A 1YJBA 2A59A 2HAEA 3JQ7B 3BJZA 5T8KA 2WA2A 1DCFA 4JIMA 4K88A 1JAXA 2ADFA 1L8OA 1X1QA 2Q6IA 2FX5A 1YZNA 3PG5A 1CZRA 2AYZA 4NZ9A 4URYR 5U1PA 1DBRA 2BC9A 1IVNA 1YS4A 1JR3D 3D1VA 3LWBA 2ACVA 1NBME 1MG0A 4R1UA 4M1ZA 3WXBA 3VJRA 1X7XA 1D0SA 5ICSA 1P2TA 1YZTA 1WOMA 4PSVA 4ZRNA 4Z9YA 3WWCA 1FSPA 1P77A 2OK7A 4LGCA 1G66A 1UMCB 1WVIA 1FX1A 3H2SA 4X7MA 2VPQA 4G4IA 3LQ1A 2H17A 3RVQA 3AL0C 2N47A 4HLDA 4UAUA 1US8A 2WFLA 5TMDA 3WYFA 2VUIB 2Y92A 1SXJD 3CNHA 3IGFA 4EVIA 3JR3A 3QXGA 3I62A 1S3GA 4B4UA 3P0RA 2HHJA 1H1LB 1T0UA 3GDFA 3GJTA 4FYKA 4LVOA 4QT0A 4RIEA 3COJA 3DDOA 4R84A 4CE6A 3H3XA 1F4LA 1ZCFA 4YPOA 2BN4A 3RYIA 3H4TA 4FB5A 1VXRA 1DAGA 1L6RA 4GOMD 1C9YA 4QUBA 4EEZA 1L7PA 4UVEA 3T5BA 4FC7A 1FTWA 3WLAA 4YO7A 1NT4A 3ANMA 3SLKA 2HU7A 2ZRMA 2F7SA 3IV6A 1PYGA 4IV8A 5FLYA 3TG8A 2R2AA 4D92A 2B25A 1GFWA 1FFHA 1SHKA 1PT7A 5CB4F 2E1PA 1REQA 2M2IA 2X7JA 4XWGA 3PDWA 2REOA 2I22A 4H6XA 4UDXX 4M98A 2Y0BA 4P5EA 3W78A 2XGGA 1UAAA 4ZCPA 1HDYA 4C4OA 4ID3A 1PJBA 2JAXA 1YA6A 2CJWA 3RWMB 3O74A 1G7CA 3I8SA 4A8JA 2ZBUA 3DTNA 3Q72A 3KB2A 4AURA 3C3PA 2J9ZB 1S7GA 1NIPA 1VG9B 1QWSA 2WWTA 4P4TA 4R2XA 5IYZA 4N6OA 5TB5A 2BGWA 1W19A 4MUXA 4K6KA 4JOCA 3U1BA 1O03A 3HKBA 3QYFA 3P26A 3RUFA 4YHHB 1EWRA 2XMSA 3F7MA 4KQ9A 3J7TA 4CR7A 1RDFA 5BR7A 5A1TA 5BVHA 1JVSA 4RDIA 3G7NA 3H5LA 2I2CA 3O3MB 1HG0A 3A9VA 5UKDA 4EAAA 4BNDB 1VLJA 5J5AA 3CNBA 1H2RS 3V6MA 3G2JA 3C8DA 3VA7A 2COEA 3FWHA 4MHSA 4O2AF 1RWOA 4XFDA 3TKAA 3LCJA 5F9FA 1UDXA 1B14A 2OMKA 2XHEA 4MVJH 3OIUA 4P32A 3I5XA 3A6LA 2P5SA 4JSTA 3K4QA 5IABA 4WZ6A 1KFJB 1NW8A 4DA6A 4CLOA 1TI7A 5FFNA 5ICFA 4EATA 5KB3A 1FUUA 3BFXA 1OZAA 1PNQA 3FVQA 2XI4A 2GI4A 4X54A 2FVXA 4I4CA 1A82A 2DAPA 5MGBA 4AKIA 2EJVA 2XZPA 5AM2A 1HKHA 4B7ZA 1GL3A 3EUAA 4G4SP 3LVBA 1ORVA 2O2CA 1B8PA 3I9V1 3HDVA 2IVZA 4WVLA 3G6KA 3STWA 4BMYA 2VWGA 4OGFA 2CV2A 3IR7A 2VUSA 4F38A 2X4GA 3PVCA 3L7JA 4UXIA 1R6AA 1EUDB 3MVEA 1J00A 1PBNA 1XG5A 3GLIA 4UZEA 1PR1A 4K9KA 5EP3A 3BPSA 2Y0EA 3FUXA 1U2GA 1OVMA 2JGFA 4P4SB 4LF9B 1T4DA 2VUUA 2QP4A 4Z3OA 4CIDA 3ENQA 2VKQA 3KQSA 4NEGA 1AG9A 1O9HA 3TJMA 2WOOA 3WLFA 4FU0A 4ENUA 5CBPA 1ECBA 3MTAA 3G7SA 4UHFA 2IXTA 2CNNA 4FFLA 5BXQC 2NVBA 3RRBA 1J2RA 2AOVA 1A72A 1N7JA 1QLJA 2HSEA 2IP2A 2ALJA 2QUJA 2GM5A 2A94A 2FW6A 4IDBA 3T3HA 2H4FA 5CYGA 2RGNC 3D8SA 1OIVA 2RGXA 2ATEA 1M6HA 3E70C 3N6XA 3Q11A 1JAYA 1TZ2A 4QHSA 5A03A 1FU7A 3B1YA 5C1PA 1JEQA 4QBTA 5ESXA 4ZDWA 2DKFA 3K0KA 1AE1A 2Z2ZA 4AM8A 4Q93A 5DDIP 5FTLA 1CUXA 1V5EA 3SQNA 2WU4A 2V6JA 1TW2A 5DN6A 1Q0PA 1UMKA 3F6EX 1APBA 1W5AA 2CYCA 3ODPA 3TLZA 4XVCA 2CWWA 1C3EA 3QMMA 2ATCA 1J8DA 5A02A 1PGQA 1PL8A 3I5AA 3OZXA 3W5VA 3EPHA 4P08A 1Z8DA 3PXGA 1S7CA 2OGTA 2R3SA 2WIKA 2J5KA 4WY5A 3H1GA 4J0FA 1FTSA 1K8RA 3T3PB 5BSKA 1X0VA 2E5FA 4TROA 1WB6A 1RZRD 2YMLA 4P93A 5CVUA 3WMEA 3F6BX 4R9SA 1D2CA 5EKXA 4XI9A 3KTAB 4BFYA 2C99A 1RHJA 3IH5A 1ICEA 1GZVA 3COVA 4NXNB 3L07A 3Q7PA 2WKRA 4J03A 4MI3A 1Q3KA 1VSTA 3M70A 7MHTA 5IG2A 2OE2A 2ZJ5A 1UJCA 3L6RA 4PVDA 4HX9A 1EK0A 1WKCA 3IQIX 1N77A 5F73A 4HH1A 1O95A 4N47A 1T0HB 1TOAA 2EARA 3WYAA 3VPBA 5KYYB 1X8KA 1FVXA 1FDVA 3AGQA 4G5GA 4NNPA 5JO9A 2XDQA 2OHJA 4KWIA 1AKQA 5DF1A 5DMHA 2OXCA 4Z1MD 3ZNOA 1JBKA 3VPCA 4MVJG 4KX5A 4DZTA 1O0SA 2SHKA 1AKMA 3R8XA 3SR0A 1PJ4A 4GU5A 3AG5A 3QKRB 2GM3A 3CZ5A 1YJ5A 4TLDA 2H1OA 2FFHA 2VJQA 3BKXA 1MPXA 3O8QA 3MF4A 3WXMA 3F71A 3D2LA 5A7HA 3RU3A 1T5TA 4G5OA 1HNZB 2OCPA 2NIPA 1ISIA 4PX9A 4TUYF 4QXRA 4QTUB 1F8FA 2P41A 4IIVA 3DZHA 4OSEA 4DZZA 2J8ZA 4KXWA 2A5LA 3U3JA 3P9IA 5EVJA 1SQ6A 1PV2A 1TADA 2QW0X 4DEXA 2V74B 4F11A 2WQ6A 3O90A 3PX2A 6REQA 4D0RA 2J3HA 1R8QA 3KC2A 2OO7A 1PU2A 4J7UA 2I67A 1ZCZA 2GXUA 1DELA 3RWOA 2BH2A 3DCNA 4BFXA 3AHEA 2OAEA 5JQGF 1Y63A 1HMYA 4MR8A 3L8YA 4OHUA 2VJOA 1O97D 2C2ZA 3KXPA 4B3CA 4RCVA 1E32A 5AOBA 5IYZB 1Q0ZA 5IVKA 2NN3C 5ELMA 5EMJA 3ZCVA 2PBZA 2AZ4A 5GGXA 5JU6A 2ZYAA 4HYTA 5AKZA 4HZIA 3VNVA 1QFJA 4G81A 2FZVA 2JBWA 3ASUA 1O7JA 1JPVA 4B2PA 4MSUA 4BO7A 4ZO8A 1VL5A 2IEZA 4QX6A 1RCTE 3G1WA 2ZSJA 1FEZA 5KCZA 2D1FA 4ZJZA 3EWNA 2QL5A 3ADDA 1NC1A 5SICE 5CB6A 1THGA 4RFVA 1ZIDA 1E2PA 4PR0A 3VYSB 3UWPA 1Y37A 2G7ZA 2GN0A 1L3CA 4ZODA 4U7TB 1P5FA 1YHYA 3IX7A 4D9HA 3GLFB 3GEMA 1K68A 1T2NA 3LKBA 2CVFA 2C2GA 4U6QA 1KO4A 4KEAA 3RSSA 1KVTA 4DR3B 1QHHA 3C45A 4J4TA 3EEBA 4YAWA 2RJNA 3U49A 4W5OA 3D6VA 1LPBB 3PI6A 1RYMA 4X8HA 1CZLA 4AP9A 3ROXA 2PZKA 2FSVC 1NJ1A 4M55A 3AX6A 2RB4A 1E7WA 3B3AA 3JU3A 3P4UA 2CDRA 4NDAA 4CNBA 3MJSA 1RTKA 3NG1A 3L4JA 3TRFA 1D4ZA 1QH1A 2FE4A 5DCWA 4BFVA 3WWYA 1UDCA 5HG0A 1S3FA 3X44A 3ZE1B 3CPHA 1U2DC 2CEAA 3RF7A 1CUEA 2P4UA 5D3MA 3BUSA 3HN7A 3TKLA 3W04A 4N01A 1TE2A 3R6WA 1LTKA 1VPEA 2D1TA 3X1YA 4F4HA 5JTUA 2X9VA 5K8UA 2A1IA 3TGWA 5JBIA 5DT2A 3ZUGA 2F3SA 3BXGA 3TSCA 1DO8A 2J08A 1U90A 5CXXA 1RI4A 2VDPB 2X5OA 3MLBA 2X6RA 4PZ9A 4W9RA 1KBZA 4XX1A 1L4LA 3G0OA 2GDZA 2HYDA 4LK2A 2D0OB 1QG0A 1Z5PA 4J4BA 1J1IA 2H4YA 3IXMA 2RBEA 4DUPA 5LWHA 4RAOA 1QGUB 3BIOA 1M8PA 1YCGA 3RRNA 1CUGA 5IVDA 4J90A 1PQUA 4M9QA 3GLHA 1F2DA 4RABA 4WRRA 4HFMA 1P9OA 3HYCA 2FN8A 2H57A 3KWLA 3IVMA 4UMDA 3RSQA 2QZ9A 1B6RA 4V0KA 3B1FA 4Z49A 2H16A 5EZSA 1NN0A 3UGKA 4MHTA 1TX4B 1H2WA 3AIOA 3U31A 2ECQA 5LDHA 4EZBA 1EBBA 1RRPA 3JRXA 4CTMA 1TJ4A 3ZCTA 3VPSA 2NW6A 1EK5A 1PJ3A 3ZWDA 5BQFA 5A4IS 3PUZA 4LZAA 3EVAA 2CL0X 1ZW1A 1UBTS 4WY8A 1PWZA 3CIFA 4KG7A 1WUJS 4PLFA 3IR5A 3AEYA 2E4AA 3FJYA 4D4LA 2O8NA 2WNHA 2OXFA 2WWXA 3FFBA 1XMIA 5C52B 2HXGA