2WIAA

Crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
253
Chain Sequence
MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Structural Fold, Conservation and Fe(II) Binding of the Intracellular Domain of Prokaryote Feob.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
total genus 73
structure length 253
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wiaA01
2OG2A 3VX4A 1DBSA 4H1VA 4IDHA 2WZQA 4I1OA 5JRJA 4PO8A 2QL6A 2REBA 2RGEA 2BCGY 4FCWA 1ESNA 4OQLA 5BN3A 2HJVA 1DG1G 2HT6A 3CNOA 2BBTA 4JS0A 1G8GA 1GAJA 2PLFA 3RDPA 2ZI6A 3RWMB 1GVNB 1FNNA 2Q6TA 3C41J 2GK7A 4M21A 1GILA 1M7HA 2QGZA 3FKQA 2IYRA 4G01B 3SQWA 5BN4A 1NP6A 3K9NA 2XSZD 3DM9B 2NOAA 4PANA 1VCIA 2P3SA 2JATA 2RH5A 1AA9A 1Q57A 1P2TA 8OHMA 4C2TA 3R9WA 2VH5R 1KZGB 2WWWA 1VMAA 4PZZA 4PX9A 4TL8A 2V9PA 4B3GA 3E5HA 4KYIB 3PUZA 3OEHD 4XIGS 5JJKA 3ICEA 4Z54A 2WWGA 2GETA 2ORWA 3FOZA 3K70C 2YKGA 3BBPA 1YR8A 4PPFA 5FPTA 1WQ1R 2HF9A 1E9EA 3NC0C 1P9WA 3NG1A 1N0VC 4LWZA 3I3SR 1Q3TA 1W44A 3IIMA 4YONB 3LAWA 4DLXA 2VHCA 3LVRE 3U3KA 1ZNYA 2GKSA 3GLGA 3DDCA 4LYHA 4Q9KA 4URWR 1KI1A 5F2EA 2FFAA 1RRFA 1EX7A 2GK6A 1G5TA 1GKIA 2VSFA 4MYCA 3I1FA 4NP6A 4IXMA 5JBQA 4US2R 4EKDA 1MABB 2QGNA 4RFSB 4TT3A 1ZYUA 3WMEA 5AUNB 3A4NA 4B2IA 1AGPA 1FX0A 4UQOA 2OCAA 1M1YE 1E9AA 2CHQA 1E2PA 4Q4JB 3HU2A 2VQSA 4QHYA 3HYRA 4YMTA 3IBGA 4HAWA 2G77B 4B35A 3KJIA 4TL7A 2GTPA 1IY0A 1ZINA 1ZRHA 1CU1A 3SBEA 3VKGA 3WNDA 1ZAKA 3ZJYA 1Z83A 1HT2E 1E2IA 4I1UA 4Z1MA 5JFGA 3RC8A 2G6BA 3M0EA 3PUXA 4UNRA 2JCSA 1KIMA 5FUWA 4MH0R 2YWGA 4DUGD 5K8LA 2WWFA 2XZPA 4KVAA 3H4MA 2JDID 2QRZA 1NLFA 721PA 2GXAA 1ONBA 4BASA 2QMOA 2E87A 2IUSA 2WICA 5SZHB 2E9SA 4DCVA 4PQRA 2FV8A 3MLEA 5DISB 1RZ3A 4TZ6A 1XPUA 4DLZA 2KE5A 1BH2A 4OQNA 2EWWA 2SHKA 5KNDA 1Q21A 4LC1A 2EW1A 1XWIA 4ACBA 3GP8A 1HA3A 4MQBA 4HAUA 4DLVA 1XRJA 4LC0A 4QNMA 2B92A 3PITA 4URZR 3ZQJA 1NNEA 3AVWA 3QPUA 3UKDA 1DARA 3PUWA 1R2QA 2IYXA 2N42A 5KPJA 3U61B 2W83A 5IK2D 1LB1B 4FMDF 4HAZA 1Z47A 2V55B 3W5IA 2DFTA 1UEJA 1Z6TA 2ZE8A 4DLUA 1LS6A 1A2KC 1U8YA 2J0QA 1E9CA 1ZM9A 4LK2A 1ZW6A 4EPTA 2IA5A 2G83A 1NL3A 1SXJD 1XCPA 4I4LA 3IPYA 2IYYA 5HPYB 5KHOC 2D06A 3QSYA 2PX3A 2V6IA 2DWPA 3RNLA 1NIPA 3EA0A 3WRXC 4TLCA 4B71A 3HU1A 4PC1A 1JB1A 3Q72A 1W49A 4ZIRB 2QBYA 2BCJQ 5KDOA 4TSFA 4JSTA 1XD2B 4Q7MB 1JXOA 2YWEA 4MUBA 1W5SA 3DKPA 5CJPA 4JZKA 3EW9A 4S35A 1PLLA 2GJ8A 2J5XA 4P4TA 2WWXA 1W5TA 1Q12A 1II0A 1C4OA 1KDOA 1LV7A 2OLJA 4PHTA 1N2CE 3H2YA 4RKEA 3LY5A 521PA 2ONJA 4D81A 2ZM5A 5FI0B 1MO6A 1TQ2A 1Z08A 2ZANA 1IN7A 3KFXA 1AM4D 1OIXA 3DOEA 3P4YA 5DIFA 2QUZA 1TAGA 4DSUA 3U3JA 6Q21A 1E79A 3QENA 2IYWA 2OCYC 2VBCA 4E09A 4M2LA 1TX4B 2YYZA 2D2EA 2GCPA 3RRYA 4DLRA 4F4JA 4M1WA 3V9PA 4LDJA 4M8NE 1QHSA 4J0QA 3RRZA 2CCGA 3QKUA 2V54A 4WZAE 1MH1A 4KXFB 2NG1A 3L2OB 4HLUA 1H8HD 3QOFA 4ZCMA 1VG9B 3WP1B 3AVVA 3P32A 3R7WA 1ZCBA 2WKQA 4Q21A 1DS6A 2KBEA 3EIHA 3QI2A 4ASUD 4BFVA 2ORIA 1A2BA 3FWYA 4BWYA 1T4GA 2OBNA 1K5DA 4G5GA 2JLRA 4NZYA 1LTQA 3SC3A 1GSIA 4CF7A 3SJZA 4A2QA 5KSPA 2ZRFA 4RCZA 3KL4A 2J3EA 4D4LA 5B2ZA 2MMCA 1Z0JA 4OK3A 1I2MA 1QZXA 2ZETA 4UXHA 5J5CA 3GFOA 3I5YA 3LVQE 4PSKA 1EFTA 4ERNA 1PLKA 2F3TA 1SXJC 4V0LA 2YWHA 3WMFA 4I1SA 1CR0A 1HV8A 1RFLA 4D4KA 4JLNA 2VEDA 3AF4A 3AM1A 3QPWA 1ZUIA 2AK2A 4W5HA 1K6MA 3QEJA 4QGFA 2CK3D 1Z07A 2OCPA 2XTZA 3PXGA 4HDQB 4Q4LA 1JEEA 1QHIA 2DWOA 1XZQA 4BZXA 1JR3D 3GLHB 2JJ8A 1M74A 4ARZA 4JVMA 4LYJA 2GESA 1SZPA 2FSIA 4R71A 3B1YA 3K0FA 2IF0A 2WSSD 1JR3E 2OXRA 4JLOA 4QBHA 3IBYA 2XOKA 2IK8A 3IEUA 3BE4A 1KAOA 2C9CA 3AP3A 4JVSB 1Q1BA 4HZIA 4LJ8A 4LV8B 2FSFA 3KDSE 4Q02A 2ZI4A 1R0ZA 2IYZA 4IVPA 4F92B 1Z0DA 1E0SA 4HAXA 4IRUB 4JL8A 2Z4RA 1P60A 3L8ZA 4Q4HB 4RZ2A 3DHWC 4CZ2A 4TYQA 2BIFA 3NHAA 3W9YA 4H9GA 1M6NA 4DSOA 1OJLA 1G20E 1FP6A 2FE4A 4M1KA 4MA4A 2FGKA 5LDDC 2A5FA 2XB2A 4GZMA 4HUQA 4KLZA 3ZS8A 1P61B 3EIEA 4AY2A 1Z29A 2OUKA 5C4GB 5H68A 3GFTA 3EWSA 2YWFA 1G41A 4OJQA 4DT1A 3VKHA 4ZDIA 2R9VA 3U44B 1L4YA 1P75A 1TEVA 4L5BA 1VECA 2NO0A 1R6BX 2JJ2A 2WWYA 4EJSC 2GCNA 2FFBA 4GP7A 3ND8A 5CK4A 2W2XA 1J90A 4OI2A 5KNBA 2WJHA 3ASYA 2ZVPX 2GA8A 2VRWA 2F43A 4Q5IA 4QHTA 3UWOA 4QM6A 4GOKA 4B44A 4N1AA 3TVDA 4GBMA 4RD6A 1GNPA 4CW7A 1WMSA 2I1QA 3TUZC 1O3YA 2WIBA 2X19A 3EC1A 4RZ3A 3SZRA 4DSTA 3ADDA 3IO5A 2VYFA 3U3OA 1E4VA 3T35A 3Q5EA 1SVOA 2P6RA 2XTNA 3K9GA 1LVGA 1S2MA 1L7VC 1WDTA 2F6RA 3VHXA 2VO1A 4LHXA 1IM2A 1XJ0A 3EZ9A 2B6HA 3GEHA 1T3LA 1IHUA 2FN4A 4IW3B 4HI0E 2PL3A 4Q1AA 2NPFA 4D0NA 5AUOB 1RYFA 2VL7A 2XNSA 3ADBA 4C7OA 2QMHA 3MUFA 3NHBA 1G3RA 2ZAMA 1XF9A 2DFKB 1KI6A 2ANCA 4G5OA 1Q22A 5CJ2A 4EFLA 5JECA 2EVWX 3K9HA 1ETUA 3QXJA 5DHAA 2QTFA 1MRNA 1EFRA 1FNMA 2CHGA 3FKSA 2DBYA 4DB4A 1ZNWA 2PH1A 4GT1A 5JSZB 1DO0A 2J0UB 3QVVA 1EK0A 3EAQA 4NYMR 2JLXA 1OE0A 2YOHA 4QJ3A 2QG6A 4IDOA 4V0MA 2NO9A 4A0FA 2A78A 3C14C 3UIEA 5EP3A 2R8RA 4EPVA 3VR1A 2G3YA 4QG7A 2F1HA 2DPXA 1KNXA 2QMEA 5CLLA 2ZI3A 3QKRB 4A2WA 1Z5ZA 4JT4A 2ZU6A 3GJXC 1ANKA 3TW4A 2Q3MA 1KJYA 4C0AC 3FTQA 2OCBA 3BIFA 4TTRA 1WCV1 3KQKA 2PT5A 4LI0A 2JLSA 1TPZA 3X2SA 4D4JA 4QJ5A 2H16A 2ZR0A 3K9LA 3GPLA 5AR1A 4G3XA 4A0RA 5CIQA 4QGGA 5ANRB 2ZI5A 3CF2A 1E2LA 1P4SA 1T9HA 4B75A 2J45A 3AB3A 5EQTA 2AWNA 3THYB 2FWRA 3LRPA 1WP9A 3BFXA 1COWA 4OKSA 4DEYA 2BMDA 3GJ7A 3N70A 4RZXA 1W1WA 2CLCX 2V6JA 1JBKA 2HUPA 2WTUA 1VYUA 3MWLA 4CEIB 4NPHA 4R2HA 1R8SA 4KFTA 4OQXA 2JASA 3W3AA 3KB2A 3T5DA 5K8TA 4JYBA 1Z8FA 3L0PA 4TSFD 4M1SA 3HPQA 3AV0B 5F98A 2H92A 3T34A 2QT1A 2VP9A 1TF2A 3AP2A 3OEHA 1G7SA 2ZUBA 1XB2A 2GCOA 2IWHA 3CR8A 4EDHA 1RRCA 2AWOA 3OF5A 1XEFA 3OZXA 4LBVA 3LQQA 1IN4A 1S96A 1AK2A 1MOZA 2R6FA 1S3SA 4R9UC 1VHLA 1J7KA 5HR5A 2ZJBA 3TNFA 1UADA 1K8RA 1OIVA 1XTKA 2TMKA 2ZRCA 4LJ6A 5E7JA 2ZI9A 1MR3F 5P21A 4US1R 4ZDJA 5KNCA 1E79D 1E2DA 1RW4A 4OK6A 4Q4AA 1DVRA 4X8OA 5JCZA 1S4QA 1BKDR 1QG2A 2IYQA 3FVQA 2P0EA 3X1ZA 3ZLJA 2W0MA 3D31A 1S0UA 1WBDA 4XSGA 3LD9A 4QL3A 1N6OA 1ZM7A 4F38A 2BMJA 5DYGA 3HU3A 3P27A 2ZS7A 4PXAA 2ZEJA 2IXGA 1JNYA 1MV5A 2DYKA 3RS0A 3QXHA 4B32A 1U2RA 3O8DA 3IIJA 2G9NA 3DMNA 5F9FA 3AVTA 4WZ6A 1P3JA 1S1MA 1PV4A 3K0CC 2QZ4A 2O8FB 1FTSA 3L43A 3VR2A 3I8XA 4HDOB 4TLDA 4TYPA 1HQCA 4A4DA 4B76A 5J4LA 4CVNA 1XDBA 1KKLA 2RGBA 2A5JA 4NHOA 3CF6R 5BN5A 3OEEA 4DDTA 2JDIA 5GADl 3CBQA 4TQAA 1NG9A 1Z6GA 1XTRA 3ZZUA 4YC7A 2GBLA 2GF0A 2O8BB 5CLQA 1W2GA 2I3BA 4TQUS 3BWDD 3GQBA 1YZUA 5D3MB 1AJEA 1YZLA 1XTQA 3RHFA 3LXXA 1NLYA 1YE8A 3SJAA 4DCUA 3SYKA 4OI1A 4W9MC 3VR5A 4TQ9A 1CXZA 1W4AA 2XOKD 3DM5A 2QTHA 4IVRA 2AHOA 2H1LA 3SOPA 5IK2A 2FGJA 5KPDA 1BO6A 1Z0AA 4FWIB 1N0UA 4CGZA 3SI7A 2KJQA 3G5UA 4E07A 3O47A 1XXHB 3CRMA 1NLZA 2IW3A 4NU0A 5IRCD 3K70B 1LF5A 1NVVQ 3DZ8A 4N3NA 2IBMA 5JJLA 2J87A 1N3BA 4HLUC 1P2UA 4PAQA 4X8MA 2ZRMA 1F3OA 2WHXA 5B57C 4QKQA 1HQYE 4N0DA 2DCUA 1GDDA 4P31A 2IS2A 3D6TB 2ZE6A 3THXB 5D3QA 1J70A 3TH5A 1S9DA 4BLSA 2ZE7A 2ZXUA 1NMYA 4TLAA 2C78A 1NMZA 2JGNA 2WV9A 1J8YF 4JL5A 4KBFA 5E3HA 4E03A 2QORA 2PZEA 2ZSBA 2JJ2D 5G3YA 1G5RA 4EUNA 4Q66C 2CEAA 4NKRA 4FXPA 4EFMA 3CX6A 3EZFA 4JBYA 1L8QA 3DPUA 3W90A 4LZZA 3DKVA 1OPXA 2JLWA 1KO8A 2QM7A 4GSYA 4WBSA 5EZ6B 3UATA 1LS1A 2WJVA 2C5LA 4NYMQ 1P73A 1CJVC 3R9XA 1YR7A 3R8CA 2GRJA 5FPYA 4B34A 2VF7A 1VG8A 5TDHA 3ZZ0A 4HUTA 1CR1A 2Z0MA 1F2UB 1KK3A 3KKMA 2IYUA 3CLVA 1XTSA 3Q8XB 1Q0UA 1WA5A 1KO4A 5L3SB 1L4UA 2CCKA 2O8EB 2EFHB 1E2FA 2OM2A 4AKEA 5DNYB 1KI2A 3PV0A 1G6HA 1FW6A 2LKCA 3B1VA 3VR3A 5EXSA 4RD0A 4O25A 3A36A 3LBHA 1W2HA 1MO3A 4W5JA 5EE9A 2QM8A 3NDBB 2NZ8A 3VQTA 4CRWB 1RPZA 1CLUA 1Z63A 4LY6A 4QHSA 1E2KA 3VNUA 3DO6A 3B9PA 3QF7A 4JLBA 3QIAA 3L8YA 1U94A 1DG3A 1ZNXA 1SVLA 2HCJB 1EFRD 4LBYA 1VHTA 2K5UA 3FKSD 1ZD1A 5JWOA 4M9SA 1ZBDA 1KYIA 4OHYA 2BKUA 4CEJA 5EXPA 2IYVA 2IYTA 1D2NA 3EG5A 2QU8A 3AEZA 1KSGA 4OHZA 3LQRA 3K0AB 1TADA 2HF8A 4MGKR 1VTKA 2MSCB 4WVFA 4XVUA 2Q0HA 2WSSA 1G9XA 1U99A 4V0ME 2BMFA 3P4XA 5KDDA 3CWZA 1R10A 3GJ6A 1OIWA 2BC9A 5KU1A 4OI0A 3B2EA 1QHGA 1L2TA 5F9HA 1VG0B 5KOYA 4MYUA 1QHYA 2AX4A 3HJNA 3EARA 5EE3A 3KKQA 2WSMA 5KTYA 3MFYA 1Z2AA 2MSDB 3NC1C 3ZH9B 4EFNA 3T1VA 5KYKA 4P4SB 3H86A 2C2HA 2P5TB 2OE2A 4C0HA 1IOZA 1SHZA 2F55A 1U0LA 2GJAA 1NVXQ 2AR7A 3AP1A 3TK1A 3BC1A 4JLMA 5BQ5A 5FPHA 1PJRA 1HURA 2QAGA 3D3QA 4XWAA 4CIDA 2N46A 1COWD 2WVJA 2C95A 2QPOA 3GLFE 3GD7A 2A5DA 2VP5A 2JA1A 2ZYTX 5DYIA 1N6HA 1WF3A 4MRVA 3GLIA 2OBMA 2P67A 1NKTA 3U7EB 3VU9A 1KNQA 1QHHB 2P6NA 3ND9A 5TY0A 2VLIA 1X8LA 3A1SA 1TU3A 1RRGA 3THWA 3B5JA 1I2DA 2F7SA 1GFIA 1OF1A 2GVDC 2VP6A 3NTUA 1T8TA 1AZTA 1CJUC 1YZKA 1G8FA 3MWKA 4V02A 5B64A 4LPSA 3ZD6A 1DO2A 1W47A 2B21A 4NCJA 4B6FA 2FOLA 1X8KA 2DY1A 2CLDX 3RS2A 3IDQA 2W2VA 3SU8A 3TMKA 5IHPA 4URXR 2DR3A 3IUYA 5JHHB 1KY2A 5C46F 3ZD7A 3GCGA 1G16A 4I81A 1FP7A 2CJWB 2WMOB 5EE5B 4PPQA 4LV6A 5FTJA 2OXCA 1I4TD 2V7QD 4AWXA 4PO1A 4BEJA 3QKTA 1SXJB 2BM0A 4FMBB 1SHKA 2QNRA 1FUKA 5HCNA 3TR0A 2FZ4A 5DN6A 1JECA 3NXSA 3KZ1E 4BEBA 2OHFA 5K8IA 5AJWA 4HATA 3AUYA 5KDLA 3IIKA 2D4HA 3CZQA 4XH9B 2ATXA 1XMVA 4FINA 1IN5A 3RYTC 2CVHA 1SKYB 1OFIA 4V0OA 2W2TA 1N5KA 4C0QC 5FI1B 1XNJA 1IJFA 2W00A 2YINC 2IHBA 2J9RA 3FDIA 1ZM2A 1F48A 2AFIE 1NY6A 1UDWA 2YJTD 2J46A 1IXZA 4B3CA 3QXCA 1YU9A 2AN9A 1WRBA 1CTQA 3GEIA 3NWJA 3NBZC 4L16A 5AJZA 4D2IA 5LD2C 3EC2A 2BEJA 3AKDA 3PEUA 2EFEB 1F2TB 4W5WA 1N6PA 4LBWA 4QXAA 2GNOA 3CW2A 5L3QB 3OEED 4X8HA 5JI2E 2BWJA 2QAJA 3BFVA 4II7A 2ZJAA 3UMSA 4WW0A 1RJ9B 3S1AA 3M4YA 2J7PD 4DVGA 1KK0A 5FTMA 3UXMA 1NJGA 2RB4A 5AWFC 1N5JA 1GL9B 1CJMA 1ZJ6A 1E2NA 3PUYA 4M4SA 2RGCA 4NYIQ 4PC3A 3WP0A 1QHXA 3WHLA 4DDWA 2A2ZA 2W0SA 4O2RA 3U4QA 4KU4A 1KAGA 4BFUA 2I4IA 5L8VA 4GOXA 3HPRA 4HLDA 2HDNB 4NH0A 4B33A 4NMMA 3K0CA 3NBXX 5GVRA 4RFVA 2ZU0C 1XEXA 4OHVA 4QFMA 3KX2A 2F9MA 1KTVA 4LSGA 1YZNA 4EJSB 1V43A 2GZHA 2PZFA 2UZ3A 1US8B 1ELOA 4YMVA 5AJXA 2FDCA 1M7GA 3M1IA 2RCNA 4JSYA 2WKRA 2FX3A 1HE1C 4HB0A 1NN1A 4DLYA 4D6PA 3TRFA 1VYVA 3QF4B 4PR0A 2WWHA 2ZUDA 3NVAA 4EQ6A 1GL6A 2HYDA 5GJCA 4FW9A 2JLYA 2OBLA 3BORA 4F7WA 4AYWA 2R44A 5CIWA 2WM9B 3AVOA 1IN8A 1ZC3A 4FI3C 5E7IA 2OAQ1 1XJCA 3EXAA 4DCSA 1J8MF 3QUSA 4TN1A 4BQSA 4L8GA 2DB3A 2V4ZA 2HJGA 5GJWC 2QTVB 3FHOA 1JXMA 3LW8A 4A2PA 1OLOA 2JIZA 5DI9A 2NO1A 5FL3A 5FH9A 3PVSA 4M9QA 1KSJA 5FUVA 5SZKB 4DCTA 2BDTA 2W6IA 3RLFA 2ECKA 2IYSA 4C0JA 1ZIOA 2GBLC 3MWYW 3TUIC 1CEEA 4LHYA 5LPNA 4KFSA 1VG1A 3K53A 3PEYA 2ASEA 2NQ2C 2J1LA 2FH5B 1T5IA 3OESA 4NCIA 2D74A 2FFHA 1YR6A 3U60B 3MG9A 2ERXA 4LCBA 1UKEA 3B1XA 1E0AA 4BLTA 1P6XA 2H7VA 5ELXA 5TXGA 4KFUA 5DO9A 2ZRIA 4JVNA 3PEVA 1AZSC 4IOMA 3AVYA 4URVR 2ZJ5A 1OXUA 2OFOA 4RY2A 2QENA 1UKVY 4TWZA 3QKRA 4KLNA 2A7QA 2O0KA 3JZAA 2CE2X 3CB4A 4D4MA 3SN6A 2KI5A 3ASZA 2C98A 4C0KA 4GDFA 1RRPA 3UK6A 3R8FA 3KXIA 4O0MA 1HTWA 1U0HC 3H1TA 4KI0A 3E70C 1S1CA 5EP2A 2OZEA 3Q5DA 3OHMA 4TMVA 1ZNZA 1CRPA 1E0KA 1XJQA 3GLGB 1NBMD 4A8JA 1IAQA 1E1RA 2OLKA 2ZR7A 2ZAOA 2ZRDA 3NEYA 1OKKA 2OO7A 4GRAA 1NBME 1N5LA 4A6XA 4RCYA 3SR0A 4Q7JB 1N25A 2R6DA 3C15C 1PLJA 4WXPA 2DHRA 2O8DA 2IS4A 2ANBA 1Q1ZA 2VPPA 1FX0B 1UM8A 3K0SA 3CRW1 1JJ7A 1E2MA 4Q9JA 4KITB 3TSZA 1G4AE 3OE7A 4U02A 4YXWA 1GL7A 1R5OA 1S8FA 2QPTA 2EWVA 1U0JA 4P0TA 3WYGA 4DC9A 3IHLA 4DLTA 2VHTA 1YRAA 4Z8XA 3BS4A 1AQUA 4K81B 2PT7A 1TF7A 3CRRA 5J4KA 5JEEA 3ZVNA 1D9XA 1FMLA 2WAXA 3AF2A 2FNAA 4IEEA 3U2QA 4A82A 4DB2A 5EP1A 5FTKA 3MMPA 5FBLB 3BRWD 1A1VA 2ZRNA 1PUIA 3L0IB 1QDEA 3CIOA 1OXTA 4HAVA 4P3YA 3C7KA 3P20A 1IBRA 421PA 4RKFA 3LX5A 1G5PA 3GLIE 3KJHA 3SYLA 1OHHA 3D8BA 3TVTA 2ZRKA 1QG4A 3IQWA 2C96A 2VIIA 3BK7A 2WIAA 4F4CA 1Z0FA 3TJZA 1UBGA 1ZVQA 1OV4A 4R98A 1E1QA 5G3ZA 4CT4B 5B30A 2IX3A 5HTKA 5K8UA 5JS8A 2N1BA 3B9QA 4OQFA 3SHWA 1E94E 1MO4A 2BM1A 2REXB 4IDPA 4UXJA 4ZI3A 4FWTA 4O3MA 5M04A 4BZPA 3W34A 4X8LA 4ESHA 1OFTA 1OW3B 3PIRA 1H8EA 3TSWA 1DAEA 3RRNA 2GJ9A 4TMZA 4Z51A 2C8VA 1E2JA 1NVVR 4UXIA 1X86B 3PG5A 2QEQA 5C4MA 3TIFA 2JAQA 4LV5B 3X1XA 2XB4A 3G82C 3SFVA 3MAAC 1GIAA 2BV3A 2F1RA 3MJHA 1KMHA 3LDAA 3MRSA 1HYQA 2CMKA 3UG7A 1OFHA 5G41A 5DN6D 3K8YA 4LHWA 5DSZA 3CNLA 4TMTA 1Q1EA 2LWIA 4US0R 2PZGA 4HZUA 221PA 3IHWA 2FPMA 4IEIA 2QBYB 1JQLB 1AIPA 3Q7QA 4JJKA 5CB6A 3CM0A 3PQCA 3LNCA 5FOXA 1Z22A 1E69A 1RYHA 1CRQA 5D3MA 5JI3E 2HV8A 1P2VA 1TTTA 4QBIA 2CL0X 4MRNA 2IWRA 2GJSA 5HKKA 4PHHA 1VCNA 3O8CA 3U6BA 2HCBA 2BBOA 1KDRA 1JAIA 2O8CA 1G19A 4NBSA 2ZYVX 3GLHE 3TLXA 2HEIA 3ZYCA 2QAGC 1U8AA 2RHDA 1DAGA 5FR1A 4JJZA 2IUUA 1LF0A 4OL0A 4C30A 4Q48A 3RVBA 4ABYA 2BBWA 1EG7A 5HE8A 1TF5A 2Z4SA 1A5TA 3GJ5A 3MCAA 3TUJC 3JVVA 5CM9C 4AKIA 3KKNA 4C9BA 4Q1CA 3T06B 4F93B 2LKDA 4XTCS 3R7WB 2X2EA 1Z0IA 3CH5A 3D7MA 3A37A 5H1YA 1ZC4A 1YZQA 2IEZA 1MRSA 3SQXA 2ZS9A 2ZRAA 4KV9A 4BRUA 5FFMA 4PAOA 4A0HA 1UAAA 3GLFA 1XPOA 3BGWA 3FHCB 2Q9BA 2R2AA 3ZQ6A 3SS8A 3ZGXA 4BFZA 2BMEA 1D5CA 1BMFA 1W0KA 1X8JA 1KMQA 1UBEA 4Q00A 5FBWB 3TQFA 2XJ9A 1B0UA 3MSXA 3THOA 1SULA 5L3RA 1GKYA 4ILEA 3UMRA 5TV2A 2JJ1A 1MO5A 3CF0A 2ZTSA 2A30A 3F3YA 4ARZB 2ERYA 2QE7A 2BJVA 2NZJA 3B1ZA 3K0FB 3QKSA 1ZU5A 1OXVA 1EXMA 3IKJA 2FEOA 4OYHA 2B7BA 2F1IA 4HLQB 5CB8A 1NJFA 4HB2A 3DOFA 1Z6YA 2AK3A 2JIZD 1SVSA 2BOVA 2V7QA 4B2PA 3PCRB 4GZLA 4TMKA 1UEIA 3AKCA 1UKZA 4OQMA 4RZUA 5FUXA 5AJYA 4KAXA 4M9XA 4XD7D 1G3IA 2W6ID 4H1UA 4TYWA 2VTKA 2IF2A 1XMSA 2QQEA 2QP4A 3FGNA 4F4IA 4EAQA 5LBIA 1ZD9A 3J81k 1V5WA 4BLPA 4JMPA 1N0WA 1II8A 4HUQB 2WMNB 1S9HA 2YC2C 4LOAA 1SQ5A 3PUVA 3KTAB 5DGXA 4PFSA 3U3MA 3OIUA 4A6PA 4KJZA 3QQ5A 2XZLA 3FE2A 3L82B 1CP2A 2IL1A 1DEKA 4HAYA 1N5IA 3ZIAA 1XTJA 3HP1A 3LH5A 1R0YA 4C0LA 4FD2A 2NTYC 2CE7A 3X1YA 1VCOA 3RAPR 4M1YA 4LX0A 4V0KA 3KB1A 1LNZA 4D0GA 3CUEF 3O8RA 2F43B 1D2EA 1X3SA 1U90A 1KKMA 1M8PA 4L4UA 1GKUB 4JLVA 1R5BA 3REFA 3QBTA 2J7PA 1E98A 3LO5A 4TLEA 3T61A 3U5ZB 2L0XA 4HEJA 1DPFA 2JLVA 2O0HA 1TQ6A 1E1RD 1QF9A 2EYQA 2REOA 5L3VA 3UMFA 1OKKD 2OEPA 3W6NA 4MYTA 1C1YA 5DH9A 1HUQA 3BOSA 3LLMA 4IFBA 1F5NA 2J7KA 1Y63A 2FJUA 4NDZA 3TBKA 1G8HA 3OIVA 1AKYA 4B73A 4BE7B 2NMVA 2O52A 4LYFA 3W3ZB 1KSHA 2ZJOA 4C7OB 4JIMA 1W36D 1CJTC 2Z83A 3KXKA 3OE7D 1PZNA 4YXWD 4CEHB 4NYJQ 1KI6B 2BEKA 2D2FA 4KHZA 4XWKA 3QG1A 4TL9A 4QRHA 1XEWY 1D9ZA 4YMWA 1IONA 2EYUA 3F5FA 1OH6A 2ZRLA 1Z6XA 3KXLA 3WBKA 2D3WA 3QXSA 4LBZA 5EE0A 3BXZA 4GI7A 3U7HB 3CKLA 1EESA 5FOWA 2Z5FA 3BH7A 3AGPA 5BYKA 1ODFA 2RKOA 4XSHA 3CPEA 4OK5A 4DEXA 2ODNA 1Z28A 4BFYA 4JLJA 1OHHD 3A4MA 4NYIR 1R5NA 4MDFA 3EASA 4LJAA 4RSGA 1MABA 4RFSA 4B6EA 3GJ0A 4WZBE 3EX7C 1JALA 1E2EA 1E1QD 1G3UA 4PAMA 5G53C 4ON9A 3HR8A 4Q4JA 1KY3A 3SBDA 4A92A 2IXEA 1D6JA 2XITA 1X1SA 4GNKA 3KQLA 1Z2CA 5HCIA 2Z43A 1H8ED 1KI4A 1X6VA 2X2FA 5HZHA 4FMDB 3VR4A 1NF3A 4RD2A 5HE9A 1EWRA 1QVRA 1Z0KA 1VYTA 4A9AA 4JKIA 1OYYA 5JZVA 2D62A 5LD2B 3I61A 1FPMA 3T12A 4A8JC 5JHGB 2OFXA 5DE3A 1R7RA 4Q1BA 3I4LA 4W7SA 4L9SA 3L0SA 2YV5A 1IY2A 3GJ4A 3QG5A 2UVQA 4Q9HA 3U7GA 1E9SA 2W58A 2EU8A 4Z8YA 3ZZTA 3AVXA 3LW7A 5UKDA 621PA 1FQJA 3B13B 4AIIA 1W36C 1J2JA 2ZROA 4M1TA 1J99A 4NCKA 5CYPA 5DI3B 3ZDQA 1ZIPA 2Q3FA 3LBNA 1GZSA 1JPJA 1N6NA 2GCOB 2Q9CA 3BAFA 1TL7C 5HKKD 3WNCA 2GVZC 1KI3A 5A5GA 5C2JB 1ZCAA 2NO7A 2BHRA 2C77A 2ZRHA 1E9FA 4GMXA 5HZKA 4B3FX 3UWKA 3OFNA 1IY1A 4QNRA 3ZS9A 2QMUA 4ZI2A 4ZKEA 2G88A 4P4UA 2PCLA 1NBMA 1OT3A 2EQBA 4Q4AB 4RD1A 1N6RA 3Q3JB 2ZQ5A 1CJKC 1FMJA 2IHYA 4UNSA 4BRWA 1VKJA 2FF7A 2XNDA 4G0NA 4L15A 4UJ5A 4TYNA 2KBFA 4LJ5A 3PFIA 1ZUNB 1KJZA 3C4JA 1ZMXA 2AL7A 1N6LA 1WBBA 4ZIRA 5FBVB 5CYOA 1OXSC 1XD2A 1R0XA 3A1VA 2OT3B 3EZ2A 4A15A 4A0GA 1GP2A 1XMJA 3I73A 1VIAA 1ZM4A 4Q7KA 1CIPA 3NEJA 2WAYA 4GFDA 1E3MA 3T1OA 3I8SA 2DFLA 2VSXA 2ZYUX 1YZGA 4R2IA 1U98A 3VR6A 3VAAA 3R20A 1TNDA 1BMFD 4BLRA 4IOJA 2VP0A 1W0KD 1XEWX 3CX8A 3WRYC 1SVKA 1UFQA 1IQPA 4HYYA 4E5UA 2ZS8A 2WBLC 1E9BA 3N5CA 4V0NA 1R0WA 4XWOA 1UJ2A 3NH9A 4PC7A 2ZJYA 1TUIA 1DAMA 1GTVA 2FZLA 2JJ1D 4N0EA 2KWIA 1YZTA 3SNHA 4DXAA 1XD9A 2WPDA 3R9IA 1BOFA 1XZPA 2C04A 4POAA 2QE7D 2X8AA 4JBWA 1EX6A 3MWJA 4QGHA 1HEIA 2RAPA 2H8KA 4E22A 1OH8A 121PA 2H5EA 2J59A 4DRZA 4GP6A 4HLCA 4JT2A 2RMKA 3LA6A 4BFXA 2KB0A 2XJ4A 4DLWA 4DBLC 1G4UR 2QP9X 3WYFA 5FR2A 3AVPA 3RS5A 2ZE5A 1P9RA 4Q7LA 3AQ4A 4C3ZA 4JL6A 4KODA 4FCVA 2RGXA 2WJIA 3I32A 4Q03A 2GHIA 2J0VA 2I1VB 3PR1A 1RVDA 3Q9LA 4PTLA 4PO9A 1T5LA 4QBGB 1GG2A 5FOTA 3A4LA 4B3XA 5E95A 5FPSA 2MSEB 3ZVLA 3B8HA 1A4RA 1GITA 1TUEA 2YOGA 3DZDA 5BXQC 4QC2A 3B7GA 3WMGA 1QVAA 5EUQB 1OSNA 2G1KA 4MYHA 1FOEB 3B6EA 3CNNA 3CPJB 3BFKA 4IXNA 4M0LA 3NBFA 1VPLA 3GLHA 2GF9A 2GXUA 2QROA 4JKYA 1NY5A 4YLGA 4AYTA 2BVNA 2ZJZA 1G7TA 3ZIAD 3RS3A 2XGJA 2QN6A 3X1DA 5F3WB 2F9LA 3TW8B 2B8WA 3TSOA 4MGYR 1II9A 2ZSFA 2QSZA 1CR2A 3OAAA 4F91B 3LXRA 1A82A 3DMDA 4AKHA 1TQ4A 2VHJA 4Q9IA 4AD8A 4DDUA 1OYWA 4Q4HA 2D7DA 4Q1FA 2EFCB 3WY9A 2VA8A 3PEWA 5IT5A 4G5SA 5FL7A 2NGRA 2PEZA 3K09A 4KSBA 2AXNA 4MGZR 5JRZA 3WNBA 1FQKA 1Y3AA 2DWQA 4PQFA 3SDZA 4IKEA 1A7JA 2HXSA 1LY1A 1DE0A 3CWQA 3SE0A 1DTSA 1N6KA 2AD5A 3AKEA 1E6CA 4PSVA 3C5HA 4WOPA 5TMPA 3FFAA 2IYLD 3BJIC 4BFSA 3U44A 4KO8A 4OJKA 1IXRC 3V4FA 2OESA 1XPRA 3ECCA 1YRBA 3GJ3A 1T3SA 1NVWQ 3TAHA 4JVLA 2RHMA 4D0LB 5KUTA 1W46A 1TMKA 1E9DA 1RIFA 5H70A 2R62A 2ZVQX 2HLDA 4TMXA 2YVUA 4XOIA 3K1JA 1FUUA 5A0FA 2RGAA 1GUAA 3BH6A 1RC8A 1KJWA 3REGA 4DDVA 4U5XA 2V1UA 1ZD8A 3MD0A 1WB9A 4CEJB 1BS1A 3FMOB 3AF1A 1I4LD 2AD1A 2IEYA 2G1JA 3MJRA 1U9IA 5J4YA 5FOUA 4URUR 2CHVA 1AGRA 2G0NA 2FU5C 2ORVA 2O0JA 1IJEA 5LB4A 1IXSB 1M2OB 1MKYA 2FA9A 4ZPXA 4YMUA 4MKFA 4NCNA 4WXRA 1Q3HA 4M1MA 1GRQA 3IQXA 2ODBA 821PA 1PVOA 1XU4A 3FMPB 1SXJE 1KI9A 5CM8B 4D80A 2CDNA 1DOAA 1W4CA 2XXAB 1JI0A 1XFAA 5E4FA 1HY3A 4IDNA 2UKDA 3H84A 1ZU4A 3BB3A 3HYTA 1LFDB 4XD7A 4BPBA 1EFCA 2A5YB 3QJYA 4P32A 1M7BA 2QP3A 2R6AA 2NO6A 1SKYE 4Q1DA 2ODWA 4M1OA 2QAGB 2J41A 2IS6A 5JSZA 3MGCA 3PJRA 3A6PC 4PHGA 1X1RA 1NN3A 2J0UA 4Y0AA 3EPKA 2VHQA 2WJGA 3CO5A 3GLIB 4C2UA 3SJCA 3IGFA 3VU9B 5AUPB 3TQCA 4TZ0A 1XBTA 2XZOA 2BJWA 4AKGA 4D26A 3I72A 3THWB 2F3RA 3JZMA 3RRMA 4Q01A 1UPTA 4C0SA 5CDFE 1G7CA 4IHQA 5FOSA 1BYUA 1G8PA 4KSCA 3T1QA 4M9ZA 2CVFA 1KO7A 2WJJA 2ZSEA 3IEVA 1P2SA 1YHNA 4BLQA 2QI9C 1GRNA 3RC3A 4B3DA 3ZVMA 3CZPA 3F8TA 3EA5A 2D7CA 5A4JA 1G7RA 1OB2A 4JYCA 2B7CA 2X1VA 1W0JA 3OFND 4OI4A 1FTNA 2PEYA 2XAUA 3THYA 1JJVA 4FN5A 4PPGA 3N2IA 1Z6AA 4V03A 1QBKC 4MKIA 4BFTA 4DIEA 4HDCA 1NIJA 4XVRA 3GMTA 4JBXA 1DAHA 2XNDD 4CEIA 3FFBA 4NONA 3M6AA 3PENA 1AQYA 3TR5A 4MKHA 5B58C 2WOOA 4S2EA 1WXQA 1KGDA 1P72A 4DJTA 1E32A 2C9OA 4GMDA 2EFGA 5FOVA 1KDPA 3I92A 1R4AA 3LFUA 1FFHA 3VMFA 4PZLA 4UJ3A 1NVUQ 1ESMA 3T15A 3B78A 2CXXA 1NI3A 4BFWA 3B60A 3WYAA 1G8YA 1KK2A 4I99A 4JLDA 1T0HB 3SHFA 4BECA 2PJZA 1OFUX 5GJBA 1M34E 2YHSA 5EXTA 2GEVA 4XJXA 3QE0A 1VDZA 5J47A 4PSAA 1G3MA 4LHVA 4C0BA 2P5SA 1T6NA 3NDPA 1G64A 4MITA 4B48A 2P6UA 5BW8A 1E2HA 5BYJA 1UF9A 1NSTA 3FPAA 1YR9A 3KQHA 3U6KA 3IO3A 2GAOA 1IN6A 4ZV4A 1YKSA 3S1AB 2ZI7A 1P5ZB 2IXFA 3BB4A 5H8WA 4MUAA 1KI8A 4LJ7A 4URYR 3KKPA 4IOLA 4FCTA 3FYHA 3HDTA 3I5XA 4WAUA 2WPDD 4U7DA 1E0JA 3EZ6A 1W4BA 4PHFA 4RVCA 3C8UA 3P26A 3W6PA 1HT1E 3VHLB 4TYYA 2CCJA 3AKYA 2BKEA 5FTNA 1I4DD 2IT1A 3U4QB 3B85A 2R65A 3E1SA 4YMSA 3SEAA 2RGNA 3KFVA 3KTAA 4AK9A 4D25A 1GNRA 4FMCB 3FHTA 1G17A 4OBEA 2YOFA 4NYJR 2NIPA 1NMXA 1SVIA 1CF4A 4R7ZA 1BYIA 1XEXB 3T1TA 1Q1QA 2O8FA 2ZSAA 3DEFA 4ZDWA 1YJ5A 2OILA 3QEOA 1XP8A 4PC2A 1NRJB 3KQUA 4GPTA 4BUJA 2ZRGA 2WWIA 3C5CA 5JWRA 1XCGB 1KHTA 2RGDA 4Q18A 3TAUA 2VF8A 3LV8A 2O8BA 3CRQA 2GZDA 4EQ6B 2WOJA 3DL0A 1BIFA 1SVWA 2CL6X 3W8NA 1OB5A 2GXQA 5EP4A 2J0SA 2A3RA 4G5RA 4DHEA 4AG5A 3LBIA 4TMWA 3QY0A 4IJMA 3RS4A 3GLGE 2GXSA 1F60A 4G1UC 2IS1A 1RE0A 2ATVA 2QA5A 1XCMA 5JCPA 1K5GA 4TT3D 4LRWA 4LHZA 2FEMA 3CRVA 1YVDA 2W6JA 1S3GA 3OAAD 5SZJA 3RABA 5EZ5A 1XXHA 5SZIA 2CNWA 4CEHA 2Z6VA 3DVLA 2E1RA 3A1UA 4MKGA 5DLQC 2GEUA 5FL7D 1FL9A 2QSYA 4YDSA 3UG6A 2P2LA 3TKLA 1LW7A 4KYUA 5FBRB 1JAHA 1JPNA 1P9NA 1E4YA 4Z1MD 4LJ4A 3ICQB 1CBUA 1OXXK 3KJGA 3THXA 2A5GA 4Y0VA 5KSZA 2QQ0A 4KCGA 3B82A 4NTZA 2QY9A 3KJEA 2MMGA 2ZPTX 4QOSA 4UKDA 4K8OA 3KQNA 4XVQA 1TEXA 4QM7A 3GEEA 3ADCA 4YQFA 2NPIA 5DHFA 4WA7A 4TL6A 2G0TA 2XX3A 1P7CA 3Q7PA 3QNUA 2HLDD 5AJVB 1AS2A 3EZ7A 4MRSA 2GZAA 1C9KA 3EPHA 3A8TA 1T0JB 1ZM3A 5CK5A 3W6OA 2AKYA 3RANA 2AFHE 1CKEA 4JLPA 5BWMA 5FUYA 1R8QA 3TGPA 3OIYA 3EIQA 3EWAA 1F2UA 3RSLA 4ZO4A 2R6GA 1CS4C 1HE8B 3FMFA 1DADA 1B23P 4A8JB 3RSOA 5L3SA 2VP2A 4OHWA 2O8EA 3X1WA 2PX0A 4BLOA 1EFUA 4CT5A 2ZRJA 4NL4H 3AF0A 4LJYA 1E2QA 1D8TA 2XSZA 4B47A 5JS7A 1XX6A 2O8DB 3AF3A 4G5QA 2FPKA 4ZKDA 1QRAA 4AYXA 1G3QA 2ZREA 1W36B 1DAFA 2C99A 1W48A 3A1WA 4PC6A 2YNMA 5DI3A 1GM5A 1JQJC 1D2MA 4IVQA 4BZQA 2Y8EA 3Q85A 5KSYA 3CONA 4UNNA 4KFRA 5EXXA 1CR4A 1T3HA 3CX7A 3QVUA 3BD9A 4TLBA 3K09C 3T5GA 1PUJA 3VKWA 3CPHA 3AGQA 4PPNA 4L9WA 2XEXA 2ZUCA 2KSQA 1G18A 3W8RA 4M22A 4B43A 2OAP1 1ZP6A 1SKQA 2C9YA 3N2EA 4MRRA 2F1JA 3K0AA 2DFNA 5GJVC 3EPLA 2IC5A 1Q20A 1XTIA 4EIWA 4EPRA 2ZYWX 1AS3A 4DT1B 2ZJ8A 2HXYA 3NIBA 2V8OA 1FZQA 3AVQA 5J4VA 3A1TA 4DWJA 1G21E 4DLSA 4QBFA 1UDXA 1HH4A 2BBSA 4PZYA 2R6CA 2CBZA 1KO1A 4ZCIA 1NG1A 4JLAA 3QBVA 4CDGA 4EPYA 1NKSA 4Q1EA 4MDEA 2OV2A 4P4SA 3UANA 4GOJA 5JWHA 5LB2A 1Z06A 1JEDA 4DKXA 3V00A 4JLKA 4AI6A 5J4HA 5FBQB 2ODEA 3IPXA 4B3BA 1W0JD 1TU4A 4RD4A 1DELA 1U8ZA 2VHUA 4LYAA 1U9IC 3NH6A 3W5JA 1UBCA 1VCMA 1E99A 2AKAB 2PMKA 2ZJ2A 1G291 2PMDA 3KUCA 4DUGA 2AXPA 3AUXA 1QHHA 4YDHB 4IFEA 1KMHB 1T91A 4DZZA 3L0OA 1KDTA 3F0TA 4B74A 1N6IA 5JMTA 4DCNA 4GL2A 2ZIAA 3H0KA 2ZR9A 4HZUB 3V4RA 1OH7A 4RJLA 1F6BA 2GDJA 1KO5A 2FSHA 1SVMA 2Q3HA 1AS0A 2ZRPA 4WIAA 3JVUA 4AG6A 4KBGA 2ZSDA 2QT0A 4DSNA 3HR7A 3WHKA 2EFDB 2B8TA 4KVGA 4PQYA 4A36A 3AVUA 4HB3A 2O8CB 1KZ7B 3KUDA 3RWOA 4HB4A 2YZ2A 4FMCF 3AH8A 1NSFA 1NN5A 2O5VA 1GRRA 2CJWA 1XMIA 3UPUA 1H65A 3HWSA 1UKYA 3IILA 2Q9AA 5AK0A 1SXJA 1T8UA 4Q47A 3B1WA 2HT1A 2WJYA 2PBRA 4QGAA 3NKVA 1TQDA 4I1VA 4UNPA 2WKPA 4CYMA 3VNVA 2GILA 1G6OA 4EPXA 3GJ8A 4NE2A 3SFZA 1RKBA 2H17A 4K46A 1VIYA 4QJ4A 4ACAA 3C16C 3I62A 1E2GA 2OSBA 4TTPA 3KKOA 3GLFB 2JLUA 1XD8A 3FMIA 2GAAA 5C18A 5J40A 5EJEA 2P65A 4IOKA 1EFHA 1QHNA 5GVSA 5AUQA 3LLUA 1WE2A 3VX3A 3CH4B 3SJBA 3P1JA 5TVKA 2QPAA 1DAIA 2FMXA 3CR7A 4A1FA 1U81A 4RD3A 5CDFA 1F2TA 1AN0A 3OIWA 4LJ9A 2ZITA 4AURA 4XTRA 2PLRA 4ZDKA 5L3QA 3WBJA 2GWHA 3E2IA 5JLJA 1AKEA 3ONWA 3ETLA 2VSOA 1EWQA 2H57A 1RJ9A 3QPVA 2JLQA 1MT0A 3U7FB 1E9RA 1H8HA 2PCJA 3G0HA 4BGDA 3U3RA 5CITA 2V3CC 4ASUA 3QKSB 4ESVA 1P62B 1W7AA 1YQTA 4AC9A 1GWNA 3VTKA 5TARA 2GEDA 4LPKA 1ZUHA 3BERA 4Q9LA 4DIDA 1Z3IX 1KK1A 4UNQA 4O2LA 4D82A 5FPKA 5C1BA 2JEOA 4IDQA 1UBFA 1W4RA 3GFPA 3LX8A 3QXXA 1JR6A 2W6JD 5JEDA 1NN0A 4EJSA 1Q44A 2YC4C 4MRPA 2HYIC 2CNWD 4Q19A 1US8A 3K0EA 3K70D 2JLZA 4U00A 5KO2A 2GJKA 1SGWA 1XXHE 4C4PA 2VP4A 4ITRC 5JJIA 1EGAA 1OH5A 2CK3A 3QF4A 1KOFA 3WXMA 4HSEA 5IF9A 1GNQA 3ADKA 2ZRBA 2CL7X 1II8B 1GOTA 2Q21A 1E96A 5TB5A 4NCHA 3SYNA 5KSOA 1DAKA 3EPJA 4M53A 1JR3A 3NBYC 2A9KA 4OHXA 2IUTA 2OFWA 3A58B 4FIDA 2X77A 2RGNC 2FFQA 2XTMA 3ZVRA 4MGIR 5EE1A 3O8BA 2FG5A 3VFDA 2CLSA 2FPLA 4EPWA 2ONKA 4LUCA 1KSFX 2V1XA 4P33A 5FTLA 2C03A 4TTQA 1G1MA 2PJRA 1O87A 2LCFA 3LWNA 1CULC 2QRNA 3TE6A 2H18A 5IDVA 2FSGA 3FB4A 5G40A 3BH0A 4LGMA 4B2LA 2RGGA 2UZIR 5EUMA 3BB1A 4ZCLA 2XXAA 3RS7A 5E7MA 1KI7A
chains in the Genus database with same CATH superfamily
2V45A 4DEVA 3QUBA 1JG4A 2OG2A 4YRKA 3LHKA 2BISA 3HCCA 2D5AA 4IDHA 3JQDA 4JI0B 1IJBA 1XU7A 2QL6A 1VHDA 3KLBA 1C30B 2BCGY 2DLCX 3L7IA 1G9TA 3QX3A 1DHRA 2HJVA 3AEXA 1PSDA 1JLKA 3ELWA 1GAJA 3SZUA 3LT2A 5I7AA 4BS9A 1GVNB 1FNNA 1EVQA 1T4CA 2Q6TA 3C41J 2GK7A 1DHTA 1GILA 3ZV7A 2F17A 2O48X 1EP2B 1NP6A 3K9NA 3T7EA 3DOIA 5LQNA 3O6VA 1RWNA 4A3SA 1UPBA 2XSZD 3DM9B 3FYUC 3LY7A 1OFGA 2NOAA 4PANA 1VCIA 4XSVA 2JATA 2RH5A 1AA9A 4BWVA 1P2TA 8OHMA 4HQRA 4BZWA 1UWCA 1GZ7A 3AI1A 3FNEA 3NHKA 4PZZA 5JXIA 3T9BA 5JDCA 2AUNA 2V9PA 4EG8A 4II2A 6CHYA 2XQIA 4I66A 1SB9A 4TM8A 2FSVA 4F9GA 2JPDA 7REQB 3K70C 2ORWA 3WGLA 5IT4A 1U5CA 4UHDA 3BBPA 4DNPA 4B6QA 1YR8A 4MJLA 3DLAA 4PPFA 2C1XA 4I36A 1PX0A 2CLLB 2HHAA 4Z4GA 3DTVA 3WL5A 1E9EA 1E7QA 4JQCA 5B7PA 1F17A 1W44A 3IIMA 2VXCA 1P44A 2YQ4A 2A9QA 3LVRE 4JP3A 4ENTA 1ZNYA 3GLGA 4LYHA 5ALMA 3ZHZA 4URWR 1R0BA 1XLTA 2WG0A 2Y27A 2Y4NA 4KMOA 3ZJ4A 1GKIA 3OE1A 4NP6A 4YRRA 3I1FA 5F77A 1U7UA 2OB1A 1PJ8A 3L07A 4IXMA 3BWBA 5JBQA 5JIBA 2SNIE 1RXCA 4ANFA 1ZYUA 3DP9A 4DDKA 3UOGA 2IE0A 4P58A 1O9BA 3HJFA 4UQOA 2IW1A 1C1XA 1M1YE 4FBGA 3HSSA 3FH0A 4GL4A 4Q4JB 1LZLA 3HU2A 2HDOA 1J06A 2J5QA 3BWMA 3K9QO 4G85A 3IBGA 4YMTA 4B35A 4TL7A 3V7FA 2OFPA 2IOHA 1ZRHA 5K6AA 1E6KA 1E6WA 3HB9A 3VKFA 3IAXA 1EEHA 4V1CI 3WNDA 2G4CA 1Y3DE 3LDFA 4OUDA 1Z83A 4IDFA 3TZBA 3INTA 2BRUA 3LG2A 4C4SA 3C1TA 3GRVA 1SBCA 1Q77A 1NURA 1VIDA 2G6BA 3F1LA 4CFSA 5F1KA 1J2UA 2JCSA 5FUWA 4BRZA 4UNRA 1CERA 4DQVA 5F7XA 2EZTA 2XZPA 4KVAA 3HZZA 4B83A 5ILQA 3H4MA 2QRZA 4QG3A 2REQB 3PC2A 1XK7A 1PL7A 721PA 2GXAA 3ZGVA 1M1UA 3D02A 3UFXB 1U0BB 4INOA 3QY9A 1HORA 2HU5A 4PQRA 3E61A 4KQIA 4YPOA 2A35A 2B35A 4DLZA 5EQFA 4MTLA 4JLSA 4JI6B 3BF7A 1ZK0A 1P29A 2B9EA 4RM3A 2CNLA 4FHCA 1OX6A 4LC1A 1ZK2A 4DF3A 3GP8A 1HA3A 3BJZA 3UGJA 2FX5A 3HKDA 4LC0A 4QNMA 2B92A 4URZR 4PCLA 1OC4A 1QCCA 3VR5D 3QPUA 3WGJA 4DUYB 1NP3A 3V7WA 1R2QA 4CKEB 1HDYA 3E3MA 2W83A 2VT3A 1Z8DA 2FVYA 1Z0SA 1SCBA 4FMDF 4FMPA 1Z47A 2CBGA 2V55B 3CT6A 2AKEA 3IPLA 3LF2A 4YJDA 4DBVO 2CGEA 2J0QA 1A2KC 4LK2A 2KM1A 3DZGA 3TOXA 1T1JA 3NVDA 1BJRE 2IA5A 1ODJA 3FI0A 3D4PA 4H35A 4R3UC 4GR5A 3WFJA 3GDGA 1NXPA 4NPAA 3AFMA 2IYNA 3L6OO 2W2MA 3N8HA 4BYMA 3FETA 4WTOA 3PHLA 4TLCA 5ERYA 4PC1A 1FNDA 1W49A 2YN2A 3NDIA 1G63A 5ALJA 4Z0HO 3V80A 4ZIRB 1XD2B 1X14A 4F2HA 3SSMA 3WTBA 1GG5A 1W5SA 3CUTA 3AEKB 3DBOB 2OM6A 2J33A 2YJZA 2GJ8A 4OGGA 1CDDA 1SR8A 1NQOA 1F5SA 2J5XA 3GEBA 4U7JA 2X5NA 2PXXA 4UW9A 5AUOB 1LV7A 5IYZB 5HDBB 1N2CE 2A7XA 2D2XA 3H2YA 5IVDA 3T7JA 4CM8B 1YOVA 1NUUA 1TQ2A 1Z08A 2H52A 2WWRA 3GWGA 4HG2A 5HFNA 4YQEA 4I1PA 3L49A 1IN7A 2XMPA 1EFKA 1OIXA 3P4YA 2RARA 3LTNC 3LY8A 2XMZA 3U3JA 2A58A 5F78A 3RIEA 2VBCA 4OPMA 3J7TA 4M2LA 4ER3A 1KJJA 2VZ0A 3LVBA 2GKGA 2D2EA 1PZFA 1Y9EA 3SJ7A 4EGCB 5FOQA 3L8GA 4CXMA 4M1WA 2VYVA 2XUAA 4LDJA 2ACWA 1YR3A 1Z4QA 1QHSA 2E55A 1QGED 2ISSD 2PZAA 3WQQA 3O75A 1FUEA 1WKVA 2R5WA 1MH1A 5JAMA 3L7NA 3RC2A 3A70A 5K0LA 1ZVVA 1JB9A 4COOA 2D0OB 2WUVA 1YK0A 1H8HD 1JL3A 3QOFA 4CQNA 2CWWA 1VG9B 4ZCMA 1PRYA 5HTOA 3DD1A 2BP7A 4F9EA 2KBEA 1CUGA 1SUFA 1R27A 3BKWA 3EIHA 4BFVA 4JN6B 1A2BA 4N3GA 1EP9A 1QE0A 2V6BA 1T4GA 4Q4CA 3LPMA 1SNYA 4GM4A 2DG2A 4MARA 5A3RA 4XDGA 1X39A 2XY4A 3SZGA 2V7XA 4MQEB 5B2ZA 2HTEA 5DRTA 3ORHA 4ILKA 1CIVA 5A7HA 1I2MA 5TSDA 3TRJA 2A84A 5CLHA 2CYCA 4UXHA 5J5CA 1EZ4A 3DKRA 3B6KA 1KBOA 1GO2A 3OZBA 1B2LA 4Q34A 3NUGA 4V0LA 5BQFA 5CA0B 1CB0A 2F4VB 4I1SA 1HV8A 1RFLA 4MWDA 3AM1A 1B8UA 3QPWA 1ZUIA 2LR0A 2QU7A 2AK2A 1QIHA 2WABA 3PQFA 3QEJA 4W5HA 1PR0A 3IMFA 3VYWA 1NAHA 2GMWA 2NVOA 4BKMA 3PXGA 1A9ZA 5C4IA 4JJ6A 3L7YA 1T13A 4R05A 1JEEA 3IAS6 4FYXA 4BZXA 1RBZA 3M3HA 3RYHB 4ARZA 5C7YA 3INNA 5CB0A 2EDCA 2GESA 2WU0A 3O4GA 4M7PA 3B1YA 3K0FA 3UXYA 1F7VA 3JATB 2ASVA 1JR3E 3NHMA 5CH5A 1TYCA 1ULBA 1KAOA 2C9CA 3AP3A 3M2PA 3IXLA 2Z30A 1M67A 4JVSB 3ZU6A 2AN4A 1SCQA 3F3MA 4HNHA 4IVPA 1V1RA 4F92B 4DC1A 3RRBA 4JL8A 4X3CA 2Z4RA 3JD0A 1G2OA 4BKRA 5CEFA 3G49A 2MR5A 4JJ7A 1ZH8A 5BSTA 4DOMA 4QZVA 4FYKA 3WWZA 1M6NA 4DIBA 4M0DA 2C2GA 5IVHA 4DSOA 2HPZA 4IDCA 3ZJTA 2FE4A 4M1KA 4J0KA 3EFBA 2QX8A 2J9YB 2PGXA 3VI3B 4L5CA 1YV9A 4HUQA 2OWEA 3C43A 4KLZA 4BRSA 2VOJA 1P61B 4HCJA 3EGCA 4A16A 5DCYA 2H48A 2GZMA 2Q8PA 4MVJF 3EDYA 3ZQKA 3GFTA 1VE7A 4N12A 4DC0A 2C58A 1NTRA 3DT9A 4OJQA 4XFJA 4L8YA 1HO3A 1P75A 2R86A 2VK2A 1GA1A 5DTMA 1M6EX 1R6BX 1QG6A 4G86A 5KNCH 3HVKA 3BL6A 4EJSC 2GCNA 4GP7A 5CK4A 4TYMA 1J90A 4OI2A 1QH8A 4R7GA 4B09A 4AULA 3UAZA 2ZVPX 3MUOA 3D7KA 2F43A 3GY0A 4BO1A 4QM6A 1OFUA 1JZQA 5JS2A 4C21A 1Y81A 4Q82A 2AMVA 1DT3A 1BJKA 4GBMA 2JFQA 3P9CA 5HUQA 4RULA 4DR7B 1FFYA 1O3YA 3UWSA 2WIBA 3R6WA 2Q4DA 2BEVB 2X19A 4NR0A 4RZ3A 5DT2A 4DARA 4DSTA 3QWFA 4AJHA 3I53A 3IVGA 1E4VA 4LMRA 2AE1A 4GR4A 3THSA 2XT6A 3OLZA 1QP0A 2J6CA 4LZNA 1J0DA 1LVGA 1L7VC 2FQXA 2QLNA 3H9QA 4LHXA 4YR7A 3FPJA 1LC0A 3MCWA 3RUEA 2KHZA 3GEHA 4LXIA 2P78A 2VN8A 1IHYA 1JEQB 1IHUA 2P9CA 4UMVA 2OV1A 3A1EA 1WU7A 4Q1AA 4ZYWA 4CQLB 2CUNA 4RVFA 1LUAA 1RZRD 1JILA 4D0NA 4YRFA 2WFZA 4KUEA 4LF9B 1E2BA 1KMMA 4TKVA 2DUJA 1MN6A 4QTZA 4UHEA 4C7OA 2DP4E 4QBKA 4M9UA 4UM5A 4CIBA 1XF9A 2DFKB 5DWVA 3T7KA 4CFYA 1KI6A 1NW3A 2QVGA 4PTZA 2P1RA 3O1HB 4G5OA 4BX3A 2O19A 5CJ2A 5A0VA 2NM0A 4IUBS 1ETUA 3QXJA 4KQKA 2GPSA 1V25A 3IR7A 1LJ8A 4LNUA 1FNMA 2NYRA 1ODIA 3FKSA 1Q95A 2DBYA 5E6UB 4DB4A 5JSZB 4GT1A 1M0SA 4JYAB 1BGVA 4CI9A 1KZHA 3DAHA 2QRKA 3MTJA 1RXIA 3ROFA 2I80A 1RSZA 2QUHA 1OE0A 1QE5A 5C34B 4BDTA 4CL0A 2JLXA 3D2LA 4IDOA 2NO9A 3PUKA 1DOZA 3S44A 3UIEA 1YB6A 2R8RA 3C3JA 5EP3A 2LNDA 4HGNA 3VR1A 2G3YA 3O2SB 4L78A 4TSRA 4UM9D 5TJHA 2PKRA 1KNXA 2BFAA 4EYEA 2I4LA 4RS3A 3SDSA 2TRSB 1THZA 1WKBA 1JA1A 1JVSA 2NWQA 3T3IA 1JW9B 2WJ4A 1XT6A 5EN4A 3D6VA 3GJXC 4RYLA 4J3FA 1T9GS 1KJYA 5BW6B 4ZANA 1X7WB 2CHUA 2OCBA 1RHKA 1ZKDA 2WIFA 3NHLA 4W6ZA 1CZOA 4KGVA 5LZ5A 1X9IA 3TTVA 4LI0A 1T2VA 3ZEIA 1P91A 3GFSA 3X2SA 3VJRA 4EHAA 4Y8VA 1XRQA 3CVXA 1ODLA 3IVRA 4BNIA 4P84A 1Y42X 3OLWA 5CIQA 4R2JA 3TEFA 3MLBA 1DUVG 1SQ6A 3CF2A 2R7AA 1E2LA 1P4SA 4B75A 2JANA 1HLPA 5IYZF 1KPIA 3K9CA 5DRYA 3ZCSA 2YHIA 3ABOB 4RJKA 4YDRA 3A4TA 1C4WA 5IP5A 4F2DA 2H4XA 2PA3A 3LRPA 2Z6UA 5C7OO 1TC1A 2OLEA 2P3LA 1X0VA 2O2GA 4IMJB 3GZNB 4DEYA 1A5BB 2FF5A 3P9KA 4RZXA 3N70A 1W1WA 4JU8A 4ZXFA 3R74A 4MVJH 1RPTA 2WDPA 4FR5A 2G7ZA 1PT5A 2H2WA 4Y1GA 5FD8A 5JS6A 4TTVA 1WJGA 3A10A 4Q37A 4BNUA 1D8AA 4X6YA 3JQ6A 5I9MA 2VWPA 3AY6A 1K9SA 3EVEA 3QI7A 3OEHA 1TF2A 2G9ZA 4R5HA 4XJVA 2ZUBA 1O0BA 2GCOA 5L51A 2UVPB 4EBFA 2VKQA 1PJ4A 3QMVA 3RFTA 2H1OA 1XEFA 1IN4A 2PRJA 1MOZA 2R6FA 3IA2A 4BNFA 2DQZA 3M6VA 1VJ5A 1TU0A 1S3SA 3DV0A 1CHNA 4R9UC 1VHLA 4IKOA 4CG1A 1EGQA 2ZJBA 5HR5A 1LVUA 2FZ5A 4AZ3B 1YL6A 1YKFA 2ZI9A 1MR3F 1U8TA 5KNCA 3DFUA 1N4DA 3KB6A 4CMCA 1Q0TA 1RAIA 4KI7A 1A4UA 2A9VA 3LU1A 3DV9A 3PGVA 4RY8A 3B6ZA 4X8OA 5JCZA 3B9BA 2XMQA 4HX5A 1QG2A 3TPFA 2IYQA 5CW1A 1XU9A 2D5BA 1DC6A 3PB3A 2YASA 1NI4A 2W0MA 3GX1A 1Z4IA 1OPRA 2W90A 3PQ5A 3HABA 4XSGA 2RH4A 4QL3A 1XELA 2P2YA 2QOEA 3VDQA 4EKNB 4F38A 3H8JA 1GT6A 1I1HA 3NXKA 1V4NA 5FULA 2VVTA 3WYDA 1K7YA 3I9V6 5BMOA 2J6HA 4D5EA 3DZHA 2J85A 4AJEA 4B7AA 3HVJA 2AXQA 5JLAA 4CMHA 4HDSA 2H6EA 3IKVA 1EMDA 1U2RA 3O8DA 2G9NA 4I7EA 4B32A 4WZ6A 5DGDA 1ZIDA 5K2OA 1S1MA 4JR0A 2L19A 4H3HB 3ROQA 2BTEA 4TLDA 1YH3A 3OE4A 1PR3A 3DNPA 4TYPA 1Y5NA 1AUQA 5HK8A 4LJRA 1DBPA 2RGBA 4GKBA 4F60A 4O4HB 1WF6A 3ZD8A 2O1WA 3HKEA 1ZEMA 2I2WA 3AJRA 3CBQA 5GADl 3PGJA 4AG3A 1XTRA 1N4AA 1KFBB 2Y9MB 4YC7A 2GBLA 1I1NA 1TJ3A 4WN3A 4P7FA 2GF0A 3CWCA 4X71A 1Y8RB 1PVDA 3BWDD 1CUBA 5KCZA 2XNHA 2BYTA 3RSGA 1HNZB 2PLAA 1AJEA 1CY2A 1Y1SA 2Q1UA 4X60A 4JR1A 1NLYA 4DN6A 3SYKA 4K5QA 4UHHA 1YA4A 1K98A 2PMWB 3QPDA 1C29B 1HE3A 2X5XA 4TQ9A 2XOKD 3TDNA 1O4WA 1OZFA 1OLUB 1ENYA 2QTHA 3VZDA 2FQYA 2AHOA 2H1LA 3R41A 3WICA 4AJNA 1XMQB 2DR2A 2FGJA 1SZJG 3H04A 1BO6A 1Z0AA 3QEKA 4FWIB 4ZQFA 3VKVA 5JARA 4CGZA 1VKZA 2I87A 1CUJA 4TWIA 3SI7A 3WWEA 1SC4A 3BIOA 3TKAA 5HM6A 1ZO8A 5GOZA 3LOPA 1U4OA 1P1BA 2QIOA 3PC4A 4KWEA 1DIBA 1FSSA 4NU0A 1FEZA 3K72B 3UGKA 4F8YA 1GPAA 3UV6A 1KH1A 5LQSA 3WDSA 2UUCB 3E9QA 4PWYA 3W8DA 2J87A 1PFVA 1USGA 3ILXA 3G8YA 1AKTA 4CNQA 1JKJA 2A88A 5LZ8A 2IOYA 5KWSA 1P2UA 4X8MA 5IAKA 1F3OA 1LGYA 1O54A 4JHLA 5MGNA 2C7GA 3OQ1A 2VAWA 1HQYE 4V24A 4E0BA 2DCUA 1GDDA 3IULA 2IS2A 2ZE6A 3QVSA 5D3QA 3TH5A 5JQGB 1FYDA 2O9JA 3FF1A 4MVJA 4Z4HA 1NUAA 1NMYA 4TLAA 2C78A 2COEA 1NMZA 4YIKA 5AKIA 5E3HA 1WXXA 4DG9A 4E03A 1NYQA 1HYHA 4YV7A 4LDPA 5A4KA 5BSGA 4C7VA 4LZAA 2LGJA 1NDQA 3T5CA 2HMAA 4EUNA 4Q66C 1PYDA 3RFVA 2FSPA 4BLWA 4GVLA 3N58A 1GT91 4FXOA 1L8QA 2FEAA 3DPUA 4J2TA 3W90A 1TT5B 4LZZA 3RSCA 1AXRA 1IATA 4AF8A 5CFMA 1KO8A 2QM7A 5TR9A 2JLWA 5AW8A 4GSYA 2Q8QA 4QQFA 1OAKA 3CGWA 4PYLA 1QP8A 3K8OE 4AICA 1XKQA 2BF4A 3AM3A 2ECOA 5CB4F 1VSBA 5MN4A 5FPYA 2V0GA 4PO3X 4I4NA 5TDHA 4F45A 1AQNA 1BHJA 1KERA 1NXOA 4B0PA 4IG4A 1MO2A 3CLVA 2PRZA 1Q0UA 2PUHA 4G4SP 1ZGHA 3G8CA 1L4UA 1NVFA 2XEDA 4PIMA 5D7BA 5SICE 5IASA 2O8EB 1E2FA 1PJTA 4OG2A 1RQXA 2KS6A 3O95A 2XGMA 1ZHFA 1AXEA 3GA0A 5AKZA 1QO0D 5EXSA 1FLAA 3UJNA 2XE6A 3A36A 4W5JA 1IPHA 3ABZA 3VC1A 3NDBB 2F00A 2QM8A 2NZ8A 3PI6A 4DQLA 3KXDA 5HKOA 3FM9A 4XGIA 3T9FA 4CRWB 1U04A 3RUAA 4AX4A 4F2PA 1E62A 1ILEA 1A9XA 2HSZA 5EIWA 1JQEA 2AX3A 4FHZA 4EA7A 3QF7A 2DQKA 3L8YA 4U4AA 1VKOA 3CG4A 1ZNXA 5BUSA 4C7KA 2G9RA 1C9JA 4OHPA 2IUYA 1EFRD 2P7IA 4BWGA 1IEQA 3REQA 4EZBA 3H1GA 2Q28A 1NYRA 5FBHA 5JWOA 5E9JA 4CM3A 1A7AA 1ZBDA 4EG1A 3ZBPA 3ROMA 2O1SA 1MEEA 2NW6A 3A1DA 4CEJA 5KJCA 4YJHA 4W6QA 2QU8A 1WD7A 3OPQA 4PS0A 3HWX1 1I6WA 1T6BY 1ZK4A 3G6WA 3K0AB 3SJUA 2EZ8A 3FJYA 3UCEA 5ICEA 5IVIA 1VTKA 2BMWA 2ESRA 4XVUA 2Q0HA 2WSSA 2JGLA 1U99A 2CKMA 3JD4A 4NENB 4V0ME 1JEYB 2GF2A 3IBCA 4Y18A 2BC9A 3DAFA 2OHIA 3EDCA 3MWGA 5AK3A 4DPMA 4WNAA 3CR3C 4PFJA 5F9HA 1VG0B 1VGRA 1F8FA 5DTQA 5ES3A 1EP3B 1QHYA 4YCMA 2BKXA 3HJNA 1K66A 4IJ6A 2UUAB 2VNKA 1DU4A 1SH7A 2WSMA 5JCOA 4ALKA 4EFNA 3T1VA 4ZVRA 2NU6B 2YDYA 1G20A 2AR7A 2BT4A 3BC1A 1JIIA 1L5WA 3EGEA 2EEZA 4JBGA 2XKJE 4R0VA 3V1MA 4CF5A 1PJRA 1QZZA 2ZBPA 3D3QA 3HJTA 1H2RS 5AKYA 3T3MB 4YT8A 4TZTA 3F5DA 5GONF 3RNOA 3GLFE 1ZWLA 2CL5A 4RMGA 1OAOC 4JGGA 5HRCA 1JAYA 1WF3A 2A9FA 3GLIA 3LQYA 2HQOA 4PZUA 3DUFA 1JHVA 3U7EB 3VU9A 1SOAA 1NQTA 1QCYA 2VLIA 3PD7A 3ECSA 5JD3A 5TY0A 3UXEA 4CMIB 1TU3A 3THWA 1XC7A 3C3KA 1A76A 1WABA 4GICA 3VYUB 3W2GA 1K0UA 4NJMB 4OVKA 3ON5A 3PX2A 1YQGA 1ZGBA 5IZ4A 1N92A 2VRCD 5B64A 5IEBA 3SXPA 3RKRA 2FKAA 1C9MA 2P11A 3HFRA 3N7AA 4CL2A 3OPMA 2B21A 4RH1A 2AMFA 5LA6B 1KZYC 4O0LA 3MCVA 2FOLA 1AF4A 4B6FA 3GUCA 4REQA 2VNSA 5IHPA 5BR7A 1VPVA 2OBYA 2VDVE 3PXAA 3IUYA 3CH6A 4KMRA 4GOLD 3AI7A 1GGHA 3OEWA 5E1BA 3VDNB 1K7XB 5LQAA 4I81A 3K1TA 5AW3A 2CJWB 4CTMA 5T6MA 3QEMB 3UICA 4MWEA 4LV6A 2HBQA 2XMRA 2ZTUA 4MYDA 3ZWPA 1YD7A 1BA2A 3WLLA 3I2KA 5CH3A 3VVMA 4AWXA 3CNHA 4LWQA 3O4JA 1VJTA 1SHKA 2IEDA 3THRA 4YV2A 4O4HF 5HCNA 2C97A 1N1DA 3BMNA 1FXWF 1JECA 3LIPA 3MJ4A 1UAGA 4XQEA 4QDTA 1MVLA 1TAHA 2R3SA 3GUYA 3HFSA 4LXQA 1Y6FA 1CIJA 2R66A 2ZT5A 1X15A 2ROQA 3IIKA 4I08A 3RVRA 4N5LA 4KQGA 4XD2A 5CXXA 5IBPA 5AJHA 3QBJA 2FUNB 1YFJA 4EWLA 5FI1B 1XNJA 2AXEA 4FGSA 4HYTA 2YINC 5LYYA 2EKDA 3KJNA 4JYPA 5DJ5A 5IS2A 3K96A 3EUEA 3A9RA 2B4RO 4G8CA 1EM6A 1DIOB 2NU7B 3B52X 3GQVA 2AFIE 1UDWA 3G5TA 3LOUA 3O8NA 5EYPA 1IXZA 3GT0A 3FHJA 2G8LA 1N2EA 3GEIA 4KEAA 3U39A 4JK3A 3ZU4A 4AUEA 4L16A 3FOCA 3JD2A 2ZIEA 3WADA 1FTQA 1JU3A 3EC2A 4D2IA 4EGJA 2EFEB 4G41A 2WAMA 4LBWA 5E6SA 4LMAA 2Z95A 3G2JA 3QJ5A 1MH9A 4UTOA 3D5TA 3W7VA 5LYJB 4X8HA 4P35A 1F06A 1W25A 3WB0A 3ZWWA 2XRMA 1T4DA 2IHTA 4NNJA 4WW0A 4ZO8A 3M4YA 3KTDA 1KK0A 4UVHA 4Y6OA 5FTMA 4TM7A 4HXEB 1P7ZA 2CVOA 3DHYA 1NI5A 3TLZA 3VDMA 5A6SB 3FW1A 1PL0A 2RB4A 3OWXA 1RNLA 2NXJA 2X7JA 3ES9A 4PC3A 4M4SA 3WP0A 4C06A 1O1YA 2ZXEA 4EHHA 5ITSA 4BVKA 2O3UA 2C2KA 4CMGA 2ARKA 2ZT7A 1LDNA 1N5DA 3WHLA 2A2ZA 3MJVA 5JY1A 1SOVA 4PY2A 5I5GA 1KRHA 1AGYA 4BFUA 4HLDA 4EF6A 2FR8A 1FRZA 2AOXA 2HDNB 2I7TA 2X4DA 3I5MA 4EH1A 4NZNA 4RLHA 5GVRA 1TYZA 3ESYA 1G1AA 1XEXA 5HIJA 1I0IA 1FDTA 3KX2A 1PYGA 4MI3A 4ROSA 1B42A 1KTVA 3QU2A 4ZRMA 2GZHA 3EGVA 3RK1A 3ZY3A 1UANA 2CSXA 1D4FA 4OLBA 3EBPA 4RMNA 3DONA 4I5FA 5K0FA 3IQIX 1DJLA 2HRDA 2D0PB 3HYNA 5K1ZA 1RYYA 4BB9A 1OXBB 1M0WA 1SCDA 3QF4B 2JHAA 2R87A 4PR0A 1Y4UA 4EI7A 1ZIXA 3MTIA 5HJ7A 4O59O 4EQ6A 1GL6A 3R3ZA 1M5UA 2OBLA 3BORA 4FC6A 4KE8A 4R83A 3FRHA 2Y76A 4AJ1A 4GPEA 1JDBB 3FD8A 1JRLA 3GAFA 3A0UA 4HDRA 4MCJA 2XRZA 1ULTA 3VVCA 3DVQX 3AEUA 4LZWA 1UM9B 1REQB 1EHCA 3IUSA 2G1UA 4FS3A 2YS7A 3N3BC 4LF8B 3FHOA 4E2ZA 1JXMA 1MJ5A 1KVQA 1OLOA 4G0MA 3NTRA 3DLHA 4UM7A 4FOLA 2NO1A 5FL3A 4M9QA 3ODGA 2I8AA 3CF4A 2C84A 2DM6A 3ABIA 3PPWA 1WD5A 4YB8A 1RPJA 3I0NA 3P19A 2IYSA 1TE2A 3TUIC 3ZNNA 2V7TA 3QX7A 1MU0A 4LNAA 4NV3A 4Y6SA 5KQMA 4QVIA 1ITZA 2NQ2C 5HXAA 4NCIA 2X6RA 5BN3B 4WESA 2FFHA 1E89A 2I99A 2QZZA 3L05A 4W1QA 4ZVUA 1E0AA 2WB2A 5DHPA 4IV8A 2F48A 3P0JA 1P6XA 2V97A 3B3JA 2BFOA 2FN8A 1IEVA 4BLTA 1ISFA 1M72A 3SBOA 1UXHA 1WQ4A 1H93A 1YRWA 3UMVA 1VPWA 4IOMA 3ET5A 4URVR 8LDHA 3G68A 3ELUA 4POOA 4LE0A 3SSOA 3BZWA 4NMWA 3PRJA 2WF8A 5EJ7A 2Q62A 4B0OA 5AVOA 3Q1KA 4KR6A 3CIFA 1EVZA 3M33A 3KSAC 4A5SA 3FUUA 2PWAA 2ZIGA 3AWDA 1U2PA 1XDSA 4EI8A 4BO5A 1H4TA 1WR8A 5AKJA 1Y80A 3SN6A 1T2DA 2C98A 2QVXX 3VPHA 1FYVA 1ONSA 4GDFA 4OBWA 3ROZA 4DV4B 1K92A 3T3OA 4R0NA 3R8FA 2CFSA 3KXIA 4O0MA 3BFPA 5AK5A 5T8KC 4YFVA 2RH9B 3E1KA 2OB2A 2WTXA 3Q4GA 4KI0A 1WQ3A 1S1CA 3W5BA 1A71A 4MYSA 4NMHA 3S6JA 1VSVA 3AUTA 1V3VA 3EOAI 2FPSA 4P93A 1XJQA 1FYXA 4G24A 5M34A 1YONA 2VAPA 3AFIA 4TUYA 1NBMD 2BFEB 2J9ZB 1FRFS 3HGTA 1IG0A 3NKFA 1IAQA 4A8JA 3U7JA 3RC1A 2ZRDA 4X1IA 1T9KA 2C5BA 2MT9A 2OO7A 1NX9A 2ZIXB 3D0OA 1W5EA 1C7EA 2MCFA 1TGVA 1VLVA 2MINB 3F47A 4EYGA 2O2IA 2DHRA 4C22A 1Q1ZA 1B6SA 4RJJA 4BNDA 1JJ7A 1E2MA 4Q9JA 3WB1A 1XYGA 3TLCA 3UMYA 2C0CA 3OE7A 3EAFA 1R5OA 3LUCA 5M7EA 4DC9A 3JQFC 4YT2A 2QI9F 3H6KA 1IIRA 3OT4A 1L5HB 1GRCA 5ALLA 4CIXA 1JQ5A 1ZMOA 2YJ6A 3KZXA 3D3JA 3OLVA 1W5BA 3CRRA 3EIUA 2DULA 1UKBA 3USZA 3Q6IA 5GONA 4ZYXA 3KJFA 3AF2A 1JTVA 4C01A 2YX1A 3FNGA 2HA4A 4HOYA 4OQEA 1TK9A 4ID9A 4NV1A 3W2HA 1A9PA 5F1YA 4H7HA 5FBLB 5FTKA 5JAZA 1A1VA 2IBTA 1LWNA 3NJRA 1VB3A 3L0IB 4YGYA 1QDEA 4PPYA 5KQPA 3P20A 3QKIA 5ALWA 3T7IA 1U7TA 4RKFA 5EIXA 1YRLA 2XF2A 5G0WA 4CM6A 2WFLA 2Q6KA 4BMDA 5EESA 3IQWA 2C96A 2DC1A 3RIXA 3BK7A 1O8CA 1VBMA 2WIAA 4PS1A 3L6UA 1Z0FA 3TJZA 3AWIA 2BEWA 4M46A 1GEEA 4IFTA 3TLKA 5G3ZA 1E1QA 3PDIA 4KOAA 5IULC 5ADHA 4OQFA 3TD6A 1I94B 4IDPA 4BBAA 4FWTA 4YRCA 1TAUA 3BSYA 3A2KA 4ZAWA 1OFTA 3DLIA 3N2KA 1UT8A 4TMFA 4KQMA 1HK7A 3OM0A 3IPAA 4GC9A 2FFRA 4PQGA 4Z51A 5EHXA 1E1MA 2CXUA 3JWJA 4UXIA 3PG5A 3UHAA 3EGDB 3CT4A 5J2TF 5C4MA 3TIFA 3CLSC 3X1XA 1D4OA 2XB4A 3EYAA 3G82C 3HEAA 2BGRA 4FW8A 4JC8A 3GD5A 2ZIVB 3A28A 3EDQA 3LE8A 4NG4A 4YASA 3U48A 2QD3A 4O4HA 5F35A 1GGFA 2X0RA 3PC7A 1F2VA 4KZKA 4WUTA 1TM1E 5LYJF 5G41A 1FXWA 1GNVA 2P4SA 3GDFA 2YWJA 2CWDA 1Z74A 4MB6A 4TMTA 1RADA 5DSZA 4US0R 2NQ8A 4UCFA 2FPMA 3BEOA 2ZBFA 1JQLB 1AIPA 3BXFA 3W4JA 3LNCA 2HWXA 4CMAA 3W8FA 3PF8A 4DWWA 2FW6A 1Z22A 5LZ4A 3PQ8A 2PMFA 1L5VA 3DBIA 1N7GA 2OKCA 2EJUA 3F4LA 3G8DA 4PX3A 1AURA 1H2BA 4YCSA 5CEJA 2GJSA 3STWA 2P5YA 5ALGA 3OU2A 3BE8A 3U6BA 3DD5A 1OI2A 5KREA 3GLHE 3HUDA 3ZYCA 1DWOA 2PU5A 4MUJA 9LDBA 3J81A 1QK5A 1JDTA 2GPJA 3LP5A 4M60A 4OL0A 2IUUA 2B82A 4C30A 2FDXA 1QP4A 1T9GR 4OXKA 5CX1A 2IX9A 1U2GC 3BMOA 3H16A 3G0GA 3WA6A 1C1DA 3CN9A 4QEDA 1EG7A 1GUFA 5H3HA 2OUIA 5L53A 5INTA 1VZ3A 1USVA 4GU5A 5KYVA 2AG6A 1SCUA 1VSQA 1GRVA 4GUAA 2WIJA 2MSNA 2ZB3A 3JVVA 3AEQB 4BV8A 9GPBA 2W22A 3RVJA 4AKIA 4Z4QA 3T06B 5I7HA 4F93B 3FROA 2R79A 4TXJA 1SD1A 2YY6A 1O5IA 1UBNA 2FPRA 1L6IA 1Z0IA 2IEGA 3O8LA 3PR2B 4ND1A 4XTCS 5D6OA 1SPBS 2PLNA 3NHJA 3QOXA 1ZC4A 1ONOA 1YZQA 4MAFA 1UMKA 4ARVA 4DNXA 5IZCA 1MRSA 5JNVA 3WIVA 5LQDA 2YXNA 2ZS9A 4MA5A 5I7SA 4F12A 3CRZA 3ESXA 4A0HA 3INRA 3GRZA 5I5EA 4PQEA 4D8WA 2PWYA 1JKMA 1FMTA 4K8RB 1I7DA 4OM8A 3EUFA 5EMLA 3SS8A 4BO0A 3ASVA 5CDTA 2BMEA 3FPSA 5K3DA 2E18A 2QUAA 4Y1FA 3TXAA 3KKZA 1Q91A 3E9ZA 1G6Q1 1KMQA 3KWFA 3NP9A 5D51S 5BURA 3TIIA 4ALJA 2YJ4A 5B7GA 1N8TA 4N7BA 3CY6A 1ZRNA 4K26A 3U62A 1E1YA 5I7RA 1G8JA 2HO4A 2XCQA 3GBPA 1L7BA 2J6IA 4RELA 2GKOA 7MDHA 4RABA 3IYLW 5TV2A 4CKCA 2HDWA 3PRYA 4OHFA 2Q5JA 4R9VA 4BO9A 3A2MA 1C7FA 1PL8A 4LY0A 3LFHA 3LSTA 3CHYA 2QE7A 3H42B 3P2KA 4EA9A 1J2YA 1FSGA 2BJVA 2NZJA 4FBLA 1AK9A 1PWZA 1ZU5A 1CZHA 2QL9A 1KQNA 2BTQA 1SHJA 1OXVA 2YZMA 1I7NA 3H1PA 3INGA 5REQA 1Y4SA 1QH0A 5E1DA 3ORQA 1UFKA 2N0SA 3KR1A 3S8MA 2W37A 3VO8A 2BMAA 4HLQB 3VR4H 4F11A 1ZHHA 1QR2A 2F3SA 4HDMA 1B00A 2ZIUB 1K89A 4DQDA 4WQMA 5FO1A 3IKMB 4BGIA 3KFLA 4OBBA 1Z6YA 4YAWA 2H2DA 4TMKA 4N6GA 5FUXA 5K3OA 1JA9A 4L8LA 4WERA 2QLFA 3PDCA 2W6ID 3AR5A 3T4XA 5IXSA 2HMVA 1IRIA 1U9YA 2HQRA 2VTKA 3E9CA 3O31A 3S7ZA 4G89A 1IRXA 2EJTA 2V58A 4FGLA 4GPIB 5AVKA 1TCBA 5JDIA 3OWOA 5IAOA 4D44A 1OTYA 4FFDA 3QLJA 4JMPA 1F4LA 4FFPA 4MS4B 4D3FA 2WMNB 4ZOLA 3DEHA 3MPUA 2YC2C 3C6YA 4HMQA 3DOJA 3KVOA 5H9WA 5KMGA 3QVGA 4A6PA 1QYDA 4FWBA 4PFSA 4DM7A 1YR2A 3E9MA 4KJZA 1INLA 3KOUA 1AKVA 3A6DA 1FDRA 2IEBA 3ENQA 1NR7A 4M6WB 2GBIA 1LSOA 1JS1X 3HP1A 1UWLA 1R9GA 2JHPA 3C85A 4KRYA 5EERA 5BR8B 2HQBA 3BGOS 3DZFA 2GBGA 1VCOA 4NU8X 1U7WA 5HMMA 3Q7RA 4ALIA 5B2FA 1XKXA 1TD1A 1JT9A 1I6LA 3V8BA 4WLUA 4NBVA 5LU8A 1L4EA 4Q6WA 2HHLA 3UT6A 3MT7A 2YV4A 5AW7A 1HR0B 3GIWA 4LHSA 1V39A 4HQFA 4KW7A 2ZVJA 1G5HA 1JUDA 1GKUB 3FI9A 4JLVA 4OQQA 3GNTA 3NQ41 4O08A 3V48A 3ZE6A 1ZR4A 1E98A 3AY7A 1CZUA 3VISA 1GV0A 5BT8A 5TPWB 3B9RA 5H83A 3T61A 2HD4A 1B1CA 1ZXBA 1AU9A 2L0XA 1PJQA 2FJ0A 3EXEB 4HEJA 4NWIA 4F86A 5T7BA 2H63A 1L3CA 1CNEA 1Z36A 2IDMA 3UMFA 1WMDA 2GD6A 2OEPA 4ECAA 4MWSA 3CB2A 3PPVA 4MYTA 4B9AA 1YO6A 3BOSA 3FYUB 2B4QA 3LLMA 1ZMTA 4C7XA 3C0KA 1Y1LA 1Y63A 1XTTA 3BXEA 1M6VA 4I8IA 1KSHA 3OETA 4DJFC 4H3VA 4DLKA 3M83A 4AB1A 1CJTC 1WWKA 2Y1XA 2DUMA 3KHKA 4BGUA 3F73A 1TEZA 1PZNA 1P2FA 2FPGB 2PUWA 3GMSA 4CEHB 3JPYA 5T4BA 1R00A 2BE7A 3DMPA 2PRYA 3PT9A 1U7ZA 2C42A 2ZFUA 3LC2O