2WIAA

Crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
253
Chain Sequence
MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Fold, Conservation and Fe(II) Binding of the Intracellular Domain of Prokaryote Feob.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
total genus 73
structure length 253
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wiaA01
3PUYA 3KUDA 2ZR9A 1SVSA 1FMLA 4IVQA 3TUJC 1YE8A 2OV2A 3L8YA 1Z0IA 1Q57A 2HF8A 3BS4A 1A82A 1JAIA 2UKDA 5JCZA 2OXRA 2OUKA 3OIVA 1N6NA 2C9OA 1GAJA 3TNFA 3AVPA 3TR0A 4C2UA 1TQ6A 4YONB 2YNMA 3OEHD 2OG2A 1OIWA 3GJ0A 1YHNA 3P32A 1IN4A 4C3ZA 4HB0A 2AKYA 4JL5A 2CK3A 4HDQB 5J4YA 1CJVC 2WWFA 1HY3A 4MYCA 4E09A 4H1UA 3TW8B 4D26A 4GPTA 4F4CA 2C8VA 1UDXA 1MRSA 3TVTA 4HLUC 4MDFA 3B1VA 1GFIA 3BJIC 4KO8A 4AWXA 1XEXA 2ZIAA 1DVRA 4JBWA 3WNCA 2QU8A 3EX7C 2GCNA 1IONA 4LCBA 4ARZB 3S1AB 1EFHA 2GETA 5HZKA 4PC3A 3EIQA 4WIAA 4ZV4A 4HAWA 1VECA 2J0UB 4Z51A 1NIPA 4HZUB 1Q1QA 2VO1A 4NKRA 4YMUA 4GMXA 2CJWB 2PLFA 4KVGA 1NIJA 2XXAA 4L8GA 3IUYA 4XWAA 2NMVA 2C5LA 4C0HA 4Z8XA 1DAKA 1NVVQ 4IDHA 4KBFA 1KOFA 2WWWA 3D6TB 1MR3F 2P5SA 1KO4A 1WRBA 2NZJA 3BFVA 2NO6A 2XJ9A 3GFOA 1I4LD 1OKKD 1FX0B 4AC9A 3J81k 3IPXA 3D31A 1ZP6A 4JSTA 3RSLA 4PPQA 2RH5A 4M1TA 4Q47A 2YJTD 3NHAA 2ZJAA 3V9PA 5IF9A 4KLNA 2ZE5A 2W6JA 3NEJA 1GM5A 1ZCAA 3OIUA 3Q3JB 1YR6A 4LJ8A 5FUYA 2RMKA 1DADA 3FE2A 5JMTA 5FL7A 4R71A 4HLDA 1DAEA 1QHNA 2NO0A 3AF0A 3L0PA 3B82A 2ORWA 3FMOB 1JR3D 5L8VA 4Q4HB 1E2IA 1VIAA 4KJZA 3WMEA 1LW7A 1SGWA 4D81A 1T3SA 4M1MA 1E9DA 4US2R 1II8A 4ZCIA 1IXZA 4FW9A 1E2HA 2ERXA 4NP6A 5LBIA 1E99A 3PUWA 2IBMA 3H4MA 2AHOA 1KI9A 2CL0X 2OBMA 4OQFA 5H1YA 2NQ2C 3VFDA 3B1WA 5FI1B 4DB4A 1A4RA 4AKIA 2HJGA 2EYUA 1GDDA 5KU1A 3ZD6A 4EFMA 3EWAA 3ZVLA 1YVDA 2XTNA 5EZ6B 2V6JA 2HF9A 1CBUA 4E03A 1DS6A 1EX6A 1E79A 3CPHA 3O47A 3SZRA 1ZUIA 3AF3A 2O8FB 3A36A 5P21A 1YZQA 1VHLA 3NHBA 3K0EA 3OEEA 3KTAA 1TNDA 4OI2A 1GKYA 1T3HA 3QPUA 4PPFA 3RS2A 4JS0A 1EXMA 3D7MA 3AKDA 5GVRA 1CJKC 2C9CA 3KKNA 4M9XA 1T0JB 4QGFA 5DI3A 3O8CA 2ZVQX 3GLHE 4DSUA 2J5XA 2OCPA 4UNRA 1XJQA 5EP3A 3W6NA 3THYB 2IYZA 3NWJA 3M6AA 3GLIB 1BO6A 2AWNA 4JVSB 3BORA 3EASA 4QBGB 1Q21A 3NBYC 1H8HA 4R7ZA 5E7IA 4DCNA 2O52A 2QBYA 1R8QA 2GJ8A 3WMFA 4IVPA 4UNPA 4DCUA 2CVHA 4Q1CA 3GLIA 2VF7A 6Q21A 2RAPA 1AKYA 4DSNA 1G1MA 2ZSDA 2ZJ2A 4I1OA 4G5OA 3VR1A 1P3JA 1OF1A 2Z5FA 4B32A 1OKKA 3LVRE 3A1UA 3AF1A 3X1WA 5BN5A 1YR9A 3I61A 2O8CA 2QSZA 3MGCA 4BFZA 2PL3A 4RVCA 4URZR 3TGPA 2VF8A 4IXMA 2XB2A 2GEVA 3IBGA 2FFHA 5C4MA 5DHAA 1DARA 2ZRKA 4DEYA 3TW4A 4BLSA 1D9ZA 1I4TD 1E2GA 3X1ZA 1NL3A 3PCRB 4WXPA 2YZ2A 1H8EA 1VYUA 2FFQA 1PLJA 1QRAA 3CBQA 2FSGA 2RGNA 4DLZA 1T3LA 3TK1A 4PX9A 3DKVA 3F8TA 3UK6A 2BCJQ 2L0XA 1SVMA 2LCFA 2N1BA 3I1FA 5JRJA 3EIHA 5IK2A 3WXMA 3CF2A 5LB2A 4DDTA 5CB8A 1QG2A 3CUEF 3SC3A 3UWKA 1D2NA 1EFTA 1Q22A 3PEYA 4LWZA 3U7HB 4EIWA 2R65A 5BXQC 2JJ1A 2BJWA 2ZJZA 2BM1A 3DEFA 2ATVA 3KB2A 4A8JB 2AR7A 2WVJA 4B3FX 3OHMA 4MKIA 4NBSA 1OH7A 1Z8FA 1JR6A 3SQXA 2WJGA 3VR2A 1DG1G 3A4NA 5FUWA 3MSXA 1SULA 3LBNA 1KJZA 3MJHA 4C30A 4DLYA 4PQRA 1MRNA 3L8ZA 4DT1A 3CNOA 1C4OA 2BOVA 2VA8A 3LO5A 1Z08A 3B1XA 1UEJA 4EJSC 4QFMA 3CF0A 4DIEA 5CDFA 2Z6VA 1CJMA 5JWRA 1Z6TA 4URVR 1P2UA 2PJZA 1SXJA 1XBTA 1B23P 1FZQA 3AGPA 3AP2A 1XTSA 3FFBA 5IDVA 4O2RA 1XMSA 3QEJA 2QPAA 4OJKA 3P26A 4UNSA 4X8HA 3SEAA 3KQKA 1RC8A 4MGYR 5EP2A 3LXRA 1FP7A 4QL3A 2IYLD 4KSBA 3WHKA 3SNHA 4BEBA 4YMTA 1Z29A 3KKPA 1CJTC 1JNYA 2GKSA 4V03A 2WOOA 2YOHA 1BYIA 3C7KA 3RS7A 1U90A 5EE0A 2NO1A 2AFIE 4BUJA 2G77B 4G5SA 1EFRD 4JZKA 5AJYA 5GJWC 3CRW1 3U2QA 5FH9A 4KVAA 5HTKA 5JCPA 4HI0E 1KI3A 1YZLA 2HUPA 2YVUA 3ICEA 1VG8A 2FF7A 2DFNA 3AQ4A 2WOJA 3U4QB 4ZDWA 2WPDD 3FWYA 3JZAA 4Q4HA 3TUIC 5KDLA 1VG1A 1DG3A 2FSFA 4DKXA 1D5CA 1DO2A 1JALA 1KY2A 4NMMA 4NYMR 4RFVA 2HV8A 5FOVA 4Q1DA 3TRFA 3VX4A 1DEKA 3PUXA 2QP9X 3OE7D 2UZIR 3IBYA 4QJ5A 3SDZA 2EFEB 2C77A 1WBDA 1XTKA 2EU8A 1Z0KA 2QMOA 3MWKA 1U2RA 4MUBA 3KJGA 5B30A 4PR0A 4OL0A 3UWOA 2ODBA 3FDIA 4N0DA 5HKKD 1GUAA 5KNBA 1X8JA 2ZRAA 1XPOA 4B75A 4YMVA 1NY6A 3HWSA 3THXA 1ZM9A 4IOLA 4Q4AA 2EFHB 2FEOA 2YC4C 1UBGA 2EYQA 1IBRA 5CDFE 2VL7A 2P5TB 3HJNA 3QIAA 4RCYA 1UKVY 2HEIA 3EZ7A 2W58A 4JKIA 5LD2C 1IN8A 2IHBA 3QXHA 2JIZA 1N6HA 4GFDA 5AR1A 1PVOA 1NN5A 3OAAD 1KKMA 2K5UA 2GILA 4NCIA 4JL8A 1N3BA 2QTVB 4LBVA 3L82B 1MT0A 1YJ5A 2ZAOA 4DDWA 3QENA 4RFSB 5EUQB 4A8JA 2JASA 3BFKA 2XOKA 4LGMA 2GESA 4TYPA 1GKIA 2ZSBA 4A0GA 1E3MA 2JCSA 2PCJA 4P4UA 2AX4A 2AFHE 4NCJA 1W36C 1II9A 4IKEA 3QI2A 2LKDA 1DTSA 2X2FA 4LYHA 2R6DA 1IN7A 4FIDA 2DBYA 3V4RA 1GRQA 4L9SA 521PA 4LK2A 2QGNA 4JSYA 1K6MA 3B7GA 3IILA 4LC1A 2BVNA 4NPHA 5CB6A 2BV3A 3WBKA 1HT1E 2F1HA 2OFXA 3N5CA 4TQAA 2P0EA 1D2MA 2GA8A 1P9WA 4LUCA 2OSBA 1NBME 3SI7A 3LLUA 4BE7B 4TL8A 4KODA 3MAAC 4LBYA 4D6PA 4RD6A 4DRZA 4FMDB 3DO6A 2QN6A 3UMSA 2WKRA 3BE4A 1FNMA 1RYHA 4DLWA 1SHKA 2FH5B 3ADKA 1Q3TA 2H92A 3I92A 1W47A 3DKPA 5L3SB 1OXTA 4L9WA 1Z0FA 1K5GA 5BYKA 3IEUA 2Q0HA 2A5GA 1XB2A 1ESMA 2O5VA 3TAUA 3RS0A 1ZU4A 2CMKA 3EWSA 1KHTA 2ZI4A 2CEAA 2IA5A 3B13B 4M8NE 1BYUA 4HB3A 2B8WA 1N0VC 4GRAA 4XTCS 3WP1B 5FTJA 1OFUX 2H7VA 4I1SA 3KXKA 2HXSA 4GI7A 4KBGA 2MSDB 4IEIA 2QMUA 3LVQE 4HUTA 2VHQA 1NG9A 4JT2A 4QHYA 1XXHE 1Z22A 3U5ZB 1W0KD 1KNQA 4V0OA 5B64A 5CK4A 3AGQA 2C96A 1KAOA 3FFAA 2NOAA 4NE2A 2VTKA 1X8KA 1LS6A 4DXAA 1E2EA 1G7RA 2NO7A 1IN5A 2IYXA 2VP6A 3B5JA 2WTUA 4GL2A 3KZ1E 4A92A 1RZ3A 4BFUA 1F2TB 1TPZA 3R8FA 4NHOA 2ZAMA 3PV0A 4P4TA 4TTQA 3SQWA 2ZJ5A 2IXEA 2JJ8A 1QHHB 1BMFA 5EP4A 4MRNA 1X1RA 2J0UA 1HA3A 4ZCLA 3C14C 4Q4JB 4JMPA 5CM8B 4G5GA 1YKSA 4LJ6A 3KFVA 4DT1B 4G1UC 2J59A 4Q4AB 1DAFA 4OHYA 3QY0A 5CYPA 3UXMA 1IJFA 3D8BA 4KHZA 5SZHB 2ZREA 1VIYA 1UF9A 4CEHB 4RD0A 1L7VC 4TYWA 5TV2A 2W83A 2HLDD 2VP2A 1LS1A 4WZBE 4CT4B 1ZM4A 3W3ZB 5JWOA 1ZNWA 4XWOA 4BFTA 4B47A 4B74A 1OXSC 3OFNA 4FD2A 2KBEA 2IT1A 3B9PA 2DHRA 3QKUA 3OIWA 5AK0A 1KI4A 1LV7A 3K9HA 1ZD8A 2ZS9A 3VKWA 4B3CA 4DCTA 4B43A 1S3GA 4KFRA 2GF0A 2V1UA 3LW8A 3UMRA 1PV4A 1M7BA 1WB9A 2O8DB 1AS2A 1G9XA 2W0SA 1BH2A 2NZ8A 3GLGE 1VTKA 4PZZA 2FG5A 4CRWB 1HURA 4P3YA 1HE1C 4M21A 2HT1A 2G6BA 2Z4RA 4PZYA 4Q9JA 4AG5A 4M9ZA 4F4JA 2J3EA 3CRRA 1R0WA 3AVQA 4C7OA 4NTZA 3OF5A 3RNLA 4W9MC 2RGNC 2J1LA 4JLVA 1IY0A 1GRRA 1W4BA 2Q9CA 4Q66C 3W5JA 2WIBA 1KO5A 4OQMA 2RCNA 4CW7A 4DLSA 4MITA 1L4YA 3DPUA 5DN6A 2DFLA 2C9YA 1CJUC 3GJ4A 2YKGA 2DWOA 4B76A 5FOTA 3AVUA 5L3VA 3T12A 4FCVA 2ZXUA 1ZD9A 5JECA 2ZR7A 4MDEA 4EAQA 1WE2A 4AKEA 1BIFA 1OFHA 4C2TA 1GZSA 1ELOA 3OFND 3W3AA 2BBOA 4LYAA 4ZIRB 3PITA 1N5IA 4BLRA 3IEVA 3TAHA 5DYGA 1YZGA 1P2SA 4HDCA 2GF9A 1Q20A 4JLNA 2KJQA 5FOUA 2R8RA 1E0JA 2CHVA 1J70A 1R0XA 1RYFA 2GRJA 2OFOA 4HDOB 4KCGA 5A5GA 4F91B 3CWQA 1XEWX 2G1KA 2IYSA 2B7CA 2OXCA 2Q9BA 4HEJA 1R10A 2PT7A 1OIXA 1P2VA 1VYVA 3ND8A 4JJZA 4Q9KA 4BFSA 1TX4B 1HT2E 1U98A 3DOFA 3TMKA 3RWMB 4CDGA 1UDWA 3W9YA 2X2EA 4IW3B 3U44B 1G6HA 1NVXQ 4I4LA 4MYHA 5EXPA 2CXXA 1ESNA 1OFTA 2IK8A 4OHZA 4BPBA 2E87A 5JFGA 2XITA 3AEZA 1J8MF 1KIMA 3TJZA 1WBBA 1KY3A 4OHVA 3SYLA 4KSCA 4ZI3A 2ZYWX 3KJHA 4OBEA 3F0TA 1MH1A 5JS8A 3C41J 1G7CA 3QE0A 5FTMA 1G3MA 3EAQA 3EZ6A 4JIMA 2CL6X 1G7SA 2ZVPX 3JVUA 4A0FA 2PCLA 4BGDA 4JLJA 1TU3A 5DYIA 4PTLA 4TL9A 2QPTA 4LPKA 4B71A 5FL7D 4BRUA 1YRAA 3BFXA 5G3YA 2SHKA 3H84A 5C1BA 1OYYA 1A7JA 1IY2A 3RHFA 1W0JA 3HR7A 2VSOA 4UJ3A 5EE3A 1XMJA 3M0EA 3HDTA 1X1SA 4IFEA 1S4QA 3BH7A 1P6XA 1G64A 3GEEA 4G5RA 5FTLA 1XMVA 2ODNA 3DZ8A 1NBMA 3AKCA 3TQFA 5JI3E 4US0R 3Q7PA 2BDTA 2OE2A 4F7WA 5H68A 4JYCA 4PXAA 2GHIA 1KI2A 4BASA 5J4KA 3KUCA 3LW7A 1VDZA 2XTZA 2VH5R 1ZVQA 1ZM7A 3QVVA 1SXJB 4LHXA 3JVVA 4JLMA 5KSPA 4A0HA 3IO3A 2RHMA 3U3KA 1CIPA 2XJ4A 1Z6YA 3SE0A 2ZUDA 3LX8A 3N70A 1XTIA 4ITRC 1F2TA 2OLJA 2ZRLA 3T15A 4BLTA 1SHZA 4ESVA 5DIFA 3PR1A 1IXRC 5HCNA 2ZRPA 3NG1A 4HAUA 4A82A 2VP4A 4QGHA 4TYNA 1W4AA 4BFVA 5K8LA 5HE9A 1Z0AA 1OSNA 5L3RA 3REGA 2F7SA 2BKUA 1W44A 1M34E 3CPJB 3U7FB 4NYJQ 5BQ5A 4CEIB 1ETUA 1WMSA 1H65A 2VEDA 1AGPA 3VNUA 2BJVA 1XXHA 1XPRA 4K81B 4TT3D 3FYHA 3OAAA 2XEXA 5KTYA 1UKZA 5J4HA 2OAQ1 3L0SA 1G18A 4Q9LA 5IRCD 2V3CC 3QBTA 2YOFA 2XB4A 2Z43A 3AF4A 4LSGA 5KSZA 4BFXA 3KB1A 1OXXK 4TL7A 5EUMA 2CBZA 1Z6AA 3A1WA 5FOSA 4EJSB 2ZM5A 1TADA 4LHZA 5L3QA 3CX7A 1VKJA 3C5HA 2BBTA 1YR7A 3LLMA 4QBFA 5TXGA 5F3WB 2GJ9A 2QMHA 3SJAA 3ZZTA 2FGKA 4XVRA 4YLGA 1D6JA 5FPYA 3CO5A 3A1VA 1W4RA 4U02A 1E0SA 1KK2A 1U8AA 1XP8A 5TVKA 1JR3E 1WCV1 3LNCA 3NC0C 3REFA 5LPNA 4Z54A 3KKQA 2EWWA 2IEYA 1G17A 4BEJA 5KSYA 2HCJB 5JJKA 1HYQA 1XCMA 1ZUHA 4IOKA 3R9IA 2OBNA 1M1YE 2ZE7A 4QOSA 5EE1A 2QL6A 1KMHB 2ZRFA 2GEDA 1QG4A 1ZYUA 1XD2B 4AKGA 2I1VB 3LQQA 3EPLA 4L4UA 3NBFA 1CEEA 1N6PA 4GOXA 4LBWA 1H8HD 3SN6A 5ANRB 3RS5A 1QHXA 3EW9A 2UZ3A 3QF7A 4I81A 4RFSA 3E70C 4XJXA 3ZGXA 4JLDA 1W46A 4ZIRA 2D7CA 1Z6GA 4TSFD 1MABA 2RB4A 4DLTA 5BN4A 1CRQA 2A5FA 2F3RA 1GL7A 2IYTA 5DI3B 3IHWA 5BW8A 5J4LA 1TTTA 1KDPA 2YWEA 4X8MA 1VCIA 2VHTA 3QPVA 2R62A 5CIQA 2IYQA 2WZQA 4FCWA 1NF3A 1OW3B 4YC7A 2FJUA 2HT6A 1G19A 3EPHA 3I62A 3Q5DA 3NBZC 1R5NA 3BWDD 4NH0A 2AXPA 2QAGB 3ASYA 4LJ5A 2ZPTX 1UFQA 1KJWA 2ZRNA 3LFUA 4RCZA 1MOZA 3UMFA 4B2PA 4DUGA 1JJVA 2JAQA 3AM1A 3LBIA 2BWJA 1TMKA 4OHWA 3FHCB 4LHWA 5KYKA 5C46F 4BFWA 4DDUA 3MUFA 1PLLA 1Z07A 1W7AA 1SXJD 2O0KA 4B6EA 4DLUA 3TVDA 1N5KA 3QXCA 4TL6A 2G0NA 3K0FA 2P6UA 4HLQB 2EFCB 2D3WA 4A6PA 3V4FA 1NN1A 1CULC 2IYVA 4XWKA 4PO1A 1KI6B 1NKTA 3T06B 1JB1A 3H86A 3LWNA 5JI2E 821PA 2IYYA 3CM0A 2ZRBA 1OB2A 3RWOA 3I32A 3ZZUA 4A2WA 2NIPA 2J41A 2QENA 3CX8A 1P5ZB 4O2LA 1NSFA 2J7PD 2BMDA 3THYA 3AVTA 2ORIA 2RGCA 3MMPA 4PC2A 1DAGA 3NDBB 4A1FA 2QROA 1DPFA 1F48A 2F1JA 2RGAA 4QBHA 3IIJA 2FV8A 3DZDA 1XCPA 2R44A 2YWFA 3QKSA 2GJSA 1IN6A 4PHFA 2AL7A 3HR8A 3V00A 3PUVA 3VNVA 4LJ7A 1UKYA 4PC7A 3KQNA 4C7OB 3EPJA 1G7TA 2HYIC 4DVGA 4Q19A 4AYXA 3QVUA 1DOAA 4P4SA 3RYTC 1KYIA 3B85A 3QEOA 5KSOA 3QJYA 3DVLA 1JBKA 1HQCA 1G3QA 1WDTA 5TMPA 3ETLA 2ZI6A 4NONA 4EQ6B 3R9XA 1UKEA 2ZRCA 2C99A 4TMZA 1P73A 3U61B 1RJ9B 1T6NA 3HYTA 2OILA 2VP9A 3SBDA 3PXGA 2CNWA 1RVDA 5C4GB 5UKDA 3EARA 2ODWA 2X19A 2RHDA 2IWRA 5AUPB 1UBEA 1RJ9A 2QE7D 2JDIA 4GSYA 4TLEA 5HZHA 2IS2A 2ZJOA 1G291 4A8JC 4FINA 4C0QC 1NMXA 2ASEA 3NBXX 2EWVA 2Y8EA 4M2LA 1TQ2A 2PEZA 3CR7A 3BB3A 2PT5A 4Z1MD 4LJAA 1AGRA 1Q12A 1ZUNB 3IDQA 2WSMA 4PANA 2EQBA 1JJ7A 3RC3A 5E7JA 2RGEA 4Q5IA 4DSTA 2QAGA 2EW1A 2NTYC 2PZEA 2GZHA 3FGNA 4NYJR 4YMWA 1E94E 1J99A 1PZNA 1MO6A 1R7RA 1VCOA 2XZPA 3GLFA 2CE7A 1W2GA 2R6CA 1HUQA 2RGXA 4R2HA 2QP4A 3K70D 2IS6A 3RABA 4D0NA 1JQLB 1MV5A 4PQFA 2NPIA 1E6CA 2ANBA 4JLOA 2OAP1 1MO4A 2IXGA 1FQKA 2KB0A 3A37A 2QMEA 2QSYA 1P60A 4F38A 1XZQA 2DB3A 2G1JA 5FTKA 1BS1A 2R6AA 1OLOA 4PFSA 1LTQA 1SZPA 2WJVA 4KYUA 1E98A 5DI9A 2QG6A 1P62B 1XEWY 3I73A 2QM7A 2YC2C 3X1XA 2A5JA 1US8A 4PSVA 2BBWA 3NIBA 5FBWB 3EZ2A 1OV4A 4Q03A 2BMFA 5D3MA 2OCBA 2ORVA 2A2ZA 4HAZA 4ON9A 5E3HA 4IOJA 3QF4B 1VMAA 1IQPA 4NU0A 4L5BA 2HCBA 2ZTSA 1BMFD 1DAMA 4DHEA 1G8GA 1S96A 2BBSA 1W5TA 5CJ2A 5J5CA 4HAYA 2G88A 1KMQA 5A4JA 1U9IA 3QKTA 2WAXA 2ZS8A 3ZIAA 4F4IA 5FR1A 1EWRA 3GJ5A 1W36D 2V7QD 5SZIA 3DL0A 4TTRA 1RKBA 2FN4A 3CKLA 2NO9A 1LFDB 3HU2A 3U7EB 2P6RA 1JPNA 1UADA 2G3YA 2VP0A 2GCOB 1DO0A 1GWNA 2DCUA 2BC9A 4EDHA 1S9HA 4S35A 2QAGC 4MA4A 1TF7A 1RRFA 3K70B 1IXSB 2WBLC 1FQJA 5FBLB 3WRXC 1RRCA 5B58C 3L43A 2WWXA 4D4KA 5FPKA 4Q4JA 5EP1A 2IF2A 2C98A 4DLVA 3U3MA 4PHGA 1NY5A 2G0TA 4LC0A 1QHGA 1UBCA 1U8YA 5GVSA 1N5JA 3E1SA 3NVAA 2J45A 4J0QA 3EG5A 1US8B 1F60A 2H17A 3FHTA 1XXHB 2ZR0A 1DBSA 3G82C 4DLXA 1LF0A 4JLPA 3ONWA 4M1YA 3CZQA 4IDOA 2O8EB 2R2AA 4MGKR 4AYWA 4M9SA 1IHUA 1ZAKA 1OXVA 1ZM2A 2QNRA 2YWHA 1GRNA 2VRWA 4IEEA 2R6GA 1KI6A 5GJCA 5A0FA 5KHOC 2Q3MA 2IX3A 3KJIA 2FZLA 5G3ZA 5AUOB 5EXSA 3ZJYA 2ECKA 2J0VA 1E9RA 3NKVA 4EPWA 2D74A 2I1QA 1G8YA 1XD9A 1I2MA 1NN3A 3KKMA 4C0AC 3T5DA 2JJ2A 2NG1A 1U0HC 2H57A 4URWR 2MSCB 2ZSAA 4TTPA 1DE0A 2ZS7A 3AVOA 1Q1ZA 2O8BB 5EJEA 5KNDA 2BHRA 3R20A 1KJYA 1R8SA 2DWPA 3KJEA 4LBZA 2IUUA 4KFUA 1OHHA 2JLRA 3LA6A 3U44A 3K53A 3ND9A 4P31A 1WXQA 1I2DA 3WNDA 1NG1A 1KSHA 3LXXA 4K46A 4KV9A 3JZMA 2OCAA 5DN6D 4OI0A 4ABYA 1U0LA 3DM9B 2C2HA 5JEDA 1KI8A 4KXFB 4C0SA 4L15A 3ICQB 2PH1A 3SOPA 2QQ0A 5C18A 1R0YA 2GCPA 3MWLA 5FBRB 2EVWX 1E2PA 2FNAA 5LD2B 1VYTA 3RANA 5HCIA 1E2MA 1Z47A 1GILA 2D2FA 1XWIA 1E4YA 4JT4A 4CEIA 1TU4A 2O8EA 4D2IA 1UM8A 2XX3A 1XTJA 4IXNA 3C4JA 4TMXA 4YMSA 3LY5A 3ZH9B 2GJKA 2C95A 3ZS8A 3LRPA 3W5IA 5FUVA 2AD5A 2WMNB 3F3YA 1G5PA 2A7QA 4UJ5A 3BD9A 1YQTA 4CGZA 2VPPA 4IFBA 1E79D 1JQJC 2PMKA 5KPJA 2ZYTX 3THWA 1O87A 2QI9C 3AUXA 4NZYA 1HEIA 2VHJA 5KDDA 5AJZA 1NRJB 2AN9A 1T5LA 3VX3A 4Q7MB 2A30A 1ANKA 2VHUA 3O8BA 4NL4H 1NI3A 4NYMQ 2GAOA 3MWJA 2IS1A 4HATA 3MG9A 1CS4C 3CR8A 5FBVB 3OEED 4OHXA 1GOTA 4R2IA 2J0SA 1N5LA 4QJ3A 1P2TA 1P4SA 3AF2A 1E1RD 4TMKA 1U0JA 2YINC 3VHXA 1Z0JA 5KDOA 4LRWA 5JZVA 2OLKA 3DMDA 4IDQA 3U3RA 4W5HA 4ZDIA 5L3SA 3UIEA 2D2EA 5SZJA 1KKLA 1C1YA 4OK5A 2OFWA 4GBMA 4ZKEA 2B21A 1FP6A 1SKYE 2ZSFA 1EWQA 1AN0A 2XNDD 3SYKA 4HSEA 3CX6A 2QQEA 4F92B 1XEFA 2MMCA 4EPXA 2ZUBA 1Q3HA 4DEXA 3THOA 1NSTA 4DDVA 4ACBA 2FFBA 5D3MB 4XOIA 1L4UA 3VU9B 5DO9A 1OHHD 1J7KA 1HTWA 1OJLA 3ADBA 4MGZR 4HZIA 5EXXA 5FBQB 2WJIA 3TKLA 4BLOA 1XZPA 4CEJA 3U6BA 1IM2A 2VBCA 1Z6XA 2ANCA 3Q72A 5JHHB 4W7SA 5BWMA 3QXXA 5AJXA 3UG7A 1G20E 2ZEJA 4KFTA 3I5XA 3PEUA 2FU5C 1C9KA 3RS4A 2QRNA 3K0CC 2BEJA 4JLBA 4U5XA 2GCOA 4U00A 1T5IA 2WAYA 4M22A 1MO3A 2E1RA 3GJ6A 4M1SA 1FNNA 1AS0A 5B57C 4AURA 1FTNA 2GZDA 1P72A 3IIKA 4XTRA 2PLRA 2ZJ8A 1E96A 5EE5B 3PIRA 1HQYE 3G5UA 1F3OA 1NP6A 2AKAB 4L16A 2CHGA 3TIFA 3U7GA 2PMDA 1COWA 1S3SA 4CEHA 1TEXA 3KQLA 1N6IA 5TY0A 1B0UA 3IO5A 3T1VA 4QKQA 5DISB 2WHXA 4KFSA 4RD3A 1JECA 3HU3A 1OIVA 5G40A 4CZ2A 5KNCA 4DB2A 5C2JB 5B2ZA 5FL3A 2DFTA 1EFRA 5JJIA 2Q6TA 1NKSA 4WXRA 3VKHA 1E2DA 3RS3A 3BC1A 3K09C 3MJRA 4N0EA 3X1DA 3HPRA 1XFAA 3FKSA 4P32A 4TMTA 3L0IB 4JBXA 2XZLA 3R7WB 4DIDA 2GXQA 5J47A 4B73A 2QTHA 2VQSA 3ASZA 1UEIA 2FWRA 2ZRMA 1GVNB 2A3RA 3IQXA 1ZU5A 1SVOA 5GJBA 5TB5A 4QNMA 4RZXA 1E9FA 3GLFB 4TYQA 2ZJYA 4P4SB 4BQSA 4NCNA 1UJ2A 1SQ5A 1WA5A 1P7CA 2ZI3A 2IYWA 3E2IA 1J2JA 3FKQA 5L3QB 5ELXA 5E7MA 2WJJA 1KSGA 4HLCA 3WMGA 1W36B 2JLWA 4IDPA 1G21E 5FI0B 1OH6A 2F43B 3U6KA 1OH8A 1E4VA 2ZRJA 3W90A 1OT3A 4Q7LA 2BM0A 2GAAA 4GOJA 1KNXA 2ODEA 5CIWA 3C5CA 3GJ3A 3WBJA 1M7HA 4KITB 2QORA 1E9EA 3TLXA 1KGDA 1XTRA 3H0KA 1E9CA 2Z83A 4PAOA 3BERA 2EFDB 4JLKA 1T0HB 1W1WA 1T8UA 1Q0UA 1G4UR 3GEHA 5HR5A 5CLQA 4URXR 1W48A 2ZSEA 3QXSA 4LJ9A 121PA 4WZAE 3AVXA 1VG0B 3GQBA 3LH5A 5FR2A 1R2QA 2WPDA 4JLAA 1NMYA 2H8KA 3BRWD 4JL6A 1D9XA 1DELA 4EFLA 4B6FA 2WSSA 4YXWA 4AK9A 2ZRIA 3AP1A 3OIYA 3X2SA 3WYAA 2XOKD 4HYYA 3L2OB 3GFPA 3K0SA 3PEWA 2J7KA 2QAJA 4R98A 3FKSD 4OYHA 1N0WA 1W2HA 2WWGA 1J8YF 2N42A 1TF2A 2O0HA 3K9NA 5M04A 2FPMA 2QP3A 3KFXA 4TWZA 1GITA 1ZD1A 1ZM3A 4UKDA 1H8ED 1Y63A 2CDNA 3VTKA 3BAFA 3SS8A 2VIIA 3IHLA 2CJWA 1XRJA 4NYIQ 2ONKA 1O3YA 3EXAA 2QM8A 5FOWA 2AD1A 1GKUB 2JATA 1U94A 4V0KA 1KZGB 2XSZD 1N2CE 2D62A 3IKJA 2V4ZA 3PVSA 4CYMA 2XXAB 1CKEA 1F6BA 2FE4A 2OCYC 1EFUA 1Q1EA 2JEOA 1QVAA 4EPYA 4D0GA 4QC2A 4RD1A 4K8OA 5TARA 1W49A 2IXFA 1QBKC 4URUR 1Q44A 2AWOA 1GP2A 2QE7A 5FUXA 2JDID 2AK3A 3VMFA 5AUNB 3ADDA 4EPRA 4GT1A 1TEVA 2QT0A 4C0KA 2PJRA 3BB1A 3ADCA 3ECCA 1SVIA 3FHOA 2ZI5A 1E2JA 1QZXA 2F6RA 2Q9AA 3C8UA 4AKHA 5AUQA 3AP3A 4Q7KA 2PEYA 1R6BX 4OI1A 3T1QA 1FOEB 2ZRHA 3BGWA 2V54A 4B44A 1G8PA 2QY9A 5FFMA 4BECA 3O8DA 1M2OB 3AB3A 4B3XA 2IWHA 3W8RA 3SU8A 2GXUA 1FUUA 1VHTA 1NVUQ 2FGJA 4A9AA 3HU1A 4ZDJA 2PZGA 4BLQA 2F9MA 2QPOA 3TE6A 3CIOA 2GXSA 1NLYA 4OI4A 4FCTA 2BMEA 4FI3C 2ZU6A 4LOAA 5JS7A 3NXSA 2B7BA 2XZOA 5LDDC 1E1QA 3GJXC 1Z06A 5JSZB 3GFTA 1FPMA 1SKQA 4TT3A 2W6ID 1PUJA 2X77A 3QG1A 4G01B 4PPGA 4FMDF 1SKYB 2CCGA 5FTNA 2KE5A 1E69A 1X86B 1XNJA 3ZVNA 4TN1A 1LY1A 3BK7A 3KTAB 4Q18A 1KAGA 1VPLA 2FZ4A 4MKGA 3WHLA 1KTVA 4FMCB 1E2KA 1DAHA 3QUSA 2WJHA 3AKEA 2A9KA 5JBQA 1UPTA 4PAQA 4TLBA 2NPFA 2C03A 1UAAA 3B8HA 4AIIA 2CLDX 4E07A 2BIFA 4AG6A 2E9SA 1S2MA 3DM5A 4LJYA 4RD4A 2F1IA 1RPZA 2JLYA 4XH9B 2WSSD 2JLQA 4GP6A 4YXWD 4RSGA 4A0RA 3A6PC 1YZUA 1QHSA 3BH6A 1XJ0A 1ZIPA 3HPQA 5DSZA 2B92A 4LJ4A 2P3SA 3NEYA 4N1AA 1U9IC 3K8YA 1GTVA 4TMWA 4G3XA 1OE0A 3QKRB 3F5FA 4PZLA 5D3QA 4Z1MA 4B2IA 1D2EA 4HB4A 1NN0A 221PA 2UVQA 3R9WA 1NJFA 2QTFA 1TQDA 1TQ4A 2WWIA 3E5HA 3VR3A 1KK0A 1ZC3A 2QT1A 4MRRA 1JXOA 1Z83A 3KXIA 1G5TA 2FEMA 2ZRDA 5AJWA 2H16A 4DJTA 4DWJA 2JLUA 3O8RA 2ZU0C 4HUQB 4KLZA 3SBEA 2W6IA 1OYWA 3W8NA 4HZUA 3ZIAD 4NCKA 1N6RA 3PQCA 2DPXA 3UATA 3W34A 1PUIA 2F3TA 3A1SA 1F5NA 3GLHA 2ZE8A 4RZUA 2F43A 1KDRA 4RKEA 2QUZA 1F2UA 1KDOA 3BB4A 3RRYA 2CCJA 4Q00A 2REBA 2GBLA 2JGNA 3CNNA 2V55B 1FFHA 5J40A 4Q1BA 4Q4LA 4IVRA 4ESHA 3RC8A 5DLQC 3AVWA 3PG5A 4LY6A 1NNEA 2D4HA 3WRYC 4GMDA 3SHFA 3TSWA 2F55A 1X6VA 2HYDA 3K0AB 3MD0A 3I5YA 1Z5ZA 3IPYA 3HP1A 4FXPA 3H1TA 3AV0B 3CONA 3CH5A 4JYBA 5HKKA 3VQTA 4ARZA 4BZXA 2O8CB 2IYUA 2OM2A 2CVFA 4JVMA 3KKOA 4D4MA 1MABB 2GZAA 2HDNB 4MYUA 3B9QA 3I3SR 3L0OA 1CR1A 2PX0A 3NH9A 4FWTA 4B34A 4C4PA 3WP0A 4RY2A 2LWIA 1YR8A 1E2LA 2Q3FA 4QRHA 4TQ9A 4TQUS 2GXAA 1RRGA 2ZYUX 1G3IA 1II0A 1W4CA 4RD2A 3ZLJA 2D06A 4DBLC 3B6EA 1N6LA 1QHIA 1ZMXA 4UXIA 4POAA 5JEEA 2ZITA 3A1TA 3ZS9A 1JAHA 2BEKA 1Z63A 1NBMD 4A2PA 3VKGA 1VG9B 4US1R 2CHQA 1XTQA 2FSHA 2GBLC 2P67A 3QF4A 4W5WA 1AZTA 3T61A 3WNBA 3K0FB 2IL1A 4CVNA 2Z0MA 4XD7D 2OZEA 1KK1A 2V8OA 4MKHA 4QJ4A 4R9UC 3PEVA 3P4XA 4LI0A 3QBVA 1K5DA 4LV6A 3SFZA 4EKDA 4XSHA 2ZE6A 1X8LA 1N6KA 4LPSA 2YHSA 2B6HA 4ZKDA 4B35A 5AJVB 3LDAA 3OEHA 3CRQA 4G5QA 3KQUA 3T35A 5IHPA 2F1RA 1ZIOA 3NH6A 3QKSB 4HAXA 1NLFA 3I72A 1GIAA 1QDEA 1M6NA 3BOSA 2I3BA 1IY1A 1T8TA 1T4GA 1WP9A 1II8B 2BCGY 4GNKA 2LKCA 4QHSA 2B8TA 2W2XA 2GTPA 2WJYA 5GADl 4Q48A 4B3DA 4LV8B 3MCAA 2XNSA 4CT5A 4LYFA 2YYZA 1GSIA 3GMTA 3M1IA 1CF4A 1JPJA 1W0KA 2IEZA 2CK3D 4BFYA 5EQTA 4YQFA 2HLDA 3I8XA 1KSJA 1CTQA 1NLZA 2ZJBA 4GZLA 4TLCA 1CXZA 4TLAA 1IOZA 5LB4A 3TUZC 2BMJA 1RRPA 4ZO4A 2FFAA 2Q21A 2VHCA 5CJPA 2P2LA 2ZI7A 5DHFA 2FDCA 2RGGA 4C0LA 2ZYVX 3Q85A 4HUQA 4IJMA 2J87A 5JSZA 4UXHA 3IIMA 3GCGA 3RAPR 3THXB 2VSFA 8OHMA 2VSXA 4P0TA 3IGFA 1EG7A 5E95A 3PENA 2VLIA 4H1VA 4PPNA 1LNZA 3BXZA 4LYJA 2IUSA 4M4SA 2ZUCA 4O0MA 1P9NA 2W2VA 4QXAA 2V1XA 2CLSA 3EZ9A 3MFYA 1R5BA 3FMIA 3IQWA 2Q3HA 2O0JA 2OHFA 3K0CA 1WF3A 3K9LA 4JVLA 4QM7A 1M7GA 2AXNA 3CH4B 3N2EA 4OJQA 5DH9A 5FOXA 3QXJA 4EJSA 5JWHA 4LX0A 2O8BA 3TQCA 3X1YA 1ZNYA 4I1VA 2WICA 4CEJB 4WW0A 4YDSA 3THWB 1RFLA 4RZ2A 1OB5A 4CIDA 1V43A 1LF5A 1JEDA 1MKYA 1E32A 1WQ1R 2R9VA 1AS3A 4OQXA 1QHHA 4XVQA 2ZANA 3FMFA 2XGJA 4G0NA 1V5WA 3CZPA 4WA7A 1FW6A 2GNOA 1M74A 3A58B 3CRMA 1KO7A 5F9FA 1MO5A 1E1RA 3GLHB 3VAAA 1A2KC 1SVWA 5G53C 5K8TA 2N46A 4M1WA 3I8SA 4QM6A 1F2UB 3PUZA 4QG7A 1OFIA 3KQHA 4Q9IA 4KYIB 5EE9A 3P1JA 1CP2A 4FWIB 1AK2A 3TSOA 1AA9A 2XNDA 5TDHA 5FPTA 1EX7A 3U3JA 1JR3A 4RJLA 4ZI2A 2WM9B 4QNRA 1KMHA 4DZZA 3CNLA 1KSFX 5CM9C 1ZCBA 3R8CA 4JVNA 1XD2A 3M4YA 4TYYA 5F9HA 3N2IA 4HAVA 2ZQ5A 3RRMA 1EFCA 4GDFA 3SJCA 3CF6R 3K09A 1Z2CA 1S1CA 2P6NA 4A15A 1U81A 1Z0DA 1E0AA 4MH0R 5CYOA 4M1OA 4MRPA 4BZPA 4OK3A 5HE8A 4QBIA 4Q1FA 4M9QA 2J46A 3LAWA 1EGAA 2QZ4A 3GLFE 1AJEA 1P75A 2CCKA 1M8PA 1JXMA 1HV8A 3CRVA 3NTUA 5CLLA 4WZ6A 3ZZ0A 3ZYCA 1CRPA 4MYTA 4Q21A 3ZDQA 4EPVA 1LB1B 5IK2D 2J9RA 2W0MA 2GVZC 4OQLA 5K8IA 1QVRA 4ZPXA 1XEXB 2DWQA 1BOFA 4U7DA 1ZRHA 3DMNA 3FOZA 3EIEA 3VR6A 1W5SA 2JLSA 2IW3A 1CR2A 1ZINA 3KX2A 1E2FA 1KI1A 1YZTA 2H18A 1G8FA 3LV8A 2FPLA 4GP7A 1YZKA 1G3UA 3DHWC 1L8QA 3P20A 4EFNA 1SVLA 2ZI9A 1JEEA 3C16C 4URYR 2JA1A 3B60A 4BRWA 1U99A 3EZFA 3LBHA 4A2QA 5DNYB 1KZ7B 2AK2A 3P27A 2KBFA 1T91A 1KI7A 3RSOA 1N6OA 1NJGA 4B33A 4PC6A 5J4VA 4V0LA 3QPWA 4S2EA 1FX0A 2PZFA 4IRUB 4Q9HA 3ZVMA 3CLVA 3U3OA 1N25A 3AKYA 1G6OA 4AI6A 2DYKA 1D8TA 1UBFA 3UANA 3VR4A 4CF7A 4A4DA 2PBRA 2R6FA 4WVFA 3SR0A 3ZQ6A 1KDTA 1W0JD 2O8DA 1ZW6A 1E9BA 2C78A 4Q7JB 5BYJA 4DCVA 4LDJA 1QHYA 2XAUA 1CR0A 3Q9LA 4B3BA 4V0ME 3UG6A 1S9DA 2ERYA 2FOLA 1YU9A 5KO2A 1HH4A 4H9GA 1TL7C 2XSZA 4PHHA 3WYFA 2WWYA 2REOA 4Q02A 1BKDR 3RVBA 3S1AA 4DCSA 2J7PA 4KAXA 4TZ6A 3SFVA 4YDHB 3A4MA 4OQNA 3VR5A 2A5YB 721PA 1Q1BA 3W6OA 2JJ1D 4DLRA 2WKPA 1AKEA 2ONJA 3FPAA 1X3SA 2FMXA 1XJCA 3GEIA 3GJ8A 2O8FA 1S8FA 2V9PA 3AUYA 4AYTA 2FX3A 5H70A 1Z3IX 5DE3A 2V6IA 2CNWD 621PA 2GEUA 4UQOA 3BBPA 4TMVA 4F93B 4FMCF 1ONBA 5BN3A 1E2NA 2OESA 4XIGS 1DAIA 1HE8B 2QA5A 4JBYA 1TUIA 3R7WA 3EC2A 4IHQA 3NC1C 4FN5A 1QF9A 421PA 4BWYA 3KL4A 1XCGB 4C0BA 4JJKA 3MWYW 4MQBA 2W2TA 4D25A 2MSEB 4WOPA 2DY1A 3WY9A 1XD8A 4Z8YA 5KUTA 2C04A 2IYRA 1EK0A 2GJAA 4M53A 3P4YA 4EUNA 4MUAA 4LZZA 4C0JA 4A36A 4ERNA 1NMZA 4MGIR 5E4FA 3AVYA 4M1KA 2G9NA 1RE0A 2MMGA 3QG5A 4NCHA 2I4IA 1FTSA 3GLIE 4TZ0A 1XMIA 2RGDA 4DSOA 3U4QA 2OT3B 1S0UA 1U8ZA 5F98A 2JLVA 1CLUA 4QGGA 2HXYA 5DGXA 2GWHA 5JLJA 2QBYB 3EA0A 2A78A 2DFKB 3H2YA 2ATXA 4TSFA 3RRNA 2BKEA 3QSYA 5GJVC 2F9LA 3TBKA 4NDZA 2IUTA 1AM4D 1J90A 3A4LA 4V02A 4D4LA 1GNQA 3EPKA 1TAGA 4MRVA 4IOMA 2RGBA 1Z28A 4P33A 4E5UA 3SYNA 4E22A 1AQUA 4D80A 2X8AA 4OK6A 1G41A 1VCNA 4PSAA 2IHYA 2EFGA 1AIPA 4A6XA 2Z4SA 3DOEA 3EC1A 1T9HA 1AQYA 1XF9A 4ILEA 1VCMA 3MRSA 2YWGA 2WMOB 1N0UA 3K0AA 5HPYB 1E1QD 4X8OA 2JIZD 2X1VA 4HB2A 4O3MA 5IT5A 4FMBB 1RIFA 3Q7QA 4JKYA 1E9SA 1ZNXA 1A5TA 1ZNZA 5JHGB 3GLGA 2J0QA 3CWZA 3VU9A 4PO9A 4XVUA 1E9AA 3T1OA 1A1VA 2WWHA 2GK7A 1TUEA 3Q5EA 4B3GA 3B1ZA 3CPEA 3HYRA 3UKDA 2ZROA 1NVVR 1SVKA 2QGZA 3OESA 2OO7A 1COWD 3FMPB 3ZQJA 4PQYA 3AH8A 5KOYA 3TR5A 1S1MA 1CR4A 1CU1A 3KXLA 1GL6A 4Q1AA 3PJRA 2A5DA 1XU4A 4V0MA 1KK3A 4D4JA 4NYIR 2OEPA 3ZD7A 3D3QA 4ZCMA 4ASUD 3T5GA 4PO8A 1E2QA 5FPSA 1YRBA 4DUGD 1AZSC 4UXJA 2KSQA 4HLUA 3B78A 4I1UA 1ZBDA 3UPUA 2GDJA 2JJ2D 1L2TA 4EPTA 1XX6A 3OE7A 2XTMA 2JLXA 3QQ5A 3KDSE 1SXJE 3OZXA 4Q1EA 4RKFA 2IC5A 1E0KA 1SXJC 4PHTA 2VP5A 2REXB 1K8RA 4W5JA 4QGAA 3I4LA 3GD7A 2YOGA 3FB4A 1XDBA 1G16A 1KO1A 4ACAA 1P9RA 1LVGA 2GK6A 3RLFA 1ODFA 5H8WA 5AWFC 4PSKA 2NGRA 3QNUA 1ZJ6A 4D0LB 4GZMA 2IS4A 1OH5A 2PX3A 3PFIA 2QRZA 1P61B 2H5EA 2FA9A 1JI0A 3LD9A 4M0LA 5EXTA 2H1LA 2D7DA 5KPDA 3NDPA 4II7A 1XPUA 3A8TA 1PLKA 4D82A 1G5RA 2W00A 1YZNA 4PAMA 4LHYA 3WYGA 4Q01A 4UNQA 1FMJA 1R0ZA 4BLPA 3EA5A 2RKOA 4IDNA 4AD8A 3TSZA 3B1YA 3U60B 4Y0VA 3SJBA 4AY2A 5JRZA 3FTQA 4WBSA 1A2BA 4O25A 4ASUA 3C15C 1G3RA 5EZ5A 1GNPA 1NVWQ 3G0HA 4DC9A 4MKFA 3GPLA 1OXUA 4KI0A 3AVVA 5CK5A 4C9BA 4V0NA 2FPKA 3RRZA 3GP8A 4EQ6A 2P65A 4ZDKA 2CLCX 1EESA 4LV5B 1PJRA 1KO8A 3T1TA 2ZETA 1R4AA 4RZ3A 5JJLA 2G83A 3BH0A 1GG2A 3TH5A 3FVQA 4TLDA 3SJZA 3T34A 4Y0AA 3Q8XB 2IF0A 4N3NA 4PC1A 2KI5A 2VYFA 2W6JD 4WAUA 3DDCA 3QKRA 4UNNA 1ZC4A 3SHWA 1GL9B 1IAQA 2DR3A 4QHTA 2CE2X 2WIAA 3B2EA 2WKQA 1IJEA 1FL9A 2KWIA 4LHVA 5G41A 4KU4A 4BZQA 3GLGB 1G4AE 2OBLA 4GOKA 2JLZA 3QOFA 3W6PA 1R5OA 1GNRA 1G8HA 4XSGA 3MLEA 4XD7A 3LQRA 5SZKB 5CITA 1TF5A 3RDPA 4MRSA 1FUKA 1Z2AA 3ZVRA 3K70C 2GVDC 2YV5A 2WV9A 3K1JA 4I99A 4B48A 5K8UA 5FPHA 1RW4A 1OPXA 2ZRGA 4X8LA 2HJVA 4OKSA 3CB4A 2CL7X 3BIFA 3K9GA 2FSIA 3CW2A 5F2EA 3VHLB 2QEQA 3LX5A 1I4DD 2V7QA 4B2LA 2TMKA 1Y3AA 3GJ7A
chains in the Genus database with same CATH superfamily
2PL1A 3KUDA 4NNOA 3QPCA 2JAXA 1SVSA 4U63A 5ALUA 1ODLA 4IVQA 3GYBA 2GYYA 3G68A 3HXKA 5KJEA 3X2FA 1Z0IA 3PPIA 1Q57A 4QOGA 4NZ9A 1XG5A 5AKYA 2PWYA 1NVAA 1K2VN 3OIVA 2Q4RA 5IJ9A 2XTJA 3DYVA 3QLEA 4XR9A 2A0FA 3AKZA 1NI4A 1OWOA 4G1FA 3TNFA 2RFLA 2EG9A 1TQ6A 4CL8A 3ZBUA 2OGSA 4JQOA 4L8WB 3FAKA 2QR2A 3WIVA 3QEAZ 1PE0A 5LYJB 3SE0A 5L7TA 2QN7A 4QZVA 4HB0A 1SD5A 1H2HA 1JT2A 2NZ2A 1LRLA 2XIQA 4FYKA 1CJVC 2WWFA 1HY3A 3HKDB 1T0UA 4MYCA 5GOTA 3UJ9A 5AW2A 4HH0A 4PYIA 3C8DA 3GRPA 2C8VA 4BRSA 3HKEB 1EVEA 3A6HA 2PNJA 1IWOA 5TLSA 1UDXA 1MRSA 2YWCA 3EGWA 3HLTA 4HLUC 4OJTA 3UK1A 3B1VA 2E5WA 2P6OA 4AWXA 2SKEA 5M34A 1JI3A 1XEXA 1CETA 3JZDA 3L0YA 4Z4EA 2QU8A 2GCNA 3GFBA 4E3WA 5I9TA 1Z34A 2R47A 3BMQB 3F90A 3S1AB 2X41A 4R54A 4DV2B 1GT91 3MCVA 2AG0A 2GETA 1J1ZA 1RJGA 3EIQA 4NU6A 4PC3A 3P2JA 4B84A 3L8CA 1YB7A 4CQMB 4KXWA 5E9JA 3H5RA 1VLVA 1NIPA 3ZCXA 3NOQA 4HZUB 4NKRA 3V8QA 5AOBA 4GMXA 2VDQB 1B2LA 4F3NA 2XXAA 1J21A 1TFUA 2HFKA 3NQ41 1QF7A 2H4FA 3LT1A 3DHYA 1RQLA 3ENZA 1H93A 2C5LA 4PLFA 2NMVA 1NVVQ 3RSFA 2VAPA 4MYDA 2C4VA 4ESOA 4LF8B 5FPQA 4K2HA 2WSYB 5SYNA 4IY1A 5A6SA 4NOMA 4F3YA 2J5QA 5LJLA 1KO4A 1WPXA 2NZJA 4NV0A 1L4BA 3GFOA 3U4DA 1OKKD 1Q0SA 5KOHA 1ZP6A 3DZGA 4JSTA 1T0PA 4M1TA 3RIGA 3INTA 2ZJAA 5KYGA 3WL8A 4G0ZA 5IF9A 2H85A 2LGJA 2ZE5A 1ZGHA 2PMEA 3VDRA 4HMPA 3OIUA 5K6AC 1BVYF 2MSKA 4D7AA 5FUYA 4LRSB 3WLAA 4R9RA 4JJ4A 1YE3A 2YFHA 2I34A 2PWAA 3WWDA 1QHNA 1JIXA 4X93A 1K8XB 4P0PB 2ORWA 3FMOB 5I7FA 1Y6QA 1MVLA 3OHSX 4KJZA 2OHOA 1GA4A 1SHLA 3P9PA 4QUKA 1SGWA 3F5SA 3FOWA 1T3SA 1BJRE 1E6LA 1T36B 3BHIA 3IQEA 1X74A 4MB6A 3IHTA 4MQEA 1II8A 1MF7A 1EX1A 1W4LA 5G1OA 1PKXA 4JITA 3IA7A 7YASA 2TYSB 5HF6A 3UYKA 2ERXA 1NW6A 2R4UA 4Y2QA 3QUAA 5HUQA 3NWPA 1LSOA 4YACA 4C1NA 4E0BA 4RMNA 5H1YA 3UUEA 4DB4A 2NQ2C 3Q9UA 2BFBB 1U6IA 4HVTA 5E1BA 4CKBB 4AKIA 5JH7A 3VYSB 1X7HA 5CYGA 3RF6A 1G98A 3ZVLA 2CMFA 5CB4B 1NF8A 1ZW1A 1WZIA 3P5BA 4PZEA 3EH2A 3VSBA 3R3JA 2Q6VA 3LK6A 3MQ2A 1E79A 1JSRA 5I9IA 3KVRA 2G72A 3DUFA 1ZUIA 3O47A 1K08A 3FWPA 2WU0A 3BFJA 4YV2A 2G1UA 4G4SO 2JD1A 2NADA 5CLIA 4Z0TA 5GPBA 3RSGA 4IGIA 3DOJA 1TNDA 3KTAA 4GM1A 3QPUA 3I9KA 3BF7A 3KOYA 3AKDA 1CJKC 2VXOA 2DE0X 4XD2A 3WZMA 3ZHSA 6CHYA 4M9XA 3O8CA 1R8XA 1XTPA 4G4JA 3GLHE 4NBLA 3EQ2A 1T2VA 3R5SA 2C2YA 2VOEA 1BEEA 4ESEA 3W6NA 5EMJA 2IYZA 2FHPA 3M6AA 1D1TA 2AI2A 3A9TA 4PIVA 4MPTA 4QFCA 1OY1A 2FW1A 3EASA 4QBGB 4YRCA 4DPMA 1RRKA 4FDUA 1Q0TA 1B6GA 2DTDA 3HZHA 3W2TA 1Z8HA 4JJIA 4L8LA 4F84A 4A10A 1IPFA 1OTHA 2FEKA 4URHA 3HVUA 3QHQA 4B46A 4ZFNA 5LZ7A 1IK4A 1Q6ZA 3NDJA 4AXBA 4D9IA 2ZSDA 1FVOA 5MDHA 2MR5A 4OATA 1ZSYA 4I1OA 4HHEA 1RKUA 3EVFA 1ZN8A 4PPYA 4B32A 4TYMA 1OKKA 3SD7A 4CU2A 1OX4B 4DR1B 3DFFA 2IVZA 4Q9IA 1HEYA 2I4OA 3LVRE 3OC0A 5AHWA 1YR9A 3OF3A 5BN5A 2O8CA 3ESXA 4HDKB 5E9AA 5F52A 2PZKA 2PL3A 4RVCA 5AHXA 4BFZA 3TGPA 1SCKA 2JC3A 2VF8A 5ISMA 4O29A 3WDLA 1PQ4A 3AIOA 3NAGA 4FNOA 2QYTA 5DHAA 3OFJA 1C4XA 1DARA 1Z26A 3HVKA 3CCBA 3PC8A 3LHKA 1I4TD 4GPEA 1E58A 2V7PA 1NL3A 1LJ8A 1V96A 3GRKA 1RI3A 3AEKA 1QAQA 2FPGA 3L8DA 5A7GA 3ROEA 2ZBDA 1N4DA 1NJ1A 1YGPA 4RV4A 1PLJA 3W4KA 4DJEC 5CA0F 1NWCA 4DYDA 3GH1A 2FR8A 4O2BA 1DUIA 1L7OA 3ZWDA 5BNTA 3BK1A 1U5BB 2QYOA 3ANXA 4NG4A 3RF7A 5LWQA 1PD0A 2ZJ1A 1MA3A 3DKVA 4O4JB 3ZDXB 4E94A 5IC4A 1K66A 5LDHA 3NR2A 3PS9A 1DFIA 3K1YA 1EIWA 3J81A 5HIMA 2PT9A 1E2BA 4A03A 3O94A 3PLRA 3IP1A 1QV9A 5H82A 4DRXB 3SC3A 4I9NA 1WIWA 3Q4GA 4U9IS 5AVTA 5BQOA 2WFMA 2ZJZA 1X7WA 1FDSA 4B2YA 3VNBA 5A7FA 2AR7A 1IIRA 2Y1CA 3OHMA 2IXAA 1JR6A 1FSSA 4RZIA 2WJGA 4RZSA 1DG1G 1AZWA 3H3XA 3R5TA 5LXTF 3VR2A 1X7WB 2ZT7A 5FUWA 1Y9JA 1IIBA 1X0XA 4ETNA 1JG1A 3AUSA 1PQYA 1XN4A 4QA9A 3G0IA 4PIPA 3CNOA 1C4OA 1XK6A 3LO5A 3NORA 1TUGA 4W6QA 3ZHZA 1YK0A 4CTKA 4PYKA 2XUDA 4RE5A 5CDFA 4J07A 1ZHOA 5EJ4A 3EXEA 4I55B 2C8LA 3FRIA 1EK5A 1J8VA 1P2UA 1SXJA 4EYKA 4EDFA 1B23P 1A9OA 1FZQA 1WUHS 2HPZA 4C7XA 1AH2A 4WCFB 3SEAA 1KZ6A 3QEJA 2QPAA 4UNSA 4TX1A 4X8HA 5TF4A 2HMVA 1L7EA 1RC8A 2HU5A 1GG9A 1SXHA 2H48A 4X6XA 3ZY4A 3WHKA 3H2IA 2DPLA 1CV2A 1Z29A 3U3JA 1UPXA 1CJTC 2QDXA 2YICA 3DOOA 3AM5A 3VVLA 2B0JA 3UW1A 2V9CA 2WKSA 3OCYA 2WOOA 2C7RA 2YOHA 1BYIA 1TDJA 3RS7A 3GVCA 3KEMA 1SR8A 4QSMA 4X64B 1R3UA 5JR3A 3O8QB 1I6LA 2NO1A 2BFNA 4UEQA 1UDBA 1TD9A 2G77B 4S1PA 1KRHA 1LTHR 3VHQA 5LXTA 2X0NA 3U2QA 4EA6A 2C9MA 1ONNA 1ITZA 5ALPA 3OC6A 5K0EA 1VG8A 4J75A 1BS9A 4TV8F 3NMUF 4DAEA 1PZHA 4J7UA 4F72A 4QO7A 3OX3A 5A2GA 2WPDD 3QU5A 1VPVA 5HZMA 3U4QB 4IRMA 1E6UA 4Q4HA 5KYXB 3I9LA 3DHVA 2L42A 3HKBA 3O2JA 4EARA 1JHVA 2J9FB 1Z45A 2GNPA 1WD7A 1NBOA 5DTQA 1P2DA 3H5NA 4NMMA 4NYMR 4Z7OB 3R3HA 1T2NA 4I8DA 5FOVA 3TRFA 3EPPA 3RHTA 1ACLA 4D74A 4UZEA 3IBYA 3EEIA 2NSJA 1E63A 1ZH6A 4RIEA 3SYTA 2HRCA 4HQKA 1Z0KA 2YN4A 3MWKA 1C30A 2BI7A 2ZDHA 4KBYA 4YI3A 3FJOA 4W5OA 3BCRA 4DMLA 4BX8A 1EGQA 4N0DA 4YRKA 5HKKD 2G7ZA 3SEQA 5CM2Z 2YY5A 4EG8A 1EQUA 3HWSA 4QD3A 2EFHB 4PX5A 1I0ZA 3AG5A 1C7IA 1XZDA 1E5XA 1P1BA 1QTIA 4CMGA 2L17A 2ZR8A 3G5MA 1DX6A 1UKVY 1YDGA 2YYYA 1TK2A 3PWSA 2G1AA 3VU0A 4JKIA 1IN8A 1Z5VA 4TV8A 3T4PA 4CG2A 4I1YA 2O4UX 1QYWA 3Q0TA 2FRDC 1N9GB 2GILA 4OH7A 3TB4A 3ZK8A 3FPJA 1Z75A 3RBVA 3F4KA 3N8HA 3ZV5A 1XT6A 4PINA 4DJDC 1EXDA 1MT0A 3BA1A 4IIBA 1NBHA 4R84A 5ALNA 2VPQA 2A0YA 3D2CA 5SYAA 3IIIA 4CM6A 2CVPA 4LMPA 2XOKA 3NUGA 2VNKA 3K1TA 1V9CA 2Z56A 2ZSBA 1TK3A 2HZBA 2A1TS 2J09A 2JCSA 4R41A 2PCJA 4LXGA 3ZWQA 2R8YA 2OCIA 3FDZB 4ZAGA 5JSKA 5K0TA 1L7AA 2C2KA 1TJ4A 1T9AA 3BMQA 2X2FA 3UC9A 1BGVA 1XCBA 4U8GA 4CL3A 1VYHA 4L9SA 1X9GA 1JDUA 1TIPA 2BEUB 2OZLA 1A5ZA 4BO3A 4AY6A 3GNQA 4KE9A 2ZBRA 3O31A 4LC1A 4MR7A 4C6HA 2WF6A 2XDAA 3W5AA 3WBKA 1HT1E 2JJMA 5EFOA 4D8YA 3F2IA 1CUDA 3GN1A 3N5CA 4B45A 1D2MA 4UVGA 2NUPA 2Q8PA 2YJGA 2WD7A 3LLUA 4HH4A 3D7KA 4KODA 4LBYA 4BE7B 4DRZA 5K6TA 5AVRA 4DA7A 1YB5A 1JDPA 1G2OA 1FP1D 1N0HA 4N6GA 2WKRA 2HXGA 2IIQA 3A9RA 3BE4A 4QOEA 4EB8A 4UTPA 4PGFA 4DLWA 5CFNA 4BJHB 1NM5A 2H92A 3I92A 4F3KA 1CJCA 1YACA 2GZSA 1CY4A 1ZCZA 2A9OA 2PRKA 4G8JA 4QECA 3NT4A 2Q0HA 2WZBA 3IDOA 1CQWA 4G2TA 4UMFA 4E13A 3LQFA 1YL7A 1VDMA 3O1HB 3ZV4A 1H2YA 2XHEA 2O1WA 4DBVO 1PL8A 3IAAA 4U7HA 4E12A 3ME5A 1Q83A 3KVOA 2B8WA 3REQA 1N0VC 2ISCA 3Q7TA 4GRAA 3GOHA 4IJKA 4QPPA 3H11A 4GF5A 3FXAA 2ZDGA 2ZIXA 4LQ4A 2XI4A 4UQPA 2H7VA 3MT9A 3EEOA 5IDQA 3KXKA 4M3NA 4KBGA 1IHPA 2MSDB 4Y1RA 1H4SA 1KYWA 5ALTA 1BN6A 2AJDA 2JHCA 1X1DA 3TKAA 4E30A 4HUTA 1GZVA 3S2FA 3I05A 5DGCA 2HA7A 3JQFA 2H00A 1KH2A 4WOJA 5CK4A 3UAYA 3FFAA 6LDHA 3RKSA 4NE2A 4YRQA 3VTZA 1CSEE 3EWIA 2H4HA 3P4UA 3NKFA 3PCXA 4UMDA 1QUFA 3S8MA 2JFGA 4KQ9A 1C1DB 1GYQA 5E8JA 3U49A 3S2ZA 3C6QA 3L7OA 2VJYA 4TVKA 3KSBC 2OK7A 3IR5A 5FWXA 1QPZA 1TPZA 3N7TA 4MTCA 3R8FA 2H1CA 3PV0A 2ZJ5A 4MYSA 4NV3A 5TR9A 2JCXA 3KT8A 1O6BA 2IXEA 5EP4A 1QHHB 3VNAA 2PX5A 4K86A 3EJWA 3C14C 3IKMB 4Q4JB 4AZTA 2Q2QA 4ZEOA 3KV1A 5CM8B 1QG6A 4I50B 4FXOA 3GFFA 2PK3A 1Q0LA 1H0HA 2PSJA 2Q4DA 4OGKA 1F51E 4Q4AB 1I1HA 1D4OA 3WWEA 3JQBA 1UP7A 3D8BA 4KHZA 2YNMD 5AK3A 3GEBA 4FLFA 3CKYA 2OV6A 4CEHB 4PS0A 4TYWA 4AJ4A 3SLKA 2VP2A 4WZBE 1KH3A 1LS1A 4JJ6A 4BOYA 3I1YA 4JI0B 1U0FA 1DC3A 3GRZA 3ZJ5A 4BFTA 4B47A 4FR5A 1EFDN 3BIOA 4B0PA 4P22A 2XYPA 4FD2A 3R74A 2KBEA 1NMQA 3TM5A 3EIXA 4KK4A 3B9PA 3X1XA 3QKUA 5AK0A 1QDUA 1UANA 4REQB 4B3CA 2E2WA 1M2VB 4DR7B 1WDLA 3RK1A 1LD3A 1S3GA 2GF0A 4KFRA 2PWZA 4BQOA 2P1ZA 2O8DB 2AN4A 4RTSA 4NENB 2ISQA 1G9XA 5C8YA 2PLWA 4MRMB 3OCCA 1R9JA 4I8IA 3OZCA 3RARA 1VTKA 1UJ5A 3CVVA 4WKCA 1HURA 4J03A 2OVBA 4C4OA 4N03A 4AKTA 5CVDA 1SUPA 4H7DA 3ZE8A 5JNSA 1JDZA 4M9ZA 4GZ6A 3ICOA 2FSPA 2J3EA 1B7GO 4LXTA 4X90A 3VR6H 1AQ6A 1A97A 3CRRA 3OQMA 5A6VA 2HJSA 1PF7E 1A0OA 1KHHA 1LQUA 2RGNC 1JTFA 3WGUA 1IY0A 3I2HA 1V16A 4L5YA 3W5JA 2ZSUA 1VI5A 4OQMA 2RCNA 4CW7A 1R9MA 3MCZA 1C3OA 4HYTA 3NTXA 1MH9A 1DQNA 1V1RB 1VRVA 3ESDA 3DPUA 5EEHA 4EKYA 3GJ4A 2C9YA 4YXFA 2J9GA 5FOTA 5KAPA 6AT1A 3AVUA 1VSVA 1Y3DE 3RK0A 3GN2A 3FUUA 3D0QA 4UM9B 1G20A 1CUGA 3G5LA 4U9UA 1BIFA 1FCJA 3ILXA 4C2TA 1GZSA 4QYXA 4R2MA 4F8JA 3VHXB 3W3AA 4LW8A 1PGPA 1Y6JA 4PXYA 3ER8A 1JKXA 4BLRA 4UATA 3LDUA 4RVDA 4D5GA 3TEJA 3RODA 1YZGA 2DUNA 1WVMA 3OSUA 4HDCA 1UCFA 2I4MA 1W5AA 3H2KA 1FZTA 4X54A 4OV6B 4MAFA 1IULA 4EYEA 4JLNA 1YIDA 2KJQA 3DV0A 5AM3A 5FOUA 2R48A 3BWEA 1E0JA 1ORTA 1SRRA 4H7JA 5A5GA 5I51A 4HDOB 3RVSA 1U31A 1E20A 4AW9A 5JISA 2G1KA 3KYIB 2B7CA 5H4GA 4EZBA 4ABTA 4M0EA 4IV0A 1BE0A 2HQ1A 1VYVA 4N41A 3R6LA 3D54D 2EBFX 3ND8A 4JJZA 2DFPA 5KINB 1HT2E 3INYA 1Y9EA 4J8PA 1HG1A 1JHZA 1LDNA 2OZPA 1T3TA 2X2EA 1A4IA 2QM3A 3B20A 4DG5A 4IW3B 1YS7A 3II6X 4NFHA 5EWJB 3DBVO 4BX0A 4CKYA 5AW9A 4ZPJA 3WGLA 1AT1A 3ZNNA 3I4CA 1ZEMA 2NNWB 4BLWA 5DXAA 3W78A 4ZTUB 5JFGA 1S5PA 4AJPA 4R8RA 1RPTA 3AEZA 1J8MF 2VNHA 1NDQA 3D7NA 3UWMA 3PWKA 5BYAA 2G1PA 1BFDA 1NVDA 2FSVC 4KSCA 4EMUA 1YASA 3KJHA 4XGIA 3PKZA 2P11A 4G0VA 3UMYA 1ISMA 4RF5A 4R2WA 2A86A 3C41J 4XDZA 5AVKA 4BO8A 2JBHA 4JBNA 4BQFA 2YZ7A 3FMGA 1XUOA 1SURA 5HHTA 5GTDA 1G3MA 2GZ1A 3EAQA 3ORRA 2FWNA 1DUSA 2CL6X 3OLXA 4QVGA 3F78A 1I3KA 4RC9A 4ZV7A 5JAOA 4BGDA 1G1AA 1OXMA 4ARCA 5DYIA 3DKIA 4CETA 2O2XA 3PGVA 4BNVA 3L77A 4QM7A 5FL7D 1TRHA 2CF5A 4BRUA 4LRYA 3AESB 1H2WA 1PYOA 4FZVA 5G3YA 4AQYB 2OO5C 3H84A 3VYRB 4D9NA 1A7JA 3RHFA 2AOUB 2HA3A 1W0JA 5DM70 1GTRA 5FHQA 2GT1A 4DBLE 4Z53A 5EE3A 1JIJA 3RG8A 1GQ2A 4K6HA 2Y4OA 2QHXA 1PT6A 3GA5A 4QUIA 3KVVA 5ESDA 1KQNA 3GJRA 3BH7A 5KNCH 4AM8A 5J2UF 4KOEC 5KWIA 5U9CA 1TRKA 3DZ8A 2BR3A 3G5TA 1HFWA 1RLOA 1T8YA 3E1KA 3IOEA 1E3IA 2QUKA 4IDEA 4NABA 4AF8A 4D45A 4DJJA 2NYUA 4F7WA 3T3EA 5H68A 3YASA 3REQB 5LWHA 2D13A 1FFGA 1MB4A 4ISCA 4JX9A 4L3OA 5D00A 1U7XA 3GP5A 4OJYA 4NPAA 2VH5R 1RXEA 1V6SA 1EVIA 1ZVQA 3BXGA 4QUHA 3QVVA 1SXJB 4U7FA 5GM2A 1U8CB 2RHCA 1H4VB 3ABOB 3HBMA 3AILA 1RU3A 4RF2A 2WAAA 3VC1A 4A0HA 3PEEA 2RHMA 2Y66A 1O5OA 3U3KA 3UHFA 3ZV6A 4JV5B 1L4LA 3QVLA 3CEHA 3LX8A 3N70A 1E1DA 4DV4B 3UFBA 4ODIA 3T15A 5KIAA 3ID6C 1RZRD 2AW3A 1K7YA 9MHTA 4CM7A 3HY6A 3HZZA 4CKWB 5ESWA 1Y81A 3HACA 4BAUA 3OM0A 5F73A 3REGA 2J3HA 2EZUA 3LGAA 2C9DA 2NU9A 3NFRA 5THQA 1W44A 1M34E 2IX9A 2ZAGA 4Q15A 3V4LA 3U7FB 4BX9A 5FLKA 1EDZA 2YZKA 4G65A 1UK9A 1UODA 4W9RA 1FBNA 1WO8A 2UV8A 2PH5A 5DK6A 4GVLA 3Q3CA 5K09A 4KMSA 5DX0A 1CUIA 1XL0A 1PVDA 4OHMA 3VO2A 1QGUB 1XPRA 3AF5A 2XEXA 2Z95A 1UKZA 2ECQA 2ZYDA 2EBUA 4MWOA 5CH3A 2KLBA 2J6CA 3OIFA 4MB2A 2CFTA 1G18A 5EMHA 5IAKA 3V6LA 4HDSB 3MMXA 4FFWA 5IRCD 3TO5A 1F8UA 4LGCA 4DARA 2YOFA 2XB4A 2CNBA 5ITZA 1EXWA 1RAFA 3HKEA 3PD1A 4WY2A 3RS9A 4IIUA 3E8SA 3QEMA 5EVJA 5KYYB 1NJ5A 3OKCA 3WA6A 3G7SA 1PJ4A 4JI4B 4LHZA 3HJTA 5DVZA 3CX7A 9LDBA 3RV4A 1VKJA 3PUKA 2X6QA 4Z0HO 3N8DA 2Z9CA 3PGMA 5TXGA 1SY7A 4EZIA 5TGZA 5DCWA 2QMHA 3PL5A 2VAXA 1D6JA 1R6DA 1S7GA 4GXTA 2ZDQA 5CNJA 1D4FA 1W4RA 4U02A 2Q27A 3F5DA 4GM0A 4L8YA 2OENG 1BGWA 1AO3A 2UVPB 3KEOA 5GGXA 2O9JA 5B3JA 1PR4A 1RQPA 3ZLTA 3FCOA 4Z54A 5IEJA 2EWWA 5BT9A 3ZYZA 4KK3A 5DTJA 1FSZA 1Z68A 4MUNA 5ERGB 5TS3A 3TYXA 3UXYA 3ZKWB 4COKA 3VM6A 3QX8A 5DB4A 3ZCUA 1TGVA 1XCMA 1TYBE 2OBNA 5ICFA 1D2HA 1KYVA 1YB2A 2R66A 2ZRFA 3SM9A 4R1LA 2Q5JA 1QONA 2Q62A 5IC6A 1FB5A 1FYEA 4KTTE 3P96A 4RNDB 4CG1A 8ADHA 1GR1A 2RI6A 5B7NA 2RONA 2X13A 4L4UA 1D0IA 3DXYA 3NBFA 2P4UA 3P52A 4GOXA 1H8HD 2I8LA 2Q1XA 2W6NA 3GZJA 1G0NA 2AFHA 3KFLA 3BCSA 3QEMB 3H05A 5ANRB 5KYYA 3D8NA 3RS5A 1JLHA 2ONYA 3HR4A 3D59A 3UK0A 2GS9A 2FETA 3ZGXA 1I7PA 1W46A 3KZCA 4Y2UA 1T6XA 4ZIRA 1NZJA 3UW3A 3D0KA 3VH4A 2OORA 4DLTA 3NNSA 4K9SA 5SY6A 2B3TA 2A5FA 3RS8A 1GL7A 2IYTA 3KOOA 3HNOA 3DFUA 1KDPA 4UPVA 3LCRA 4X8MA 4F0JA 1VCIA 1U7PA 4KV7A 1PNQA 5IUNC 4U9HS 3KO8A 4YC7A 2O7VA 2XXJA 3AHEA 2X58A 3I6QA 4JB0A 2HT6A 3CLTD 5CG2A 4HNAA 3Q5DA 1R5NA 3HGQA 4YP0A 4U6NA 3WSVA 1YXMA 3V1TC 2QN8A 1GNTA 2ZPTX 4Y6RA 1UFQA 5THKA 5HJ2A 2PXCA 5GINE 2ZRNA 4U5QA 2I2BA 1JDJA 1GSHA 1B4DA 1ZOPA 4B2PA 4CQLB 3AJAA 1IRIA 1JJVA 1QZ3A 2JAQA 3M89A 4Y30A 4AX8A 1T6BY 3VO8A 4N47A 1KARA 2NXWA 3FHCB 4LHWA 2P0YA 4G1EB 3VO9A 1WZ2A 4FZJA 4MR8A 4DDUA 2ZIVB 4WLFA 5ITZB 3L0CA 1HDEA 4B6EA 5EESA 3RFXA 3FVTA 2V4MA 4DLUA 4ECAA 4GR5A 3LS2A 3QXCA 3T9EA 3TL3A 5ILQA 5B1YA 3O03A 2X3UA 4NEGA 2P6UA 4CMIA 3OQBA 4QOFA 4GKVA 1M6YA 3WLJA 3UJBA 1WY7A 2R7AA 3FSJX 1GQYA 2I78A 3WMRA 4PO1A 3GU3A 1Y8QB 1C81A 3BXEA 3H86A 5JI2E 5JMPA 4HNRA 4G25A 4BNNA 2O1SA 2H1SA 3CM0A 1KOLA 2VAMA 1L8LA 2PVSA 3M5DA 3TB6A 3ZZUA 5U4QA 2J41A 1KS9A 4A2WA 2F3UA 1KORA 3G9UA 1M6HA 3QU7A 4M7PA 1P5ZB 1XZIA 3CUTA 5AP9A 4WXMA 3JQAB 4WACA 3GWZA 2RGCA 4PC2A 4E7PA 2NZWA 3KOMA 1DAGA 5MHTA 2ROQA 4WI1A 3NDBB 3SZMA 4DR5B 3L1HA 2O3UA 3RRJA 3T38A 1AX9A 1FE8A 4ENRA 2OECA 3IOMA 1GL3A 1VBKA 3AG6A 1NRWA 1N2ZA 2XQIA 4G63A 1X7ZB 2X7XA 3ZD9A 2FV8A 2IDZA 1KEVA 4ME6A 3BTUA 1I3LA 5EN4A 3SBOA 1KS2A 2WHYA 3L7CA 1PEDA 1C1DA 5BY2A 5DHPA 1BA2A 2B4QA 3DP9A 2OR3A 4GE0A 3EXHB 3GLRA 3KJNA 3HR8A 3SKXA 5CVCA 4MULA 1RJDA 4KRGA 1G2PA 1OLXA 5KYNA 1X2BA 4LJ7A 2N75A 3V4OA 3ZQKA 3ZXUB 3KQNA 1S2IA 1VBMA 4LQLA 3RTDA 4CQLA 4PG8A 3ADPA 1P17A 2FUNB 3DV2A 3OE4A 4PEVA 1KE2A 1N75A 2CKDA 1J2YA 2E21A 3ROQA 1SCDA 5CTAA 1RYZA 1P0MA 3HY4A 3QVUA 1RM3A 4RYDA 4WLVA 3RYTC 1P8JA 2FSSA 5K0ZA 3B85A 3QEOA 2MYUA 4RVOA 5KTPA 5JS6A 3AEKB 5KS2A 3IQDB 5K0CA 5J5VA 3DVLA 2E5LB 1JBKA 1HQCA 1WCYA 4NLLA 5CXUA 3OSZA 4OGWA 1B8VA 3ETLA 2ZI6A 2YY6A 1T1RA 4RV5A 4EQ6B 1MX1A 2C99A 2ZRCA 4KX5A 5HTOA 3WL3A 4BCDA 3JAWA 2HBRA 2E55A 1C9MA 3L05A 4Y2SA 3SBDA 4MCJA 1UOOA 4O1HA 4O4LB 1E5LA 4AO6A 2G67A 2P69A 2VYVA 1ZN7A 3IEKA 2VJCA 2ODWA 3PX2A 2ZUSA 3EXFB 3N7AA 5HZHA 4IX9A 2QIPA 2IS2A 2DRIA 5ECYA 5ENVA 2VHVA 1NMXA 3VZRA 2I0FA 5I7VA 2AC2A 1TQ2A 2ZJ0A 1L5ZA 2PEZA 3U7QB 4RDXA 2DVMA 3OFVA 1EM6A 4Z1MD 1E7SA 5DHTA 4R1UA 1Q12A 3IDQA 1KP2A 2O57A 3CE6A 4CV0A 1MJFA 1NONA 3WWZA 3CBGA 5LIPA 1ZESA 4Q5IA 3IBCA 4DSTA 2PZEA 4D9BA 4FQ8A 4YMWA 4NYJR 3F71A 3FTDA 2X42A 3GJYA 5HKBA 2HKIA 2ZIWB 3RVKA 3F6YA 5GP1A 2FPIB 3GLFA 4LQDA 2R6CA 3OBIA 1HYEA 2OB1A 5FNVF 3PGKA 2J3IA 3HBAA 1LC0A 1BRMA 1TO2E 2RGXA 5G1PA 1L4KA 2QP4A 4HVCA 5JXJA 2WP8J 3M6VA 1GO2A 3GUYA 3P9KA 5E4YA 1GLGA 3RABA 1CS0A 1MV5A 3DL2A 1QH8B 3I64A 2NPIA 2NVBA 3S4YA 2BZ0A 5BSGA 3E9CA 4HQNA 3BWBA 5EPOA 4KR6A 1I7LA 3RIXA 2FEAA 2DZDA 4F38A 3QOYA 1GGFA 1A9QA 3HGMA 3AJ9A 4PFSA 2QX8A 2H1FA 3PQ7A 3VI3B 2WJVA 4RIFA 4EHFA 2QG6A 1P62B 4NJMA 1IATA 3SXJA 2NV0A 3ODPA 1OBOA 3GRCA 4D9CA 5EIXA 2NUBA 3HO8A 3IYLW 4PSVA 4WRRA 1NW3A 3FHJA 4F3CA 5FBWB 3EFHA 1XO1A 1L5HA 1P7VA 4X1IA 5CNIA 4UUPA 3EZ2A 2YL2A 2Z98A 2JAHA 5D3MA 2BMFA 3QUQA 1MIOA 2GPTA 1CERA 2GPBA 3H9BA 4HAZA 1JZTA 2XODA 2IDKA 1LTKA 2QD3A 5DTMA 2ZTSA 3O4JA 3K1AA 2VTEA 5FCDA 1VHQA 5JG7A 3SX2A 4DLNA 4HAYA 2G88A 3QKTA 5T41A 1MDBA 2WAXA 3IA2A 3GUCA 1WTCA 3S40A 4BWGA 1U2PA 4X1YB 3GJ5A 3UYLA 1W36D 4BV8A 1PZFA 4HJRA 2GRUA 4WGGA 1BW9B 4CIVA 1SZDA 4ER0A 1TYZA 3HU2A 4G8CA 4GWLA 5ICEA 1UADA 3GIWA 1BMDA 4JXXA 1DO0A 1GWNA 1Z56C 4FIZA 3HADA 1XLVA 4KQ1A 4N65A 1ORIA 2HPHA 3VR3D 3OTHA 1IXSB 1RRCA 4CI0B 1YKGA 3SC2B 1HYBA 3OTIA 4AB1A 2L19A 1HE4A 3LUBA 4HR7A 5EP1A 3T0GA 1L5HB 2C98A 1NY5A 3QK7A 2IY9A 3F46A 1YV9A 1XJWA 2EOAA 1NXVA 4X1KA 3D4PA 3I9FA 3V7WA 3HA7A 4B3SB 3KQOA 1U8YA 2G4LA 4B7XA 1PR2A 4ZQEA 5GVSA 2VDLB 2BGGA 3E1SA 3NVAA 2HPVA 4IH4A 2PXAA 3U7IA 2RC5A 1US8B 4EG6A 1AK9A 3VBEA 2G9RA 2PX2A 5BV7A 3H11B 2C54A 1JJAA 1DHTA 2DBRA 3A4VA 5D85A 4DLXA 1NPDA 3CZQA 3LQKA 1N2CB 1V7CA 4N7JA 3L6DA 4RNCA 5CFRA 3M4NA 4M9SA 4AYWA 3COYA 1OXVA 1ADBA 2V7VA 5GJCA 1SH7A 4IEEA 2YBEA 5DYNA 1RHMA 1X9IA 3G9TA 5J63A 2FZLA 4LZJA 4N0PA 1M2EA 1CUSA 2HSDA 3N53A 2R86A 3L18A 3NKVA 5D3ZA 2D74A 2I1QA 1ULAA 1YUBA 2PFGA 4EPWA 2B69A 2GRAA 4DKJA 1I2MA 1NN3A 1CNFA 3RAEC 4F97A 3T5DA 4OL9A 2NG1A 1U0HC 3EVZA 4HV4A 5ITWA 2AR0A 2XCOA 1JWLA 4URWR 4MZDA 4P6VF 1Z0SA 1Q1ZA 2YXEA 3PNSA 1ML3A 4FTWA 2BHRA 3IRUA 4E1VA 5EJEA 5LLDA 2PYIA 3FUWA 4FILA 4AO8A 2DWPA 4E2FA 4KR9A 3GRFA 4KPGA 4LRXA 4RAOA 1OHHA 4N01A 4Y98A 5EWJA 3ND9A 2G9UA 1I2DA 1P29A 4G0WA 4G1VA 1JHXA 4BFCA 1YJBA 1WUJS 2OOKA 4HWRA 2W70A 5TGTA 1OTXA 1LZLA 3USCS 4O02B 3EULA 3IT3A 1T4CB 2MR6A 3PE6A 5JEDA 1F9EA 1KI8A 1XZEA 5HDQA 3KSAC 4S2UA 3KB8A 2ZGVA 5EWMB 2A9JA 3MERA 2PH1A 2XUFA 4Z4CA 3LGXA 4G84A 1Y6FA 2I33A 1MAVA 1N2IA 5BWOA 5C18A 2WMDA 5AKKA 2GCPA 2P2SA 5E8RA 4C7MA 4ILKA 1EEXB 4DLLA 4LY0A 4KQ6A 1X39A 4AJEA 4H59A 2HQSA 5LD2B 2ZATA 1Z47A 5K05A 1VIVA 1XWIA 4CEIA 3FUXA 3VPGA 1BS2A 3C45A 2BGNA 3G8AA 1XTJA 3GRUA 1V11B 3AT1A 4L4XA 5A4IS 3HJRA 4J3NA 1HQDA 4J3FA 3ZS8A 1JLMA 2YWBA 2AD5A 2WMNB 4KN9S 5FUVA 3IVRA 3D81A 5G4LA 3W1EA 3ZD8A 4BO6A 1N2BA 1RP7A 5C8DA 1RR6A 1WU7A 2I8CA 1C9NA 2P7HA 3NGMA 4I66A 1JQJC 2A67A 2JAUA 3O83A 3BSFA 4QPDA 1LRKA 2PMKA 1UXJA 3KQPA 1K7CA 3V5NA 5C8VA 5KPJA 3O5AA 1IJBA 2QI9C 3HYSA 1HEIA 2BD0A 1BHSA 4FYIA 4P2BA 5AJZA 5KDDA 1QF6A 2OA0A 10MHA 2B98A 3GNLA 1Z7GA 2LCIA 1Q95A 1T5LA 2XNHA 3L4BC 3NWBA 1WMAA 5CRIA 3O8BA 2NUTB 4QAJA 2EIXA 2O19A 1NI3A 3MM4A 4OB7A 3D6JA 3FPHA 1G8KA 5FJJA 4HATA 5LC1A 3N0WA 1CS4C 1GPWB 4TN5A 4BO0A 3SICE 1GOTA 3WK6A 4R2IA 3O2NA 3S2IA 3FZNA 1H1DA 3DE4X 2II6A 5CXSA 3LZ6A 3RUHA 2YXBA 5JADA 1Z0JA 5KDOA 3UAVA 4LRWA 2BCEA 1JIKA 1V3TA 3AK4A 3DMDA 1RMYA 3MVEA 4ZN6A 5L3SA 1TJ5A 3UIEA 4NJEA 5BR4A 1U0SY 2EJCA 4OK5A 1VA4A 3IOYA 4ZKEA 2XUQA 3EWNA 3NO4A 4KIUA 1FP6A 1FDOA 1G4HA 1PDWA 1SKYE 1WSWA 2XNDD 3M1YA 3HV2A 2FG6C 3OLYA 4IDGA 4IHAA 1G0OA 1VA5A 4NG5A 1ECFA 3M6LA 2P3LA 3E7FA 2QUIA 2ZUBA 5F5NA 4DEXA 1P2GA 1ZS9A 2JFBA 4DDVA 4ZHQA 3OTWA 2WTMA 2GPYA 2O2JA 3G2OA 5DO9A 1Z73A 4KAFA 3ADBA 2HZ7A 4MGZR 2WJIA 2H0AA 2VC2B 4ZVTA 3VJRA 4L5CA 3MPOA 2H7CA 3DZBA 4HNAB 1Q7RA 1H3FA 2VBCA 1QUEA 2ANCA 3Q72A 4WK0B 1Z5NA 5LLSA 4D9MA 3KB6A 3VH1A 2AJTA 4ZT2A 2RAVA 3V6MA 4MWZA 3L7AA 5T4HA 3A26A 4NV1A 1RPNA 5EZYF 3E15A 1C9KA 4U3JB 3K7EA 4Y8VA 3SSMA 1BVHA 2DUMA 2KHZA 5MN4A 4NWIA 2FMKA 3HBJA 2PKCA 4B4DA 2QMYA 1C1HA 4EY4A 2VN8A 2VCHA 3DJFA 4K28A 1T5IA 4U00A 3ZXSA 3GJ6A 3AUJB 5AKGA 2G80A 1WY5A 3LG2A 4XX0B 1DAOA 1O96B 1CDOA 2IBTA 1JUDA 4WNCA 2E4ZA 2B2CA 2D1FA 2QMZA 4XTRA 1GEEA 1A9TA 1FFCA 3EHEA 4L0QA 2C0PA 2ZJ8A 2QJTA 3CA8A 6YASA 3EE6A 4LJLA 1HNZB 1NP6A 5AYVA 4REMA 3MINA 2IYAA 4OFZA 4CMAA 2CZGA