2MR5A

Solution nmr structure of de novo designed protein, northeast structural genomics consortium (nesg) target or457
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
136
structure length
136
Chain Sequence
MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords De novo designed Protein OR457
publication title Solution NMR Structure of De novo designed Protein, Northeast Structural Genomics Consortium (NESG) Target OR457
rcsb
source organism Artificial gene
total genus 43
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mr5A00
2L69A 2LV8A 2LNDA 5GAJA 4J29A 2N3ZA 2MR5A 2MR6A 2LVBA 2N75A 2LTAA 2KPOA 2L82A 2LCIA 2LR0A 2LRHA
chains in the Genus database with same CATH superfamily
1E2LA 3VOBA 2ADOA 4ESOA 2C2YA 4Y7DA 5B12A 3L6OO 4D4LA 3DPSA 1TQ4A 2FDRA 1IHDA 2G82A 3FUWA 3BGDA 2Q5JA 3GRVA 4HXYA 2G9ZA 2QD2A 3RJTA 2X0NA 4FNAA 4MLPA 4U5QA 3FKSA 4W8OA 1NYRA 2AI1A 4DLSA 4FMCB 3U6KA 3C3DA 1P1KA 1KDYA 5JAIA 3WB0A 5LXTB 2WNSA 2KPOA 2A9PA 1Z5NA 4CFYA 2HA5A 1K2WA 4MQMA 2C83A 3O1IC 4L4YA 3MELA 4FCVA 3BD9A 1PT9A 4JT4A 3LE8A 4LTNA 3JPYA 3QELA 4NBKA 1HNNA 1D1SA 1XD2A 1RPJA 2G67A 4MIYA 4X45A 4QQRA 4XASA 4DCVA 4DLYA 5IASA 3GJ7A 1RBQA 2C1XA 4EFDA 3CUSA 1RD4A 1QH1B 4JC0A 4B3HA 1Z07A 2IE0A 4DAEA 3ZDCA 4LHYA 5EUMA 1UDRA 5ER6A 3C5HA 3WIUA 2XVXA 2ZAMA 5FL3A 4UZEA 1OZGA 4RDHA 4LMBA 5THKA 3NBKA 1KMHA 2OV6A 2Y1FA 2FK8A 3T99A 4A5SA 1AKWA 4L95C 4FFOA 1SGWA 4GKBA 1UXJA 1MIOA 3FOAA 3GROA 4GI1A 4RVHA 2XZPA 5HVNA 5A3QA 1ZJYA 3GY0A 2IPXA 3WNBA 2DPLA 4S2UA 4OF4A 4B2PA 1JP7A 3H1PA 3EPLA 5BUSA 4R8LA 2YH2A 1CWUA 1OI2A 3L1UA 1V47A 2HBZA 3WB1A 4BO8A 1ZKDA 5GVRA 4QQKA 1JZSA 2PY6A 5F7ZA 5TS3A 2OGZA 1LPOA 2P65A 4P0TA 1SC1A 3T9EA 3OC0A 1THGA 1FUIA 3BXGA 4D8YA 1SVMA 2ZWPA 1KO7A 1L5SA 2CLFB 4NH4A 1EP9A 3LT0A 4TTSA 2HBQA 2QRPA 2H4FA 4P3NA 4KGZA 2G9NA 3RSCA 1T9ZA 3FOWA 3LQ2A 4I4NA 4BNZA 2IOHA 4KW7A 4I14A 4C0QC 5FAXA 1H3EA 3E58A 3S5UA 2XUDA 1E9BA 5DTJA 4EB6B 1F5NA 3DNPA 3DT8A 1Z6ZA 2NSJA 3AFOA 3SQXA 4I5IA 4WLFA 3Q9NA 1XI2A 4EKGA 4YNBA 1TQ2A 1VMDA 1XN1A 1KK0A 2RCYA 1O6FA 4PR3A 4QQ8A 1QK5A 3EDOA 5TRTA 2PGJA 2Q1YA 4G1VA 4RKEA 4BZPA 1HDEA 2M2IA 3G2PA 1C9KA 4GM0A 1ZCAA 3RV4A 4PFSA 4LTDA 1X74A 3LT4A 2J3DA 4N0EA 3RFTA 4C0BA 4I8IA 1KC1A 3G49A 3BIJA 4WINA 4PGMA 2ZJ4A 2C4TA 2GCIA 1DAPA 2UVPB 4YMIA 2ZSIA 4I5DA 4S1TA 3IRVA 8LDHA 2DTEA 3ABOB 4CM7A 4EUFA 3AJAA 3CZ9A 3VKHA 3KKLA 3BFKA 3ETLA 4EHKA 4N65A 3B52X 1Z0JA 1PDWA 3PA8A 1EBFA 1DKOA 2YBEA 5D3MB 3DKVA 4YUAA 1CY2A 4HGNA 3VI3B 2DJIA 4ODIA 4YAFA 2Q7XA 3PTLA 2PS1A 4LRQA 1EGHA 4ME6A 5JU6A 3PQ7A 4BO1A 2JH9A 1Z17A 2ODBA 4NV3A 1R50A 4NMLA 3TH5A 3P2KA 3OLZA 2W2VA 4M9RA 1A5SB 5DMXA 5FT9A 1KPGA 3PWSA 1VLZA 4HRXA 1BROA 1F4LA 4Z86A 4IFIA 4B2LA 4EGQA 5C32A 1E8DA 3H2ZA 3HP7A 3M6UA 4QODA 5AI0A 3TM4A 1N8SA 3KG2A 1B2LA 3KLBA 1I6LA 4AX4A 4Z54A 1U8CB 1ZGJA 1WMDA 4N3AA 5KYYA 1TO6A 5MHTA 3MPUA 2Y8EA 3EJ6A 5A5DA 2GXSA 3HVKA 4N6OA 1E7YA 1QM5A 3K9BA 2CVQA 1X7HA 2LGJA 4UVIA 1FVFA 3SBEA 5AVUA 4NYIQ 2VSYA 4X62B 3SKVA 3KOWA 3C3YA 2XXAB 3TGWA 4HS9A 4NKRA 4CIWA 3O47A 1KQPA 3S27A 2BGIA 1L4NA 3B12A 2XE4A 2AFHA 3LQ4A 4WA7A 3B1ZA 1RP7A 4Q15A 5I5EA 2VNHA 4JHXA 3TIFA 3TFWA 1VKRA 4BN4A 4DIBA 2REBA 3FLBA 3TD9A 4D56A 1MR3F 1RZUA 1M2GA 2JCYA 1O6GA 2C8JA 1R7RA 2BKEA 2JL1A 3DFZA 3HKBB 1W87A 2BMWA 2JHAA 1V2HE 3QXHA 5IAJA 1IBRA 2GARA 2QNBA 3LUKA 4LZAA 3W0LB 1U9JA 4YK7A 3VUFA 1XPJA 2WYHA 5HE9A 3OX4A 4L2IA 1U7PA 1XAHA 4EGJA 3QEAZ 1OH8A 5DWVA 2ZB3A 3T61A 1EXVA 1O94C 5KQRA 1F3OA 3IPAA 4UPDA 3HWWA 4QYSA 3CJTA 4I6EA 4BFVA 5ETJA 1Y4DE 4MYCA 5BR8B 5LQUA 2ZVPX 1L7MA 4BKRA 4XWYA 2VP0A 1TYZA 3SBOA 2IXGA 3OM1A 5DTRA 5A02A 4EA9A 1HNZB 2PQ6A 3ZHXA 2IY9A 1LZLA 1YQWA 2Q1SA 2RHHA 4D45A 2PT5A 2R6DA 4J90A 1JH9A 2PUWA 4HG2A 3GC6A 1QYWA 1QJ4A 2GASA 2V97A 3BKWA 3SS8A 2FWRA 4HY3A 3UK0A 5ADWA 1M33A 3NOVA 4E51A 3KC2A 3Q0IA 4IF6A 3MRSA 3FUTA 2HU8A 3OOSA 4IWYA 4M1YA 4RPGA 1ZUWA 4B5LA 4K46A 4MW5A 2ZRPA 3AHFA 1PDOA 1JEYB 4FCWA 1ZYUA 3AP2A 3O8OB 1G16A 1Q16A 3KU1A 4P1ZA 7REQB 4CUJA 4MV0A 3BHJA 3TIVA 5K8VA 1WBBA 2A9QA 1QVAA 4PCUA 1GUZA 3SXUA 1B1AA 1JHVA 4PRLA 5LP6F 2IGBA 3AW9A 1VSTA 1YQEA 3ZDFA 2QD1A 4DDMA 2ZRAA 1VKJA 3K5IA 1V11B 4JJFA 5A03A 4C7OB 2BP7B 3GUZA 3D3QA 1T1SA 5JSYA 3R3ZA 3SM9A 2D2VA 3DTVB 4P35A 4X60A 1PO7A 1A77A 1E2NA 5E6SB 3U3DA 4A6XA 3UJAA 4BWGA 1GTG1 1AS3A 1ZM9A 3UQYS 1BCRA 2NXNA 3FWZA 2G4CA 3KE8A 1W44A 4NAUA 1ZVKA 1RXYA 3NGLA 3JYNA 5LQRA 1F12A 5B3JA 2X6TA 4A92A 3RROA 4DA0A 3X1JA 1H2RS 1WHTB 4GR9A 1UBNA 4EFNA 4UVGA 1Q7EA 1UPFA 3IV7A 2P0EA 3WX0A 4JVOA 2QUAA 3AUSA 3CH5A 3UMCA 4P4TA 3ILVA 4D8VA 2BF4A 4LBWA 4YJHB 3HNPA 3OH8A 4WHMA 2R1TB 4H18A 1TU4A 4OBXA 4UUPA 1IOVA 5I7VA 2XUZA 1RBMA 4B81A 1LD3A 1MEOA 3S68A 4RV9A 4R9RA 2O8FB 4GNRA 4M55A 3DAFA 4JYMA 4UTXA 3ONNA 4GDMA 1RLUA 3QKIA 3WGYA 1MW8X 3H75A 2UUOA 4Y1EA 3D43A 5IFKA 3CS3A 1P4HA 5E0KB 2HCTA 3TBFA 4IG9A 1G0NA 2FDCA 4OQPA 1F6DA 4QUBA 1O9GA 3NHZA 3QLVA 4G4GA 3OQMA 4Q3DA 4LJKA 3UK6A 2Q5IA 2XXJA 3K4QA 3ZJ4A 2D7CA 2F1OA 2ACVA 1RJ9B 1BMTA 4MQFB 4PQEA 4ZICA 5LN1A 1BWPA 5L3ZA 2HMAA 5JR3A 5CB6A 5IARA 2P35A 1IWOA 3ULKA 1F4PA 2ATXA 2XUAA 5CNKA 4B31A 2HW8A 4L4UA 5TT0A 1J00A 1QSGA 4HVAA 1NZDA 3ICWA 3IOEA 3TR0A 1V41E 2OUIA 3QHQA 4A73A 4MWDA 1ISHA 1CB0A 3CRNA 1C7JA 4ON9A 5K6AA 2J4CA 1SA0B 2ZRBA 3IUEA 3M4YA 3ORHA 4PX3A 3UPUA 3RYCA 1AF4A 3GT0A 4S35A 4OQXA 3CLUC 4P0PB 4P54A 2GI4A 4KSCA 5FD8A 5HIKA 2VZ9A 1BD4A 1Y4AE 2NN3C 3ORFA 2JNWA 2UUPA 2H9AA 3HGTA 1A2KC 2GJ4A 1AIPA 4RA6B 4B9AA 4CM1A 2JCVA 5LOVB 4PSCA 4XQCA 3P9PA 1Y89A 5L4SA 1RHUA 3Q87B 1XMIA 1YR6A 3OU7A 3LNTA 4O1HA 4ZOLF 3KOYA 4W5OA 2IH2A 1BQ4A 4BC0A 2SKCA 3GG2A 2AHRA 1ORRA 2YVKA 3DLBA 1SHZA 2C59A 2FHSA 1E2KA 4TT3A 4HZUA 1C14A 1D6SA 1N8KA 3BMNB 4NZYA 5FADA 3P2OA 4JNKA 5JMPA 1A8IA 1LBQA 1ZVVA 1OX4B 1IYZA 4FEAA 5AHOA 1XDSA 4ASUD 4MV5A 4ZVSA 4P5PA 1XZPA 3K0FA 1N4DA 1PWHA 4F7DA 3VDMA 1JE0A 4TQUS 1YJBA 2PBZA 2NNLD 3EH2A 4WBNF 2PX3A 4FFWA 3X0DA 1RCFA 3PQ4A 4DV6B 4R9UC 1MIHA 4K9MA 4K86A 1IAQA 1RVV1 1DOAA 4Y6LA 3DHEA 1JKXA 5FBWB 5IH3A 4ZK6A 3EUAA 3PLAE 1JQEA 4EG5A 2RAPA 3FCSB 3LPMA 5IPFA 1CVRA 2JFBA 4UTPA 5CGZA 3T0GA 2F55A 3JR7A 5IEBA 2ESRA 4CMHA 4W7IA 5L3SA 1RPTA 3LO5A 4U6SA 4KWEA 5BV1A 1P9WA 1UMKA 3LIPA 4IVPA 2BGTA 2CB9A 1NJGA 3E1SA 3URMA 1G9XA 2BL4A 4BMYA 2BGGA 2CV2A 2VSQA 2QYTA 4QQFA 3LVQE 4ZOQI 3D3JA 1X1DA 3BT7A 5FHRA 3M5PA 4OKIA 4DXDA 4EG7A 1KYIA 3GMDA 5H82A 1THZA 4HD8A 1I3MA 3QVGB 5DI3A 1Z25A 3AFGA 3DE4X 5CB4A 4RPJA 3KK0A 1A7UA 1PZNA 5KTPA 3K71B 1MQSA 2BGNA 4Z0NA 2J9FB 4DRXA 2VDNB 2PUCA 5KWVA 4FNGA 1D0SA 2AQKA 2YXEA 5HYVA 1KGDA 3FRHA 3DAHA 4DLAA 4G1FA 3E7XA 2EC5A 4A6EA 3HCRA 3OKFA 4GPIB 4WEOA 2EQAA 3E9RA 4RW0A 2ORIA 1IM5A 3IMGA 4BX8A 4H59A 3AY3A 1OI4A 2FMXA 3Q4GA 5CH5A 3C74A 4V1CB 5IBRA 2ACEA 1JJBA 4DHWA 2PUFA 2WJWA 3FJ1A 3OICA 3V9AA 3FUXA 2P3OA 5LOVF 4S1NA 2QVXX 2O2IA 2Q9BA 1ADBA 3R3WA 4HUQB 4GZ6A 5LQDA 2H7CA 3CY6A 5ELMA 3SZ3A 3DAYA 5ERGB 4AU1A 4ZJZA 2VRCA 1CUGA 3NTVA 2QI9F 3PJFA 4QTUB 4YACA 3HY6A 1S2LA 3W5IA 2V0NA 1R0LA 2WHRA 3QMMA 4UKDA 1TA4A 3G6WA 5A6VA 4TT8A 1P8JA 1TD1A 2VXCA 4NNJA 3FAZA 4Q47A 1CRPA 5ALLA 1NP6A 5ALMA 3KD3A 1XEAA 1X92A 3IC5A 2C9DA 1W48A 2QYSA 4TS1A 3JYLA 4AJKA 3KSDO 4IJUA 4K2HA 5JNRA 4EG8A 3KT3A 1NULA 3A0UA 4PLCA 4ZEXA 2A2ZA 4BE7B 1SHTX 3PT9A 2KLBA 2VT6A 1JDUA 3OMWA 4UJ3A 5EZSA 3K4PA 2GRJA 4KG7A 4B47A 2MWMA 5AW6A 1W0JA 3A6ZA 4YFVA 2MMGA 2C2WA 4IDDA 4CN8A 2BIFA 4M1EA 1OPRA 5DDIP 3PC4A 4UXHA 4F5ZA 1M7BA 3L0BA 2RKOA 2ZUFA 3NAMA 4E4RA 1L5QA 3E23A 1E0KA 1IULA 3HRIA 3R5SA 1I2DA 3QUCA 2ZRQA 3P9ZA 4BYMA 3G2IA 1C8LA 4Z4GA 2E4XA 1EVKA 1Z0KA 4GYJA 4IDGA 2A0XA 4K26A 1P91A 1KVRA 4IHAA 1TTQB 3N70A 5KNCH 1JHRA 2NZJA 1Y7PA 3N6RA 3O8RA 4XEHA 2GLXA 1Z2EA 4EYSA 4Y2SA 1KVTA 3I01A 4OQZA 5FL7D 1XD8A 1M2HA 1VL5A 5CT9A 4PRYA 4J3NA 5LKRA 4P4SB 1FW8A 2FW0A 4MMZB 4D0NA 2W7TA 3WG9A 2AW5A 4QDKA 4QPNA 3HJCA 4J0IA 1I4TD 2C4WA 1M2OA 3A04A 2LIPA 3AG5A 3CNBA 4XDZA 3GLIE 2NO5A 1P45A 4IIVA 1BDIA 5J2TF 1EB9A 2ST1A 4I1RA 1SKUA 1RU3A 3PSAA 4GO1A 1XEWX 4ER6A 2EP5A 4GWLA 1H9AA 2A33A 2VSNA 3GEHA 1NJ8A 3FRJA 3H2HA 4AZTA 4RTNA 2Q29A 2I8AA 3FMGA 1X80A 2J3LA 3JWGA 4MZDA 1IHOA 1QOQB 5I47A 2OP1A 1ZM3A 3Q3HA 4OQFA 3LXUX 3U7QB 4BVAA 2WFMA 4P98A 1KY3A 4BFTA 2REXB 4MVJM 1JYEA 1WUIS 2CL0X 2DHCA 1H8EA 2E4ZA 2EU8A 2F9LA 3GIWA 4X44A 3E3OA 1PL6A 3UJ8A 1L7DA 2POQX 5LJLA 2Q4DA 4FHEA 1Y5LA 3W5VA 3IHKA 1CUCA 4NAHA 4TXJA 4K0RA 1PWZA 3L46A 4JJIA 2POCA 3N2GB 1QOZA 3L7BA 1YA8A 5EVCA 8OHMA 3QXXA 3MB8A 4MPPA 3HZZA 1BQEA 2W9XA 3E2IA 2MHCA 4CMGA 1TT5A 4GXQA 4LOJA 4DE5A 4FOPA 4BBJA 1JW9B 1MZVA 2PYIA 2CNWD 3NANA 2VNIA 3E9EA 2YDXA 3FIUA 3KKKA 3ZWWA 4DC9A 5IMSA 3U16A 1PGPA 1NWCA 1JU3A 2ZIAA 1SXJA 1MEEA 2CYAA 2WWFA 5EKTA 3UK2A 1Q5PA 5IG2A 2WQZA 4G0UA 1HL7A 4G25A 5DNCA 1XBTA 3IVMA 1KU0A 2ZE5A 2EL9A 4BUJA 3VOTA 3B1FA 2O8VA 3PFGA 3UMFA 4NZ9A 4AWBA 4CM9A 2HHHB 4UNRA 3JATA 4JYPA 4B4DA 2FPIA 1SU6A 1MAVA 3BF8A 4Z9YA 3A9CA 4L9RA 4HWSA 4OGWA 2QQ5A 3I1YA 1Q83A 1OF1A 2CNOA 2Q1WA 1HH4A 5FOSA 3ZVLA 4YCAA 3RR2A 1AHIA 3HZOA 4AKGA 2B8JA 2FUG1 3T5CA 4TUYA 2H2AA 2OC9A 1C8VB 3FPLA 3RVQA 3R24A 3WAKA 1PWXA 3SEFA 4C0HA 5FP0A 3OU6A 4G2TA 5ALOA 2Q1UA 1U2GA 3IULA 3HMKA 1D4FA 2ORWA 3TQQA 4IIFA 3RUCA 2H48A 2B2CA 2G8NA 4MPTA 3TI9A 5FTNA 2D1RA 3B13B 2DC1A 4MKFA 4PQRA 2FWMX 3V5NA 1II0A 4KQEA 5HS4A 2ZWMA 4RJ2A 3EARA 2C92A 2JI7A 2VS1A 4HDSA 2OCYC 3U9TA 4PZDA 1EK0A 2HV8A 5JQGA 3BYZA 2G63A 2WPNA 1KQOA 3E82A 4S1WA 2XB6A 3EF0A 2ZB2A 4E94A 2D7DA 5IP5A 3OIVA 5EJFA 2C8LA 4ZMRA 1DIOB 5JQWA 3L8GA 3P2IA 4E07A 1Y3CE 3VHQA 3W8EA 4L5YA 2IE8A 2J9YB 5DKFA 5IBCA 4BNWA 2CLKB 5KNBH 4DDVA 1P2VA 2FRVA 2HJHA 3AEYA 4RVFA 5T4FA 4WADA 5DHSA 1C0PA 5FFNA 1I13A 1IIRA 1KK3A 4CCYB 5EZYB 4QJIA 3DMTC 3UAZA 2ZAOA 3PPIA 4JR2A 3GBPA 1L0BA 5L6MB 4KI7A 3SQMA 4OV6B 3VYUB 2GPBA 3RG2A 3FFAA 2CVPA 3IEKA 1QIFA 3HZHA 2ILVA 1M1YB 2OE2A 5DRTA 4ZJUA 1YZVA 3OPYA 3IH5A 4ZALA 4DMUB 4G4IA 4OXYA 1FXSA 1P9LA 2W6JA 4ZHQA 4DA6A 1KEZA 3IHWA 1HLGA 5MN6A 1BDBA 3VISA 4EB3A 1CUDA 3ENVA 3QMVA 5LUBA 2E87A 1LGYA 5JZOA 3ASZA 1FDIA 2PWPA 4LRYA 2C9YA 1T6BY 1GPUA 5C4IA 2PRSA 3I8SA 1PVOA 4RKFA 4E08A 2JBWA 4UU0A 4D44A 3EGDA 3IDAA 3CF6R 4J6FA 1U2ZA 2CHVA 3OM8A 1QP7A 1B2RA 2VNSA 5AH0A 5K6RA 4YJDA 1IK4A 1ZXLA 3OJOA 4F3NA 2CSXA 1NXXA 2FR8C 1LRKA 3R5XA 3MINB 2SCUB 2VNJA 4GZLA 1TU0A 1AHHA 3BCRA 1YVEI 4DYDA 2EYUA 1TVKA 1Q84A 2HXSA 3AF5A 5CVDA 5TR9A 4DCCA 1LRJA 5JC8A 4NENB 4J76A 5K6AC 5HMMA 1QTQA 2BELA 1XZFA 4Q16A 4DY6A 1QGOA 2C5LA 3LDAA 3PE3A 5AI9A 4I0WB 4GOND 4BATA 3SY8A 4DV4B 4RDIA 3VSAA 2QYOA 3ND5A 4P2BA 3WI7A 2R8BA 3ESAA 3LNCA 1FFSA 1NVUQ 2X5JO 1HEYA 3OMXA 2FQ1A 4CM8A 2Y2VA 4U1RA 3WQHA 1V5GA 4XD2A 2GUGA 2D1FA 4F11A 2A5FA 1PZFA 3L8FA 4QDUA 2VCHA 5PNTA 4D5EA 5JSHA 1PFQA 1GM5A 4DGSA 3DDZX 3PIDA 5C18A 3CB4A 1ANKA 1LW6E 3JSXA 3RVBA 1T0BA 1AKYA 1QRDA 2H0RA 3AOEC 3FMOB 3GUVA 4MA5A 4E2FA 5IDQA 1G20E 3BXXA 5J4VA 4A0SA 2Q28A 4N7MA 1ZM2A 2XZDA 3EVTA 2PGDA 3CKMA 2JZCA 2O05A 4HLNA 3W2HA 5CCXA 3DOIA 2QPOA 3TTTA 5CVTA 3CHYA 5FFMA 1CNMA 3LYHA 1UZAA 3M0EA 3QWIA 2OV8A 1M6VB 6LDHA 1ATIA 4W1PA 4XM2A 5K0SA 5KYGA 3J81A 3C5WP 4D96A 5JYCA 4AJPA 4QJBA 4IGAA 1EZ4A 3EEOA 2BGKA 4C3ZA 3LKDA 4TYYA 4A8PA 2IDZA 4S12A 2H65A 1ZK1A 3OX2A 1E2HA 4MCHA 2FH5B 1QXSA 3EQ2A 3DMHA 3L0YA 2GCGA 3M4XA 5C80A 1D4AA 2FMUA 4NPAA 2DHDA 3DWGA 4L0MA 3ZV5A 3PR3A 4ARBA 1DAHA 1DC6A 1Q17A 2ZI4A 3D02A 2Z1DA 2DUUA 4IYJA 3CSSA 4HS4A 4OHZA 2FPMA 1B26A 2QAIA 4O4LB 3ZEAA 4C0KA 1NAHA 2AG1A 5A4DA 3C8MA 1DEXA 4AC9A 4BFWA 1O6ZA 2AH5A 5SICE 4C9BA 1PYOA 1QGUA 2HLDA 2ZAIA 3AZQA 2KMLA 3F3SA 1XROA 5AVZA 5J47A 4JBGA 2O50A 1PJLA 4FJ2A 4RL6A 1JFLA 2ZIXA 3FR8A 3AKDA 3K5PA 4BKMA 3JQ7B 4KMOA 5TF4A 4RF4A 5EESA 5F9MA 5AVXA 3AB7A 2O5CA 1T4GA 3W4KA 3K1YA 4PC1A 1MC8A 1YC5A 1HA3A 1Y9AA 3HP4A 1OZAA 3KP1A 2QJRA 5E8RA 4EFKA 2M9MA 3NH9A 3RHSA 1DUSA 4RCYA 1VHDA 1E3EA 1H2XA 3GJYA 2PO5A 2VC2B 1IZ9A 2MSKA 2HX1A 4UCXA 4JP5A 1Y1PA 2RHBA 5G4KB 2J08A 4YRGA 3U3JA 1GRQA 1QG2A 1IY2A 2AZDA 3OQBA 4LTMA 5SYAA 4JJ8A 3C5VA 3K0EA 5D3QA 5CBPB 1OVMA 1ZGBA 4WJKB 2JAOA 5CU7A 1USUA 1GQRA 2V8OA 5EHIA 2NWQA 4WQMA 3TW6A 2XNJA 2Q4TA 1Q1NA 3WJ7A 3BWDD 4HQ6A 3LXMA 2QKYA 5CFNA 4LQCA 3OAAD 1GNLA 2OENG 5DMHA 1YTLA 5FTKA 5TMEA 4KKVA 4CKEA 2Y9MB 3F4BA 4M46A 4U2BA 5EN4A 3NATA 5KMGA 3UAYA 4YIHA 1CF4A 5SV2A 4B3CA 4D57A 1BVHA 4DEXA 1Q95A 1KYWA 2QZZA 2R62A 5E7MA 1THTA 3A4LA 1CFJA 1R4NB 2Q8PA 3JZDA 1IZYA 1D09A 3QFCA 3F1LA 3AVWA 4PHCA 1IY1A 1I24A 2WMOB 4PZLA 5K20A 1ZNXA 3S8MA 3Q5EA 4W5RA 2GPNA 2DSTA 1NP3A 4YXFA 2QMEA 3TDKA 1UZLA 2JCGA 1U0LA 1DBSA 1MFPA 1A50B 2G17A 2PXAA 3H9BA 3HYNA 3O8LA 2E7ZA 3PQ5A 1TUIA 2Y66A 2YIJA 4IJQA 4CLDA 5BQFA 1PQ4A 2A7XA 5JBNA 1U8TA 4XEUA 5KPDA 1Z6TA 3THYA 1F4VA 3ZCQA 2YWGA 1DG9A 1KXZA 2QK4A 4K9PA 1DG1G 2XZTA 2JF0A 4NCAA 3MGGA 4DV7B 1B8PA 1QH8B 1T2FA 3UT5A 2Z3VA 1EWTA 1FFEA 4MP3A 4PY2A 2ILTA 5E3HA 1CIPA 1AZTA 3IUJA 1L1QA 3IAM6 3PZBA 5B30A 3RS8A 5FWYA 1UDCA 1JDZA 1YQGA 3D8TA 4FS8A 4DR3B 1UBOS 1MU0A 2NV2B 4XVUA 1P8AA 3MGBA 1V8FA 1LQTA 1J1IA 3GD7A 4M0LA 3I9NA 1QKJA 3QF4B 2HQ1A 2QUHA 5ALXA 4G5YA 4EMTA 2AV6A 2QN2A 3C3AA 4YQZA 3LGSA 3JVDA 1NYQA 3R0XA 4G24A 3WAGA 2H5LA 1LBEA 2BWJA 1QO0A 3H9GA 5E7IA 5HG0A 4I5GA 3G17A 1VRCA 4IAOA 4RMGA 2WF8A 3T7KA 4IJMA 3QNUA 4W9MC 2V9CA 1P2GA 4HGPA 4XPIA 5JNVA 1I94B 1NE7A 3CUKA 4RZUA 3AXTA 2Y1WA 1OFUX 5FUYA 1WZ2A 1JR3E 3ZI0A 4K1XA 2ABWA 2ZE6A 3JD0A 1P19A 2XNSA 1OVGA 2R00A 2QOEA 1E20A 4EWLA 1DEKA 1ZR4A 2HA3A 3B38A 3LUFA 3K70C 5GGYA 1DKPA 3FHCB 3DFKA 4B7AA 5KKNB 1K89A 4ZVMA 3HPRA 3ZLBA 2K7ZA 2NVUB 4EJFA 5KQSA 2SKEA 4GVXA 2IYOA 2FB9A 4PQYA 3V8VA 3RGGA 3LG2A 1K3TA 1YOVA 3MCZA 3TW8A 3DAOA 3EZ6A 4H0FA 1X7DA 5DISB 3KL2A 4FYWA 1RMQA 2I7DA 1IBMB 3DUFB 1Q19A 5DJ5A 5HM6A 2CHFA 4UDXX 1DTWA 1K5DA 2YXDA 1V16B 4OP1A 4BFUA 3OOHA 3DF7A 4TQAA 1UFKA 4L7VA 2CJYA 3FMPB 3ZU2A 3AM1A 2X0RA 3ILSA 3W77A 2FG5A 4E2ZA 1A7JA 2CJWB 4UUNA 1ULHA 1EM6A 3KUKA 1DDGA 2P9JA 3D8HA 5JCOA 1HQYE 3NOXA 3ZWBA 2L42A 4A2CA 4OQEA 2Q3CA 2VLIA 3I9OA 4G1MB 3KR2A 5HKOA 1C9MA 1K75A 2VDVE 3IQZA 3RE1A 1GUYA 3STVA 1CUBA 1ESEA 1JSZA 1W88A 2V5AA 3HB4X 4P31A 3P0JA 1KH2A 1SAYA 2W2MA 2P68A 2HQBA 5FI0B 1YBFA 1MNAA 4ZYXA 4XSVA 1OB5A 2BEUA 4JQSA 3CX6A 4TVKA 3AINA 4M0CA 4BVKA 1ZONA 4GSYA 1F2UA 1H5QA 2WYUA 1PR5A 3GGPA 1NMSA 3OIDA 1FP4A 5DT9A 1U6IA 3NORA 1RYMA 2M6SA 5F9HA 3CX3A 3D2CA 3OFJA 3IGFA 1QCYA 3NFYA 5BQPA 5I3CA 3AL0C 3SZGA 3V2IA 1R00A 3FNHA 1L4FA 4EB0A 2Y68A 5TX7A 2QNRA 3HEMA 3N2EA 4YRRA 3BD8A 1FSSA 1K7CA 1YZGA 1D6NA 4YH1A 5AK5A 3TTXA 5EJEA 1N6OA 2H2IA 1NVDA 1NPYA 3EISA 1EWVA 2X5KO 3GP5A 1TMOA 1L5VA 2ZRMA 4X64B 4D0SA 2F6RA 3KEMA 1L1EA 2P7IA 3WHIA 3MOSA 4MVWA 3BG5A 3AY7A 3EOZA 3G5AA 4KXXA 1X7YB 1YBAA 1EFUA 2IF0A 4MKXA 3BEOA 4R54A 3A9VA 1WD7A 3L4BA 1F6BA 1OTXA 1BOFA 1KHHA 2MJLA 2Z2KA 2W8ZA 3M2PA 1KIAA 2Q0QA 4AK9A 1JLKA 4E5UA 2F67A 2G04A 3C6XA 4PZ9A 2V7BA 2L2QA 4URHA 1NN3A 1NRJB 4NBNA 2B83A 4ZGBA 1BHSA 2ZITA 5JT1A 1GL6A 1YE5A 2JJMA 2XUGA 4DUGD 3H9CA 2G08A 2EQ5A 3GZJA 3R6WA 5THQA 1EFHA 5DTEA 4PG5A 4BVGA 4MV8A 5JD6A 2O59A 4DIFA 2BFCA 2IQ5A 3F6RA 3N2YA 2Q5FA 2QX4A 2V45A 2D59A 1CHDA 2J33A 4RHFA 5AK4A 5LZ7A 1FDSA 2GF9A 5FNZA 3VZRA 3QYFA 3EXFA 3E5NA 1AKUA 3EH1A 4B6SA 1CS0A 2EYQA 2PAAA 3K31A 2YW9A 3HXLA 3QKRA 1WOYA 3INYA 4LSGA 3HLTA 4UUAA 3ANYB 4F9EA 5EIAA 4UQLA 2FLWA 1JG1A 4W9RA 2GNPA 3BTOA 4HXEB 4TL6A 2XZOA 1OC4A 4GMFA 4BU0A 3DV0A 4MRVA 1Z7YA 1HT2E 3UOGA 3FCYA 3U4AA 5PGMA 2VFAA 4N5HX 5DBIA 4S05A 1Z6PA 2DBVO 2IYLD 4V0RA 3RTDA 5BMVA 2J48A 3CTMA 3G2MA 3NRBA 4I9FA 1HETA 1NC1A 4YRDA 3MJSA 5I8WA 1CJUC 1UBTS 5FLYA 2P9GA 4GW3A 3F98A 1SELA 2LPMA 2VI5A 3PQDA 2P5TB 3AI1A 5TV2A 1NUQA 2FPKA 4JLUA 2YZGA 1V8OA 4QUDA 1Z33A 4LX8A 3TQTA 2RGYA 1O96B 3UFXA 5LCXA 2HRRA 3KJIA 2XGMA 1S8AA 4X85A 4F92B 3W1VA 1KJNA 2C9BA 4OHOA 1XAJA 2AD5A 1WF6A 1YE3A 1E3WB 2QJWA 1R6DA 2W6MA 3ANXA 3ABQB 4QDZA 4Z6KA 1R0SA 1KP3A 1XDGA 5TPZA 5JSZA 4FGSA 1VCMA 5B6IA 1U3FA 3RREA 2VDWA 4AMBA 4AUNA 1EBUA 1IHYA 4EPRA 5E6RA 3UM9A 4YAUA 1DO2A 2QIOA 1NI3A 1UMBA 3QKWA 1PGOA 3BMCB 1U7ZA 3PYXA 4UOZA 4UEWA 3DWIA 4Z3KA 1KEUA 4NFHA 4I3FA 4F5YA 1IU9A 2J3HA 2IYNA 1M8PA 5ALVA 2R8YA 4CPDA 1JXQA 1MNQA 1TDJA 1Y33E 1EWQA 3KSRA 2EWVA 3CN9A 2E21A 3GYBA 4PX5A 3WL5A 3IUQA 4V0KA 1FUYB 1GL3A 3AZPA 1TTHA 1XF1A 1QZ3A 2RHDA 4OSEA 3B2NA 4YRMA 2CLCX 3ZHQA 4G2NA 2YYYA 3IAXA 3IE0A 5JS2A 4HK4A 4GZ3A 1PS9A 3U4HA 5A2QA 3H11A 4AS1A 4G0PA 1YVPA 1P7CA 1QFZA 2BFEA 1SXIA 1IPEA 2R8XA 4YRNA 1FQJA 3KZOA 1OFTA 2HU2A 2P2DA 3CIOA 2XUHA 4AZWA 4TKVA 2MSLA 3TZBA 4X6YA 1X14A 4V0ME 3I9MA 1TAHA 1EGQA 1TJ5A 3O2QB 1ZOLA 2X15A 3R41A 2GDJA 3GLIA 1S8NA 3N2ZB 4CT4B 4JCOA 5AVQA 1PK9A 1EUCA 4PCAA 4K8RB 4RDXA 2MTBA 3K2EA 3W3AD 2Y3IA 1E2PA 3KJHA 4H6VA 4ZOEA 5A0FA 3TNLA 3ZH9B 5LLTA 3OIYA 1NQVA 2YTZA 1Z47A 2E5WA 3OZBA 3VGJA 1AT1A 3ASVA 3FZYA 5ICFA 4C6RA 4F0JA 2B4YA 5HIIA 1JPNA 3VPDA 3S4YA 5CLQA 3DZHA 5F23A 1YQQA 4LJAA 4ZT3A 4MR8B 3EVBA 5KNDH 1JA9A 1UWKA 4PZYA 3U4IA 5JXGA 2GN2A 3QTBA 3M6VA 3LYAA 4WZAB 2F9MA 3VKVA 1K06A 1TK2A 3QVMA 2G36A 3H0KA 4MCAA 3X3HA 4Y98A 5HK9A 4D43A 3MUOA 1PBTA 2WA1A 5ALHA 1CY4A 3DZFA 2NU9B 3ZDXB 3RC8A 5J2UF 1WXFA 3L79A 3L6CA 4WXHA 1T6NA 4ZYVA 3WGJA 2YDYA 5DNEA 4AZ3A 4QWWA 4OX9Y 3OKCA 3F7MA 5LP1A 2C2BA 5DSZA 1G21B 4FOLA 3G0IA 5AYVA 3ZK9A 1TFRA 5KWJA 4NE7A 4JC4A 3Q9LA 3ROKA 2YY5A 2IEYA 3P0FA 4MGKR 4MYTA 4D26A 3HR8A 1V1RA 4CQMB 5JZMA 3QPUA 1JWAB 4DQ0A 4AJEA 2FSPA 4HMOA 4LIPD 5MN5A 4XIFA 2O5VA 1GCIA 1L5HA 2ISQA 3V7FA 1V2GA 4NPCA 4P7JA 2NNWB 3GBVA 3QIAA 1COWD 4H9GA 4KH1A 2RD2A 2QD5A 1N1EA 3BIFA 3D31A 3MILA 4KXMA 2DT8A 4A0GA 4LXHA 5CX1B 2XWSA 5I4IA 4FZVA 2KM1A 3SF8A 3BFXA 3INNA 5I9BA 1TA9A 4NJEA 3TS1A 1N6RA 2J5KA 3TKYA 5FULA 4CKCB 3DGFC 1WDKA 1DKNA 1QIHA 3FCOA 3I23A 2W2TA 2D5CA 1SEVA 2JC3A 3FKSD 3HQ4O 1DBRA 2QLTA 1EK5A 3DHVA 4G01B 5EP2A 3MLEA 1ID1A 3NHWA 2RK4A 2YV3A 3WKCA 3N74A 1H9CA 2H1SA 4QO7A 4RHTA 3ZWYA 4HT3B 2X8JA 5JLJA 1Z34A 4BNIA 1ODKA 2HNKA 4R2JA 4DKXA 5EJ5A 3PF9A 1EWRA 1CZUA 2IPLA 1FXWA 5ESXA 2F1IA 2ZLBA 4EZEA 3E8SA 1KZ6A 4E5MA 2DBQA 4UBOA 4H0NA 2OC4A 1OU0A 2PX6A 4LJLA 1KPHA 2VHXA 1DEAA 1VJTA 2R6JA 1YIAA 2EXXA 4TRMA 1J8MF 1Q0PA 3MSCA 2YRWA 3ZDRA 4G0OA 4JEMA 4DSTA 2I2FA 1M2NA 4Z4IA 2BFFB 2XUFA 1HE2A 1TB4A 2NTEA 3QVLA 4MKIA 4TMYA 3PPYA 1JJ7A 1YZTA 2ZTHA 3MD9A 3OEHA 4M36A 4MW1A 4ZZ3A 4UTNA 2J0QA 2ZS8A 1T4CA 1IB6A 3KPJA 2IYTA 2R8PA 4DLLA 2VKQA 1EK2A 3M33A 4HYQA 3MRTA 3Q3CA 1L4HA 3SX2A 5AW3A 3NC4A 3VYTB 4G6ZA 3TQIA 2VVTA 5DYIA 2PH3A 4E1VA 4I9GA 4BCDA 1BG6A 3NWEA 3LOPA 2YMLA 4TQGA 2XWJI 1P2SA 1ZNWA 2GK3A 1P4GA 3RFVA 1L8OA 1WOMA 3R7DA 3JVIA 1RI5A 3CRQA 1ZMRA 4N03A 5ECWA 4BUCA 4ERXA 3TOVA 1EK1A 4IO0A 3ETCA 2AR7A 2R6R1 3I2IA 1JPUA 3JAWB 4RZ2A 2O3JA 4P9NA 3HVIA 3GVIA 4Z0PA 3T0IA 3F9RA 2QHXA 3PEVA 4XI9A 3HXMA 3VI4B 2VQFB 1PGQA 1Y1TA 2C03A 2FSHA 3LUAA 3O9ZA 1COZA 3EXHC 1DZ3A 1JGTA 1Y7IA 4L16A 5FR2A 3BIWA 1IN4A 3AESA 1VJCA 4LJ7A 4X1IB 1V35A 3ENQA 1PFGA 1X9HA 3PYMA 4YBZA 1GZVA 2XEXA 3ZBTA 4AO7A 1GZSA 3W5AA 1RJGA 3HYTA 5E4FA 2IS4A 1DJNA 4CXMA 1KOLA 3ZD9A 1UK7A 1FJHA 3QIVA 2VP2A 5C9ZA 1H0SA 3SLGA 4QT0A 3WLNA 5BN5A 2OMEA 4IS3A 3CX8A 2XNDA 1CD5A 3G0BA 1Z13A 4R5MA 2O9JA 3ESXA 4WRRA 4QOHA 5E4JA 5F2KA 3OWHA 5IT9A 1GTL1 5EIEA 2F4VB 3IJPA 4QULA 3Q2KA 4EOGA 1PZGA 3NIBA 3NR2A 5ELLA 3WE7A 1WSAA 5TQVA 5KUTA 3V1KA 4TXLA 1EA7A 1ZX1A 2PT9A 3WLMA 3LT2A 5E6UA 1UOPA 1BU8A 1P1RA 3DKIA 4IP0A 1B15A 3B1JA 3VMFA 1ISMA 3GK3A 4FMBB 3NUQA 4Z51A 4FE7A 3N8HA 4F04A 3C6MA 4IX9A 1X8LA 4BFLA 1D2AA 3ECSA 3K6JA 1TTPB 2IYRA 3P0RA 3QFFA 5GJCA 4FI3F 1SCDA 3KTAA 1YQXA 3C3JA 3FY4A 2QP3A 1M9NA 1S7GA 4HLUC 1ZJ6A 3V9PA 5ECYA 2QUKA 2Z09A 1P0CA 5EXDA 4URUR 4ZARA 3SHQA 3HXOA 1GPNA 4ZQIA 3LBAA 1QIJA 4YRPA 1TEVA 5GZ1A 1DXQA 3N7AA 2WU3A 3LC2O 4GUAA 4MKGA 1XXLA 1JIVA 2EKQA 2R5FA 4LCEA 4NMMA 4TWAA 1VPLA 4B87A 1S3GA 7YASA 3PDJA 4GOLD 3I09A 5TJHA 3B6MA 4QNMA 1RAHA 2EERA 3KAJA 4MVJG 3V1UA 1SCUA 4QOEA 2AOXA 3EXIB 4OK3A 2WBLC 1NUPA 5FBKA 1QC5B 4LHZA 2VEOA 1KY2A 3QA9A 4M1ZA 2ROQA 1TLFA 5LA6B 3AWDA 4K05A 4KLAA 1HMYA 5CHYA 3KXLA 1R0BA 1V1JA 2JS7A 5K0BA 1DKLA 2BD0A 1VHJA 3CH6A 3WY9A 1XMXA 2I3DA 4JUFA 3LHKA 4XAQA 2ZIFA 3ADPA 2Y71A 3A3KA 3EE6A 5A7HA 3VU9B 1J2TA 5JDIC 3L8EA 1HXHA 1PZMA 1K7EB 1K4YA 2NZVG 1BOOA 1F9AA 1FU7A 2AHOA 1N0UA 1XK7A 2PZAA 1NLYA 1IDN1 3NIDB 4ZT4A 4B6EA 1H05A 4QPDA 2MT9A 4M1MA 3FM9A 4N41A 1ISJA 1SOAA 4BNYA 1D2MA 1XNGA 1KR2A 3NBXX 1JECA 4R2HA 2OILA 4P81A 4LKRA 4PZAA 1DAFA 4PAWA 5EWMB 5IHXA 2AF4C 2MYUA 1MJHA 1YL7A 4RVSA 1TC1A 1J9ZA 3PHGA 3TNYA 5LXTF 3ZE8A 4RNCA 4W9NA 2IEDA 5EMNA 4U7FA 2GSDA 4Y6SA 3ZWCA 3ZZ1A 4EJSC 5CK4A 3U4QA 4PNPA 4EGFA 3PUIA 3T5AA 4PIMA 1E2MA 3GFTA 4QSHA 1CTQA 2Q3LA 4YO7A 5ES3A 5ULLA 1YZKA 2XUOA 5K7SA 1CF9A 2WINI 1I4WA 3MFQA 2FEWB 3NBZC 1EHIA 1R37A 4OAOA 3TMYA 1SG9A 4RD1A 5FOTA 1D0IA 2D74A 4E5SA 5HKLA 1NU8A 2E1RA 4CIYA 5ILOA 4OH7A 2HZBA 2FPUA 2OLEA 2WT4A 4JBNA 1D9XA 1EXMA 4MHOA 5AW9A 1D04A 4GEKA 1M73E 1ZEJA 1GSHA 3OQVA 3H5VA 3M81A 3RSHA 3SR3A 4B45A 2YN0A 3IO3A 4BN0A 4C22A 5JNSA 3E15A 3A9WA 1CVLA 3R7FA 1VCOA 4F5DA 2WVJA 3GHHA 4MVXA 4RD3A 3S7TA 4D81A 3Q7IA 1U5BA 4X6LA 1AURA 3RRMA 4B7XA 1DAEA 2CXQA 3BE8A 5DLDA 4NONA 3GJ3A 1HRKA 1RRKA 3G8AA 1FBNA 3O74A 3Q3GE 4XYBA 5H80A 4R2IA 3WRYA 4S04A 3R4VA 4YHBA 1SPXA 1UP6A 1RXIA 1MQ8B 2REOA 2YJNA 3A6EA 4ND4A 1IHPA 3DEAA 3KZ1E 2PRIA 2Z8ZA 3WKDA 1FC0A 1J5XA 1JU9A 1GQQA 4BKQA 3GOHA 1RRGA 4LY9A 2ECQA 5INTA 1ZD2P 4L5IA 2G09A 2RKBA 1TI7A 1M8FA 3COYA 3I9V6 1QCCA 4YCBA 3KAPA 5D84A 1T9GR 4GC5A 3ETGA 4JC5A 4FLEA 5JI3E 1ESMA 1A4XA 1VJ0A 2Z58A 4K6HA 3PDIA 4D80A 4O4IB 4IX1A 2M1ZA 4MUKA 5KBYA 1XZLA 3HJRA 1T6YA 3AR8A 4XB2A 4UHDA 5HRCA 2HIAA 2HSDA 1LPMA 1X0XA 5CVJA 5B7GA 4RTSA 1E6MA 4AROA 3ROGA 3DWFA 4RTLA 3A3PA 5IX8A 1B7GO 1Q50A 4KR7A 4NYIR 1BHO1 4M0EA 3ROFA 4DQUA 1K97A 2A8YA 2BFBA 2XF8A 3DZBA 2IQIA 2SECE 2WV9A 1WUJS 3DBVO 4IMPA 4NRDA 4TM8A 4BMZA 3K9FC 1OT3A 1IBCA 4ZIRA 4EDHA 4C2UA 1JR3A 4Q9HA 3FGNA 3QUQA 4F4FA 5TPWB 4MQUA 5JW6A 1FNSA 1QCZA 4PVCA 4O59O 4QFCA 4RIHA 2H3EA 5T8KC 4L6CA 3SD7A 5B64A 3SYLA 3LQQA 4FEGA 2QXYA 3KTOA 2QPLA 1OYOA 3WP0A 3EWSA 1FFGA 4P08A 4XXHA 5K0EA 1EZ1A 2Q6OA 1E0DA 1PR2A 2PGIA 2X40A 2X5OA 4FFBA 3LCRA 3TD2A 1HDGO 1U0BB 2CUTA 3GRFA 4NU8X 1B74A 1QGAA 1YB5A 4XUCA 4B3FX 3C39A 3ZWVA 2QTFA 4XUDA 3PEEA 4DF3A 5A1TA 5KTYA 2ZRNA 5HFJA 4XQEA 2B78A 3LWBA 4E5VA 1NG1A 2A4KA 2B8TA 4RXMA 2AYYA 2WAOA 2CL7X 5CNIA 5K3AA 3FFTA 3WMGA 3B8EA 4J49A 4AMGA 2WI8A 5FTLA 5KOJA 3U09A 1KR5A 4JIGA 1NXQA 1PFUA 3O26A 3VJMA 5AJHA 4NX2A 2OBMA 5K2MA 3GEMA 1J2RA 1C41A 4J0EA 4KZPA 1EESA 2DMRA 3DDNA 3USCS 2HHAA 4YWHA 3MJCA 1IQRA 3WFIA 5CDFA 4CR6A 2IYUA 1H4SA 3NYIA 3ZK8A 3WLLA 2DUNA 2Q4EA 2GM5A 5JLAA 5CDSA 1DDOA 4G5GA 2XMSA 5HR5A 1UZMA 3OSZA 1HLPA 5GJVC 4L74A 5A5GA 4GI2A 3NTXA 4WKGA 4JELA 2YWRA 3X43A 3RV3A 1TQHA 3IEMA 2HADA 3ZZMA 1C3LA 1R8YA 1ZUNB 5HIAA 5FJJA 4B71A 3H3XA 1EDDA 2Z8YA 2AXPA 1M74A 2QLJA 3AP1A 3CRMA 4UHKA 4EO9A 2JIPA 4IOJA 4I50B 3SR4A 4QBTA 4QKQA 3OY7A 5ADUS 2NU7B 3GLTA 1JHYA 1HT0A 1QQ7A 2ZT6A 1CR6A 2IZ6A 1ZGHA 1JQ5A 4Z0TA 1BDJA 1X3SA 2NO0A 3BXEA 3U37A 3ZDAA 3RQSA 3LBYA 1LWNA 1AV7A 2WFLB 3TSAA 1E77A 3NT5A 1PHPA 3QGMA 4XCXA 4YS6A 5HZMA 3CCBA 4RZXA 1SKAA 4ONEA 3P2EA 5DHPA 3R0QA 1TE2A 3D9QX 3N53A 2E0IA 1LVUA 3L2OB 5DE3A 5K0JA 3U4GA 4MICA 5COBA 4U2DA 5L45A 3CZ4A 3BWVA 3H2GA 3ROXA 3OECA 2Y9PB 1T2AA 4LW8A 4DR2B 1Z3IX 3RVKA 4Y9TA 2IUTA 1QH0A 2FF5A 4G63A 1WMEA 3ZQKA 3EFOA 3A10A 4DT1B 1F6WA 1I4OA 3RVMA 2YHUA 4ZCLA 4QELA 2PKRA 3A6FA 3ZHOA 4BJ1A 5JTUA 2QM8A 2ZU0C 1X1EA 5IYZB 3VTAA 4JBIA 4C4PA 5E38A 1G3IA 2GFQA 4DA7A 2R7LA 3JARB 4K9QA 3TLMA 4D0GA 4W5WA 5J58A 2E4UA 1KI3A 2OBFA 1FQOA 3C1OA 1JTFA 4DVJA 4BKUA 4Q9IA 5HJ5A 1TA0A 4N0PA 5BSMA 2B34A 4WW0A 1SG0A 3FYUC 5H0IA 1SOVA 2AG8A 2OCKA 4TPKA 3PITA 4BGUA 4DBLC 4NG4A 4Y2TA 1XZGA 1OLSB 3TUIC 3PX2A 4BQEA 1XSEA 5CG1A 4WKNA 2Z04A 5ITSA 1XXHB 2P8JA 5C51B 1U7XA 3CF0A 1FVOA 3JY6A 4CMIB 1R9MA 2GLUA 2IH4A 1Z6QA 2YHSA 2PNFA 1TKCA 2VRCD 2OORC 2ZRCA 5EPEA 2VXOA 1V4VA 1XRNA 1GNVA 1GT6A 2AS0A 4WBNA 3TEMA 2HO5A 4LF9B 5EP3A 4CLOA 3CMMA 3HTXA 5IKMA 1VXRA 3N0VA 2GBLA 2XMBA 3HG7A 3PWKA 1YVRA 4MLZA 1ZLXA 2BE7A 4MQ4A 2JGDB 4DUYB 3CUWA 1MGPA 1T0IA 2P69A 1N1MA 1KYXA 2I22A 4O0MA 1QPGA 2HCBA 2P9HA 2RONA 3DTNA 4LDAA 5F4BA 5ALQA 3UGTA 3V55A 4DJEC 4CTKA 3NM5A 1X8KA 5JNWA 1SXQA 3O92A 1IXSB 4WVLA 3E18A 4PQGA 1W0JD 4QNNA 1WZEA 4ILKA 5K03A 3H1AA 3BORA 3R5FA 4RK0A 4U2FA 5E7JA 5FOVA 2DH5A 2EZ9A 3RUPA 1TAGA 3UMGA 4F3KA 4N1AA 3RAEC 1EUDA 1I9CA 1D1QA 4XJTA 2G5CA 2R1ZA 1W76A 3FW1A 2GQ0A 2RFLA 1C1XA 3SCZA 1E3SA 1DPGA 1NQXA 3KFVA 5AM1A 1UBFA 1BE0A 2W2NA 3QENA 1WPGA 2JD1A 3TCNA 5H70A 3RSFA 1ETUA 3EIWA 3D6FA 3K7EA 4JB0A 1XLTA 1JRLA 3P1JA 4CTJA 4R9NA 4AXXA 2YWCA 2O8EB 2HJRA 1IM2A 1T34A 4YAGA 4U2CA 2R0QC 1G6OA 1MVOA 4M4SA 2PSEA 2WTMA 4ND8B 4EB8A 1FU8A 1LDBA 1LXCA 2WABA 4RE6A 5LOVA 4OTZA 5KSOA 5FPSA 4YN3A 2V1UA 1TIKA 4DQKA 2ZIZA 4R05A 6REQA 3WNCA 4GXNA 1FPMA 5EFOA 2JATA 4Y9RA 3AF6A 1G9TA 1XNJA 4KVGA 3H5RA 2VJPA 4URZR 1RKUA 4ZAYA 3GAZA 4D82A 3CBQA 4JUCA 4RFSA 1WLSA 3CF4A 1EEXB 1RAAA 3W6UA 1A72A 2QTGA 3W5DA 4V0MA 4GP9A 4ALLA 2PVCA 2AFIB 1E59A 3T3OA 2PVSA 4LFBB 3NQ41 2V0GA 5JXHA 4FCCA 1ILWA 1EUQA 1E94E 1W93A 4GI7A 4UU7A 1H8ED 1NC3A 1ZD4A 3DLIA 4UUOA 4DR6B 1RYDA 1YT5A 2E85A 2FQXA 2PZKA 3B5JA 3R3HA 4ENQA 3EGEA 3HCFA 1QYCA 1RZVA 5CLIA 1RHQA 1DMRA 1ZGZA 2FLKA 2Z95A 3E3MA 4KTVE 5IVIA 5TY0A 3RO7A 2YJ4A 2HJGA 2AEMA 4N3GA 1RJWA 1EGAA 3T7TA 3RGWS 3HU2A 4LK3A 4BECA 3BL5A 1P0FA 4DMLA 5IN4A 2YZKA 3GIDA 3P2JA 4L02A 1K7FB 4YB8A 1AHNA 2XVAA 5CAEA 5F12A 2CBGA 1SXJD 5F2OA 1EXNA 4RO0A 4KQ2A 4WACA 3WLKX 2JFOA 1XX6A 4WNAA 1B41A 1WL8A 2JLRA 1OFUA 3PHCA 1QDEA 1WPQA 1Z0ZA 3H7IA 3PDWA 3PGLA 3PUHA 4RH3A 5MFZA 1JIJA 4G5SA 1O77A 3LW8A 2QM3A 3BDVA 2MSWA 4QO8A 4Q4JB 4V3BA 3SXJA 3IA2A 4Y2PA 5E2BA 3BM5A 1FRNA 4NZMA 3RF6A 4FB5A 4ZCTA 4FMDB 2GCPA 3BH6A 2AJ8A 4PHTA 4NMXB 1FB5A 5CLGA 5C37A 2CEAA 4S3MA 4H7IA 4PSAA 1QV6A 4HNAB 3WQSB 3EC7A 2XCUA 3QEKA 1TTTA 1DG3A 1E9DA 3PXAA 4K3VA 4MO2A 2AXQA 3G6KA 1MDBA 1KWGA 5J2TA 3U4CA 2GN1A 3T0FA 4GLFA 4KV7A 4ER3A 2BI7A 5H83A 3PFCA 2VDQB 4I4IA 2WJZB 3TQSA 3G0HA 3U4MA 3OZGA 2JK0A 1U8AA 2NU6B 2A92A 2WB4A 3COZA 4DCPA 3H16A 1G7TA 3E4DA 1Q0TA 1OGYA 4TLLB 3EVFA 3R0IA 3K1TA 5CFMA 3W5CA 4FW8A 5KSYA 1NXOA 1EVQA 4WT7A 5DOZA 1DXOA 1XYYA 1IXYA 1BWQA 1Q3HA 1LPNA 2HLHA 4U7TB 1VBNA 2PBFA 5KVAA 5KYXB 3WFJA 1V4NA 3JZIA 3ZTYA 1GQFA 2XRFA 3NV9A 1U63A 2B99A 3AEQA 3SYRA 2BZ0A 2BLLA 1WCIA 2C95A 3GW8A 1Z0SA 2X3FA 2WLTA 3E5RA 3PNVA 2EKBA 2ZDGA 3T5TA 1TGYA 3CB2A 1GZ3A 2VA9A 5HUQA 5IDXA 4RS3A 1SH7A 821PA 3UKDA 2NACA 2IX3A 4NEGA 5JSKA 5C8VA 1FP7A 8GPBA 2I6XA 2OWDA 3FCUB 1VCHA 4Q3OA 3LT5A 4UMDA 4YVFA 1X9IA 4MIEA 1BS9A 2DP4E 4RD6A 3RKUA 4MP8A 3M1LA 2Z2IA 1TZKA 4OBWA 3T7IA 4CBVA 2I1QA 1MT0A 5EKUA 1UXOA 5J4YA 3JTMA 1E4EA 3H6HA 1N5DA 2W6JD 3RU3A 3JW8A 4M8IA 3ASYA 1NDHA 1WDMA 2ZEJA 3R23A 3ZQJA 4YJ2A 3E3NA 2P1DA 4TTJA 5C1DA 1BXGB 1WUYA 1BS1A 3F9CA 1L5WA 1KSJA 3BMQA 2Q45A 5E1OA 5B36A 4J4BA 4G1EB 5G2OA 1QOPB 4RPCA 3VMMA 5EHQA 4FHGA 1SZPA 1JEQA 3ZV6A 2E5LB 3TLJA 4IH4A 1IOWA 1RW4A 2P9TA 3AILA 1DAMA 5A4JA 3ZWKA 4NAVA 4O8CA 1WXIA 4IPTA 2D3TA 2X22A 5JDCA 2Q46A 3P97A 4RJJA 5CDYA 2J5XA 5LQNA 2BEVB 2FNAA 4FD3A 2NU8A 3UG6A 1E3QA 1NUAA 1L5GB 3VVLA 4EF4A 3UMRA 2Y6VA 1A5BB 4Q1VA 2CCJA 1XRJA 2HGSA 2IYAA 3OOYA 1P9OA 3IBFA 4C5AA 1N6PA 1FW6A 3KEOA 4M6WA 5TGDA 4FQ5A 2Q3DA 4Q4AA 2OGTA 3RRJA 2GERA 2I76A 3A36A 3LCJA 3MZ0A 1Z5VA 5ENZA 3RDPA 1HKUA 3F6SA 5BURA 1T29A 1GUBA 3HY3A 3LUGA 1ZK3A 3CO0S 2XWPA 1C3VA 2JFWA 3WMEA 2Q9UA 2VZLA 2BMDA 4DVGA 1RZRA 2BE9A 2EV9A 3AF4A 3H9UA 2FEKA 4CQNA 2NG1A 1F1BA 2WU0A 3O95A 5THXA 4NJOA 2PJZA 1KAQA 3P9CA 5H1YA 4AKSA 4NJMB 5I3ZA 5U1PA 3SZLA 4J9VA 2NUBA 4PQFA 4BKOA 1QHFA 4P0QB 4HFNA 5B57C 1KQ3A 2Z5FA 2VUIB 4PR0A 3GI1A 4BNNA 2DFDA 1EP2B 2OQRA 3M6WA 1ENPA 2A57A 1RWPA 2GVZC 4WXMA 3SKXA 4B0OA 3VYVA 3X1XA 3S29A 3AY6A 3I76A 5A62A 2AX4A 3E9QA 2FFQA 1PT5A 1QS0B 2VDLB 2Q50A 4XB6B 3D3EA 1ZU4A 2I3GA 3BILA 3Q7SA 1N92A 3P0EA 1JI3A 4L4ZA 5KDLA 5SZHB 2Z1NA 3RSSA 5EXTA 1MQ9A 1E92A 3ONEA 4ZTBA 4LRXA 2GH1A 5E3IA 1KH1A 4QD3A 4V2IA 1SKQA 4Q9AA 1IBSA 3OZTA 1N2CB 5D5HA 3QMPA 4EF6A 3RIMA 1PG2A 2PTGA 3GJ0A 4Q7KA 4AY3A 2CLHB 2VHWA 1G66A 2UVDA 1RS0A 1Y4SA 1U90A 3EEYA 4WY2A 1T2EA 3KZCA 3O1LA 1QHHB 1H42A 1XE3A 2K6GA 1WBDA 3PD7A 4P92A 3UPTA 3U1VA 1G7CA 1T6ZA 2HLDD 2JBAA 2PKWA 3DLPX 3PHHA 4FUTA 4CLRA 3W5JA 1CG6A 3IKJA 5H9VA 1A97A 1V48A 4NV0A 1AOXA 4J0QA 3ROPA 4YP5A 1ZCFA 1MPTA 3HCAA 4PRKA 4TV9B 2GCEA 2WJYA 1J25A 3CX7A 1B6GA 1ZC3A 2YFYA 3I0ZA 4U02A 3ZNNA 4AF6A 3NHPA 1SBIA 2IXDA 4M88A 3UHPA 5K0CA 4QRDA 4YDSA 2VDUE 3S1SA 4Q9LA 2GDZA 5CYFA 3EVGA 3HO8A 1AVTA 1Q12A 4OLAA 3CVOA 1FYEA 1FUUA 3E05A 1XEXB 1E1CA 5FR1A 4BJ6A 1F2TB 2X42A 2A84A 2ATEA 1CUAA 2GHRA 2J5RA 2WDZA 2WZQA 1IBKB 2OCDA 4EEXA 4M38A 3OSUA 4P58A 3DFIA 2HPZA 3EQZA 4F8EA 3GJTA 4YMGA 4INOA 4WJZA 5CCDA 5I01A 1WTCA 3NHKA 5JROA 3HKDB 3ICEA 4HP8A 1YCDA 1PR0A 4WNIA 4B6PA 2P4HX 1XZEA 1XZCA 1W5EA 5AK6A 3KWLA 4U2EA 2J31A 4UE3S 4YCLA 1ISSA 4LXQA 1DLIA 4M9QA 1UDXA 1A4RA 2GRUA 3MTJA 2R84A 2V5UA 4OAQA 5FB3A 2PT7A 2WIKA 3ZQ6A 1H2BA 1Q0SA 3MIZA 5EXPA 2BMEA 4R8MA 4NCJA 2YS7A 2WSMA 2OR3A 4P93A 1DGQA 1ZICA 4H15A 2O8NA 3FNEA 1QHYA 2JD0A 1M1NA 4R9SA 3IAEA 4OM8A 2V7WA 4DN6A 2PMWB 4GAEA 5BOSB 3UXHA 3B78A 3NB0A 3QFHA 3DE5X 4OFWA 1BWRA 5BXQC 3I6YA 1H8HA 3QXSA 5FO0A 2HXYA 4QTZA 2W2OA 2HA7A 2ZREA 1FFWA 2XE6A 3N7TA 1PKXA 5EP4A 4F93B 3RK1A 5SY6A 5DT2A 5EMKA 4MRPA 3IQEA 3BN3A 1QORA 2O3QA 3DZJA 1Y63A 4HADA 1ML4A 1C80A 3FHOA 1UEJA 4DILA 3C5EA 1KVSA 4PZ0A 1EMDA 3TO5A 4CMAA 2B25A 1KZ1A 2W2QA 2FV8A 4ROSA 3JQBA 5CNJA 1AMNA 3NTRA 2AFRA 2XSZD 1VPTA 4XX1A 3TM5A 5JH7B 4FZ3A 4DQDA 3UJ9A 1T8YA 4QAJA 3GLKA 3VNBA 4CDRA 3FF1A 3HVHA 5CH8A 1NXPA 2AK2A 2GHTA 1SPBS 3AFIA 4IXNA 2QMYA 3HLYA 1BJKA 2ZQYA 3ZUGA 4DJTA 2AZMA 1J2EA 5C8DA 5JI2E 2IZOA 2VCEA 3O9VA 1Z7EA 1XALA 4AYWA 1NI4B 1OAOC 4X3PA 4FR0A 1TF5A 3ICPA 4FJ0A 2NVBA 2X0KA 3UPDA 4F6CA 5IWAB 4F96A 1LTHR 3NIFB 4GF5A 2CVHA 2RB4A 4WVFA 4JENA 3GJ4A 2A9FA 1NWHA 2XOEA 5JEEA 5FKJA 4ZYWA 3H42B 1ISRA 2P77A 1OB2A 4L15A 2X0FA 2MR5A 3KB8A 4AY4A 3EOBI 2BKUA 1JTVA 1P1IA 2RK3A 4G26A 1YDFA 5L7TA 1L7AA 5D86A 1CUJA 3GJQA 4FE3A 3K1AA 3KSZO 2FFBA 4U9IS 4BLQA 3L05A 3C4JA 3WLFA 3H5LA 8AT1A 4QFDA 3QYPA 2I4OA 4MVYA 5JBQA 1JR2A 1A5ZA 2AOTA 3S2IA 4EY6A 3MGCA 4DR1B 3U5TA 4B5KA 4HQKA 4GT1A 2H7XA 1PVVA 3SYKA 1ESZA 5CYPA 4ZV9A 3BD6A 1PJCA 3K96A 3ZE6A 2O8CB 1GA4A 4JT8A 4DLTA 2KS6A 4BC1A 4QLOA 4G5OA 3ZE2B 5DZSA 4CVNA 4B3DA 3OE7A 4Z99A 1QK4A 4PEVA 421PA 2JRCA 4AUKA 3I04A 4R1QA 1Z6AA 3HXQA 1V5EA 2B3TA 1G17A 2BRUA 1UPAA 4LXTA 1ZH4A 4IDHA 1YDWA 3LKVA 3Q11A 3UENA 4F97A 4ZVLA 1FYWA 2HCFA 4LDJA 1OD6A 3U3ZA 3FLMA 4ND1A 2LNDA 4NNOA 2ZI3A 1RQXA 7GPBA 5CLLA 3M9LA 5IBPA 1GRVA 2YCLA 3E9ZA 4V0LA 5C8YA 4CKWA 4O4LF 4O4HB 3NLLA 1F20A 4EPTA 1TM1E 1RVDA 3PB3A 2FZLA 2J6HA 3KKPA 5BWCA 1W94A 2JH8A 3QH4A 3HUFA 3I2FA 3A14A 5CJPA 3ZGNA 2QXUA 3PG5A 5GONB 1KO1A 1SXHA 2HOQA 1NVVR 1XZBA 2R66A 1TZMA 1N6HA 1YZ3A 3ON5A 3OCCA 4L75A 3UANA 5DTIA 3IXQA 1NV8A 3K9HA 3N05A 4OYRA 5TQJA 4LOHA 3CT4A 3M3PA 4JIMA 1EP3B 3OURA 4K6KA 4UVDA 3WDSA 1E7SA 3DGEC 4PO8A 4UTZA 3NC0C 2WAAA 2R47A 1OREA 2GA9A 2KSQA 1YB1A 3NUGA 3G2QA 1CJVC 3MBKA 2O2CA 2X4GA 3U9SA 4C0WA 4YUZA 1GOTA 1T8SA 4F8YA 4HYEA 3D7NA 2LV8A 4LEIA 4ADSG 3MVEA 1U8UA 3R20A 4FT4A 3T54A 4KAXA 4CL8A 5FH9A 3RRZA 1V1MB 2JHFA 1C3JA 3KYCB 1H3NA 1C9JA 2ZJ1A 4UNNA 4D2IA 4N9WA 1YBVA 1HT1E 4JYZA 3GG9A 5EINA 3A1FA 1J0XO 1G5FA 2QV0A 3C15C 3HP1A 4LXYA 3A9SA 2RJOA 4BE9A 2HMTA 3NTOA 2Z5VA 2O3UA 4KWCA 1B16A 3N2NA 3KQSA 5AI4A 3HCOA 2QTVB 4YXWA 3W8NA 1ZRMA 2PGAA 1B0UA 2QUIA 2VZ8A 2AJCA 4IVQA 2VPYA 3WL7A 1K4KA 4GE0A 3RUFA 1NN0A 4U8GA 1X86B 3J7TA 3KVVA 4PWYA 3NYRA 4Y6QA 3RODA 1E1NA 1PS8A 5CX4A 2HDHA 5K09A 4Z53A 1QWSA 4BUZA 1DBVO 4XYMA 1V43A 1J8QA 2QMHA 4GOMD 1DJPA 1YBHA 2J4FA 2SBTA 3DCNA 1DWOA 1FNDA 3NVMB 4IHJB 1GGJA 1YR8A 5DYTA 1UJ2A 1Y1QA 3HUTA 1JJFA 4ZI7B 1XQ1A 4Y6PA 1XRSB 4CM4B 3CVUA 3IPYA 3HXTA 3OZRA 3R5TA 3QE3A 4DMMA 1SURA 4H6PA 3CR3C 3DZDA 1GILA 3H1BA 4KQKA 5FWDA 4HI0E 4KHPB 1T5IA 4CIDA 3KOUA 5CTAA 5H3LA 1ZVQA 3LY8A 1N3BA 2R8OA 3LUJA 2YN2A 3LFTA 2VEDA 2ZYRA 1JLLA 4PSKA 1CULC 1DQSA 3KXDA 1JDBB 4NY1A 3MMXA 3CEMA 4MR7A 5E9AA 4DGQA 2HGZA 1PFKA 2LD4A 4G3XA 4G36A 4KYTA 4DMKA 2OG2A 5B3AA 3B7WA 2ZXFA 3RYFA 1K3FA 4BRZA 4ESVA 4KMMA 2CL6X 3C1AA 3MWJA 5HQ3B 4Q93A 1QMPA 4EJ6A 5KSZA 4UHHA 3S8EA 4JYBA 2PXCA 1W0KA 4F3RA 1PR4A 2C4VA 1XTZA 3DB1A 3WLSA 1B8NA 2DKOA 2E37A 5BUQA 2GESA 5HA5A 3DYVA 4MUAA 5TPZD 1QYXA 3IQDB 2J3KA 5KOYA 2P1ZA 5HGJA 3HA7A 1NY5A 3GYGA 3LA6A 3V8PA 2ZJ6A 1T5BA 3FKJA 2Z4TA 1M1UA 4EW3A 4EG6A 1ID8A 4FGKA 4RK5A 4RKQA 1QVWA 1LDGA 1MOQA 3OZFA 2X8AA 3AUXA 3O90A 4UCQA 3HKEB 2KX7A 3N3BC 2JLWA 1O08A 1RRVA 3MK31 3VZQA 2C84A 2FN3A 4TKZA 4DMRA 1GPAA 4IZ6A 5LPNA 3V4LA 3H17A 3N2KA 3ODPA 4DCUA 5ES4B 5CG2A 4Y2UA 3TMKA 2R1UA 4E03A 1BRMA 1JUDA 3A1NA 5HUJA 2REQB 1PFVA 1U28A 4JBWA 2O6LA 3AFMA 5EE3A 1Y7TA 3TJRA 3WKBA 4QWMA 2MSEB 4RVNA 3D6MA 3A3OA 4R2KA 1LPPA 1TW2A 1L3IA 2OVBA 4RA9A 5CXUA 3KPVA 2OV2A 4HDKA 3LRTA 2BHLA 1JMKC 2QD3A 1P7WA 2DRIA 1VHLA 2OTCA 4Y18A 4N3CA 1B3BA 2K2QB 2JGFA 1AQYA 2I2BA 5YASA 1Y7HA 4LDZA 3QSGA 1DINA 3KKZA 2TS1A 2EP7A 5FI3A 2JAQA 3DHYA 3F71A 4J1NA 1MX9A 1DBWA 3GEGA 4AT1A 3F49S 1Z29A 2PBLA 1OI3A 5D00A 4X65B 4B75A 4JLJA 1HDYA 4KPUA 4WY8A 4K6FA 5JDCC 4RUKA 2GCOB 2O0MA 2GPTA 1I32A 1U04A 3GP8A 2IITA 1P2DA 2GEVA 3UUWA 2IL1A 3OJ0A 4HDMA 1EDOA 1KDOA 1UWVA 1V37A 4MQ6A 4ARZA 1B8OA 1IFXA 4PZZA 2JFNA 1T5SA 1WUHS 4QYIA 3ZNQA 1MFZA 1XCBA 2GNAA 2WHPA 1E9EA 4N8SA 2D0DA 5B3KA 3ZE9A 5KDOA 4ZTUB 1WCYA 3I6QA 5TMDA 3BFVA 3C3KA 2WJ4A 3IQXA 1TADA 3K30A 2WWXA 1JXMA 1OTHA 2LWIA 2ZUBA 5J4KA 5EIFA 3D8RA 4LRTB 3E9CA 1KA9H 1CRQA 1N2HA 1R6VA 3UW3A 3WWYA 3IOBA 4IIJA 2WTAA 4Q18A 3U19A 2HZ7A 3RS0A 2F8TA 4J0JA 5C5DA 2UZ4A 4HQFA 4AWAA 3L02A 2AGVA 4ZVQA 1NVWQ 2XTZA 3FWPA 1CQWA 5EZQA 4L6AA 4DPLA 2ZUEA 2O3SA 4U9UA 2XW6A 1N0HA 2XQKA 2EFYA 3D4LA 3GFPA 2W2PA 4N3BA 4TYQA 4BHTA 3TI7A 3A1UA 1K4MA 4WCVA 2ZZMA 3DR5A 4AN0A 2DWOA 3L0OA 1K8YB 1RT9A 1S2NA 1XD2B 1ZXBA 2CCKA 1WR8A 3GFSA 4NIMA 4XE5A 3TKAA 4CLRB 3KUCA 3U7IA 2GAAA 3N8NA 3I64A 4N8DA 3WLPA 1T3TA 2C3UA 2VNAA 2O0HA 3GRPA 1KP9A 2V7EA 2W8BA 5AHWA 2QE7D 1Z18A 2QMUA 4BNJA 1AO0A 5LBTA 3B36A 1U0HC 1JVNA 1CEQA 4K9NA 4TM7A 5DFAA 3FTCA 2CXPA 3LHDA 3V8NA 2NO7A 4ALKA 1M2KA 2KWIA 3L6RA 1GTMA 1KI6A 2IXTA 2W83A 5LKAA 1W4AA 3QFTA 4BMPB 1E6CA 1L8QA 4NBTA 1YZNA 1GAEO 3DDSA 5LR6A 4HWTA 2O2EA 4ZVKA 3MJHA 1E7WA 4HSEA 1U0GA 3B53X 5LQSA 1OGJA 2QW1A 1IZ7A 4OJNA 3M5WA 4R41A 4Z7NB 1CVIA 4DR4B 4J0FA 4MQ5A 3IOMA 1NKTA 2CMGA 4FYIA 4YAIA 4YQEA 3PBKA 5FFFA 1DAOA 1TOAA 1F8GA 1QYVA 5CA0A 2OCXA 2H00A 2V6FA 2XQGA 5JS1A 4XARA 5JMWA 1MVNA 2C42A 1QONA 2H57A 4ZA2A 2VPQA 3AKYA 3RRXA 4ZI2A 2PRJA 5IUJC 4TLMB 1I4DD 2PD3A 5K4AA 3AHDA 1RYHA 2I8CA 1Q2UA 3DC2A 3TSCA 5LJIA 3LDUA 2WTUA 3C8UA 3BPSA 2W0MA 1GAWA 3RQIA 5BR4A 5J2UA 2EZ8A 2I29A 3LYUA 3NWPA 4Z0HO 1OH7A 5FBHA 2C2HA 1VKNA 1VI2A 3DDUA 5JV5A 5HSGA 4HN2A 3E70C 2JAUA 3OEHD 1R0RE 3UWMA 4HN4B 4MV4A 4X90A 1JG2A 4J43A 3I05A 4BYGA 2OO3A 4HO1X 1SWWA 1JJIA 4JHLA 3T34A 3UH0A 1KOJA 1P5ZB 2ZBRA 4LOKA 3AQ4A 4PE5B 5H5JA 2PUBA 3DNFA 2UXBB 2CXOA 3HBMA 2FW6A 1A9RA 2DF8A 4PGAA 2CY0A 4Q01A 1EQUA 2XR1A 2Y0DA 1P2BA 3IAHA 4BOYA 1Q0QA 3ZHYA 2F3RA 2QM7A 4Q19A 4DNQA 5GOZA 3UN1A 3VPHA 3B7PA 3VOAA 3ZU4A 4EX6A 2YWXA 3NAGA 4Y67A 4QATA 4X7PA 3EGCA 4W7SA 1GRRA 4AG5A 4CG1A 5F21A 4N4AA 1J2JA 5KNCA 1RQPA 3LC1O 4LECA 4DBZA 1CXZA 1JZTA 1PSDA 1XKQA 1QVZA 4WCFA 2W2LA 2EW2A 2BJVA 4I1IA 1TX4B 2PLRA 2M6KA 3LUCA 3I32A 2C7PA 5KYTA 4UXJA 3ZDBA 2W4QA 2P9CA 2ZYTX 1GL7A 1HURA 4GPD1 3IHLA 3AG6A 1JG3A 2VOJA 2WF9A 3SX4A 3GDOA 1MB2A 2RI6A 3LUDA 3O84A 4WSOA 4JAVC 2VK1A 2J0UB 5B58T 2IEZA 3GDWA 1N5JA 2G0TA 3FYHA 1WXHA 3HNOA 1JEEA 1IXKA 4EKIA 5BNIA 1DOHA 5IJXA 4QM6A 2G40A 1TCCA 1QTRA 3TPCA 3ML1A 1X1BA 4OUKX 3ZCSA 2VRWA 3CR8A 1JXOA 4B3BA 1RACA 2RG7A 3ZWDA 4B3TB 1ZIDA 2ASEA 3H6GA 1P6QA 4J1QA 1V25A 4TV8A 1I51A 4S24A 2CCGA 5C8ZA 3JYHA 2ODTX 1J8DA 4G09A 2WB2A 2ZR9A 2CFCA 1MQAA 2NUPB 2XTMA 3D0QA 4ZRNA 5FOWA 1E2DA 2EG9A 1K2VN 3D6UA 2FWAA 4DIDA 1GN8A 4NYMR 2PS0A 4NBUA 2HRCA 4HB4A 2E5FA 4ZT6A 2O3RA 4RGQA 1L8XA 4WLUA 4X7MA 4DG8A 4N48A 3MMNA 2VUSA 1AK2A 1NSFA 2BY4A 3F2VA 3ZXYA 1LFDB 4KV9A 4F1JA 4H3VA 3QX3A 3SIWA 1OBFO 4KIGA 2YHBA 1ZIXA 3E61A 3S2UA 3P32A 4C0SA 4QSMA 3VV3A 4M9UA 5JPCA 2G7ZA 3O4HA 4E0BA 1H2EA 4L51A 2EL7A 3I5AA 3KYDA 4L2IB 4JT2A 1NR7A 2IU4A 2PGXA 1KYZA 2HRZA 4B8YA 4M89A 3O4JA 4DDHA 2CHQA 4OATA 5DEOA 4YP9A 2PUDA 5G53C 3VKFA 2XHEA 3SHOA 3V2UA 4R2WA 1RYEA 2D1YA 3PWZA 4KE6A 1BRTA 1PL8A 1UPBA 4WLEA 4XGQA 3WJAA 1N5IA 1CY8A 1TUGA 2R6CA 4E46A 3M8KA 4KE8A 5DN6A 1J0BA 1YMQA 3L04A 4UE2A 3K9CA 2H31A 3R6LA 4NMWA 1Y0BA 3KTFA 1GTSA 1S96A 4XGNA 2I5PO 1CUXA 3SJUA 4BRUA 1NBIA 3QBJA 4BMOB 2CWWA 4NDAA 5AXAA 4BNKA 1R8SA 1BEZA 1OFGA 4MAAA 5ALGA 1KMQA 3S7ZA 1QH9A 4BNXA 2GKGA 2CDNA 2B1JA 1CNFA 3EVZA 4JX8A 3WBJA 1NUHA 3PCXA 5L9AA 1TM7E 2NZUG 2FPXA 2ZWOA 4AMUA 2FG6C 2G7MC 1DO0A 2Z5LA 3EMBA 4L08A 5G3YA 2OVFA 3N07A 3KSMA 3VPGA 1CC1S 2UZ3A 1T0PA 2LRHA 2C61A 5A4MS 7ABPA 1XQWA 3TTUA 3I9LA 4JBLA 1X7WA 3KR0A 1AD2A 2PPVA 3VSBA 4CFSA 4E2YA 4ZCSA 1QRUA 1UC5B 4GNKA 3K32A 3AB3A 4KIFA 2J6BA 4RXUA 3IB3A 1FTNA 3R7LA 1E5QA 4BZZA 2BTQB 4P3OA 1PSWA 5B3JC 4NCHA 4RLQA 4DR5B 4IG4A 4V2UA 2Q2VA 2H1HA 5FTMA 5KNBA 3I62A 1QPBA 1G5IA 3FWHA 4JP8A 4ERNA 1J7JA 2BZ1A 4PYRA 2H8KA 3GLRA 4PC7A 3U62A 1X7ZA 3CJQA 1XTQA 1GCAA 3EQ6A 2J09A 4BS9A 4DCJA 4M8SA 3ONWA 3LCVB 5EQDA 4Z8XA 4IHQA 4K6MA 3MQFA 3OF2A 1KDTA 1ORIA 4MR9A 3AF0A 1EA5A 3KJZA 3REGA 4LX0A 2ID7A 3Q3IA 4I5EA 3W8DA 9GPBA 2E4AA 4CMEA 2QPAA 2C0PA 2F43B 5F3DA 1ABBA 3LZDA 4C87A 3B6ZA 3HJGA 2EAUA 1YRAA 3H5WA 1VYUA 1Z82A 3NX4A 2FMHA 2FSVA 3UJNA 3AO0B 5KVCA 3MS2A 3OTHA 4LJ6A 1UMCA 1Z7WA 2FFHA 3QLUA 3H97A 1SVKA 1KQNA 3V4VB 1ZSYA 3F8SA 3GUHA 1TYCA 4RGVA 4RULA 3M6MD 3G1UA 2F7SA 1G2OA 4JNCA 3QLVC 4M0KA 5A3JA 3NHRA 3FPHA 4RVDA 4XM1A 1M0TA 1P4JA 1VQ1A 1YDGA 1PWYE 4HNSA 2VLBA 2FQQA 1KI7A 2Q7OE 2OO7A 1CZRA 1GPMA 2DHRA 2RGWA 2ZUWA 2M32A 3AR4A 3DBRA 3FDZA 3JX9A 3WWOA 1RKXA 4TX1A 1WQ1R 3B60A 2CF5A 2HU5A 1W36C 1KAEA 1N6LA 3IBCA 4TTVA 5TC4A 4UQOA 3MPOA 4ZVOA 1TVCA 5T64A 3DVAA 3I34X 2GAIA 3EFBA 3OOEA 4GD3Q 1G5RA 2GAFA 2JHGA 4F46A 5LXTA 1GZHB 2H5IA 1VSUA 2FPRA 2D5AA 2XGOA 3H13A 4MUGA 4MW6A 5EOVA 1LSJA 3BMOB 3OEWA 4ZT7A 5BN3A 5GP1A 2P2YA 4E7PA 1Z4MA 1JI0A 1Z56C 2K4MA 2O2SA 1Z4JA 2HIMA 5A2GA 1M1YE 3I1IA 1TJNA 4IM7A 5JRZA 1SCIA 4Q00A 3RYCB 1XHLA 2W37A 5FUMA 4DNOA 4EI8A 1PJ4A 1BE1A 4FFVA 4DV3B 4EKYA 2DB3A 5KTSA 1DCFA 2QTHA 2X9NA 1LDYA 5KAPA 3HJBA 1XPRA 4ZT5A 5I6DA 1JFRA 2H2DA 1RMYA 2HF7A 3WV5A 1FMLA 1JR3D 2II6A 4I4LA 1V3QE 1TIPA 1W5SA 2FN9A 2LDXA 3N39C 3PS9A 3ADCA 1WZIA 4QPZA 5DNVA 1Z0AA 5IK2A 3S1AB 4XOUA 3SNHA 2PHZA 4JLVA 4A5OA 3LPNA 1OZ0A 1AE1A 4P4NA 5JYBA 3R6GA 3HFGA 4UAGA 1J24A 3NETA 2BKXA 4CCWA 1QGYA 3T3IA 3KZVA 1PBNA 1BN6A 1SOWA 3K0FB 2IS6A 1P31A 3DO8A 1W85A 4Q3EA 4EA8A 3ORRA 1KYQA 4BVHA 3BIXA 1ICIA 2VK8A 1UKYA 3DKPA 2HQOA 4J0HA 3ER6A 4PHHA 5FPPA 3V6MA 4RK6A 3R77A 1CQJB 4IZIA 5JJBA 4HKTA 3IUMA 1E9FA 2ZTLA 1X19A 3KVRA 1KKMA 2JJ2A 4BVBA 3C24A 3NI2A 1RRPA 2ERXA 3NHFA 1LBTA 2PKYX 3CNHA 3Q88A 4TL8A 2CL5A 4OMDA 3DWEX 4DSAA 5JY1A 5LA6F 6AT1A 2PFGA 3VJRA 4OH1A 3FGPA 1V4BA 2Y1KA 1I3KA 4KBYA 1NURA 2UKDA 1TKAA 1RFLA 4KC0A 2Y99A 3T3PB 4BVLA 5DI3B 1VCIA 2WIGA 1BHQ1 2XHZA 4IXDA 2C5AA 2V6BA 4CMJA 4FQ8A 1NVMB 1RYNA 4FPXA 4DRXB 3G8CA 3K72B 2R6AA 1KBZA 1V7CA 4KSBA 2QNIA 1M8GA 4QZVA 2XGSA 4ENPA 3H7AA 2ZSJA 1YUMA 4K3UA 3HB7A 1K8XB 4W63A 2UVPA 2WJVA 4YTEA 3C70A 1GPLA 1ZISA 4S2EA 1WXXA 1T26A 1KYVA 2B8EA 4KLZA 5ALRA 5P21A 4MITA 3ZCUA 4QNRA 2WJPA 1CP2A 2V6JA 2DH6A 2HM7A 2RGUA 3QPCA 4A0HA 2H6EA 5G1NA 4DEVA 2RHCA 3FBWA 2D8AA 1E2EA 3UKJA 1FF9A 5REQB 5K01A 4ZEMA 4CEIA 1GG5A 3GLFB 3D2BA 1Z8NA 1ZMXA 4QGFA 2V65A 3LC7O 4CYMA 1XDDA 4MGZR 4P82A 4KPGA 2YCBA 3EHDA 2JFYA 4QPCA 5E2IA 4OMCA 1NXVA 1GZUA 2XDYA 5CCBA 5AKYA 1XP5A 1TM3E 4RYDA 4I36A 4M0UA 3ZU5A 1T91A 5HQTA 1OIXA 1U8EA 5AKKA 4A8JA 4J7AA 3THXB 1FDWA 1JSCA 5K3FA 2XXBA 4PYIA 3NHAA 2VNKA 3DD1A 1ZAYA 4M54A 1RP1A 4KL8S 1Q74A 3RI3A 3V2GA 3SVLA 2HK6A 5FWXB 1URPA 1B42A 3G5TA 1EI9A 1S5PA 3NKFA 4MMYB 4WK0B 5LYJB 4BXOB 4NXNB 3I2KA 1GQSA 5AK0A 2XMCA 4IY1A 1YC2A 1Q7GA 5EGNA 1Z4LA 3WGMA 1PT8A 4U7JA 3GWGA 1KAHA 3B82A 4LJYA 2XDWA 4FNOA 1V0JA 5C1OA 3UJDA 4TKMA 4NCBA 3QWFA 1CS4C 3IIEA 4D9FA 4OFXA 2PUJA 3U44B 4ACAA 3G59A 3CNEA 1GWNA 4DZTA 3C87A 5AXCA 1Z62A 3RCBA 5IT4A 4REQA 4BJ3A 2WFAA 4AQYB 1VOTA 2EIHA 3T9AA 2VL7A 1JG6A 4Q4HA 5JZSA 2HRBA 3NBAA 3SYNA 2F3UA 1VECA 1GY8A 2XIJA 3LKZA 4TLDA 1I5RA 1YE8A 4B1FA 4HGOA 3I1FA 3D6AA 5IVPA 1UBKS 5FAKA 1W5FA 1YVDA 4DA4A 3SSAA 1PUIA 4XFKA 1R0XA 3LW7A 4XJXA 2GYYA 1TECE 4Y0AA 1ZOIA 4RZIA 1V95A 4XWAA 3QWHA 4IF4A 5BT8A 1E5LA 2KB0A 4RPIA 2F3PA 1YD7A 4JP3A 1LNZA 4NZPA 3TRIA 1M2OB 2GPJA 2V6MA 5JAHA 1AKNA 1MABA 3ABIA 4OGKA 1WDLA 2RI0A 1Q14A 3I5MA 3L5OA 1SD5A 1Z74A 3JD4A 3AIMA 4O4IF 4F4IA 5FI5A 1FX1A 1SBHA 3DBOB 3KPUA 1EM8B 1L5ZA 1VRVA 4GMHA 4BNUA 1BYUA 2GB4A 1Z12A 4JR1A 1DXHA 5DX8A 1KAMA 1MA3A 4NE9A 5DNDA 1T2NA 3PVZA 1XVVA 3JRNA 5DTQA 4KWHA 2E4WA 3WBFA 1X80B 1HORA 3MT9A 5D5PA 1W4LA 3S8YA 4M49A 1E5VA 5DV9A 1G8AA 5EHZA 1N2OA 2IEIA 3MNFA 4YP6A 5KI6A 4FGWA 3H6KA 2QGFA 1XL0A 3BGVA 2D0PB 5DIZA 1EFRA 1R27A 1V26A 3V8BA 4ZZ0