2MR5A

Solution nmr structure of de novo designed protein, northeast structural genomics consortium (nesg) target or457
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
136
structure length
136
Chain Sequence
MGTVVIVVSNDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGAYEEVVRDIVEYAQKEGLRVLVIKVAQDQELLERFYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed Protein OR457
publication title Solution NMR Structure of De novo designed Protein, Northeast Structural Genomics Consortium (NESG) Target OR457
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 43
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mr5A00
2LRHA 2KPOA 2LVBA 2LCIA 2LTAA 2L69A 5GAJA 2N3ZA 2N75A 2MR6A 4J29A 2L82A 2LR0A 2LNDA 2LV8A 2MR5A
chains in the Genus database with same CATH superfamily
2YY5A 3TI9A 3GLGA 2O2ZA 3DE1X 5HBRA 4HG2A 1VHWA 1C9JA 1D4OA 4XIYA 2RK4A 1J2YA 1ONOA 3TXXA 4Z53A 4TV9B 2ZJ1A 3R1IA 4D25A 4AJJA 2ZI7A 5KPJA 3NPAA 4MINA 2A9OA 1UANA 4IIJA 4Q7JB 3JRXA 1OH5A 5A4JA 2RI0A 1ENYA 3FOEC 1NLMA 1YHZA 1NVVQ 2PPLA 2BC9A 4QGBA 2VDWA 3ETHA 3CH7A 3AYXB 3I5MA 5B3JC 1N7JA 3V33A 1MNAA 6Q21A 1RWOA 3H1FA 2BAGA 3QLVA 5D3ZA 2HNBA 5TEVA 1T4DA 5DK4A 2IU0A 1XYVA 3DT6A 3R3JA 1TYAE 3V2UA 1R8XA 4IM7A 4DV2B 2C04A 2ID8A 3WGYA 1YA6A 3QKTA 1FFCA 1KIMA 1QIHA 3HK2A 3O82A 3S3TA 5EP1A 4ZREA 4D9CA 3A6PC 5IAGA 5K6AC 1LEHA 2CD7A 4DXAA 4X3OA 1XAIA 3VNRA 1RKQA 1YRLA 2ODTX 1B6GA 3A0RB 3AR2A 4RLQA 4HAIA 1E1CB 3CLHA 2PKCA 2QN1A 4ZAGA 4DDWA 5I4IA 3CNLA 1DEKA 1X7XA 3S2YA 4DLWA 4C30A 4YYEA 5BVGA 4DMLA 1WUHS 1OTXA 2NO7A 3MXOA 3EVDA 1YE5A 4FINA 5D84A 4I5IA 3QUSA 3WWZA 3DV9A 2O6LA 4KXLA 4DGSA 2HSWA 4RHFA 2E37A 3C3JA 1MHTA 1DJMA 2A5YB 4DCPA 3WMRA 4AK9A 4HPXB 1EVLA 1SVLA 2ZAOA 4WFIA 3W5HA 1CZKA 3IA7A 4PTZA 2BKUA 1TAGA 4YHBA 4UU0A 1AUXA 5DNDA 2NV0A 5ERYA 1SFRA 1XQ9A 3ND6A 4AQDA 2LKCA 2Q2NA 4BHTA 4ZYZA 1RIIA 2OV4A 4FWBA 2XT9A 2GT1A 3WQSB 3K5WA 2I78A 4L9SA 2RBKA 4WXMA 4BLPA 1D2NA 1RLJA 4FLMA 1EVEA 3ZG6A 1IOZA 3EDMA 3K30A 4Z4EA 1KC1A 2PTGA 3QE0A 3U9SA 4AZWA 4YH1A 5ITWA 3JSAA 4A0FA 1DWPA 4LC9A 1RAHA 1R0ZA 4H7HA 4AMUA 5D5QA 2VRCD 2Y0BA 5JH7B 1EM8A 1OROA 4NV0A 5WRFA 4OQ4A 2XHEA 1C3LA 2ZTLA 3F8WA 2GVZC 4LXTA 4F8YA 3A9TA 2GS9A 3CLSD 2VDJA 2MMCA 3JWIA 4G85A 1P80A 4R05A 4ALLA 3U3OA 1CRQA 4M60A 3EY4A 5F2NA 3PF9A 4B8WA 5EJMA 1GVHA 2MSNA 4ZDWA 3SC2B 2R97A 4PW0A 3QXXA 2BONA 1IPEA 1P5JA 3H04A 1GCOA 2BM1A 5CDUA 2VUIB 2GK3A 4D9GA 5MHTA 3QXGA 1YR2A 4KFUA 1G1AA 3F1KA 4PEVA 4AI6A 1BFKA 3U7FB 1Y1TA 3L41A 5DYYA 1RXUA 1Y7IA 2C7PA 4Y3UA 3HDJA 2B4YA 2JAWA 5J2TF 5TGDA 1RYYA 3WGNA 2DR0A 3WRXC 3PQ5A 1Z5PA 3DOIA 1AMOA 5EKDA 2O3JA 3QF4A 4U4AA 3KQVA 2XMPA 5AT1A 1TIBA 2FOXA 4F96A 4XRGA 1HYBA 1KA9H 5CT8A 4EG3A 2P6OA 4TLEA 3UT5A 3VDQA 1PD1A 2FPPA 2GPJA 4Z1OA 5KWIA 1FTNA 3MCTA 3WYEA 3K7EA 1QX4A 2FJUA 1XYGA 5KOJB 4KFSA 1ULTA 3M70A 1THMA 3AR3A 4D9JA 2HDNB 3VZDA 2W2VA 5IWAB 5LQAA 1WPGA 2PUWA 4QTXA 3W3AH 3FTEA 4PYMA 4FHCA 4PNZA 1JIUA 2BM8A 2H2IA 1R50A 4G5GA 3IMKA 1G17A 2FCRA 4GEKA 2BEUB 1AHNA 3OH8A 4WCFC 3KS9A 2YL2A 1GN8A 3HB5X 4XE5A 4C4XA 4C4ZA 4BY9E 4WBXC 2YRWA 4KQIA 3AILA 3DT8A 4LGMA 1T2FA 5COBA 4DBLE 1P2BA 4IXNA 2HLDD 2F3UA 3A6LA 2COEA 4CT4B 2Q1SA 5BW8A 3QMMA 2Q1UA 4MRMA 4RTQA 3FFXA 1XZLA 2IUEA 1X8KA 2QJOA 5DLYA 4B3SB 4MVJD 1GQRA 1OILA 1VMDA 5LBIA 3ZE6A 4D9IA 3GJ0A 1MB2A 1TADA 2Z2ZA 3FUUA 1WA5A 3WR5A 3V9PA 4IPTA 3KHUA 1F8FA 3UYKA 2F00A 4IGAA 3U4QB 1OX6A 2OBNA 3WYCA 4HBGA 4IDFA 4I4TA 4O2LA 2G72A 3HSYA 5DNUA 3VYTB 1Z62A 5CJPA 4HDNB 1II9A 4DAOA 1GSHA 3RK1A 2OYRA 5JNWA 1H1LB 3D8BA 1QG6A 1CR0A 5EMHA 2QLBA 1XVTA 1P39A 2XE4A 2HM7A 1VPWA 1NL3A 1QH8A 4JJ6A 4X44A 2G1PA 1D4AA 3E5NA 3L9WA 1IK6A 1VA4A 2XWJI 3V2GA 3ITKA 1DDGA 3ZJYA 5K0BA 1STOA 2YWBA 2Z3VA 4K8RB 2JNWA 3LG2A 4LDPA 4MV9A 4FFMA 2N0SA 2ONYA 4W1QA 3UFXB 3EQ2A 3PE6A 1KR5A 1ST3A 4FMCF 2W22A 2E9SA 2YWHA 4LI0A 3LXMA 1CZRA 3AM4A 3RVRA 1IRIA 2RIRA 1P5RA 1V2HE 2QS9A 2V97A 2WU3A 3FWYA 5IHXA 4JEIA 2O0LA 2JLBA 2ZUCA 2JBAB 4RWEA 1CB0A 1QH1B 3VTAA 2O07A 4C0HA 5BYAA 4PXAA 1L1FA 2GEKA 2K5UA 2DF8A 5AW0A 1EGQA 2EZUA 1GG5A 2GN0A 5G1NA 4CE6A 5SY6A 4BCDA 4DDHA 3CFYA 3OSZA 2P9GA 1DIBA 1VJRA 4W5HA 1AF7A 1TA4A 3DEJA 1T2CA 3CNOA 2DBYA 3EASA 1VMKA 2WT8A 5A5FA 1Z5WA 4ENTA 4D0SA 1P1HA 1MQ9A 3KVVA 3DBOB 4JHXA 1M2JA 1NJGA 3FHCB 1Z13A 1B26A 5CM2Z 4YAOA 5CVDA 5HRAA 5KNDD 2WRZA 1QFJA 2QPOA 2XGSA 1GNTA 1RI2A 1FP1D 3DAHA 4L6CA 3L6BA 3D7KA 5LXTF 3QLTA 3WAKA 1M5RA 2EKBA 3R9KA 3SBEA 3JRNA 3BZBA 1XZNA 3OKPA 2WAMA 4Z7JA 4G56A 2OBYA 3DTTA 4S0XA 4XWYA 3PGA1 1XAHA 5CBPB 3WGIA 3IALA 4KLRA 1L9XA 4TLLB 3RCBA 4JLMA 4R2XA 4DANA 4XX0A 1XC7A 4M86A 4F93B 3CY6A 1TT7A 1PJCA 3PC6A 1HX7A 4Q3OA 1GV1A 1FUEA 2ZUWA 1CVIA 4GEGA 2GESA 1ODTC 4A6EA 5IT9A 4H0NA 2JI8A 4RY9A 1S3FA 1CQPA 4YPVA 5ULLA 4KDEA 3OZFA 2X58A 5LM3A 1X15A 2XUKA 4TRJA 1BDHA 3W5VA 5H1YA 3PJFA 1E0KA 3M6VA 4IIFA 4MQ6A 1NA5A 4CIDA 4CV2A 4YRSA 3LCMA 3B6IA 3EEBA 4LDJA 2IXAA 1CX9B 3ZS8A 3BYZA 1F8XA 2WJGA 3CMMA 3KQSA 3TSYA 3CG0A 1T36A 2FPRA 4QYIB 2QP4A 1SUPA 1W30A 1J0EA 1DKPA 4HXGA 4WK2B 3UHOA 4LDNA 4EYEA 1LVHA 5LU8A 5EZYF 1YBAA 3E9ZA 3VJMA 4BN5A 4J0HA 1WB9A 3O94A 4D8VA 1IBMB 4IEIA 1VC2A 3GJ6A 1IJFA 3GLSA 5CFRA 1N75A 3K6SB 3IO3A 3O2QB 3R9XB 3LDAA 3N2GA 3PQ8A 5FLKA 1QNFA 4MEJA 4FDTA 3BE5A 4EB0A 5U1PA 4YCJA 4MKFA 4MIKA 4H1HA 1W8DA 5T57A 2W4QA 1XNJA 2OEPA 3RAGA 4BMXA 2B69A 1WD5A 4JYPA 2DFDA 2NYAA 2X8BA 2PUVA 5KWSA 3ADPA 3I0NA 1XU7A 2G9VA 3G9TA 1Q57A 3ZBTA 4PBRA 3AEYA 1E1DA 1P5HA 3PK0A 4QWMA 3GLTA 2X0KA 2ZG6A 1CUVA 3V6MA 5JAZA 2HU8A 4DHWA 4F3NA 5DN6D 3Q7RA 3OE7A 1Y1PA 1RM5A 4CIXA 3DULA 1NT2A 2CHFA 1SUCA 3H8JA 4BU0A 2YHIB 1L4NA 1TKCA 1X1BA 2GCEA 1FQWA 2DQSA 4GECA 3DWEX 1E99A 1ST2A 1DC3A 1JFSA 1KY2A 5JZMA 1HXHA 3NTUA 1KVQA 4OATA 1YDMA 1FK8A 1XMVA 4WSOA 2AFHB 5DBIA 2VHWA 2NACA 1K7SN 3RREA 4M53A 2HRBA 2A1UA 1IPHA 3NHBA 1WP4A 3PEEA 4IJMA 3RC3A 2P2LA 4LHEA 4X1YB 2IXTA 5B1IA 1NNEA 4U2FA 2EDCA 3MMXA 3EXG2 3MMSA 3TZKA 2JJQA 4MJ3A 4EHKA 2X5NA 2G83A 1AGRA 3MGGA 2ZIFA 1V4BA 2V9PA 2X0NA 3NEJA 4LYDA 4P58A 1YDFA 4V02A 4YCDA 2C61A 1N92A 3GJQA 2DFVA 1GTRA 5CGZA 3TBFA 2PG3A 3INTA 4G4SP 3HKBA 4JODA 4NIMA 5I5EA 4NRDA 521PA 5MN6A 4R1MA 2NO5A 3RADC 3AVXA 3NGMA 2BBWA 3ZGLA 2AW3A 3U49A 1DG9A 1W6UA 2QRQA 3QJGA 3TB6A 3C6MA 2XB8A 1AMUA 2EWWA 2W11A 2HA5A 5LDHA 3RRFA 3WHLA 1JHQA 4FGSA 1ZCZA 2R6DA 3ILSA 2XMBA 1FU8A 2SCUA 2Q1XA 3CLTD 4D9MA 1MV8A 2GLTA 5FWXA 1V5EA 3H8WA 3DVRX 4EUFA 2OAEA 4ENWA 1RYMA 4FX5A 3TBHA 5BYJA 2X2OA 1F51E 1OAKA 3ZU3A 1CLUA 4HZUA 2G8NA 1E9RA 1L8OA 1M75A 1FSSA 1MO2A 3HCWA 4LWZA 3IPYA 3PS9A 2PUBA 4I4CA 3RYFB 1L7BA 3ZGXA 3A9CA 4XJTA 2EW2A 1RVV1 4DKJA 1C0LA 1FX0A 3LLUA 4P5DA 1QWOA 2IW1A 3QKRA 2H4JA 1LPMA 4NQRA 4RA6A 3SIRA 4AMBA 1CZUA 4I08A 3ROMA 1NBHA 2HCJB 5A5GA 4G5SA 3S81A 4Q39A 1S9HA 3DFZA 1NVVR 3PGMA 1GNPA 4UCQA 4B44A 1WZ2A 1E62A 2FN4A 2EF1A 3M6MD 4PTYA 1U0HC 1ZM4A 1BN6A 3OTOB 3RFUA 2J9FB 4PCUA 3R76A 1G8PA 1LQ2A 2HSEA 3X1XA 2XYPA 5FTWA 5F1PA 1X70A 4J4BA 3O8LA 3PRHA 4MV7A 4WK4B 2OK8A 4WBNF 1OFUX 1ISHA 4MQ5A 4DLTA 3G2PA 3S0JA 3EDYA 2RFLA 1A88A 1GGVA 1YJAA 2HF8A 4LV5B 3QZUA 4IEFB 4LXGA 1UDBA 1ISIA 4NCKA 4KX3A 1YZKA 4Y2PA 3TLJA 2WDZA 3ROPA 3VPDA 2EU8A 2KB0A 1RS0A 2Q41A 4H15A 3QG1A 5J43A 3DE5X 1EFRA 2IIPA 4Z3OA 4W63A 1RWWA 2PGAA 4R1NA 2IV3A 4RDXA 4GYKA 4CM8A 1I3OA 3VR5D 4OP1A 2XEXA 5AESA 5JZ9A 1JJIA 2CK3A 3V1YA 4JMPA 2PUTA 1EE2A 1VE1A 1EGMB 4U3JB 2CXRA 1UMCA 3HP7A 3BA1A 4BZWA 1N5JA 1BS9A 4JBNA 3Q9LA 3RLIA 3U44B 2RGRA 4NECA 1DZIA 1QLWA 5F4BA 4DBVO 3L93A 1D8TA 4WGFA 2ZB7A 2IX3A 1KQOA 1Q0HA 2O2CA 2OMEA 5FPYA 3EBPA 1U7DA 4ROTA 2IWRA 3TB4A 3HRKA 3L46A 3ICWA 4KB5A 5CVVA 4F72A 4ZEWA 2XMZA 1ECBA 1KMIY 1YAJA 4MUEA 3RBXA 3K0FA 2ADOA 1B41A 3RS4A 1CY4A 2JIMA 2Y27A 1U5AA 1VMAA 3H8VA 4TMFA 1QQBA 3CPSA 2CCKA 2GARA 3DVLA 3UJ7A 3VPBA 2Q7XA 5EJ8A 5KNBA 4C7KA 1D9ZA 3M83A 4F06A 4TV8A 5DN9A 1O2DA 2CUTA 2GHIA 3LLVA 1WUTA 4ZEMA 5JNSA 1HKUA 1RTKA 2JANA 2OORC 3JAKB 4KN9S 4MVJG 1E5DA 1ML3A 3QW4B 4B45A 1FTQA 1EWVA 4NJMB 3IAUA 3EEIA 3CUYA 4A03A 3BF7A 3CO0S 1D5WA 4TLDA 1EXNA 2QTLA 2F1HA 3CJRA 3LHDA 3ME5A 4WACA 2H00A 5AQ1A 4HNUA 1S8NA 1JLLA 4NK4A 1L3BA 1RM4A 1XFDA 1KDZA 5LKRA 2Y9MB 3P0HA 1O4WA 3QENA 4GOJA 1TJ5A 1MA0A 4BNGA 2X23A 3TOZA 4G24A 5C31A 3U7RA 4MVJF 1GCAA 2MYNA 4ZGWA 1TT5A 3WE7A 1LQTA 2ZI3A 3DOJA 5HDBB 3K05A 1IZ8A 5C8VA 3B1JA 4MCJA 1RWNA 4EDFA 3KSZO 2BGGA 3HGTA 4K86A 3FJYA 5JHHB 4KIUA 2W6ID 2O05A 2CNNA 3MUOA 4QSMA 4RJKA 4ZYLA 2FN8A 2AN1A 3LP6A 5LZ4A 3RVNA 1LF0A 2BGMA 2CXOA 3G59A 4AWAA 4BNVA 3LHKA 2ZWPA 4BVHA 1GSIA 4V2IA 3TOVA 1ZU5A 4K2AA 2C03A 5DV9A 1XAJA 3PF8A 5T8KA 1UXOA 3HB7A 3QU9A 3R6GA 4A6DA 1TJNA 2C9CA 1WVIA 2XUOA 3DGFC 3EPPA 3AI2A 2QP3A 3PQ4A 5EMMA 1DFIA 1DAMA 1NQWA 3ZXSA 1ZC4A 3ZHOA 4D45A 4BE7B 3EYAA 3W6ZA 5K4GA 4NU8X 4UM9D 3WWYA 6CHYA 4CF7A 3I0MA 4ZYWA 4BNYA 1DHRA 2RC6A 4Z4CA 4CM1A 1VI6A 3U81A 2YW9A 2FX3A 3CKKA 2Q3HA 4NE2A 4X71A 5CLQA 5CEJA 1XZHA 1X9IA 2DECA 5TQVA 1NNUA 4TL7A 2C84A 3IAXA 4WADA 4FR0A 2PWAA 3CS3A 3R3YA 5J40A 4B4KA 2WR8A 3G82C 5IVPA 3O2NA 1MXFA 3G2LA 3DLAA 4KJXA 3U1TA 2M32A 3J80A 3CZRA 3T3HA 4DCSA 3NWBA 2PUAA 1U6KA 2BBTA 4OOEA 1XOIA 4OYHA 1THGA 4L5YA 3UKJA 4D79A 4LRQA 2H1OA 2XUZA 2E6KA 3TRFA 1VJ0A 1PLJA 2WYOA 3DZHA 4XJXA 2YHSA 2WWGA 3PC2A 5F73A 2YNMD 3OJXA 3HYNA 4POAA 3SS7X 4Z4HA 1L4GA 2ENUA 5EHQA 2J5QA 1KQ3A 2ZYHA 4C14A 5KCMA 7YASA 1ADFA 1JR6A 1NXTA 1QF6A 2V3WA 2PLFA 1CJKC 4HNHA 5HOQA 2AQIA 2Z1DA 3OTHA 3QJ5A 4IZHA 5CYPA 5JWOA 1VYVA 2VRBA 4HUQA 4M9XA 2B1JA 5KAMA 1TPZA 4BFWA 5GZ1A 2YXNA 3QEMA 3AFMA 5CA1A 1IHDA 2PXXA 1Y9DA 4OH7A 2VPYA 5CCXA 1E7RA 5K3AA 2PRKA 1AO3A 3PDJA 3NORA 2XNDD 3A31A 2EX1A 1PZMA 2BE9A 1JHZA 3TSOA 4NL4H 2HFJA 1AQNA 4S1WA 1AXEA 1U3FA 3EXIB 1QIIA 4CTKA 1V7QA 3L7LA 5ENDA 2ID9A 3OWOA 4MV0A 1JAXA 2IS4A 2BW0A 3KPVA 1WSBA 2JD2A 1R8JA 4HNAA 1E9BA 2CXNA 4NZOA 3RARA 4ZOLB 5MN4A 3U3RA 4KR3A 3UB2A 3EMKA 1N78A 4K87A 4E09A 3JQ7A 2YW2A 5H3HA 5DYIA 2C5BA 5HFNA 1R0KA 3DZKA 1J5EB 2YJ6A 1JE0A 1LSJA 1GFZA 1VKZA 4EBFA 3FCYA 1YVEI 5A1TA 5JRJA 3ZGNA 5JUWA 1VJ1A 4TTAA 1U2TA 3Q3HA 5JD4A 5BQ3A 3NUQA 1ZCJA 2W2OA 2CLSA 4UBOA 2YMLA 4BUZA 3ZCUA 3UMYA 1SC1A 3F1LA 2HEIA 3FWHA 2WHQA 4LHYA 4OKIA 2AR9A 2G09A 3QF7A 3NANA 3R9WA 4BS9A 3FJOA 1YR3A 3A3PA 4BV2A 4MR9B 3BRWD 4ZOAA 5FUXA 1J09A 1P19A 2FV8A 3EB9A 3ZDBA 1Q20A 2Q4OA 4YR7A 4AJ2A 3QEJA 2OA0A 2H0AA 2Q5IA 2B6NA 1JEJA 2QZJA 3MIIA 4INZA 1HL7A 4QYWA 3AHDA 5KEIA 1QO7A 2IEIA 3KR1A 2O1WA 3CGGA 1I1QB 3KLNA 4NICA 3UC9A 5C5IA 3PCRB 4Q24A 5TPZD 4G1EB 1DKQA 2IC5A 3LM8A 3AYZB 5KREA 1G3RA 5AM5A 5L9AA 1LBEA 1IUPA 1EBUA 3FYUA 4CDNA 3FOCA 2XF8A 3GDGA 3HO1A 4Q1DA 5DXFA 1T8SA 4MGKR 1DV1A 1CSEE 1T29A 1G9SA 1M1YE 2PWBA 3LX8A 4OHRA 4GZ6A 2OZKA 1ID1A 1PDVA 2KMLA 2OL4A 4XW2A 1DWUA 4H7FA 3RT9A 2EWVA 4B6EA 1K7YA 3FGOA 2YXLA 5EY5B 1MJ5A 4RWZA 1NSYA 1H1TA 3VR1A 1J23A 5EMJA 2CVQA 1RXIA 2BEKA 1H2FA 1PR2A 1CUUA 3EN0A 4M87A 2YJGA 4QYXA 4BO1A 5CDHA 1IG3A 2PQMA 2I67A 1B76A 3DXXA 3FVTA 5JE8A 1LTKA 1T9CA 2MYTA 1OF1A 3LK6A 5B37A 2QAGC 2OFFA 4NENA 2PYDA 4P86A 3OAAD 3CZMA 3CW2A 3A3KA 4CW7A 1SCBA 1U0JA 3MB8A 3DWIA 2X8LA 3ND8A 1OE0A 3EC7A 5C9ZA 3X1ZA 1SHJA 3DZGA 2JCBA 4OXNA 3B3GA 3OUTA 4HGNA 4CT5A 4MGYR 1I0IA 1YRWA 3IHKA 4M0UA 3T0GA 1C2YA 4C0LA 2WF5A 5KIAA 2GM9A 2OCIA 4KVAA 1ZGAA 1Y4ZA 2FFRA 4WXEA 4WOCA 4BVAA 1U02A 3IAS1 3ZR4B 2JC3A 5K0EA 1XL0A 4BRUA 2FSVA 1CUGA 2B2XA 2PGNA 3KCNA 2CZGA 4DWVA 4BC1A 4PLCA 1TM7E 3U7QB 3LCRA 2NXNA 4P4LA 4IV5A 4ND6A 3FWPA 1G6HA 2B21A 3P9ZA 1JHYA 4RDIA 3QXHA 4FI3C 4QX6A 2NSHA 1C0EA 1E9SA 1M2FA 1WTAA 1CQIB 2WHYA 1M6VB 3B78A 3EOBI 5C51B 1YVPA 4RZHA 2YHUA 2VTEA 4ACBA 2OK7A 4K6GA 5DNYB 1GRQA 1OV4A 3EX7C 2WWWA 1M76A 1FRZA 1WF6A 3N1UA 3QA9A 1CNEA 4PZUA 1DCKA 1SK8A 3HWRA 3NWPA 3S5UA 3TYXA 3U13A 4AY2A 1OT3A 4D97A 3OMWA 1KZ4A 3STWA 5EE0A 2VLBA 2ZB2A 4DEVA 1WZEA 2Q0HA 2P40A 5JJ5A 3NUGA 2WJJA 1NPYA 3HKDA 5BMVA 2D5LA 3Q1KA 1G42A 3JQ8B 4X91A 3VHXA 5CAEB 1WXWA 4E31A 3D59A 5DASA 3THXB 2D1QA 1SUWA 5KNLA 3HNRA 1HEYA 1VE5A 3RIEA 1XTKA 5J2UB 5DTQA 2XB9A 1CWUA 1NWCA 4FFSA 1BJRE 1H69A 1RYBA 2ZSIA 4LSMA 3F90A 3R9IA 5DJ5A 4UUPA 1EWQA 5JCPA 1R4MA 3LT4A 1IXRC 4MW2A 2CLIB 2ZIVB 4IDPA 4IX9A 4EFDA 4BNIA 5GZ3A 1KY4A 2R1UA 3A04A 4KV9A 4FKMA 4HNQA 2DUUA 2OBBA 4NXNB 3UBMA 4BBPA 2F1IA 3OE5A 4LJ4A 2C0CA 3L18A 1IHOA 1ZIOA 3EFBA 3SHFA 5ICMA 1FNCA 4ZP1A 4TM7A 3CINA 3EQ7A 3D81A 4LE2A 4X90A 4BP1A 4NFSA 4XVUA 3HLKA 2HA3A 5DI3A 1RPZA 2GZMA 5FI3A 4HWKA 3VSAA 4EY8A 1T6BY 3AIKA 4KYUA 2C5FA 2HU7A 4MV8A 4RK4A 3ZWXA 1M2VB 4C2AA 3BMQB 3HDTA 3C14C 3JWJA 3RIYA 4G4IA 3QY0A 2CMKA 4DVGA 3EH2A 3E8XA 3Q15C 2V6BA 4E6PA 3NFRA 2G82A 2O8EA 3KUDA 1FA9A 1QFYA 2NYVA 3N87A 5KKAA 1VM6A 1KU0A 2WVJA 2D59A 5A5EA 1I3LA 4PO9A 2DUWA 2QJRA 1G8JA 1Z7BA 1L6RA 3LWDA 1MJGA 4GIBA 1Z7EA 2QX7A 4KQGA 3IPAA 4KMRA 1PFKA 4D98A 3CR7A 4LCEA 4AIRA 4BIIA 4WECA 4EFNA 2FHSA 5KVVA 3PJDA 4G1CA 1C7ZA 5C2JB 3DT9A 3CU5A 2QWXA 2R2GA 4V24A 3R7FA 4QKQA 4M7PA 8MHTA 2ATIA 1NFQA 2PS0A 3GARA 1U98A 4G07A 3HJAA 3TMKA 5DCLA 5H9WA 4RM3A 2YZGA 1ZH8A 1ZMTA 3N2KB 1KDYA 1V1RA 2ZKLA 4UARA 4CKXA 3UUEA 4YR9A 1B8VA 1FS5A 4KE7A 4N7JA 3TBKA 4BJ6A 5L4LA 2J41A 2XWSA 4OSPA 3V4LA 1VSBA 3Q0IA 4D8XA 1KF0A 2P8JA 1GZ6A 2FRDA 1VE7A 1XCJA 4J2HA 3GEDA 3AMVA 3OFKA 2BTEA 1SVIA 3BMCB 3HEMA 4FDAA 4P3YA 5DYTA 1HTWA 1U94A 1SKYE 2F3QA 2Y1GA 3WSTA 4B5KA 3GUVA 4F2PA 1T5OA 3E3LA 4IIXA 3V8RA 4QLBA 4Q19A 4MPPA 1SMKA 1C7FA 1XTBA 3U9TA 2F62A 1N8SA 4W5QA 1X7HA 4CKZA 3KJGA 3CLKA 4ZC1A 4AX8A 1L7MA 2P7IA 3I6YA 5BOSB 3G2QA 4K26A 4XARA 3UZUA 2FAXA 4B6QA 4HKTA 5B7PA 4EF5A 3D5TA 2GZRA 3I2YX 3L84A 2ECKA 3LJKA 4KAJA 2YKGA 2B92A 2GD1O 1V45E 3UH0A 9LDTA 2QSYA 2ZIWB 3QHQA 3VU3A 3PNLA 1HQCA 2VQ3A 4HVTA 4UNPA 1JF8A 1GYRA 3KEGA 3KXPA 1H6DA 1NAIA 4JELA 4DLYA 3S4YA 3AONB 1X1DA 1H3EA 5JYBA 4F46A 4MYTA 4MO2A 1RNLA 2FEXA 4DNPA 5HZMA 3HZRA 3UAOA 1DJNA 1WO8A 3CWCA 3LUHA 1PBTA 2PXAA 4FFWA 4KJZA 1EG2A 4X92A 4E13A 1TJ3A 3TUZC 3LUDA 2EARA 5D2CA 3ELBA 4HXEB 4QXMA 1M7GA 3CUTA 1FLNA 3MMNA 4MULA 1OB5A 1J7JA 1Y7TA 3ETDA 3GFVA 4BO9A 2AC7A 2ZSEA 3QEAZ 2R6AA 3QVOA 5BO5A 4N41A 3NMUF 1J0BA 2P67A 3EMDA 3I4LA 3USZA 4Q4CA 1J2RA 1TM5E 4BP8A 5HVNA 1G1MA 2D1TA 2VAPA 2PUEA 4GL2A 1ZIDA 2QN9A 3ITEA 4BO5A 2W2KA 1US8B 3WFZA 2FXVA 1BXRB 1T2EA 2BFPA 1BHSA 2P11A 1L1EA 3M4NA 3QVUA 4G9GA 4EKGA 3GFSA 1YZUA 4CL8A 3MERA 4FJ0A 1AOXA 3R6DA 4OIMA 4CIAA 3D7NA 2WPNA 5IT5A 5JD6A 1YZLA 3GZNA 4G2TA 2QPTA 3C15C 1G6KA 2D0DA 2QVCA 4O3FA 3ORFA 2NXEA 4G0WA 1JRLA 5C4GB 2AT1A 1QIKA 1K0UA 2X7XA 5EUMA 2BF7A 3IULA 5AO9A 1HMPA 3WGGA 2AVDA 1PV4A 3LXUX 1YR1A 2ZANA 3K1AB 1P7WA 2NU6A 1ZUHA 5ALNA 5H82A 4I36A 3LDHA 3N05A 3TX6A 2FZ4A 4B83A 1VZ2A 2OC9A 4GRIA 3NRBA 3EFHA 1BKDR 1SXPA 4RHUA 2HWKA 1GEEA 4NDNE 5FNZA 3HVRA 3SLGA 3Q8WA 4DQXA 2HL6A 1E58A 1QE5A 4XXHA 3RF7A 1ABFA 4WZAE 1GQ2A 3UKDA 3VYWA 1I4EB 2CFSA 4F6RB 1Z0UA 4XZ3A 3QKIA 4XIIA 2F43A 3WLHA 1U99A 4FXOA 4A92A 3UO8B 2N75A 4ZTZB 1QR2A 1N36B 4H59A 2HMAA 4AY5A 3E82A 3BPSA 3ZHZA 3Q40A 1ITZA 1IN1A 1SIOA 2GEDA 2IYEA 2CD9A 2Z08A 3I8XA 1J5PA 4DXHA 2J3MA 1QYCA 1W34A 2AXPA 2E4VA 2FFAA 3DKIA 3NHKA 3ZX5A 4DYVA 1PU2A 1XMJA 4TZKA 4XVHA 3CNQS 1RXSA 1U7ZA 2IELA 1P1CA 1HSOA 1T8RA 1ZO8A 2EBUA 4J3JA 3Q12A 4AZ3A 3VXKA 3MTGA 4JWKA 4C6RA 4KYVA 5IBPA 5HP4A 2VT3A 3TG8A 4JLNA 3H9JA 1UFKA 5HUQA 2MSEB 2C96A 4DSUA 5IG2A 1GPBA 2XGOA 1UMBB 1A5ZA 3MPOA 5FKJA 5EKSA 5C7YA 5KO2A 2LIVA 4PZEA 1U04A 2XSZD 1I30A 2I65A 4JS0A 1JMVA 1KERA 4FDMA 1BMTA 4PS0A 5HIJA 4C4TA 1XCGB 2XNCA 4ZYXA 1SXIA 3KDPA 3KEOA 1T13A 1RWBA 2FQ1A 4REQA 1KMHA 3OEHA 1V11A 4UUOA 3WHKA 1M8PA 1J22A 3IC5A 2XMCA 3VAYA 1F3LA 2ADFA 3GPDG 2DP4E 1V8OA 2CGEA 6REQB 3RYCA 4MYRA 1E98A 4S1OA 2HTEA 4HEA6 2VCHA 3ADOA 3HVIA 3P2EA 3DCJA 5SICE 4B7ZA 1QZZA 5GVRA 5D7BA 4UM7A 5E0OA 3B48A 1U8FO 1QTRA 3H3JA 4DV7B 3ML1A 1UBTS 4QOEA 5ESXA 3TX2A 4Z3DA 4E94A 5B2EA 5F12A 3TQFA 1W2WB 4E88A 4QECA 5JRDS 3EW7A 4WXPA 1MTZA 3KTDA 1M1YA 3WYDA 4EGQA 1V16B 3FKSA 4II7A 1EDBA 5FA5A 2XNSA 4CU5A 4FCCA 2SKEA 5FO1A 4WIAA 3H5NA 1AKWA 3JQ9C 2OMKA 3IPCA 1SWVA 2C7QA 1VPLA 2NUTB 1Y80A 2CHGA 5AM2A 3UB4A 3U7EB 2VQSA 2ZS7A 1AS0A 3ZVKA 3OQNA 4QARA 2BUAA 1R9MA 3AF6A 5HKLA 1PS0A 1NRIA 2NZUG 5CTAA 1W85B 4CTJA 5C5DA 5L3QA 2G1JA 4X6YA 1GPDG 5HIAA 3B1ZA 3E9MA 3EBLA 3OPNA 3M5PA 4L8LA 3IA2A 3UMBA 4I5EA 2REQB 4L2IA 1JSLA 1V9LA 4IQ8A 3VV3A 4RSMA 4G97A 2GHRA 1W88A 3LGSA 2FLKA 4KWEA 1XF9A 2J85A 3EDQA 2VYVD 2I03A 4KDRA 3H17A 1J0CA 1W25A 4M46A 2HY7A 5KYNA 2JJYA 1A9QA 3I1JA 3HI6A 5CFOA 3ZV7A 1VOTA 1YWGO 4LWQA 1JKXA 4JVOA 1GV0A 4MVJH 2Z95A 4A73A 4M9QA 4ESHA 5AI9A 4E5SA 4GBGA 2VP2A 3RPEA 3VYVA 5D6OA 1XUOA 1E0DA 3ONDA 2PS1A 3ZE9A 1DARA 4NQZA 3STTA 4C21A 1RMTA 4NCXA 4CG2A 1YMUA 3EHEA 4A4DA 3LC2O 4F4UA 3QQPA 3OD5A 3OU7A 3PHCA 4CQJA 5IJ0A 2JIZA 3RTEA 3L6RA 2DPMA 3Q2OA 2H1SA 2DU8A 1IU9A 3R5TA 1FYEA 2PVCA 2NYRA 1NI4B 3L0YA 1Z6GA 4FPXA 4FYWA 2KLHA 1JR3D 2YVQA 3ZCQA 4QDUA 4HSGA 3ODPA 3TRHA 1M6YA 3PLNA 3QTTA 4OMCA 1J70A 2HWWA 2FVYA 2IEAA 3I9NA 2CMHA 1DEAA 2BV3A 3AWIA 4LS3A 2JLSA 1A9XA 1RWMA 1Q7EA 3RHFA 3ZVMA 1M1NB 1E6LA 3AU9A 4LMAA 4J7UA 4BTLA 4D3XA 1OCEA 1MVNA 1Q77A 2PGIA 1FVOA 2VNSA 3Q7EA 4J0JA 3OY2A 3ZTWA 2DKOA 4A0SA 3P4YA 1MC4A 2BFDA 3AUJB 1F48A 1O08A 2PBLA 3QWAA 4UATA 4HX9A 2YR0A 4TN1A 1X8LA 1I14A 3WP1B 4X8MA 5BWOA 1KJNA 2UUCB 2PH5A 2G5PA 5LSAA 3QHAA 2DKNA 5CH3A 1CVLA 1YR7A 4XH9B 1PD0A 3ZY5A 5CYGA 5HTOA 1ODIA 2C0QA 1V5WA 2PO7A 5KNDH 3UENA 5JROA 1KDTA 2H4HA 3IP9A 1CUAA 1WU7A 1Q0PA 3CRW1 4AD8A 4A2PA 2ODWA 4BMCA 2XR1A 1OH7A 2CLHB 4IH4A 5D86A 1KXZA 1PIWA 2XVXA 1IWOA 3UH1A 3TOCA 3WL6A 1ZM3A 4YLEA 4RJIA 4NAHA 5PGMA 5SY4A 4LJ8A 4CMEA 1F4LA 5IAKA 2YN4A 5LIRA 4COKA 2CXPA 4RTJA 3FR8A 3WGVA 3E35A 2C4MA 2W8BA 4NESA 3PP8A 4KAAA 4QFDA 5G0TA 3U6BA 1JAHA 2BGIA 4LHXA 2JRLA 5LQUA 4L7QA 4UW9A 1JJAA 2BYTA 3I5XA 2QVYX 1SKBA 1C9DB 1VIMA 2FPMA 3VR3A 1NG1A 1WHTB 2JFVA 2JBWA 4GVXA 3SN6A 4EHLA 4Z51A 4A36A 4HGOA 4NDAA 4O63O 1APBA 2EYUA 2DFPA 2JASA 1ZR2A 5GY7A 2QL5A 4I0WB 1HNNA 3GOHA 1GPAA 2FX5A 1M8FA 4KACA 2C1XA 1M2EA 4U6NA 3SFVA 1W5TA 2YV2A 1K6MA 4CEHA 3D8RA 1JU3A 4QUGA 3GGDA 4KUGA 5FUQA 5AVJA 2GPBA 2RHRA 3D2LA 3DO5A 3HNOA 1W76A 4O0LA 1JFFA 4QRIA 4RACA 1XA3A 2VL7A 2FZEA 2O19A 4P38A 1JG2A 3QFHA 3RC1A 2D6FA 3FETA 1G55A 2H57A 4OGKA 2VXCA 4M6WB 4NHEA 2WINI 4UMVA 4KU4A 4BKPA 4DIUA 4PZDA 3ER8A 2Q3MA 1VJDA 1PGJA 4JB0A 4E5YA 5H7XA 2B61A 1KGDA 1W29A 2YFKA 3MT0A 1G64A 2GF0A 3G0BA 3Q6IA 5C46F 2UVPB 3BD9A 2WWRA 1GL3A 3VH1A 3T5AA 2ZATA 4FB4A 4ZYTA 5AJUA 5C5EA 3WIUA 1D3AA 2GNAA 4AO7A 3LS2A 2A78A 3QWHA 4ND4A 4GZLA 5H16A 3RUEA 4DR6B 1U0OC 1XWWA 1G5QA 5I9LA 3C1TA 3FLAA 1IPFA 2B99A 3Q3GE 1K66A 1F14A 2H1WA 3M2TA 3QUQA 4LVCA 3NJ4A 4TROA 1DRVA 1GKIA 1HFKA 3M1LA 4Y0NA 2RMKA 1C9MA 3RR2A 4DYDA 1B93A 2J67A 1V48A 2H3EA 5F3DA 5ICSA 3IVCA 4G5YA 1PW7A 4W1PA 2D5CA 5ARCA 4ARZB 2PKYX 2H11A 1TOAA 2PV0A 2WJAA 3OE7D 3EVFA 1X7WB 2V7QD 3M6IA 4ZVNA 5ADHA 3C3KA 5E2BA 1J8VA 2RK3A 3KFVA 4LZOA 4U2DA 1PJ3A 2C07A 2I0FA 3AI3A 4J6EA 4OMUA 4U2CA 3SGLA 4TLAA 2PVPA 1K88A 1GY8A 4X62B 1G8KA 5ALKA 1NFFA 4NNOA 5DH9A 4X8HA 5TQ0A 4BEVA 4L72A 2XT0A 2B4AA 1DX4A 3IKJA 3JZIA 2A1TS 5CHEA 4EUNA 1AQ6A 2GILA 5KYXA 4YRRA 2J6CA 5GONB 5B58T 3MJEA 1ZP6A 3IP1A 2IZOA 4PQGA 3W8FA 5AK6A 1N4AA 1M34B 3OOHA 3TWOA 3WKAA 3OTQA 4OXYA 3LX6A 1SEPA 1FW8A 2R11A 4WLOA 2FEOA 2DH6A 3C6YA 2HMWA 4XEHA 4TS1A 4DDVA 1UF9A 1UPTA 3L7JA 3QUBA 4P2BA 2A9PA 2VEOA 1HEIA 5IDWA 1GXSA 1Z07A 2PO5A 2P78A 4YUYA 3AKEA 4EHBA 5L4NA 1UEJA 4XGIA 2ZRCA 5A5DA 1O97C 5CLGA 4DV3B 4BMNA 3EIOA 5D3MB 1JEYB 3PL1A 3DDWA 1DTEA 5E8RA 3ANXA 4MLCA 2BFMA 2O2SA 4WEQA 4YT2A 3EZ9A 1PJSA 3CIFA 3I73A 3UBTA 2IITA 4WZAA 2YIDA 5JNUA 3G8AA 4RJTA 4MPRA 1TM4E 3HDYA 3WNVA 4B3XA 4EMUA 2GPWA 2QLLA 5AW5A 4OOFA 3ZHSA 2QXTA 3ITNA 4RH1A 5ERXA 3F9CA 4G89A 2I4IA 1P0QA 1BDJA 4I50A 2YS7A 4OO3A 4F71A 3CUSA 1F4PA 4U7GA 2NUAA 5KC9A 3AT1A 2WIDA 1ZL0A 1LV8A 4XVCA 1CEXA 4WJKB 4JLOA 4ND5A 4WNYA 4MW7A 4CLOB 2H54A 1XVLA 3E3MA 2OP0A 3MMPA 4X1OA 1QHNA 4X85A 2IHKA 4AYTA 4Y6OA 4BMYA 2WWYA 1FJHA 3I12A 3SX4A 3SYRA 1V1MA 1W0KA 2VQ6A 4WN9A 2VPXA 4DIFA 3RT7A 2HA4A 5KX5A 3OM0A 4QO8A 3KP1A 3VR5H 2XCRB 1NE2A 4JGGA 4TZ0A 1R27A 1SAYA 1ZN2A 2ANBA 4QPNA 1XEAA 1GZSA 3YASA 1ETHA 1MOQA 1E3JA 5COQA 1P4SA 3GX1A 4HDAA 1PQWA 5EIFA 5EQJB 1BXKA 3U39A 1AV6A 1OTHA 3DB1A 1EI9A 5AHRA 1ORVA 1EFRD 3OQIA 3P2IA 4NFYA 5EYPA 2WF7A 3MQ4A 3VYUB 4DPKA 1XJ5A 1V43A 3QVVA 3IUEA 1TKRA 1YCFA 4YP9A 5DLQC 3V9AA 2CV1A 5DHRA 4HH0A 4P36A 2ZYRA 3CLRD 1EK5A 1QIJA 2CK3D 3PHBE 3ST7A 4V1CI 3O92A 3F5QA 2R8PA 4JUIA 3F46A 4I2VA 4RPIA 4MLZA 2NLOA 2NTYC 2YCBA 2WICA 3CZCA 1YZVA 3AVWA 3VTZA 5LYJF 1JZSA 4TWRA 5BSFA 1IVSA 3OFND 3DFKA 3PC7A 4G81A 2VLIA 5C34B 1YDWA 4IDCA 1IIRA 1SUAA 1YC5A 1EESA 1JKIA 3GRAA 2XRFA 3ICCA 3I09A 1K4KA 1B6SA 4UJ5A 3WRYA 2BZGA 5AYVA 4GXTA 1B16A 2YXPX 2EL9A 1RLUA 3T9EA 1Z5ZA 4IWNA 4OBWA 4UUBA 2WU0A 4AAYA 3OPQA 4RKFA 5CPFA 1IN7A 4RIIA 1IWBB 3JSXA 5KNBD 4BKMA 3UPTA 3I34X 1XFAA 4P9NA 4R5HA 2Q6IA 3U48A 4C08A 5JBNA 4O4IF 3TXYA 3GUYA 5DT9A 2ID7A 3REQA 3ZZNA 2IOQA 4N82A 2PGOA 5ICEA 3OC0A 4BN0A 2WG0A 1XJWA 4OJNA 4F4CA 3ROFA 4I1PA 2V7WA 5CLIA 3ABZA 4E70A 3NDBB 3JATA 4OREX 1L2TA 3P1JA 4WLVA 3ZDXB 3NOVA 4U7WA 1WPQA 3L2OB 3DL4A 3BFXA 4NS4A 2CVHA 5E1MA 3VU9B 5K05A 1Q0ZA 3VV2A 2Z2KA 1Y37A 3B8EA 4GQAA 2D0IA 3R3SA 4JL6A 4ABYA 5IJAA 2YINC 1PNRA 4IKEA 1DRJA 1FFXA 2W5UA 3KLOA 1JFVA 2QMUA 3PPYA 4LTNA 1XJCA 3UQYS 1UC8A 4QOGA 2I76A 4NBTA 3DBLB 2ZJ8A 1BE1A 3IVRA 3THOA 3LU1A 5T6BA 2GAJA 3NC1C 3HU5A 4UZSA 3PEWA 5JMPA 4J0GA 5C53B 4MOWA 4CGYA 4UBMA 4TXMA 1JVSA 5FORA 4RD0A 3CLSC 3K1YA 3A1UA 4OUKX 4RVNA 3S55A 3E84A 4ND8B 3FNIA 1V7CA 2ZUVA 2HT6A 2JFUA 2JHFA 3D1JA 3NIDB 4UNQA 4ANFA 2YJ3A 2AB0A 2MSKA 4AZ0B 3MWEB 1PLLA 4HBZA 1QS0B 3IAHA 1KDPA 1SUSA 1USWA 4B32A 4BQSA 4L74A 3X1MA 5BUCA 1ZJ6A 1XNGA 2BEWA 1ZFNA 3LXXA 5J1SB 2VN8A 5LP6C 3UJAA 5F7OA 4LOAA 3ESDA 4RF4A 1BE6A 5CIYA 1T2DA 3E2MA 2C00A 4GBED 4JQYA 4Y2YA 2E6UX 4IOJA 1DTSA 1SBHA 2C9MA 3IPLA 3KYBA 1YZHA 1QIFA 4O4HA 2HF9A 2J6BA 2OZEA 2CMFA 2MSLA 2HMYB 3ZHCA 2DG2A 2RGAA 3KOOA 1YR6A 3GFOA 3MM4A 4I5GA 5A0FA 4KIFA 1EEHA 1I1HA 3AXTA 3ILVA 4RSHA 2R8BA 2OHHA 3HA3A 4O1MA 4QQKA 4KQJA 3U3JA 5JCXA 4DVJA 1TZ2A 3IKLA 1LS6A 5LQMA 4RM2A 3WNBA 4W7HA 4X93A 1NI5A 2HWYA 3DQQA 4POOA 1ACLA 3M6UA 2UYYA 3DOHA 1IDN1 3ABRB 2AX3A 2EGUA 2HSDA 4YJ3A 3KPUA 2DBQA 2IY8A 1Q0LA 4ZQGA 2G5CA 1VL5A 4YMSA 4XPIA 2V8BA 1Q3KA 3SJCA 1BJTA 3HKEA 2CCGA 2FSIA 5K3BA 4QEKA 5G3YA 5ITZA 3F47A 4UUNA 4X1KA 2Q5CA 3TAHA 3ENKA 4DT1A 4EVSA 2BBSA 5IZ4A 2OG1A 4PYOA 5H83A 4MW5A 2VZ9A 1NXQA 4HYTA 2IY9A 4S1TA 2GEUA 1A50B 1VG8A 2JLZA 1Z8HA 3UV7A 3LLSA 4ARSA 2RGDA 2UAGA 3KOMA 3I72A 2P1DA 3CX6A 3V1NA 1PYDA 3KQHA 1QJ4A 1WDTA 3B2QA 3IKVA 3WA7A 6ADHA 2GK7A 3WNQA 1I01A 1T35A 3ANSA 1RZ3A 3BAZA 3I5UA 2FFQA 4OMDA 4K0RA 1OW3B 2DCUA 4XTCS 2ZM6B 4QU8A 2C31A 4PO8A 1KYIA 5IJXA 2OGZA 2WUWE 2O2HA 1NFRA 4D82A 3QPVA 5ILQA 2QRKA 3WGMA 3W2EA 4Y1RB 1PEKE 3N74A 4FUTA 2G40A 3I8SA 1T3ZA 1N6PA 3L07A 2AEJA 5ALOA 3UWSA 2FZKA 2WYVA 1OA0A 3NP9A 1OR8A 3R09A 1J24A 4LJ5A 3KSUA 4MVJP 1BS1A 4OUDB 3DBHA 2ZW9A 2VAVA 3KELA 4JJ8A 1W6RA 2YVLA 4RDHA 3SJZA 2NPFA 3TM4A 1E0JA 1K5PA 2V65A 1Z73A 1EUCB 3CF6R 3H2YA 5E6RB 3VSCA 3AQ4A 3NH6A 3ZQUA 3LAWA 3JQAA 1PJ2A 2DOKA 1WMAA 1U9IC 2QMYA 4UM5A 2AOWA 3JVEA 4A5SA 4PLVA 4CLHA 1MH1A 2I6GA 5EJ9A 1AE1A 2C92A 2QLTA 3NHLA 4HWPA 2CDBA 3H2KA 2EYQA 4LJ9A 1EFTA 2GUGA 4PGGA 3EGOA 1E2JA 5FL7D 2I62A 1K98A 1SGWA 5B12A 1K06A 3E18A 4LI3X 4FDLA 5FOWA 5TGTA 2WQZA 5AICA 3GAFA 3PXDA 3H5IA 4TXLA 3GQVA 1SVKA 3ZWKA 1X7GA 2F55A 3V4RA 2VHJA 2V0GA 3P0EA 1K9SA 1CRZA 3O90A 5E3IA 5P8WA 4QEZA 4DR1B 4CEIA 1LDGA 4IXTA 2OCBA 4A10A 4H3SA 4EZIA 4D4LA 3UW3A 1HTTA 2ZRMA 5DB4A 3DMRA 4R0VA 5E9QA 4QXOA 1RQ2A 2C77A 2P30A 3THWB 5FTLA 1KI8A 1BW9B 2WVGA 3AVPA 3DG9A 1AC5A 4D6XA 2QD2A 3EVEA 1WD7A 1WB6A 1QVAA 2W9XA 4MQ4A 1XALA 3TQQA 4D57A 4H6XA 1WDWB 1ODJA 1L7QA 2Y93A 3IESA 1UJ4A 3N86A 4RC9A 1NVWQ 2HK8A 5I9MA 1KBZA 4DLZA 4IIVA 2EEZA 1DDOA 1OAOA 3HCAA 2FQYA 3E9RA 4H2DA 5D00A 1X1EA 2F17A 3ZBPA 3PB3A 4GH5A 5KYYB 1JQEA 3CNHA 2BFFB 2H5IA 2XQFA 1S6YA 2J5BA 4C7BA 1U3GA 1RXCA 1UBKS 4QGHA 4EY4A 1AUQA 1D2EA 4RF5A 1YS9A 1CJSA 1XRSB 2FN3A 2ZSBA 5LLTA 1S7GA 4BBJA 1II8B 1W4BA 3EAFA 2O3QA 3KR2A 2I8AA 3OA2A 2DBZA 4K3VA 4TL8A 3T94A 1XNRB 1T25A 1X8JA 2DQKA 2BFOA 3EA5A 1NF8A 3FZYA 1AM4D 3IFSA 4RXMA 4W5JA 2MIIA 5HZHA 5THQA 1EFVA 3C4QA 3DBVO 2P9QA 1UBEA 4JQZA 1IQPA 2QBYA 5KTSA 2ZWMA 4FFLA 1GDTA 3KOYA 4ITUA 4MW4A 3RBAA 3VYSB 3GAMA 2H7YA 1ZRNA 4P7KA 4C78A 3ZI4A 4BCCA 4FYKA 4YAWA 3UJDA 3F96A 1AIPA 1JA9A 5FBRB 1P1IA 3ON5A 3WLTA 5AW2A 1QE3A 4OY3A 4RE6A 1B8OA 4LQ4A 1CK4A 3GLRA 3QXSA 2QSJA 4ZC8A 3EXG1 1T4CB 3GXOA 1R8SA 5HQTA 1XVUA 3EPJA 4WZBE 1G6Q1 1J7KA 5F7ZA 1NHGA 5J58A 2C0PA 2FDRA 4AMYA 3PDIA 1Q6ZA 1RE0A 1NLZA 1Z12A 3NCHA 2Z6AA 2XGGA 4E4RA 3TNJA 4EJSA 5KOHA 2PBRA 3AL0C 4MDEA 2QIOA 1N9ZA 1EK2A 1SQSA 3PGLA 4TV9F 5TT1A 2Y6UA 2AQ8A 4G01B 1CUCA 3EISA 5M3BA 2J0QA 3RS3A 2PKWA 4UXIA 1EP1B 3TM5A 3AIIA 2WWTA 5CHYA 4D43A 4HVLA 1UWCA 4AS1A 4OX9B 1C4KA 3MAGA 3ANLA 3N0WA 5E4FA 2CLCX 1YCGA 3B6KA 4G0OA 1Z5NA 1Q7CA 3GEMA 3RTBA 1AKUA 3KU1A 2EERA 4PN7A 2P91A 1X1AA 4B7CA 4IUBS 5K3FB 4EI9A 1KK2A 4IKPA 1U6IA 4UFOA 3SBOA 1H4SA 3IXQA 5KVQA 3UYLA 1PTJC 1N0IA 2JD0A 2P6PA 1XQXA 4D3FA 2QN6A 2B6HA 3WX0A 1YA8A 4QU0A 1XD2A 2M9MA 1Y98A 1S0UA 3ULKA 5HF8A 5LJLA 1CFJA 3PUKA 2R6JA 1RXWA 2YJTD 1G2QA 2ERCA 2HF2A 4NMMA 1VJTA 2JHAA 2OGTA 2YS6A 2G67A 1CS0A 2H0QA 3L4JA 4QRHA 1QP4A 2PA3A 2L18A 3FWZA 3RSLA 2ZRGA 1JDZA 3C3YA 1ZI8A 2Z4RA 5AJHA 2AHRA 4OVKA 3AHFA 3KYJB 5AKHA 4BX9A 5GJCA 4DDMA 3K0SA 3DVQX 4PTLA 5ALVA 1KVTA 2OHJA 1GNQA 1S2GA 1FBTA 3C45A 3QWIA 5EE9A 1JG1A 1AB6A 1A2KC 2DLCX 4C89A 5IEJA 3UQZA 2IYYA 1H0RA 1FPMA 3H0CA 2B8NA 4P80A 4C0BA 4YMUA 2JDIA 1VL2A 4B3BA 4IL5A 3ZQKA 1XV5A 2B8EA 1J97A 2WJPA 3P9YA 1E3WA 5KWJA 1ZOIA 3EZ7A 1UK7A 2YQ5A 2P35A 3R7NA 5TLSA 2FSSA 3P9IA 1EX1A 5FADA 4C4AA 2D54A 1Z4JA 4G0NA 1EFKA 4ZOQI 3W5CA 4MDFA 2XLBA 3I04M 1TLTA 5AOBA 3T3GA 5FAKA 1R6BX 3G7UA 3PWTA 4ZQBA 2FDXA 1NMZA 3E53A 1XA4A 3CCFA 4IS2A 2FQWA 4NBSA 1WBJB 4Y2UA 4CTMA 1E2LA 4GI2A 3TLCA 5A1JA 4FKZA 5JH7F 4N5LA 3HCNA 5DGXA 1GPWB 2AMLA 3OI7A 4UBIA 1U28A 3N0VA 2D1RA 3EC2A 1E5TA 2O06A 3PFBA 2AFHE 1J8FA 4GI7A 2KBFA 4DHEA 4J3FA 4BJ1A 3WGJA 4Q9KA 1MAVA 4AZSA 2AG0A 2P9JA 1ILEA 1FYXA 1N1GA 1GITA 3D3NA 3LK7A 2YY6A 4FOLA 4J07A 4OP3A 3VPHA 2WFLB 3AESB 4WKNA 2UZIR 4A6PA 5HJ2A 2YIJA 1O94A 2XCTB 1U9YA 4C5CA 4D0RA 1TAHA 1UMDB 2O57A 4HGRA 4PRLA 5DLPA 3T5TA 3U9LA 1FMFA 2OBMA 3A10A 1OZHA 1NN0A 1Y0BA 4OXIA 2WM9B 4JBHA 5C0OE 1C7IA 5KS2A 5KTMA 1WXHA 2PBZA 1T3TA 3CKMA 3IBSA 3U7JA 3MWJA 4JD5A 4TV9A 4BGIA 4CKCB 3PPXA 4TSKA 5CG1A 4JUDX 4RS4A 4CLRA 3T7TA 1DADA 1V8DA 3TD2A 1FSPA 1PX2A 2GF9A 4YMHA 3TGPA 1XD9A 5KC8A 1I94B 1HO3A 3AM5A 1VSUA 4R9VA 2OC4A 1K5DA 2X9QA 1FDIA 2EKQA 1JB9A 3PQ7A 3DAFA 1E2MA 3DE2X 4NOLA 1HLFA 4V3BA 5ELMA 1T2UA 3K94A 1FVXA 2F67A 3WMEA 3PPVA 3CRZA 2DKFA 2YC2C 5U9CA 2BT4A 2C59A 4Y2HA 3V4OA 4ZT2A 1T6YA 2X14A 3JQ6A 3LW7A 5BNZA 4B47A 4COOA 3GJ4A 3IURA 1M2KA 3A06A 4D9NA 1PTKA 4C0JA 2FPIB 2V7PA 3COSA 2PNFA 4I5FA 1V6SA 2GOYA 5BSRA 3TW4A 1E6EA 5DYNA 2WJYA 4M0MA 1PG2A 1SCUA 5L6LB 3IIIA 1M6EX 4IFBA 4X54A 1V3TA 1R0BA 4MWOA 1KSGA 5I9NA 3QVJA 1YOBA 2PL5A 2QZ4A 3F9RA 5IT4A 3TTSA 3PUWA 5EIEA 3LOPA 2VBIA 4R7ZA 2Q7DA 1H2BA 1UZMA 3CWQA 5TJHA 2EIHA 3DBRB 3ZCTA 2ORED 4BYMA 3HXLA 4N3AA 4LFBB 3GLUA 1ZQ1A 1EJBA 3IOBA 1ZAKA 4JP1A 1E7MA 1L6IA 1S1MA 2XMGA 1EA7A 1N4DA 1ZOLA 2VXOA 3F0TA 4YDRA 3ZUGA 1SBIA 3FUXA 1IE3A 1R5JA 2XQVA 3KM0A 4J7XA 5GJWC 4G84A 3UGTA 1TVKA 3DOFA 3O93A 4H4DA 4WOJA 1KBOA 5ADUS 3JALA 3K0BA 3QFCA 2D2FA 4IMIB 1QFXA 1QF7A 5CG2A 3Q7QA 2HDWA 2VDMB 3AUTA 3GIDA 1H9BA 4ZVLA 4D0GA 5AKXA 3T4PA 1UZUA 4JWTA 1D09A 2WTXA 5FOUA 3S2ZA 3ZWDA 1PHPA 1AF4A 1JXOA 2OSVA 3FF1A 3O03A 5IDQA 2AC4A 3G8DA 1HEUA 3M4YA 1AURA 4UAUA 4C3VA 2BJVA 3IH5A 3VNAA 4PX9A 4UHCA 1IJBA 1V47A 4BQEA 3CW8X 4I9UA 4CM7A 4KCGA 1JJVA 1QGZA 3W90A 4LBZA 2FPSA 3BD6A 4LC0A 4AF8A 4M76B 4OLAA 4NBLA 4A1FA 1GLVA 2BMJA 1TMGE 2QNIA 2WUDA 3JWPA 4N7RA 5IYZF 3DZCA 1ZK0A 2H51A 3RSCA 1AK1A 1LU9A 1VJGA 3B7WA 4Q1CA 1N5RA 1H6BA 2NO4A 4Q9AA 1QO0A 3AY3A 4GC9A 1DT5A 5LC1A 4XB6B 5REQA 3ICEA 4HDRB 1BEZA 1K68A 4C5AA 1MXHA 4YRTA 2A58A 4Z9YA 4TSFD 1OH6A 4N8SA 3MCWA 3K92A 1AGYA 1E9DA 3IILA 4NKRA 2BKLA 2NNLD 4CWAA 4M2LA 1XMQB 3VDNB 3HO8A 4Y1GA 4ASUA 4RNDB 1J0DA 5CVCA 1AKMA 2HU2A 2HLHA 3ESBA 5A6VA 4R41A 1W0CA 3FB4A 3LQKA 4OV6B 3TKAA 2APJA 2ZJBA 1IG0A 3NWJA 3D8UA 1HH4A 3INYA 1A9OA 2HU5A 4WA8A 4RANA 1VSVA 4JT8A 3VJKA 1ZJ5A 2DPGA 1SHUX 2W2LA 3KZVA 3O8OB 5EOVA 2FMKA 2G63A 4YT8A 3LT2A 2Q3EA 3E6AA 5FEUA 4KG7A 4MUFA 3LL7A 4R9UC 3C7CB 3A4YA 2P77A 4GX1A 3BGVA 1M3SA 7AT1A 1D1QA 2EBWA 2CLEB 5I7WA 4KQWA 1RT9A 4I4NA 3W79A 2H2HA 4RUKA 4J2OA 4A2QA 3BTVA 3HU1A 3DMDA 3OF5A 5BW6B 2V5VA 4L9AA 2CFRA 2INGX 3LWNA 2WJHA 2XQIA 2ZU0C 2Y6VA 4JOQA 1YUNA 5NLLA 1ZKDA 3AOEC 2YNMC 5EE1A 2V6JA 4N7BA 1FXWA 1GQSA 1I4DD 1TM1E 5FWAA 2AOXA 5FTKA 5G4KB 3KX2A 3KC2A 2OE2A 1N6HA 2YOGA 4UVEA 4W9NC 2H9YA 4JR2A 3SX0A 1L7NA 1C3VA 3A1TA 4WJZA 4KPUB 4B2YA 4US2R 1Q21A 4TYPA 3H42B 3D2CA 1KS9A 3ZTTA 2A92A 4MPTA 4WDQA 3B6MA 1QSGA 3IVAA 4YTEA 5LBTA 4KIWA 1JB1A 5FR2A 1OI2A 2XX3A 1RRGA 3IUMA 4DFDA 3BTSA 3B1VA 3EFOB 2PZJA 1MEEA 1Z7YA 2VJAA 1VL1A 2IYRA 1QHEA 1P1RA 2XVMA 3D7MA 5ELLA 1BEEA 1FP7A 1JPNA 2OV8A 5CH8A 2J7PA 4NH4A 4FMDB 1NM5C 4NH0A 4Y6QA 3VNVA 2QM8A 3NKFA 4QPCA 2Q3FA 1RHRA 1K8YB 3KKKA 5AI5A 3MWLA 4QFBA 1J6UA 4ZT3A 4RFSA 1MDFA 1GKLA 3UFXA 4JSRA 5AW4A 1RMYA 2C4TA 2H2AA 5GGXA 3C3PA 5EJ4A 5FV4A 2UYHA 3DTVB 3N6VA 3MJFA 5A4MS 3N5KA 5IYZA 4B79A 5KYWB 4MQLA 2ZUBA 1I7SB 1Y7HA 3A1NA 5KDLA 5HUHA 4DV1B 3KEMA 5GIOE 2LZ0A 3L7AA 4Q7MB 3FPKA 3UMJA 1EP9A 2JBAA 2RGNA 2X8WA 4O4LA 1JEQA 1TF7A 3A14A 4R01A 5FBWB 3S70A 4DTCA 1F6BA 3PEVA 3TR6A 1BHO1 4I3FA 4E5MA 2OR3A 2H06A 3BS4A 2FNAA 4C1NA 4GDFA 4IFIA 1L4BA 3WISA 2ZBVA 4JQCA 4BXOB 1DDIA 4W5WA 2WNSA 4UOEA 3SX2A 3TEJA 5FAXA 3QYFA 2XB2A 2L42A 5EP3A 4ZJPA 4DV0B 1GTG1 3R0XA 2BSQA 1B74A 1E1LA 1JIXA 3QLUC 1B0UA 2OT3B 2BGJA 2ERYA 2HNAA 5EZ6B 5TMEA 1OX4B 2VHTA 2Q3JA 3FHOA 4P92A 4WZBA 3SMVA 4DMHA 1E3IA 4QPPA 1WDKA 1JQ5A 2FG5A 3PVCA 4R2KA 1FC0A 2PWPA 3LX5A 1C9YA 2X86A 1XRNA 1YZTA 2W2MA 4L02A 1YOVA 2PD3A 3PDWA 5LBUA 2SHKA 3OT1B 1TZCA 3IUYA 2O3RA 3I9V1 2QRUA 2EGHA 1JDSA 1GRNA 2C3PA 2P2GA 1EH5A 2YICA 4HFNA 4ZVSA 4CQMB 4EB8A 2XCQA 1TM3E 2H2WA 3KXDA 4M9RA 4IUYA 1C4WA 4EUEA 2PMFA 2ZE5A 4GSKA 5JNLA 1X2BA 1KMNA 2FU5C 3EH1A 3OE1A 2KHZA 2PZBA 4MUKA 4WZ6A 3TZBA 4EELA 4B3MB 1GAWA 3A25A 4IJUA 3ROGA 2FOLA 3QXCA 4ALNA 2ZTVA 4LV8B 2YWEA 1GZ5A 3WYFA 3PUZA 2BLNA 1ZLXA 2CNWD 2ZJFA 3MCZA 3LRTA 5KMGA 3K2IA 1XZKA 4QDXA 1FTYA 4YJDA 2Y1XA 1XP8A 3BDIA 4MJXA 1KU6A 2NXJA 5IUJC 3ELDA 4MWBA 4OM7A 2VG8A 2FWBA 2XVZA 3SDZA 4H3VA 4B35A 1VRCA 3ECSA 4P3XA 1SXJB 4GGMX 2KLBA 2PUDA 3ZHQA 4JFAA 1JP7A 1IYZA 3DM5A 1VIVA 1HLDA 1XKXA 2OILA 4ZCIA 1JNYA 2AZMA 1E2PA 3OTGA 3R8CA 3SMQA 4DF3A 1M1ZA 3OEYA 3DQZA 2PQ2A 3CYFA 4ZO7A 4YV2A 1LBSA 3NXKA 3IYLW 4GM0A 4DCMA 4F5WA 4IHQA 4UTNA 1USIA 3B1KA 2HDOA 2LGJA 3HBAA 3K6SA 1IOWA 2PEYA 3ZYCA 1IVNA 1Q5PA 1U5BA 3RHTA 4D80A 5K3EA 2WKSA 4BMOB 1KO7A 1NW4A 4LRWA 2XXBA 3Q9UA 4BQPA 3BXHA 3NC0C 5I7FA 2IYQA 1C81A 3JQPA 2FLVA 4JBLA 3IHLA 5L3RA 1DUVG 2PYIA 4JP3A 4MMXB 4U5QA 3SICE 3G9XA 4P31A 1CR4A 1TD1A 5EJ6A 2A30A 2G04A 4I81A 1X94A 5DLDA 2Y1CA 3JARB 1MQAA 3BXZA 3CRQA 2FH5B 1Z2OX 2EKPA 2IFTA 4WPGA 5F1KA 5EWLB 5JALA 2WDPA 2J3HA 2Q50A 1VXOA 3OZSA 4JNKA 4ECAA 3NBXX 2ET6A 4KQ2A 2C5HA 4KOEC 5HHTA 3GLFB 2BR5A 3Q85A 3ZCPA 2PZFA 2OFOA 4F45A 1PVDA 1HR0B 2D3WA 2P2SA 3IQXA 4G86A 3M8KA 3FNBA 5AVRA 3O3CA 2AFHA 1JGTA 3GGGA 5F3WB 1K1EA 1BKSB 3PTLA 1MHPA 1S4MA 2J4FA 2QW0X 4F4DA 5BWMA 3TFWA 1A97A 3HB1A 1OLUA 3N8GA 1WG8A 5KJEA 3TVTA 1DBVO 1IY2A 3IR7A 1GCUA 1T2NA 1U7OA 1LV7A 1TTHA 1XHLA 3HO6A 1TM2A 1L3CA 5G0SA 2BTQA 4IKOA 3ES9A 1U7HA 2WFZA 3UXMA 2CL7X 1VE9A 4ZPJA 5ITSA 3JQFC 1FZTA 3B2NA 1MKYA 2XUQA 3K9NA 1K6IA 3D0QA 1MV5A 2NSLA 3QBTA 1JUDA 3LT1A 4YRDA 1P4GA 2PSEA 1Z35A 2YWCA 3JQQA 1O57A 2WUFA 3BBPA 1C0KA 1Y48E 1BVYF 3GQBB 3K0AA 1XVIA 3ORRA 3QVKA 3JQGB 4JLWA 3VPFA 2IUFA 4P7GA 2ERXA 5AK5A 3DMTA 3O3MB 2ZJYA 3I28A 3AF0A 2PUHA 4JYMA 1YVRA 3H86A 3PA8A 3ZCVA 4EF6A 3EGDB 1CUJA 3N0RA 4H0FA 5J63A 1FFSA 4GXNA 2GSDA 1KZ9A 5BUZA 2Z09A 1W87A 3H19A 4DM3A 4H7EA 1L8QA 2VF4X 2VRWA 4F97A 5EJEA 5I4CA 5CFPA 1UM9A 4CLDA 1WZIA 1OXMA 1YMVA 2AI2A 3H4MA 1GZHB 3H1AA 4IILA 3R0IA 3UK2A 3LUCA 4ZAZA 5CEEA 5F64A 4MKIA 2D06A 3DMNA 1PFWA 4NLLA 2NT4A 4ZD6A 4YRAA 1MBZA 2TMYA 1HOXA 2CZQA 1FFDA 1DKRA 4GT1A 5DK6A 1H1DA 4I4IA 3RVMA 2C8JA 1ESZA 1IMOA 3IELA 1P60A 1PJTA 1S89A 3I1IA 3KLPX 5JXGA 5FJJA 5F33A 3K9GA 2GFHA 1C30A 2JHGA 2C29D 4OL9A 4XIJA 1J1ZA 2QR2A 5FOSA 1TYBE 2VF8A 4QODA 4MAMA 1DIOB 4NV3A 3TS1A 3F6CA 1YRAA 2QUZA 3K2BA 3OC6A 4BO3A 5D5HA 2XCOA 1C1DA 3U62A 1E4VA 4LYAA 1SIWA 3MLAA 3H2IA 2YJNA 3DEKA 4PHGA 4QEDA 1ISGA 5ARBA 1AU9A 3HN2A 5DDIP 1F9AA 1UP4A 4GMFA 1KY3A 4MW0A 6NULA 4UQLA 4EYGA 2AWOA 3CPEA 1KTIA 4U8HA 1GTJ1 1RI3A 4LCBA 2OZLB 3CLUD 4ALJA 2OESA 3CURA 4L4SA 4MCIA 2NZ8A 3GT0A 1UKVY 3U4IA 2H92A 4PICA 3HM2A 2EVWX 1SOAA 2QT0A 1SCIA 1DC4A 3G1UA 5KKNB 1Z0SA 4U3JA 3GVCA 3RG2A 5CDYA 5LP1A 1WBBA 1R4NB 1YHYA 2CHVA 5DM2A 3T5CA 3IT2A 2ZRQA 3U44A 2V7XA 5DHSA 3D3QA 5G4LA 4HQ0A 5BSHA 3BJRA 3FFWA 5K01A 5ALMA 3SIWA 2Z4SA 1YDEA 4EPYA 4BGDA 4PLFA 3STUA 2C98A 2ZZKA 5JASA 3LIPA 3H2BA 4MS4B 1QPBA 3B60A 4FIZA 2O3SA 2QENA 5AI4A 3DP9A 3F4LA 5AK0A 2FGJA 3AIMA 3ZJ4A 2Z9DA 1EIZA 2DFLA 1FDTA 2I2CA 3HDGA 1A8PA 2E5WA 2V45A 3ISTA 4JUAA 4KFTA 2QE7A 2BIFA 1I51A 4LK2A 1OFGA 3FPBA 3KFLA 2D4AA 5J1TB 4DPMA 1I80A 1SUBA 1KEEA 2Q2QA 4EUSA 1KZGB 1A77A 2Y1EA 1QONA 3M81A 2X2FA 4HYEA 3DUFA 2NVUB 4Z9FA 1Z63A 3FIUA 2FXIA 1SBYA 2X4DA 3PHHA 4PG6A 2I8LA 4UVIA 5DWQA 3X44A 4Q12A 3AEXA 5LB4A 2O9JA 3B5IA 2MMGA 4EFKA 4E2YA 2R3SA 1X14A 4ZOLF 4E7OA 2CFIA 3HFRA 1RFLA 3E81A 1CF2O 4CRWB 1BCSA 1P4HA 1YQDA 1VDMA 1VCNA 1M67A 5ALRA 1RAIA 3GYBA 4E07A 1B0ZA 1HMYA 1KFJB 2VUTA 2XZDA 1YS2X 1ZK3A 2ZJ5A 4LYGA 5DCUA 5HQ3B 4O2RA 2DQYA 4M1WA 1TLFA 2FG6C 1S2LA 4H4EA 1QXSA 2AMJA 2QT1A 4KI0A 1TJ4A 4UDXX 1W0KD 2HQSA 3KOWA 5HKKA 3VKWA 1NJFA 1VECA 2DHRA 4Z99A 5K3CA 1EBFA 3AY0A 1FW6A 4F84A 2XD9A 2ZK7A 3LPMA 5K0JA 1R7RA 1JG4A 4QAQA 1DB3A 3VHLB 4EX6A 5LP6B 2LVBA 4LF4B 1SIUA 2JJ1A 4TSRA 4QBHA 4M4SA 3LBNA 1L5LA 1XZAA 5EI5A 2H9AA 5JCZA 2VTVA 3SJAA 1EWRA 2GYUA 3EG9B 3TW8B 1SZJG 3ZDEA 1U0TA 3OZEA 1YB2A 1GAXA 2PZGA 4YONB 2PWZA 1W4AA 3CC8A 1XQVA 3FG9A 2P6UA 1NQAO 1RMQA 3BXEA 1H2YA 4TM8A 4ZCPA 3WLSA 1FP4B 3NOOA 1OAAA 4X64B 1XTJA 1QYWA 4JC8A 1DO0A 3SXUB 2H8KA 5HS6A 2NU8B 1T9DA 5KNBH 5J4HA 2CV2A 3AF5A 3EA0A 4CDMA 3PQ6A 4H6WA 2BFEA 2DJIA 2IPNA 3LZDA 5F51A 4J0KA 4HHEA 5BN5A 1UBUS 3NT4A 4XWGA 1EFCA 5A6SB 4B7XA 4NEHB 4BNTA 4ID9A 4GE3A 3FTCA 5ECDA 3BE4A 1I13A 3IVGA 3OQBA 2JAXA 3DS8A 4DLKA 1KWGA 2QSUA 2FSUA 4LDQA 3HFJA 3WKBA 1FFAA 4YJGB 1YR9A 3C48A 3AEKB 3W34A 1WAMA 3H5VA 5IPFA 4FIDA 3GB9A 1JDBC 4WNCA 1QZTA 4YLGA 3RH0A 1QVRA 2XITA 4FJ1A 3PGJA 4V38A 2EG9A 4GX0A 4XGQA 2VNJA 2NOAA 4MVJI 5BORA 1ZM9A 1N5KA 1P74A 2OQIA 5CLJA 1DKMA 3ZZ1A 2X76A 4XDYA 4FQ8A 4G8BA 1YL6A 1T9HA 3HA5A 1CY8A 3PITA 4MARA 2B9VA 5ELXA 1P2GA 4LOKA 4L0CA 5D6NA 4BMPB 2QRVB 4MIYA 3KFXA 4MQFB 3SCZA 3UWOA 5FPKA 1CBUA 5CNKA 4OI2A 2J9RA 1L5OA 2WIAA 8ABPA 1S02A 2WU8A 3ELWA 3NHZA 4TLBA 1NW6A 3CSSA 3C5VA 3E9YA 4ONEA 4LK3A 1XQ6A 4JVLA 4XI9A 1N3YA 3BN3A 4XDZA 1FVHA 1UPFA 1ZN9A 1BH2A 3ORSA 3OQPA 1UWKA 4Y2XA 2HHCA 4WK0B 2QN7A 2YQZA 3NTQA 2HJWA 1W4CA 2ZBFA 3FCAA 3VOAA 2WAOA 1GGKA 1V95A 3IP6A 4XIFA 3LWBA 2A5FA 1XZPA 3KE9A 4UVHA 3AL2A 4DQDA 5B55A 3DR3A 1UBMS 2BP7A 3QNUA 1J2UA 4ZMRA 1I32A 4QTUB 5F23A 3R7DA 3JS5A 1Z4IA 3PQCA 3ZHUA 3FOAA 3B36A 1XA0A 1HZZA 3FOWA 1QIGA 1ZICA 5FUWA 3MK31 4URVR 2IS6A 1ESNA 1MG5A 1UZLA 1ZA2A 5GVSA 4YXWA 3DZFA 4JVSB 821PA 4O0MA 1WCYA 3AHEA 3KCQA 4C87A 2HHLA 2ZYGA 5T67A 1V7PC 3NUZA 2BMVA 1KDRA 4QJ5A 3UICA 4Z1MD 3NAZA 4GSLA 5H3CA 5FIUA 3HYSA 4XAQA 4HDCA 1ZR4A 3H2ZA 1QFMA 4RLSA 5ANRB 3X1DA 2RGBA 1N5IA 5DXJA 4URHA 3L1IA 2D0PB 2G7MC 2EATA 1GCIA 4MQEA 5AVWA 4HEHA 4P3PA 5JNRA 2H59A 4RD3A 5J2UF 3UK7A 2GPTA 3VBCA 3PPIA 3TQSA 5E9WA 3LYUA 4W6QA 2OD9A 1XZDA 3GP5A 3P19A 3LBYA 5GADl 2LNDA 3QBDA 2VIIA 4R5MA 2ZTUA 3NIBA 4JAVC 4UC0A 4FOOA 4UBNA 1E66A 1QTIA 3PA6A 4V0OA 2A6PA 5G40A 2VJMA 3HB9A 2RH4A 3GV0A 3PXBA 2XIQA 5G0VA 3SQDA 2LV8A 3ZI0A 4HOYA 4E32A 1W48A 1YVUA 1NUQA 4PSKA 4MHOA 3IPRA 4G3XA 3FPFA 3QRWA 3SVZA 3O0TA 2H5LA 5KJCA 1U0SY 2R8XA 5EGSA 3Q5GA 4ND3A 5EWMB 1DWOA 2AEMA 3AEQA 4X1IB 4NS1A 4KUHA 1MNQA 2VDVE 3HLYA 4G25A 5ERGB 1H8ED 4JLKA 2AXEA 2QTZA 3RYTC 2Z8ZA 1QMPA 2BDTA 5L51A 1WXDA 3MWGA 1Z0ZA 2NSDA 6PFKA 4NYIQ 2I1QA 2B35A 2RB4A 1Z6TA 1PN3A 4J49A 5JO9A 4BBZA 3RFFA 4QYSA 5DTMA 3PWKA 3DFMA 2EFGA 2NP7A 4GGOA 1Q74A 1YR8A 3KKQA 4V0KA 3U5TA 4RELA 1Q22A 3IMEA 4PPNA 1XK6A 4F3CA 4H6PA 4L07A 1SUIA 4RGYA 1OV6A 3TCKA 1NNI1 4X20B 4U2GA 5BWLA 4KITB 3T1YB 1NY6A 2WW8A 1U0FA 4CCWA 3K71B 5DEIA 4Q6BA 3OG9A 2G0AA 3LO5A 2GK6A 3WLQA 2HK9A 2W6CX 3Q3IA 4CHTA 4BPBA 3JQAD 3NRJA 3V32A 1ARZA 2IW3A 1EUDB 4C4RA 4QBIA 2ZE6A 2QYSA 4S2EA 2QT9A 3U7QA 4G1FA 1CEEA 3PXXA 1WKBA 2GBIA 3QU2A 3W05A 4TXHA 4HGPA 3DDOA 3JPYA 3RJMA 1Y9EA 1X7DA 1VLVA 1CQIA 2AUTA 3ZGOA 2ECPA 3MOGA 3TIXB 3T61A 3A9VA 3JVUA 3H0EA 4FFOA 1DRKA 4N12A 5HW0A 1NVMB 5EC8A 4KOAA 1Y1RA 4P4SB 4A23A 3GP8A 3BHJA 2YWDA 2Q4BA 3FR7A 4JXJA 3O9MA 1Y5NA 4NJEA 1KNXA 4LF8B 4QTYA 1D6SA 1WDLA 2Q3CA 2EQ5A 1A7AA 3NDJA 1WKCA 4QM6A 1YQTA 1ZCAA 3JYHA 3QBVA 5ISMA 1I3NA 2RONA 5AVXA 3I62A 1R4AA 4DIBA 1VBNA 3GN1A 4F4HA 2FUNB 3HJBA 2PAFA 4GZMA 3TZEA 2Y1KA 4C88A 1G4AE 2XOEA 4QU9A 1J0AA 2UZ1A 4DABA 3THXA 3PUXA 1FP6A 1HLPA 2AN4A 3LUKA 4MEBA 3BJMA 3KT6A 4V39A 3W5SA 4FYYA 4DBZA 1YJXA 3HGMA 4JB8A 4TKMA 1SUEA 2C9ZA 4P83A 4J75A 1XDSA 2FW7A 5IK2A 1QGAA 1SHLA 2AUMA 3OZTA 3K09C 1VMEA 3G0HA 1N3IA 2ZE7A 3LYLA 4HAOA 2VDPB 4OKSA 1UOQA 3IVMA 1DLIA 2AQHA 2DR3A 3BICA 3EWNA 4JBWA 1JBKA 4P4NA 2YMPA 1F2VA 4GU5A 2CVOA 2PS3A 5HTKA 3HE3A 1OC4A 2C95A 1X1CA 4F5ZA 5K9ZA 1LW6E 2IZ6A 4RLHA 3SD7A 1A9YA 2QTGA 1USUA 4MUXA 1T91A 4WXHA 4Z0HO 1KORA 4PZ9A 1Z4LA 3IQHX 2WJ4A 1GLNA 1CV2A 1G3IA 2XV1A 1UWLA 3HP1A 3PL5A 1KI4A 4RIEA 4AMZA 2Y0EA 1FFEA 1KQFA 1JQKA 2YXDA 3PC8C 4A2CA 3QX3A 4QREA 3SI7A 3ED5A 3OIVA 1XRRA 2BFCA 1M2VA 1X38A 3BMQA 3OPYI 5AUOB 3UMMA 4PAWA 2VQEB 2HREA 4IHJA 2ZYVX 4EKIA 5AUPB 2IU6A 2M98A 2QMOA 4LNUB 5TF4A 1NSFA 3O8QA 2VUHB 1ZHHA 3E2IA 3ONWA 2ZCVA 4XQGA 2PHZA 3H9UA 5HQJA 4FYVA 1X13A 4IMJB 1E61A 4S1VA 3TVYA 3OIYA 3DKRA 4YCBA 4B6SA 1MEOA 3IQWA 2AMYA 3QFSA 4QT4A 2OV1A 2XLCA 1KK0A 2YIMA 3AUKA 4J2TA 1T8UA 3COJA 3W9UA 1AGXA 3ZNQA 2FI1A 3RVPA 2H18A 5M2QA 5I6DA 1AZWA 2PKXA 1PK7A 2D62A 4KZPA 5JJIA 4Y98A 2OCLA 1MC8A 3EXFB 3I42A 4N0EA 5CXUA 1OXBB 1HM5A 1T2VA 3KQLA 2EFJA 1JL3A 3UV3A 1FMJA 4RKQA 2VHXA 4GVLA 3M5WA 3OOYA 2AXNA 2BFBA 2BZ1A 3KDAA 4PZYA 5HE8A 5PNTA 2GYWA 4DSOA 1KJIA 3UOWA 3VC7A 3PD1A 4WN3A 5B3JA 2UYCA 1FNDA 1ZHFA 3AOGA 3O3OB 5LNK6 3DB2A 3QP9A 1YK0A 2FVXA 2ZIXA 3CEHA 1MZVA 4WWHA 5AM0A 3RVKA 4DUGD 3GFPA 3LX4A 2IX9A 4UHDA 2A94A 4JLJA 3I6BA 1F2UB 1YDHA 4YCLA 2YCLA 4EQ6B 3KSRA 8GPBA 2QA5A 3GNTA 2WP8J 4Z86A 3GDWA 3RTCA 3U4DA 1HDEA 2I2WA 4Y6SA 3H11B 1JS1X 1P0MA 2VDUE 4FW9A 2JJ2D 4H1TA 1GTZA 3V8VA 4DLRA 1L5RA 3G49A 4M3NA 3Q6MA 4V0LA 4C76A 3H1PA 1S01A 1EQ2A 1MF7A 1RR6A 5JCJA 5BUSA 1T8YA 2CUZA 3N2LA 3HA2A 1VB5A 3F6YA 3VRHA 2QL9A 4EY7A 4W7SA 4N6OA 2IYOA 1YRQA 4RAOA 5GZ6A 3B3QA 4Y18A 5FO0A 2NMVA 1O8CA 2OCDA 1FUYB 2YFHA 2HLNA 2VJKA 3AKCA 4RY0A 1XMXA 2BDUA 4FEYA 3PGXA 3KD3A 4IIUA 2BHTA 2NTJA 2PMKA 3MG9A 3G0IA 1MIHA 4HDMA 5M34A 4J1SA 5I9SA 1MC1A 1LSUA 3KPWA 4YC7A 3L8YA 2GNOA 1B6TA 2ZWOA 2JEZA 4JGIA 1ZD4A 3K6KA 1OBCA 1XTTA 2A84A 2B5OA 2OBXA 3G2MA 1OTYA 5LOVB 4AMVA 5FXMA 1K8XB 3VMFA 3ZBUA 1T3SA 1F3OA 1LRJA 2GN9A 5JY6A 1X7ZB 4UTOA 3Q7SA 1KVSA 3IIKA 4PLTA 1O8BA 1CFZA 2W48A 3PDUA 5G1OA 4C04A 4E14A 2W8ZA 5BN3A 2BHLA 4EI7A 4MHTA 2R65A 1WXIA 2RB5A 1UAAA 1E1NA 1MC5A 3KK0A 3CRVA 1EFHA 3A26A 1SCDA 1DL5A 3DFUA 3R8FA 1US8A 2YYSA 1M2HA 2HA7A 5JECA 2QRLA 1EK0A 2OXCA 3FTFA 1O94D 2AH5A 1CETA 4HFMA 3WJAA 5K0GA 4QVIA 3D64A 5JBIA 1J9EA 2IYZA 2JGDA 2RHGB 3AR9A 2IHJA 4NPCA 4HGYA 4B43A 1BZYA 2PPVA 3VYRB 1VLLA 2D5BA 3F71A 3I4FA 1X1TA 4BRSA 3J7TA 3OQJA 1RPAA 1NIPA 1PFGA 3GMDA 2ZI4A 4N47A 3WGQA 3DP7A 3PXEA 1DRUA 3X2EA 4CV0A 5JAIA 3FMGA 5IBQA 4KR7A 4AUKA 4ZODA 2YASA 3BMOB 4XQCA 2M1XA 2QGNA 3WV4A 1ZUWA 3VSEA 2BDEA 1AQYA 4FNMA 4EARA 5AOVA 4RZXA 1XPJA 2J59A 3DKKA 1JIVA 1G5FA 2I6XA 5EFZA 1WZUA 2P6NA 3QIVA 4C7VA 4ZJYA 1RM3A 2PL9A 3FBWA 1Z7WA 3O21A 1ML4A 5DM70 4P0PB 2QMZA 5IFKA 1T0BA 4ILKA 2CJPA 3CLRC 3IAEA 2C2OA 3OCVA 3S99A 1T1JA 1T5LA 4RCVA 1XZQA 3SY8A 3EWIA 4E5KA 1IAQA 1UPCA 4ZFNA 1P2TA 3HU2A 2G3YA 4JSYA 4KWHA 4M1OA 1A04A 2HJGA 4G0YA 2JVJA 3GO4A 3T7KA 3A9UA 1NJ5A 4OGGA 1I6LA 1XEXB 2C1EA 4R51A 2EC5A 3DPUA 4YRCA 3U17A 2QVZX 3L1KA 4BFYA 3Q88A 1B42A 4FYJA 4RVCA 4RK1A 4D9FA 4HB2A 4NULA 4CF5A 2PX2A 4WCFA 1ONNA 2Z4TA 3L8GA 3L0BA 1XKLA 4TYQA 1PNQA 3R75A 3V7FA 4B71A 2O8DA 5FI0B 2O5VA 4JJAA 2P9HA 1LGYA 5EHXA 4RQAA 1DGQA 1MEJA 3LQ4A 1C14A 4B81A 5CFMA 1LX6A 2HXYA 4R2JA 1TQ4A 2NADA 3QI2A 3D6AA 2FE1A 1CY6A 1RC1A 3MWFA 3R24A 5EZSA 3AJ8A 1ZUNB 2O8VA 5KYUA 4Q9JA 1NONA 1OGYA 3V6LA 4TXNA 2O23A 1E2NA 1IUNA 1IZYA 2NWQA 2PXCA 3UB3A 3L40A 4H77A 1Z56C 3EUEA 5IEBA 3IMFA 3BMNB 4DSZA 3MWYW 2HF7A 5L4SA 2C82A 2VP6A 3PQ3A 1ZOPA 4YP5A 5CT9A 4C05A 2I9KA 2ZEJA 3WLNA 3PQFA 1R9JA 3HR7A