2XYGA

Caspase-3:cas329306
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xygA00
4QTXA 3R5KA 3DEHA 5IAEA 3R7NA 2CNNA 2NN3C 3IBFA 5IBCA 1RWKA 3GJQA 2QL5A 3NKFA 3GJTA 1SC4A 5LUBA 2J31A 3P4UA 3R7BA 1BMQA 3UOAB 2QL9A 4ZVQA 2AR9A 1RHMA 3PCXA 4N7MA 3NR2A 3SIPA 2P2CA 5IAKA 2H5IA 3DEKA 4ZVSA 2QL7A 1RWWA 4N6GA 4NOJA 2WDPA 4D3ZA 4EHNA 4HQ0A 5IBPA 3R5JA 4HVAA 4LSZA 1IBCA 2H4YA 2Y1LA 1NW9B 2J30A 3EDQA 2H54A 1M72A 4JJ7A 4EHKA 5K20A 4FDLA 2CNOA 4QUDA 4NOLA 4ZVUA 3V55A 4HQRA 4JR2A 5LU8A 2QLJA 4N7JA 1GFWA 2HBYA 4QU5A 3ITNA 4DCOA 4EHAA 2Y0BA 4I1PA 1KMCA 4AWAA 4QU8A 1I4EB 4EHDA 2K7ZA 2XYPA 1NMQA 4QTYA 4JQYA 4FEAA 5IBRA 4PS0A 3P45A 3GJRA 1RWOA 2HBZA 1RWVA 2FUNB 5IANA 5IASA 2CNLA 2H48A 1NMEA 2H51A 2C2KA 3H11A 4PRZA 1NMSA 1K88A 1QTNA 4ZVPA 5LU9A 4QUHA 5JFTA 2CJYA 3RJMA 2C1EA 4ZVOA 4EHLA 4PRYA 5IC6A 1RWPA 1PYOA 2XYHA 4M9RA 3D6FA 4QUEA 2C2ZA 4FXOA 1RHKA 2QLFA 3UO8B 1SC1A 2CJXA 2XYGA 3H11B 3S8EA 1JXQA 3OD5A 3PD1A 4QUJA 1RHUA 2XZDA 3GJSA 3KJFA 4JJ8A 5IC4A 1GQFA 5IARA 1I4OA 1F9EA 3R6GA 3E4CA 4I1RA 5I9TA 4AW9A 4EHHA 5H0IA 5LUAA 4FGUA 4NOMA 2FQQA 3SIRA 4DCPA 1F1JA 3V6MA 4EHFA 1QDUA 4JR1A 4QU9A 4D3YA 4D3XA 1RHQA 4JJEA 2H65A 5IABA 4N6OA 2HBRA 3DEJA 2J33A 4N5DA 3NS7A 3QNWA 3V6LA 3K7EA 4ZVTA 1I51A 3R6LA 2DKOA 3KJQA 2FP3A 3H1PA 4NBKA 5I9BA 4AWBA 1RHRA 1SHLA 1K86A 4IEFB 1SC3A 3H0EA 4JB8A 1RE1A 4QUGA 1CP3A 1QX3A 2CNKA 3KJNA 4QUAA 1PAUA 1RHJA 2H4WA 5IAGA 3V3KA 4EJFA 3IBCA 4JQZA 4JR0A 2H5JA 4NBNA 1ICEA 2HBQA 4DCJA 2C2MA 2C2OA 4N6NA 3H13A 2CDRA 1CVRA 3EDRA 3S70A 4NOKA 3BIJA 4QUIA 1I3OA 4QUBA 4QULA 3DEIA 4IYRA 2XZTA 5IAJA 3D6MA 1RWNA 4ZVRA 3R7SA 1RWXA 1RWMA 3V4LA 4NBLA 3D6HA 4PS1A 4QU0A 1SHJA 3V4OA 2J32A 3PD0A 2QLBA
chains in the Genus database with same CATH superfamily
1Y8CA 3MMZA 4PM4A 3MG9A 4BNXA 4UPEA 4BWFB 4JDPA 3NHBA 3RAGA 2XUQA 4AU1A 4RQBA 4K9MA 3GT3A 2WRZA 4I1SA 2DPLA 2ZJZA 4DUPA 2QN9A 2W2PA 3PCXA 3B82A 3T7SA 3NR2A 1N2ZA 2RHDA 5CBKA 3VNRA 1AGPA 4LYDA 3X3HA 3K1ZA 4BQFA 2IYNA 1J2YA 2GERA 3IDAA 4KBYA 5G3ZA 4KN5A 1W2HA 3Q6MA 2J3JA 2FZKA 1KR2A 2BZGA 2OENG 4MI9A 4YJ2B 1N2CA 1YAJA 2AYXA 3GNLA 1T6ZA 1HPLA 1P0CA 1R8QA 1V96A 3B53X 4FQ5A 4X8MA 1ZKDA 5LNK1 3KQHA 4J9VA 5KHOC 5JTUA 5KVSA 1A9XA 4XD7D 2XGOA 4LHYA 5CJJA 1CERA 1HLDA 2V58A 5LBTA 1XWWA 4HPXB 4GLFA 1A9SA 2RKBA 5EKUA 3QH4A 1KZ9A 5H9WA 1LA2A 1TLFA 3I2IA 1GPH1 3AY0A 1EAYA 3MCUA 4RVFA 2O0JA 2OKGA 2NU9B 1OXBB 3ZY2A 2PZJA 1HKHA 2B4KA 2BDEA 2PKYX 2XB4A 2XMGA 1G1MA 1RTTA 4LEIA 2CFRA 5F7ZA 1NNLA 3RF6A 4P9NA 2RBGA 4ZK2A 4LX0A 1O0SA 4B7CA 2GM9A 5JZVA 4XE5A 1XMPA 5IJZA 1ODTC 1WOYA 2YXLA 2XAAA 4QHYA 4UHJA 2PD6A 4MVCA 4D5GA 1ZUIA 2CKDA 4WAUA 5E7MA 3G8AA 5EJIA 5CDSA 3G2IA 4OH1A 1D0IA 3CO5A 5KOIA 2PSHA 4MPJA 4TMZA 3BJIC 3NOXA 1D2MA 2VZEA 2J9GA 2V8OA 3PXDA 4QUKA 2DGDA 4L4UA 4V2UA 5ES4B 4IUBS 3HFJA 3HJCA 1GTMA 5EIFA 6ADHA 3RSLA 4US1R 7MDHA 2WB4A 4CM9D 2P6OA 3ND8A 4JJ8A 2Z08A 1AKYA 3W4IA 1U8ZA 4QBFA 5FWYA 4IOMA 4AI6A 3LO5A 4OXXA 1SIUA 1BRTA 1YQEA 2VDUE 3IQIX 1B2LA 1RAFA 1Y4AE 2I34A 4O1IA 3LTNC 3K94A 2WF5A 1J49A 2P9JA 3OAAA 4ZYWA 121PA 2JFPA 3C6YA 1Z35A 4CLRB 3LXMA 2GRUA 1QDLB 5K3AA 5J47A 1CF4A 4IRXA 1TK9A 1LB1B 1V7ZA 1X3SA 2OB2A 2WA2A 3G0DA 3OZFA 3QU9A 4ESOA 2ZSFA 3LY7A 3QEAZ 2BM1A 1J8MF 2GX6A 2P3LA 4EKYA 4NBKA 5K09A 2NZVG 4HYQA 3AW9A 2GAIA 1NL3A 3P0EA 4FCVA 2ZAGA 3PNSA 4FFSA 5T7BA 2GCOA 2VFAA 1XDSA 3AUFA 3A2KA 4PTYA 2L18A 4QG7A 1PR4A 2R6FA 4NJMB 2V03A 2AJBA 4ZOBA 1SUIA 3SICE 1W8DA 1FW8A 2C2MA 5A5VA 1YRBA 1IQRA 3GF4A 1SBHA 3WHIA 1DEXA 1VLZA 4C7XA 1DG3A 1VJDA 2ZRHA 2AKEA 2IEAA 3EZGA 4CXMA 1T43A 3D6MA 1D6JA 4K87A 3TG8A 1CUEA 2GBPA 4PPNA 1L4MA 3KD3A 1YU6A 2Q27A 1EUCA 2Q4TA 4ZAZA 3UWKA 4G56A 4PO3X 1GWNA 2WM8A 1ZC4A 4O08A 4X1IA 4B5KA 1CUBA 4UVGA 4ZANA 4KHPB 1U0SY 4BE7B 3MXTA 2QS9A 2EGUA 3JD2A 3W04A 3P4UA 3I1FA 4FHCA 4J91A 1R6TA 2POCA 4Q7MB 3WKCA 1K06A 5EP4A 5LKRA 1T4GA 2C4NA 1PNRA 4MO2A 1PR6A 2B21A 3USCS 4D9HA 2WM9B 4M1QA 1E4EA 3IR5A 4LMRA 4G37A 4QBKA 2PBRA 4AYTA 4EENA 1SIWA 3FAZA 4MUBA 3I6ZA 1EG2A 4EDFA 3WAGA 3CRNA 1EXWA 4WK4B 2C9CA 2D2FA 3KELA 5D2CA 3ZDRA 1Q95A 3ZVRA 4YH1A 4R1MA 2WVHA 4L5YA 3KOYA 2IHZA 2GSWA 2FFBA 4ISBA 3QYFA 4TKLA 1KAMA 3UTCA 1KJNA 4TTVA 1QFSA 3AEKB 3H2HA 4R81A 4GE3A 1AGXA 4K2HA 4EPVA 3CH7A 3RIYA 5P21A 1NE7A 3HDTA 4MW2A 4NHOA 3ROPA 3RAEC 5B37A 1TXGA 3W8NA 3PFKA 2PX5A 4N3AA 4R5HA 4P5EA 1H4TA 2O3UA 3ELWA 2OE2A 3L7KA 4KQWA 5CX1B 5E7QA 5BVHA 1YH3A 2CC2A 2ZT7A 1J8YF 1ZBDA 5E6UA 4IDQA 1UZAA 3A1NA 3T8YA 3IRUA 4PEVA 3DZ8A 3LVBA 4HNAB 1MDFA 1QHGA 1BN6A 2FN8A 3V2IA 4GZ3A 2H0RA 3W2TA 5LU9A 4KDEA 3Q7IA 1FSGA 2VUUA 2D2VA 2BFCB 3LUJA 3BWEA 3W1EA 1X94A 5M7EA 1XRNA 4JSTA 2VP2A 2PXCA 2ZRKA 3ZZUA 1KO7A 3HWX1 5MFZA 3U2QA 1NI4B 4Q6BA 1LRLA 4TLAA 1O97C 3H2SA 3HMKA 5BOVA 3L6DA 1JLLA 1YNSA 2YYAA 4L5IA 3KKLA 1JYFA 3KAJA 1V8PA 2GEUA 1BSVA 4JJZA 4QGAA 3RW9A 3N2ZB 3OLVA 3GFTA 1JGTA 1WETA 3CC8A 1VMKA 2G08A 5DGCA 3NTQA 2GM3A 1A7UA 4KO3S 1PQ4A 2G40A 2WI8A 3AQIA 3COJA 1XXHB 1XTUA 2UUOA 1W94A 1PVOA 5JRDS 5KTRA 2YVQA 1FDRA 5C2JB 2J0UB 1W5BA 3TTSA 5FOXA 2AC7A 2B5VA 4U1RA 4TMKA 3KJQA 5C4IA 1OH7A 1KAGA 4AG3A 3C3JA 4BLTA 4EJ2A 4MW0A 4Q1CA 3U3KA 3B6MA 1W85A 1XCLA 2BH9A 2PVSA 3MWDA 4ALKA 4BYGA 1GNLA 1YV9A 1F3OA 1A1SA 1DRJA 1ZJJA 2JK0A 1BXRB 2C9DA 3QY0A 3AJDA 2X0DA 1XLUA 3D0RA 3W4KA 1ZNQO 2YWXA 4G1MB 4R9RA 2H85A 2CXXA 2BSQA 3GFQA 1DNPA 4QDOA 3FGPA 2NO1A 2C0QA 1L7PA 4QDUA 1U2PA 4O1HA 3NTLA 3AL2A 3I2FA 4KWCA 4WVLA 1EVYA 1XF1A 2Q6LA 1M54A 3AF4A 3OX2A 3AM4A 3DFKA 5BRNA 1YT5A 2JFOA 3MJDA 5HQJA 4D9KA 2IEIA 4WLFA 4FD2A 4US2R 4FMCB 4KR6A 4HH1A 1DP4A 5JLAA 3PKIA 2NZ8A 4CDGA 3H5IA 3LUGA 1OJ7A 4JT8A 1EX9A 2HQRA 2X42A 4MV7A 3JQ9A 1D4FA 1DPFA 4QTZA 5U4QA 3ICPA 4OY3A 1OKKA 3W2FA 3JQBC 3KDAA 5J2TA 3ZE1B 4X7BA 5B7PA 1JEJA 3GBVA 1QQ6A 2OXEA 3H2BA 3PHBE 4MA4A 3EXFA 1C3LA 2ZJ8A 4BLUA 1HWYA 2X6TA 3O73A 5JJ5A 1OLSA 1I2ZA 1N5LA 3ND7A 2MSLA 2NU8B 1LJLA 3UAOA 2PY6A 3BULA 1TRKA 3NEYA 4IS3A 3FCEA 1JPUA 4KOEC 4QDTA 4Q93A 4MS3B 1V7QA 3P5BA 4Q00A 3A4MA 2FTKE 4OQNA 3A4IA 3EZXA 4GBJA 1Z0DA 1VG9B 4GICA 4N7JA 1EE1A 3HKEB 4Q7LA 2B36A 5E8JA 4ZC8A 4I1PA 2J7PA 2O8CB 1ANKA 3C3WA 4G84A 5TIIA 1EXMA 3R7WA 4EVSA 2Z1DA 4NMMA 1ZM2A 2Z1MA 2XT6A 5K1ZA 4CIWA 1TMOA 4YDSA 3K70C 5KNDA 4H1HA 4CCYA 3QE9Y 3KD2A 1U6IA 1GDDA 3QIVA 5THXA 4LY9A 3TKLA 5M04A 2QYTA 2PLWA 5LM3A 4P84A 1YKFA 3UCEA 3RK1A 3KKKA 3V8NA 1KWKA 4WT7A 2AG6A 4MP8A 4MS1B 3AHDA 4YALA 3IE0A 1EA5A 1QCCA 4C4OA 2ZRCA 1S2GA 2NU7B 4L95C 3UH1A 4Q9LA 1QO0D 4PLHA 4X84A 1N8KA 2HF2A 3AG6A 3RVQA 1QMPA 4JENA 3PQ2A 5KNBH 2PYDA 2HDNB 1EI9A 2YC2C 3JR3A 3ZIUA 2QZ9A 1I6WA 3EC7A 4PX3A 4EG3A 3H9EO 1X7HA 4LBYA 2H9YA 1YI1A 1BEEA 1GHTA 3ENZA 4X5OA 4F5ZA 4JUIA 4PVDA 1T1GA 3GDOA 3EB9A 3M5WA 3Q10A 3LWNA 1JAIA 2KI5A 1UMCB 3BMOB 3H4TA 3L4SO 1UDCA 1SBCA 2WIKA 2ZBDA 4B8ZA 4OBEA 3QLEA 4AJ2A 3LX6A 3WZ2A 4PYJA 4HS4A 2DFNA 3M4ZA 2ECPA 5CT4A 2A5FA 3U7GA 1N2IA 2J33A 4CDRA 3G6WA 3OQVA 3OP4A 4Z4FA 3LMKA 3JU3A 1I1HA 4TV9A 3TLYA 4S04A 4ZMRA 3TQRA 4R31A 4DBLC 4CG2A 2YICA 2EFHB 3BJEA 1F06A 5EGNA 3WK7A 4DLPA 4OSOA 4AWBA 3K1JA 3WDLA 2ON6A 2MINA 4MVXA 4QPPA 1C9MA 1SD2A 4JITA 1RYHA 3CRZA 5G1OA 2VWQA 2PCLA 3ANTA 1BOOA 4Q15A 5IAGA 1E66A 1A9OA 8GPBA 1U0NA 2NAPA 5FORA 1D2HA 3BA6A 4GOOD 2Q5QA 1FW6A 4D5EA 2HNKA 1ZI6A 5JADA 3HSYA 1N0VC 4B40A 4OQXA 1CF2O 2QQFA 3QVGA 1Q1QA 1PK9A 1X9IA 4TUYB 3TFQA 1TM1E 2EF0A 3MB5A 3GG2A 2NVUA 1V25A 3T35A 2AQKA 3QW2A 4GGPA 4KRGA 4XYEA 3CE9A 3KQMA 1VDZA 3GWGA 1IEWA 1Y1PA 5HJ7A 2FUG1 5BOSA 2GD2A 2I0FA 2UVPB 3D5EA 1V6SA 4D25A 3HNPA 2VDNB 4O2LA 2J32A 2DQKA 3PYLA 4K05A 4NBSA 1YKGA 4E88A 1ISMA 4IINA 3H04A 2X0NA 4QTXA 5B6JA 2Q1UA 1FTYA 4DWOA 5I7HA 2YJGA 5LQDA 4BHTA 4HNQA 5C1IA 2PA3A 1O0CA 2CSXA 4DMFA 1AH2A 3HI6A 1WCWA 4HBGA 3DDSA 1YNOA 5EZYF 2J3KA 3JWEA 3OHMA 4IS2A 2QLNA 3UBTA 3GUVA 3L0OA 1K4YA 4AN0A 5KQRA 2DULA 2Q9BA 2YINC 3ZE8A 1RZRD 1GT91 2G0AA 3KWLA 3ORSA 3D4BA 1U9IC 4GBGA 1JXAA 5FADA 3TQSA 4MIOA 3ZTWA 5CNMA 5HF6A 4RV9A 2VCHA 2OHVA 1XMVA 3QX9A 4EATA 3NWBA 4TWIA 4Y9TA 5TNXA 4EA7A 1ZMBA 1DJOA 1FDTA 1QAMA 4HXEB 1DOZA 3NT5A 3IVXA 2H1LA 4A2CA 1GTSA 1B3BA 2C5SA 1LBIA 1KFEB 4OA5A 5J59A 3RC9A 2KBEA 2BDTA 2GHIA 5A4KA 5G0WA 1YRWA 2ZU6A 3B5IA 3A1VA 3EEIA 4QXAA 4BQQA 1M74A 3X0DA 1D4OA 2YN0A 1E4YA 3OJLA 3QPDA 5I4IA 3TD6A 1UXIA 1Q7EA 3NHAA 5EWJB 4BNVA 2IZ1A 1Y7TA 4NPAA 1KBQA 3RS7A 1C81A 1C4OA 4RADA 3BFJA 3EAGA 4PR3A 1J22A 1YZ3A 3M3DA 3VDXA 5I47A 3BHJA 1FRVA 1NLMA 4G5XA 3IR7A 3O3MB 4QX6A 1ZMTA 1Y5IA 5EIEA 3ED1A 4XIGS 3AZPA 4A03A 2FPMA 5EJ7A 3HXKA 2A4MA 4MVJF 9ATCA 2ZM5A 2QX8A 3K96A 3DEZA 3L1VA 1T6XA 3QKIA 4I1YA 4QHSA 1DBQA 4GW3A 4JHXA 4PC2A 3RLFA 3VYWA 5K45A 1G2OA 1QWOA 1WF3A 3LX4A 3AETB 1T24A 3DR5A 4U5XA 4HX2A 4LRYA 5DHAA 2IUSA 3EGXA 1HQCA 3TIVA 2GXUA 1ABFA 1PK8A 1SG0A 1D4AA 1MTOA 4GUDA 3UANA 4ZCIA 4LJRA 3DLTA 3LP8A 3O75A 2QLMA 1XD2B 3CZQA 2BC9A 3AC0A 1RLUA 4WCDA 5CXQA 4H6VA 3N70A 4HWRA 1VMIA 2O8EB 5CLGA 2WUFA 2ZWPA 1U8UA 3IBCA 2JGEA 2KM1A 2J85A 3TS1A 1PZGA 3VJKA 1RBMA 4ZU3A 4JBLA 2J3IA 1VJGA 1M7HA 2AR0A 3MGKA 4YCDA 4IXDA 3P2OA 3IELA 1V8DA 3Q72A 5CG2A 1COWA 1DRUA 1TC2A 2K6GA 2FG6C 3EOZA 1R8YA 5DKFA 2AS0A 3T38A 5BQFA 5BRJA 2JASA 3BJZA 4YMGA 3RS0A 5MN6A 4L9SA 3BMXA 4Y2VA 2VJLA 1YE8A 3JAWB 5GVRA 5T67A 3OOYA 4R05A 1RC0A 4BMOB 2RGAA 1TW2A 1E62A 2ZKIA 1Z13A 2WVGA 2ZJ1A 1Z8NA 3BX1A 3IBFA 5BR1A 5H68A 2J87A 5A0FA 5K3CA 3WYFA 1NN1A 4UAJA 4XTRA 3R74A 1IJFA 5K7SA 3LQKA 1CY7A 3IQDB 2YX1A 2QRQA 4YRKA 2I03A 3EBPA 3PK0A 4A3SA 3DCJA 1H4QA 2OK8A 2P91A 3ZX5A 2BEWB 3PGXA 1RQGA 4TVSA 3D2LA 4JP1A 3PQDA 1QFMA 2E6UX 3S55A 4ZRMA 1LH0A 1M6EX 5AP9A 1DJNA 4B3MB 1TCUA 1A88A 4A36A 3ADBA 1LPSA 2AOTB 2D1QA 4WOBA 1YKSA 3PE3A 1DLIA 2CVFA 4YIKA 3T61A 3JZDA 3SZ3A 3EXG2 4JLSA 1GCIA 2DECA 3L2OB 1WXDA 2R44A 5KVCA 3TBKA 4Q3OA 4ZYLA 1RRKA 4C03A 5DULA 5EVCA 1Y89A 1XEXB 3KZCA 4IDFA 4JLVA 1H0SA 3TLBA 5CFLA 4DUGD 1JYSA 4HUJA 2HI0A 3LVQE 2W8BB 1O8CA 3OZBA 4S05A 1YDMA 3ZDBA 4QNMA 3EDYA 1JZTA 1YK1A 1FQWA 2V96A 3O84A 4IY1A 3T7EA 3WFIA 3AG5A 1XXHE 5K8CA 1W93A 4KITB 2G0NA 1MX9A 4M21A 3OIUA 2WFLA 1P2DA 3OO0A 4HAZA 4Q5IA 2DJ5A 5A3SA 3T4XA 3MS4A 4JB2A 4LTNA 4P31A 2RH8A 4UTOA 3U40A 3ZVLA 4BZXA 5JISA 3HJRA 1OV6A 1PV4A 1UDRA 4UXIA 5CM8B 5AW9A 3TCNA 1E60A 4EG5A 1IG3A 1Z6YA 4MLCA 3M6AA 4KSCA 2IJGX 3EH2A 1CE8B 1UJNA 2GAOA 5C35A 2NTNA 5M2QA 1BCRA 2GJ9A 2C3PA 4AQYB 2V54A 1SPXA 4G4SO 3TSWA 1G66A 3JRWA 3Q1LA 4RDIA 4S0XA 1KTIA 4TZ0A 3NOVA 4WBSA 3FPEA 1GZ5A 4IZOA 1TYZA 4WRRA 3RIEA 1AMUA 1NUAA 2EATA 3IAXA 821PA 3OZRA 2HMSA 2ODQA 3PNMA 4IUDS 3V48A 1JKJB 1Z33A 1BFUA 4G89A 4MKRA 5EC8A 3WGMA 2OORC 4PRKA 3IQXA 2CNDA 4E70A 1ZOSA 2QOEA 4G0NA 4IXNA 1YRAA 3CX4A 4P80A 1JIUA 4MP3A 4KZKA 1EJ0A 1JU9A 1VLJA 1JDBC 1GKYA 4FYVA 1QCYA 1HE4A 3CB4A 3VI4B 4BLQA 1D2GA 2P0EA 3GFPA 1YBHA 4X62B 4QOHA 4HRXA 4MI3A 2QI9F 4GR4A 3SG0A 2A9VA 1AS2A 5FYDA 1EFPB 3IHTA 1BFDA 2CW5A 5HK8A 3FMGA 3KB6A 1PEYA 2YJZA 3TLEA 2JFUA 3E7XA 5TJHA 1SU6A 4JD5A 4HAIA 1NLUA 4LVCA 5EHGA 5HZGA 4J16A 1KBOA 1XNHA 5IAJA 5IMSA 3DD5A 3CVJA 1CULC 1FEZA 1PSWA 1Z2OX 5AKIA 1BH2A 2JHCA 1O54A 1Q3HA 1QRAA 4KLRA 4NCIA 3RVMA 5L53A 4E5SA 1DBSA 1G41A 3FVWA 4X63A 4IVNA 2O8FB 3QPWA 4MS1A 3T52A 1IXYA 5JRJA 2JVIA 2Z98A 4P0QB 5GONB 2FPIA 1AIPA 1I5OA 2FPPA 2Q49A 4UDOA 2D8MA 3GJ3A 3N74A 4QVGA 4A0HA 4BLOA 2QU8A 2R8OA 3JARB 3QLUC 4OAPA 5KYWA 3RVLA 5FL7D 3PS9A 3W90A 2B30A 4K9PA 4Z1MA 3E81A 1E3MA 1DRWA 3ROQA 2WAAA 1BVYF 3JR7A 1XAHA 4I1UA 4JBHA 4EMUA 3RRYA 2ZAYA 1JAHA 5JSKA 3FDFA 2P6RA 4BVKA 4DQ0A 1U4NA 3L82B 3G8DA 1SUBA 3K0CC 4J43A 4MX8A 2QN8A 3AJRA 1UXHA 2J08A 2E5FA 4KLNA 1Z7BA 1X80B 3GOHA 3LK6A 2OK7A 5LZ8A 1XRMA 4HLQB 2FZWA 3E5RA 4OVKA 4Q21A 1L5WA 1QG4A 2QXYA 4XTCS 2CF6A 2FEPA 3R3XA 1ZVQA 1DIGA 3CZ9A 5DGTA 1YC2A 3KAPA 3HJGA 1UBLS 1V3VA 4RTJA 1JJAA 5ENDA 4TGLA 3B52X 1KI8A 3LXUX 4BMPB 2I54A 1K68A 1G8JA 2GZHA 5BR8B 5ELLA 1XFAA 4KDFA 3B6EA 4X85A 4D99A 1VYVA 2V7BA 1QYWA 2VHQA 3O2NA 4N3GA 5LQUA 3RJMA 3WBKA 3I53A 4JBIA 1KI3A 1QHHB 1RBYA 4B3FX 4BKPA 2ALJA 2HWWA 4OHVA 4TUYA 1OWNA 2D0PB 3WA6A 5B53A 4CTNA 1VHWA 1ZEJA 3CUTA 2VSXA 2F1KA 2X77A 5IF3A 1HF3A 4RVHA 2CXOA 2DY1A 2HXYA 3B6IA 3ER6A 1RZVA 3GEMA 4JYMA 5ELXA 3CT4A 3HVJA 3WL4A 3TH5A 4KVFA 4AP5A 2P6NA 2JIRA 2I2DA 5LA6A 5I9TA 2YDYA 1QQTA 3OT1B 1LBQA 5K0EA 2YJ3A 4Q3EA 3G85A 2PSEA 2VAMA 5DN6A 1T9CA 1RHQA 2R48A 2P67A 2C9ZA 3W1VA 1Y8AA 2BHNA 1SXGA 2CFCA 3C48A 3TE6A 3GYBA 3OJXA 1MPTA 2QT1A 1MB2A 4ZAVA 1PL6A 1ZUHA 4CM8A 4E5MA 5D87A 1FNDA 3QNWA 3BT7A 1W4RA 1KQGA 1KJIA 3TBHA 3UC5A 2G5CA 1KOLA 4FOLA 3GLIB 2LDXA 3AY7A 4L8YA 3IUYA 2Q7OE 1RP7A 2F3QA 5BN3B 5CNIA 2DBZA 3EAQA 2NYVA 2Z9CA 4C04A 3AINA 2B8NA 3Q41A 1A7JA 1D2RA 5JMPA 3SSAA 5CIWA 1V4NA 1JG7A 5DT9A 3EXG1 3VR4D 3P97A 2C88A 2Y1DA 2A14A 2F62A 3EWAA 4J7UA 1A9PA 4K9KA 5J5AA 5COQA 3N39C 5HBGA 4CIYA 5KYGA 1Z06A 3KVNA 3ESDA 1HYGA 1E58A 2DFDA 4LJ8A 2Y05A 3T3EA 4B2IA 5IZCA 1JL3A 2R5WA 4P2BA 5GJCA 3MPOA 2GM5A 4P83A 5K3EA 2NO4A 3N7TA 2A5GA 1RYYA 3DV0A 4X00A 4AL4A 1AV7A 5CDFE 3CTMA 2JLUA 2AR7A 3JQ8B 3T3PB 1UWVA 1M2OA 3FYCA 4URXR 4HT3B 4OQEA 4LVNA 3MWFA 4ITRC 1E20A 2B34A 2C97A 4FWTA 2IOHA 3GGCA 1I5EA 2QV7A 3NBFA 2BMFA 1KKMA 4MB2A 1RLTA 3AP2A 3OESA 4HFJA 3RG2A 4A9AA 2NYAA 1TVEA 3I5YA 4GRAA 3M6UA 4AY3A 3OQOA 4Q9NA 3O8QB 2NO5A 4G0YA 4IH1A 5L9AA 3GK3A 3E27A 3VO1A 5G4KB 1YUNA 2PN1A 5TMDA 3OZGA 4C4PA 5K05A 4MXDA 1OYYA 1SUSA 3LQFA 4NK5A 5DJ5A 1H2WA 1KYWA 1M1YE 4IIYA 1RC8A 1VA5A 2QKYA 3W2IA 5IBPA 1LVHA 3GZNA 2C2YA 4M9ZA 3R24A 2C59A 2QR5A 1SHUX 2QTGA 5KYXA 2BH2A 5DH9A 1Z4LA 2JKZA 3DKKA 2C54A 2Q0XA 1WZEA 2N1BA 4KE7A 4FW8A 1IPEA 1FTGA 3WI7A 4YPFA 2PUGA 4KQFA 2DXIA 3U62A 4LZOA 2XXAB 1DAMA 3LBNA 1Q57A 2DAPA 2GPSA 4REOA 3OZTA 2VPIA 2VJCA 3A1EA 3DR3A 3PQ3A 4KYIB 4BP1A 3U7FB 5FEUA 3PCTA 1YJQA 1T5OA 2HK6A 3ORYA 4I1IA 4RMNA 1R6UA 3FNIA 3QOYA 4IVRA 5ENVA 3C1TA 5EIHA 3D8RA 3UK6A 2AK2A 2GD6A 4NDZA 2QJFA 5LQJA 1FXWF 2AMFA 1LF5A 3KR9A 3C7KA 4PGAA 4I5FA 4PZZA 4RULA 2Q8NA 3PEYA 5GADl 2A1TR 2IW3A 3PB3A 2JCGA 3TPCA 4RD4A 5FPKA 1JR2A 2DWUA 4R8RA 1PT8A 4EY4A 2GT1A 4TROA 5HQ3B 1I2AA 5EY5B 1SKMA 2FP4B 4E4YA 2AI3A 5F35A 2Q62A 5A4FS 1QQBA 4C22A 2VPTA 2JHPA 2OYSA 2IP2A 3VU9B 5LP1A 5IT0A 4TWBA 1VHQA 2ZAIA 1IBRA 1OGJA 1XF9A 5IDQA 3LPDA 3MT7A 3H42B 2JFFA 1JG4A 1XKTA 3IV9A 3N8IA 5NULA 2EL9A 4PQGA 4BB0A 1R4ZA 3JAWA 4GAEA 3GLHA 3IA2A 4LWZA 1WDLA 3V1MA 4YJ3F 1HE1C 4HDOB 3ENNA 3CF4A 4YQEA 3P27A 4NX2A 1H6CA 1NXQA 2O7NA 2QQ5A 3B1VA 2XTMA 4GYJA 1U80A 4JP3A 4OLHA 1OGIA 5AM4A 3WLSA 2OLEA 2VP4A 1J7KA 3T4PA 4YV7A 3U3OA 2O0HA 1E8NA 1SB9A 3C3XA 2Z43A 5AJHA 1O57A 1DTEA 1FYFA 2GQ0A 3BM5A 4HAVA 4IHJB 2IIBA 3FIJA 1QF9A 4BN4A 1CP2A 1AG9A 1KFCB 3KVVA 3KZMA 4XQCA 1AB6A 1ZIDA 1LRKA 1PHRA 4G5SA 2Y9MB 5CPFA 2ZATA 3H0EA 1AKNA 3AYZB 4OMCA 3UK2A 2X0IA 5JAHA 2D13A 3DBRB 3RRNA 5KYYB 4NZ9A 5LLTA 1PEAA 2DETA 3KJZA 3Q9NA 4YBZA 1MQSA 4C0KA 1AN0A 1B15A 1C8VB 2AOTA 3V1YA 4JU8A 2DH5A 5DW3A 4E5KA 4EMTA 4CQNA 2GPAA 4R9VA 3EA5A 3NNSA 1E7SA 5DWQA 2QRHA 1J0AA 2CE7A 3HXPA 5B30A 2XOEA 4NZPA 4LZNA 1IVYA 3ORHA 2XZTA 1R18A 1WCXA 4HAXA 4JI3B 5C7LO 4QT4A 2LDBA 4MVJI 2PZ8A 2VAVA 1P17A 1DOHA 1HSOA 2CMHA 2LTAA 3DVRX 2W8BA 3H2KA 2WPDD 1P0PA 4KL8S 4P5PA 4RKRA 3ZE2B 4CIXA 5ALZA 3VSAA 3LYUA 1DQPA 2O2DA 4FNAA 2ISQA 1YDEA 4ERNA 1JMKC 4P4GA 1J25A 3LY9A 3X1YA 4HHEA 1Q20A 2W6ID 1JSLA 1NBAA 1A2BA 3EEFA 2X4IA 3IALA 4KLZA 4D9MA 1Z4JA 1ACLA 4Z4HA 1T5IA 1NZFA 1L9KA 1XDZA 2O0LA 2CEAA 2OGWA 2XPCA 3CLTD 1NLYA 3CR3C 3DO8A 4GBMA 1E2JA 2ZJBA 2GN6A 1D1PA 1R0CA 2HYDA 3KHSA 5BNWA 4G5RA 3L1JA 1GCAA 4O2BF 5B1IA 3RS5A 3CE6A 4G1EB 4YO7A 4Q4AA 1M6WA 2FSUA 4FYJA 4L15A 2G9VA 1JWAB 1NFQA 4JLKA 4W5JA 3KQPA 4FFNA 4MOWA 4WY8A 2AOUB 1G9XA 3F6BX 5ELMA 2FEKA 1ZH2A 5EFZA 1PZEA 4K88A 1SQ5A 3IKLA 1PGOA 5ALNA 1U9IA 3DMHA 1GYQA 2Z3WA 2VTEA 2WJHA 4IV5A 2RGXA 1ZYUA 4MV5A 1J1ZA 1TYEB 4NEQA 5E95A 4TL6A 4FDVA 3RIHA 3ZW7A 3RC8A 1K92A 4OA8A 3NANA 4DJJA 5JARA 1PD1A 2A0UA 3M3PA 4X8LA 3CMMA 2YVAA 4WY2A 3X1DA 2OWEA 1FJXA 1KVTA 3M1AA 5KNCA 2RI6A 1E7WA 1DKLA 1R0YA 3HKDB 3HUDA 3QVUA 4S1PA 3ENKA 1I7LA 1B41A 2AW3A 3DUFB 4D9FA 3TD2A 3H2YA 1CRZA 4LNUB 1ECBA 5KVAA 4FYIA 5GZ6A 3D6FA 4KR7A 1FUKA 5A3VA 2ZZKA 3SYTA 2O52A 4I9UA 3AR3A 4WL0A 1W49A 3VZSA 3JD0A 5LYJF 2ZITA 1VYUA 1ZY2A 2YYSA 3AUJB 1RIIA 1A8UA 2BFEA 3ASUA 1CR2A 2FLWA 3EIFA 1XO1A 2AF3C 1IXKA 1I0LA 2QTHA 4B4UA 1SC6A 4PSVA 2V4UA 3FUCA 5I7EA 3JVDA 3LCVB 3UK0A 5BMVF 1SVMA 3WAJA 1XL1A 2OCKA 5FBHA 3LT5A 1E92A 1IAQA 4FYHA 3LQQA 4REMA 3C2QA 3V7FA 1R74A 3QVWA 1MKYA 5TS3A 4TPKA 3OHSX 3N87A 1AO0A 4ZALA 3WGZA 3CUWA 1L7QA 3L02A 4B9EA 1B0AA 2O9JA 2XEXA 4RX1A 1RS0A 4OI1A 4LF5B 1P74A 2BVNA 1QFYA 2GLUA 5TQ0B 5BSUA 4F3KA 2G1UA 4RKYA 5A9TA 1LDBA 3WICA 3RUHA 4DPMA 1E2LA 4OH7A 3ZS8A 5JD4A 4EKNB 1BKDR 1MJGM 3AK4A 1TJNA 4JQZA 1KDYA 4ER3A 1WZIA 3F7NA 3QVOA 2BFDB 3OEYA 4F8JA 2BHTA 1V8BA 2IZ5A 2CYBA 4QGSA 4RJTA 5JAZA 1ST3A 3B1JA 1QH0A 3ROKA 4EPRA 1XZKA 1SKYB 2PL1A 2C3MA 3LQRA 3ZHVA 5EJ6A 3FSJX 1Y4ZA 4PLPA 1JX6A 3C14C 5KU7A 1N77A 4C7KA 3JS5A 2Q0SA 1YZLA 1DX4A 3IVMA 4WNIA 4M49A 3BTOA 5EP1A 3AL3A 4XDHA 1E0AA 2BLLA 2C4MA 4EELA 4NU0A 4OPMA 3VR6A 4RKQA 1W0KA 2GRAA 3IA7A 2K7FA 1W8IA 2C7GA 2CSUA 4U00A 1SU7A 1XRJA 5GM2A 3ZV4A 2VNJA 4ILKA 1GZ6A 1JT9A 2F48A 5C46F 2FSIA 4P3YA 3R8XA 4AY5A 1BWQA 2PTGA 1RYMA 3T34A 2O5VA 3U09A 4FOSA 2B25A 4FYMA 3TI9A 3WOHA 1UBJS 3FA2A 1XNQB 3NXKA 4ALIA 3F90A 1KHTA 3KOMA 4FU0A 2P4QA 3IBGA 2RMKA 1SKQA 4LGYA 2ODBA 3EUWA 3KKPA 1KF0A 3FHTA 1D6SA 3U44B 3AVYA 3I05A 3QBVA 1RPZA 1EWKA 3G2JA 3WRWA 1GRRA 1XMIA 5AI5A 1V41E 4B3GA 1VLQA 4MRNA 4U6NA 5JD5A 4HTAA 3SF8A 1KTVA 2ZANA 5KKAA 3LT4A 5J40A 2V6BA 1RLJA 3RTAA 4HVCA 4RORA 3NM5A 4TM8A 5EMJA 1OD6A 4OFXA 1LLDA 1XSEA 4P4SA 5AI0A 2FRDC 1ZWLA 3BCUA 3QHQA 3VX3A 1TYBE 4DPLA 3MERA 3MLEA 1LDGA 1P29A 5BN3A 3LCMA 1DI0A 4YO8A 4LBZA 2ZE8A 5AM5A 4DWVA 7REQB 1R16A 1UKZA 2HQ1A 4QJIA 1QQAA 1M8PA 1R5BA 1MGPA 3FFTA 3TM5A 3OWXA 3IAAA 3IHWA 5DNAA 1UC4B 2ZJ3A 3AHIA 3OPXA 3PG5A 4UTNA 4JXXA 3GLIE 3OCZA 4MUHA 5I5EA 4FI3C 3BILA 3UEOA 2R8EA 4LCBA 1VMAA 4KJXA 1Q14A 4WACA 2G28A 4O5AA 2HX1A 3GLFB 2DHDA 3FR8A 1ZU5A 3JQ8A 3RGGA 1TLTA 2R8BA 1QMGA 4ZQBA 4YP1A 4R0NA 3VZQA 4HDKB 3CVYA 4FDMA 3FTNA 2JS7A 2I8CA 3I4FA 4BZQA 1IN6A 1JQEA 3A31A 1EM8A 1GQRA 3R2JA 4KQ2A 4PFKA 4A1FA 5JLJA 1Q0SA 3HYCA 3WK4A 2WMYA 4LWOA 1Z47A 1G6KA 2A9JA 2CCJA 2IWHA 2W6OA 3L01A 1XPRA 2DKFA 3G2HA 2EBFX 1ST2A 4C7OA 1I30A 2OBXA 4S2EA 2HAEA 3ECSA 1H2XA 1IB6A 2RHOA 4DE5A 4JI5B 3BXHA 4QYIB 1RFGE 5B5SA 4JLOA 3NI2A 2IC5A 5MFPA 4OHOA 3WXBA 3GPDG 3P0RA 4KG7A 2C57A 2JAPA 4TWAA 3T7IA 3TK1A 3T7AA 4LI3X 4A82A 5AVZA 1UMDB 4KNWA 1IRIA 1RKXA 3CRW1 3H3JA 4FFOA 5JBIA 2Q4BA 4XQ9A 5C1PA 1KDZA 2OORA 1MMFB 2G82A 4G0QA 1HZZC 1BMDA 4I6GA 4D0LB 3D3EA 3DNPA 3LF2A 6GPBA 5L3VA 4EKGA 5TPZA 4GPD1 4EX7A 3P9YA 2H5LA 4CQMD 3CEJA 3WYDA 3FX2A 1C1HA 3WLJA 3BWVA 1N2BA 1L5RA 3PJRA 4DOMA 1OR8A 3VZCA 3WGOA 2IV2X 3KJGA 2Y0DA 1P19A 3EZYA 2FGKA 3GGGA 3M89A 3WL5A 4GI3A 2HLDD 3I01A 2BT4A 2FQXA 4EPXA 2IS1A 4PLZA 2KHZA 1UBKS 3M82A 5EIXA 3BXGA 3MINA 5AK4A 4TMFA 1KK0A 1DHTA 2VJMB 2XKBA 5KJ1A 3UGJA 3S7ZA 4KPUA 4LZZA 5AJXA 1CHDA 1E2PA 1UPUA 3EWIA 3KFLA 2ZS7A 4MGZR 1N2OA 2WC1A 4OU4A 2LZ0A 4TQAA 1TW3A 1QG6A 1R0LA 1NV8A 3OEED 4C0BA 5BN4A 3I9V1 4F6RB 1YS1X 3M6FA 4LSZA 3RDPA 1ZCZA 3LS2A 1ZM9A 4FR2A 1DQZA 4P81A 3DOUA 1M0EA 1S2LA 3M9WA 4FLEA 3NBYC 1DUIA 3QLUA 4UBNA 1MA0A 2FB9A 1YZVA 2WNHA 2E4XA 1K7CA 2QPTA 1NG1A 4B6FA 2ZSDA 1DBRA 1TK3A 4UFPA 3DLPX 4D6XA 3ZU3A 1E2EA 3OE7A 3IOMA 1YA6A 2YR0A 2WFZA 4QBTA 4JT9A 2NYRA 4ARBA 4XFDA 3VR5H 2Z9DA 1YL7A 1WKVA 5CAEA 4W5WA 3GVPA 3M6MD 2XMDA 4U7GA 1QGOA 4RH3A 4UCFA 3NBKA 4XUCA 3TE7A 4A8HA 5BR4A 3E2IA 3HN2A 3PPWA 4MWZA 3OUZA 3UY4A 4ZAFA 4AZ0B 3FJOA 4U3JB 4G1BA 3UHAA 4MYUA 1US8B 1GILA 2R6ZA 4YMTA 1Q7TA 3MD0A 2G1JA 2OOSA 2Q3LA 2VHXA 3FJYA 4G4IA 3H17A 2QRGA 4B73A 4ARCA 2PFGA 4BWGA 2XVAA 5BNIA 1DKNA 1FS4A 1WRBA 1BZYA 2FEOA 3AV0B 4N39A 3NUGA 2EERA 4ZT2A 4C3ZA 1IHUA 8LDHA 5F12A 1SCUB 3V4PB 5FR1A 4AM8A 1SVOA 4AUNA 2VPQA 5TGZA 2KE5A 2YWHA 3KKMA 3RR2A 2RAFA 1JHDA 1WDMA 1MJNA 4IKPA 5TF0A 2Y0PA 3O31A 1E3QA 3C6ZA 3HN7A 2LUOA 4NL4H 3ZBQA 4F5YA 2FLVA 1CJSA 1JI0A 4LYYA 3G2PA 1I7QB 4LFAB 4P38A 3DAGA 5FHRA 3TSZA 2F59A 3WDKA 3C7AA 5AW2A 3CZ5A 4CRWB 1MH1A 4FSHA 1EVKA 2H0AA 4UJ3A 1REQB 2FEWB 2H2AA 2CHGA 1AUXA 1M34E 3L0ZA 5DZSA 2RONA 4HH4A 2KX7A 1QRRA 3DLIA 2BKXA 3PDUA 4YPOA 1PO7A 2GYYA 3E0QA 2VQDA 4CG0A 3AOGA 3B9PA 3B3JA 3KSZO 1WBBA 4E4TA 1IIBA 2O8BB 1QGUA 4NAVA 1EBBA 3VVMA 3PXEA 1T35A 1TZKA 5C34B 2ZCUA 4ZI2A 4YT5A 4HSEA 3L9XA 3S99A 3DPUA 2OG2A 4QTTB 3SE7A 5C18A 4PNPA 1ZXBA 2ZXEA 3L6BA 2WDZA 1W35A 3IDOA 1O6GA 4AJ4A 4JC8A 1T3SA 3NJRA 1C0LA 2FOXA 3OLQA 4I14A 1DUVG 3WQHA 4TWRA 3QWIA 1OJLA 3C3PA 4D45A 1BWRA 3UCXA 4B7UA 3DOCA 1D2NA 5A5GA 4MPDA 1AQNA 1H65A 4L22A 1P0QA 5IU6A 2WICA 1WEHA 4FP9A 4OCZA 3REGA 3U7QB 4UXJA 2C5HA 1JJBA 1CUGA 1YXMA 2GKOA 2A92A 1F8FA 4JYPA 2PFKA 3P32A 4AJNA 4BO4A 5IJ0B 4O4HB 4U7FA 1T6NA 2GO1A 2B8JA 3WGQA 1ZI9A 3K70D 4MR9A 3FWKA 1YZUA 1PFWA 3K15A 3CA8A 1PG0A 4DC9A 4KZPA 4IG4A 3P9PA 4FHFA 1Q7RA 2VXBA 3EVAA 4URYR 1HDEA 4QVIA 5DCWA 3EGWA 4RYDA 2WSSD 5AVSA 2IQ5A 3UMRA 3JWIA 3AUSA 3THWB 1Y33E 4R5MA 2VJQA 3PSAA 3QG5A 4DNPA 1VSQA 1TLLA 4A4DA 4CGYA 3F6PA 2JJ2A 4ARAA 1R0SA 1WXEA 2XZPA 5IRCD 2WMOB 4UM5A 5CLLA 3GUHA 4OAOA 3WZMA 1D09A 4DA0A 2OFPA 2ZTLA 2IVZA 4YGYA 5F1PA 4XI9A 1A4RA 1Y9ZA 3R3VA 1RQXA 5KNDH 4QLOA 2ZJ0A 2EF1A 1ML3A 4WKBA 2Q2WA 4K6MA 3BKWA 4R84A 3ZKWA 1LV8A 1JEAA 1UPFA 3IIMA 3TW8A 2TSYB 4R8MA 3NOQA 1E1NA 1WKBA 2PZKA 3KPJA 3V4ZA 1JEYA 2A0YA 2P2DA 3FMOB 4N18A 4NCAA 1QK4A 1TB4A 5A2GA 3G2LA 2W4MA 1BWSA 3VNUA 3T5PA 2PMEA 4HLDA 2UUCB 1ZJ5A 4X71A 5CCXA 3AVXA 1G20A 2XUFA 2Q1WA 1VIAA 3G89A 3RFFA 2AUTA 4OHYA 1GGKA 2IXDA 3PX3A 4ZVOA 2ZVPX 2Q1XA 4I4CA 3PT5A 3FYUB 3THXA 4D4HA 2NTEA 2R60A 2NUAA 1NKTA 2X3UA 4RK1A 5HG0A 2WWFA 3DZCA 1JXQA 3PE6A 2JEZA 4Y2YA 1KDRA 3CLSD 4ZI7B 1ZM7A 4FHGA 3N0RA 2W4IA 4EB0A 4CL0A 3IQHX 5A4IS 4DWJA 2HWYA 2ZYTX 2H00A 2WJYA 2Z30A 4WERA 2QQEA 2R0QC 4WADA 2DWCA 1WTCA 4ZZ3A 4HZIA 2X6QA 2B61A 1N0WA 3TB4A 2LCFA 1DFHA 4JODA 4U9IS 2R6JA 1J7JA 2WKWA 5DP1A 3WKDA 2XMRA 2HSZA 1IBMB 1YE3A 3MB8A 1H5UA 4ACAA 2HHLA 2RGNC 3ZWAA 3MM4A 4B2LA 4IDPA 1V71A 2KJQA 2D4HA 4WK2B 2ZJ7A 4DMLA 1E6KA 2BZ1A 5EJMA 4MDFA 3CH6A 1E1DA 4HFRA 4LXIA 2KQUA 3W9BA 4G65A 3CPHA 4Y6GB 5K6TA 2PQ0A 2Y1OA 3AP1A 2MTBA 3RS2A 2YV4A 5BYAA 3ROEA 3IOCA 4WXEA 3U7RA 1KDTA 2NZUG 2OZPA 3KHTA 4TN5A 1JIJA 4L85A 2XRFA 3E1KA 1Y3HA 4IQ0A 5KC9A 1ZUNB 5IJAA 1C14A 5FUYA 4BC1A 2Y1KA 5DSZA 2KS6A 4PG6A 1TUEA 2WHXA 1XV5A 4BO5A 5FNZA 1ISJA 3SJUA 4PX9A 4LDJA 1ZIYA 1OB5A 3LIPA 4MQ4A 4RD6A 4F60A 3ID6C 1VRCA 2E6KA 3VO9A 4F38A 4H7EA 1AS3A 3JQQA 4MV6A 1JE1A 5A02A 1SHJA 3R5HA 3NWJA 2QN2A 2FLKA 1W96A 5I7AA 1DJQA 3QPUA 3DZJA 4RS4A 1KEVA 3SDSA 4OQMA 7REQA 4YV1A 5KOJA 4NE9A 3B1YA 4MUIA 2QL5A 1NBEA 3DULA 3HV0A 3VNQA 4A6XA 1O0BA 3D1LA 4N41A 4UBJA 1XJWA 1WUTA 4H7PA 2CXQA 1CUAA 1I24A 4LPKA 3EF0A 4G23A 3K6RA 4WJZA 2W8ZA 5ERYA 2JW5A 1YBVA 5EWMB 4CM4B 5IK2D 3OF2A 4J75A 1ZITA 5GJVC 4ZHQB 3KBOA 1QHSA 2ZJAA 4BWVA 1BX1A 1EB9A 3I73A 1VJCA 1M5RA 2W98A 1GPMA 4P08A 4HDKA 1J5PA 4ND8B 4ER7A 2IKSA 4OHZA 3DZHA 3RBZA 2FPWA 4LNAA 2C20A 1YBMA 2CD9A 3DCIA 3PDJA 4KU4A 1PJBA 1MW9X 4OQQA 3UAGA 3CG0A 3ZUGA 5AT1A 3O91A 1NV9A 4CMEC 5HSGA 2VK2A 2WHRA 4QYIA 5BNZA 3ZKAA 2PEYA 5LSAA 2QMOA 4HB3A 2AYZA 1C7ZA 1W59A 4PYNA 1XXLA 2V6MA 4M8IA 4UU1A 2NPFA 4FNGA 4IIXA 3PDCA 5BW8A 2CNLA 5J23A 5IYZB 3BF8A 4C3OB 1PFGA 2AOVA 3H83A 3ZLBA 5CLFA 4NCNA 5FI3A 2CYAA 1YRYE 4H3VA 3F3KA 2JAXA 2HU5A 1DXYA 4TYQA 1S02A 3ESAA 3LFTA 1PDOA 4FMDB 3M2TA 2FCAA 4RZQA 4DNXA 3TWOA 5LOVF 4I5DA 4YTEA 3S8YA 3JVVA 4L74A 3LPMA 3AKDA 3STYA 5BT9A 2B2NA 1LGYA 1EEXB 4MI6A 1THZA 2V7UA 4FYXA 2CLLB 2Q9UA 2OM6A 4JB3A 2OFOA 4GLLA 1GQFA 2PX0A 3GL9A 4WXRA 5LQAA 4V24A 4HWOA 4FT2A 5REQA 2F55A 5F4ZA 1AM4D 2DPXA 3LECA 5BMOA 4X66B 4HBZA 1SOAA 1NQVA 3O4HA 1XZJA 1DZ3A 3KU4A 4NBRA 5WRFA 3W34A 5HWSA 2F3PA 2VRCD 2XQKA 4CEJA 3DTTA 2Y1WA 4DY6A 4A2WA 2VKTA 3G9UA 2GPWA 2ZXUA 2D3TA 2ZB8A 3P9CA 1JG1A 4YJHB 4YCCA 3GDFA 4GMHA 3N8HA 4D79A 2IS2A 3NGXA 1MB9A 1QKIA 4MR7A 1QE3A 1Z2EA 3CWQA 4LYFA 2LW7A 3DFUA 3DT6A 5DMXA 1Y7IA 2VXOA 3OFSA 4EJSB 2D1SA 1QHYA 1A8PA 1UFRA 1C0EA 2QAJA 2QB5A 2UZIR 3D2CA 4DM7A 4DKJA 5C80A 5L3QA 4M7RA 4BRWA 2ERYA 3STTA 3LOPA 1SQ0A 3A11A 2QTMA 4PV7A 2X8JA 2P90A 2C2GA 4GLOA 4LDQA 4U9UA 3IUPA 1Z8HA 3PLNA 4W5RA 4IIGA 3TRFA 1W76A 5AIBA 1TQ6A 3UICA 3K4QA 3KL2A 3EVFA 2VQ6A 5HIIA 3IB3A 2WT4A 4KQ9A 2YZKA 1F14A 4LBVA 4XLTA 3I2JA 1SC9A 1ZN8A 4YVFA 3A0RB 5FH9A 1P5RA 1Q3TA 2V4MA 4LK3A 3NEJA 3OOEA 1XZAA 2ZTVA 1ZG3A 4JI1B 4PIMA 2ZYAA 3CLHA 4YCLA 2J0VA 2QBYB 2C9OA 1OF1A 4BS9A 5D5QA 4MKHA 3ED5A 4PICA 3HG7A 4W9NC 5JY6A 1ZMOA 1IIRA 2XBUA 3HLTA 4U3JA 1UBMS 5AVOA 1X15A 5HDQA 5K0JA 1AA6A 1A04A 5ECWA 1GCUA 5G0VA 2R96A 1PFKA 3MAGA 1K7XB 1L4EA 1FK8A 2WF6A 2ZUBA 1ZJWA 521PA 4HH3C 3OQHA 3SZMA 3IV7A 3T3NA 2PUAA 2WZBA 4H3SA 4L2IB 1ECLA 4YS6A 1GR1A 1AC5A 4IXMA 1K0UA 2E82A 4A26A 1T5TA 1JA0A 4HN9A 5HJEA 3E53A 3L8GA 3I0ZA 2Y1LA 2SNIE 3K4PA 2H31A 4DIUA 1UPAA 2O3QA 3QFSA 1QZXA 2ZVQX 5CLIA 4RE5A 3ROZA 3T5CA 4C2AA 3JWPA 1MEJA 2VN8A 5DWVA 1DUSA 3LKVA 3OKCA 3B89A 3SIWA 3ZBTA 1MAAA 2HBYA 3GMDA 4ADSG 1VI6A 2JGNA 3JD1A 3G9QA 1XTSA 1KMQA 1NQUA 1R6AA 1ZNYA 3WZLA 4C43A 1Z6ZA 1DQNA 2WD9A 3NGLA 4Z5XA 5LXTB 2DFTA 1QV6A 1U9YA 3IPLA 3QVJA 1VFNA 5CPBA 3VNBA 1OPXA 4BX3A 5DLYA 4WXMA 1LLFA 5T64A 3Q2OA 4OV6B 5GMOA 4MVJG 3ZNNA 3IC5A 1CY8A 1F2TB 5CH3A 2DOKA 2JAHA 4LMPA 1C3XA 1KPGA 3N3AC 3LP5A 1K88A 4LPSA 3UVEA 1FP6A 3FOZA 2WIDA 3NYQA 4FDAA 1SXQA 3G2NA 2B4QA 2CLKB 2FRDA 3FZNA 3ZWXA 1N32B 3GJXC 1L1FA 2XR1A 3NCTA 5HKKA 4RJKA 1UM9B 2P11A 5L4LA 3Q9SA 3P9XA 1Q1EA 1W19A 4I9FA 1F48A 3HCCA 3TRJA 3U37A 1SC1A 4LRTB 3UT0A 3VPHA 5F7XA 5FXMA 4M1SA 3S8EA 3CNOA 8ADHA 1HV8A 3RARA 3VDNB 5KJCA 2GVNA 3FF4A 3IHLA 3TQIA 2HWUA 2AUMA 2FZEA 2X5XA 4LRQA 1Y1SA 1YR8A 2RBEA 1CQJB 2X2OA 3FOAA 3MS7A 4B85A 2FWBA 4DCPA 2WWGA 4YRIA 4PLVA 4WOJA 3ZHSA 3ZBUA 4BV3A 4V1CI 2M98A 1IB0A 4ZV4A 2AG8A 3RJZA 4BNFA 5EPEA 2HF9A 4E5DA 4MGEA 3OOHA 3CUYA 2QRKA 2DPGA 2FWRA 4DSTA 2HJSA 4RLQA 1WTAA 3P2JA 2CLIB 4RO0A 3RJTA 3IDSA 4OI0A 2ZR9A 4C5BA 2ACVA 1FMFA 2EJUA 1XZLA 3VTFA 4A5SA 3THWA 1DX9A 4NENB 4QODA 4RM2A 4Q01A 1H9AA 2JGDB 3BDIA 2AX4A 1YB5A 4Q4HB 4TVOA 1G6OA 1OXTA 3OURA 3SLGA 1GQQA 3P0IA 5L3SB 2Z83A 3TECE 2VLIA 4Z9XA 3EDRA 1KMHA 3K53A 4G0PA 5GV8A 2H0QA 3FOFC 4GNKA 4IIJA 4RS3A 4AJJA 3TOXA 2L19A 1YC5A 3OKPA 2Q3HA 4QFBA 3T7DA 3WQSB 1CVIA 1Y6QA 2OR3A 1IN4A 4PYRA 2W0MA 4MYHA 5COBA 1HZZA 3PGA1 1S3SA 4QU0A 4Z7JA 1YJXA 1RXCA 3RYTC 4BLRA 1ZRMA 2JATA 2YVUA 5J5CA 2XNKA 3WRVA 1GQYA 2FPSA 4I5EA 5KAMA 2IGBA 2YV5A 1KP9A 3MD9A 4RCZA 1GNSA 2IZ0A 1FYXA 5DOVA 5AHWA 3NP9A 3PFGA 2PJUA 1A8HA 4A91A 1HBJA 1P1FA 3W8DA 1EDOA 3FFBA 3D8SA 1DWUA 1QC5B 1NC1A 1TKRA 2CMFA 5JQGB 4DV7B 3H1AA 3BTUA 2Z0MA 5JI3E 1ZOIA 2QZZA 1AXGA 1BJTA 1JKXA 2BI4A 4UATA 4MRRA 4ZI7A 1KU0A 2AG0A 4R1TA 4TLDA 5AVWA 3ANNA 4XWYA 2F43B 4CUKA 2I22A 4AN4A 1LBTA 3IODA 1P77A 5AW8A 2Z58A 1JAXA 3LDFA 1FFXB 4MQUA 4CM6A 2Q46A 4EF4A 1AQLA 3G23A 4LOAA 1QRTA 5TGDA 2GTPA 3JQAB 2IXTA 2RE8A 1C4XA 3F49S 3PZBA 1QYVA 2R1VB 5IJXA 2ET6A 4W4TA 1R8JA 1A9RA 2AWNA 5CFRA 3ERCA 1KNQA 4L8LA 3NDBB 2HB6A 2A33A 4UOEA 2AMJA 2HT6A 2LVBA 3VZBA 3LZ6A 4RK6A 5IJ9A 2GZSA 3ZD8A 4F85A 1LNQA 4WUTA 5A03A 4PPFA 1JFFB 4C3VA 3UTDA 5KWJA 3QSGA 2QM3A 1CNFA 4Z4CA 3ORQA 5H70A 4FNOA 1BKYA 3I9MA 1N3BA 3FLAA 5HCUA 2P1RA 2BFAA 2YWCA 4AKGA 3A3PA 3EG5A 4E33A 3DPSA 3EARA 4X3PA 4W8OA 4ESVA 4NU5A 2WUVA 4ENSA 4NCBA 3BWMA 2P2ZA 1Q7BA 3LO8A 3KL4A 1ORWA 1U0FA 5GZ3A 1D6NA 3GRZA 2EV9A 3CLRC 4WSOA 1EUYA 5E38A 3CPJB 3I9JA 5C5IA 1AQYA 3SNHA 2I91A 4TXHA 1Z62A 3MFYA 4DYVA 2PGOA 2WUWE 1R6XA 2EBUA 1G8HA 4UMFA 5CITA 5IKXA 1SOVA 3ABSB 3GX1A 4MYDA 1G63A 4K6GA 4H1TA 2CXTA 2YWDA 4TT3A 3RGWS 4EDHA 4EI7A 5EAIA 3HC7A 4N5DA 1JA9A 1QH8B 4L9RA 1N25A 3WLOA 2ECFA 3K7EA 4RPCA 2F3UA 5EL0A 3WDSA 1TZ2A 2CL6X 1YI0A 5D00A 1PT5A 2WSLA 4UDXX 3NHMA 2ZSHA 5E9QA 3VUEA 1WHSB 1PR9A 3VU0A 1SC3A 4KR2A 1E3SA 1V6AA 1YVDA 1WNFA 1VPVA 1BFKA 2QIOA 3B3FA 1NFRA 3GFSA 4NCXA 3SE0A 1NVAA 4CT4B 5JPCA 2ZIGA 2RHTA 2PDAA 1V45E 1PJ2A 1QSGA 1YSCA 3KR2A 3ZPXA 1G8GA 1GA6A 3DWFA 3H1GA 4MVJM 4TTIA 2O2HA 4RVGA 2R87A 5LPNA 4N48A 1TZCA 4QQRA 2D4AA 1Y4SA 2SKCA 3MIIA 2CLHB 1NQOA 3RKUA 3RSCA 1YTUA 3TQHA 5K03A 4FTWA 1AKUA 2RHGB 2ZB3A 5ABPA 1WLSA 1EU1A 5JNLA 1A9TA 4L4XA 2V9PA 5AESA 4BV8A 3O47A 3TTWA 2DUUA 1QHEA 2AW5A 2YDXA 1UBRS 3F6RA 4JI8B 3L93A 3DZBA 1RE0A 2BEUB 4GOXA 3KSMA 1Y6GA 4KO1S 1RRVA 4EA9A 2IZ7A 2M6SA 2PRYA 1M6VA 2GZAA 3NWOA 4O2RA 5I8WA 2HQSA 3PQ6A 2HA2A 5LQMA 1ULHA 4QGHA 3IYLW 2AEEA 3PQ5A 1SKUA 3CNBA 1BG6A 3A2NA 5JH7F 5CDYA 3I04M 2C1XA 1XJQA 1YCHA 2IYAA 3QKRA 2Z3VA 4URUR 4NI5A 5AI4A 2GZ2A 4MIKA 3MHPA 1U5AA 1W46A 4KDRA 2RB4A 3WLQA 2X0JA 1EIWA 1HT0A 3QK7A 2DQZA 3IEMA 3ITNA 3CTPA 1VIMA 1OH5A 1UJ6A 2QLLA 2VS1A 4EA8A 1Y8RB 4O4IF 3VOBA 2LKCA 1OWPA 2RI0A 1USWA 3Q0EA 1V2HE 2YS6A 1JXMA 3FCCA 2J5BA 1Q16A 2HIGA 3ECAA 4HS9A 1P5FA 2X0FA 2XUAA 5CEJA 2UXBB 1XA0A 4RFVA 1RQ7A 4GXNA 1PR5A 3UBMA 4XWOA 3KEQA 3I6IA 1JFLA 1W47A 4EBFA 5AR1A 1X92A 4QUHA 2BKEA 3ET4A 2GF0A 5AI9A 3A6KA 4OHBA 4HYYA 1L5MA 5AKJA 1TIBA 3Q3HA 3TRKA 3WTCA 4YDQA 1L0BA 1MPXA 1Q15A 2OILA 1QIIA 1RHUA 4DMRA 3EQ2A 3DD1A 2VAPA 2NU6B 2F6RA 2P9CA 3LUHA 1NVTA 3OI7A 2QNIA 1Y9DA 3V3TA 3VC7A 1AQJA 1OU4A 3D2AA 3HP4A 1PFVA 3NG1A 4GI1A 1O89A 3DC2A 1BU8A 3NVKI 2WF7A 3U9SA 3ER8A 2HUPA 3M6VA 4Q3AA 2ZJ6A 4Z86A 3SS9X 4BVBA 4XEUA 1OI3A 2VH1A 1AKMA 4YROA 3UM9A 1ESZA 4LA4A 2AFIA 3VKWA 5KYNA 1R4NB 3KRTA 3SMVA 1A7AA 2BFPA 3RWBA 3CEMA 3KQUA 2B3DA 2AZMA 2RAPA 3IB6A 4L2IA 1FCJA 1M75A 1Z5GA 2A3RA 4R9SA 2FQWA 3E15A 4S35A 1G98A 4Z9FA 5BSMA 4BMVA 3AR9A 1MAVA 1OI7A 2W2LA 4FHZA 2XRMA 1PKEA 1ORVA 1Q1GA 1U02A 2CZGA 2ZETA 4O8ZA 1W5EA 4M1ZA 4GNRA 4QG3A 2WU8A 1WCIA 3RKSA 4MDEA 1T0HB 4HGRA 3ETGA 3GN2A 4KFSA 1JHYA 1ZNXA 4KXMA 1TZBA 4M0PA 5LXTA 1E3EA 2EIXA 2L42A 3QI7A 2NTJA 4LF7B 2GK3A 1XTKA 4UHCA 3EEYA 5D3ZA 2V0CA 1TECE 2PKCA 1SCJA 2W2VA 1Q3KA 3BMCA 4G1UC 1CX9B 5B2ZA 3WL7A 1JUDA 2E4ZA 2GJSA 4FPXA 5LLSA 4YPVA 4LF8B 3DEHA 4URZR 4UTVA 2H1IA 4QEZA 4IFTA 2WAMA 3QYAA 1CQIA 1KJQA 3FNRA 3B9BA 2QYHA 3NRCA 1ZH4A 1RHMA 2AX3A 2PJZA 4KQMA 4NZOA 1UM9A 1I36A 2ZTHA 4DLAA 1KC1A 5GVSA 2X7XA 1N2SA 3RJ5A 3HR8A 4ZO8A 5A5FA 4X1YA 2R6GA 3KIPA 1HL7A 3ZHBA 4TTRA 1UJMA 1P0FA 1P8JA 1NF2A 2GPBA 3JASA 2JCXA 2D7CA 2HSGA 5ESWA 2H54A 3QWBA 1A4IA 3FROA 3B3GA 1J06A 1KI7A 2QN3A 5HR5A 5ESRA 1II8B 1CQJA 2FPXA 3Q8MA 1YZTA 4HQRA 2X15A 2OQRA 4QATA 4URHA 1I8TA 3ORFA 1BVHA 4CKEB 3WBFA 4EUKA 1KAOA 3EZ2A 3PT9A 5TLSA 3DCNA 1O9GA 1GYPA 1OAOC 4BP3A 1NASA 1ZESA 1NYTA 5CBPA 5M34A 3V8QA 5HX7A 3K9FC 1G59A 2Z04A 2H17A 5KNCH 3HJTA 4C6RA 1V9CA 1WB4A 2R8XA 4S2UA 3DV9A 4R4JA 3JQ7B 2NTYC 1P2TA 5LBIA 4MB0A 3SJ7A 4CMEA 3IAS1 1KO4A 1RVV1 3TZKA 3HYSA 4DIKA 1W2WB 2WJ6A 3VC1A 1BE1A 4QXMA 3STUA 3ZQKA 3D1VA 4DEXA 1TDJA 4YASA 4L4RA 4IR7A 3I23A 1Q0UA 3WHLA 2DPMA 2NSLA 1PL0A 3NM6B 3U49A 2YUTA 3PPYA 1D1SA 1JKIA 3EVEA 3GLRA 3PGKA 4U39A 3GQVA 2OA0A 4BN5A 1G3QA 5L3SA 1CUVA 4BVLA 3ADCA 3UT5B 4X45A 1KEWA 1XLTC 3UH0A 5GGXA 2YIJA 1VIVA 2EFJA 3G17A 2BE9A 4LMAA 1DXHA 2EYQA 4L28A 3LLCA 4PINA 4UPVA 1P18A 1T4CB 3C4QA 1NQTA 2QTNA 4KGDA 4ZU6X 3IO5A 3WMEA 3ABZA 3BSSA 2VDQB 3A8TA 4YI3A 3U3DA 1CRWG 1RRMA 1ZFNA 3I45A 2LIVA 1Z38A 3IUQA 4G36A 5D8DA 5HJ5A 4KP7A 4P1ZA 4MB6A 2GYUA 1G19A 4GE0A 1FNNA 3B1ZA 4AXXA 1GTRA 1WMEA 3DE3X 4PX2A 1ZD2P 3C6QA 3DL4A 4EVIA 3HWSA 1ULSA 3LD9A 1ZMRA 1JQ3A 3L7AA 4RE6A 4FI3F 2AGVA 2HK9A 1RAEA 4F9GA 3TOSA 2WHYA 3P20A 4GGMX 4OP3A 3WYBA 1TRHA 4MLDA 4XFJA 3SFZA 2CFTA 3F47A 2X0RA 3V8PA 3BB4A 1Q0QA 1IQUA 1KO8A 1OWLA 1AU9A 3SX0A 2OXFA 3MMSA 3LBAA 4B34A 5KNBD 4KQJA 1JILA 1U9CA 4CM5A 3DH0A 1X8KA 2QUHA 2C7RA 2Y6VA 3A1CA 1B93A 1K3UB 1M2EA 2EFCB 3ZHOA 4HXFB 3KZKA 3PICA 1DELA 2O8DB 5BNFA 1EFVB 2Q5CA 2G76A 3NT2A 2IZZA 4G24A 3NHFA 2CDRA 3EOAI 3MWKA 2I6QA 3LW7A 1E5VA 1W25A 3JQAA 4LS3A 4PAQA 4XM1A 3PX2A 2PU7A 4CV3A 6REQA 1OUMA 5KNLA 2AZXA 1CEQA 4FSDA 5ADVA 1V5EA 3IBTA 4X6XA 4BMDA 1T9DA 4OHXA 2Y93A 1FUEA 1I14A 2NUPB 1KOFA 1JWLA 1ES9A 1BEUB 2XDQB 2ZP1A 3KZNA 3M81A 5JCOA 3VR6H 6CHYA 2KLBA 2QQGA 1OBVA 3ZWMA 4JEUA 4FXPA 1IAVA 1SG6A 3BD6A 3K4HA 3K9QO 4G2TA 1IJEA 1R0XA 3D3WA 4U2FA 1RM5A 2IYSA 1SC4A 3TN7A 3ZLJA 3AILA 3WO0A 4YX9A 1F0NA 4POAA 5ADWA 3L4JA 4CV0A 1Y1RA 1KSFX 1YWGO 4OJMX 3UAZA 4CJXA 5K9ZA 1U5BB 4R3NA 1YJCA 3H7AA 5SV2A 4PZLA 2VAWA 2I62A 4J7AA 4ND7A 2HRDA 2X9LA 3I6BA 2P40A 4MEBA 3V42A 4K6KA 2M6KA 5ETJA 2IU4A 3ETLA 4PPYA 1E3IA 4KQHA 1JQAA 4X1KA 2DSNA 5EVJA 5KDDA 4HV4A 4LGVA 2BGGA 5CXUA 2H3HA 4YMIA 5AQEA 3AQ4A 5L4SA 1SUWA 4MRAA 3THOA 1LPMA 1AXEA 1YFKA 4PLYA 3WHKA 1ADGA 1D1TA 4M4SA 1U6JA 2CVHA 1GUZA 5CYPA 1N5RA 3VKFA 3W7AA 3ZHZA 4ATNA 3ZJUA 1JIIA 2VNKA 3QVXA 5CDFA 3D6NB 2PWAA 3OTGA 2FJPA 2CLOB 1XKXA 3WG9A 1SQ6A 3K1YA 1NTRA 4ZKEA 2Q3DA 2XTNA 3OOWA 4CKWB 3AY3A 4YJ2F 1A5SB 3R0QA 4BBJA 4NR0A 2WQZA 4V3CA 4EGQA 3UN1A 2B99A 1XQVA 3G68A 2C4UA 3I4CA 3INGA 1TYDE 3C5CA 5JROA 3RRBA 4HUTA 3USZA 3IKTA 2AOXA 4GYYA 4E5NA 4RMIA 1NYRA 1ZINA 3PP8A 3WIDA 4TTQA 1Y63A 5H7XA 5JWOA 4ZTBA 2BCEA 5LMCA 4H1VA 2ETVA 4JYBA 4P8RA 1KRXA 2CJXA 1GEGA 2VIIA 2RGUA 2WIGA 5AICA 1HNNA 2X5NA 4LY0A 4OK3A 5ED0A 5K4GA 1CRLA 1SULA 2PAAA 3N3BC 2GB4A 1NN3A 2TMDA 3EH1A 2VDPB 3MEQA 3OQJA 5EWLA 4YRBA 2HR1A 2PXXA 3I83A 4JIGA 1TT7A 2MR5A 3MOGA 3NHPA 4BP8A 1C3OB 5JXJA 4K9RA 3RTGA 5TS2A 3OT4A 1EQ2A 4IIDA 1ADBA 1T0PA 3G1UA 3G5TA 5FLKA 4E31A 1H3EA 2AIRA 2XE6A 3M4JA 3SZUA 3IIJA 2WYVA 4CYMA 3JAMA 4WNAA 4QIHA 3GN1A 3JQRA 4LAFA 4TSFD 3K8YA 4GXQA 2C98A 4CMCA 2ZI6A 4LF6B 1LPPA 5F5NA 4LW8A 3H0KA 3E4DA 4QHTA 3IPCA 3RROA 1WZ2A 1XEWY 1Z7EA 5HP4A 1E1KA 4X54A 3IAM1 3OPQA 2C31A 3ZJYA 5JYBA 4QUAA 1TK2A 4PGGA 4PO9A 5ICGA 1X1AA 4AJHA 1Z28A 4M0LA 1J9ZA 1ZGAA 1Z4KA 5E6RA 1SXJD 4H0NA 4MVJE 3RTEA 3KT6A 3EFBA 4RY9A 3CG4A 4QE3A 4LF4B 4F46A 1XE3A 2ZE5A 4M0MA 3OSUA 1NVDA 4NOKA 4ETWA 1NBIA 3RKRA 4BFYA 4TXLA 3ZWDA 2PZEA 1HE5A 3OCVA 1B8UA 4R8SA 2YBEA 1P5JA 2E49A 1F2UB 1Z4OA 1I4TD 3ADPA 2PRJA 4IGFA 1G1AA 4KN9S 2BI7A 3SSNA 5IPFA 3SHOA 2EQBA 5TF4A 1TJ5A 2KLHA 3DO5A 3VQTA 9LDBA 3BF7A 3K5PA 4HEQA 1CQZA 4C0QC 3ETEA 1MX1A 3JVUA 1JG3A 1KS2A 4RANA 5FAKA 2HF8A 1HLFA 4GVLA 1V1MA 1XZDA 1UWCA 2XRYA 3AUKA 4RENA 1N36B 2ATXA 3EEBA 1ADYA 3U9LA 3FI0A 5BN5B 3ONVA 5HBRA 2Q4OA 5J63A 1BGWA 2GETA 1SG9A 4DHEA 1CS0A 2QW8A 2M9MA 2V3WA 3Q88A 4LJYA 4PHTA 4KXVA 4MKFA 4C01A 1SU8A 2NU6A 4DDVA 3P9IA 1RKBA 1MRZA 4BNHA 4MICA 1SK8A 2Y68A 1K8RA 1O1YA 2H2HA 3RSGA 1UFOA 3B38A 3FLMA 4DANA 2X4DA 3BIWA 4R8VA 5EKDA 1PNTA 3VYTB 4B8YA 4D41A 1TKBA 2J9YB 3O74A 2P2YA 1FS5A 3JAKA 4NPCA 1J5XA 4MV0A 4C6SA 5KX5A 4FDTA 1ZEMA 4D0SA 1IUOA 5JCJD 4QGGA 4AS3A 4YXFA 5IWCA 2HWKA 4W99A 1E1QD 3B1XA 4K2AA 3RB8A 1TC1A 2FPRA 4FE7A 4ZU1X 3E9DA 3MTJA 1CDEA 1T6BY 1YZKA 1OROA 3BE4A 3ZWOA 3A1TA 4QEKA 3K1AA 4QRDA 3MTQA 1FDOA 2BBWA 3P19A 3LP6A 5EA2A 1X39A 2OQVA 4LFBB 3KLMX 3L1UA 4UUOA 3D4IA 1QP7A 2H1SA 3ZNOA 2VYNA 2R8ZA 1CZOA 2W2OA 1EWYA 4O25A 2XDYA 3KYDA 2JA2A 3WK8A 4I50A 4M76B 4URVR 1HLGA 3RTDA 3WGYA 4B71A 3E0XA 1V9SA 1Y6JA 1XDDA 4BLWA 4KREA 1RI1A 3DQQA 4YRTA 3NZEA 1B0PA 1JLMA 2VP3A 1CS4C 3C0KA 3V8VA 3PUZA 1KMIY 2AN5A 4JGIA 4H17A 4LSWA 1I01A 1OLOA 4G0OA 3KLPX 1SK9A 2WV9A 4QOGA 5ALWA 5K5EA 5IC4A 5JVDB 4TLMB 1ZAYA 3TR5A 3NHWA 1J33A 1E0DA 3EFOB 2OHHA 4FIZA 3U31A 4EHHA 1B1AA 3VV2A 4I1VA 5BY2A 1SY7A 3EQZA 2Q5OA 2D6FA 2AH5A 1Q22A 2J5XA 4ZOLF 2QG6A 4OM7A 4HDMB 1DTWB 2VDJA 2VPXA 1YCFA 4N03A 3K09C 1SZJG 2M1ZA 2HNBA 2OUKA 2OQ2A 2VLBA 3BGOS 1PLJA 3L0YA 1EDZA 3OZDA 4GR9A 4UDYX 3W8FA 4N3BA 1VM6A 2HH9A 2VYVD 4AULA 4DKXA 1F7UA 3VMFA 2DKOA 2AQIA 2ACEA 2V7XA 3C87A 3IUEA 3L8ZA 3NDRA 3DBVO 1ZA1A 4EYKA 4XB2A 2Q2OA 3EWNA 3ZCSA 1KH1A 3E9RA 4QQKA 1H3FA 2VP9A 4IF6A 1VG1A 5A6SB 5HXAA 1B2RA 1E3TA 3X1KA 4MV9A 1QNFA 3GGSA 3EASA 5LD2B 4NBNA 1B76A 1U2SA 2CHEA 2WJVA 3TLMA 4UW9A 4YYZA 2PSSA 1NI5A 1CJMA 4OLFA 4HDRB 2AMVA 5LWHA 1JQJC 4CKEA 4PZAA 1MIOA 1XEFA 2DERA 2O8BA 4M0CA 3CUVA 1UWKA 3TD9A 2FZ4A 1KPHA 4R1PA 2ZI7A 1FFGA 3KU1A 1TCBA 3SYNA 5JCZA 1A72A 4M9QA 1OZ0A 1ONBA 1T2FA 3F5FA 3UHJA 4XH9B 3UG7A 1MAWA 2IGTA 4ZEMA 3FZGA 1X9GA 3HPQA 4MKIA 1F0KA 3UUFA 2XVMA 1E77A 1IC6A 4AZSA 3O21A 4DT1B 4LVUA 3RT7A 4RJLA 4TS1A 4AJLA 4YCAA 5I4KA 4GSKA 1UKCA 3GOQA 3V7WA 1ZK0A 1A0OA 3UT5A 2JH3A 4FFWA 2ERCA 1NUPA 3WV4A 2I65A 1IBCA 1N9KA 1NW9B 4O2AA 5JAUA 1NDQA 2XNCA 2KYRA 2VHVA 1FX0B 4CKCB 3B51X 1O5IA 1MX5A 1Y6ZA 1NNI1 4IMIB 2XNJA 1C1XB 4NE2A 4ZVMA 2QLJA 4BNLA 5C51B 3FNFA 3UOGA 1JAZA 4OD0A 4YGXB 4AMZA 3A2MA 2CL7X 2QMUA 4HWKA 2RIPA 3ZDEA 4O4JB 2O2IA 2ZRMA 1KI2A 1AS0A 1BQ3A 2PO7A 5FPHA 3L4BC 2UXCB 1WO8A 1YMQA 4MITA 1GDTA 4FE4A 3QX7A 3RK0A 1V5IA 4I0WB 3EXAA 2C2KA 3QPAA 1ADCA 1KVRA 1NMXA 2X6RA 4EKDA 4ZFNA 5ITWA 1AHPA 1VJ5A 3T99A 4UNRA 4Q9AA 1O77A 1H3NA 1XK7A 1W30A 2FMUA 2C78A 3R5TA 4FGKA 4AKEA 2C1EA 1W5FA 4C5AA 3EXHB 3JPWA 2K5UA 2ZQYA 3H99A 4LHWA 4NTZA 2Q7DA 1QIKA 1U1IA 4D43A 1KIMA 2CJFA 4IMJB 4DILA 1W29A 4I4IA 3FPHA 1UKVY 2V55B 4MHOA 1DC8A 4JLUA 4M99A 4B46A 3G0IA 2X2PA 1LBHA 2FXVA 3SR3A 3KEFA 3LT2A 1E2IA 5EIAA 2WG2A 3A14A 5DX1A 1SD5A 5ICFA 4IM7A 5CNKA 4FEGA 4UVDA 4EPYA 1Y34E 1N7GA 2R97A 3IKVA 4BU0A 4OHMA 2XGMA 2XY4A 1UK9A 2P6MA 3REFA 2YN2A 3GY0A 3WGGA 3GJ6A 3VUFA 4F3NA 1E9EA 2PO5A 2KBFA 3LNCA 4BNJA 4EF6A 3RABA 5LVAA 2IS6A 3H84A 3MK31 4M1MA 4UE3S 1YK0A 1VCHA 4OFWA 2EJVA 4LYHA 4RD3A 1U5BA 3RVJA 4ALJA 1P3DA 5J2UA 1GM5A 5E1DA 3AOEC 3GXOA 3DXXA 3M0EA 1XN4A 1YZFA 4MR8B 1YULA 2OT3B 3DT9A 4UMVA 4C89A 4KMOA 2IU6A 5GOZA 5CB8A 1KI6B 2FR0A 2H29A 3KJNA 4TVBA 4C78A 2Q50A 5E6SB 3WNBA 4F06A 3N7AA 1HDZA 3WIEA 4PVCA 4EH1A 1EE2A 3C3CA 3OZ7A 1M2GA 2WHEA 2WHPB 4LJ5A 1HO3A 5SZKB 3I8OA 3PFWO 4KNYA 3DO6A 3DYIA 2C3YA 5CLHA 4FGSA 1UWLA 2PH1A 4BQNA 2ZWMA 4WWHA 2ATCA 4E21A 5B1EA 5CG1A 2RB5A 1EB8A 2M1XA 4PHCA 1RWXA 4Y98A 2H3EA 4KGZA 4RIFA 4AD8A 1YB6A 2CXNA 1IN8A 1NXWA 1X1EA 2QVCA 4ME6A 1U8FO 3RLIA 2BUAA 3RU9A 2DLDA 1U81A 1LS1A 1WUJS 3E7WA 3TZQA 2WJWA 4AURA 1K6MA 2UAGA 4FK8A 5KMGB 1XZCA 3PYXA 1ZGBA 2IYFA 2HXGA 3ROFA 3UJ9A 1IHDA 2YFHA 3K0BA 2IDKA 2Y92A 2B78A 4PFJA 2C4TA 5LDHA 1NJ2A 5ULLA 4E2YA 1FTNA 2CMGA 4GEKA 1FP7A 3AI2A 3TLXA 1GPKA 2H2WA 1EYZA 2H6EA 3OQ6A 4FILA 3U0VA 2EC5A 5EJ9A 4HVAA 1RMYA 1MEEA 3KTAB 5EMHA 3RANA 4CHTA 4F4UA 1FSPA 2J30A 3O4GA 4AF7A 4PCVA 3MTEA 3LK7A 1S5PA 3M34A 3MJVA 3UXYA 2W0SA 2VZ0A 3ROTA 2Y66A 1BW9B 1QYRA 3SEZA 4IF4A 2P5SA 3F98A 1IDN1 4IX1A 1S2NA 4LCJA 2E89A 2BV3A 1XAJA 2VYQA 3GRRA 4D26A 2IYPA 2QTLA 1LPBB 3DLBA 2JGMA 5K8JB 3NHKA 2XF8A 2K7ZA 3BG5A 2NP7A 1G64A 1PWYE 1M2WA 1P60A 3QXGA 3VAZA 1IM5A 1U9JA 4MCIA 3ZY3A 1NVUQ 3ZIAD 1M1ZA 2QY9A 4PFSA 2XTJA 1JHXA 4HFMA 2XCRB 1LSSA 1MT0A 2ZB4A 1W5AA 4QASA 4FONA 5I7FA 1DWQA 1NSTA 3R7AA 4L6AA 2IHYA 1CXZA 3S2GA 2B1IA 4MWGA 1UQUA 3HB4X 4RHUA 4WZAB 4BKOA 4BL5A 5COAA 1L5LA 3ND9A 5B3JA 3I30X 5K2MA 2HFJA 3SS7X 4GDFA 1OSNA 1XP8A 1MOQA 4DLYA 1FL9A 3G8CA 1WU8A 3MJSA 4GUAA 5AKGA 5EKTA 4BB9A 5KTMA 1FTQA 1Z6AA 1JDVA 3PA8A 4YJFB 5FPQA 3I72A 1CTQA 5CCBA 2UXDB 1DIHA 2F4NA 1LNZA 3FPGA 2B2XA 2ORIA 3PGJA 1KARA 4CT0A 4BNIA 2XYVA 3DWIA 1M7GA 3BFVA 5ALJA 2P2NA 1DCMA 1RPJA 2VBGA 4BAUA 4G63A 4HEHA 2VNSA 3JWHA 5E4FA 3DVSX 4TKVA 1N2HA 3EDCA 1XLTA 2FPGB 2ZBUA 2RDMA 1N8NA 3CCBA 5EJ4A 1Z9BA 5JT1A 3AR8A 2PJRA 1ZRSA 1OE0A 3GLGB 1GU7A 4KBFA 2C4WA 3HU2A 3IGFA 4KHZA 3A37A 4QOEA 1RJ9B 4XDGA 4BASA 4EI2A 1E0KA 1JR3E 3E9YA 3P52A 3UF0A 5CB4A 4X60A 1Q2XA 4NONA 3CM0A 1BWPA 3GP3A 4O4LB 4OXYA 1JU3A 1SXJB 3FW1A 1U8EA 3R9KA 1C0KA 3CY6A 4M1OA 4IILA 3WADA 3E22A 1TTTA 4ENRA 1EFRA 3CRVA 8AT1A 4OREX 3GJ0A 4B81A 2ZREA 5IN5A 3RO7A 2EAUA 3ZGNA 4B87A 5ADHA 1XA4A 4PHGA 2WWYA 5FDFA 2HRCA 1GGEA 1ZNWA 1JHQA 1V5GA 2RG1A 4R41A 3OY7A 2DR2A 1E1MA 1Z07A 3EQ7A 2H4FA 3JQDA 3U4QB 1NX9A 1D9ZA 3LWZA 2ZSAA 3IX7A 1QPBA 1N2GA 5D86A 4TV8B 5AXCA 4YUVA 3T3DA 2GZ3A 1WM1A 4ONEA 4QJ4A 5BWBA 3KSAC 4CMKA 5HUHA 1KQFA 2OHFA 2IITA 2QM0A 4NPHA 3S40A 1MABA 3WLAA 4D57A 1NC3A 2PNFA 4JBNA 1NJ8A 3LSTA 2G17A 3RNLA 1PWEA 3M5PA 4A27A 3HRKA 3LQYA 2QRUA 4I4TB 3BK7A 3FUTA 1WEKA 2CVOA 2VT3A 2GEVA 1AOXA 3EIEA 3K6SA 1L5HB 4YP0A 1EUDB 1G3IA 1JJIA 2VOJA 2OTCA 4HATA 2QZSA 2BIFA 4QSHA 4IZ6A 1ECGA 2HQBA 3EZLA 4J0FA 3PFFA 4LGMA 4Z49A 1M34A 5KQLA 1T9AA 3B6JA 2AB0A 4BGVA 2QMHA 5EJAA 1VGQA 1CY4A 4CKXA 1K3FA 4ND3A 3VDMA 3KS9A 4NYIQ 4CG1A 1L4GA 1DFGA 2F64A 5B64A 5DGDA 1Z17A 4Y9UA 4ZEWA 2JI8A 3I12A 3U4CA 2LPMA 5EIBC 2QM7A 4MRVA 1JEQB 2BSAA 5A71A 3RRZA 4RK0A 4CUZA 1XROA 4E1VA 2VI5A 2PT6A 2HLHA 3OUTA 4HNGA 4B79A 3KYJB 3MUEA 3LHSA 4BNDB 3LVFO 1CJCA 1E1RD 1GFIA 2V65A 2X3YA 1WSAA 2W70A 4EB8A 4R7TA 2FSSA 2ZRGA 3O1IC 3SJAA 2YFQA 5B3AA 4V0SA 1P4JA 2WTAA 3WSVA 5JZSA 3V00A 2JCSA 3QGMA 3GWZA 2ZUVA 3QITA 2NUTB 3AFGA 3O83A 3SFTA 4AICA 2OPHA 4U7DA 4XB1A 1TE2A 3PPXA 1Y48E 3P2IA 2UYYA 2XMBA 1O6BA 4BNZA 2OCXA 4KWHA 2O5EA 1GQOA 3BB3A 5LC1A 3T1VA 3VR2A