2XYGA

Caspase-3:cas329306
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xygA00
4DCJA 1GFWA 4AWAA 2HBRA 1I3OA 4N6NA 4QUAA 2P2CA 3UO8B 3P45A 2CJYA 2Y0BA 1K86A 1QX3A 1SHJA 3V4OA 2C2OA 1ICEA 4EHDA 5LUBA 3PCXA 4JR1A 4D3ZA 4QTXA 3NS7A 1SC1A 4M9RA 4EHLA 2FUNB 1RWVA 3R5KA 4IEFB 4QUEA 3S70A 5JFTA 3H1PA 1I51A 2CJXA 2NN3C 2QLFA 2XYHA 4FEAA 2Y1LA 3DEIA 5I9TA 3GJTA 2H65A 3R6GA 4N6OA 2H5IA 2J30A 3UOAB 4NOMA 3R7SA 1RHRA 4NOJA 2H4WA 1KMCA 1RHQA 4PS1A 5IAJA 2XYGA 5IARA 3S8EA 1K88A 4HQRA 2QL7A 4D3YA 1I4EB 2DKOA 5IAKA 5IABA 4PS0A 4ZVPA 2XYPA 1RWXA 4EJFA 3D6HA 3V4LA 2QL5A 3QNWA 2K7ZA 3RJMA 4EHNA 1CVRA 1RWWA 2J33A 3GJQA 4JJEA 2CDRA 3ITNA 4ZVQA 4EHKA 4EHAA 5IASA 1QTNA 1NMEA 4QULA 2CNNA 3IBFA 2CNLA 4AW9A 1RHJA 1JXQA 3PD0A 4QUBA 3D6FA 4HVAA 4I1RA 3R7BA 1RHUA 5IBRA 4EHHA 1NMSA 1SHLA 1F1JA 3H11A 2FQQA 4JR0A 5IAEA 2C2ZA 4HQ0A 4QU0A 1RE1A 5I9BA 4NBKA 1IBCA 4QUIA 4FGUA 5IC4A 5LU8A 2FP3A 3PD1A 4N7JA 5IBPA 4D3XA 1CP3A 1F9EA 1SC4A 3R6LA 4QU5A 4FXOA 4QU9A 2XZDA 3V3KA 3IBCA 4N7MA 5LU9A 2QL9A 5IANA 4ZVUA 4QU8A 1RWKA 1RHMA 2CNKA 2J31A 3H0EA 4N5DA 3NR2A 4QUGA 3NKFA 4LSZA 4EHFA 2C2MA 4AWBA 4I1PA 2HBYA 3DEJA 2H4YA 4JJ8A 4N6GA 3V6MA 4NBNA 2QLBA 1QDUA 2XZTA 4NOLA 4PRYA 4DCOA 3BIJA 4IYRA 1GQFA 2J32A 2HBQA 3KJQA 3GJSA 4ZVOA 2WDPA 4ZVRA 2H48A 5IAGA 1PAUA 1RWOA 1NW9B 3DEHA 4PRZA 3H13A 1I4OA 1RWNA 2H51A 1M72A 2AR9A 2H5JA 3KJNA 4JB8A 4JR2A 4ZVTA 3SIPA 3EDQA 3R5JA 3KJFA 4QTYA 3H11B 5H0IA 5IBCA 2H54A 3V6LA 4DCPA 3P4UA 4JQYA 5IC6A 3D6MA 4NBLA 3DEKA 4FDLA 3R7NA 2C1EA 3EDRA 4ZVSA 5K20A 2QLJA 1RHKA 4QUHA 1RWPA 2HBZA 3V55A 4NOKA 1BMQA 1PYOA 3K7EA 3SIRA 1SC3A 4JJ7A 4QUDA 5LUAA 3GJRA 2C2KA 1RWMA 1NMQA 3E4CA 4QUJA 2CNOA 3OD5A 4JQZA
chains in the Genus database with same CATH superfamily
4J3JA 1GQQA 3CW8X 3MWLA 1X7XA 2D5IA 4G85A 1AH2A 2Z2KA 3VU9A 4INAA 2Z5VA 2CE2X 3NVDA 4HNGA 1QC5B 3V8VA 3VI3B 2WV7A 4AJJA 2BIFA 3M5CA 2BBWA 2QWXA 4U7PB 1XF1A 2HD4A 3KJEA 3QMMA 1FLAA 3OOWA 4KQHA 3ULKA 3X1ZA 4EHDA 3NHYA 5T6MA 5DHUA 4WDQA 1IZ9A 1Z2OX 2XBUA 2OYCA 1Q0ZA 1YB2A 2WA1A 4C29A 4GPZA 4RV4A 4LPKA 1L4KA 5DFAA 2Z30A 4EX7A 1OWNA 5TRTA 1QHHA 3QU7A 1CJCA 3ENKA 5AK5A 4FKBA 3DL4A 3O8NA 3RW9A 1O9HA 1U9IC 1RXUA 1Y3BE 1GQYA 1G98A 1NNLA 1ZN9A 2FDRA 2J48A 5EHQA 3NIWA 4OMCA 4QYTA 1MX1A 3T06B 3IDSA 3ZD6A 1IEWA 2GYWA 2ECOA 2YHIB 5JXGA 1JDZA 5D87A 4KDFA 2E3JA 4B3RB 2M6KA 1OU0A 2XHZA 1Z0SA 1LBIA 2EU8A 2P4HX 3DMDA 4QREA 2JGMA 2BGRA 4IXMA 3T15A 1C3OB 4DRZA 2ZUCA 4MWZA 1U94A 1TO6A 2Z8YM 5JNLA 2BCEA 1FTGA 1XRJA 4KGDA 1NBME 1U9ZA 3FPKA 3DXFA 4FTWA 4G5FA 1AIPA 1F48A 1TK3A 4H7DA 3UVEA 3X2SA 1GY8A 1DXOA 4OM8A 4FR2A 3SJ7A 3D0QA 1VE9A 1W1UA 1Y6QA 5LBUA 5BP7A 3KB2A 1QANA 4UBNA 3Q40A 3L18A 1PN3A 2IVZA 3LD9A 4PSKA 4ZCSA 1LPBB 3T38A 1N6PA 2I55A 1SVMA 1EP3B 3T95A 3U4AA 4QL3A 3P9KA 1X94A 2Y68A 4K40A 4RCZA 4QFDA 2BGWA 3I28A 2BEVA 1NJ8A 1Z88A 1QH1A 4LXHA 2OXCA 3K4PA 4U8HA 2AXPA 4Z0NA 3NW9A 1DOZA 1V8PA 1YB1A 2RIRA 2CFOA 3A6PC 4X7RA 3DT6A 5I4CA 3DLHA 1L7MA 4X20A 1EG7A 2M6SA 4AURA 2VAVA 2G9VA 4KFSA 1T24A 1W0JD 1TU0A 2AMYA 2P1DA 4I6JA 3GDWA 2X86A 4MVJM 4RL4A 4RQAA 3ZLUA 1BXRB 4EBBA 1JWAB 4OATA 3PRYA 5HE8A 4Q12A 1Z6YA 3P9QA 2XAAA 3RYIB 4K8RB 5IWAB 3MYYA 4W9MC 2DH6A 5F9MA 3MB5A 4Z9AA 4PG4A 1M2OA 1S2GA 1ZN7A 2I8AA 3KTAB 4JH0A 4WE3A 3W4IA 2VJAA 3ABSB 3MRSA 1L4FA 2PWBA 2WF9A 1PTKA 1KQOA 4YJFA 4QVIA 2O23A 3WB0A 3FPHA 4PZEA 1OGJA 2HH9A 2BDTA 3X1WA 4FFBA 4IOMA 5B2FA 3RS0A 5LLDA 1CEEA 2FX3A 1B0PA 2BL4A 4GM4A 3AEZA 2BGUA 4BMNA 3GJ8A 1G7SA 3K9QO 4NEQA 1LQUA 2OHOA 1X7DA 4I0WB 4QDTA 4XWTA 5EL0A 1I3CA 1NVXQ 4QUDA 1YF3A 2IX9A 2XKKA 3AI7A 1PJZA 3L79A 5LZ5A 3PRHA 3LBFA 1L8OA 1F06A 2AZDA 3GWGA 5COBA 5C4GB 4ZIRB 4KREA 1CUWA 1J90A 5DX8A 2QAGB 5KYXA 3LDAA 1F51E 3KQTA 2BKEA 5DI3A 3QI7A 3AUAA 4UMFA 1OAOC 3A4IA 2I4MA 3ZYZA 3EJ6A 2Q1YA 1P77A 3RF6A 1R0CA 4EFDA 2HDOA 1OFVA 4C21A 4JV5B 2PT5A 2ATCA 3A14A 2XMGA 1BRTA 1LLFA 4ISCA 4G23A 1GRNA 1N2SA 2OHHA 3ZDAA 4E5NA 1W2HA 1NM5C 2INGX 4HWTA 4BVBA 4BL5A 3SZ3A 1OX5A 4BGIA 4RZIA 5DXFA 4EJ2A 1V4VA 1OXKB 3F5MA 1QIKA 2VL7A 3E9DA 4C0XA 3DJYA 5LCXA 1DAEA 2Q6LA 1GZ7A 3AUXA 4YRDA 1NULA 2R6GA 4O25A 4TZTA 3VAYA 4DV4B 2WWFA 1F6WA 4BMVA 5JE8A 2ATIA 5C8ZA 1E0JA 1XBTA 3AJ8A 4RU1A 2H92A 2VHYA 4FHDA 2JCBA 3CCFA 3E3MA 2HWUA 4HQNA 1BROA 2FWJA 2VNSA 3OMWA 3S99A 4IFBA 2I6QA 5D1NA 4NNPA 2WAAA 2Q4OA 3PFHA 5CJJA 2GRUA 2VHZA 2WMNB 3BDVA 3EMDA 3HYRA 4RPKA 3U3XA 4POOA 5EJ5A 1KPGA 3ZOZA 1U7TA 1IFXA 2JFGA 3F4LA 3M4XA 3O8QB 4CDNA 3DTVD 4PINA 4KK4A 4LJ8A 4WLEA 4UXIA 2JIBA 1L5SA 2IOQA 4RK4A 1BKSB 4F8EA 3O2QB 1AK9A 4IF6A 2DSTA 1CZRA 3A4LA 4OQMA 1HTTA 4BU0A 1I36A 1X8LA 1OGYA 1LC3A 5HK8A 3RHTA 4ARCA 5AW1A 1L4HA 4D3XA 5JDCC 3JQ7B 2IHTA 3HRHA 2J4DA 4IWNA 1ORDA 2GAAA 3L6UA 4RIGA 1Z6QA 2VPPA 4MKHA 1XT6A 5LU9A 1UBMS 1LU9A 1GPNA 1NW6A 1JKIA 4R01A 4X5OA 1W85B 4M99A 3ZWXA 1GVHA 3DMNA 5TLSA 1USGA 4CGYA 1JH9A 2MSWA 3QYPA 1OFUX 3C43A 2JA1A 2RAPA 4C22A 2JAHA 2ZREA 2F55A 1QG4A 2PWZA 4D9EA 5L45A 5KYXB 4R0VA 4GM0A 4CDGA 1XQXA 1VI2A 3Q12A 4J7AA 4K86A 1SH7A 1GQFA 2GDJA 4JX8A 2MTBA 4CF3A 1RC1A 4RAOA 2JJ8A 4TUYA 2AR0A 2MSNA 2Q1SA 4U7JA 3EB9A 3NWEA 3G0HA 1CDEA 3F9RA 2YRWA 5FOVA 1IZYA 3GXBA 1AUXA 1VCMA 1RYDA 3IQXA 5JJIA 1U7OA 1P3Y1 2I87A 5DK4A 5HKOA 5JROA 2ZTMA 3IH5A 4QTYA 3QPDA 1OLUA 5FV7A 4TQUS 5A1JA 2HY7A 5B3JA 2NTJA 1KMMA 1RTKA 1V0JA 2LGJA 1BE8A 1D0SA 3O7WA 4CE6A 4CI0B 1TK9A 3BXFA 2HEGA 2QRJA 1JFFA 3TR0A 4RORA 3EXEA 1GPYA 4II3A 4YAWA 1GEEA 4FGKA 2WU4A 3VR5A 5KYVA 4BX2A 1NX9A 3JQBC 3C3MA 4ZYLA 2QTMA 4U9IS 2R5NA 3WYGA 3EEBA 3NCHA 1M6EX 5GONB 3UMFA 3R09A 1SRRA 1HT1E 2QM8A 4CT4B 1IIBA 3IIKA 5FBKA 4ZEOA 2IHYA 4D74A 2IYOA 2WSSD 2IIBA 1IG3A 3CZ4A 2C20A 4AG6A 1GITA 4BNFA 1Z83A 3KQVA 1EAYA 2HJSA 4EB6B 4KIFA 2ZZNA 5K45A 4XIFA 1L4LA 3CUVA 1T9ZA 4M22A 1SBHA 4ID3A 2ZBGA 4B09A 5J9FA 3U31A 3S81A 4KR2A 1ZN8A 4LV8B 5HGXA 2B69A 3BCHA 1C0LA 1NFQA 4V3BA 1NNSA 2GESA 1Y8ZA 4A6XA 3DBLA 3INYA 4TV8F 3MCVA 4BN4A 2CUZA 1WUTA 1V11A 4RPJA 1M6VB 1NU8A 1QIMA 2RGNA 4JGGA 1V6AA 2P6MA 3D6TB 4O59O 1T9AA 4IIJF 4RIEA 3SHVA 3L0DA 4GSLA 1R9GA 2H63A 3QFCA 1M2GA 1DG3A 4M9QA 1C0IA 2W71A 1T34A 3COPA 3QXGA 4JEUA 1FB5A 3OZ7A 4EHAA 4YBRA 3ZU4A 4CF6A 3TLXA 2BM8A 1FRFS 2QLMA 1JXOA 1SIOA 1U8EA 1G19A 1U2EA 2ZYTX 5DCLA 1TX4B 4XD7D 3UKJA 1UM9A 1N34B 1NI3A 1YULA 4N0QA 4MJ3A 3HSKA 1UKEA 4Q93A 5B1SA 1AHHA 4JASB 1JFRA 1RPZA 4OX9Y 3AKYA 4CKYA 1Y4SA 2D00A 4GI1A 2VJLA 1KDVA 3DBRB 4FGUA 3M3DA 4WZBA 1SIUA 5B3AA 2MSKA 3LUGA 4K5QA 1E7MA 4WW0A 2NU9B 1FFDA 1H1LA 2CDCA 1N1EA 1KETA 1I1QB 5I45A 2ZPTX 3U7RA 2I33A 4FYMA 1N7IA 1F6DA 1WDTA 2I2WA 4NK4A 3CIOA 5EWJB 3DP9A 2VQSA 5F4BA 4EELA 3NWPA 4UAUA 1FTWA 1VMKA 1WUYA 2RKWA 5FOUA 5IDWA 1HFKA 4EATA 3NGXA 5G0VA 2AXEA 3THYA 2C7QA 3PJGA 5DH9A 4B43A 1V8OA 4E5MA 4FMDF 4O5OA 3IAHA 2GM4A 3UW1A 1YMUA 1J8MF 4TL6A 1TQHA 5L4NA 3K6JA 1E59A 4M87A 2VA9A 4JB0A 1LBSA 2XB8A 3ZYCA 2AFIE 1OKKA 1JQ3A 4R16A 3QE9Y 3PEFA 1ZGZA 2LCIA 4P3YA 4AU1A 3T1YB 3WL6A 5EE0A 5K3SA 3R0JA 2Z8ZA 1T2EA 2VDUE 4FLEA 4I1UA 5FAXA 4KNYA 3ABIA 3SR3A 2JRLA 3QF4A 2BVNA 4XUDA 1JIVA 3EDQA 3FCEA 4PX2A 4QG7A 1WHSA 3LFHA 3MJVA 1ZXLA 3BDIA 4WBNB 4QELA 3HJUA 3L0BA 4NBLA 4MV1A 4PBRA 1PJSA 4BNNA 4AM8A 2DWPA 3QFHA 3ZHXA 3IPXA 3TLZA 4O4JB 4C5BA 1RMTA 1K7CA 2XKBA 3FDIA 2BAGA 1A8HA 3JYPA 4R5MA 1DKQA 2RKOA 2ZXFA 4EKDA 1ORHA 1G8AA 4KV9A 3WLEA 5K3BA 1E2EA 3HZRA 4K03A 3JV7A 4OYHA 3TL3A 5A5GA 2I99A 3ZEIA 3IEVA 5JALA 3L93A 4UHDA 3ZLTA 4A1FA 4AWAA 2ZJ1A 1KK1A 2GBGA 3CURA 2RHCA 2NZXA 3L0IB 3SQOA 4A8JA 2OO7A 1WCWA 4HJRA 1WPRA 1DLIA 2IHUA 2J5BA 5CCEA 2R8OA 4HEA6 2PZMA 4BFZA 1B0ZA 2W37A 4JEHA 1M66A 4P7FA 3R9KA 1PFWA 4U2KA 3ZI7A 4DM3A 2PKYX 3WXBA 5KWJA 3PHGA 3UWKA 2PUGA 4L4ZA 2YC4C 2J30A 2QN9A 3QJGA 1GVNB 3WMGA 3GIWA 3GLTA 5J2UA 5M7EA 1RAHA 3HVRA 5IG2A 3I62A 1MORA 1QUFA 3GHYA 3K72B 3K9GA 1MB3A 4H27A 5JS1A 3CT4A 1G16A 1MGOA 2RK6A 3FIUA 3FVRA 2F3PA 4DCSA 3K70C 1H23A 1FBTA 1PSZA 4I9NA 1V37A 2O2EA 2VH1A 1Z4LA 4LJ6A 4EJFA 2PUJA 3JYHA 4DZZA 3I2GA 1YJQA 1FLVA 1U8YA 4O5AA 2J85A 2V9PA 3KELA 4A6DA 3R75A 5KTSA 1EVIA 1N5RA 3P9IA 4IJUA 5T5QA 2B5WA 3HFJA 4ZAZA 3BMNB 5BWLA 3TIFA 3AGPA 1AUOA 4FLMA 2WZBA 2ZUFA 3HKDB 3Q1LA 4QFBA 1W8DA 2CHGA 2XXBA 3TSOA 3UAOA 4Z4QA 2XNCA 2EQ5A 5GV7A 1P1IA 3WKAA 3GPIA 4EWLA 3QFRA 1PJRA 4URUR 3KSUA 1NG1A 3VKHA 3B7PA 1VTKA 3KSAC 1TAQA 4M49A 1G8SA 4PYRA 3CX8A 3NHWA 3ENQA 5DIFA 2QVBA 4RH0A 1P81A 3QBEA 4U4AA 5CVCA 1RS0A 4MUEA 4Q4AB 5I7SA 1RJ9B 2QN1A 3RJ9A 2FZVA 2BRUC 1MABB 3AIOA 2HXSA 1EDDA 3O83A 3R3YA 2HA6A 1TPYA 5IEBA 1Q15A 4US0R 4YFVA 4MQ6A 1RWKA 1HNNA 3BMQB 1K2WA 3W5AA 3SX2A 1HYQA 1DC3A 5AMXA 5IVPA 1RXWA 3WGUA 4N9WA 4ZYUA 4BLQA 1BAPA 2X5OA 2HL6A 3BTOA 3ZCSA 3THXA 2F2TA 3HPQA 1BHO1 1J5XA 4N48A 2HQRA 3GUHA 3N58A 1TYZA 1YE5A 1UFKA 3KUUA 2AUMA 4DCOA 5F73A 3ROPA 3ROGA 4ZVTA 3GJ3A 2G4CA 2IJGX 4IEIA 5HGJA 1YZ3A 4K8OA 5DBGA 3OHSX 2PMCA 4Q0MA 1LQTA 4HLUC 1S6YA 1ZWKA 2YJ3A 5CH3A 1BKYA 3KJFA 3ZLVA 2XITA 5EGNA 4EZEA 4QEKA 2EG9A 4DGQA 1WZNA 1PNTA 1RZ3A 2QMOA 2HRBA 4RA6A 5CDFE 3QJYA 3ZJYA 4EHBA 1JNXX 1LDYA 3OT5A 4HGPA 4J6EA 2WVHA 4DW8A 1YFZA 4EPRA 1G9SA 2Q1XA 1H05A 3V55A 3G0OA 3UYLA 3N8GA 1JE1A 4GOMD 1NUQA 1QLWA 4GYYA 4RHTA 3WLAA 1KEZA 2OQRA 3PT5A 2F17A 3OPNA 1T2AA 3K0FA 1RQGA 3ZZTA 1V43A 4E0BA 7REQB 3VHXA 2FWNA 2LXNA 3DZJA 1AKWA 2C0PA 2WP8J 1E1QA 4YLEA 2FPIA 4OAOA 1WV1A 3CLRD 1JIUA 3E22A 1P2GA 1CD5A 2XGGA 1Q7BA 4CU5A 1ZA1A 1VP9A 4CIAA 4CLRA 3AW8A 3MS4A 3DTYA 1HFJA 5E9WA 4DQKA 4YMHA 3BWYA 3IODA 2WU3A 2H7YA 2NTVA 4PYQA 4L3VA 3BH6A 5EHNA 4DR6B 3UMMA 4RFLA 3A8TA 3MRTA 3PXEA 1WVIA 1XHFA 2E48A 3ORSA 5KI6A 1R0ZA 3RLIA 3DE7X 3BB1A 1EH5A 4KAAA 1K6JA 2PFKA 3ZHQA 1FU8A 2QENA 3GN2A 5IFLA 2IS6A 2JARA 5IAJA 1HZZC 1U5BB 2GD0A 3V2GA 5K0FA 1YFKA 4K28A 5K8CA 3QSGA 1ZGHA 3AG6A 4LF5B 5AOAA 4J8PA 2ZJAA 3WADA 1P1HA 3ZV3A 4B82A 4LJSA 4GXQA 3RSGA 2EZTA 2XNSA 1K9SA 4EHKA 3ME5A 1J0AA 1IHDA 1QHEA 1T26A 3BEDA 3NTVA 3TFOA 3OT1B 3F2IA 1YL5A 2OILA 4C3ZA 3UMRA 3E35A 1NF3A 3IT0A 2HLPA 4DWJA 5LA6A 5BORA 3R6DA 4B6SA 1ZM3A 3USES 1XN4A 3ADPA 3WRXC 4X71A 2R60A 4A27A 5HNKA 4AN0A 1RE1A 4OEHA 3ZWBA 4BLVA 1ATIA 2PTHA 3BH0A 1MJFA 3Q9SA 5ALRA 2VUUA 2XCLA 1MNQA 3HYSA 5T8KA 1JLLA 2R7LA 3OPMA 3DOJA 4MUIA 5LIRA 1BH6A 1M75A 1MJNA 2H2AA 2O0HA 5A2GA 1KDRA 4F3RA 5K0NA 4DM7A 5JS8A 3INGA 3HY6A 3SPXA 3IKLA 4G4IA 5D00A 2G8LA 5DNUA 1R8QA 4ZJZA 4GSKA 3M89A 3RUIA 1AGPA 2A2ZA 2CFSA 2Z43A 1JMKC 2AW5A 4KO3S 4QLAA 1J97A 3IERA 1SG0A 1Q0HA 2OORA 2F64A 3ETJA 4R2MA 4KPUA 1KDZA 3O0DA 1QF6A 2A7QA 5BXYA 5IEJA 2R86A 2CVHA 4M3NA 5ITZA 3EFOB 3I9FA 2COEA 4G1EB 1U2DA 3IQWA 4IIDA 4NOLA 4BO9A 3RSZA 2C54A 1MG5A 2ZIFA 2P0YA 3PC2A 4QOIA 1UAYA 2JB9A 3ZY2A 1JAIA 3GFTA 1W5AA 4KU4A 5E4FA 1GLVA 1XV5A 3ZHYA 3ZKWB 2C4TA 4HOYA 1SMKA 2CXHA 3QELB 4NENA 2WFZA 5IKXA 1JHQA 3U5ZB 3AJRA 4DDMA 1YDFA 3MXOA 3ZK9A 5JPDA 5EWMA 2DP4E 3DAYA 4CM3A 3BERA 3EDYA 3GPCA 3U4IA 4FD3A 3EC2A 4I6GA 3Q6NA 3FI9A 4PC3A 4CMJA 2VDMB 1QGED 4CODB 1G3IA 1M7HA 1CJKC 5BN5A 4M83A 4YACA 1GZ4A 2NZWA 2V7QD 2JVIA 3LLUA 3LUPA 2HRRA 2N9UA 3HSSA 1QHGA 3WGVA 2C7BA 3G79A 1TQDA 2CWWA 3K1ZA 4LI0A 4BS9A 5JZSA 2YWJA 5FL7A 4NF2A 2DECA 4FKMA 2F9MA 1QONA 4NBSA 5KYUA 2QP4A 4FFNA 2BGLA 3KEMA 3N7UA 1W25A 3G0BA 2GYYA 1VYVA 4O4IF 4MW5A 1CUBA 5KTKA 3BFVA 4XR4A 1ENPA 1CY7A 3ECSA 2G80A 1SWVA 2PYDA 4NATA 3W1EA 2DZDA 4EM6A 1B6SA 2ZOSA 3RU3A 4REQB 3JQ9C 3AP3A 4DFDA 3IAM6 3QFTA 3U9SA 3RKRA 5JH7B 1IEQA 4N6OA 2IZ6A 4DARA 1Y9ZA 3MAJA 3HVIA 3MOGA 5F7XA 4E21A 3AUKA 4FB4A 4RZ3A 1GRVA 1UAAA 3A7DA 2V8BA 2WA2A 3R1IA 3BXEA 4JBWA 5IVDA 3STYA 4CZ2A 2QL7A 3JQAA 3JRXA 3GG9A 5KYWB 4E5PA 4P93A 2NO6A 3TMYA 3UHPA 2PM8A 3FSGD 1Z4IA 3IYLW 4HRVA 3U4QA 4RL6A 3CR8A 4GGMX 3JCZA 2G9NA 4V0LA 1SBIA 5DX0A 1Y5MA 4J4HA 3X0DA 2XNJA 1U1EA 3V7WA 3EFEA 2NSHA 3A0UA 1D0IA 4HAWA 1XL0A 1RCUA 1FP6A 3I83A 5H9WA 3LTEA 1EUDB 5BW4A 2VTBA 1NVVR 2BTEA 2NT3A 1LPSA 2PPLA 3BSSA 1RHUA 4LXYA 4P98A 4PPQA 4J76A 1Y3IA 4WVFA 2EJUA 2I3DA 4K6KA 3WX0A 3ZTWA 4BFXA 4WK6A 2FPRA 2C4NA 3LCJA 8ATCA 1AHPA 4YJ2B 2R6AA 4TVOA 4JODA 3U37A 3A31A 3GEBA 3I2IA 1CSEE 1VJ5A 4BNTA 4YJ3B 2AN5A 2QV7A 5KOYA 1Q12A 2B34A 4HR7A 2VJCA 2PWYA 1T4CA 1F2TB 3VGPA 3NNDA 5DZSA 5A5DA 2OCAA 1SKQA 2PXCA 2BH9A 2QJWA 3W79A 3QLEA 1RLUA 2VYCA 3N8HA 4KVFA 4DZTA 3WLSA 1Z18A 4JWTA 4WWHA 4O3MA 5AQEA 3NUGA 2ZRKA 2WJ3A 3HU2A 1E8DA 5TGZA 5JXJA 5C7LO 1VYUA 9ABPA 3ZWPA 3KQSA 2AXNA 1AQNA 1QH0A 1QRAA 2JLQA 2JIZA 2P78A 3AEQB 3KJQA 4HWGA 4WMLA 4RHUA 4MKIA 4YCAA 4WJLA 5AW8A 2GCPA 1GFIA 2WVAA 4PX9A 4E4TA 4RMNA 5I7HA 1HDCA 3A1UA 4KJXA 4BQRA 3SQXA 1TF2A 1FP2A 4M54A 1MW8X 5FOQA 5DB4A 2AC2A 4B31A 2ZITA 1MO2A 1FVXA 4B33A 1K8ZB 1ZCZA 1JSCA 3CQ9A 3OBIA 4HB2A 5KZMB 5IM5A 1UJ4A 2W11A 2RGXA 1U02A 3EDRA 5EIHA 4IXDA 2ZIZA 2I34A 1BS2A 3LLMA 1JR3D 2DUWA 1Z7EA 3SC2B 4ZI7A 4DZRA 2DFLA 2WTUA 3N1UA 3KIPA 1MO4A 2XDAA 2JLYA 5H02A 1H9CA 2Z3VA 2NV2B 1CR2A 2XX3A 5JAQA 2CZGA 4A82A 4BQIA 2X8WA 3QU9A 4OOFA 1JYFA 3S5UA 4BNUA 5I7WA 1QJ4A 1E18A 1RBMA 4C6HA 2XUJA 2P27A 3EX7C 1QPZA 1PKEA 2P9CA 4PQEA 3RS2A 3ANTA 3BREA 2YY7A 2YZ7A 4MROA 1CY1A 1TMOA 2FF5A 3HCAA 1ESMA 4NPAA 2XTJA 4Q7JB 4RK7A 4QSHA 1E99A 2YRXA 1BRMA 3R7WB 1LDEA 5IF9A 4BVLA 3MRVA 1TM7E 2GWHA 5K0SA 3RS9A 1WA5A 4P8RA 3GUVA 4A2WA 3MHTA 4MI1A 4URFA 6NULA 5BRAA 1XCOA 4ASUD 3L49A 5EZSA 2BN4A 2ZSUA 2ACEA 4DCMA 2I6FA 4G3XA 2B1QA 5HIJA 1AJEA 1W36C 1XO1A 1Y80A 2XWSA 4JHLA 4MOWA 4ND2A 3U3DA 3KYJB 3SSAA 2PGNA 1KA9H 3MTIA 4C78A 5C5IA 5CA1A 3RIXA 3WMRA 2OPBA 4ZPJA 4YCMA 1NU6A 3RBXA 3IMGA 1FIUA 1I0IA 1XTKA 4TSFD 1P72A 2GN4A 2FMXA 4QBHA 1WS6A 1GYPA 3I4FA 4NPCA 2Z1MA 4OI4A 4UNQA 4NC9A 1RWBA 4PU0A 1XWWA 4R68A 3GLHB 4RMGA 3WAJA 1CTQA 3DLIA 4P92A 4WFJA 3RRMA 1ZK1A 3U3ZA 1C0PA 2XCTB 4CL2A 2JATA 1UXHA 3L8DA 3LPLA 2V4MA 4JA2A 3COJA 3T9CA 4QULA 1P19A 5J5AA 3WJ1A 3ZE9A 1UFQA 3PUVA 4MV5A 2LKDA 4J0GA 3VHQA 3LCUA 1PDOA 4FONA 4X95A 5H83A 4CR8A 1UL1X 2EEZA 3WLRA 1NYRA 3IALA 3WZ2A 1U8AA 2XMPA 1YQTA 4HN9A 5FBHA 3TK1A 3O73A 4GMKA 4MW9A 5G40A 1PR6A 1FFBA 2O0JA 3GZTB 3U9LA 1VGRA 3MMPA 4JLPA 3VX4A 1I8TA 2BHNA 3M6LA 1ADYA 4IVNA 1QF9A 4R9NA 5EXPA 4L0QA 1U5AA 4BP3A 1TW2A 4C7VA 1EU1A 3CKKA 1SVOA 4ZXFA 1GNLA 3QUSA 1WMFA 4WKGA 4BZPA 1DRVA 3OE7D 1HM5A 1D1SA 2YINC 3HB4X 4MYCA 3EC7A 4GP6A 3HKEA 1Q84A 2AFHB 1MT0A 3MTAA 4OUDA 3ZY4A 1LPAB 1LDNA 3VDNB 3O4IA 2VNKA 2H4YA 5D6NA 1P3JA 4GRIA 4BVJA 4PZDA 3PNOA 3SG0A 5KOJA 1Q1ZA 4M86A 1D2AA 2PMBA 1HLFA 4MP6A 3GJSA 2OVBA 3N76A 2Z2YA 4ZVRA 2YHAA 4FCTA 1NVVQ 3K6SA 2XUGA 2EP7A 4DEXA 2JJ1D 2D5BA 1V39A 3DYIA 3DE6X 5E7QA 2VS1A 1Z13A 3B3GA 3L7IA 1U98A 1J1ZA 2ZYRA 1M8GA 1SUIA 4F3KA 4LSWA 1XNJA 3CO5A 4JYZA 1A9RA 1DV1A 4DSOA 4KYTA 4KB5A 4ND7A 1QYRA 3NYIA 3CX6A 2HPHA 4HGZA 3JWIA 3I4LA 4I1SA 5KSZA 3MUOA 4W8HA 4I4TF 3SKYA 1QC5A 1E1MA 1X0VA 1A5SB 1QIIA 5DNWA 4AG3A 2CVOA 4OXYA 4UTOA 5TMEA 4UUOA 5C1DA 4US2R 5I8WA 4RVNA 4CQJA 3UUGA 1VJ0A 4UTNA 2J0UA 2PV0A 3ILHA 3GX1A 1H8ED 4DCJA 2L18A 2HBRA 3O21A 4YDRA 5EVJA 2IDMA 4TRMA 5D6OA 4XCQA 4ZARA 2YXDA 5GADl 2H4JA 5AKJA 4R2IA 4OTZA 3GFPA 5IAAA 2WM9B 1DCMA 4J0EA 5NLLA 1MPTA 2GMWA 4R1UA 1NQUA 1YR2A 4H3HB 2RMKA 4CQLA 3GFRA 3MHPA 2RKBA 3QKUA 7YASA 3HXQA 1Y5NA 3RO7A 3QY0A 5ALGA 3IUBA 4IFEA 1UOPA 2BW0A 1PV1A 3H2KA 4DHEA 4D9IA 4DB4A 5CJPA 5AKHA 1GGJA 3AVXA 5A0TA 4H0NA 4CTMA 1D1PA 2I6XA 2I2AA 3DR3A 3O8OB 1E2QA 2GK7A 3HDGA 2GEKA 3DB2A 3JTMA 1C1XA 5DTRA 2OAEA 5HS6A 3V8PA 2V6FA 1C3OA 1SCBA 3OPYB 3W90A 4WXEA 2GO7A 1V1JA 2K7ZA 1EK1A 3JWHA 3TUJC 5KOIA 1JU9A 4L74A 3NC4A 4WKPA 1R4MA 4M7PA 4YYZA 2PSJA 5LZ2A 5CTAA 4BX9A 4XWOA 1XYVA 5I9SA 2H07A 3PENA 1EVYA 5LPNA 5KPDA 4BO7A 3MTBA 2CXXA 3WGIA 2YJTD 3Q3HA 2HJWA 3WK9A 3OJEA 1NX6A 1WZIA 2FOXA 2OGWA 3HUFA 2VC2B 4BXOB 2PKCA 1EZ1A 2HDWA 2RI1A 5AKZA 5JZ9A 4UNNA 4BBPA 1FDSA 2X7JA 4MB6A 4RELA 3K70B 4FEEA 5CCDA 2IUTA 1ZBQA 1P39A 2ZUWA 4FOLA 3GB9A 4MAAA 4Q48A 4QTUB 1LPNA 4XVHA 4GVLA 3CUKA 1X7HA 3RYHA 2H5EA 5JJCA 1R00A 4IQ8A 1TQ2A 9LDBA 3Q8MA 3P9SA 1SZDA 1QR6A 1XMJA 3NASA 1CEQA 1BXZA 1BQ4A 1V7PC 4MV3A 4I99A 4TMKA 5C3UA 1K0FA 3VYRB 1G2PA 2FR0A 3CEHA 4F5EA 1K3UB 4ARZB 1NVUQ 2QI9F 1N7HA 1AN9A 1CW2B 2MOKA 3T12A 3G2KA 4WNAB 5EYPA 4GPTA 2VUHB 3TCXB 4AYTA 3PJFA 1Y8QB 1DC6A 2AX3A 3BQNB 3CW9A 3D5QA 5CFNA 4I1PA 4AP5A 3R9XA 3RYIA 4MP8A 2ADFA 1WABA 3P9ZA 3R7LA 3WICA 3IDQA 1A0OA 4IGFA 2B4QA 3PQ6A 4G5HA 3KB8A 3VNUA 2AQ8A 1RBZA 4QDOA 5G0WA 1PWHA 2FPGB 2BGNA 1QMPA 2WD7B 4J3FA 1OT5A 5AI5A 1PT8A 2NU6B 2QE7D 5ERXA 2OCIA 4NDNE 3MUNA 4G1FA 4O2AB 3EISA 3IP1A 3OETA 5K1ZA 2H51A 5BNWA 5LNK6 2Y9PB 1OXUA 5HA5A 5CG1A 1RBQA 1IULA 2NZJA 1PR1A 1GL9B 2R3SA 1V41E 4BU1A 3PGA1 3A6DA 2D5AA 4DLSA 3RQIA 1OIXA 3BL8A 3W6NA 3QTBA 2AWNA 1MENA 1RD4A 4PNEA 1RHKA 2QU8A 3O1LA 4KCGA 4ZIRA 4Z5XA 2FSGA 2Q9AA 3BBLA 4KQWA 3OTQA 3N9IA 4NV1A 3K8QA 3OE4A 4AJEA 3NAMA 5ESRA 2GYVA 1X7WA 3MJCA 1JIJA 5AOVA 2QSYA 1XU7A 3ILYA 3V9AA 1OX4B 1IK6A 4OXRA 4MQEB 1G8YA 2DPXA 1IE3A 1MP0A 4PR0A 5EJGA 4DYVA 5KYUB 2MCFA 1K98A 2ZCUA 3CPEA 5F52A 5AJTA 4D8WA 2W2QA 1YI1A 4ZN6A 1IVSA 2ZRQA 4IO1A 4KEAA 4YQZA 1GQRA 3DUFA 5JXWA 1ZVMA 2R7MA 1XI2A 1J2EA 3A4NA 4BN5A 1Z3CA 2FQYA 2JVKA 2QYSA 2V6GA 4MWDA 4UAGA 2GXAA 3R5KA 3D59A 4NFSA 4NSNA 4J0HA 1TZ2A 1SXJE 4RQUA 5FI5A 3I9V1 2JC3A 1Q0PA 1JFSA 1OXBB 2ZJ4A 2C94A 3UPTA 4MAMA 3A05A 2HSJA 4U7FA 1HUQA 3U6KA 2QS9A 2VP3A 4DNPA 1D4FA 2XY4A 3PXBA 3E1SA 3RUPA 4DWWA 1IOWA 4MQMA 4DJEC 5JT1A 3OZIA 1Z28A 1DOAA 1OBHA 1RHQA 3CKLA 3LWBA 2ODBA 4K46A 2HNBA 2EF0A 4BQPA 5CFLA 1KMIY 1MVOA 5J2TF 4YRPA 3VO2A 3EZ7A 3QQPA 3QHQA 4M55A 4R8VA 5CH8A 1IONA 3KXDA 3OQVA 5HOEA 3GNLA 1BNCA 4RQTA 4RJIA 1YHNA 2PH7A 3T1VA 4EFNA 5L53A 4UVGA 1S8NA 1FSZA 3OWOA 4NU8X 4RVGA 4F8JA 5KVVA 3ZNQA 5HCNA 5B1IA 5DU2A 4F9GA 4G1BA 1UEIA 3HWRA 4QE3A 5JYBA 2IHJA 2QLNA 4V1CB 1L5WA 4PIMA 1VG0B 2Q6VA 1KERA 5SY9A 1E0KA 4NZYA 3VBEA 5AW6A 2C9MA 4I66A 4QOSA 1XCGB 3PHIA 4S1TA 5BRNA 4C5CA 5ABPA 5JHHB 5E9JA 2XT6A 4LHZA 5IT4A 5JAZA 1PUJA 4DR5B 4HQ0A 4HYEA 5TGTA 4MW0A 3SU8A 3TVYA 2CYCA 3TDMA 3DBOB 1BDMA 1N2JA 1Q0UA 3K4HA 5TF0A 4C7MA 5K99A 4QXPA 3VSDA 1U81A 3G5LA 1RFGE 3LWNA 4PRLA 2LNDA 4MVJF 3PQFA 5DNEA 3GEEA 4CMHA 4DNFA 3E9YA 4OHVA 1KVRA 4QWMA 1KFJB 5BUSA 4I55F 2NUTB 3RYTC 5FFNA 4BC0A 3W77A 4CV3A 1XVLA 4URXR 2W6ZA 5EQDA 5I4KA 1OYOA 5SYAA 5T3UA 5J4VA 1KKUA 3E9NA 1CFJA 4S04A 5FRDA 4KHPB 3E3LA 1NP7A 2OO5C 3M8KA 2AOXA 3PIRA 4C4OA 4IYRA 1HMYA 1PT9A 4ALMA 3AFGA 3CF4A 3LSTA 2VPZA 3FFTA 2GJSA 3KZVA 3Q7TA 2GH1A 3CUWA 4TKVB 3STTA 4ALKA 1SVWA 1H42A 5EKUA 4ESHA 1YRHA 1S2OA 3EXFA 1WX1A 2H5JA 2DFDA 2W2LA 3EVGA 2WHPB 3F74A 4TZKA 4XSVA 2ZUEA 1VJ1A 1CG6A 3E58A 3INTA 4GC9A 1P0FA 1TIPA 4I4NA 3TECE 5DYNA 3W78A 3JD0A 3D43A 3KOMA 2EKZA 4P32A 4ZVSA 4BFSA 5GONA 3L92A 3LGSA 4Z2AA 5H3HA 3A6KA 2WJ6A 1QYCA 3ZCRA 3USZA 1G1AA 5BWCA 2A0FA 4WHMA 1J39A 3KTOA 1H6DA 1TVEA 1VIYA 2BEWB 4MTLA 1A8SA 1Y63A 1QRUA 3OCJA 4EB6A 2WPDA 1PGPA 1ZO8A 3A6JA 2GEFA 2WE8A 3ENVA 1MAAA 1R8SA 3H1AA 3JPWA 1T2VA 2C5HA 5FTWA 5K2OA 4Z9FA 1I14A 5FUMA 1X7GA 3DEAA 1V26A 4FGWA 3VJLA 1YS7A 5TPZD 2VP2A 5CP8A 4N6NA 4W5QA 1TJ3A 5H80A 4FGSA 1XCBA 4PONA 4F1WA 5JATA 2QUJA 2R8PA 1XAGA 3RVLA 4DUPA 1M10A 3OZTA 3RSHA 3QWBA 3I9MA 5KTPA 1WV0A 2GAIA 1JEEA 2FSVC 4BP8A 1IG0A 1M6VA 3DLAA 4MPTA 1PEKE 3WRWA 2FI1A 2PU7A 1WP4A 3H1TA 1WPXA 4TL8A 4HGYA 5E95A 3EIFA 3OCWA 1W4RA 3FVWA 4N3BA 5JJBA 4LOJA 2OR3A 1CYEA 1N9GB 3KJZA 5DYWA 1B8OA 3A2MA 2CHFA 3IRUA 5BV7A 1FS5A 3ES9A 4R3NA 4ZAWA 1XWIA 2WJJA 4PTZA 1JBKA 3M83A 4B9EA 3W3AH 4F6RA 1TRKA 2SCUA 3LT1A 4OHPA 1T1JA 3QNWA 1TM5E 2ZSKA 4MRRA 3RJMA 1CY8A 2VDPB 3FCXA 1W6RA 3LBAA 4GQIA 1BEEA 3DHYA 5MF6A 4UHKA 4TX1A 4K2AA 1F3LA 5EGSA 4BQFA 3KYDB 4EFMA 1O97C 3LPCA 2IHVA 1M5TA 3DBRA 4HL6A 4WAUA 1AQLA 1JSRA 1TF5A 1ONOA 2NU9A 3FNFA 1RHJA 1JXQA 3IAFA 2ZSJA 3PD0A 2XV1A 3QXSA 4GBMA 1Y7PA 3OG9A 2NQTA 1HYBA 4M7WA 3R7FA 3UV6A 3AEKB 5EWJA 4IRXA 4KLRA 4Z2YA 2PUHA 1DO2A 3OA0A 4IMPA 3SJAA 1KQPA 1ODSA 2ANCA 3Q7IA 5T4FA 2B1JA 2GS9A 1DKRA 1C7ZA 4JMLA 3ZKAA 1LLQA 2Z83A 2FPMA 3B82A 1JSZA 3C8MA 3CNNA 2ENUA 2RGEA 2P5YA 2Z04A 4GFDA 1FFXB 2DKNA 2JFXA 4MUNA 2P0EA 3K6RA 4E3WA 1XEAA 3O91A 3IE2A 3I34X 3RAGA 4F4JA 1Y3AA 4U3JB 3TQSA 4BWVA 3HUDA 5LQDA 3ASZA 2ZSAA 3RAFC 1PR0A 2GARA 1YB5A 1RZUA 2CXSA 2HV8A 2YR0A 4EHFA 1DT5A 4L6CA 4FWTA 3QYJA 5HKBA 3BB3A 1XKXA 3GW8A 3C6QA 1ZJ5A 1ENOA 2GZ2A 4JU8A 2HMWA 2NYAA 4EG8A 3KR2A 2JAWA 3CJTA 4ESEA 4MJLA 4QPZA 2J3JA 5L95A 2RFLA 1HQDA 3LIPA 3PLNA 2C5SA 1W96A 2ORVA 3UKOA 3UJHA 4JB3A 3FDFA 1QDLB 3QE3A 5JG7A 4LNHA 2AK2A 3I9JA 3EOZA 1BSVA 1Q77A 1WM1A 3FLAA 3TBHA 3ZU5A 2JGJA 5C7IO 1VHTA 3E4DA 2JCYA 2PD3A 3E23A 3TRKA 4NICA 2HA0A 1CHNA 3L46A 3T7IA 1SCNE 2J1LA 2ZWIA 3VOBA 4ZGBA 2OYRA 2C9DA 4ENQA 3FRIA 2GCNA 2JKYA 2QPLA 4MYTA 1A2BA 1X2BA 4H31A 2OCYC 4MV8A 3SJZA 3TL6A 1U3DA 1CETA 3ROEA 2I9PA 1OH6A 1KO1A 4B6JA 1XP8A 2I4TA 2YVAA 1O95D 3DFMA 3OZVA 5H70A 1PSWA 3UT0A 1E1CB 4AF7A 3ED5A 3L1KA 4Y9TA 5EKDA 1ZESA 1YRYE 1E9CA 3I2KA 2Y1KA 2QNIA 1SURA 2ZWVA 3IBTA 4MITA 2I4OA 4ZMSA 5JQGF 2P75A 3KU1A 1TXGA 1ZK4A 3A1VA 4Q4DA 1MFPA 2P1RA 1TGVA 2V55B 3BWMA 4MQFB 1JDNA 3ZG6A 4GKJB 3LLVA 3EG9A 1U6IA 1F2UB 1RIFA 1Q2UA 4N9QA 4YASA 4B4DA 1GV1A 5AM5A 4PZCA 2E89A 1ZY2A 3HJNA 4TLDA 4EITA 4ER3A 2ZIAA 2G4VA 2K5UA 1OYWA 4ZEMA 1F8XA 3L1JA 8MHTA 4Y2RA 1AU9A 1T35A 1E77A 1RAAA 4NY1A 1DQNA 3JARB 5FR1A 2B6NA 5JAUA 4NESA 4D8XA 4JJZA 2HK7A 1F7UA 4CCWA 4NRDA 1I7PA 4WZZA 5CVEA 3RRFA 4Y7DA 1N36B 1K5GA 1XWFA 4NULA 1QOQB 2BUCA 4FSDA 3FWYA 5L6MB 5LLTA 3WOHA 4HAOA 3M34A 2GBLC 3F97A 3EEOA 4BX0A 1N1GA 2QUZA 4I1YA 1H2XA 4YONB 3W06A 1JLRA 2ATXA 4MUHA 2XWPA 4E3ZA 4I5GA 3KQLA 2ZUSA 5IXSA 2JGEA 1E7SA 1W34A 5DBHX 1Q74A 2Z09A 4LYYA 1LVHA 3AK4A 3RG8A 1NAHA 2ZRMA 3FTPA 4U2BA 1FDVA 1XZKA 4ZQEA 1WVGA 3U60B 2CB9A 4Q9AA 1W36B 4I1RA 2J5KA 4RADA 1RJ9A 2BFBA 2QLTA 1MABA 3I01A 5IW8A 3VKWA 4MUYA 1Z5VA 5A3SA 5DNCA 2BKAA 2AF4C 2CLMB 1GLGA 4HGNA 2O8BA 5E6UB 3BAFA 1XZBA 3BMQA 4FLFA 3ZGXA 3FUTA 1CIPA 3I9NA 5ALNA 2YN2A 3O6VA 3KSBC 1GSOA 2GXUA 1J06A 2VVTA 3MWEB 3NZEA 5LQJA 2ZAIA 3M4NA 1GN8A 3HMQA 1Q6YA 1DC8A 1Z5UA 3DM9B 4ZVUA 3VPFA 4AZ3B 1XJ5A 4P3OA 4M0UA 3PU6A 2BMDA 1WXXA 3KR9A 4BFTA 4EIWA 2EBHX 2BD0A 4F4HA 1J1UA 4KXNA 1N3YA 2PUWA 3A0RB 2F8SA 2N75A 1P7PA 2HK8A 4IIEA 5BV1A 1EB8A 5LYJB 2H5LA 3D4LA 5K2MA 4UM9D 4DAEA 1Z29A 3D3QA 1Y9DA 4DLPA 2EFGA 1WW3A 2J32A 2YNMA 2HMSA 2KBFA 1YVRA 3A7EA 2ZXEA 1E61A 4BNXA 3K2EA 2OC4A 3TDNA 1EPUA 1M72A 3E3NA 2PBFA 3F6EX 4XTCS 3S27A 1J5PA 1M0TA 4K26A 5EHXA 2VTKA 3GIDA 2C4WA 3GEGA 5IC5A 3I76A 4DF3A 2V1UA 2O2HA 1XEXB 1XYYA 2TRSB 5JARA 3LKZA 3AVVA 4E1BA 3L7CA 4EPTA 3V8BA 5C52B 3L06A 3PXAA 5CPFA 1WDKA 3VZRA 3GARA 2JNWA 2R2GA 1A88A 4RY2A 1GYQA 5CTJA 2N1BA 4WVLA 1S2DA 4DDUA 4JVLA 4P83A 3WB1A 2K7FA 1Z5PA 3VR3A 3ABRB 5MN5A 3EFBA 2D54A 1BA3A 1DCKA 4PG8A 1LCIA 1KU6A 3AY6A 3FB4A 4TV9B 2IYEA 1ZSVA 3ZBUA 1NKSA 1IBLB 4G0ZA 2YWHA 2X2PA 4KGXA 3LUFA 4MUXA 1JBEA 2P7IA 1HL3A 3PYMA 5LBTA 1GPDG 4N49A 4I5FA 5ESDA 3UK7A 3V7UA 2MT9A 4KK3A 5F21A 3QW4B 4ENTA 3R5XA 1U5BA 3S70A 2WYOA 5A9TA 2OQIA 5EMMA 1OF1A 3ZNPA 4BB5A 1XZJA 2C7PA 4KQFA 2XADA 1XELA 3GUCA 1C9MA 1TF7A 4PQRA 3NETA 1FNSA 2J09A 4FYJA 3FJ1A 4G36A 2WLTA 3LQQA 1Y42X 4M0LA 4B81A 4RMIA 1V8BA 4BB9A 3GWZA 4FD2A 3BQ9A 1XQ6A 3EXG2 4WA7A 1HLPA 4PN7A 1MB0A 1UBOS 2Z2IA 2VYVA 3OT1A 3ZW8A 2B30A 3H16A 1YQGA 3LHSA 4BMYA 2PZAA 1UBKS 5KO2A 1E4OA 2YWBA 1A96A 4URVR 1ADCA 2CZCA 5K0BA 1U9IA 4LW8A 5FBLB 1E5LA 5JAMA 2JGAA 1LF0A 1NRXA 2J3MA 5JXHA 1SOWA 3LL4A 4RA9B 5SZHB 3WK4A 2O3QA 3R77A 3H1FA 2R6HA 4MGYR 3IAS6 3FVTA 1VBKA 2CNLA 4BHTA 4IV5A 4NZZA 3TVDA 4BO0A 1K6EA 1F4VA 1O94A 1KDTA 1N6NA 1PZEA 1WD7A 1XROA 2FG7C 2G0AA 3KXIA 4C4AA 2BI4A 1JMVA 1I2MA 3WIDA 1EGHA 1JXAA 2B8WA 3AB3A 3C5VA 3JZAA 3N75A 4Q9KA 5IAEA 5C8YF 5H3CA 1QFMA 1G41A 3IGFA 4L0CA 4G24A 1NW8A 3T5DA 3ZX4A 2QW8A 4WPGA 1VE5A 3L84A 1GCOA 3B3FA 1AUPA 1XHEA 4JN6B 5M5BA 1X8XA 3NI2A 4S1VA 2UUAB 1OWMA 3LH5A 2GXQA 5IANA 2GF2A 3EFOA 4E4RA 2VRCD 4FOOA 4DVJA 5DM2A 3C1UA 2XCOA 2B5VA 4F21A 4UHHA 2CNKA 2GCIA 5HOQA 4QEZA 3DOIA 4AULA 4A3SA 2ZI6A 1E6UA 2GNAA 2LDXA 2H31A 4DCVA 1WETA 5KQRA 1L2TA 1ODCA 3G02A 3LQFA 1AS3A 2B2CA 3LVBA 3GAFA 3QELA 4QBTA 3ZKWA 3AB8A 4LMAA 3GXOA 4FJ2A 3FMOB 4NFYA 3OY2A 2Z2JA 4Y3UA 1I80A 1C14A 4MZXA 2Q6KA 1GGFA 3HBAA 1D7AA 3BJRA 3MMNA 3QW2A 2I7VA 3TQTA 1ABFA 3VQTA 4EF6A 3G0IA 2OL4A 3I9OA 3JQ8B 4FSXA 4OQZA 1XAHA 2WT9A 1DRUA 4F84A 4MJXA 3RU9A 4LE0A 4MW4A 4N8DA 4S2UA 1T0UA 1A7AA 1VM6A 4V0NA 5DCUA 4HUTA 4YT8A 3AVPA 2HWXA 3L1UA 1GGEA 1FYDA 1XXHE 4JVNA 4XX0B 5FKJA 5THQA 1YI0A 1YC2A 4QQNA 2ZLBA 3DOHA 3ZJ4A 4BXOA 1FUUA 4BNLA 1I4WA 3O2SB 2QMUA 4Z9XA 4FYXA 3N53A 5ILQA 2GHRA 3EZFA 3L4BC 3LA6A 4CQMA 3OQMA 4N03A 3KJXA 1PK7A 3RK4A 2OB2A 4XEUA 1I4DD 3SS7X 5KTMA 1N8SA 2R6CA 3K96A 4DJAA 2O2DA 4JBGA 1TZCA 4O8CA 2OA0A 4AKEA 4JX9A 1EXVA 2IY8A 3EIHA 3S2ZA 3BUSA 4OKSA 2AMJA 2EXXA 3AETA 1FMCA 1MX5A 1R6BX 2R4UA 4REQA 4LY3A 3S5JA 1CERA 2BKVA 2GPNA 3HMKA 1L8AA 1I6WA 1PZFA 4WCFA 5JH7A 4JI6B 1SXHA 5L4LA 5CFRA 2J9FA 2R48A 2B8TA 7MHTA 3QHAA 1FEZA 1IB6A 4H3SA 4J03A 3SFTA 1E2PA 2C95A 2HJVA 2ZDQA 1I32A 1L7BA 1IN1A 3KT0A 3DOOA 1N2GA 4YJGB 3LHFA 3PFNA 5DM4A 2NVUB 1ILWA 3FKSD 2NN3C 1R6VA 4PC6A 1N8KA 3DCNA 1I5EA 3VMMA 4C2TA 4L8LA 2ODQA 3OZFA 4BNYA 3PC3A 2B0JA 3CB2A 2BFMA 1Z36A 4LWZA 3LX5A 4N3AA 3SXPA 5TV2A 2Q2OA 4EABA 1QYWA 1YFLA 4D4MA 2FMUA 2QW1A 3KTFA 4HQRA 1ZM4A 5IAKA 4BUJA 1IM2A 2DWQA 2GVDC 1CJBA 2PYZA 3H8WA 1EUDA 2IBTA 3KCNA 3KM0A 1Z63A 1L8QA 3MGCA 4WZAB 1Z2NX 3SWWA 3RCBA 1L5ZA 5LMCA 4DJ5X 5A4DA 2JBWA 1R10A 2Q5LA 4K6GA 4DREA 2O8EB 1T13A 4FQ5A 3K94A 4IQ0A 5L4SA 3CKMA 2C3OA 3K9NA 4FMBB 1YU9A 4DDHA 2C1ZA 3NT4A 4F91B 5A1TA 5CLJA 4YJ2A 3O03A 5G3ZA 2WUEA 1TMKA 4C7XA 4YJ3A 1TM1E 3I8XA 4C7OB 1J0XO 4JDUA 4TOIA 4XD2A 3VOSA 1ID8A 3M2PA 3RBVA 5B55A 1TB4A 1F2TA 3AH8A 1NT2A 2OTCA 2ZTSA 2BLNA 2VG8A 1IHOA 1VIDA 1TAGA 2IS4A 3HYCA 1RM4A 3R44A 1TMYA 3RD5A 4IWXA 3WB9A 3P9PA 2E4VA 3VYWA 3PFWO 3B1FA 1DKLA 1NF9A 3K73O 3ZDCA 3GVHA 5GTDA 1QHYA 1QGOA 1TYDE 2IPNA 2Q4EA 2YQ5A 3O7MA 3PT9A 4G0MA 3VA7A 3QITA 1Y98A 4WESB 2C5BA 1C8VB 4DSUA 2ZIXB 1TLFA 1PL0A 1ZG3A 3AEQA 5JECA 2QVGA 2E85A 3UK0A 4NABA 4QT4A 4Q3AA 4NARA 3M6XA 4GX2A 2BR3A 4JI7B 5C35A 1R16A 1QR2A 3IQGX 3TLBA 1I2DA 3CLKA 3KOOA 4G25A 1ZJYA 1CNMA 1AHNA 3MT8A 4PSAA 3KKOA 3UJ6A 1ZU5A 1DJLA 2X42A 1HLGA 2V5AA 4INZA 3KP1A 1D07A 3RFFA 3WSWA 2JJMA 4PRZA 3F6YA 3MQFA 1KJJA 2C77A 1E3LA 1R6AA 3H8JA 4LTDA 1X74A 3BRQA 3PNQA 1YTLA 2JAQA 4BY9E 1FLNA 1GOTA 2ID4A 1V9CA 1R8JA 3T94A 2HO4A 3K5PA 4MUFA 4PG7A 2QRLA 1ZICA 3C3YA 3M0EA 4YAFA 1RJFA 4EOGA 3OQOA 1G7CA 3TZQA 3ZWKA 2A4MA 1UK6A 1YQDA 3ETLA 4FMCB 2QF7A 1FDTA 5KJEA 2Z95A 2H2WA 4GW3A 4NP6A 3VNRA 3OFJA 5IT9A 3GPLA 2BMEA 3TQFA 3M5DA 1B6TA 2I2BA 4QTTB 1J42A 1FPMA 1AF4A 2LPMA 3A6GA 3GFBA 3N2EA 4G1VA 4PZYA 3ANYB 3R7WA 1Y33E 3DPUA 3HVKA 5DBEX 3ROMA 4XWYA 3A06A 4PYIA 4G0UA 1CP2A 1ZIPA 2WW8A 5AH0A 2D7JA 3QE0A 3UBTA 4Q21A 1A9YA 3FYUA 3H84A 4G9EA 4QBKA 3W7VA 4MRVA 2NXJA 2PJZA 2A58A 4BNDB 1B2RA 1DUVG 2FMFA 4W8OA 4ZQHA 2XSZD 1MO5A 4JI8B 4GE3A 1UKZA 4ZO6A 1H93A 1P0CA 3AUFA 3B6EA 3ETHA 2IPXA 2XGMA 4NBUA 4NU6A 4RY8A 5TC4A 2H4FA 3EY9A 3L7MA 2Y1XA 1UBEA 4ZKEA 4W1SA 2FFAA 1L1EA 1GKLA 1PVVA 4ZQCB 4NHEA 3OQHA 1J0EA 4MV9A 2Z9CA 1E7RA 1GPWB 1KJYA 1XA3A 3MYRA 4J6FA 3WYEA 1ECJA 5IARA 1OXSC 4HZUB 3HB1A 4PYNA 3P7MA 1E1YA 3TUIC 3DA8A 3T4EA 5B4UA 5AHOA 1T8UA 1EUZA 4KXWA 4EP1A 5K3FB 3RVBA 2YZKA 3I72A 3CF4G 5BWBA 5J3JA 5LP6F 4PWZA 5TDHA 2ASVA 3I1FA 3IXLA 5KJ6A 1U3UA 4ZVQA 3EYWA 1N2CB 3LDUA 1B42A 4KO8A 2NU8B 4X65B 3H2BA 3W5DA 3ZZ0A 4XWGA 4QARA 2Q2QA 1EVKA 1U99A 3RVOA 1ZW1A 4N12A 1GN9A 1TEHA 2B2XA 4OUKX 1I2ZA 3PWTA 1YAHA 2ZIEA 1DWUA 3DTTA 3OPYI 1XXLA 4EG0A 1N4AA 1G2IA 1Z5NA 4JQOA 4QDKA 4Y2UA 3TL2A 2MSLA 1W4LA 2BKXA 2QQGA 1NXOA 3UC9A 3GP3A 1I0LA 1IBCA 3ROKA 3CVOA 5AVXA 2GPSA 4GICA 1PCXA 2SKEA 2LP4Y 5E38A 4Z7QB 3U09A 5EUMA 4EQ6B 4H35A 4EZBA 2ZTUA 3PUKA 4J0JA 5CBPA 1UKVY 1JZQA 1P9OA 2PVPA 3CRVA 4IIHA 4DVGA 3QXXA 1RDFA 1A3CA 1C3LA 1GV0A 2H4HA 2HC9A 1T6NA 2DJIA 3D6UA 4IIJA 3VPSA 4PYMA 5FTLA 1MG0A 2UYCA 4S1PA 1UK8A 2QN3A 2DWCA 2AEJA 2DG2A 1BGXT 4AWBA 4ZDKA 4N82A 3LBHA 2JL1A 5BQOA 1UZUA 5KQGA 5EMHA 3DDOA 4R0MA 4D9NA 3N6VA 3RHFA 4RE6A 4JJAA 2NNWB 3NJ4A 3QWHA 3OIYA 1V1MB 2IUUA 2QPTA 2B8JA 3A27A 3EGDB 3AKDA 4AC9A 3OM9A 2GZDA 2C8VA 1ZCAA 5B3LA 4FT4A 4IP0A 1OFTA 5FULA 3H11B 3EF0A 1OZGA 3ZXIA 3NKLA 1ISFA 4A0RA 2KI5A 1KAMA 4FM9A 4TLMB 1NLMA 3H0KA 3ISTA 3STXA 3VBCA 5BQXA 3ITDA 2EFJA 3T99A 2G3YA 4EA9A 1XD9A 4Z9BA 1YDWA 3ZHRA 5LZ4A 1M1ZA 2NACA 3KZKA 1TE2A 4ZCIA 2RGCA 4EYSA 2AN4A 2ZE7A 2ZR7A 3WZMA 3OH8A 1JDTA 4D25A 3G2IA 4YJHB 2VSNA 1PWEA 1SQ5A 3L04A 3ZH9B 4ER5A 1IIRA 3EW9A 4MW7A 3MK31 1E1KA 2GPYA 4UE2A 3L8CA 1WXIA 4RF5A 4AMVA 5ES4B 5LOVB 4JT4A 3C6KA 1GTRA 4OQ4A 3DFIA 4KQKA 2WFLB 3FY4A 4A0QA 4DABA 3RIEA 2Q7DA 1V3QE 4CFSA 4UVEA 4RHYA 4CNQA 1CY2A 1QLHA 1QE0A 2E82A 4F3TA 1XRSB 4NH0A 3D02A 2RHJA 4QOFA 5KAPA 1O0SA 3G2NA 3I4CA 3O8OA 1V7CA 2RK4A 4WXMA 1FFWA 1E9FA 2ZYIA 4RW0A 4D98A 4JI4B 2Z8XA 4ESVA 2GT1A 1TJNA 3OPYA 4OXIA 4F4UA 4KDRA 3R23A 3F46A 1NIJA 4QTZA 3WNCA 2QUHA 5G0TA 4BCCA 4G0VA 2X0KA 4B8ZA 4KAJA 4P3KA 1SUDA 1W44A 4IDBA 5E3JA 4D46A 1DEXA 4J16C 1FRNA 1JGTA 3IELA 2HN9A 3RUHA 3SEZA 5JYEA 3DS8A 4IHKA 1Z2PX 1RRFA 1QVZA 2AMVA 1GILA 2FZGA 1NMYA 2LDBA 1DWQA 1BHJA 3B6IA 2PNJA 3WL3A 1ESCA 2CT8A 4JLSA 1J33A 2B3TA 1GFZA 2ONCA 2F8LA 4G4GA 4OB8A 5EQFA 1IWBB 4L4XA 4BJ1A 5GJVC 2QE6A 1JHPA 2RDMA 5C8XA 3GGPA 1XYGA 2PUVA 3QE4A 3I5AA 3URKA 2WVJA 1KY5A 3GGCA 2ZUTA 3NFRA 3ZCPA 4IDPA 1NMSA 3EQ2A 5HUHA 1JI3A 2UVDA 3U4CA 1FK8A 1ZONA 4PPNA 4V03A 1XPJA 2YS7A 3AUTA 4JP2A 5EOVA 1JT9A 1YHZA 1GXSA 2XVYA 4ARZA 1V7ZA 2D2EA 1A71A 4ARAA 3X1JA 4CCSA 4V1CI 4GLLA 5JPIA 1PUXA 1PJ3A 4LY0A 2DBQA 3PEUA 4MR9B 4UXJA 1P1BA 2W2MA 4L1KA 2B61A 4EUKA 2CHUA 2PV7A 3RS3A 1EX7A 5CVJA 5HJ2A 2MINA 3KAJA 3LW8A 4CN9A 3RWBA 2D3TA 4OJKA 2Q6IA 2PIAA 3W3AD 1OVGA 4TLCA 1NUAA 2IYYA 2YMLA 4NECA 5GOTA 3ZUGA 1P45A 4D3SA 5FFFA 1Y8AA 3EF1A 1H2BA 5H81A 4BWGA 1MC8A 2OM6A 2NU6A 3G59A 4PSDA 2QTFA 3JASB 4QGBA 2ZB3A 4KSYA 5KWVA 1RRCA 3DKRA 2LCQA 4J0QA 1M73E 4OJMX 5HM6A 4HDRB 4LXTA 4REOA 3ZGYA 2UKDA 2OENG 4XGRA 1HOXA 1UM8A 1WBJB 2YIJA 4HTFB 1QWOA 4BAUA 1VKOA 3DVAB 3VC1A 2IUSA 2OO3A 2UYOA 1V48A 2G4LA 3PNSA 3TQHA 3KFLA 1VE3A 4H15A 2GILA 4KGVA 5JFOA 1OUMA 1TFUA 4R1OA 1XNHA 1VI5A 2ZQYA 3FGZA 3I6YA 2L42A 3TOVA 1XNRB 4ROTA 1ZYUA 2HQOA 5TEWA 5E4TA 4I5IA 5KB3A 4HLUA 1Z6AA 1ARZA 3HV2A 2W6MA 3CRW1 3NGMA 4MQEA 3T7SA 3D7KA 1SUWA 1ZN2A 3HR8A 1H8HA 5EERA 2MYUA 2PRIA 2QTLA 1XTZA 1PYOA 4G8CA 1P2BA 3EOAI 2P9ZA 2FSFA 1PD0A 1T0BA 2ZWAA 4MUMA 1TCCA 2IP2A 4WEQA 3JTEA 4IVPA 3KSZO 5DT9A 1AMOA 4TYPA 1IJEA 4YP1A 4N18A 2YY6A 3PWSA 3H2GA 3IB3A 1MAVA 2Z4TA 2V0GA 3MVEA 4Z6KA 4UHFA 2REXB 5A3RA 4POAA 3CZMA 2Y0BA 1L7OA 4ML3A 4FMPA 4CJXA 4ZD6A 3AF4A 1YMQA 3H4MA 3KQQA 4BB0A 1W581 3M6MD 5P8WA 3TEFA 1U3VA 5FEMA 1HDOA 1R3UA 4FNGA 1FXUA 1NVMB 4XJSA 1I01A 2JIPA 4EYOA 2ZJFA 2BFAA 2Y1LA 4B3DA 3GJTA 2P7HA 1C3VA 4MARA 2Q9BA 5EEHA 3N2NA 3JRNA 4EJSB 1VBMA 2HA2A 4HWPA 2AEMA 4J49A 3IP5A 4Q15A 3T0FA 4EK9A 4X44A 3UXYA 3HXPA 4A6EA 1N3BA 2DBVO 2DKOA 3TX2A 5ESXA 4MUKA 1ONNA 4DYHA 4V1CA 4D4GA 3PFGA 4RSMA 1W1IA 1F9AA 2WUGA 3IURA 1W5EA 4I2NA 4MVYA 4WKNA 3TR5A 4ZOQI 5JEEA 3PD7A 4B3CA 4ZCMA 1Z08A 1JA1A 2VSQA 1SOAA 2BZ0A 2AXQA 3A3KA 5WRFA 2KHZA 5IASA 4RZ2A 4P80A 4PGFA 1SCJA 3LL7A 2IS1A 4RHEA 5DVZA 1JEOA 5EE9A 2Y1DA 4MV7A 1N0HA 3KLMX 3P2EA 5DEOA 3SZMA 4KIUA 1PS0A 1AS2A 1FXWF 2E4WA 3U1TA 4CMEA 3KQWA 1XPOA 3IEXA 3GUZA 5KOHA 3ETCA 1DBQA 4FOTA 4EZIA 1T9GR 3G6WA 3A25A 4GMFA 2C3MA 1MA0A 4J90A 2NUTA 5KSWB 5SZIA 3W9BA 2QTBA 3AF6A 3F67A 1PS9A 5DKFA 4AY5A 3DV0B 3O1IC 3RUCA 6YASA 1AGRA 1E3JA 3PEVA 4G5OA 1D9XA 4N5MA 1CUAA 3FTQA 3MTGA 4OXNA 3WRXA 1XZIA 4QQRA 2GVNA 2BKUA 1TCVA 2HMAA 3IMCA 4DMUB 2XTNA 1DT3A 1NFFA 3KEFA 1P2VA 4PSCA 1ICIA 4TKVA 5J1SB 1JQAA 1U28C 3HA3A 1OW3B 3E8XA 3F5QA 5EHZA 5TS2A 3B9RA 4PG5A 3UFXB 4U9HS 4QDZA 3WFZA 2PMWB 3THSA 3DMHA 1OSNA 3TFWA 2RONA 3QA9A 4P4NA 3EF3A 4X1OA 4ZCLA 3E61A 4EY4A 5JXIA 3GT0A 1FVFA 4GP9A 5B1DA 1LNSA 1EX6A 1QWSA 2IEIA 1NW5A 4H0FA 4OHCA 3VZQA 3FCCA 3ZCQA 1UBHS 1TPZA 4EVSA 2QX7A 4ND8B 3TTXA 4RLHA 3VHRA 3UV7A 2WMDA 4PFKA 3IIEA 2H1HA 3B2QA 1ZXBA 2AG8A 2EHJA 4MRPA 1RLJA 3KJGA 1NN5A 4AJ9A 2I71A 3F6RA 3WLIA 2HRCA 1TW3A 1Y8CA 3H9QA 4LDNA 1YNSA 3LZ6A 3TH5A 1J2UA 2VKQA 5L3VA 2ZJZA 2MYNA 3QVTA 5SV2A 1J49A 2G83A 4IS3A 4RENA 5C32A 1E20A 2WIFA 2OV2A 4OSEA 4KOAA 1GRQA 3PNMA 4QOGA 3VAZA 2X22A 5EE3A 4MEJA 3AIKA 3IHWA 3NBZC 1ZJWA 4NYIR 2HAEA 4BRZA 2WTXA 4M8NE 3MGBA 3CC8A 4MKZA 4N3GA 2HRDA 1Y6JA 1NRJB 2R5WA 2B99A 3RJTA 3WFIA 3MINB 4BEBA 3X3HA 5C46F 2VBCA 2ZRBA 3OLCX 3ID6C 4QSMA 3ZXUB 2X2EA 4ZMBA 3ZN2A 5HXAA 4EMBA 3M1AA 6PFKA 3QXJA 1X1RA 3QEKA 3DF9A 3HLTA 3L8HA 3P0IA 5EZYF 5CDFA 2R751 3P94A 1VMIA 3VVLA 1X1BA 1OD6A 2WKPA 3NHUA 5LDDC 3VUFA 1MFZA 4RPGA 1UANA 1PDWA 1R0BA 1IYZA 3GNTA 1M5UA 1L4GA 3R7SA 4KYIB 3LU1A 2DQZA 2V74B 2CMHA 3VU1A 5L3QB 3JQ6A 2YMQA 3PC7A 5AVRA 1PZHA 4PTLA 4FBLA 3RVNA 3TXXA 2A5FA 4ZVPA 3W5BA 2Q99A 4TUYF 3TKYA 1KK3A 2NQ8A 3BFKA 1KMQA 1GAEO 3GNSA 2JFFA 3PEWA 4DR2B 4IAOA 1XMVA 3AEKA 3M2TA 3RS8A 3OQIB 2J7KA 1Y82A 3FMVA 4S1WA 4JAVC 3RYFB 1P17A 4HEA1 2CMGA 2VNAA 3I5UA 4O4IA 5LWHA 1P8AA 3H5AA 5IJXA 1NMEA 2IPOA 2DF8A 4JLJA 3VX3A 3PC4A 4IIYA 4K6OA 1GNSA 2CLFB 4YCNA 5IAOA 1EYZA 1X38A 2O0LA 1LBEA 1CUGA 1E9VA 1P1CA 3F9IA 4IUYA 3W1VA 2ATVA 1P7YA 3LV8A 4HAIA 5DSZA 1U2GA 4AF6A 5JADA 3HCNA 2Z2ZA 1NQAO 5EUBA 5FBWB 3DV2A 2W7TA 3Q3JB 2JI8A 4U3JA 1AZWA 1RT9A 2XMBA 4JYBA 4PBSA 2DWUA 4GD3Q 4HDOB 2VYQA 1WBDA 4FE3A 5LQRA 3MRXA 2QG9A 1BQ3A 5CHYA 2VP5A 1ZEJA 4A2PA 2G28A 5K7SA 1MUUA 1WUIS 1ZX1A 1SPBS 2PGIA 3TQOA 2WU1A 3EZNA 4YT4A 3O75A 1XMOB 2M32A 3HBNA 5SZKB 2RGYA 2XUKA 1MEEA 1H69A 3BMOA 1E9AA 3BSYA 3H0EA 3KUDA 4G2NA 4H4EA 4IMIB 4M8IA 4IO0A 4NG4A 5T67A 1CRZA 4D0SA 3RAPR 1CQJB 2XD9A 1DWPA 4Y0NA 3QP9A 4Y6SA 1FVHA 1NZJA 2J9XB 3ILVA 2G04A 3PQ4A 1I3NA 3KBBA 1E3SA 821PA 5HR5A 4HK4A 3QGMA 4JVSB 5BW8A 2WJGA 3PXGA 5JASA 2RG1A 1LY1A 1TA0A 3EBOA 3KJNA 2WTMA 4ITRC 2Y92A 1YCGA 4RY9A 3RSQA 2QG4A 4Z4IA 2YL2A 1NV9A 4YS6A 1MQ9A 1P29A 4LNAA 2P2SA 1VLJA 3PFFA 3LCRA 1E1CA 2JIQA 1PJTA 1U8XX 1E2LA 2O1SA 4TKUB 2ZT6A 4TLAA 4FI3C 1GPAA 4WXHA 1T9HA 2EQBA 2GN2A 3G85A 4FEGA 4KXVA 4EDHA 2DPLA 1N8TA 2WSMA 1SQGA 1SC3A 1S7CA 4M0MA 4R1SA 1F2UA 3OFNA 1T5DX 5JDIC 2GN9A 5JR3A 3KPJA 3LMKA 1RKXA 3JWGA 3K05A 4FN5A 4MXDA 4OHMA 1W52X 4LYHA 4XW2A 1PDVA 2CMDA 2PZEA 4CIWA 3UO8B 2OB1A 3JARA 2CJPA 4LZOA 2C2OA 2HA5A 2RH8A 4L76A 2FSHA 4JOSA 4AWXA 2ZDGA 1CQPA 4Q4HA 3R7DA 3C6MA 3LOPA 4IZOA 3UWMA 1B41A 4AZ0B 2Q3HA 2V0NA 2XMQA 4YNBA 1AXRA 1WUJS 3DTVB 3OESA 1P73A 1QZUA 3DEIA 3DNPA 4OK5A 1NOIA 1KR5A 4L8WB 4G65A 3U7GA 4N41A 2RHRA 4XAQA 1EFRD 4RGBA 2G8NA 4P38A 3LO8A 1JE0A 2QN6A 1KFCB 2YWDA 2XTAA 4RCVA 3G23A 5FWDA 3GQBA 1M34B 3MWYW 1QRTA 3CRNA 5DTQA 1E60A 2IHBA 3V2IA 2YRFA 3N2IA 4OXXA 2PMDA 2FPKA 4HFMA 4RY0A 5KVSA 5DHSA 1JT2A 4RYDA 3TTSA 4H7PA 4QUKA 5ITVA 3NG1A 3ANXA 1QH9A 1QU3A 1YUMA 4X8LA 4WFIA 4AKSA 2BHLA 1TC1A 5F7ZA 5K4HA 4M0DA 4Y1RB 4ZPXA 3MB8A 3VJKA 4BATA 4RIHA 4NYIQ 4AJOA 1Y4DE 3K16A 1GTG1 2I2FA 1L5VA 1XZEA 1GZUA 2EKQA 3HBLA 3PFCA 4F2GA 3NX4A 3N2KB 5E6UA 5BVHB 3RV4A 2WQZA 4DCCA 3ZNNA 1I1HA 4L5AA 1E8MA 1H94A 4RJLA 1MJGM 2OK8A 2XHEA 3MWEA 3TNJA 1DQPA 3DHNA 4Z1OA 3SQWA 2IEBA 2G1UA 2OQVA 1DTSA 1T4MA 2ZRIA 1SU8A 4MQ5A 3PTZA 3CVYA 4AZ3A 3L05A 3QKRA 4PYOA 3UJ3X 4L7VA 4ZC8A 3OURA 1M2HA 2BDUA 4K9MA 2MYTA 1US8B 3V42A 4QU5A 2KWIA 2QIPA 3GMTA 2NZYA 3REGA 4KN8A 2FUEA 5LYJA 2DFKB 1LBQA 1M2JA 1RJWA 1Z8NA 2VH2A 3JWJA 4PZZA 5F3DA 5GGXA 3VFDA 4TLBA 2XKJE 2Q5HA 2Z1NA 3KALA 4P3PA 5I5EA 3PF9A 1BKDR 3SOZA 1E79A 4H6XA 5AJZA 5ENZA 3DBVO 3QVJA 3UMBA 1E0AA 3M6FA 2Q45A 4E33A 4L9AA 5LR6A 4RD0A 1VPDA 3AR7A 3GZJA 3VDXA 3Q4GA 4Q37A 4WY2A 1YZQA 2XUFA 4LBVA 1YASA 4IH9A 4RJ2A 2B0CA 1U2PA 3ZWVA 4ES6A 2IYWA 8AT1A 3KPVA 1MTZA 3DOCA 5BMOA 3BQMB 1WPGA 3QEAZ 2EDCA 3JQQA 1B0UA 3LJKA 2TSYB 2ZYAA 2ZUVA 4TMVA 1VBFA 5TMDA 5FAKA 3IPYA 3PKZA 1YA4A 3FPCA 4ZGGA 2VXYA 4KQEA 4L4YA 1EWYA 3AQ4A 1L7VC 1Y7LA 3RH0A 3NHJA 2YXEA 4YUWA 1D6MA 3TE7A 1BFKA 1DAHA 3A6EA 1FZQA 1RP1A 2WF8A 2YDYA 3GUYA 4I50B 4JWKA 1O57A 4LGCA 4LOAA 2NXCA 3QKWA 1OIVA 2DHQA 4K9QA 3OKFA 3D8SA 5T64A 1EVQA 1FC0A 1FSPA 1SD1A 3IOBA 1PJCA 3HZOA 4R2XA 1XZDA 4V39A 3RWOA 5BUZA 4DV2B 3PXUA 1RWMA 3IS3A 2IQIA 4Y6QA 5CMLA 4EDFA 8LDHA 3OF5A 1VRCA 2XTZA 5ALZA 5EKTA 5LBIA 5L3SB 2H8GA 3HUUA 4PQGA 2HREA 4D79A 2WFAA 1G8FA 1BFUA 5DLPA 2O7RA 5EQJB 2IT1A 2OD7A 4P2GA 5AVOA 2AKEA 3HHEA 2V6MA 3T5MA 3GR6A 3HN6A 4OSOA 2H0AA 3OD1A 4LJ4A 4EI7A 2OZEA 1RKBA 2R84A 3LPMA 1J09A 5K4AA 3SHFA 3HGMA 1ZZEA 1Y4UA 4Z99A 2W48A 3IVGA 4QTXA 1RKQA 1WXGA 3N8IA 2PKQO 4EHLA 4UZFA 4LWQA 4URYR 2GLUA 1NVKA 2ZZMA 1XPRA 3I42A 3OF3A 4CR6A 4DNOA 3GN1A 1JVSA 3R6WA 3TSWA 3RTGA 2Q3LA 3WQRA 4DY4A 4EPWA 3FM9A 1UBTS 1T9KA 2R6ZA 3HWSA 1XKTA 1M83A 5GJBA 5EAIA 4B80A 1FDUA 3QVGA 3P96A 3O26A 4YHHB 4DM4A 4C0WA 2FCRA 1M3SA 4JNKA 1G63A 4I4TA 3B2NA 3H5IA 4ZOLB 4Q3CA 5CPBA 1R37A 3JQPA 1GKUB 1DPGA 4JLNA 2X0EA 2CC2A 1NW3A 2Y2UA 3GP5A 5CYGA 1IK4A 3LXRA 3O4FA 1Z5ZA 1QP4A 3L01A 2NVWA 2R62A 4FKZA 4R8RA 3BK2A 4DSNA 1SA0B 1B43A 1DAOA 3IAM1 3N6XA 3KXLA 2QN2A 3KD2A 4AXBA 1XGKA 3CYFA 3JX9A 2YN0A 1G5PA 2IKQA 3E9ZA 2YFKA 3BRCA 1Q1EA 2ROQA 5CEJA 4I5DA 1AURA 4DGSA 4LMRA 4CKZA 2F1IA 2WKSA 1YD7A 5EXDA 3UHFA 3KHKA 3WRVA 3IUMA 1XCMA 1Z0FA 2AQIA 3LT2A 1S8FA 2QD3A 4AN1A 4L85A 2EJBA 5FXMA 3WIBA 1BQEA 4Z7OB 2B8EA 3D2LA 1UH5A 3JR7A 4PGAA 1ZVVA 3T9AA 2VZ9A 1VL8A 4JL8A 1JSXA 2XTMA 2YMMA 3BXOA 5HFAA 3SF8B 5AVKA 5KC8A 1KSFX 3QSYA 4LSZA 1A5AB 2ZRCA 3L82B 3ZWWA 3S68A 1M7BA 3HP4A 4TT8A 1XPUA 3SR4A 2B94A 2VZEA 3BZBA 1XZHA 3JQ8A 1ZITA 4Z4HA 4BKMA 5KPJA 3QFFA 1QQ6A 3EVBA 1IN7A 1WF6A 3IOMA 4X3CA 2NADA 2YJ6A 4K81B 3TW4A 2HJ9A 4ZQIA 5ISMA 4GI3A 4W7SA 3BFJA 3C1OA 4TT3A 1RWNA 1G5IA 3QMVA 5LKRA 3K9FC 1J9ZA 3QOWA 4NPHA 4TTPA 3AZOA 1ZI8A 2QJRA 4JL6A 2M6LA 2NU7B 2WJAA 4E46A 3UMYA 3ASVA 4NQRA 4KPYA 4RTPA 1Z2DA 2FQXA 4QIHA 1KEEB 4UHCA 3GGDA 3FLEA 1WSDA 1ZD2P 2ZRJA 1M7GA 1QS0B 4KIGA 3TI7A 1M2NA 3WGNA 4EPVA 1NG9A 2CKDA 4GMXA 7ABPA 5LQSA 3PJDA 4AS1A 4FS8A 3RAEC 4UNIA 4YGXB 5CW2A 5BSHA 2QSJA 3LXXA 4FR0A 4MW2A 4Z3OA 1L5FA 2VF7A 2WNHA 5JMPA 4UBMA 3N0WA 3TOXA 3D7LA 1U1GA 1G7RA 1TCUA 1IATA 2BBSA 3T7JA 3UH0A 4ACAA 1VPLA 2J6IA 521PA 2PH3A 3SNKA 3D8RA 1KWGA 4YJGA 2X58A 2WMYA 5GVSA 1W94A 2NVUA 3DE3X 3K4QA 4E15A 4WH0A 3MCUA 2A9RA 2FFBA 4PZUA 2ZI7A 2PU5A 3CNOA 2O14A 2AIRA 2E18A 4M0EA 3ROQA 5K3CA 1NASA 5TT1A 2FW1A 3W6ZA 3E9CA 3JR3A 3NS7A 2DJ5A 2BGTA 4CMGA 1ECFA 5C3MA 4LAFA 4NR0A 4UMEA 4YXWA 3G82C 2QUIA 4ABYA 5C5DA 4KQCA 4X45A 3SDZA 4D4JA 2P62A 3GZNA 2Q5QA 3PDJA 2V96A 4JP3A 4PLPA 5D5QA 1ITZA 3N5CA 5FWYA 1GZ3A 1P9NA 4B44A 2JLCA 5BNIA 4LQLA 2BFDB 1C1HA 1H2RS 2DBZA 4JQCA 2O8EA 3DOEA 2CN1A 3KE9A 5IJWA 3VC7A 1Z37A 3TRDA 4GMDA 5HHTA 2FFJA 7GPBA 3CXUA 1KJIA 1V8FA 3TJRA 2DTXA 2Q6OA 1QDEA 1SUCA 4WZ6A 3LUAA 5DNAA 5EKXA 4B46A 3FD8A 3UPDA 2CJFA 4JLMA 1ID1A 4M0KA 4OHXA 3V1LA 4E31A 5EJ4A 4C7OA 3JD1A 3E8MA 2OD9A 2YWGA 1R74A 2CW5A 4TM7A 4P54A 4IJVA 3AR4A 5IMBA 3V9PA 5FD8A 3U16A 2OWEA 3N8DA 3HA2A 2RD2A 3OEYA 1S01A 3AG5A 1K8RA 1P0QA 2WZQA 4N76A 3RC3A 1E7QA 3ELWA 5U1PA 3ZE0B 3QBJA 1N2BA 2NVOA 2HWYA 2Y1GA 3F1LA 3GAAA 1SK9A 4IKEA 4FNAA 4ND4A 3D3WA 3U2QA 1F8YA 3WLLA 4M2LA 2OHVA 2JBAB 3BHMA 4XIYA 1WXDA 2QTTA 3KKKA 4P7KA 2B78A 4WESA 1Y5LA 5KU7A 2XLCA 1SCUB 4MNTA 3VTZA 2ZIXA 3K20A 1IXZA 1J07A 2I0FA 2EZ8A 3KFXA 5ED0A 2C88A 3B53X 3W2FA 1S8OA 2E5FA 2X4IA 3HBMA 2EKBA 2DUNA 4UUNA 4YWHA 3L5KA 1K97A 2NSLA 3KKPA 2G07A 3LC0A 4E5DA 4C2BA 4M1ZA 4BX3A 2GEDA 3AF0A 4Y2YA 1SFRA 4J94A 2C2BA 2AE2A 3PZRA 4YRIA 3AU8A 3MPUA 1AC5A 3PR3A 3SVZA 2DH5A 2PGJA 3OAAD 2O6HA 4GOOD 2GK3A 4KI7A 4BV3A 2DB3A 4PAQA 3KWFA 5B3KA 3AINA 1OU4A 1E7YA 1AUQA 1XUOA 2JCSA 4KAFA 3WDLA 3WFJA 4IDQA 4ZTZB 2RHOA 4AVYA 2P4SA 3DW1X 1I4OA 3D4IA 2FKAA 3IT3A 5GMOA 3EMVA 1A5BB 5A4IS 4WNYA 4IFIA 2WIGA 5FPKA 5LA6F 1SXJC 1YE3A 4NJMB 1E96A 2C5GA 4HNVA 5K3AA 4Q82A 2V3WA 3T5PA 4MDFA 3C41J 2DBYA 2OUIA 4F12A 5CDGA 2FRXA 4MVJA 3TCNA 4HV4A 1XKQA 1QP7A 2QXUA 1RYYA 2HLNA 3DM5A 4FCCA 2OV8A 4QDUA 5KINB 5HW0A 5LUAA 5E7JA 4C3VA 1P5HA 1MH1A 4MS4B 3CRQA 3ESAA 3CEJA 1N6OA 3KQYA 2QPOA 3QM1A 5FWAA 2XOXA 2IY9A 3MMSA 3FI0A 1GPH1 4R2KA 2IW3A 1EKXA 1L5HA 1BOFA 1C80A 3O4HA 4L78A 1Y81A 2D7DA 1NY6A 2A30A 2D2FA 2VNJA 2Z08A 1Y5IA 4QGSA 4ZCRA 4QUAA 5DM70 3FCOA 4JLWA 2IODA 2WJYA 2FG5A 4GKKB 1ZNWA 1PFKA 3T41A 3BE8A 3DLTA 1VA5A 1FX1A 2AA3A 3GOHA 2PEZA 4D3ZA 2FOLA 3D8UA 5EVCA 1GGVA 5I8PA 4HZUA 1P80A 3AM5A 2AZTA 1ETUA 1HDGO 2IIQA 1VDMA 4JLAA 3VNAA 2VLIA 5GM2A 5TMPA 3R40A 1CB7A 5FI1B 4GWKA 4JYCA 4LVNA 1LLCA 2WSLA 3ABZA 5K3FA 5JO0A 2BM9A 3T4XA 9MHTA 4Q4JA 2Y1OA 4W1RA 3FHTA 3AFMA 2NU8A 2BI8A 3RRBA 3E9RA 5HQTA 2P9QA 3BS4A 1AGNA 3CNHA 1X7ZB 3I5YA 3C3WA 1U8CB 1MEJA 2G63A 4GDMA 4CCYB 4P81A 4DPKA 2OZLB 3AEUB 1WU7A 1X7YB 3QLUA 3TSZA 1EA7A 1DIGA 4A4DA 2YWEA 1ZGJA 2PR7A