2XYGA

Caspase-3:cas329306
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xygA00
3V4LA 1CVRA 4JJEA 2C2MA 3H1PA 2WDPA 3DEIA 4HVAA 1RWVA 4NOMA 4QUEA 4ZVTA 3S8EA 2QL5A 4FEAA 2CJXA 4ZVQA 3GJSA 5IAGA 2HBZA 4JJ7A 3UO8B 4NOJA 5IBPA 1NMSA 1SC3A 3DEHA 3DEKA 2CNOA 4JJ8A 1RWOA 2CNLA 4JR1A 1ICEA 1RHKA 2C2KA 3EDQA 4JQYA 1BMQA 4HQRA 4QU8A 1RWMA 3V6MA 2AR9A 2C2OA 4DCPA 3E4CA 3ITNA 4EHDA 3GJQA 5IAJA 5I9BA 3V4OA 4NOKA 3GJRA 5IBCA 2H51A 4I1PA 1NW9B 4ZVPA 3H0EA 3P45A 1K88A 2J31A 2C1EA 1QTNA 5IBRA 3R7BA 4EHKA 4JQZA 3PD1A 3R6LA 3R7SA 4M9RA 3R6GA 2QLFA 3K7EA 1RWKA 1RHMA 4ZVOA 5LU8A 1SC4A 2H65A 3QNWA 4QUHA 1RE1A 4NBLA 3RJMA 1F1JA 4N6NA 1F9EA 1RWXA 3R5KA 3NKFA 3EDRA 4PRZA 5LU9A 4EHAA 2CDRA 4JR0A 4JB8A 4N6GA 3V55A 4N5DA 4D3XA 2XYHA 4IYRA 2HBQA 2Y1LA 3PCXA 3UOAB 4EJFA 2K7ZA 5IASA 2XZDA 1NMEA 4QUDA 1PAUA 4FGUA 5IABA 3GJTA 4QUBA 2FQQA 4D3YA 1SHJA 1KMCA 1PYOA 2HBRA 3IBFA 3NR2A 4N6OA 4NBNA 4QU0A 1GFWA 1RHJA 4NBKA 1I3OA 3IBCA 5IAKA 4PRYA 1K86A 2J32A 3V6LA 1I4OA 2H4YA 2H5IA 4N7JA 4I1RA 4N7MA 2H4WA 4PS0A 1RWNA 4QU5A 2QL9A 4DCJA 3V3KA 5H0IA 4QUJA 2CNKA 2J30A 3SIRA 3H11B 4EHNA 3H13A 2QL7A 3NS7A 3R5JA 3D6MA 1RHRA 4IEFB 4ZVUA 3SIPA 5IANA 4HQ0A 4FDLA 4QUGA 2J33A 4JR2A 5LUBA 1NMQA 4AWBA 4D3ZA 4QTYA 2XYGA 1RWPA 2FUNB 1SC1A 4QULA 2H5JA 1I51A 4EHFA 3KJNA 3PD0A 4LSZA 5IARA 1JXQA 5JFTA 2QLJA 1M72A 4FXOA 3KJFA 4AW9A 1I4EB 1QDUA 2XZTA 4ZVSA 1IBCA 3D6FA 3OD5A 5IC6A 2QLBA 4EHLA 2H48A 2CJYA 1RHUA 2Y0BA 2C2ZA 2XYPA 3BIJA 5IC4A 3P4UA 2NN3C 3S70A 5I9TA 4PS1A 4NOLA 4QUIA 3R7NA 1GQFA 4QTXA 4AWAA 1RWWA 2DKOA 4ZVRA 2P2CA 1RHQA 1QX3A 2CNNA 3KJQA 2H54A 3DEJA 5IAEA 4DCOA 2FP3A 4QU9A 1SHLA 2HBYA 3H11A 3D6HA 4QUAA 5LUAA 5K20A 1CP3A 4EHHA
chains in the Genus database with same CATH superfamily
4GO1A 2HDWA 3IFSA 2VHYA 3MT7A 3EX7C 2JCXA 3FLBA 4JJEA 4UDXX 4HVAA 4E5MA 2V0CA 1KYXA 3H5IA 3ZVNA 3VZPA 4EG5A 1RP1A 1Q0PA 2OENG 3EGDB 4JCCA 4MKRA 3G89A 4XM0A 1MB3A 1F8FA 1TKBA 1X1AA 1J06A 3R44A 3VPXA 2HHHB 2QKYA 4F04A 2VOEA 5E6RB 1NRWA 2HMYB 3IULA 3AKDA 4EUEA 2FRDA 1YCDA 3WYCA 1SWVA 5AXAA 3HO6A 2WKSA 1H4VB 5TV2A 5CHYA 1L7QA 5FI3A 2PRZA 5JE8A 4BXOB 2JBAB 3UV6A 3TIGA 5DYYA 2W6ZA 5EJEA 4ZODA 4BNMA 3F6BX 5H81A 4DLBA 1KWKA 4JU8A 4QEKA 1Y33E 1DUIA 3E5HA 1ZM7A 4F9GA 1Z0KA 3FSGD 5CUQA 1TQ4A 1N9GB 3FVWA 3L6EA 1K3FA 3PKJA 4GSKA 5KSYA 4PCUA 1Y6FA 4K05A 4UARA 4TLEA 2GM4A 1WSAA 3INYA 1TIBA 4GNKA 4M1OA 4NCJA 5BMVA 1J9EA 5LOVF 1IAVA 4E1BA 5AK0A 1M8GA 1I4LD 2IU6A 1UPTA 3IC5A 3OLZA 4B6EA 5CYGA 3TLCA 2O57A 3NTRA 2YDYA 3VSEA 4WERA 2WFZA 1LI4A 2ZQZA 2C82A 4FJ0A 3JU3A 4FEGA 2C77A 3BWCA 2QRQA 1WU8A 1DXHA 1RT9A 1BU5A 3PIDA 4OO3A 1QZTA 3C14C 4BPRA 3MB5A 4P4SB 2MU1A 1QZXA 4IZOA 4ND5A 3DT8A 3MTBA 1Y9DA 2IOFA 3Q7IA 1V3VA 5ALSA 4AO6A 1B3RA 3EZ2A 5A2GA 2J6HA 2M6KA 2E87A 2WYIA 1Z83A 3MCZA 4JA0A 2VWPA 2CNWD 5KIAA 4JC4A 3I3OA 1LSUA 3ASYA 1NBIA 1BA2A 3GRFA 3QLVC 4FFWA 5CFOA 5KNCD 1QG4A 4OQZA 1I2CA 4DCMA 1PJ2A 5F76A 4M0MA 4CKCA 4HATA 2FW6A 3BWEA 2IE0A 1XCLA 1MRNA 2O7NA 3IERA 3Q9LA 1ZO8A 4I5DA 2RGDA 4M46A 5BOVA 5B1EA 3FKSA 2QZJA 2WM9B 4LHEA 3DDHA 2B0JA 1AHHA 1PYDA 5ALLA 1NUTA 4JLKA 2VJPA 4EHLA 2NU6A 5JCOA 1QH8A 5LZ4A 4P1ZA 4FXPA 4B8YA 1TXGA 2DFKB 2Y1EA 4C4SA 4C5AA 4P0PB 2DC1A 3SMVA 4HNAA 3RC9A 3AT1A 2JFWA 1DINA 2I1LA 2BGTA 2QQEA 4XR9A 1EFHA 2C5HA 3IP8A 3PFNA 3TW8B 3VDNB 1ZVVA 1YU9A 3K9WA 4W99A 4YJHB 4I55B 5F9HA 3IUSA 3M33A 3P0RA 1E89A 4HVLA 3V4LA 2VJCA 4ITVA 1TPZA 1ISPA 3IOBA 5AVTA 3GF4A 4YAKA 2CNWA 2NOAA 4PGFA 4C20A 1P9OA 2R6AA 3HMQA 3RUDA 5KNCA 3S8EA 1LNQA 2EHDA 4H0FA 4Q82A 4Z4EA 2VDMB 3HABA 1XTIA 4M0UA 3BULA 3UO8B 2BUCA 2JFZA 2BFCA 2IITA 4RUKA 3JTMA 2I7TA 3PSAA 4U6SA 3G7SA 1XHLA 2I22A 2I54A 3UUEA 4LQDA 4XX1A 2LNDA 1OCEA 3WADA 1OIVA 5CDYA 4DSOA 3N70A 4G8CA 1Z6XA 2ADOA 1IN4A 4G01B 4J75A 3KKOA 2WIDA 1DEAA 4U5XA 4YMIA 5T4EA 2B2CA 1VLJA 2AI1A 1N5IA 1UBMS 1P5HA 1QQ6A 1Y7TA 4CMEC 4G1CA 1MEOA 1PF7E 1XLTC 4YAFA 2IPLA 2J9ZB 3WJ7A 1Z5UA 5IBRA 2IZ0A 2ZPAA 3THSA 2GBPA 3CUWA 2GBLC 4PPNA 4RBNA 2FE1A 3ZNOA 1Z7YA 2JAXA 4BRUA 2WHPB 5L9AA 5JDIA 3WB0A 4PNHA 4TKVB 4BNTA 2GK7A 5ED0A 5LJIA 2FHPA 4N39A 4QQFA 4EGAA 5CXXA 4ENPA 2L18A 1RQPA 3KVOA 5J5CA 4GRDA 2UZ4A 1OGJA 3DE1X 1FFSA 4CFSA 2D8AA 4IDAA 3I62A 3RG2A 4KUGA 4LZAA 1H4TA 4S1VA 2B4YA 4QEZA 3AI3A 4XGQA 3ZY2A 4A36A 2VTVA 3R5FA 5DN6D 2QYHA 3G17A 4OQLA 3TQFA 5I47A 4GQAA 4AMYA 5F98A 2F7SA 2I7VA 5F1PA 4YRMA 2X8AA 1FLVA 3AY0A 2B5WA 3GL9A 2AC2A 1EEXB 2W7TA 2G0AA 2X1MA 3HZZA 3L8GA 4V0LA 5IXYA 1OV6A 5ABPA 1SIUA 1LRLA 2QD5A 4NC9A 1OKKD 2GRUA 1KK1A 3R77A 2VF2A 3L7IA 4HYQA 5IVKA 4OI0A 2YUTA 3BQMB 1H2XA 2GF0A 3OA2A 4FDAA 5DHSA 3SHOA 4L28A 2VT6A 2HU8A 3C7DB 1O87A 4X95A 3EXFA 1Q11A 3D2BA 1MDBA 1Y48E 4P4NA 4F8JA 1JH9A 3O94A 3FKJA 4ZU1X 4NEGA 5FJIA 3WGOA 2QYTA 3CQ9A 3PRHA 3RWBA 1EIWA 1GPNA 3Q15C 3X1DA 4B3IA 2X5NA 3HI4A 4EBFA 1IZ7A 3VVBA 3STXA 2YW9A 3OKPA 4L15A 1DJMA 5FL3A 1PDOA 1GL3A 1XEAA 2I78A 3U7EB 3WSTA 4IDBA 3FYUC 4DANA 3OE7A 3T3EA 3HDQA 2PGIA 4MV4A 3BC1A 1EKXA 3DE3X 1KZGB 1UOEA 3B3FA 2Y71A 3DOCA 4D8UA 4N5NA 4LISA 4WEOA 4B6OA 1DAGA 3D2AA 2FSUA 3WGKA 4NBWA 1X3SA 1MT3A 2OD7A 3OECA 2P5UA 5DBIA 5EE9A 2SNIE 1OKKA 2QRLA 4KMMA 2FJUA 3SS8A 2IRWA 4KI0A 5H80A 3TR6A 3EASA 4XQGA 1NT2A 5DT9A 5AP9A 2YIMA 2DLNA 5J4HA 2WDPA 3CRQA 1G2OA 1KEVA 4JQSA 1C0LA 3O82A 1LLDA 4DPKA 4O2BA 1NVWQ 2FFAA 4Q02A 1QQBA 4BVHA 6REQB 1Z6GA 1AKNA 3C2QA 3FPSA 5LD2C 1L7EA 1XKXA 2FUEA 3DAHA 1DUVG 3NFRA 1FX1A 4KWTA 4LSGA 3SFTA 4R0NA 4ND3A 4TZKA 2FUCA 5AK6A 1OXVA 2BLLA 5DCLA 1X77A 1Z33A 3PEEA 4NBVA 4AJ9A 3FMIA 3QBJA 3PV0A 3F4LA 2YJ5A 4NH0A 4A2QA 2XY4A 1XZIA 4Y2RA 4YUYA 3II6X 3BH7A 1XVIA 5TT0A 3DZHA 3KZOA 4LKOA 2XMZA 1PNTA 2IYUA 3VTAA 1IHYA 2QS9A 1XEXA 4PQYA 2G88A 1JXAA 1PJ8A 1SGWA 1XWIA 4GM4A 4HRAA 3HG7A 1GPWB 4RF3A 3PD1A 2ILVA 4WT7A 3FN4A 1ELOA 2J0UB 2OFOA 3R6GA 3QVVA 3FI0A 3L82B 1XZ8A 4WIAA 4J1QA 4QGSA 1M33A 4WZBE 5B1IA 1O6CA 2C42A 1AA9A 4KIGA 4IDPA 4F84A 3DAPA 3EDRA 4QXQA 1ZAYA 2JZOA 3PFWO 4X6XA 5J47A 4URZR 2XSZA 5E8JA 1KI4A 3MBKA 3ZJ4A 4YJ3A 2ISSD 2I6GA 3BUSA 3R6DA 4G8BA 4RPHA 1TGYA 2R96A 2V96A 1RBZA 4H6XA 1T5DX 2IEYA 4IXWA 4MA5A 4I5FA 4DYDA 2KMLA 1OLSA 1MV5A 3ZHRA 4INZA 3F8WA 1M2HA 2AXNA 4EUFA 3MSXA 4JKIA 3LX6A 5FOXA 3LCMA 1L4LA 1YRWA 4CDNA 4TYQA 1WP9A 3TRJA 3OO0A 3ZK9A 1JWBB 5ES4B 4TYWA 1LUAA 1NV8A 5IPFA 1XDDA 1L5WA 2CDAA 1R4MA 1NLUA 2ATEA 5BV0A 2C5FA 4XOUA 3RO7A 3WLLA 3EBLA 3ZQJA 1SXJE 3P2YA 4FFMA 4M3NA 4RU1A 1ANKA 3BB1A 2XMQA 5DV9A 5GY7A 1TO6A 2ZRNA 3PR2B 4P58A 4O63O 5L51A 3HACA 1OV4A 2WFAA 1X9GA 4DCVA 4CKCB 5CLHA 1UWLA 4TTSA 2OQVA 1GFZA 4QBGB 1PG2A 2FRXA 2HXSA 3LSYA 2D4HA 3MRXA 3OIYA 1E64A 1JPUA 4MA0A 4RLHA 3LHSA 3ZU4A 4OK6A 2PA0A 2IODA 2UDPA 3JQ7B 4TMXA 3IRUA 2F1JA 5FULA 5JDCC 5SZHB 7MDHA 4KLCA 3ZDCA 3DAYA 1JV2B 4XM2A 4B2PA 3KSZO 5FNVB 1J9GA 3LDAA 4ZCQA 2GPYA 2R8BA 3LK7A 4UQOA 3ZD7A 3K09C 1Z07A 3MWDA 5ADUS 4KGXA 1WCV1 2P69A 2R86A 4KPGA 4YP5A 3JAWA 4NYMQ 1ZLXA 5I9TA 1A7JA 1MHPA 3DS8A 4UREA 5TMPA 2AMVA 2NGRA 3A3PA 5H9VA 1YDEA 5C8VA 5K8UA 1U1EA 2IK8A 3DAFA 3FIJA 4ALKA 1SRQA 4U7GA 5BSUA 2PS1A 3VTKA 1II9A 5ALEA 3RTAA 2QE7D 2YXBA 1UT5A 1IMOA 3H11A 3QTLA 4UHBA 5EG5A 3U3JA 5AK5A 2ZIXA 1QDLB 4G8JA 5I7VA 5J2UB 4ENWA 1W7AA 1WHSA 2B36A 2GCOB 5FKJA 3VYRB 4YX9A 4Q37A 4QUEA 4LUCA 1V5IA 4FEEA 4J03A 1B6SA 1QS0A 2VDOB 4QHSA 3W9UA 4C7JA 1OU4A 4GOXA 1RM0A 1T4CA 1ZL0A 3RVSA 4A6PA 4PSDA 1JU9A 1ZKMA 1K06A 3F3SA 3OQ6A 3VC3A 4MHOA 3EG5A 3HYCA 2DQSA 3B1KA 3DKIA 3IAS1 4P7KA 2OWEA 2C3OA 4RTOA 3A6DA 4FFRA 3K20A 4O4HB 8ATCA 2YJNA 1NQXA 4HLUC 3OWXA 5KYWA 1K2WA 1WAMA 1D9ZA 3VU8A 3LY5A 3MGKA 3QE3A 2BTEA 4INJA 4K8OA 3V42A 3GFTA 2WVAA 1PS8A 2LCQA 1CE8A 4AY5A 2WINI 1J99A 4ZEXA 1OIWA 3BRCA 7AT1A 3A9UA 3UPUA 5EFOA 1CZOA 3KVYA 3U60B 1BH2A 2PT7A 4FHCA 3BRWD 1TF5A 4Q24A 4TUYB 4QT0A 5DBEX 4DE5A 3SS9X 2AQ8A 1F51E 4LXGA 5BPHA 3QJ5A 3M4JA 4LE2A 2A33A 4B8WA 2I6SA 4FFVA 5ALZA 4C4YA 4QBHA 1W52X 2QE7A 2AVNA 2ZI7A 1R6XA 1JEQA 5B3JA 4UNIA 2BTOA 5BSWA 2ZT5A 3N9IA 1RYDA 4NBLA 4OAPA 5J4KA 2OR3A 2ZZMA 4TROA 3L1UA 1KSJA 4A7PA 3PFIA 3WMXA 1IL0A 2G09A 2ZE5A 4OI2A 4D3FA 1SCUB 3PCXA 4UUPA 4YJGB 2GSWA 2X7JA 4E21A 4YYZA 1XU4A 2BFPA 2JIDA 4IIDA 3ZYCA 2VF5X 3AGPA 1BD4A 4H15A 4H4DA 1LTQA 2FQQA 1GSAA 3C3WA 3ISJA 1UEIA 3VZRA 4X5OA 2GZMA 4PZDA 4IOLA 1N92A 3PWKA 4ARBA 1CJUC 1EP9A 3LHIA 4O02B 2GAJA 4NENA 4JS0A 1FFBA 5IAKA 2YV5A 2P6NA 1PBTA 2X3YA 2EAUA 1BSVA 4K40A 3SC6A 5A4FS 3OX1A 2WMDA 4O1MA 4U7WA 5LQMA 3SXUA 1SXQA 4QU5A 1OBCA 1AZWA 3AUYA 3NPMA 1JS1X 2ZSHA 1ZJYA 4D74A 1NKVA 3FWZA 5FQOA 3QKIA 1OYOA 4EVSA 1OXKB 2H17A 4HFNA 4QT4A 5DHRA 2OFWA 3VOSA 4TXJA 1M0EA 1W5SA 5K0LA 4E88A 3OETA 1PR0A 2PEYA 5FYQA 3L7BA 1IEWA 3TQOA 4A5SA 6ADHA 1QHIA 4KI7A 3U7IA 4F3CA 4DDVA 2Q6OA 4F3KA 3HCPA 1ONBA 4S35A 5DSTA 3EPRA 4NFLA 4D3DA 1N0UA 1GR0A 1NV9A 2PWPA 3FMVA 2PVSA 3WO1A 4F3YA 5CXQA 1QQAA 2F6RA 3FMFA 1YDWA 1QVWA 4GKAA 2BP7A 2HLHA 2VSXA 3MELA 1B26A 1E5XA 2FPLA 3DNFA 4HQOA 1NA5A 3HNPA 3B9RA 3P4UA 4H1TA 4NAUA 5FBLB 4JITA 3RRZA 1DZIA 5JQGB 5CDSA 3ADBA 3E3LA 4L4ZA 4AKSA 4EA9A 2LDBA 1SPXA 3JR3A 3FDIA 4G25A 2X0JA 1FSFA 3TTXA 4Z7NB 3F96A 5IJ9B 1KO5A 5F7OA 4UEKA 2RARA 4WNAA 5DYWA 2WHYA 5JVDB 2VG8A 4RV4A 1J09A 2G71A 2CLLB 1IXSB 1NF9A 2WQ7A 5LUAA 1T3SA 1TVKB 2XDQB 4ZHQF 1OFTA 3ZR4B 1ZGJA 3B78A 3DQZA 3BZBA 4AKGA 5D01A 1GFIA 3LDGA 1P9RA 3CNBA 1AKRA 1L2TA 4DBLC 3IP3A 2BCEA 5CVUA 1E6MA 1HKHA 1UMDB 2H63A 1AQYA 1I01A 3O1HB 4I0WB 3R74A 1I2DA 5D84A 2D1RA 3B7WA 1NI3A 5BN5A 1RYMA 3SGLA 1LLCA 5BXQC 4Q00A 1W36B 5AO9A 3CIOA 3KT6A 4KN8A 2R44A 4KXVA 1R16A 4NG5A 3WICA 3JY6A 4MV1A 2J3LA 1E0JA 3DBRB 4GUDA 3SSAA 3NGMA 4KQJA 4I50F 4F2HA 3NGLA 5JEDA 4BO8A 3TR0A 2P75A 4AY4A 3MWYW 2Z6AA 2FY8A 3DZCA 3H2HA 4BMXA 1V6SA 3P26A 1CRWG 2IOFK 4WESA 4CIAA 1NR5A 5ALWA 3UUWA 3DQQA 3M1YA 4P82A 3D3WB 3L6CA 4RHUA 1U0LA 1US8B 4WQMA 2D8MA 3TRIA 1NWCA 5DGCA 3AHIA 3GLQA 3CUVA 1PWZA 1S4QA 2WG1A 2ZT8A 5JADA 3KJGA 4MVJF 5B4TA 5HCIA 3RS8A 4LQLA 5I8ZA 4D5GA 4P7FA 3R9WA 2R751 3MAAC 3D9QX 5KZMB 1M1YA 1AZLA 1D6SA 1CUUA 2W2PA 4EOGA 2BL4A 2YZ2A 4MQFA 2J7KA 1K6XA 2WWRA 3PENA 4IOKA 4F72A 4OHMA 2CYAA 3H2BA 5BV2P 4PAMA 4LE0A 1WVMA 1GRNA 3ESQA 3VVCA 1GRQA 1QUFA 1XAJA 3FMOB 4JELA 1A8UA 5G1PA 4C4XA 4C7BA 4FE4A 4YR7A 3MOGA 3EVGA 2C0CA 3CLUD 1DB3A 1CRPA 4PSUA 1K4MA 2P35A 3H9GA 1I3OA 3W2GA 3NHLA 1JQLB 1K86A 4ZI2A 3GRVA 2Q1UA 1T4GA 1KDTA 4MMYB 3JVUA 4FZVA 1QU2A 3GDGA 2HMUA 4IP0A 5BWNA 1Q91A 2HHJA 3AEZA 4HD8A 1EP1B 2AJCA 2DWQA 4YB8A 1E92A 1ZU4A 3BMXA 4EYOA 2XVAA 3AINA 3B1XA 4GP6A 2V0GA 4TX1A 3GFOA 5FWAA 5E9AA 1EK1A 4LY9A 2BEVA 2MYNA 2IIQA 4LDZA 5M2QA 5J1SB 2F3PA 2BR4A 4I1OA 4MWOA 3LA6A 3VO8A 4N3GA 1XUOA 3GUHA 3AJRA 3QOWA 1I3LA 3EA0A 4A8HA 1OBOA 2DFLA 2PH3A 2Q4DA 1M74A 1FK8A 1G5PA 2AW3A 2Q4BA 1FVFA 4DYVA 3FGPA 3DFZA 2WUGA 3U48A 4L57A 3TZBA 2PSEA 2EW8A 3EPJA 4OLHA 3L79A 1W6RA 4IVPA 1T0JB 1N0IA 2QUBA 1XYYA 2DX7A 2SKEA 2QQGA 3E1SA 1O7JA 3QE4A 4YALA 1HFKA 1BFUA 5CX4A 3L93A 9MHTA 1QV7A 4KZPA 1C7FA 2IL1A 1PX2A 3GFPA 4Q3DA 3RYFA 3X44A 4ALIA 4Y9RA 4D0LB 4D4GA 1YDMA 4G4SO 5C1OA 4BGEA 3VNRA 1UJ6A 3MD0A 3KSDO 4RVOA 5AW6A 1V37A 1YZUA 4WX2B 4JEHA 1M54A 3P4YA 1YZQA 4DV3B 5CW2A 1CJVC 3WHLA 3ZY6A 1P31A 2P3QA 4LDPA 3TEMA 1CXZA 1JEAA 3W9BA 3AJAA 2X0FA 1D09A 1FDOA 4KUHA 3KUCA 4H7FA 4Z1OA 1ZJWA 2NG1A 1YU6A 1OYYA 4HGNA 4URHA 2OO5A 1GPYA 1YIDA 1EDDA 1I8TA 1UDBA 2I6UA 1FU8A 3VQTA 2W6JD 2YNMD 1D0VA 3B36A 3D43A 3IVXA 2WZQA 3PHJA 3QPUA 4NJEA 1P0MA 1YJ8A 4IDNA 1I7DA 1YIOA 4CN9A 3ORYA 2IDKA 1ICEA 2A8YA 4WLFA 3ZWNA 1A04A 2W71A 3LUCA 4G0ZA 4IJ5A 5GMOA 3RGWS 4PN3A 1NJFA 4EJSA 3NFYA 3PQDA 5AVYA 5KNBD 2YFYA 1WCXA 4FFBB 3WNDA 5A9SB 5C1BA 4JP2A 5A71A 4HNTA 3K4QA 1E1LA 1WZIA 3IEUA 4CMKA 3THYB 3RTGA 2GM9A 2QEQA 3KOMA 3RAGA 3TOCA 5ESWA 1NDQA 5JMOA 3ZWYA 2CGEA 3Q8MA 3KZMA 1MRSA 4F6RA 2UUPA 4TS4A 1Y63A 3I37X 3K7EA 3OICA 1JLRA 4JAVC 1T6NA 1B8NA 1FFXB 1XD8A 2H5LA 3BTSA 4JMLA 4BFYA 2IBSA 1T3HA 5GPBA 4XVCA 1B0AA 3ENZA 5J1TB 4E5NA 4OQDA 3C85A 4QFDA 1IEQA 1JP7A 4LY0A 1RYEA 3T6KA 1N8NA 4PX3A 4N6GA 4Y6GB 2J3KA 3R5XA 3T7CA 2R1VA 4NDAA 4C4RA 4AVYA 3GT0A 1JHYA 1G8AA 2HRDA 3V8MA 1CZKA 4YQYA 1MT0A 4MZDA 3RTDA 3BSYA 3E7PA 5A6SA 1C7JA 5EESA 3ZN2A 3B20A 1ZAKA 3OCJA 4WZ6A 2EFDB 2FPMA 4EGJA 1M0SA 1NU8A 3CU5A 4JI2B 3O8OA 4HI0E 1Q7RA 1WB6A 2BKEA 3GRAA 3R9IA 2FMKA 2R00C 3KEOA 2O0HA 4DCJA 2C2XA 3CY6A 3M6UA 3I2FA 5H0IA 1G291 2W2VA 2PX0A 1TTHA 3E5RA 3A0UA 1VJGA 1U2SA 1YR3A 1JSLA 3NQ41 3FTDA 3O5AA 4B3HA 2O48X 1RPTA 2GXSA 1PWHA 1JJBA 5CDGA 5BSFA 2B5VA 5L3RA 3QI7A 2Z2KA 2OKGA 5E0KB 3QOFA 4EKIA 2A5JA 4QJ3A 1BCRB 1C9KA 3H6HA 3SS7X 4OHBA 1G3IA 2IUSA 4AU1A 3BFKA 4WN9B 2BMVA 1E5DA 2VWQA 3KR1A 2CJFA 4AKHA 5G0SA 2WJ6A 1MKYA 3SQNA 4EKNB 3LFTA 1VZ2A 3O90A 5FI1B 3DEAA 1GKKA 1Y82A 3PQEA 2PL9A 4YASA 1H2WA 5J5AA 5AW8A 2XTNA 3QGMA 3V4ZA 3VU9A 1IUKA 4IGAA 3RAEC 3MMXA 1ZSNA 2FN3A 1QJCA 3B1YA 4WEQA 1P73A 3I39X 2VTEA 4XIFA 3DMTC 3R09A 4U39A 5HJ2A 3DW3X 1Z9BA 1BE0A 1FMCA 3ANSA 5FR1A 1RYYA 3QE9Y 3LBFA 4A8JC 5C8ZA 1WPRA 1ZLYA 3B9QA 1AUPA 3D6HA 4TS3A 2P0YA 3ZLBA 3DULA 1B8UA 1CC1S 1N1EA 4JYAB 4ZO9A 3JWHA 2OB1A 4H4CA 2O7RA 5DTIA 1CVRA 4ID3A 3SJBA 4DDMA 1JHAA 4LHZA 3C5VA 5J2TB 5EKTA 1FNNA 1I3NA 4D4IA 3OEHD 1A50B 3MCTA 4FEAA 1GILA 5HBRA 4ZFNA 3GJSA 4CCSA 2V7QD 3NJRA 3BGVA 4G5SA 4KMOA 2C0PA 5DWVA 4P3KA 1ZOIA 4BP3A 4NYIR 4JJAA 2EVWX 2NM0A 3TVYA 1E2IA 4HY3A 1WABA 4RHEA 3H04A 1CP2A 5DM4A 3U7QA 2I9PA 2XCUA 2ZRGA 2A0KA 5FA5A 3ADKA 4H17A 2IW1A 5DX8A 2JI6A 5EZ5A 4A23A 2XNDA 1MH1A 3L5KA 1ZONA 2GTIA 2NU6B 3GEPA 1QH8B 2WMYA 5LPNA 2FFRA 1GDTA 5F5NA 1CUIA 4NV0A 4A92A 1OZHA 4QOGA 5ILOA 3GD7A 1MJ5A 3GK3A 3NTXA 4EHKA 1K5PA 2Y68A 2ZB7A 3OBIA 4KQ6A 1MZVA 1GU0A 2PHZA 3IDSA 4M6WB 4OVKA 3NJ4A 4ENVA 1UIMA 4FDUA 2Z95A 4C6RA 1KRWA 2X0EA 4BYGA 4PLZA 4MUNA 3PJGA 2YRWA 1G20A 1FL9A 4EFLA 4JSYA 1QP8A 3NKFA 4HR7A 2X0NA 3KSBC 2YC2C 1GPDG 5E3IA 3OZBA 4UMFA 3RSFA 3OEHA 3S5UA 4AN4A 3QFTA 2B3TA 2EYUA 1Q7TA 4UNNA 2G4CA 4MV9A 3HDHA 2CVQA 4CT0A 4RKRA 3SEZA 8ADHA 1CWUA 1QIGA 3I45A 3L8DA 3T99A 4WCFC 4AY6A 1W48A 2BFCB 1SVIA 3MGBA 3C5CA 5ESRA 3AVUA 4EY6A 4C0QC 3H18A 1N3YA 1SBYA 1MC1A 1WTCA 1XRQA 1C1DA 1TTQB 3DA8A 3H84A 1BOFA 2POQX 3OJXA 4K87A 2ETVA 4QODA 3MS2A 4KQ1A 1TKRA 3RC2A 3C1UA 5EMJA 1N0HA 3QTTA 2QVLA 3VU0A 1QPBA 3EARA 3QLUC 5H1YA 3L8FA 4DA6A 2H8KA 2PJDA 1V41E 1XK6A 1NHGA 3WE7A 4FR2A 4BRSA 2E6UX 1UCFA 2EZUA 1YAJA 2LKDA 4IIJA 5LYJF 2QRUA 2XCTB 2YTZA 5KC8A 2AKEA 2R97A 1MGOA 4KTTE 4TYNA 3AW8A 4GE3A 4CV0A 4OGFA 4I8DA 5SY6A 3WHKA 1AZTA 1QTQA 2HV9A 4QECA 1YGYA 2BM1A 2ZAOA 4P93A 1NW7A 3OQIA 3RRFA 3M49A 1KP3A 3HYRA 2Y6VA 1N5MA 3C87A 2VJMA 5TF4A 5LNK6 3L7DA 3DVSX 3MUFA 4JODA 1UDCA 1TM4E 1WW2A 3O1IC 4MWGA 2VZ8A 4O4JF 1JTFA 5E2AA 2VDUE 4B34A 4I66A 2C9MA 1XRMA 4FLFA 3HU3A 1YB2A 3B1JA 4ZZIA 1MC4A 2BFBA 5HHTA 3GLIE 3ZBQA 4ZYYA 3AVYA 3BWXA 3K0KA 1K98A 1ODKA 2V4UA 3OQBA 4U2FA 1KZHA 1N2XA 3AHEA 1VJCA 1W47A 1Z0DA 5IKOA 1VL2A 5B3AA 3HUTA 3K1YA 3ZD9A 2Q27A 2AWOA 1MQAA 4WJKB 1OA0A 1RIFA 3C16C 1Y4ZA 4MS4A 1IOVA 4GEKA 2IS4A 3UANA 2C7QA 1YQQA 2VRCD 2X5OA 3H9BA 4JJZA 4KQEA 2HIAA 4D80A 1ACLA 1VLLA 3MWGA 3FHLA 4LYDA 1SG0A 2DT8A 5IJWA 4Y8VA 1MTOA 1Z4KA 3A37A 3CEPB 1YK0A 1QYIA 3KKZA 3PR3A 4CR8A 4E70A 2OFFA 1K8XB 2JAQA 1L5LA 3WWYA 3FNIA 5L3QB 2JATA 2ZR9A 1DO8A 1Y3DE 2JC3A 4COKA 4M7OA 1Y6QA 4BE7B 4RSGA 3RS7A 5GVSA 4GT1A 4OX9Y 1DI0A 1DG9A 3CH6A 1EZ4A 3KB2A 4HWGA 1VCHA 5THQA 4BJ5A 1M66A 1ZWLA 2GDJA 3N0TA 4RWEA 1JEDA 1OZAA 5FTMA 4F4UA 3V4OA 1DSSG 4KN5A 1DXOA 4YECA 3ECCA 4FX2A 3L7YA 4KQIA 5EJ6A 2VRNA 4XWTA 1PCXA 4F2GA 2R8ZA 4LAFA 2WG2A 3DL7A 1TJ3A 1G5HA 1HTBA 1LDMA 2BOVA 2GESA 2GBFA 5GINE 1IQPA 1IDOA 1FCJA 4IM7A 1EP3B 1P62B 1TJ5A 3GMSA 4BNKA 5AKXA 3ELDA 5JY6A 4GC5A 3KG2A 1BKSB 5FPTA 5FUVA 3ICPA 3Q3EA 5JSYA 2C2HA 5ALRA 4POOA 2E85A 3KQHA 3AP3A 2BKAA 3HCFA 4IPTA 5FFMA 4EKEA 2W6MA 3LT4A 3QF7A 1AA6A 5B3KA 4ETMA 3LZ6A 2EG5A 1E58A 2IUFA 5CFZA 4FKMA 3TB6A 5JOQA 2O54A 4C9BA 5KSPA 4C07A 2QLMA 2XQGA 4OBEA 1RAIA 2RHRA 1OLXA 3PCRB 4HDQB 5JNSA 1CUDA 4HBGA 5DM1A 5LDDC 2FUKA 3VDXA 5BYBA 3NHSA 1PVVA 4UJ5A 1FNBA 2AB0A 3H99A 4HLCA 5FOSA 3UT6A 4QBKA 5D5PA 3ZGVA 4DADA 1QTIA 1TLLA 2JFXA 4LJRA 1B23P 3U40A 4BY9E 4AF7A 2RD2A 1JQ5A 1YBMA 1YB6A 2PTHA 2KBFA 1V1MA 2X1LA 1B6TA 1FZQA 1L7DA 1JKFA 1XEXB 1Z4NA 4NE9A 4DBLE 2HUNA 1S3GA 3S81A 2GN1A 3W2FA 1NW5A 2W42A 2CVOA 2O4UX 2B2NA 2PQ2A 4X6LA 1YZYA 2B8JA 2FWRA 3EEYA 4NL4H 5BSEA 1EUYA 3BE4A 1N6KA 3GI1A 3DP7A 3T7TA 2F17A 2MYTA 5BMVF 2QROA 2Z98A 3PQ8A 2HQSA 3LC7O 1ZD9A 4BNJA 2GWRA 1OX5A 2Q3CA 1HDCA 1NXTA 3WL5A 5HIKA 4N4AA 2XYPA 1CRQA 2FSSA 2JL1A 1U6KA 2YX1A 2ZW9A 4IV8A 5KYVA 4ARUA 4JLBA 3I9JA 4PS1A 5IKEA 5HQ3B 1QP0A 1GQFA 5DNWA 5HDQA 4MVJP 4R1LA 4HAYA 2Y9MB 2X40A 1GGVA 1UP4A 3E9MA 3IKLA 3OQVA 3VH3A 3ZGYA 3TKYA 1L5HA 2ZRLA 3HMKA 1GRRA 1F3OA 3GFQA 4QBIA 5DYTA 1JHQA 3WG9A 5DHAA 1R4MB 4XZ3A 2N9UA 1ZM2A 2INGX 1ZJ5A 1FNSA 2Z1DA 1XNHA 3COVA 4X1IA 5ELXA 4QPNA 3QUQA 1XYGA 1NPTO 2UZ3A 3GUUA 2X8WA 2XCQA 1F2UA 3LCVB 4FOLA 2P9TA 4BCBA 4AT1A 5AUQA 1QFSA 3ORFA 3S7ZA 1EDOA 4ZQIA 3OX3A 3TXXA 4ZIRA 5ELMA 2RCYA 2TMGA 4Z9BA 3H9JA 3USES 4CKBA 5BSKA 3QU9A 2EZ4A 3OHSX 2WLTA 4Y6OA 4KE7A 4NMWA 3LY8A 3L01A 4ESOA 2NT4A 1XPUA 1RHKA 1CB0A 4ER6A 3WIVA 1TCAA 1NZFA 2AX3A 2CHEA 3SHWA 3TE6A 1SVLA 1KDYA 4BMYA 4DQUA 2D6FA 4CI0B 4RIHA 3RBVA 1F0YA 1Z4MA 3FNGA 4JBLA 4DUGD 1KIAA 4L5CA 2IXBA 2H51A 2FW7A 4IX1A 1R8XA 4UE2A 5KVCA 3OOWA 4KBFA 1JA1A 5CP8A 3MPOA 1XRNA 1SUWA 4QICA 3CZAA 1REQA 1UK9A 1VSVA 5AVXA 3MPUA 1IBRA 4CV3A 1FDTA 1WOYA 1J2TA 2FG5A 2FFJA 2QRPA 3DLPX 3LYAA 2COEA 3M2TA 4CM3A 3JAMA 1U04A 4EI7A 1I3CA 5BN3A 4UNPA 2FFBA 4DFDA 5GONA 2XB4A 3WTCA 1V8DA 2PE5A 3DV0A 1ZVMA 2V58A 4KQFA 2H2AA 2D5LA 2XCRB 3U9SA 2NSHA 3IQGX 1QS0B 2AUTA 2BEUB 2PUWA 2IV2X 3TK1A 2VHVA 4PV7A 3V1MA 1T4CB 2FPIA 3IODA 2ZRMA 3W8FA 3COJA 4I5EA 5IABA 4EPRA 3OOYA 5GJCA 5B6JA 5CFMA 1SHJA 4GGMX 2J48A 4JJ6A 1XRRA 3ROZA 4A6DA 3R0JA 4HCJA 1AS3A 4G3XA 3W2TA 2WOJA 3EXHB 3H3XA 4H1WA 3DE4X 4NK5A 3HKBB 5KYWB 5TQVA 2A5LA 2JKVA 3GT7A 4P38A 4TLCA 4TWJA 1N7JA 2GUGA 1CE8B 3N3BC 4OHRA 1AUVA 4ZO8A 5LP6A 1B1AA 1X7DA 3AVOA 1JJ7A 5AJVB 3LBHA 4LPKA 5ER6A 1XEFA 3B8EA 2XWJI 3HR7A 3DOUA 4XIIA 4W1SA 3T0GA 5JS8A 4GYWA 4QOEA 4KR9A 1P2GA 2Z3VA 3SDZA 2CC2A 2N75A 2EKPA 3KQQA 2QLJA 1EFTA 4FLMA 3ZGXA 4A2CA 1DAIA 1GJRA 2NUAA 3C6BA 3OPYI 1P77A 1P4RA 2CF6A 1SUBA 4ZDJA 1NY5A 2VDWA 2XJ4A 1Z26A 3EGVA 4UZEA 3AHJA 2ZYGA 5IK2D 1HNXB 2NX2A 3QVJA 5M3BA 1V3QE 2AT1A 5EOVA 4ENSA 1RKUA 2B83A 4G9GA 3U09A 3QE2A 2X1VA 1UH5A 3Q40A 4Z8YA 4KWCA 3FOEC 5J23A 2PWZA 3FROA 5E7JA 1U8FO 2OESA 2X2PA 3AM3A 3ESRA 3STUA 4GLOA 3D6TB 3DF9A 4NENB 4M1EA 3AF5A 1D6NA 4EYQA 1QAQA 3LX8A 3AUXA 3C6XA 3TDMA 3SXUB 1VYHA 2Q2OA 4F9TA 5EIOA 3R0VA 4CI9A 4ZI7A 5ITZB 4OHWA 2G07A 1IZYA 3RNLA 2B7LA 2K2QB 3F6YA 1OGIA 2HPVA 2AG0A 4UMDA 3D7MA 2AF4C 4G4IA 1LQTA 4N3CA 1U2DA 4B2LA 3T7SA 3FKQA 2ZP1A 4OLJA 3MTDA 3RVLA 4ZMSA 4JJ8A 4UD6A 3KXLA 2E5LB 5EE5B 2C58A 2HSWA 1T35A 1U9IC 4QNRA 2W5UA 1Y6GA 3BL8A 4BHTA 2C29D 4LNAA 1EVLA 4OP1A 4PC7A 1C0PA 1NYQA 4HWRA 4M53A 2X22A 1LDEA 1OREA 2Z5VA 3E2MA 5LMUB 2BP7B 4ENTA 4OGLA 3G8DA 4ACAA 5ADWA 1PLJA 1QGOA 2XUGA 3UFXB 3L4JA 1VL1A 5KHAA 3VV2A 3B82A 3FE2A 5HUQA 3ZHZA 4YXFA 1C14A 2XWBF 4TZTA 1F60A 1SZCA 1EFPB 1BXGA 1E9BA 2AIRA 4WNAB 3DTVD 4XEUA 4O0MA 2PBLA 3HO8A 3CUTA 2FSVC 1LPOA 1YIAA 2I33A 4HO1X 4OKIA 4F85A 5F9FA 5COBA 3U16A 7REQB 5JYBA 4HDOB 4NV1A 2F4NA 1CUSA 4LVCA 1Y4DE 5AI6A 3TINA 5IDXA 3RBZA 5KWJA 4QE3A 1ZP6A 5CJJA 4B7UA 1L1RA 3EFOB 1RRCA 3NUGA 4DLKA 3R5TA 2CD7A 3EIOA 4HNSA 4LWPA 3B6KA 3R8XA 4KLAA 1X1TA 3KB1A 1CQXA 3L7NA 4PRLA 3D3KA 5BN5B 1J9ZA 5FBRB 4PNEA 1N5LA 2IP2A 3O3CA 1YWGO 2ZQYA 4I4LA 3ZVKA 1OHHA 1SBIA 1TRKA 2QN3A 2WYVA 3ZWOA 2AOUA 4KQHA 4OATA 3GOQA 4RKFA 1WZNA 2Y27A 3CYFA 5G41A 4CM4A 5FH9A 4UHJA 5DW0A 3A6PC 3EQ9A 1W1IA 3H2YA 4QUJA 4MB6A 3PC3A 3GP8A 3RIMA 3ESXA 5IJZA 3WB9A 4AIRA 3C41J 1I1NA 2DVMA 1ZD1A 1P33A 1SOUA 3MUNA 4WESB 4ZVUA 4Q1AA 1ISSA 1CEXA 1UJ5A 4WXMA 5LBIA 1H2EA 3OKFA 1DGQA 3N3AC 3K30A 3NC1C 1LVUA 2FZGA 1RWPA 2ZYVX 3ME5A 4Q9DA 3V1YA 4EB6B 3L9XA 1IQUA 4R7TA 5UKDA 4KXQA 3FYHA 2HY7A 2VSNA 3DMNA 4I9FA 4JSRA 4XQEA 5CTJA 2NXWA 1MX1A 4AZSA 4YO7A 1PZNA 4G1UC 4YJ3F 2R8YA 3VNVA 1LVGA 3HRKA 4LHYA 1M34E 1PS0A 2OLJA 3ZE7A 5LSAA 3V4PB 1AQJA 3WIOA 2FSFA 4C05A 2QLNA 2RSLA 9GPBA 4WKOA 4Q01A 2VZ9A 2ARKA 3S40A 4MLZA 2W2TA 4M88A 3U4QA 2BISA 2DGDA 1I1OA 2F67A 3BL5A 2UU9B 4FINA 4KRFA 2HSDA 3AV0B 3PIIA 2B7BA 2N1MA 1CLUA 1II8A 4NU5A 3MJFA 1HEUA 1CBUA 1IHUA 4RHCA 1Z4JA 1KBZA 1GTVA 3VGPA 4EYSA 3I42A 1CTQA 3RM3A 1QIFA 1GSIA 2GZ2A 2OHJA 2QTAA 2WAMA 1ZI8A 3B3GA 4B6QA 3OT4A 4IDGA 1QHHA 1Y0BA 1AV7A 2A5GA 1FP4A 4EUNA 2QMHA 2MMGA 2QXYA 1J8VA 3PFKA 1FP1D 3WBKA 3G5AA 5H68A 3ZGZA 3PXAA 5J43A 4QYIA 3WL7A 2ZRKA 1LCIA 3NC0C 3SY8A 1SC3A 4LVUA 5TNXA 1UPFA 2YXPX 3GH3A 4TMFA 2QP4A 3VO2A 4PCVA 1C9YA 1ZPDA 3GDFA 1USWA 3OU2A 4KIJA 3WMFA 3I4CA 3ABSB 2CDNA 1VKRA 5CB6A 1NTOA 2GJ9A 4ZT6A 2Q9AA 5FLEX 1Y8ZA 3OOHA 3C4JA 1M9NA 1P1RA 2WVGA 1JALA 2G67A 2KW5A 3PDJA 4B6PA 4P4UA 3RSCA 4ZRNA 4C1BA 3UM9A 5AKYA 2EKBA 4HMPA 3ZNQA 2B35A 4FHGA 3HEBA 3DMPA 1ID8A 1H6DA 3FTPA 3QX3A 1XWFA 2FDXA 2CL0X 1Q92A 2WKQA 4PC6A 2KI5A 3R3HA 1HNNA 2Z5GA 1J8FA 4PNPA 2X0KA 3NHYA 5IM5A 4ARZA 5E3HA 3ER8A 2XQKA 4NFSA 4FUQA 1R8QA 3ANNA 3ZCQA 1ZNWA 3BE5A 1L7BA 2G80A 3HQ4O 3KYIB 4JGBA 1UM8A 1Q6YA 3RU2A 5LQUA 2ZBEA 1XMOB 1POXA 3A6FA 1Z75A 2Z2ZA 3SYNA 4G1MB 1DJNA 4XRGA 4QFBA 1NVTA 1YQ9A 2BMAA 2PX5A 2ZDQA 1QLWA 4IKOA 1MOSA 5HX7A 1CF4A 2HYDA 2PNJA 3WR5A 3FLEA 1N75A 2XA2A 4C3UA 3IXMA 5TMEA 3UBMA 3ZV7A 5I4KA 3ANXA 3U5TA 10MHA 1V95A 2J32A 1LWNA 3DT9A 1ODIA 2UVPA 1AIPA 1U0RA 2WHXA 2A0FA 2D4AA 3CONA 2LR0A 3BH0A 3T4UA 1QQ5A 4E5SA 4EJSB 2CVFA 4ZKDA 2QTBA 2LXNA 4CQNA 4G0VA 2B34A 3CG0A 3SHTA 2RBGA 1W9HA 3SPXA 2REXB 2IKSA 3EXHC 2AI2A 3NANA 5IU6A 4XE5A 4C4TA 4L3VA 4YV7A 3FOZA 1VA5A 1JSZA 4Q4JA 1I13A 2F9MA 2SCUA 3CF4A 2LCFA 3NZEA 2ZJ7A 4JGGA 3UY4A 2P6OA 4MR8A 1CR0A 5DM60 5FPSA 4K28A 4TQAA 2QT0A 4DPLA 2R1TA 2H31A 3JAKB 2B78A 1I6MA 1JLHA 3WIEA 1ILWA 3PC8A 1RBMA 2CLFB 2LRHA 1PWXA 2P2NA 2R1VB 1MENA 1FFCA 2RGXA 4MS1A 4O4IF 2W6PA 3DKVA 1KAOA 2V6BA 3D3JA 4QTXA 3W78A 5DI9A 5LMZA 5MFPA 1CS4C 2WUDA 2LP4Y 5A6SB 4YC7A 4ZANA 5EKSA 3QU4A 2CNNA 2OC9A 3GB9A 4G26A 1DOHA 2OO7A 3OOEA 4BE9A 5FBWB 4PHTA 3ADCA 2YMPA 4UE3S 5AW0A 3G68A 1Q1ZA 3O8OB 1IC6A 3AEKB 1WLSA 4A4DA 1X7ZA 5IM4A 3TN7A 4X8MA 1IUNA 2GVDC 2KWIA 3IPLA 3H1AA 1DAOA 1DXQA 1XA3A 4ZVQA 3L92A 1WF6A 4IUYA 3ZYZA 3JZIA 5FOUA 4BUJA 4QOJA 1GUAA 2JCYA 4RH0A 3RLFA 1I7LA 1YS1X 2X4GA 1QCDA 3CWCA 4EQ6A 2VDVE 2MSCB 3DFMA 3L46A 4PZ9A 4UTZA 3WHPA 4Y7CA 4XCXA 1T0IA 3W06A 1I3MA 3ZHVA 1DV2A 5D51S 2WIKA 1E6EA 3VR6A 4JYZA 4FCWA 5CK5A 3RABA 4HXYA 1KRHA 3RKRA 1E1RD 2O9JA 4L5AA 4OP2A 2HFKA 3GPBA 4P84A 1AK9A 4DLSA 2I34A 4WLEA 4XI9A 2CFTA 5I9MA 4HTFB 2AEFA 5G3YA 3KOWA 4X63A 4RA6A 3U7JA 3DE6X 4D4LA 4RK5A 3VU9B 2ZI4A 5AOAA 3H4MA 1B2RA 3A36A 3OBBA 4YJFB 1NNLA 5I4IA 2PKXA 3HRIA 3HTXA 2J5QA 4UHKA 3SU8A 1R5NA 4MMZB 4ZOEA 4FFNA 4Y98A 4YP1A 2VRBA 3D4LA 1FBNA 1WDKA 2G5GX 4YCBA 4YVFA 4DIOA 4WNIA 4AYXA 2EGHA 1RE1A 4LX0A 3WK6A 1JEJA 5JI3E 1NULA 4UDOA 1YB1A 1P7WA 1XPJA 3SJZA 1SXHA 1KWGA 2YHBA 2ONYA 4BU1A 1R64A 3E2PA 4AC9A 4XLZA 3WAKA 3KQWA 1RADA 2FXVA 8ABPA 2ZSFA 2D2XA 2Z9CA 3KWFA 1ZY2A 1KI9A 2X15A 4MVWA 3TS1A 1XN4A 5EA2A 2J9GA 4K6MA 1WQ1R 4YS6A 2UXBB 1Z82A 2XI4A 3P71T 4BNVA 2R4TA 4L72A 1OU0A 4LJ8A 5DK6A 1IBKB 2HADA 3RLIA 5A3QA 4YRQA 4O08A 1E1RA 1CB7A 2O2GA 3FA2A 4L51A 2ZSBA 3TDNA 3THXA 5E95A 3ICEA 2JGMA 2V6MA 3H0KA 2BEJA 3B1ZA 4TTVA 3AW9A 2EIHA 4BX8A 3X1YA 2A9OA 4RAQA 2MMCA 1KJ8A 1U0GA 5DHQA 1N8KA 5BR8B 3G8CA 4UOEA 3FDZA 1HFWA 1PT8A 1AN0A 1ZXBA 1KDPA 4RMJA 1FOEB 1HT2E 2FG6C 2LIPA 2R6R1 2QF7A 3ILXA 3P9CA 1XZDA 1U3UA 2AG1A 2Q3DA 2X4DA 3ZU5A 1EBFA 2Y2VA 1FX0B 2H5JA 1S6YA 4RF4A 1L5NA 4UHCA 2CUTA 1NVXQ 3ZDXB 2ZYIA 5BQOA 1P91A 1F7VA 2IYFA 1G20B 1KHTA 3NWPA 1ID1A 3FYDA 4NZZA 4K6GA 4E11A 2PANA 2WYUA 3A8TA 4BUZA 1TZJA 3B5JA 3JQ8A 4GG1A 3O74A 5C4MA 1BE1A 3M6LA 4HN4B 1MW8X 3OCZA 2YV2A 1OB5A 2R3SA 2VZ0A 1JKJA 2E55A 2Z8ZA 4GPTA 2HWYA 3M3DA 1NBHA 1D2HA 4MYTA 3D6JA 1Z6QA 5E6UA 3LH5A 3OIWA 3KJQA 4RJLA 4RVNA 2O2JA 2IHYA 5K1ZA 2OQIA 2NYUA 2AOWA 4WUVA 4TWZA 1UZNA 1C1DB 4I19A 4YIKA 2BGWA 4YV0A 5CT9A 2XXAB 3WLHA 3V4VB 3R4CA 1CYEA 1YRBA 4EGSA 1M5RA 3JATA 4DZRA 2CFCA 1SUIA 3CLKA 5CLGA 1N1DA 2GPNA 4G1FA 2FPGA 4MLDA 4MDYA 5CEEA 1E0AA 4TXLA 1E5TA 3JVEA 3FUXA 3EBPA 2WRZA 3QRWA 4GI3A 3SF0A 4HNUA 1CQPA 2NUBA 3EXAA 4IIJB 4M38A 4RC9A 4TMYA 2WQ6A 1A9XB 1SO8A 1AD2A 4RMGA 2VNKA 3NDPA 3PNLA 1NZDA 4O2LA 1NBWB 1OTHA 3CTMA 3HKDA 3A3OA 3CGWA 2GCGA 2O2ZA 2OCIA 2RHGB 3CSUA 3R40A 4DGSA 4EZEA 5AVOA 3SC4A 5CEFA 1Z6YA 2PLRA 1WSDA 3BXEA 4HDKA 5F5XA 3PVZA 3BHJA 3K2BA 1DS6A 4CL3A 3KQLA 1C8VB 4Z3DA 3AUSA 3H5AA 4BNIA 5JCJD 2VJMB 4I9GA 4FIDA 4NLLA 4AECA 2AD5A 2RGNC 2ZE7A 4ND8A 3EVEA 4IR7A 3FTQA 3O2QB 3PK0A 4HRYA 1MV8A 3FUUA 1KMQA 2A4KA 3QYAA 4MMXB 1ACJA 5JXJA 5MGBA 4MX8A 4WWHA 4ZT5A 4MV0A 2AX4A 4A9AA 3CCBA 3J7TA 1BA3A 4QDZA 3L4BA 5HK8A 4DNQA 1CR4A 5JMWA 3Q87B 3PTLA 2VNIA 3DAOA 4OK5A 5G0VA 3KQKA 1NFRA 1NVBA 1XD9A 2XYQA 3HN2A 4CRWB 5IT0A 1KO4A 5ALNA 2XJ9A 2CV2A 1EK5A 3GFGA 3UUGA 1WXIA 5AKLA 2XRYA 2GZRA 2XXJA 3IQZA 4BRWA 2XOKD 4JLOA 1LPNA 2Y76A 3C7TA 3KE9A 1X80B 3IAM6 3ZZ1A 4R98A 2VDPB 3H9QA 4AKIA 1N6NA 3QU5A 2RGCA 1C29B 1W88A 2YZNA 1NDHA 4UVDA 2Z09A 3U2QA 4BFSA 4CFZA 2QZPA 2CJWB 1T2AA 4IDQA 4D92A 1XJWA 3HU2A 3IQWA 4UM5A 2CL5A 1U2GA 3CRRA 4CLOA 3AIOA 3EFHA 3HBJA 1HOXA 4JU9A 4ER0A 3LQYA 3PQ2A 2GLUA 5JCJA 3FJYA 3JD2A 4J0KA 4PZZA 4ASUA 2B61A 2ERCA 3X1WA 2BPOA 4FYKA 2DT5A 2PMCA 4BWGA 3NX4A 4CXMA 1EA7A 3AHGA 2ZBVA 3H13A 4AJEA 3OJFA 2RH4A 3H2KA 1W85A 4LY3A 4DJAA 1VIYA 1HY3A 1N6PA 3BKXA 4ZWNA 2HQRA 3KSUA 2DHCA 4PQEA 4ZEOA 1GU1A 3VTZA 1HK7A 2WICA 4QLAA 2IH5A 2VH1A 3M83A 4KFCA 2DBYA 2X58A 2P7IA 1WY5A 1FTQA 4D8WA 4I4TB 4ZXFA 1PFKA 3FLMA 4JT4A 5I7RA 5E7MA 3V3TA 4B33A 4MXDA 5A4AA 3GRCA 4RKWA 4ETNA 3HJBA 4A82A 2EWMA 1GGNA 1M0WA 2BSXA 1WCIB 1QIHA 1LZLA 1T9GR 3FPBA 1NTRA 3I4LA 3GRRA 4QQ8A 4S1OA 2CXQA 5HKKD 1IXRC 4LTDA 4NR0A 5DYGA 3QU7A 2Y9PB 1DX4A 4K9DA 4WLNA 5IUNC 4PWYA 4GI2A 2WTEA 2V7XA 2R6FA 3JARB 3R5SA 1NUSA 1MNQA 1W87A 2PX3A 3PKZA 4PZLA 4E1AA 4EW6A 4A0GA 3F3KA 3Q7SA 1I7SB 1ZGBA 4XKJA 3E05A 1KS2A 2FKNA 4GX0A 4IL5A 3HCNA 3QMWA 2GEFA 4LYGA 4NONA 5GV8A 2VQEB 5A4JA 4FYWA 5C8YF 4BQEA 1DAHA 4LZLA 4PFSA 4U6NA 3TZLA 5G4KB 2IT1A 5TQ2A 3TW0A 3ZUPA 5CFNA 1RAAA 4W63A 4H16A 4FYHA 3K0AA 3T7DA 4D4KA 3ZWVA 1JQAA 1XAGA 2C8JA 2XLBA 3PD7A 1T9GS 2DJIA 4MW9A 5M7EA 4D3SA 3IAEA 4J29A 1ORRA 1M0TA 4I3HA 1PS9A 3TUJC 2I8CA 3WYEA 2JHFA 3HKCA 4YYEA 3ZIAA 1TZ2A 2WHEA 1OFIA 2E48A 4B3DA 1AGRA 2GS9A 4M9XA 4NS4A 1I9GA 2WIJA 4F1WA 1GXSA 4WXYB 4BN5A 3A1NA 4F11A 4MO9A 2AFIE 2FR8A 2HA3A 1T3ZA 4EHDA 5HKKA 1IN7A 1NIPA 3GUCA 1L3CA 4BO2A 3VR2A 4Q3LA 1Y1SA 1G8PA 2GJAA 5ES3A 1S7GA 2PZGA 1JYEA 1Z5ZA 3I8XA 3OUTA 1QP4A 2GZAA 3NGXA 1ZINA 5IWAB 2QTRA 3GFRA 4Q3EA 1BE6A 4DV2B 2DRIA 2P6UA 4PAOA 1LNSA 1YJBA 2OG2A 1S8FA 5CYOA 4CIWA 4MB0A 1OBFO 2IEZA 3K53A 5F1YA 2R8EA 4MPDA 2GXUA 3WZ2A 2WBLC 3OUZA 4UUMA 1UBUS 3LBAA 1TJPB 3ZJYA 3NDBB 4RMNA 1OXXK 1QWOA 1KKUA 3GLSA 3SNKA 1E4EA 3WGHA 5FEMA 3RT7A 1NR7A 1MABB 3K1AA 4DCNA 3C8HA 3ET4A 3OQMA 2AQHA 3T0IA 4JT8A 1OWLA 1A9QA 4RFLA 4RZHA 2FOIA 2ZUCA 5EVJA 3ELBA 1J07A 3H6KA 4LRYA 4WFJA 1NMEA 1DBVO 2GPWA 3B6MA 2WMNB 5KJFA 3WNVA 1O57A 4EH1A 2Z57A 1MAWA 3JQQA 3LVFO 4XYLA 1C8BA 2K6GA 4FMCB 2Z6QA 3X1JA 1NBME 1CERA 1U28A 2H4HA 4OJTA 1CUEA 4PAWA 3VR3D 2PUFA 1M2KA 4PY2A 3OZXA 1B3BA 3U44A 2N0SA 1XQWA 3M1IA 3NMUF 1JB1A 5KHLB 2JLZA 1GTZA 2OAEA 5DFAA 2IF0A 5EINA 5FBQB 1YMVA 3W05A 1LTHR 3GMIA 4IG9A 2R5NA 4EAAA 3S8YA 5T4FA 1RKQA 3BMCA 4PR0A 2TS1A 3ZQKA 4BKRA 4G4SP 1SBHA 5JROA 3EYWA 2Q7OE 4DOMA 3ONVA 3PQ7A 1REQB 2HZBA 1PD0A 1FDUA 4RSMA 1DT3A 4RADA 1W93A 1MO3A 4JI5B 2JFPA 4O3MA 3HYNA 4G5FA 5F7XA 5H4GA 3D64A 5D7NA 2P9HA 2VHJA 2C9ZA 5DF1A 3R7AA 3SJAA 2IS1A 4QOIA 5GONB 4LHWA 5L4SA 1M2OA 1BFDA 1A82A 1H8ED 4UXIA 3SM9A 2AYXA 1KK2A 2JCGA 3PPIA 3TIXB 4BZPA 1B8PA 1GLGA 2ZB2A 2WT8A 4JUAA 3W4KA 1EUZA 3CRNA 2X9GA 4BFZA 2ZWIA 4MQUA 1YRHA 3ZJUA 1VB5A 4G24A 2PNFA 2GA9A 4ITUA 1K5HA 1SHLA 3TVDA 5BSHA 4U00A 1PNRA 4L8FA 4F5ZA 2DETA 7MHTA 2VXBA 3HNRA 1YL6A 3NO4A 4H3HB 5BQPA 4CMJA 3CNNA 3DMDA 5TXGA 4BNLA 4GU5A 2QDXA 3B60A 3G9UA 4G37A 5I7UA 3ENKA 2GJKA 3JWGA 1I0LA 3L49A 2XVMA 1A4IA 4YCLA 1R6AA 4ZU3A 3IX7A 2VXOA 1S2DA 1E0KA 2FVXA 2QAJA 3HA3A 4UTPA 1YS6A 1NQUA 5LP6B 2O8DA 1VKOA 5FL7D 4GLLA 1ZDMA 2G3YA 1Z5VA 2LZ0A 2Q3BA 2Z83A 1ORWA 4RS4A 4X94A 3LPDA 4AG5A 1B76A 5KNDH 2ORWA 3NVKI 3THWA 1XU9A 5KPDA 1FDIA 1JU3A 5F78A 3LSTA 5PNTA 3EK2A 1S8OA 1LI5A 1UBKS 1YQUA 3U1BA 3MGCA 1H8EA 4C0XA 1Y3CE 1XZQA 2R2GA 4R8SA 4UVEA 3DDNA 3AUAA 1H23A 1SCQA 3MRVA 3A32A 5B1SA 1IWPB 2V3VA 3HVJA 4N0QA 5CAEB 1X3LA 2YYAA 3VHLB 4CMHA 4H27A 2GHRA 1T8PA 5JZMA 1O54A 5CGZA 1ZUWA 9LDTA 3TNDA 1VG8A 4K1LA 2AC7A 4MRPA 4NEHB 1XVTA 2C2WA 1BKDR 1C7QA 3ZWCA 4N3BA 1QX4A 2QN1A 5ICFA 4YLYA 5IAOA 3KJIA 1AKWA 5JISA 2NO1A 1FPMA 1R4NA 4G0PA 3NHBA 3N07A 1JJFA 1KS9A 1SQSA 5HIIA 1NPDA 3O93A 1D4AA 5E2BA 3GLHE 4E08A 1A1SA 4JZKA 3QMMA 2PV0A 5FL7A 2OQRA 1AQUA 3T1NA 3ZWDA 4XWOA 4KVGA 3ZKAA 4YREA 3O4FA 1PFUA 3DZBA 1N6HA 3KVNA 5IVDA 3IEMA 3IAUA 1PYOA 1T43A 1N1MA 3CZ9A 3FVVA 4H9GA 3FWKA 1Z63A 3C3CA 4HMOA 4ZZ2A 3TI9A 1E1QD 5IP5A 5JNWA 4F71A 2ZT6A 1ZNQO 5AW7A 1XD2A 3KPWA 3G79A 4AJLA 4C6TA 1RWNA 2W2LD 3ZVLA 2PIAA 4K2AA 1JA0A 4GOMD 4RVUA 2RKOA 2WI8A 1QANA 2QTGA 3MT0A 1DBSA 4DQ0A 4JXZA 3TQSA 3EEFA 1YI0A 2VDNB 1GZ5A 1GQ2A 2GLXA 1U98A 3EUWA 3PZBA 5K03A 3WP0A 3B85A 2WU0A 3IH5A 3I5YA 2Y66A 2AFHE 5KEIA 1P1JA 5CD9A 2WLSA 1RC0A 3IT0A 4JB2A 4J94A 5JECA 4WTOA 2GXQA 4W5HA 2MR5A 4W6ZA 3UT5A 3AX6A 3ORHA 1DDGA 4PLCA 5CXUA 5JPDA 16PKA 1U1DA 3C48A 4I08A 4W9NC 3ANLA 5C7LO 4CM8A 2VT2A 2XLCA 1DIOB 1E6LA 2I1VB 3HM2A 5GJWC 5IARA 1KJ9A 1NW8A 3L43A 3FTEA 1YONA 1GVHA 2FPKA 3JYOA 4NJMB 5BSTA 2BW0A 4QHYA 3H1FA 3TNYA 4B6FA 4L9WA 3NU1A 1N7GA 1J1ZA 5KVQA 5KCMA 1U3TA 3WRYC 3A6JA 1VJ0A 5LQRA 2QLLA 4KYUA 2GCIA 2V97A 3NBUA 5K51A 2NTVA 1ZUNB 3AKYA 1UJNA 3SKXA 1B43A 2VVTA 3RJZA 3STWA 5JFOA 4CM9D 3AFOA 4W8HA 1PW5A 2F1RA 721PA 3TFQA 2ZTSA 4MWDA 4B6GA 4G85A 4RLFA 1K92A 4NJOA 2P9ZA 1ENPA 2PPVA 3KXIA 2IFTA 3IAFA 2CZQA 3MF4A 3T4XA 4ABYA 1L5OA 1QB7A 2YWRA 4RA9A 1MH9A 3LOQA 3W8RA 4OHKA 1T9CA 4LBWA 4EHJA 3VTFA 3OJLA 1KI8A 1HYHA 4I6JA 4U7HA 3PQFA 1UJCA 3WYAA 4KPYA 1AXRA 1G21E 3HY3A 3PL5A 1GHTA 2O2CA 1UBTS 1E8MA 1HWYA 3QUCA 4P92A 3S2ZA 4CNQA 1RJGA 1UZMA 4ISBA 4WJLA 4MYRA 1SK8A 1JG6A 4HZGA 3MJRA 3GZNA 4B3RB 2QOEA 2PGNA 3B3QA 1YZNA 2O8EA 1EP2B 2ZVDA 5HXAA 5HFJA 5U9CA 1QIKA 3DTVB 1CJMA 2GAOA 2ZIEA 3B5EA 4KYVA 4Y1RA 2CE2X 4NZMA 2V7PA 1E4VA 5D7BA 4HXFB 4E5YA 1RQGA 3JPWA 4C0JA 4CCYB 4XJSA 2JLYA 1Q0TA 3VO1A 1I14A 3EPPA 4F92B 1MFZA 1D1SA 3BDVA 1JDNA 4L0QA 3R3JA 3I5AA 3SLGA 2IY8A 3T3GA 3RIEA 4V1CA 3PT9A 1U8UA 4ZQBA 2GBGA 1LH0A 3KTAB 2FAXA 1L1EA 1V11B 3EHEA 2XDWA 1GEGA 3MSCA 3DTYA 3TQQA 1GKUB 1KOFA 1XT6A 2X6QA 5DHPA 3TECE 5FLYA 1KP9A 1II8B 4B4WA 3AM4A 2BF7A 4F6LA 4IG4A 1AVTA 1WULS 2O0LA 2Y99A 4J0JA 4QUHA 1ULZA 3RRXA 1EUQA 4HSGA 4F6CA 3A26A 1OFGA 3D5QA 5LU9A 3DH0A 2QX4A 3EIQA 5F2NA 1FFGA 3UHPA 4EHAA 1Q16A 4BX9A 5DCYA 4O4JB 2D2IA 1QHHB 4JOBA 3TI7A 4F97A 3IAHA 3V9AA 5KOHA 5AHOA 5H5JA 4CLEA 3L3BA 3QBVA 2QTCA 4KWEA 3SYTA 3RS3A 1KJQA 2LDXA 1KTIA 4Q3CA 1VE7A 4DMGA 5IFKA 4PSCA 1BJRE 2C0QA 1KYYA 2P77A 2RC6A 3KXDA 2AD1A 3R2JA 4BVGA 3DTTA 4RKEA 2EC5A 2BMDA 4J2HA 4XX0A 5EZQA 4BMPB 1FA9A 1L7XA 5GVRA 2JEOA 2DECA 2F64A 4H3KB 4QDJA 1CZNA 1UDXA 4L2IB 2LKCA 4CYMA 1YFJA 2M9MA 1YA8A 3A4NA 1KHHA 3NM6B 4MWZA 3WVNA 1LW7A 1DEKA 2J08A 5ENZA 1R3UA 2W8ZA 3GA7A 2ZBGA 2VJOA 2MWMA 3WKEA 1WHTA 1W46A 4BNDA 1R0KA 1ZCBA 4RS3A 5JCPA 4HPJB 1KZ7B 4JWTA 2QVXX 4PPGA 2PKYX 5BQXA 4JP3A 1RE0A 2CFSA 1YO6A 3PXDA 4GX5A 4RIEA 2A7QA 3ZE0B 3F97A 5L95A 2OGZA 4KVFA 4D82A 1RABA 1GCGA 3OCUA 5KI6A 1RPAA 3HUUA 5EMNA 3AESA 2X8BA 4K1XA 4EARA 4F06A 1RLMA 4MJLA 2AJ8A 4X92A 5K3AA 4CR6A 4ARZB 1E9VA 1HLDA 1FVHA 5I7OA 1N2OA 2C84A 3AY7A 1UKYA 2QYOA 2V74B 5EXTA 1PI3A 2J09A 3BBLA 1JHOA 1UMKA 2HDHA 3ED5A 2X7XA 4L95C 4NE2A 4BMVA 3UXYA 2EGGA 4DG8A 3PLRA 2Y1WA 1PFYA 3D1JA 3ETJA 3IRVA 3TW4A 1N2CE 3HY6A 2QSJA 3KZCA 1EX6A 2AEMA 3R41A 3U7RA 3SF8A 3SYKA 4ND6A 3G7UA 4OJKA 2NPIA 2OC4A 1QIDA 4ZYWA 3IEPA 5BQ5A 3FHCB 4BEWA 4ZAFA 4U9UA 2UVPB 2QRNA 4DEXA 1WWKA 5TC4A 2FQYA 1XU7A 1OWOA 4R41A 3L4KA 2O07A 3FTFA 1OAKA 1RWVA 4CEHA 1FXSA 1VG1A 3CVOA 4G5OA 4GWLA 3CT4A 4IHAA 4L4RA 4U02A 4ECEA 4JQOA 3O91A 2AMJA 5DBOA 1SUPA 4BLQA 1YBFA 1VFPA 3C5HA 2FEXA 1SB9A 4XA8A 4S1NA 1O0CA 5A06A 2EZ9A 4Q4JB 2SCUB 2E6KA 3IIJA 3ZDFA 1ZRNA 2ZI9A 5E4FA 2WZDA 1EGMB 4MR8B 4ZREA 1QHNA 3FVTA 4D9IA 5HOEA 1L4NA 1Z37A 2V9PA 3CVXA 2QW1A 3FIUA 3K73O 3LXRA 4F46A 3Q2IA 2R1TB 1BHJA 2YFHA 5IC5A 5EZYA 2Q7XA 3GJYA 5BMOA 2VQFB 2I66A 1EI9A 3ABIA 4KPUA 5CDHA 2G7MC 2YY5A 2ZI5A 4AIIA 2CYBA 2PSDA 4IMJB 2Z4TA 4CGZA 1Z18A 3PTAA 4L73A 2LV8A 4X1YA 1X7XB 2VDRB 5CA0B 4M1ZA 1EM8B 3VJMA 1Z0ZA 1K68A 1CEQA 2D2VA 2W11A 2WIBA 3PRYA 4RETA 1CHNA 4QYSA 1N5DA 4RF2A 5HA5A 5KTNA 4ZI7F 2Y05A 2H7VA 3D3NA 1DE0A 3G13A 4AURA 3KPUA 2OBYA 4QRHA 4WY8A 1CIVA 3S27A 1T2EA 2Y67A 4DMKA 1X7ZB 3ZKWA 4P36A 2ATIA 2HBQA 3LUDA 5ILQA 2BBOA 2EX1A 5T41A 3ZUGA 1SKYE 4RQUA 3WL4A 2CFRA 2X86A 3DDCA 2Q6IA 1HDYA 3L1KA 2N47A 3R8CA 2A9PA 4ZCLA 3PFHA 2CB0A 2Q5QA 2GZ3A 1LX7A 4AJPA 1EX9A 4BNUA 5TARA 2A14A 4FGSA 1QC5A 4L75A 3CLRC 1QF9A 2OWDA 3QPCA 5EP4A 1KFEB 4UQLA 1YL5A 5JMTA 1G3RA 1H0SA 1P6UA 1X14A 1Z7EA 2IEAA 4AWXA 4W7IA 4RA6B 3WJAA 4C43A 4IOJA 4L8LA 4EPWA 5JEEA 3LHKA 4C4PA 4JP8A 4OG2A 1U0OC 3FMPB 2HC9A 4L9RA 1T4DA 2D5CA 3AETB 3B12A 2RONA 3DM5A 2WV7A 3H05A 4BTVA 4L7QA 2NU8A 2HI0A 4IIVA 2QP9X 1UDWA 1G98A 2JFOA 1DWQA 2WZBA 2XZTA 4YY3B 4CKEA 5IC6A 4ENRA 1NC1A 1XCBA 3DWIA 1A5ZA 3KCQA 5CB8A 2NVBA 1WXQA 2OGTA 4YPVA 4C7OA 1U5CA 1QUEA 1G19A 1R0RE 3K8QA 1KMNA 2WIAA 1RWWA 5DGTA 1G2IA 5LZ9A 1QM5A 1U4OA 2P90A 3AEUA 1VBNA 2P2LA 3VR4H 1IXYA 2ZS9A 3HCEA 5KJ1A 4FP9A 3FPLA 2DPHA 3EGXA 2FP3A 1GCOA 1EH5A 2HMVA 4FYXA 1SZJG 4MVJI 5IZCA 4WCVA 3STYA 4EB3A 1SURA 3KCNA 2QRJA 4QUBA 5HG0A 5JRZA 4F8EA 3M4YA 3HUEA 4QPDA 3KLNA 3A9VA 3MD9A 3OZWA 5IYZA 5K0TA 3F6EX 1NQAO 4XSVA 1TQDA 2IP4A 1KEZA 4Y0VA 3OQOA 3FDZB 1C2TA 3OU6A 1XJ0A 5C2JB 2VK8A 2H92A 4KREA 4URWR 4V0MA 1HSZA 4X66B 4NE7A 4DJJA 1E9CA 1H22A 1FEZA 1M10A 1TK9A 4JR1A 3G1UA 3L6OO 4PIMA 3UPDA 4QG7A 4OTZA 3C8ZA 3NYWA 4W9MC 4H1VA 1P29A 3GAMA 4S0ZA 5KTYA 3STHA 1DL5A 4FYYA 1T5IA 4KDEA 5IVHA 1S0UA 2GD2A 3COYA 3V7WA 5AKEA 4ZRMA 1KSHA 4GMGA 4JV5B 1V5WA 3DT6A 1OWMA 1FU7A 3D0QA 1IG0A 4J0QA 5D8DA 3E8SA 2Q6TA 4TVOA 3D6UA 1J70A 4ZVPA 5IVPA 1K88A 1W5TA 5B1HA 4BZXA 1H1LA 3CLTD 4IQGA 5CX1A 1T2NA 1OXTA 2RCNA 2C8KA 1JKJB 3U3ZA 3WK4A 4GKJB 3E9EA 2Q0SA 4JP1A 4U6QA 2DR3A 5EPUA 4IAOA 4DMUB 1HDOA 1R9NA 3GLGB 1QHSA 1YQTA 4PIVA 5DE3A 4BLSA 2ZK7A 4IIFA 3F7OA 4DB4A 2QN9A 1L5ZA 5I9NA 1MJNA 2PXCA 1C7RA 2W0SA 2ZRJA 1P1IA 2DLDA 5HFNA 4DDWA 4DA7A 2XZPA 3RYTC 4TTJA 2GKSA 1I30A 2JVIA 3DTNA 4HDSB 1JKXA 4U1RA 3TSWA 3UQZA 2I2WA 4P34A 4MUXA 2ZJFA 3H1EA 3W7VA 1L9XA 1IULA 2PXHA 4D9HA 3DO6A 4QSHA 3V1UA 3WLSA 2O3RA 5EE1A 1SNYA 1TK3A 2R6HA 4K0KB 3LBNA 1S2IA 1G9TA 4DBVO 3HKEA 2H1VA 1HZZC 3FVQA 4D43A 3EPKA 1SUSA 1FRFS 3GCXA 3K9QO 5ADHA 3X0DA 5WRFA 5BVGA 1DIHA 3WA7A 1QWSA 2E4VA 2QJTA 4OYRA 3VNQA 4DRXB 3N53A 5DTRA 4EW1A 4EB8A 3FRIA 4HZUA 1X19A 3IDZA 2PKRA 1NURA 5AJXA 2VYNA 4LYHA 3TNJA 2G9RA 4ND8B 5TS2A 1JAXA 2SHKA 4FDLA 4LI0A 5JD5A 1E7RA 2XUZA 5EHGA 5BR1A 3I73A 3IGFA 2AZDA 1GL7A 3HYLA 3L7AA 1P8AA 3N6RA 2D5IA 4U8HA 2XMGA 2H59A 5BUCA 1F6DA 1OR8A 3DFKA 3G2OA 5CM8B 3RVDA 4GOND 3VAYA 4AZ0B 1JXQA 3LT0A 5AKJA 4QQKA 3RUCA 1H3NA 1SXJD 3GFBA 5T7BA 4M8KA 4AYWA 3NEYA 5ITWA 5KJ6A 4IICA 3EJWA 2JLAA 4UVIA 1Z29A 1JG3A 1IIBA 1UFVA 3FUTA 3Q3CA 1AGXA 4Q7QA 1NSFA 1HG0A 3C3AA 2VTBA 1EWYA 2QB5A 1VIMA 3NBZC 4PSAA 4NQZA 4AWAA 1USUA 4XIYA 2JJMA 4BBAA 2XIQA 2OZLA 2PUVA 5C46F 1V8BA 2QTTA 1BDHA 1W88B 2WWFA 2IVFA 3H5VA 4B4KA 2JH8A 3LXXA 1OVGA 2EW1A 3L8MA 5G40A 1T1IA 3UAOA 3HI6A 2OZVA 3WLIA 2H1WA 3BREA 4DC9A 4KH1A 2RHBA 1IVYA 2JFBA 1ADCA 1EUCA 3LW7A 4YN3A 3UKJA 3I0ZA 1XG5A 3IA2A 4PLPA 1ZK1A 4O2AF 4GC9A 3TL6A 4B3JA 1LEHA 1W4RA 2BIFA 3BQ9A 1A1VA 1NQWA 4PINA 3ER9A 4BJ6A 1W85B 4BMSA 3H3FA 4INOA 4AQ7A 3CLSC 2CXXA 2Z5FA 4MI6A 3FOCA 5EIXA 1PNVA 5IUJC 4GH5A 3JQDA 3RU3A 4X20A 1SXJA 2ZSIA 3DCJA 1A2BA 3RFTA 1MAHA 4Q12A 3N0WA 3GGGA 4X61A 4BQOA 3MINA 1E3WB 4BZZA 4ZYTA 3ST7A 2CMFA 4K9RA 4CKXA 1GKIA 3C3PA 3KB8A 5DEIA 4EMSA 4IEIA 3AB8A 3J81k 4LF4B 2FRDC 5DYIA 1M75A 2DKNA 3V8VA 3VYVA 3ZZMA 4FFPA 3IVGA 5F51A 1OPXA 3GIDA 4HNVA 4F4HA 2ZUWA 2H2GA 4G2TA 2ODTX 1U11A 4JX9A 1MB0A 3W5SA 2DUNA 1UBEA 2Z2XA 3KLPX 5JSFA 2BFNA 4IS3A 3T5MA 3AR6A 1YZVA 5BYKA 5JD6A 2B1QA 2Q5CA 5JJLA 5IM4F 1N2BA 2BGIA 2W93A 3EZLA 3U3XA 3P8ZA 3REQA 1L7RA 3DP9A 1GN9A 1P81A 3H1GA 4B7ZA 3GT4A 4LYFA 4YA6A 3UMGA 1J21A 3E03A 4G9EA 2JJ8A 3FWNA 3QQPA 1ZIPA 3B2QA 3GP3A 4OCZA 4R1SA 1I10A 3E5MA 1T9KA 3JS5A 3ZVRA 4BN0A 3VYTB 1O6FA 1Q2UA 2ANBA 4DIUA 2ZVQX 3ZHUA 3HKCB 1TZBA 1YB5A 2L0XA 1PEAA 4JZYA 2F3SA 2O7SA 4IKEA 4PLGA 3JQFA 4RULA 1Q1AA 2BI8A 3IPRA 5DEOA 1CZLA 2AR0A 3QX9A 3BXPA 1O6GA 5SICE 5F3RA 3T5DA 1JDTA 4E5DA 4EVIA 2BFDA 2JJYA 2FN9A 2NXJA 1X0XA 3H8VA 2X76A 4YHBA 2VT7A 2GPTA 3G2QA 1KMHA 1BMFD 2H29A 4YRAA 1SA0A 2NO7A 2EKLA 4Q21A 2PAFA 3BXFA 5DWQA 1JG4A 2HU7A 3HCRA 2X1HA 1V7ZA 4QA9A 5LQCA 3GAZA 1WXHA 3W5HA 1NNSA 3WK8A 1Y1KE 3C1AA 1G8SA 2C20A 2PD6A 3E9DA 4K86A 3EVNA 4FYJA 4NPHA 1NASA 6YASA 1I4DD 4GIBA 2BJVA 1GYQA 1L4GA 4DARA 3G8AA 2XOEA 5CCDA 5L7WA 1C7IA 1PZFA 2VIIA 3GROA 2JBWA 1A4RA 3VXKA 1E4EB 2CJYA 2CLEB 3BK7A 3K1AB 3TQCA 3B2NA 4OQMA 2VP3A 4R1OA 2ABWA 1DC3A 3V7UA 1N5RA 3RUHA 4DQVA 2K7FA 2EP8A 3EC1A 4TM7A 4BP1A 3QFFA 4N5MA 1OXSC 3OCXA 4YAUA 1E3JA 3K5IA 4JL8A 2WWTA 3LAWA 5JCOC 1F1BA 5L7YA 1QXSA 1T6YA 3BIFA 2VCYA 3ZEAA 5HF9A 4FSHA 1V35A 3RG8A 5H3LA 1CDZA 3LUHA 5K20A 1J8DA 2BZSA 4PG7A 3K31A 3YASA 1JQDA 4J1TA 2YXEA 2G1JA 4FMBB 4W1PA 3A58B 4YAOA 5G1OA 1UFQA 4KQKA 1U7OA 5ERYA 4XYMA 4EW2A 4II3A 1MN6A 3CVYA 3PGMA 4DIEA 2YWEA 3KEGA 4HWKA 3EXG1 2NVOA 4UXHA 5JUWA 1W4CA 1Z0FA 2VA9A 4RVDA 4JUBA 4BO9A 3P0IA 1E2PA 3DPIA 4ZAVA 2VDLB 3GG9A 3I9NA 3K0BA 4MGIR 4BNYA 2B6NA 3V34A 4BLTA 1HTTA 5K8CA 4JH0A 4JN6B 4BIMA 3T1YB 3K0FA 3A9SA 1HE2A 2AXPA 2CWWA 3AB7A 3ROKA 1VLZA 1FFYA 2EATA 3N75A 4F8YA 2SBTA 3M81A 2J3QA 3H0EA 5ALMA 3I8OA 5AW5A 2UXCB 4ME6A 2P9JA 5P21A 1L7OA 2RGRA 4RQTA 2HMAA 3L4SO 1GCAA 2OHFA 3DR3A 2P9GA 3LY9A 4J07A 4CEJA 4R05A 1XZAA 4A26A 1MA3A 1BWPA 1CQZA 2C59A 2FSGA 3QNWA 4HGZA 4WBNA 3R7WA 3EH1A 1E9EA 2YHSA 3MBOA 2EEZA 1TAHA 4DXDA 3KPJA 3LX4A 1AHIA 1NMZA 2I7XA 4QXRA 5BWOA 1J2EA 4GLJA 3WMWA 2CLIB 1JX6A 1TM7E 4DB2A 3RQIA 1YMUA 1Z5OA 1P7VA 1SVOA 1U3WA 3EVBA 4L5IA 1K8YB 4HEQA 1O94A 3G8BA 4KZKA 1X8KA 4WOCA 3RH0A 1O95C 4OB7A 3UMSA 3ABOB 1KZ1A 2H9IA 3QPWA 1USIA 3K0HA 4OQNA 4RL6A 5J63A 5B64A 4GNRA 3AF4A 2FE4A 2ISCA 2XBUA 1NSTA 2QORA 3GRZA 4PHCA 1AU9A 2PEZA 2X23A 1TKCA 1M73E 3HFJA 4NF2A 3JASB 1JDJA 1A9SA 5JNRA 4B71A 3UJCA 3LDHA 2VBCA 4R83A 4UMVA 4PLFA 5COQA 1DAPA 5I7SA 1FLDA 1L6IA 3H9CA 1YUBA 1KTVA 1PTJC 3K1TA 4UULA 3QNMA 2Q1WA 4Z1MD 1JEOA 2H18A 4CF5A 1UC9A 1KYVA 3BKWA 5BWMA 3KE8A 4UHDA 5KO2A 3F5FA 2GFIA 3CV3A 3PFCA 5IS2A 3EY9A 4NFHA 1MGPA 2FN4A 3ND6A 1YV9A 1I51A 1MFPA 2O3JA 3AH8A 1H42A 2XVYA 5HZHA 5LBTA 3U56A 1C3XA 1SG6A 5LFAA 1K6JA 1S2OA 1ZIXA 5BT9A 4IUCS 1KFCB 1L5VA 2C1XA 2CLMB 2B20A 1YC5A 2FYTA 1R4NB 4YRNA 3KRTA 1Z39A 4QGAA 4EITA 1F2TA 3SJUA 4J1SA 4ARSA 2ZAIA 2ZI3A 3QLVA 4IDCA 1ZMRA 1JDBB 1Q57A 2I4IA 4YCJA 4BE4A 3AVTA 1L7PA 1E2NA 3L41A 4KX5A 1UF9A 3LF1A 3AO0B 3ETEA 4XWKA 4Z6KA 5C1PA 4DV1B 4KLZA 4I6EA 5CT8A 4DXAA 4DR4B 4DJDC 4F5YA 3PX7A 5JCXA 3ZC3A 2L17A 1M8JA 4OHFA 2RAFA 1XD2B 2DBZA 4JLAA 4KJXA 1PEDA 4KYTA 5EJ5A 2RHOA 3QLEA 1X1DA 3OLXA 3PNQA 4OUDB 3NUQA 1PT5A 2BGLA 1M6HA 2QAGB 2O5EA 1PZHA 2ZIZA 4Y9DA 5EL0A 4TQUS 3BD8A 4MWTA 4TWRA 2GFHA 4XSHA 1DQRA 2UYGA 3EXG2 4HRXA 4AZ3A 3VKVA 1U7WA 1RXCA 1YRYE 5F52A 2ROQA 3GZ4A 6GPBA 3NCTA 3T5GA 1DBPA 2OHIA 4JHLA 3DOFA 1VP9A 5EWLB 1IAQA 4FK8A 2DCUA 1ECGA 2BFEB 1XCOA 2QU8A 2ZTHA 2FWAA 1DPFA 3I04M 5LB4A 4TLMB 3RIHA 1J0DA 1HT0A 3ZHCA 2JK0A 2ZREA 4EUKA 4N01A 3PNKA 2VAWA 2V6IA 1ECCA 2PGJA 3FUCA 2VDQB 5JT1A 2ATVA 3A3NA 4PXSA 4W1QA 1EFDN 2XNKA 4BPBA 2R6JA 1FC0A 1HO3A 3AQIA 4DBZA 2EJUA 3KR2A 4FE3A 4IZ6A 1JMKC 3HBMA 4TRJA 3LCCA 2GZSA 2ODPA 2WSSD 3CR8A 2FPPA 3OTIA 4PHHA 3THRA 2ZXUA 3FH0A 4RXUA 3PVSA 4JYBA 3I12A 3ZHSA 4CMEA 1E7SA 1RJDA 2FCAA 4P35A 1XLTA 3Q3HA 3HCCA 3P0JA 1LA2A 1RAHA 1YOVA 4OFXA 2Q1SA 3ETHA 4WFQA 5BOSA 1RFGE 2BFOA 2XZLA 2H07A 2FZLA 3OC6A 5A3VA 5IASA 3RK4A 2XUPA 2G70A 4XPIA 1MIHA 1U7TA 2GBLA 2XT0A 3IELA 1Q7BA 2QI9F 1HDXA 2ZRQA 4ZV9A 2IEDA 3GZNB 4IHQA 5KYYA 3L02A 4JVOA 2O8EB 1IHPA 3QXSA 1SK9A 1UXIA 1GZ3A 4YJKA 3HEMA 1UKEA 4RK7A