4P83A

Structure of engineered pyrr protein (purple pyrr)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
165
Chain Sequence
KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered PyrR protein (Purple)
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transcription
total genus 50
structure length 165
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p83A00
1O57A 4RACA 1CJBA 2FXVA 4RHTA 1ZN9A 4PFQA 1R3UA 2JKYA 1G9SA 3O7MA 1BZYA 1XTTA 4FYMA 4RQAA 1Z7GA 1WD5A 4P83A 4RANA 3LPNA 3DMPA 3ACBA 4P80A 1P17A 1U9YA 4P86A 1Y0BA 3DEZA 1P19A 4M0UA 5E38A 2XBUA 2YZKA 1XTVA 1LH0A 1A97A 1BD3A 3ACDA 4OHCA 1G2PA 2C4KA 1I14A 4TWBA 2WNSA 1GRVA 1ECBA 3NAGA 1I0LA 1ZN7A 1QCCA 3OHPA 4QYIA 4LYYA 4P84A 4M0PA 1V9SA 5EUCA 1PZMA 1MZVA 1QK5A 2H08A 1NULA 4QRIA 1DKRA 1A3CA 3M3HA 2H06A 2VFAA 1D6NA 2P1ZA 3H83A 3MJDA 2PS1A 4ZFNA 4IJQA 5JV5A 3N2LA 1W30A 1IBSA 4WMLA 3EFHA 3DAHA 3OZFA 4RQBA 2EHJA 4Z1OA 3GGJA 5BRNA 5ESXA 1JLRA 1JLSA 4RADA 4RABA 5IPFA 2PRYA 4KN6A 1L1RA 1OREA 2H07A 5BQPA 1A98A 1J7JA 3GGCA 4RAOA 1UPFA 4M0KA 2JBHA 1P4AA 4RHXA 2HCRA 5KAMA 4WN3A 2PRZA 5K51A 4JITA 4P3KA 3ACCA 1DKUA 2IGBA 1G2QA 1ECJA 1A96A 1FSGA 1L1QA 1P18A 1VSTA 4JLSA 2DY0A 4QYIB 1UFRA 1DQNA 1I13A 1GPH1 1STOA 1DBRA 4X44A 1OPRA 3KB8A 4P82A 1I5EA 4RHYA 1QCDA 1TC2A 5HIAA 4P81A 5IAOA 1TC1A 1XTUA 3OZGA 1XZNA 1QB8A 1YFZA 2E55A 4S2UA 1QB7A 1U9ZA 1A95A 4LZOA 5BSKA 1AO0A 2AEEA 1ECCA 3G6WA 1BD4A 4LYGA 1DQPA 2GEBA 4LZAA 1OROA 1XZ8A 5KAPA 4MB6A 4F8EA 5HKLA 5ESWA 5BQOA 1G9TA 1ECGA 1ECFA 1QK3A 5JSQA 3MBIA 2JI4A 1HMPA 3S5JA 4RAQA 1NONA 1A4XA 2JKZA 4RHUA 4LZNA 1QK4A 4X45A 1I0IA 3HVUA 3GEPA 3LRTA 1O5OA 1VDMA 1VCHA 3QW4B 1HGXA 4RV4A 4PAWA 1ZN8A 1UPUA
chains in the Genus database with same CATH superfamily
4EW1A 4LQCA 3PEEA 1PR6A 2HK7A 1CJBA 1ZU4A 1R74A 1EX7A 4UCQA 4NV1A 2QTTA 3BXZA 3O8CA 3OE7A 3HGQA 2QGNA 5KSOA 4G65A 1X9IA 1LI5A 3OZEA 5A06A 3M6AA 2R1UA 4RVUA 1Z7GA 2I76A 5E7JA 5JMWA 2QGZA 5THQA 1E1KA 4ZT2A 4MI9A 1MV5A 3M9XA 1J8VA 3H7AA 3W5IA 1UC4B 4GOND 1FIUA 4E13A 4PYMA 1AOXA 1PEDA 2G71A 2HK8A 3KT3A 5CVEA 4BDSA 3IKTA 3O47A 3BFPA 1NAIA 1KYIA 2BH2A 3IURA 4O2BA 2XBMA 1JJIA 2NXNA 1R66A 4YAKA 1C7RA 1GPYA 3F6CA 4KB5A 1V1MA 4DCVA 1RXVA 2ON6A 1C1DB 1RWXA 3PE4A 3BL6A 4NZOA 3O93A 2Z1MA 1YS6A 1YJCA 2XIQA 1NIJA 4QDTA 2RHMA 1FB5A 4C0BA 3R76A 2ZK7A 4ALIA 1AS3A 2GZ2A 3OY7A 4ZI3A 4IDCA 1G8KA 4OBEA 1US8A 1LPSA 1RRPA 3E4CA 1S1CA 3EUAA 3IE2A 5AI0A 1NE2A 1UM9A 2GBPA 1KZYC 2AOUA 2RJOA 2XD4A 4FZRA 3LHDA 4IILA 3T52A 5IAGA 1DBSA 3PEVA 4ND4A 3ADOA 1M6VB 4Q3DA 5DK4A 4M8LA 1Q7BA 5DASA 3U4DA 3FGZA 3OE7D 4FJ2A 1QS0A 3G0IA 1QQ6A 3T7EA 1JGTA 3OTIA 3FCUB 4R1MA 4U7WA 4AG3A 4EO9A 2O2XA 5DNVA 4A10A 3V2UA 5A3RA 1NBHA 2QD4A 2ZSBA 3CW8X 2HJ9A 3MCTA 4KVZA 4GU5A 2OZKA 4MV0A 4YP1A 1FJGB 4QX6A 3STTA 3NHFA 3TTXA 2NVUA 1OZHA 3KXLA 3MGCA 4BLSA 3KCNA 3F8TA 4KIUA 5JMTA 1TYBE 3SWWA 4MYDA 1UJBA 5KTRA 3LX8A 1AQUA 2EVWX 3PFHA 4YRMA 1AQNA 1T43A 5H5JA 5B6IA 1RP1A 2V5AA 1UBRS 1DHRA 3RANA 1EK6A 1XD2A 2V97A 2XUIA 1FTSA 4MCIA 4DQXA 5J4KA 1GZVA 3C85A 4OB7A 1FJXA 4TYWA 3D7LA 4NAUA 1HE4A 3CINA 3KJIA 4MV6A 1N5DA 2WLTA 1J56A 2P9JA 2HHAA 3CUEF 1S2LA 5K6AA 3SHOA 1A27A 4HPWA 4KJZA 1LLDA 2JJQA 1EVEA 3COSA 1MFZA 1YZLA 3D64A 4RTPA 4EQ6B 3Q9NA 3TUIC 1K5DA 4YT5A 4S12A 4CODB 3BE4A 3QPDA 1XU9A 5HBRA 2C2OA 4C1BA 4EHNA 2FOLA 2JANA 4DMMA 1FS4A 1SVUA 4AQDA 1RI5A 4C43A 1E59A 1DRVA 2D54A 2FKAA 2IIPA 5CFLA 3FZEA 1XEXB 1QCZA 3HGMA 3QEKA 3SYLA 1K8RA 5HSGA 4TKUB 4MR8B 4N4AA 5ENDA 2PX8A 1IXSB 1JBKA 1WXXA 3BH7A 5JNSA 1P5ZB 1XKLA 2H85A 3NUGA 1KGDA 2QI9C 3IV6A 3UQZA 5K8UA 3HP1A 4HYEA 1ADYA 2DWCA 1FS6A 1MZPA 4CU2A 3UH1A 1RQNA 3ZBTA 2IW3A 3LSTA 5HVNA 3HA2A 1ZWKA 1RW4A 3GFRA 3JATB 2MYNA 2OFOA 1JIJA 4IF6A 4KMSA 4ZVOA 1CRWG 1M1YB 1RVV1 1X94A 2LV8A 1AUXA 4JYCA 3VR6D 1C7QA 1PFWA 3OTWA 1PZFA 1FX0A 2XDQA 5ADUS 3KYDB 1TM3E 1CY8A 3I9MA 4IOLA 4MS1B 3P97A 4UCWA 1OLXA 1SPBS 1X7YB 3EQ7A 1H2WA 2I4IA 2OBNA 1PD1A 2A94A 2Y0EA 4CQMD 5E38A 3V4VB 2KPOA 2OCGA 2Q6VA 2Q8PA 2VC2B 2YXNA 3GLHB 3MJVA 4N0DA 4UU8A 5DGHA 3G8DA 1SQ6A 1QYRA 4RZQA 2C42A 5JNWA 1X70A 5JDIA 1MVNA 4URVR 4P7JA 5K45A 4CETA 3N2GB 1Q0RA 3I9KA 4GG1A 5CGZA 3AV0B 3BAZA 3KSUA 5AKKA 3X1KA 3NT4A 3M9LA 3FHOA 4GP6A 4NAHA 4P84A 2ZROA 2FMTA 3FLAA 4KI7A 2A1IA 1SC9A 1TRKA 4M49A 3GGOA 2I66A 2CXOA 2W6ZA 1LVUA 2ZRJA 2ZB8A 3K8YA 5JE8A 2VYFA 3X1YA 4WNAA 4DANA 2JFFA 3AF4A 5JTTA 3JWJA 3DEKA 4DDVA 3LCRA 1C9DB 1RQGA 3PGLA 1XDDA 3OO0A 1I9GA 3VR2A 1C5KA 3HUTA 3OQHA 1RYBA 5AVVA 1LNQA 2B36A 4B6OA 4YP6A 2QTZA 2FWIA 3LZCA 2NYVA 3N3BC 3EGDA 1G19A 2PZAA 1DC8A 4BBPA 4QVIA 1IMJA 4GZ3A 2FSHA 1OXMA 3EYAA 1M1YE 5G02A 1E2QA 3E9QA 1LDNA 3F6EX 3H2JA 4UREA 2P6UA 1RI1A 4B7UA 3O9MA 4PTYA 2FX2A 2OYRA 2ZUUA 3DR3A 5J47A 4WZBB 2WE7A 2C94A 1I4TD 2XE4A 3FNGA 4FB4A 4Q6WA 1SCIA 2WMNB 2JAPA 1Y7TA 1CQZA 1UZAA 5HOEA 1NVVR 3EGOA 4LGVA 3KQVA 2I80A 3BS4A 4EA7A 1NLZA 5B36A 3IR6A 1ONOA 3A10A 4TX1A 2O2HA 1CJSA 1J25A 1XVAA 1QKIA 2YIVX 4FC7A 3SZRA 3E7FA 1CQIA 6CHYA 1MB4A 2XE7A 1RLJA 2IGTA 3B6KA 4GD3Q 4TS9A 2D2XA 5CGQB 1PSZA 4IVQA 1Z4OA 2B1QA 4BLRA 3HB7A 4IH1A 4C6SA 1RQRA 3K7EA 2QZ9A 4J9UE 5D6OA 4RYLA 1AQ6A 2JFHA 3OE1A 5BP7A 4D79A 1C9KA 2QZ4A 2JHGA 3H9UA 1J06A 3EIEA 4I5EA 3ZJVA 1OBOA 2NX2A 5FWDA 3R8CA 3VR2D 3SEFA 1BWQA 3OJWA 3TSYA 4C08A 3FYUA 2XYVA 3I39X 3NBUA 2OZLA 1CZLA 4X63A 3UF0A 2BSQA 3PI6A 1Z4NA 1PYGA 3RFXA 1R6XA 1DQRA 4XE5A 4V03A 4BDTA 3HVUA 3GEPA 1C1XB 5AVOA 5LZ5A 1RQPA 3PC8A 5DT2A 1DQZA 4G5SA 2VXCA 4G8BA 4OXNA 2MMGA 3HKBA 1NE7A 3KXIA 5IKOA 1GQQA 2CKDA 3E81A 1Z2NX 2GZRA 3W2HA 1TZKA 3NBFA 2O8FA 2WSYB 2CVHA 3VHRA 4EPYA 2QRQA 5PNTA 4X7BA 3FW1A 2JGJA 1Z7YA 5EP2A 2QVLA 4IKPA 2HHCA 4K1XA 4N8EA 4OXIA 4DSOA 5JI3E 5KVAA 1Y4AE 1YVRA 3D6VA 3OESA 4KGZA 4ZQHA 4OSPA 5KI6A 1K06A 3E9YA 5F2EA 1BKDR 3EG5A 3AVYA 4D9BA 1CNEA 1NQXA 1PJ4A 2GPJA 4N3GA 1ADFA 3BQMB 4EW6A 5JTUA 2GN4A 2YS6A 1L9XA 4HJRA 1XTZA 4HRVA 4E32A 5FL7A 2R6AA 1T1GA 1RWKA 1W5AA 2WOJA 4GL4A 4TV9B 3ZHYA 3KQNA 3PQEA 4HOYA 2NU9A 2WTEA 2X8JA 4KO2S 4DNQA 2X3FA 2P2ZA 3OAAA 1UPCA 4AKIA 4N5HX 1SC3A 4Y1RB 2JLVA 1DELA 5BSRA 1DEXA 5HTOA 2HA6A 2DT5A 1KHTA 1CUZA 3QQ5A 1IJFA 1Z2AA 4GMXA 3G8AA 4DDUA 4ZMBA 3KSZO 1TNDA 3AINA 3L07A 4E7PA 3A26A 3HYLA 2FV8A 2Y8EA 2IV2X 3WJ2A 4IZOA 1U7OA 2KWIA 1CRPA 5JNLA 2DVMA 1B0PA 2VBCA 1CJTC 1XRLA 1WZNA 4N39A 3HJNA 5EXDA 3HCWA 3CYFA 3FVWA 1JR3E 1KSFX 2PA0A 2ZJBA 3AB8A 3SLRA 4CI0B 1DRUA 3PWZA 4KQ6A 1MJGM 1FTWA 1KP2A 4BO5A 5IFLA 1VL8A 4YJHA 1QP0A 1JLSA 1C4OA 2J59A 2QPOA 3F6SA 3G1TA 3L04A 1NC3A 4UHHA 4B8WA 2H4FA 1HTTA 4GVLA 1C1HA 1MAHA 3HSYA 2JIOA 3FCCA 5T64A 1UPTA 3W4IA 3LW7A 4IRUB 4BV3A 2RGUA 2OXEA 2FDXA 4RVFA 3L1JA 1LW6E 2Q07A 1QYCA 5EJMA 3KIPA 5FL7D 1OASA 2QTGA 4L0CA 4I81A 3PWKA 4OPMA 4IWXA 1XLTA 4G5QA 4DARA 4MCAA 2N9UA 4ZQEA 3Q7RA 4BQEA 5L4NA 4QLAA 1RKUA 4QQKA 1CW2B 1FSGA 3LTEA 3GVCA 3R0VA 5K0JA 2IXFA 4DMLA 1LA2A 4H7EA 4MQLA 3N07A 3FFAA 1MTZA 4HNAB 4XJTA 1J5EB 3GJ4A 2JFQA 1L5ZA 2WLSA 3H05A 3I9LA 4FZJA 3K2EA 1H2RS 1RKBA 1GN9A 3FFTA 5TF4A 2VJNA 3SZOA 3FXAA 3FLBA 1GFIA 1W4ZA 2WFZA 3CUVA 4GBGA 3SIPA 4HDSB 3WWZA 2CUNA 3MMXA 1T0BA 1AQYA 2I0FA 2NXCA 1LDBA 3GDHA 1KPIA 2VP0A 1XZ8A 1SBIA 1E9BA 1XL0A 1USGA 4PHHA 1HM5A 2JIZA 2P2GA 2PWYA 2GJ8A 5D3KA 2Y68A 1P62B 4N65A 5EUMA 4W1RA 4UHEA 2H1WA 5JS8A 2OM6A 4IXMA 3LHKA 5IASA 2IXBA 1R6VA 1QX3A 2XMCA 3QWFA 4JROA 5IVPA 1YC5A 1MB9A 2EL7A 1RLIA 3GJ0A 5FBRB 1QFZA 1BDJA 1LDMA 3AOEC 5JBNA 5ICMA 1J2YA 2X9GA 1NIPA 3VDRA 1KQFA 1KFKB 3SN6A 1ZUD1 4QT4A 5E1MA 3AM5A 4P36A 2PMKA 2Q3JA 1D4AA 4H9GA 1F14A 221PA 2C2BA 3O90A 3LC7O 5IN4A 1DGQA 1LNZA 3ZU6A 5JZ9A 4BLQA 4HF7A 2C1XA 2CMDA 1WD5A 1Z6QA 4P3OA 2F3RA 5CD9A 2E7ZA 1DLJA 4LXIA 3LOQA 4HTFA 1XVTA 4IQ0A 1ZI6A 4O08A 4MUBA 3LT0A 3T94A 4CIBA 2C9MA 4PLHA 1M2VA 5KB3A 1KTIA 3VX3A 1MXHA 3KHKA 2VRWA 4WNYA 5F3RA 4J0HA 2C00A 3AUUA 9ABPA 1EMDA 4A92A 2JIZD 3ROKA 1N3BA 2BVNA 4HADA 2PFGA 4LYYA 2X15A 5ITZA 1ONBA 1AN9A 1E9CA 1YQDA 1YJ5A 1ID1A 4P7KA 4I50A 3TTVA 4B83A 3C1OA 4CQNA 5CITA 2QTLA 4H4EA 4XB2A 1R12A 2X76A 4MWOA 5K01A 2ZLBA 2Q6KA 3DF7A 2VOEA 4G2TA 4Y6OA 5AKJA 1F7VA 3KO8A 5EHIA 5YASA 1DIGA 1HDXA 4ZI2A 3BK7A 1XK6A 3Q87B 1QP8A 4PHFA 4PZLA 1FXWF 5EIXA 1V6AA 1TE2A 4MS4A 4OA5A 3IC5A 3HJFA 4MW5A 1Z8HA 1PV4A 3SZUA 2Q7DA 4OH7A 1O54A 2AFHB 3EZ6A 1MP0A 3E3LA 2VDNB 2XZOA 3QYJA 4KXWA 2IKQA 2QN7A 2QD5A 4NEQA 1SULA 2BKUA 2JFXA 3BICA 4P5DA 2BJHA 5BQPA 5KTSA 1Z9BA 3MILA 3FIUA 1JQBA 1O08A 2Q1SA 2O6HA 3C74A 5KDDA 4OXQA 2FPRA 3JD4A 4V1CB 3LAWA 4LK3A 1NA5A 1A04A 3HO8A 2J6IA 2GNOA 2RAVA 2DHRA 3Q3CA 2O5RA 4G1CA 3VHXB 4BFLA 1B7GO 4CEHB 4IPTA 1XCMA 4LFBB 4Y8VA 1YUMA 3USCS 3WICA 5KC8A 2WJYA 3SC2B 1RKXA 2RONA 3TTUA 3DHWC 5FPQA 4R31A 4C7XA 1XTBA 4X44A 1JZSA 5TGDA 1OX5A 1OW3B 4GX5A 2GOYA 3IAS6 1HTBA 5ALWA 3QUTA 4EHDA 3KHSA 1D4OA 3MCUA 3C5WP 2VXYA 4DIUA 2OSVA 2AKEA 2R25B 2NUBA 3HBFA 1WHSA 2G1PA 3DEJA 1XZAA 4BS9A 4ZPXA 1THTA 1C8BA 4RVCA 1BJRE 2WV9A 1EFAA 2WYOA 2OL4A 2XUKA 1MA0A 2VOJA 2ZYTX 3G1WA 3MM4A 3MWEB 4RE6A 4RVNA 2EWMA 3H5TA 4ETMA 1ECFA 3CVOA 3HWX1 5IS2A 4JI8B 3IVRA 2AR9A 3G0OA 2Y99A 3SSOA 1Y63A 1IIBA 1N1DA 3Q8WA 3UENA 4MIOA 4BGDA 3GT7A 3ZGYA 1XDBA 1U1IA 5C7YA 1KDTA 5DSTA 1HGXA 3RV4A 4CCSA 1XZHA 4CCWA 2NV2B 3HXMA 2HZBA 3QVTA 5TQ2B 5C8YA 2ZRAA 4M1SA 1V7ZA 3GJSA 5FR1A 2D7DA 2JZNA 2WW8A 2XOKA 3HPQA 3IT0A 4FGJA 2QTVA 3OT1B 1YQEA 3MT0A 2F48A 2EJTA 1P5HA 1SK8A 2EX1A 3FE2A 2XNHA 5JH7B 3KAQA 4IAOA 2GM5A 1OTHA 3N8GA 1H2YA 3A4IA 1X1EA 4ITRC 1KA9H 1XLVA 2A5GA 4JZYA 3EIOA 1KE1A 1N1GA 2FPIB 2R86A 4HFMA 3O4HA 3DE1X 1CJCA 1TM2A 2PKEA 3MLBA 1TJ5A 1PQUA 3NHPA 3PUWA 4N41A 3I9FA 5M04A 4G5RA 4LMBA 5C81A 3A6LA 1EGMB 3ASYA 4COKA 5KWIA 3SLKA 4TSFA 4LF8B 3AESB 1QZUA 1Q17A 3M9WA 3T0FA 2CUTA 1MBZA 1EFPB 3MS2A 4AG5A 1Z0JA 2VTKA 3B3GA 1A71A 1VCOA 2BUCA 4WXPA 4PRYA 2EP5A 2MT9A 1M2EA 5I5EA 1QV7A 4KLCA 2IS2A 2H08A 2B1JA 4Z49A 4FBMA 1MQ9A 1QIGA 4QGGA 4AKSA 1JIXA 4X8LA 4BNLA 1EFCA 2OPBA 3B38A 2E0IA 1K8QA 3GCWA 2FPUA 3HEBA 1UC5B 1Z88A 1Z39A 1BW9B 3S1AB 5HK9A 4Z9FA 2ZULA 2RSLA 2G7MC 3B12A 2C3PA 3AY7A 3EDOA 3NU1A 1P2VA 1SR8A 1U8YA 4LNUA 1DMSA 4I8IA 4D6YA 3RIHA 1YS2X 2VS1A 4HFNA 2N46A 1E0DA 3TR6A 3L7MA 3T9AA 1YU9A 3SGLA 4AJJA 4O1MA 2XOKD 3EXHB 4QYTA 1PRYA 4JDUA 1N34B 3ADBA 3SK0A 2QG4A 1KI4A 3EBOA 2WC1A 4CFYA 5FTWA 1E92A 1TJPB 3SPXA 1RTTA 3EMDA 4L0DA 1JT9A 3HQ4O 4PSDA 4QPJC 3F8SA 3VGPA 4CPDA 4CIAA 2JB9A 3KOWA 3MOIA 2QW8A 2XQJA 2JGIA 1N5KA 4WECA 1RSZA 1XMIA 4JQCA 4XDGA 5AI8A 5DK6A 1V45E 3D3KA 5IF9A 1E1CB 4HXFB 1H2ZA 3TMAA 2NADA 5FDFA 1V5GA 2HO5A 3CF2A 5B5SA 2EJVA 1N7JA 2EATA 2POQX 4JX8A 1PS9A 2Y05A 2NSHA 3AOGA 3AYZB 3IP3A 3TI7A 3LC0A 4QXOA 4U9UA 1A82A 2X3YA 3MS7A 4L73A 5KVCA 1GYRA 3E5HA 4DREA 2QRMA 1NJ2A 4D4IA 2AG6A 3MNFA 1GTG1 2WF6A 3EWSA 1N6NA 1ULZA 1TTHA 3PXGA 2FPKA 3LGSA 4OQPA 1MEOA 1D4FA 3AY3A 2BR5A 3QA9A 3L6DA 3Q3GE 1T24A 1RWWA 3R5XA 3EGIA 2BJVA 3RVNA 1RTKA 2HA0A 4NWIA 4CM7A 4DM7A 3GA5A 4EY3A 4ENUA 2GN2A 3THXA 2KYRA 4NAVA 1FFGA 3WGNA 1J21A 3GRZA 3FI0A 4XUDA 4RMJA 4E2YA 4MB2A 5SZKB 1PJBA 3FROA 4DA7A 1WW8A 3BWCA 1R88A 5ALQA 3V7YA 5ANRB 3UAVA 2DWOA 4BC0A 2OAGA 3LQYA 3KOMA 1XTRA 1VJ5A 4PNEA 3ANMA 3OOWA 2CT8A 1XPOA 4AO8A 2Z3VA 5JSHA 1A8HA 3U60B 2DPMA 2WT4A 4HCJA 2ECQA 4FTWA 4UEQA 1SOUA 2ZI4A 3C1UA 1AO3A 1NYQA 1QC5B 3PJRA 5IZCA 4J0DA 2F6RA 2BF4A 1G8MA 1I51A 3G2HA 2MYUA 4CM9D 4AJKA 2YBDA 3H2SA 2ZRBA 3EJ6A 3HY4A 1ZGAA 1DEKA 2H8KA 5EL0A 2JGEA 4UNQA 1Q92A 3NEPX 4ND7A 1L5FA 3HUFA 4MKFA 1EUZA 1VMEA 2VDPB 3KTDA 3EOAI 3NRBA 4IS3A 1A8IA 5I7FA 1ZNQO 1R10A 1NHWA 1U2SA 3CF4G 1LFDB 2QTRA 2FSUA 5F2KA 5HGXA 2LIPA 4J1TA 2R6CA 3GARA 1V8OA 4Z8XA 3SC4A 3UJ9A 5JRDS 3S1SA 2IHJA 2V74B 1T6XA 1WXIA 4XXHA 4CKEA 3HBAA 1WNTA 4ZDKA 5HUHA 2QRVB 1W4AA 2INGX 4KIGA 1XB2A 4YMLA 5TJ9A 4F21A 5EVCA 3N8NA 3DZBA 1L5HB 1MT0A 2W71A 3TL3A 1II8A 4BQPA 2CDRA 1FQKA 4GECA 1GA6A 4Y2RA 4CEIA 1B6RA 2XSZA 4CKCA 2JEOA 4LF7B 1U9IC 2V7VA 3DT6A 3LZ6A 5KCMA 2XWPA 4PLWA 2FZ4A 1BDBA 1XIVA 1U7HA 3C43A 5FTMA 3SJBA 3X1JA 3BIXA 4XX1A 3UC5A 2VHJA 2HGZA 4NS1A 4X1IA 3VKUA 1WMFA 2ZS9A 5G4KB 3WIDA 4JLNA 1JDSA 1UWVA 4D8TA 1QDLB 1T9GR 3IO5A 3ZNNA 2W6NA 2D1TA 1B42A 3WGKA 3NATA 3WLSA 4ZCRA 2DF8A 3E3OA 3KKKA 2VDLB 1ZJWA 1HUQA 4LJAA 4IIVA 4P7BA 4DNFA 4QJBA 1H8HD 3AKCA 3GDOA 3IV9A 3QYFA 1A9PA 4DSZA 3IVGA 1EDEA 3E9ZA 1P1IA 2YMPA 3LIPA 1MH9A 4Q1EA 3CUTA 3HCAA 2PL9A 1YB4A 3KKZA 2A33A 3NIWA 5FBVB 1K6MA 4CUZA 2ESRA 4J9VA 5C18A 3CCFA 3WG9A 5I48A 3FBWA 2OWEA 2PGDA 2O4CA 5ISMA 1GM5A 1NAHA 3AP3A 1G3UA 2WI8A 1X7WB 1X77A 4LPKA 3P4XA 4MTLA 2GB4A 4JLSA 3L7YA 4Q4HB 2WWGA 1ES9A 2WD7A 2NO9A 3GMIA 5U9CA 2H00A 1WXQA 1SCUA 2IH5A 1NP7A 3EFEA 5ES3A 4K9DA 4P22A 1ZIXA 4TWAA 4B35A 1NBMD 5JS7A 3NCTA 1TUIA 2E85A 2GK3A 2XSZD 3OCCA 4LHVA 3BJZA 4QYMA 3TQIA 3C98A 3KQYA 4DGQA 4EG7A 3OZGA 1IEXA 4WNIA 1KI2A 4FDMA 1ABEA 1CX9B 3JALB 4I5FA 4MDEA 2W2TA 4E94A 1P7CA 4IGIA 4MVWA 3KUCA 2O2DA 4F8EA 1EEHA 3KEOA 4NTZA 1KEUA 1T29A 4WLFA 4AVYA 4J3JA 3H5IA 3PUXA 2QR5A 3EFOA 3NOOA 5D3MB 5H4GA 1P4HA 4GNRA 3KVVA 4C3UA 2Z2KA 1T35A 4Q1AA 1R4NA 1USVA 5JHGB 2JAXA 4LDQA 3RTCA 1ZD2P 3GRVA 4AJ9A 3FOFC 3NHJA 3MWDB 1WO8A 2V6JA 4P4SA 3AIKA 4QLBA 4YJ2A 1I01A 1Q0QA 4RTJA 1CS0B 3UV6A 3VRHA 2AFVA 3AVTA 2HFKA 2NVWA 3LT1A 4MVJG 1N4AA 4LCEA 5ESDA 4PG7A 2HSEA 4QTZA 1S8AA 1XJQA 4AWAA 3FPJA 4UUAA 3R5FA 4BNNA 1XZQA 2DE0X 3RIMA 3H3JA 3N7TA 4QQFA 2BMWA 3U7QB 4FOTA 3WIEA 2GARA 4OBBA 1MX5A 3UEOA 4A6PA 1S96A 1VE1A 1IOLA 2AX4A 2IP1A 3ACBA 3D3QA 3HLKA 4CR7A 4DRZA 5BSEA 2BM8A 4GXQA 3CX7A 4FNGA 4X9XA 3BWMA 4RTRA 1AF7A 3QUBA 2RFLA 3F67A 13PKA 2C54A 1H8EA 3IQDB 1VKRA 2BR3A 3GA7A 3FTPA 1UDCA 1TX4B 3U49A 4DAEA 5I51A 1HFWA 3DPIA 4LXTA 4TVBA 5JVDA 3MWLA 4JBLA 2XWJI 1S7CA 3DOEA 2GF2A 3LLVA 4RPHA 3MUOA 5DN9A 4QTYA 3ENNA 4P5PA 4Q19A 4DG8A 4JI0B 1Y5MA 3JYQA 4GICA 5BN4A 4KXVA 1NW6A 2KS6A 3H8VA 4HH0A 2JLXA 1M1ZA 4IIJA 4RKRA 4RELA 5TR9A 2BY4A 5E7IA 3D31A 4MRSA 3UFXB 3C24A 1J09A 2NGRA 3TSOA 3W7VA 3BF8A 3AQ4A 2HDNB 3E7XA 3SR3A 4M1MA 4XR9A 3P0HA 1VL1A 3NIGB 3V4FA 5K4AA 2JI7A 1HRDA 4R2JA 4GPTA 2QLFA 5LFAA 1ZYUA 4JP1A 2WBLC 1KK1A 4HTAA 2QW1A 3L0OA 3NVAA 1R37A 2HDOA 2C5HA 2QLLA 3B8EA 1E0SA 4MCHA 4KQXA 4TXLA 3WS7A 3F71A 4CGYA 3ONVA 3U3ZA 2UXBB 3DAOA 4G9GA 4MI6A 5TJHA 1AGRA 1PJAA 4HB0A 4Y6GB 3E05A 2HRBA 3MSCA 2PQMA 4RPLA 4KH1A 4LVCA 3DFIA 2AOWA 3Q6MA 4D43A 1NG1A 2NUPB 2G5GX 2WWWA 3L6UA 3QXHA 5D1NA 3T3DA 1CT9A 4OJYA 4J4BA 1WTCA 2W2PA 5ITWA 2QT9A 3G9XA 3OEHA 3GX1A 1V48A 4YHBA 1U0HC 3FZGA 2XEDA 3A9TA 3F46A 6AT1A 1Y7HA 4ARCA 4HDKA 1CZHA 4LHYA 5EINA 3TX6A 2CHFA 2E4XA 2Q6LA 5ER6A 1W76A 1SVIA 4MQFB 3HWSA 1M54A 4QA9A 2EYUA 2R6HA 2JFOA 3WTCA 4EPXA 1AUQA 2WWFA 3W77A 3QZUA 2VP9A 5M3BA 1SZPA 4YBRA 3Q3VA 4OGLA 4WFKA 4B9AA 4EOGA 4MRPA 3HJUA 4F4HA 4OREX 5IAOA 3D2CA 2HJHA 5H7XA 3FFWA 1S0UA 3DHVA 3HCEA 5BW6B 3KHTA 1ZH2A 3KPJA 2VNSA 4YCJA 4TGLA 3WL6A 4Y67A 1IN8A 4LZAA 3WXMA 5B37A 5TXGA 5DHFA 1M7GA 4R2HA 2ZRFA 1AVTA 4HNGA 1FFXA 4RTQA 3IP5A 1HDCA 3HMKA 2LKCA 4NZZA 4DAOA 1PW7A 2P0AA 2P68A 3OIDA 1MPTA 1XKXA 2IF0A 4AJLA 2IQIA 1XNJA 1RABA 5AK5A 4XM0A 4UNSA 4KR9A 1EFLA 4BBAA 1I0IA 2YHIB 4X6XA 1R4MA 3N39C 4FHDA 1HORA 1MAUA 2ZAIA 3TSZA 3UHJA 1EFUA 1C9EA 2QAGB 1PZNA 2X1VA 2O2IA 1COZA 1XOIA 4E2FA 1EQ2A 2F3TA 1JHAA 2IYLD 1JXQA 4OM8A 3GRPA 1VJTA 3ZE0B 4EKIA 1DNPA 2LIVA 2I3BA 2OHIA 1IPHA 2OYSA 3OEHD 4W6QA 4J4TA 1L7MA 2W8BB 2QY9A 4GI3A 3TSWA 5JQWA 3OQJA 3KJZA 1PT6A 1N2XA 3B78A 3T15A 5LD2C 2WWTA 3UAWA 4YECA 4PLCA 4F06A 4S24A 1OZ0A 5CA0A 1D03A 1YASA 2VHYA 2W7TA 4EHJA 3ZVNA 5ITVA 3E35A 2BEWA 4ZPJA 1GNLA 2ZKIA 4J7AA 1PDOA 3VPHA 4OUKX 3AI1A 2OFWA 1CC1S 1MQSA 1RVDA 2H3HA 3FMIA 3KWLA 3MA0A 4IMIB 3IAS1 5MHTA 5DCUA 2D00A 4RY0A 3K70D 3PQFA 2GWRA 2E6KA 3VI3B 3JZDA 5J43A 1PTJA 4JGIA 1YGYA 3U4CA 3F0TA 3OPYA 4MPTA 2K6GA 3A7EA 1JS1X 2KQUA 3MD9A 4KV7A 2PMWB 1O58A 5CNJA 3ZD9A 2CVOA 4X61A 1LX6A 1AURA 3JSAA 1Z0FA 4G1EB 1NXQA 2AOXA 5B1EA 3FZYA 5TY0A 2P69A 2E4YA 1KGSA 4G0NA 5E1OA 3W6OA 1KZ7B 4D9CA 2VEDA 3PIRA 4BKUA 3UT6A 1D9ZA 4C3OB 3TOCA 2D4AA 1YU6A 2CYBA 1YDMA 3EOBI 1CP2A 4LJKA 2WFLB 3DEYX 1L3IA 1VE6A 1I7QB 1F0PA 1S9HA 3N2LA 4EGSA 1FSSA 1AGYA 3FDFA 4JZKA 4TSKA 2A5JA 3R8FA 2K2QB 5BNTA 1FXSA 3OZFA 1E1QD 5TQVA 3WK8A 2WAMA 4HXGA 4ZWNA 4QGSA 4UMDA 1FDVA 3VO9A 1MABA 5AM1A 4AP6A 2A9PA 3L40A 2QVGA 2DUJA 4H1HA 5COQA 4A0SA 3LECA 1F2TA 1E1DA 1MW9X 4EI9A 1T5TA 2HHLA 2WYUA 2BEVB 3FUUA 3NOXA 3VNVA 3QVVA 3S29A 1IOWA 4QIHA 5F5XA 2JA2A 2QPLA 2EJUA 2G9ZA 2OPHA 1A8QA 3E5NA 1Q15A 5K09A 3NV9A 4KQ9A 5F51A 4TRRA 4EDFA 4L4XA 1TKAA 2PYIA 2JIBA 2QVYX 1A4UA 1RXIA 2HC9A 3UB2A 1DRJA 3VYTB 3D1LA 4L6AA 4ZQCB 4ETWA 4Q4CA 3SZ3A 5LZ2A 3BBPA 2ODEA 3KAJA 1U6IA 3U7GA 4KRFA 2C9YA 4B71A 1YA4A 2JIQA 3TQSA 2JI6A 2V3WA 5JJCA 2W2KA 4OQFA 1WP4A 3NVMB 3VMMA 1EFVA 3X1ZA 2UZAA 4DCOA 3FTQA 3LPMA 3ZK9A 2CLCX 3Q7PA 4O2RA 4UDOA 1DV1A 4POOA 4KQHA 2R8YA 3OTQA 4MPPA 2EW1A 4DJEC 2FK7A 1XI2A 3BSFA 2EKQA 4BFWA 4BJ1A 4GVPA 3L92A 3VXKA 3NKVA 4FOPA 1VKNA 4U5XA 1ZSVA 1BN6A 2JDIA 3LQ2A 3VR3D 4CHTA 2QP3A 3NFRA 1CUUA 2PGAA 5FP0A 3I3OA 2OVBA 3L6CA 2NP6A 4BVGA 3H16A 5FPSA 5JD3A 3PG5A 1CHDA 3EUFA 2VDOB 3E22B 1X7HA 4LXGA 2OHVA 1Y8RB 3VHQA 1QRSA 1E1RA 1FUKA 1FZQA 2WVAA 3R0ZA 2Z9DA 4N9WA 5F5NA 1UDRA 5F73A 2BSXA 3SHWA 5CFOA 1Y8AA 2UAGA 3P9NA 5ERXA 4ZTZB 3ZZNA 2FEMA 4OL9A 4P4LA 1ODIA 3AJEA 3QFHA 4NPAA 3QY0A 1U3FA 521PA 4QPPA 2JKYA 2FMXA 1Z56C 1G60A 4I9NA 4R68A 4E6EA 3K0CC 4X1YB 16PKA 1ESMA 1SXIA 3EA4A 4DJ5X 3W2EA 5C8DA 4CLOA 3KQHA 4G97A 4IIDA 4ROTA 1QH8A 5A0FA 5FB3A 4CMKA 4RGVA 5HF6A 2X40A 5LA6B 4HZGA 4G23A 1QE0A 3DEZA 1EWVA 2ODPA 4YDSA 4B4DA 3DWEX 5I3CA 1O8BA 4FNMA 1ZGGA 3MPUA 3E03A 3FTEA 2OCBA 4P2GA 4DA9A 2GDZA 2WPDA 2PKCA 2PT7A 1AXEA 4N3BA 5JCXA 5JZBA 3WRXA 1Z35A 1GAEO 2MWMA 3TG8A 1B8PA 4HNRA 2NPFA 2GEFA 3VSCA 3H5VA 1QO7A 1AUPA 4ZREA 4TKVA 1GY8A 2O2SA 4OQDA 4C6TA 3CLRD 3AP2A 1PG5A 5HKKD 2BF7A 3KPWA 3U61B 5LOVA 4KUHA 2E4UA 2QN3A 3JVIA 1JDZA 4FOLA 3HJGA 2H4JA 3WLLA 4CMAA 2GZHA 4HAZA 1E1RD 1GZ6A 2OQVA 4FINA 1E6CA 1EM6A 1K9SA 3W6UA 1U90A 5KTMA 1P7VA 4F9FA 3FPLA 5IM5A 1L7AA 1G63A 3MVEA 3DAHA 4LWPA 4V3BA 2IRWA 2GN9A 2VCYA 3C7DB 4QTXA 5KS2A 4Q7EA 4YRKA 2ZI3A 3PFCA 1F8UA 4A1OA 1ICEA 4R41A 2EX0A 1I30A 3KCQA 5D1HA 3D0RA 3EF1A 2B4TO 3FUCA 1L4YA 3CTPA 1PYOA 2YHBA 4MYSA 4FMDB 1I94B 3WGYA 4AJPA 4WESA 2IIBA 3BJEA 3L77A 4GC5A 4M0LA 4OO3A 3RBAA 5BV2P 3QRWA 4DBLC 1KI6A 2DQ4A 3FNIA 3M6VA 5I5GA 1RJ9B 1O7JA 1NMXA 1N9KA 3CUSA 1YZUA 2QVXX 1GAQA 2V7PA 3NTRA 2CXUA 3JY6A 4L85A 4PXAA 4AMUA 5C31A 2BKLA 4UUOA 3R41A 2HPHA 2HQOA 1RXSA 3NP7A 4WVFA 3N28A 2GAOA 2XNKA 4MQ6A 3SX2A 4Q4JA 2GR9A 2AQIA 4Q24A 4O3FA 4V0MA 2H1VA 3UWMA 4KPUB 3D1JA 2BFOA 2NYRA 2NN3C 3BQ9A 2VZ9A 3Q40A 2E6UX 4Y3UA 5CDTA 3TSAA 2DUUA 4IKOA 5IMBA 3WAJA 1L4MA 1NN0A 3PD7A 2E55A 1DADA 2XZLA 1GV0A 3SFTA 3UAYA 4HQFA 2FZCA 2CHVA 3TIVA 3ZCRA 2FF5A 4MYHA 1GHTA 4MDHA 2OMEA 4MJ7A 4NRDA 4XDZA 1KEKA 1Z2PX 4KK3A 1A2OA 1BHO1 3H04A 2ONJA 1ZOSA 4BRWA 1YQXA 1OA1A 2CLKB 3FBGA 4JL6A 4PONA 4HPJB 4XFDA 3EZLA 1VL0A 1YACA 5FBKA 2FE1A 4E1AA 1L5VA 3HJAA 4YMSA 5H3HA 4HLQB 1SHKA 1M72A 1JTEA 1AKVA 3EG9B 4FWIB 1Y4ZA 2CHUA 1FDOA 5G0SA 1ZW1A 3QIAA 3LT5A 1W73A 3BWVA 5ECYA 1ZOPA 3L7JA 4C4ZA 3DEHA 3GP3A 3WLMA 2P4SA 4L6IA 1E4VA 4A36A 1QNFA 2VH1A 3LUCA 1HI9A 1S89A 2PAAA 3IR5A 5CDUA 5LKRA 2WIKA 1U0BB 4HQ0A 3H86A 1DCFA 4EPRA 3F4BA 4TMXA 9MHTA 2Z58A 4PYIA 1LPAB 3UXHA 1PAUA 1FDRA 3IXMA 4TWJA 3NOQA 1ISIA 2QLMA 4AZTA 2J3EA 3WLRA 3FWPA 4F04A 2Z5GA 3B8HA 5EIHA 1JXMA 2CWWA 3SS8A 1KI1A 3FH0A 5E0OA 2VBIA 2ZJ6A 1WKCA 1DAFA 1TA9A 1FRVA 2NNLD 1GG9A 1KNQA 3WNCA 4ERXA 3CRW1 2WJAA 3I5MA 3ELYA 4O02B 3Q8LA 1RYMA 2ZWMA 3G0BA 1QAOA 4PX9A 4UARA 5B1IA 3PF8A 3DAYA 1JYEA 1QK5A 2WG2A 2A2ZA 1H3FA 3HI6A 4YAOA 3TRIA 1MB3A 1PN3A 4RS4A 10MHA 2IU3A 4LV6A 1MIOA 5LNK1 1M2OA 4IEEA 1I9CA 4X1KB 1WMEA 2F59A 2FUG6 2C92A 4LBWA 4RCZA 1NU6A 3C3MA 1ZAYA 1Y1KE 3FOCA 2HYDA 4GNKA 5ALLA 4FHEA 1Q91A 1YFJA 4DWJA 3V80A 2YNMA 3QVUA 2DTXA 1NP6A 4O4HB 3WJAA 1JECA 2B8JA 4JJIA 4ZAFA 2I65A 4RULA 3IFSA 3GGJA 4BO2A 3GRFA 2IV3A 1LC3A 1YI1A 3I42A 3K0FB 3I0ZA 1HYQA 1NBWB 2J3IA 4G5HA 1ML4A 4IOKA 4CV3A 4JVMA 3ZV4A 5DNUA 3BD8A 3LH5A 3AUYA 4HN2A 3WHIA 4DCUA 3T41A 1W2GA 4HLDA 3D8TA 5ARBA 3DS8A 4CF7A 5FYDA 4QBIA 4AY4A 2WTNA 2FWPA 3DDUA 2GX6A 4C0HA 4G07A 2OBYA 3ZE1B 1UBSB 1XDWA 5AH0A 4P3KA 4KE6A 2XVMA 2CK3A 5KJCA 1PU2A 2WUDA 1P1KA 3RREA 2CCGA 4DUGD 1QM5A 1DP4A 3T9DA 1RRVA 3BMOB 5EHXA 3LV8A 4QATA 2V1UA 1ZOOA 2KMLA 4DNOA 1RPNA 3VPBA 1CIJA 1MIHA 1SXJB 5TS2A 3WSTA 2VJPA 2HF7A 1WD7A 3E2MA 4MPJA 9LDBA 4M8KA 2FUNB 1E62A 1GZ7A 2ZRLA 3BCRA 4R8VA 4LF9B 1E98A 1HQKA 7MHTA 3HB1A 5LB4A 2QR3A 3VKHA 1XNRB 2ZTVA 1TEVA 4HQRA 1RP7A 2VBGA 4M89A 1SWVA 4LVUA 5BSKA 3GMTA 3PA6A 3G6WA 2C9CA 2PWPA 3TLJA 4ZN6A 5DBHX 1EESA 1JU9A 4ZVSA 3HKDA 4PHTA 2CGEA 4E46A 2GFHA 1FBNA 2YW2A 2QV7A 3UIEA 2HIHA 3ZQKA 5LYJA 6ABPA 1NHGA 1K5GA 3UJCA 5CHYA 3U4GA 5IJAA 1Q2UA 4RO0A 1TJ3A 4MZDA 4PG5A 1K0UA 1JJVA 3U3XA 2Q0SA 4OVKA 3X2FA 5JFGA 4Q7JB 3K5PA 1SIBE 1Y82A 2B30A 3D2LA 4N49A 4IEFB 2V7BA 2X42A 1UCFA 4X20A 5FFFA 2V0CA 4YUVA 1IVSA 2IYQA 3AHIA 3EWIA 3U5TA 3DKKA 2JI9A 2OK8A 1KU0A 3L6RA 2CSUA 1OT3A 1ZN9A 3FCAA 3V8NA 2JZCA 1MGOA 1I3MA 3FNFA 4BZWA 2Q3FA 4E7OA 4TWRA 2GCOB 4UVHA 1P6UA 3Q6IA 4L1KA 3U4QA 3MT8A 4Z2AA 3ZJ5A 1ZHFA 5EKUA 1XRQA 2W6IA 2V6GA 3HKCB 4JJEA 5ALVA 3AFOA 2NU7B 4M46A 5EEHA 3TCKA 1U7TA 3WYGA 3MQ4A 5DH9A 4F84A 2PXXA 4RZSA 4KFTA 3UW3A 2D1RA 1Z06A 4DLLA 5FLXA 3TKLA 3VZQA 1G7TA 2XXBA 1GKYA 1HDIA 3MTJA 4LZPA 3VH4A 4Z8YA 1ECPA 4CUJA 4X8OA 4S05A 1KO4A 4W5NA 4K6OA 4AMBA 2SKCA 3T5PA 1JFVA 2J46A 4KQIA 4LA4A 3IEIA 5FOVA 1IQUA 4JJKA 2B3DA 1UF9A 4BB6A 3R20A 4RS3A 1ADGA 2ZQYA 3JWPA 4P1ZA 2J5RA 1EFDN 2GXUA 5CMLA 3TLGA 2HA7A 4FFBB 2QP9X 4YCSA 4E22A 2AZTA 1UMCA 4PSCA 1C0LA 4ITUA 2HADA 5DYTA 3RQIA 4F4IA 1A8UA 1POWA 3UXMA 2H1OA 3GNTA 1O0CA 1VSVA 3HRHA 3KKEA 4LXXA 2JFUA 4OYRA 2MINB 3DULA 1IWBB 1XZGA 1CWUA 1DAGA 4JY7A 4KVGA 4QG7A 2R3SA 4YLGA 2WU3A 1G3QA 3DE5X 2R6ZA 2PX0A 1SIOA 2R4QA 4OP1A 3WNQA 1QVVA 4YJFB 1GCAA 3JS5A 1QU3A 4FX5A 4LJ4A 3GCZA 5ILOA 3CT6A 3INYA 4UW9A 4G26A 3WRYA 5JROA 3EX7C 1N2CA 4ML3A 1P2TA 1UJNA 1ZR4A 2IOFA 4KXFB 2BTQA 2YJGA 5IVIA 4Q1VA 4O3MA 5A1TA 5BNIA 1UK9A 4JJAA 3RKRA 1KQPA 3RYIB 4ENSA 3W8NA 4KAFA 2JHCA 1UBJS 4IJKA 1ZHOA 1GWNA 1E2PA 2B61A 3EUEA 2GD0A 2WM8A 4X62B 4BLTA 5BR7A 1B15A 3AI7A 2AZ4A 1USIA 4B9EA 3CZAA 4IZ6A 2LD4A 1C4XA 1R0CA 5JBQA 1MOSA 3ICVA 2BMFA 3DZGA 1Z3CA 4KH0A 1N0VC 2ADMA 3LX4A 1KVSA 4PX3A 5LA6F 1IEVA 3RVOA 2EBWA 2H2IA 2VQ3A 2R1TA 2Y0PA 2X1LA 3LVBA 4RSHA 3I01A 1USUA 3FUXA 5EPUA 4DYHA 2AEEA 3DZKA 1L8OA 3CZMA 3T9EA 4HPXB 2AW3A 2W9XA 4P98A 5CLHA 1YL6A 1FYVA 1CIPA 4NYMR 4R9UC 4CV1A 1FFSA 1Y4SA 2HCTA 3BGIA 4M53A 2JBWA 1KY4A 1UKAA 2QS9A 2R7LA 1EUDA 3EMBA 1HE1C 2BGIA 3OFVA 4QECA 3KSAC 2ZYSA 4WBXC 1DIBA 2YMQA 4G4JA 1Z4IA 3VVMA 1JQDA 3HXPA 1JQ5A 1L7NA 4PIVA 3O2JA 2BWJA 4IXTA 3RTAA 5FV7A 4WIAA 2FG5A 4L8GA 4ZCMA 1REQB 2XF8A 5A4MS 1NNEA 2BFBA 5FBLB 2PT9A 3NIDB 1EE9A 1GYPA 3MJCA 3OIVA 4JJ6A 3R9XB 3IDQA 4L78A 1BEZA 3U26A 3DJFA 4EHBA 3O7MA 2W2QA 2X2OA 1X7XA 4J0EA 5IKMA 1QTRA 3B3FA 1GSAA 5DDIP 2B37A 3MTIA 2ZM5A 1V1RB 4IR7A 2A9RA 5DMHA 3SICE 4KDCA 1B8UA 1L7VC 4X7MA 2AMYA 2ZETA 4XWOA 3FRIA 1Y5NA 1JHQA 3BSSA 5C37A 1RPTA 5EJ7A 1ZVKA 4P3XA 4D8YA 1DT3A 4FMDF 3COPA 4EWLA 3SU8A 1B8OA 3T5DA 1OH5A 2A78A 2WJPA 4FYYA 2GVDC 4R9SA 5DISB 2H1RA 3ZE8A 3X3HA 3WGJA 1EVZA 1J5XA 4FQ5A 4J16A 1QHGA 3BGVA 2D0IA 1X42A 5MF6A 2B20A 2QE6A 1NFQA 2PSDA 1UKBA 1Y8QA 4ARAA 1NMEA 1ZGJA 4R8MA 1K88A 4DBVO 2DWQA 1TW3A 5HQTA 4DDMA 2NO6A 3AF2A 2IHVA 3ITEA 1HOTA 2A5YB 4OHRA 2X0FA 3ICOA 1TCUA 1S6YA 1ZGBA 2AN5A 4MQEB 2JD0A 2A9FA 5A7GA 4BQIA 4KZPA 3E9NA 3KDSE 4LBYA 3RARA 3VO1A 3ICPA 5IWAB 1SHZA 1VYVA 2VUTA 2ZUFA 4Q9AA 3Q5DA 3ZIAA 4GLLA 4AYWA 4E11A 1NVAA 3BULA 4HQ6A 1Z6PA 3E5MA 4H7DA 3EZYA 3B7PA 1AY0A 1IQPA 1ND6A 3F7NA 4TYQA 1E79D 1DUVG 4XVQA 4ALKA 5JAZA 2AFIB 1D6SA 1H94A 3R7NA 1WSDA 2XUJA 1EQUA 4DDTA 1ZX1A 3UK0A 2FSVA 1Z8NA 1H0SA 5IT9A 3SSAA 5G1OA 1VYHA 3ER9A 1N2GA 1C80A 4AS1A 4W9MC 4V39A 1H4QA 3MJHA 1E6UA 3FUWA 2BLNA 2Y27A 4P58A 5EKDA 4D3YA 1AF4A 3LT2A 1NVVQ 2BE7A 4MUNA 4Q3KA 3V4OA 4H0FA 3F4KA 3RROA 3W7AA 2CMFA 3OCYA 2QJTA 3QV1A 2HLHA 3ZIUA 2DKNA 1B6GA 4EUEA 4QFBA 2WZQA 2GN8A 1UT6A 1WXFA 3GN2A 3K09A 4TL7A 4K3VA 3A6KA 1HE3A 3TFQA 4KXYA 3TZHA 1W6UA 4HQOA 3Q1KA 4LCJA 5KDLA 2IPAB 3NOVA 2P77A 3V1LA 4D9KA 1KFJB 3GPIA 1DAHA 4CIVA 1P2DA 3EGWA 2W6JA 3ZPXA 1J8YF 3OURA 3T1VA 1ULBA 2IY8A 2WIJA 1WBBA 3ER8A 4G5XA 4J0KA 3QU9A 4CLDA 3ZIAD 1J2JA 1U99A 2J9ZB 1KH1A 2G28A 1L7RA 1PWHA 3T8YA 4HZUB 4RY9A 3QENA 4UU7A 5BR4A 5J2TB 4FZVA 1KWGA 3PLRA 3IIKA 2OCPA 3LLUA 3LRTA 1JEAA 3DKIA 5GJBA 1RZVA 2C96A 1VLVA 2Q1XA 1VHDA 1Q22A 5IK2A 3DCNA 3IAFA 3BE8A 4QXQA 1F20A 4JVNA 1LSUA 2AFIE 1FC0A 3OU6A 4LRQA 3OZVA 5K8LA 5CFMA 2DR3A 2KX7A 1LLFA 3NWPA 3ESCA 3EXEA 3B1FA 3RNLA 2XGMA 2JC3A 1OI4A 4B3FX 4CMJA 2YXDA 4CNBA 1F2DA 2C2HA 1WIWA 4CZ2A 1RLMA 2ZBVA 3MB5A 3T9FA 3JWIA 4F6CA 4FFVA 3T5TA 1YI0A 4Y7DA 4B8YA 5I4CA 1ONSA 2MSKA 3K9NA 4QGFA 5D7NA 4WXEA 1VHLA 2IPNA 3IAAA 3FWYA 3KT0A 5GM1A 4AN4A 4B6JA 1BXRA 4TLEA 3UA4A 4MRMA 3MAJA 2NO1A 4HEA1 2AOTA 3NIBA 2J5QA 5FQNA 1I4LD 4NU0A 4TMFA 3FWNA 4OI2A 3AUSA 2XTMA 4C7JA 4CI9A 5CBPA 1F6WA 1QCCA 3ICCA 2HWXA 1I6WA 2I8CA 2YXLA 3UYKA 2PZFA 4DJDC 4FDVA 2DLDA 1AD2A 2R11A 1J9EA 1IPFA 1YUBA 4AJ2A 2UU9B 1OU4A 3L18A 1PT8A 3K9BA 2VUHB 1GQOA 2PNJA 4S1WA 4F56A 2XAAA 4QM6A 2OCYC 3VNUA 3LQKA 5AJZA 5AW3A 5IFKA 4L08A 4ATNA 2PCJA 3L7OA 3LWBA 3AEQA 6LDHA 3U1BA 2TMYA 1MJFA 1U98A 2BV3A 2C5EA 2CE2X 3W5SA 4J75A 3FYHA 1II9A 3ME5A 3MGGA 4G0OA 4RSGA 1BE6A 3J7AC 1DX4A 3UOAB 5FFMA 1YDGA 3ZJYA 1EGHA 1PGQA 3BHNA 4N5LA 4YR7A 2D7CA 2R79A 4XR4A 2VQSA 2Z8YA 3BWBA 1B0AA 3IUBA 1YAHA 2W00A 4WTOA 5D01A 1IATA 4A8JB 2PRYA 1FK8A 3DE3X 2W6MA 5E4TA 4ER0A 3PF9A 3H5AA 4TZTA 1B1CA 2Z3ZA 3EBLA 4K86A 4FUTA 4PFJA 5CB4F 1J8FA 3QVKA 3BBLA 3P96A 2XYRA 3OJFA 2XVXA 1ZKDA 3CTMA 2YH2A 4MS3B 5E6RA 2QMOA 1FJ2A 4NE2A 4M1OA 2DERA 1F9AA 3TB6A 2DFTA 3DCJA 1ZWLA 4HS9A 4WL0A 3RU7A 3T1NA 3TM4A 2ZIXB 3A6ZA 3VYWA 5A03A 4BMYA 1KF0A 2X14A 1BG6A 2YV2A 1GTL1 3EZNA 1WLYA 4G24A 5BPFA 5I4BA 2BUAA 3B1JA 3L7AA 1OPRA 4KFSA 4YDHB 4EKGA 4V0RA 5ABPA 3UK7A 2NO4A 3ZTTA 4ZHSA 3BTSA 1N5OX 3ZOKA 3RYCB 4F1KA 2J07A 1MVOA 5BN3B 1BRTA 1SU4A 3PC4A 3V8EA 3DBIA 2PGJA 3SSNA 3VA7A 4KO3S 2G63A 1KI7A 1QZXA 2QVCA 1MNQA 3PTZA 3W7BA 4BNWA 4ARBA 4UAJA 1T6BY 4YP7A 4QZVA 1G59A 5TDHA 3SBXA 1JHXA 5CCDA 2HIAA 3OC6A 2WSBA 4GYYA 4NYJR 4AIRA 4E2ZA 1K6EA 1FQOA 3QU7A 5ADVA 3CPEA 3PFNA 4ZHQA 2FNAA 2B69A 1F2VA 2P1DA 3SBOA 3HL0A 2Z0MA 4GI7A 2HFJA 3DNMA 4CM8B 2H9IA 2HSGA 4G0VA 3QW4B 2H17A 1GR1A 1X8XA 4YALA 2G83A 4D9IA 4EUFA 2WMOB 4BOYA 4IXNA 3KUUA 4K9PA 3ORSA 1U7WA 7MDHA 4PWYA 1R9GA 1JPJA 1XSEA 3F9RA 4L27A 4LC0A 3FRHA 4Q48A 1Y3AA 4EB8A 3IMGA 1EGVB 1J8DA 1UDAA 3NAZA 4FZ3A 5EMLA 5MFZA 4MVJA 1IHDA 4K6HA 4C0WA 2D8AA 3GQBB 1XAIA 1HDGO 4ALMA 4BXOA 3MJ4A 2XXAA 3PE3A 2H1CA 1TF2A 2EHDA 2G06A 2OCXA 2R2GA 1IEWA 3A9SA 1ZM4A 2COUA 4GQBA 4HP8A 4M0UA 1D07A 1Z6YA 3EQ9A 1OXSC 2BE9A 1A4RA 1UKVY 3QEMB 5HOQA 3RVPA 4WWHA 1U0GA 2EBHX 2Q5OA 1COWD 3CLKA 1KC3A 2IV7A 4J1NA 4KXLA 2BFMA 3HCNA 4MRRA 2VPXA 4XGIA 3MB8A 2VSYA 2RJNA 3I58A 1NDQA 1Y6FA 5KOHA 5JNRA 3C7AA 3NTLA 2GYWA 3O1JC 1R0YA 3V9AA 4UASA 4G2NA 3W2TA 4K6FA 4JEIA 2FDCA 3CEMA 3S55A 3BRQA 1YE3A 1K08A 3B5EA 5KREA 1ZA1A 2A84A 2I67A 1QBGA 1FNBA 3NG1A 3VBCA 1XHFA 4PLZA 4G0YA 5LZ7A 3JTMA 3V6LA 2C61A 1CF9A 3E4DA 1WZUA 3B2QA 4TTAA 3UUWA 2WJGA 3EEIA 2PSJA 3TE7A 4A2CA 1V3VA 1II0A 1JFFB 4KYVA 4RF4A 3H3FA 4WKCA 3RJZA 3OFNA 4LY3A 4H7FA 2FZEA 3ZLTA 1U81A 1HK7A 3OT4A 4WERA 4KG7A 5ALNA 1D1TA 1PFGA 1RHKA 2H6EA 2WIDA 1IK6A 5CH8A 5ENVA 3U62A 4Z5XA 5F9HA 1T8UA 2QU7A 1P9LA 2J3MA 3NH6A 3SQNA 1LTQA 4CTKA 5ALZA 2OO7A 5KWEA 4IH9A 2ANCA 4ENWA 2P9GA 3IQXA 3V7WA 4ZP1A 1NN3A 5E9AA 1W85A 4KOEC 2IIQA 1PEKE 1J0DA 1NLYA 3BPSA 1Y7LA 2FWMX 2VNIA 4FGLA 1OX6A 4Q00A 1X1CA 4JT9A 5EIFA 4BKQA 2JFGA 5HKBA 2P3OA 5EG5A 2EQAA 2HDHA 2WYVA 4FLFA 4I55B 2EP7A 4LQ4A 4MITA 4BASA 3H2KA 4QFCA 5HJ7A 4X94A 4JL5A 2GHRA 4LHEA 4CN8A 3SBEA 3ZW9A 1EFTA 3LRXA 3W3AH 5A0TA 5EQFA 1FBTA 4E5KA 4MVJI 2M2IA 5KU7A 1OAOA 1OWPA 1QCDA 2V4MA 3E3NA 2EQ5A 2O9JA 1MAWA 3OZUA 4KXXA 4NC9A 5DBEX 2J9RA 1VP9A 3RS7A 4UM9B 3H7IA 5E95A 3BC1A 2GHTA 5FHQA 3O26A 3A25A 4QBFA 4ZOCA 1ECCA 2ZB3A 2P41A 5KYYA 4KIFA 4LSZA 5AVSA 3N0TA 3OOJA 2CJPA 1AM4D 4URYR 4XZ3A 1QHHA 5K1ZA 3DLHA 4ZD6A 2O3RA 3SC3A 2DLCX 1MO2A 5CX4A 2ZWAA 1AG9A 3R3SA 4MZXA 4JXKA 3D4IA 2O6LA 4NONA 4XIJA 5AOVA 5HZHA 2QGFA 1YKGA 4M4SA 4BGVA 3NMUF 1CUXA 2CXSA 2L17A 5EOVA 2VG8A 4F1JA 1ZXXA 3C3PA 2R6FA 2I6UA 2PDAA 3DOUA 5JALA 5A6SA 3SHVA 1T6ZA 3LHIA 3WLPA 3D0QA 3DFUA 2O52A 3LK7A 2H2HA 2V6FA 5T6BA 3T7SA 2REQA 4RJKA 1TQ2A 3OVMA 3VVCA 3NBXX 2Q4DA 2GVZC 3UHOA 3OJ0A 4Y6RA 3ECCA 5FAXA 5DV9A 3LDGA 8LDHA 3QVSA 3Q9UA 3HLYA 3NWJA 1UPAA 5C5DA 4AO6A 2JLZA 2C03A 3W8FA 4MULA 1EBFA 4DDKA 4CE6A 1MT3A 2DRIA 5C7LO 1U0SY 4PQRA 1ZZGA 1DUSA 1H4VB 3T7RA 4YMGA 2H1IA 3JQBA 3M5PA 3ANXA 3D6AA 4NBRA 2NUAA 4EHAA 4XSHA 1CG6A 4YCNA 3THYA 4V24A 4GDMA 4ZZ2A 2OSBA 2GMWA 3MERA 1RBMA 4BBJA 1IOVA 2P7HA 2VDQB 3M83A 3OIUA 5HX7A 5CLLA 2QTAA 3K1AB 2UYHA 4ABTA 3EPHA 2FWAA 4R7ZA 4MUAA 3IGFA 4TRNA 3PDWA 1V7QA 1XZBA 5GTDA 5LPNA 3MCVA 3PZBA 2H06A 2Z1NA 4PO1A 1E4EB 3OEWA 2D4HA 2OO5C 2YOFA 5D5HA 5CDYA 4O29A 2WHEA 3S40A 5JYCA 5KU1A 1T5BA 3HR4A 4BLOA 3AHGA 3FDJA 4GMHA 3H1EA 3GFFA 5IDWA 3ADPA 4WMLA 3F47A 2HL6A 3B6ZA 3ZHTA 1VMDA 3OI7A 3E27A 2C82A 1OVMA 3H4IA 4M9CA 1PL7A 4YRIA 1U1FA 2HCBA 2VAVA 3E82A 3OQMA 2X8WA 4QC2A 4MDYA 2RK4A 4JLMA 1SY7A 4XTRA 4P5EA 5J2TF 5ALJA 1LB1B 5IEBA 3ASZA 1TGVA 3RAJA 1ONNA 3P9PA 2A9OA 3P45A 4NMLA 5KUTA 2HF9A 1QZTA 1ZH8A 3Q3HA 4HN4B 4QDUA 3HV2A 1TVMA 2WM3A 3DCIA 4Y6QA 3KD2A 3OLCX 1NP3A 4OQMA 1UEXC 3SS9X 1O0SA 4EG3A 1XWIA 2Z5LA 4O2BB 1U0JA 2YCBA 2Y2VA 5KSYA 1BMDA 1UBNA 4XFJA 2OV3A 3AJRA 3PC6A 2GSWA 1V1MB 2DU8A 5EMMA 2CNKA 1C14A 3GZJA 4YRPA 4BEJA 5T3UA 3A28A 2VP5A 3A9VA 2PMEA 2PUDA 4FE7A 3GLSA 5CFZA 4DCPA 3ESRA 4HMOA 2P5TB 4RD0A 3CVWA 4LFAB 1XA3A 2O0HA 1N6HA 3FDXA 2P3LA 4KGXA 4MWTA 4BEBA 3I53A 3TFOA 1L7OA 2EEZA 2HRCA 4DCJA 1AV6A 1W87A 4B4KA 3REGA 1LTHR 1US8B 1NR1A 2XB8A 1E1YA 4D3XA 4HMPA 1UM9B 2XT0A 4LYDA 3AEUA 2AOUB 4K87A 1PZEA 1X0VA 1YVEI 1RCUA 2IXGA 3CNLA 4HLNA 4J1SA 3WV5A 3O1LA 5IVHA 4DCSA 3WOVA 3UV7A 2V3CC 2XAUA 1QS0B 3L02A 5IXJA 4JYPA 4LF5B 3PKZA 1U65A 1XPRA 1CRLA 2ZJAA 4N0QA 4HVLA 4XX0A 3UCEA 4NU5A 3OOHA 1YRLA 3F2IA 2DQZA 4Y2XA 2NVUB 1V8BA 3L1VA 1EDOA 3RFFA 3TQFA 2VT3A 1GGMA 2Z4RA 1S3FA 3O8QA 4TVOA 5AOAA 1CPYA 2CFRA 5AW0A 3LM8A 4F2PA 4CR6A 3ROMA 2ZBQA 5IAAA 1DEAA 2XYHA 3ZVRA 3RAFC 1XD2B 2PZMA 1W8IA 2ZRQA 2ZJYA 3BIOA 3GEMA 5BMOA 1QJ4A 4BFYA 2YWXA 2WINI 4LE0A 3SDSA 4HS4A 4PNPA 3HDGA 3PVZA 1L4BA 1UXJA 5F7OA 4OX9B 3IAM1 2VUIB 2MIIA 3BGWA 2RGAA 2J08A 1I5RA 3WMWA 3ADCA 1T2FA 4MMXB 1L8LA 3NBKA 3RU9A 4XGQA 1HDYA 1AKRA 3OM0A 5C4IA 5F64A 3ORQA 4ICIA 4M6WA 3UK1A 1C3OA 2BPOA 3O8BA 4JBNA 2WF7A 4OHKA 3D54D 5K3SA 3WLKX 4F7WA 2HWUA 1V39A 2XXJA 3VSBA 3HV0A 4ZOLA 3HG7A 4ZALA 1RE0A 4OUDA 5T4HA 1EJ6A 2BMDA 1TT5A 1ZRSA 4G8DA 2ZQ5A 3G3EA 3KVOA 4JQZA 4YRNA 4EGFA 1A50B 1HURA 3HVIA 3SYNA 4G09A 3OEEA 4F9EA 1KK3A 4I4LA 1H1LA 3WDMA 3OLVA 3U7EB 3OCVA 2R5WA 3QE3A 4EUSA 5DBGA 1YE8A 5JAQA 1DKNA 3WRVA 1IHYA 3QF4A 2XCQA 1ZI9A 1ESNA 4IXWA 3ORYA 2QL9A 3EVGA 1YQUA 4KACA 3UPDA 1J0BA 3FKSD 4D92A 1WCWA 4HEHA 4A91A 4COOA 1Z47A 2X77A 1I7NA 2IZ6A 4XARA 1K2VN 4ETNA 4CLRA 1PBTA 2ZJOA 4PO8A 1FX0B 1XTSA 2XDQB 4C0JA 1IL0A 1QYIA 5CLGA 1PGOA 4CG1A 2VZ0A 1OLXB 3G17A 4ID3A 4NZPA 5KAMA 1V6CA 2EF1A 1M0SA 2P3SA 1VBNA 3BDIA 5DCWA 3A3OA 5I7SA 2DHQA 2FPGA 1ODSA 3PQ8A 4WFJA 2B4YA 3GGPA 1FA9A 2QRUA 5JECA 1YVPA 3QELA 4UXHA 4YDQA 2R1VA 3NWEA 2DY1A 3JQ6A 4ZJZA 2XA1A 1MJHA 1MDBA 1E5XA 3FDZA 2W6PA 3JCZA 3KOOA 2CHEA 3WKCA 3LCVB 1PJCA 4PFSA 1VPDA 2AJTA 1Q1AA 2WB4A 3K9QO 4B3HA 3C6KA 4ZI7A 3OEED 4B87A 4YWHA 4FVTA 1RJEA 2YUTA 3P5BA 3LLMA 2H4HA 1XEAA 1RR6A 1FS5A 3A7DA 2OO3A 4MW4A 5AM4A 2ATXA 4CM5A 2W2NA 4JCOA 1XCGB 2GYVA 3B85A 3ONEA 3BYZA 3ZCSA 1L7DA 3U2QA 4KWHA 4PZAA 2QHXA 1OLUA 3A4LA 5BQOA 3VO2A 5T3YA 4BB5A 4BAZA 4C76A 2I2WA 4TQ9A 1Z12A 1W46A 5JD6A 4RY8A 4F3TA 3ROFA 1DC5A 4M1ZA 2V7UA 1RM5A 2O3UA 4H59A 1PJZA 1N9ZA 4CLEA 4UJ5A 1O5OA 2XADA 2I99A 1BVYF 3EGDB 4M1YA 1W1WA 3TVDA 5TLSA 2X8LA 3DE6X 3HPRA 2C5SA 3X43A 2PO7A 1PVVA 1EBUA 4BX0A 4ZO7A 1KZHA 1KOFA 4UCXA 4EY7A 3AL0C 2FZ5A 4RHTA 1RM4A 3N8KA 3ZS9A 3Q7QA 4PFQA 1QG4A 4NU6A 2GLXA 1QRTA 2BIFA 1KERA 2CL5A 4D96A 1L4EA 2O2JA 2QM0A 1SUFA 5L7TA 4E1VA 4WKPA 2RH4A 1GFSA 1RM0A 2PA3A 4XA8A 5BSFA 1HBJA 1OV6A 1KYVA 4UBLA 1SBTA 2OCDA 2AXEA 3K0EA 4EFLA 5FNVA 5ITSA 1BH6A 2J5XA 5FXMA 3BJMA 1P19A 3L7KA 2GEJA 2X9QA 4BKOA 1CQIB 4IUYA 1G2PA 1VI6A 1AUOA 4EPTA 4NXMB 4EFKA 1H22A 2H4WA 4E0BA 1F3OA 5LUAA 4PC3A 3ND6A 2G8LA 4OHBA 2P6RA 2PZ8A 3LC1O 4YLYA 1X19A 2WWHA 3A6HA 1CERA 1ZK2A 4TVSA 5B57C 3WGIA 1XMOB 3T1HB 3FMOB 2X8BA 4J2HA 4L16A 5DI3A 1KJIA 1MB0A 3RVBA 4R71A 1DMRA 1ZJJA 2FCRA 3BB4A 4BV8A 3PGXA 4MROA 2FPSA 3U7IA 2VRCA 1SKUA 1W75A 3LA8A 3DTNA 1GQFA 1J1UA 5JAUA 4PVDA 2QYSA 3V32A 4NOMA 3GY0A 2XVZA 4LCBA 3TLZA 1JKMA 3JQ7A 3TO5A 3ZWKA 3HFRA 4R9VA 2YV5A 3H6HA 1C9YA 1UBHS 3RTGA 4N12A 4B46A 1O8CA 1SBCA 3CNEA 4KQKA 1PTKA 5C5IA 2O8FB 1P81A 4KO4S 5L3RA 5AW2A 4DLTA 3UJDA 2ZRPA 4GWGA 5J9FA 3RJTA 3DA8A 1A98A 5DBIA 4PAMA 3H5WA 2F3SA 1E32A 2FK8A 2JVIA 3UZUA 4IOMA 4B3DA 4XEUA 4K0KB 1RQLA 4EJSC 5AJHA 4P8RA 3QFFA 4OI4A 2R2AA 3RUFA 3PYMA 1I3NA 1KRHA 1O9GA 4PHGA 3SP1A 3MAAC 3N2YA 4GYWA 2WABA 1VPEA 4ASUA 1RYNA 4KBGA 2ZSUA 3W9YA 2XR1A 4JNKA 4YRCA 5A3VA 1LPBB 3K1TA 2NU9B 3ZLVA 2X8JB 2GM4A 2JVKA 3GV0A 1SCAA 4FDLA 4WA8A 1QFSA 1B3RA 2WHRA 1M2HA 2PUTA 1ORVA 2XRMA 2ZIAA 2OHJA 3A9RA 3QKSA 5KYVA 2GZAA 2UYOA 3ENZA 1K7EB 4RZXA 4W4TA 3VZDA 2FW8A 5CVVA 3VJRA 1AJEA 3LBYA 3GD5A 4ZU3A 4KE9A 4UTRA 1SZDA 1E3SA 1V8ZA 2Q28A 3KV3O 4J7XA 2FW9A 1T9KA 4KBYA 1PLJA 1FP2A 1Z18A 3CY6A 4FW8A 4X3PA 3JARA 3U0BA 3C15C 3INTA 1XRMA 5M2QA 4FFOA 4PZCA 2X5KO 2F9FA 2NP7A 4XWGA 2FJPA 4N5IX 1Y34E 3HZRA 1T5IA 3OUUA 1NQWA 1KAGA 3HFSA 1KY3A 1R1DA 1THMA 2IHYA 3C97A 4IWNA 4HNSA 1P1JA 4NZMA 4B4WA 3OWXA 3L8ZA 4CG0A 2EERA 4YJHB 1QK4A 4DA8A 1KDVA 2QV0A 1PWXA 3FNQA 1AMUA 4MB0A 4F5EA 1XUOA 3VZBA 2YIDA 4QPCA 1VDMA 3KQUA 1ID8A 1EUYA 3G2PA 2JGNA 5BWCA 3K53A 4DXHA 4EYKA 1ZIOA 3O9ZA 2VHXA 3WHLA 3E3MA 4YRTA 4NIMA 1ZG3A 2WJ4A 2QW0X 4ASUD 4ZZIA 5HUQA 3THWA 3EGXA 2GAAA 3B1WA 2FEPA 2GSDA 2X0EA 2W0MA 4K6GA 3UJ3X 1VXOA 4O4JA 3SR4A 3X44A 4X54A 4BKRA 2PUAA 2CF5A 4W5RA 5AHXA 1TEZA 1RT9A 2PZJA 3UXYA 4C0KA 5JQGA 2MSEB 3TJMA 5HRUA 2Z6VA 1F8GA 1ZOLA 2RHJA 3AOEA 3M70A 3OZSA 1SD2A 5AWFC 2I9PA 5KNBH 6ADHA 2AWNA 1XQXA 3FMVA 3NORA 1HOXA 4F46A 2HYIC 3F3MA 3X2EA 1P0CA 1RYHA 1XJCA 1TU3A 2IZ1A 2HBZA 2P2CA 3HFGA 4BMXA 4ARIA 4OLBA 1WPQA 3HUDA 5KYNA 3FOZA 4OLAA 2EW8A 4M0PA 1E5QA 4RCVA 3B20A 2BDTA 3EDCA 5AIAA 5T4BA 4QRIA 1T8RA 3OF2A 1T5OA 2O05A 3RVRA 1A1VA 3CW2A 3DLBA 1HMYA 1DOAA 2H18A 4GH5A 2IX9A 2O2EA 1QH0A 2V8BA 4LYEA 4B45A 2G4CA 3DJYA 5KHAA 3VPGA 1EIWA 3D8UA 4LG1A 1XXHA 1Z4QA 5GM2A 1NVKA 2PRJA 3UWDA 3GLIA 2XMRA 4QYSA 1KFCB 1S8NA 5BSMA 3PBKA 4NMXB 4BLPA 4D4LA 3I23A 2J6CA 2R85A 5AR1A 1OFTA 3FPKA 1E2BA 4LMPA 2VPPA 4S3MA 1HY3A 2P6PA 2REBA 4KYIB 4XASA 3D6UA 1TD9A 3WWCA 4YRGA 4LIPD 5AVRA 1GUBA 4B48A 2ZXUA 1YKFA 2F43A 2JW5A 3F3YA 3FZQA 3OT5A 2W6OA 1AGPA 1EJBA 1FU8A 4LKOA 4W5JA 4INJA 4HTFB 4PC7A 1LRLA 1QYXA 2P8SA 4XGKA 5UKDA 3ZWAA 4KPEC 2PGNA 1GGHA 5EVJA 3RM3A 1P6QA 3W4KA 4MLPA 2MSCB 3AR5A 4QUBA 1M2VB 1UK7A 4TM7A 5J4HA 2JAWA 3RS2A 2IUYA 4D6XA 1UXOA 1AZWA 4HJXA 1Y5RA 1S1MA 1TMYA 3B1YA 3JAKA 3GLUA 2H51A 3LSYA 2QPAA 4PU0A 5ALDA 4ZODA 5JYEA 1LJUA 1AK2A 2GWHA 1F5SA 5ITZB 2HLDA 4CGZA 3WXBA 4IV0A 4TM8A 5FNZA 1I7LA 5HRAA 1J07A 2YBEA 1JKIA 4I50B 4PYLA 4TYMA 1K97A 1T6NA 3ORHA 3T4UA 2XPCA 4WOPA 3A3KA 2WYHA 4AIIA 5HUJA 2XWBF 4JU8A 1EHIA 4EVSA 4AICA 1NATA 4GX1A 3SQLA 2JAUA 3ZBUA 3ZTWA 1CYEA 2Q21A 2ZPTX 4G4GA 4MS4B 3OZRA 1IN1A 1E3TA 3K16A 2YYZA 3AHHA 2ERCA 3KKOA 4J0FA 4YMHA 3V2IA 2A8YA 2JD1A 2NQ8A 4XI9A 3UVEA 4BGUA 1VBMA 3GROA 4EF6A 1MW8X 1UJ6A 4KSBA 4FIZA 4F3KA 1SJ9A 1EI9A 2VSQA 3D0KA 2FOXA 4KAAA 4M8IA 2CNNA 1OKKA 2IY7A 3VO8A 1EAMA 1M2GA 3V1KA 1UBCA 2IZ7A 1TFRA 3IBFA 1H9CA 4BTVA 4WI1A 2ZOSA 4CQJA 3J81k 1Y5LA 5IJZA 3WB2A 4UTVA 3PS9A 1F4LA 2JJ1A 4HR7A 3WZLA 3II6X 4V2IA 2YZNA 1XTTA 5AJVB 2EF0A 1BMQA 4AURA 1UK8A 1FPQA 4M9ZA 3TGWA 4E3ZA 1PVOA 2IC5A 3G0GA 2RBEA 4BAUA 3HA7A 3PA8A 1DC3A 2HLDD 5D7BA 3BA1A 5H16A 2C2YA 3T7TA 3SVTA 2X5XA 1TLTA 1OAKA 2NXJA 3E70C 3DLPX 3EZ2A 5HBGA 3RAEC 3D8RA 1QIFA 3M6XA 5DTEA 4RJTA 1RJDA 5JO9A 1EK5A 2FEXA 5DULA 1GLVA 1ZN7A 2VKQA 2G6TA 4B6FA 1PL0A 1CE8A 3EIWA 3K1JA 1JG4A 1O94C 2F8LA 1FLNA 4PFKA 4Q3EA 1F60A 4UQOA 2QQGA 3C3BA 3HO6A 4LGYA 5D85A 3EFBA 3RJMA 1JQKA 1YDHA 4MLZA 1IBKB 1X2BA 4IRMA 4O8ZA 5G4LA 5K3EA 2XDWA 4ZI5A 4FEEA 3WLTA 3BE5A 1KSJA 1SIUA 3ILHA 4DVGA 2VNAA 1NXSA 5CVUA 4FK8A 3LGXA 1SBYA 3GMSA 5EZYA 4ROSA 1NMQA 3QMWA 1OKKD 3DXYA 5AW7A 3DKPA 2WKWA 2I71A 2VZLA 2YJTD 4GXNA 1K5PA 2EFGA 4J4HA 3RADC 3WDLA 3EARA 3JYHA 4H0NA 1UKEA 3TLYA 3ZZMA 5C8YB 1VCMA 4WV3A 1E4YA 2JJ1D 3DW3X 5JASA 1V2HE 2R68A 3WWYA 2QTVB 4TOIA 2O3JA 2GPWA 1ESDA 2VI5A 3D4NA 3NAMA 2VJQA 3PHIA 1Y3DE 4L51A 5SICE 5CCEA 3HZZA 1P4AA 3IQZA 4K40A 1YBFA 4ALJA 1QRAA 3Q7IA 3P9QA 2B4RO 1MG5A 3K9GA 4CNQA 3SFVA 4BP1A 4TT3A 2BC9A 1L5GB 6Q21A 3W6ZA 1VL2A 4WK0B 1GGJA 1LBEA 2ZIZA 3KJNA 3IEUA 1QQ7A 2CBGA 3MTEA 4L0QA 1JJAA 1AB6A 2TS1A 4EY6A 5DBOA 1IWOA 1O6CA 3BD9A 4ZYVA 3O2QB 3VNRA 3D4BA 4GP7A 2PU7A 1EZ4A 1K8ZB 2E5WA 3GUZA 2Q5HA 1JRLA 2RARA 1LQUA 3QUCA 4GM1A 4Z0NA 4J6FA 3TBFA 1MC8A 1VIMA 1E7YA 2GHIA 1KOGA 4BP8A 2VJCA 3OZCA 3K32A 3H5RA 4DWVA 3P9SA 1RACA 4Z9AA 2GVNA 1ZJ6A 2V5VA 1TYZA 2PV7A 2QNBA 1ZRHA 3DAPA 4WZAA 4ZYWA 3EVZA 4X97A 3S70A 3Q5GA 4BUCA 2ZVQX 3TIFA 4DNXA 3LMKA 5DCLA 5HF9A 3ZZTA 3BF7A 1HQDA 4LNUB 1EVKA 5A62A 2OMKA 1ZEMA 4G1MB 5AOCA 5I9LA 1JBEA 4QU8A 4CIXA 1R8JA 3CLUD 1H9AA 3UMMA 2I1WA 4TN5A 5COBA 2C2GA 2XQVA 3L0DA 3ZLJA 3UH0A 3OX4A 1E9EA 1N1EA 3L4SO 4CMIA 4UBIA 1HYGA 3KT8A 3RD5A 3TH5A 4C29A 2FFHA 3C41J 5FIUA 3OECA 2J4DA 1G21A 3RS9A 4ECAA 1K66A 2O5VA 5H81A 4Y1FA 1YMVA 2NPOA 2QROA 4NFYA 4P4GA 2Q0QA 4TT3D 5F12A 4UMEA 1UK6A 4YCCA 1FRQA 5C80A 2O50A 3AF1A 1J24A 5ALRA 2J5KA 3U3MA 1KBOA 2AT1A 1U0TA 3ESZA 3CHYA 2REXB 1U9CA 4RFVA 1J8QA 2WP8J 5H9WA 3FUVA 4EG8A 4G8JA 3AG5A 4QGBA 4QUKA 2NMVA 1Z83A 4N01A 2H1FA 3ZDFA 2MYPA 3NH9A 4JI1B 3H75A 3VTKA 2ID9A 4EIWA 4DCCA 1E64A 2XMGA 1VE5A 2FKNA 2IPLA 4KYUA 4BIIA 1ZQ9A 2JIPA 4AQYB 1OB2A 5EJ4A 3ZU5A 5C46F 5J23A 2E18A 4TL6A 1SNYA 4PCLA 1J5PA 2KB0A 3GUHA 2DPHA 3H2GA 3ZWDA 2VYCA 3OBIA 1DXOA 3OZTA 4RGBA 4UUPA 3OO1A 4LRTB 1KYTA 1T2CA 2A0XA 1C9NA 2TMDA 1OBHA 3Q0TA 4YRDA 5KTPA 3WB0A 3THXB 2DX7A 5F77A 2ZUDA 2B78A 2RHWA 2FSGA 2OY0A 3BXHA 4PLVA 4BMOB 3ZV5A 1F8XA 3RASA 3GBSA 4HUTA 1MXFA 3HXQA 2I4RA 4PSVA 5JI2E 3HHEA 2CW5A 4GI2A 2WUGA 3V1MA 5LWQA 3WFJA 3ZEAA 2HJVA 2UZ3A 2X0DA 3I2GA 4DC0A 2BD0A 3DTTA 3LWZA 2AKYA 3H4TA 4ZKEA 1JILA 1E7MA 5U1PA 2CF6A 2FX3A 1ZM3A 1V9CA 2ETXA 5C8VA 1A2BA 3TF5A 3VTAA 4K9LA 3WMRA 4WE3A 3I04M 1PDWA 3JRXA 6REQA 2YTZA 3L0SA 4HWTA 4FJ0A 3ZCTA 1TUGA 1YB1A 4PYOA 4H31A 4K8OA 5L9AA 3CB4A 3GJ7A 4OXXA 1G8JA 2AYZA 2H0AA 3ETDA 4OLJA 2O5CA 1U9IA 4E4RA 7REQA 4X85A 1P6XA 1UT5A 2GAFA 1SC4A 3KKLA 2JGAA 3DFFA 3G9ZA 5LQDA 1U1DA 1W7AA 4HNHA 3KAPA 5FA8A 5LQJA 1AV7A 4Q3NA 4DRXA 5IKEA 4CKEB 1K27A 3WGGA 1GL7A 3QOXA 3QXXA 1DFGA 1TQDA 4CDNA 1XP5A 2PBLA 4M86A 1Y98A 1I13A 2UYQA 3C8MA 4KWIA 4MUXA 4Q3BA 1ZNXA 3BGOS 4EVQA 1I5EA 1II8B 2ACEA 4LNHA 3QLUC 1XTJA 2GERA 2Z57A 1TC1A 3MN1A 3QLVC 4CEIB 1XCJA 1YFZA 3IRVA 3KXDA 4GX0A 3SQOA 4Q1CA 2FPPA 4CKCB 2WQZA 2YWBA 1EJ2A 2QDXA 1VE3A 2CFCA 5G0VA 2CLEB 4EFMA 2XZDA 3ZE7A 3P52A 1UWKA 2QM7A 1O5TA 3HNPA 4OL0A 5DYIA 3WDKA 1Q57A 1NVDA 4X1IB 2VP3A 1JDNA 4H2DA 1UZLA 4B3BA 3V4RA 2EBFX 2A7XA 5EXPA 4I5IA 4Z7OB 2P5SA 3AERB 1S8OA 4GI5A 1G1AA 2E37A 2FVXA 4LY6A 4RLHA 3IOCA 1GPKA 1EE1A 1KFBB 1WMDA 4MWDA 4OIMA 1EXMA 1H65A 1KYZA 1X8KA 3NFYA 2Y1WA 3JYLA 5H80A 4ALLA 1NXWA 4EUKA 2VJAA 2XNCA 3F1KA 2VQ6A 2WSLA 4NG5A 4NX2A 3Q3IA 2RGRA 1GZ5A 1WR8A 1OB5A 1E18A 1SUAA 4RACA 2FXVA 3DQZA 4WDRA 4XUCA 4GMDA 3TB4A 1YJAA 2AQKA 1EK0A 1DEOA 2NYUA 3SYRA 1Y3CE 1W0KA 1QIIA 1YRQA 4I08A 1L4LA 1U2PA 1JG2A 1EWKA 1NMZA 4ISBA 5IN5A 3ZCVA 3R3UA 4R1UA 1VGVA 3ZHZA 2WD7B 3H9BA 3WLHA 3N87A 3ZR4B 3H99A 3S99A 5A4AA 1SCUB 1XV5A 2WR8A 2LUOA 3QPAA 1W52X 3CLTD 1ND5A 3H0KA 1EUQA 1E60A 1MC5A 1ULUA 5CNIA 1YK1A 3MBKA 4K81B 4LDAA 3TZLA 1UAYA 4UBJA 3FTDA 3IQIX 1Z22A 3M6IA 4FHGA 1NJ1A 1WE2A 4HAWA 4XFKA 3VR4A 1ZUNA 4B7CA 1QDEA 2JKVA 2PTGA 2Z6QA 1KJYA 4R8SA 3P0IA 1NBME 1YS7A 2CLFB 2OQRA 2O0KA 3IQWA 2QXYA 3P2IA 3UWSA 1XQ9A 3V3KA 2D62A 1ZITA 3KALA 2WQ6A 2ZZMA 3GLQA 1EFRA 3B9RA 5JNTA 2O8BA 1ADCA 1GGFA 1R6BX 3ZDBA 1RZUA 2A59A 3NT5A 1L5KA 1YIOA 3EFOB 4WXMA 3W3AA 3RFVA 2M6SA 2XUAA 5FWAA 1QG2A 1R4NB 4Z9YA 1JX6A 3CLRC 4M1EA 4XYEA 1JPNA 2W93A 4I50F 4B3CA 1ZMRA 1EUCA 3GAMA 3PTAA 3L79A 3PUZA 1KAQA 1NKVA 2CXXA 4UXJA 3CZ9A 3N2KA 4UUNA 2PXCA 4YJ2B 4KKXB 3L5OA 1U02A 2IOFK 2FWJA 1W0KD 5E6SA 1W9HA 2H07A 4R8LA 4K6CA 2V54A 2NZJA 3H42B 4WOBA 1KQ3A 3QBTA 1L5RA