4P83A

Structure of engineered pyrr protein (purple pyrr)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
165
Chain Sequence
KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Engineered PyrR protein (Purple)
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
total genus 50
structure length 165
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p83A00
1D6NA 5IAOA 1OREA 1QK4A 5KAMA 4QYIA 1QB8A 2E55A 2PRYA 1DQNA 3OHPA 4PFQA 1XTTA 4Z1OA 1G2QA 2H08A 2EHJA 1XZNA 4JLSA 1W30A 1LH0A 3HVUA 1A95A 3N2LA 3GGCA 5BQPA 1ZN7A 3ACDA 4LYGA 3H83A 1P4AA 4P81A 4P82A 2YZKA 3MJDA 1BD3A 1ZN8A 5E38A 1VDMA 1O5OA 1A98A 2JI4A 1FSGA 1TC1A 4LYYA 5K51A 3G6WA 4RANA 3LPNA 1Z7GA 2P1ZA 5JV5A 3S5JA 1OROA 2JBHA 4RHYA 2HCRA 1A96A 1BZYA 4MB6A 4TWBA 4P83A 2H07A 1A4XA 4RABA 4F8EA 1OPRA 4RV4A 1A97A 1Y0BA 4RADA 1ECGA 1QCCA 5BRNA 1UFRA 1JLRA 4M0KA 1DQPA 3OZFA 2JKYA 2FXVA 5ESWA 3MBIA 2C4KA 4P84A 4X45A 1NONA 2DY0A 1GRVA 2JKZA 5ESXA 1MZVA 1ECFA 1DKUA 3ACCA 3DMPA 1ECCA 1QK3A 5EUCA 4RAOA 1U9YA 3DAHA 1VCHA 1O57A 3EFHA 3LRTA 3KB8A 1L1RA 1JLSA 1I0LA 4IJQA 1P17A 1XTUA 5JSQA 4P3KA 4QRIA 1QB7A 1P19A 5KAPA 4WMLA 4ZFNA 2WNSA 1I0IA 4KN6A 1ECBA 1QK5A 1WD5A 2H06A 1UPUA 2GEBA 3GEPA 2PRZA 1IBSA 5BSKA 3QW4B 4RQBA 5IPFA 2XBUA 4WN3A 1GPH1 1NULA 4FYMA 1P18A 4LZAA 1U9ZA 3OZGA 3M3HA 4M0UA 1PZMA 3ACBA 1I14A 2PS1A 4RHXA 1R3UA 4JITA 1G9TA 1XTVA 2AEEA 1HMPA 1V9SA 1J7JA 1I13A 1CJBA 1DKRA 4M0PA 4P80A 1L1QA 4PAWA 1QCDA 1AO0A 3NAGA 1I5EA 1HGXA 4RHTA 1YFZA 5BQOA 3O7MA 1A3CA 1VSTA 4OHCA 4RQAA 4X44A 3GGJA 2IGBA 5HIAA 4P86A 5HKLA 1XZ8A 1DBRA 4LZOA 4RAQA 4LZNA 1G9SA 1G2PA 3DEZA 4RACA 1STOA 1ZN9A 1BD4A 4RHUA 1UPFA 1ECJA 4QYIB 1TC2A 2VFAA 4S2UA
chains in the Genus database with same CATH superfamily
3DB1A 4HPJB 4LOJA 4XWTA 4TTJA 4UAUA 1P7YA 3UMCA 1EFDN 1U7ZA 1HMYA 5JWHA 4BFUA 3K0AB 3MWKA 4GOJA 3ILXA 4YJHA 3SC6A 1H23A 3P71T 5LBTA 3GT3A 2C3YA 3KWFA 3RARA 2W5UA 2ERYA 3COVA 3FI0A 3M6WA 4R7GA 4WY5A 3ZE2B 5I7OA 4BP9A 3MUFA 1DSSG 1CPYA 2EZTA 4ADSG 4I2NA 1M8FA 4M8KA 5HWSA 5IUNC 1ZXXA 3HWRA 3QY9A 2RJNA 2J6HA 4RPHA 4CW7A 2NMVA 1E5LA 2ZW9A 2VH1A 5FOTA 1ZN8A 2IIPA 2IYFA 2WWVD 3TBKA 3ECCA 1MHTA 4LCJA 3R3UA 3VV2A 4Q7MB 5IKPA 2EYUA 2FSVA 5FAXA 4DDUA 2OZKA 3VR5H 2WVJA 3HCWA 3MHTA 4H15A 3VZQA 4CHTA 1E4EB 4MOWA 3FZEA 4RABA 2VTDA 3EQ6A 1NRWA 4RTKA 1SUAA 2Z6UA 1HT2E 4B5KA 1RKBA 1YZQA 2J7KA 3EDQA 4RADA 1KJ8A 5DM0A 2QP4A 2NPOA 3GLHE 2QTTA 2X0KA 2R8EA 1DKMA 3DA8A 5I9LA 2PUEA 1CY0A 3O8NA 4NWIA 4NJEA 1AQYA 2EJBA 1VSBA 2JHGA 4EYSA 5I9MA 3N8KA 2PKXA 4D3FA 1QIFA 2ZCVA 3U7HB 4GT1A 3ZI7A 1W29A 2G17A 3LY7A 1YZKA 3KU1A 4NCIA 3ELUA 2FMXA 3BHIA 1ZSYA 2F3TA 4NABA 4Q34A 1L1RA 4AT1A 5BSWA 5U9CA 2FEXA 1WA5A 3A32A 5BPFA 3GQVA 3UCEA 4PSVA 2RKBA 1JU4A 4NONA 4HPXB 4R5MA 3VM6A 3F73A 5BWCA 2ZTLA 4KX3A 1JJVA 4WADA 1JDBB 1D4ZA 3C6BA 3O47A 4KN6A 3WKCA 3DZCA 4ENSA 1V45E 5AWFC 4X66B 3LUHA 3RABA 1T24A 5L95A 3GG9A 4LDPA 3LI2A 2BI7A 4KQFA 4W7HA 2FY8A 3QVGA 2BEUA 2PRZA 4DABA 4EW3A 2YJNA 3TGLA 4V3BA 4ZXFA 3OJFA 1Y7IA 4UDYX 1T8RA 1C4OA 1U9ZA 2CXRA 2P68A 3NOQA 4IG9A 1M2JA 3HYSA 2PGAA 1GZVA 3QITA 4NCXA 4EYQA 1V3UA 2H1VA 4LF8B 1ZQ9A 1K7XB 5DBIA 4PPFA 1KY3A 2H0RA 5ALGA 3C7CB 1KC1A 3OU7A 4MI9A 1P5HA 1ZHOA 1VA4A 3O4VA 2X14A 1FJGB 1EP3B 2YXPX 3DZJA 1EWTA 4B3HA 4B5LA 5GOZA 1DP4A 3STUA 1XZPA 2H3EA 2HBYA 2XVAA 2EDCA 4EKIA 3ROKA 5CD1A 4H4DA 4Y2HA 5D5HA 1T13A 4H7IA 4WOPA 3KHTA 4FYJA 3K0EA 4CKXA 1P5JA 3W5SA 2FB9A 1HTTA 5AHXA 5C7YA 3BBPA 4P86A 3DKKA 1EQAA 4B0OA 2QP3A 1IQRA 3PC7A 1J1IA 3KQYA 4B6OA 3LTEA 4IMJB 2LCIA 1WVGA 3O8QB 4TS9A 3KKOA 1ML3A 4I4TB 1UPFA 4UTRA 3FRHA 4WNCA 5I47A 2I4NA 4NH0A 4N0QA 3KCQA 1N3IA 1Q5PA 1J0EA 1PFUA 4O2AA 1AGPA 4R0VA 2F1HA 4AN4A 3FMPB 1IHUA 3M9LA 4GMKA 1W96A 1Y34E 2C99A 2R8YA 3OETA 3GLFE 4QAQA 5SYAA 4HZGA 4ZA2A 3RNLA 2G5GX 1I1QB 1Y3IA 1S3GA 4CL3A 4G5QA 5ED4A 2EW1A 1EIWA 4Z1OA 2AOUA 3ZBTA 2HA3A 3SS8A 1DV1A 1IG3A 5LD2C 3UK2A 4YRAA 1JKXA 2Q4TA 1NMXA 3DKRA 3AXSA 5CPBA 4DARA 3IKTA 4KQCA 3K0CC 4LMPA 5EXEA 3L4JA 1HYGA 2J1LA 3OC6A 4AC9A 1ENOA 4EL5A 2FCRA 4XI9A 1KDZA 1C8LA 3LLSA 4BL5A 3Q8WA 4JDPA 1ZK3A 2YUTA 1P1HA 4X3CA 1S2NA 1JMYA 3R3VA 1WMBA 1U9IC 1XCPA 1H2AS 5EKSA 3IB3A 1ULSA 2WR8A 3I9JA 5JDCA 4P38A 2HYDA 1JW9B 1R4ZA 3DT8A 3B1ZA 3CQ9A 2MU1A 1O6CA 3G1UA 4C5AA 2AOWA 2OXCA 4NYMR 2KPOA 4TTIA 3ZHUA 1P5RA 2Q3LA 3IPXA 3SBXA 3PCXA 2W8BB 3M1YA 1U5BA 4E31A 3Q7QA 4F91B 3ABQB 5KOJA 3F6CA 1GZUA 1PO7A 2JBAA 3HJTA 1LI4A 2FK8A 1A71A 1YR8A 2D13A 3OKFA 4QBTA 3X1XA 2RKOA 2XUZA 5K4AA 3D7NA 4UUMA 5CIWA 2FX3A 2ZRIA 3LECA 2C31A 4AZ0A 4QKQA 1T2AA 3VVLA 2IBSA 3ANTA 1HYBA 4XWAA 2KSQA 2LBPA 4MVJD 4MLDA 4E13A 1ECLA 3NZEA 2Z8ZA 2IUYA 4JL6A 2PNJA 3SC4A 3RRJA 3FB4A 1MIOB 1NAIA 1P19A 4MULA 3NXKA 3UC5A 3UHPA 3T7DA 4EY6A 1IEQA 1OW3B 2YYSA 4N03A 4UZEA 2IIVA 3IBYA 5CH8A 2QT1A 2H4HA 3R6TA 5DTIA 5ES4B 4C2BA 1K92A 3RI3A 3TL6A 1JWLA 2F8SA 1AKTA 2X2PA 2XPCA 4ZQEA 2WJ6A 4D9CA 2PGXA 1CRPA 1Z22A 3JWIA 1HF3A 2WPDD 3QK7A 3G8CA 4ZAXA 2CXPA 3FB1A 1FFXA 1ADJA 4ZGWA 1D4OA 5JDIC 2C2HA 4L0DA 2HDOA 1RAGA 1YQGA 3A6HA 4UM8B 3KHSA 3O1LA 4DCVA 5IASA 1PP4A 1WUJS 1QLHA 4TXNA 5KHAA 4FYXA 5KYVA 3DMYA 4MYDA 3B9QA 4Q3CA 2H00A 5EKUA 3VUFA 5H1YA 2VZEA 3INRA 1LPBB 3KPUA 5IEBA 4Q9JA 3FBWA 1O97D 3CRNA 2ONCA 1H2ZA 4E11A 5B2FA 3S6JA 3JQ7B 1W4AA 3VXKA 3T41A 3AK4A 1XLTC 3UHOA 3A3OA 3BB4A 4U1RA 4ENTA 3DL0A 5BW4A 4RTSA 3AVTA 1XJWA 5HKAA 2IPOA 4KBYA 1Q1AA 1PZXA 2FLVA 2GZSA 1NSTA 3ZWNA 5EHZA 4RJTA 3CRQA 1L8XA 4HB4A 2UYQA 3KFVA 2XQIA 1FXSA 1IUPA 2R6HA 1J0CA 1E8NA 1U1CA 3FYUA 3LCRA 4RH3A 1JEDA 5JMTA 5IWAB 1UEIA 1MOSA 2GCOB 4JEHA 2FRXA 2V0CA 2YZNA 1QONA 1JDTA 4FSXA 3KWMA 1GUAA 3A2NA 3NB0A 5G0SA 3U09A 3HUTA 3W2HA 4Q4CA 3KXLA 3SJBA 2TECE 1VJCA 4OBBA 3F90A 1H2BA 3C41J 3JR3A 1JEQA 3LWZA 3PQ2A 1HK7A 2IIBA 4OU4A 4DF3A 1PK8A 3UJ9A 5BOSB 5KYYB 2Q3EA 3I61A 5JCXA 1WG8A 1NFQA 3EHDA 3WHLA 2RHOA 3SZGA 3CBQA 5DSXA 1H93A 1C0KA 1WUTA 1SWVA 3U0BA 4CRWB 3WK6A 4WKBA 2YBDA 5CDTA 2GN0A 3NPAA 1KBQA 3CVWA 4B7UA 4PPYA 3WLMA 1G6KA 3EW7A 2YZKA 1E1NA 3EDRA 3VKGA 1Q16A 1MAAA 2FSSA 3BK1A 5ADVA 1E5VA 1GQ2A 3ANLA 4FS8A 4PF1A 2QRKA 2AN3A 2HL6A 2AJLI 4FIDA 4QDUA 5JPIA 1UDWA 4BQSA 5LZ4A 1EE9A 4LV6A 1Y8ZA 1AV6A 4KSBA 5L4LA 1DLIA 2EBFX 2Y2UA 1W2WB 3OQHA 3VPCA 2DBVO 4DLSA 3OCUA 1CQJB 5EJ6A 2GF0A 1XALA 1KJJA 4UPVA 1TZBA 1ECGA 1OBCA 3CNBA 1YGYA 4Y2QA 3NETA 2OFOA 3PDUA 2AKEA 2C4KA 4Q3LA 1BMTA 4X63A 2H29A 1PR9A 3L8DA 3QMWA 4QM6A 1ZISA 2HBZA 4EMTA 4XARA 1HOTA 4RETA 3O8DA 2B21A 3VDQA 4CLOB 1QS0A 3DTVB 3HQ4O 4UUAA 2B94A 5C8YA 1E6CA 1MW9X 2OP1A 4BNTA 2L0XA 2JJ1D 1V1RA 1V7CA 3MYRA 4X0EA 2R8OA 3THYB 1U8YA 3W6NA 3WRYA 3PUXA 5K99A 4HDOB 4JC8A 5MGBA 4ER3A 1EVEA 4ESEA 2FWNA 2XRFA 2PY6A 1SCIA 2DLDA 3IB6A 4X85A 3PHCA 4N5HX 1MJGM 3RC8A 3C5VA 3ZW7A 1Z8NA 4ZIRA 1K8RA 3CIFA 3HCOA 5CJPA 1M75A 3MAGA 5B3AA 4B82A 1G8AA 1T0JB 1X94A 5IZ4A 4NDAA 1BVUA 4CKBB 4R2KA 3LDUA 3CF2A 5JQGA 3MT9A 2DKNA 3CT6A 3ZWWA 1CJCA 3GLGA 1CUWA 2VR1A 2Y1FA 1ENYA 2CDAA 1DUIA 3HY3A 3I9MA 4F12A 3STYA 3KETA 1YRLA 3OIGA 4G23A 3L8FA 1XMQB 1VI2A 2LPMA 1PT5A 3Q8LA 4RHXA 3COWA 3BCRA 1Z4KA 5M34A 4LWQA 2V3CC 1BCSB 1OLSA 1PL7A 2E5WA 3PK0A 4Y7CA 1KH3A 5JRDS 2BPOA 4EGFA 1JKJA 2HXYA 4XYBA 4YJDA 3KKQA 4J7CA 2WJHA 1ACMA 3TNDA 3DMDA 5IANA 1CYEA 1TDJA 1Q15A 1Y7LA 2LDXA 3BWYA 2GSDA 4ZQGA 5EFOA 4Y9TA 1OBHA 3RFUA 1D07A 3AC0A 2XRZA 1HURA 3OPYB 2OB2A 1ONOA 5DHRA 5FB3A 3MGKA 1PYGA 4PS0A 2R6CA 3TBFA 3X43A 3GNQA 3MCUA 2I7TA 4K03A 2HB6A 2Z30A 3ZNOA 5BVHB 1TM7E 1ZI9A 3EGXA 4EJFA 5CYOA 2DYKA 2KWIA 3HGMA 4TXJA 3W2IA 1G8FA 4Q4AB 2VDMB 5AKLA 3C3DA 3ZZMA 4DJ5X 5FX2A 3EQ9A 1E9DA 3I04M 2OMEA 3PGMA 4TSKA 3UWDA 3ZHZA 1FNNA 2A5LA 4P4SB 4JOSA 4NFSA 2P35A 5T6BA 1LDYA 3RWMB 1HH4A 2E55A 1E9FA 3T99A 2WTNA 3L8EA 4GKAA 4Y2PA 2Z3VA 3DE3X 4RL6A 2RHJA 1H69A 1X7ZB 1XTTA 4W5HA 2JZOA 5BQ3A 3IKMB 1SUIA 2N3ZA 3KT3A 3JQDA 3FOAA 4NARA 1EX6A 1PVDA 2JD0A 2PSFA 4EPWA 5CCEA 1ND5A 4LDRA 2IV2X 1LK0A 3PQ5A 3DGEC 4HGZA 1CHDA 1Y37A 2C7BA 5G41A 4AKGA 3AL2A 3C3XA 3L0BA 3BF8A 1SIOA 3NT5A 2YWFA 5HDBB 5JO0A 2WJVA 3EGIA 3MJDA 1COWD 2O06A 4MA5A 1BD3A 4QWWA 3WR5A 3HVRA 1F6WA 4N8DA 1O96B 2BMWA 1ZESA 3H4MA 5DSZA 1Z5ZA 5JS6A 4LJRA 4B3RB 2IU6A 1XA3A 1P0IA 3HVIA 2A2ZA 3KWJA 3TNYA 3S5JA 4UTNA 1B8OA 4ISBA 2R7LA 4NOMA 4Y1EA 3FJYA 1K0UA 1DWUA 3O94A 4MJ3A 4RTRA 4OFWA 4R98A 4YCAA 2FRVA 4DV2B 1EX7A 4P6VF 3KLPX 3V32A 5H80A 2GXSA 4B1FA 4XWGA 1M7HA 2H48A 2LIVA 1NDUA 1X7WB 4JCCA 4P92A 3R7NA 1S7GA 5DIFA 3WHIA 2QXTA 3GAZA 1LDMA 4MPRA 1UBNA 2BMJA 2R97A 3TFWA 1PLKA 3FNRA 1XWIA 4BS9A 4HK4A 2COUA 3TZKA 1P4RA 2QR3A 2NXWA 1P73A 4PO1A 3TQCA 1RHQA 3HSSA 4MVJH 2JFOA 4RO0A 3U80A 2Y71A 2OESA 2Q2OA 3CZAA 3DVSX 3SN6A 4F38A 2A92A 1W19A 4YVFA 2HI0A 5BV8A 4MUKA 4Q03A 3FJ1A 4FHEA 1FB5A 1MVLA 3PIRA 4FFBA 4E88A 3ZX5A 5FUMA 2PFGA 3WWZA 4BMOB 4D4MA 3UAXA 3LQYA 3EZGA 4E5NA 5JCPA 3NTRA 3RTEA 3HY6A 1ZIXA 1GADO 1FJ2A 3OMXA 1E9SA 4L22A 1WMDA 1PR3A 1YQDA 2Q0HA 4N12A 5LA6A 2FN4A 1TJNA 2NXCA 4QTYA 7GPBA 5KWJA 2OV1A 5LLDA 3GJRA 1Z3IX 3LX5A 4EYOA 4YT2A 3FCUB 1I14A 3FPSA 5EWJB 4XIJA 2B7BA 2FU5C 3O4GA 4J03A 3CX3A 1FDTA 2OORA 4JN6B 4RYDA 5HBGA 4PX9A 4R16A 5B7PA 1YZLA 2FFBA 4DKXA 5HIKA 1XE3A 1XD2A 1NUUA 3BGVA 4L72A 4YREA 3OLXA 5EUMA 3W5UA 2WC1A 4ND8B 2QNBA 4XQ0A 5IM5A 3H1AA 4J0HA 1KHTA 4JXKA 1E3EA 3I52A 3RJ9A 3TM5A 4BLOA 3KG2A 3VU8A 4UBOA 4FMPA 3ZW8A 3U13A 3UKDA 1G0OA 4NCJA 1IOWA 2FHPA 3AVPA 2EJUA 5EIHA 4B3GA 4EPRA 4E5UA 2ZRHA 4O4HB 1F14A 2HLDD 2ID4A 2BP7A 2ODAA 2PVPA 5LYJB 1BVHA 2CHEA 4PQFA 1QRSA 1G6HA 1QIEA 2N1BA 3UKOA 4ZOLB 3HL4A 5A5VA 1UM9A 2GBLA 2BEVA 4RACA 4KI0A 2TMYA 1DL5A 1EUDB 2TMKA 3L1KA 3MMZA 5DT2A 3SSAA 4DADA 3RTBA 3N8HA 4AJ1A 4WEOA 5DLEA 3REGA 4FGZA 4FZ3A 5SY9A 4IHJF 3OM1A 4XLLA 4X9XA 2SKDA 1XF9A 2WF9A 5DK4A 1I1NA 3G5MA 3UUWA 4O4JA 1JX6A 1NLFA 4KO2S 3SDBA 1V3VA 4CPDA 1M6NA 1NXOA 5KCZA 2YMLA 4CEIA 3P9PA 3EBOA 3PYMA 3QHPA 5U4XA 1R6UA 1RYEA 1VPDA 2OCKA 4QUEA 1VGQA 4DMUB 5K8CA 5LIPA 4C2TA 5C2JB 4P0TA 3ZK8A 1OI2A 1IG0A 1WKBA 3CYFA 4UAVA 4LYAA 5KYWB 3I0MA 3EZ9A 1KU6A 1CY6A 1YDMA 3I5YA 1KQGA 1Z2PX 1AM4D 1AGRA 3G2LA 4UFOA 2WUGA 1HL7A 2RK4A 7ADHA 1T91A 2JFFA 2XKKA 2K6GA 4CTOA 2EQAA 2CXNA 5D85A 2H1LA 1VMDA 2I6FA 4UNNA 5KWSA 1FMJA 4ZALA 4HH0A 4PG4A 5LDHA 1CY7A 1ZUNB 3TW8A 4HN4B 2E49A 4P83A 2GFHA 1Y6GA 4HY3A 5F3WB 3IAS1 3WTBA 4GO1A 4JJEA 4RV9A 1BH2A 4WECA 3RUIA 4HRXA 2BDTA 1SXIA 1ISPA 1Z2AA 4W9NC 3HYNA 3ADDA 1ZD5A 4CCYA 4I6JA 1RMYA 2OO3A 3KT6A 3KOXA 5CLGA 3RIYA 4BNNA 1AXEA 2LCFA 1VHDA 3M4NA 3U7QA 1OJLA 1YSCA 4HWPA 5ESXA 3UJBA 1K86A 2XNCA 5F1YA 5GOTA 1EJ0A 1C81A 1NVAA 3NI2A 4QU5A 4AD8A 1ECCA 3CB4A 2BHTA 1P4SA 3HJBA 3V48A 2H9IA 2XKJE 4URFA 1W0CA 4UD6A 2X3FA 1CUZA 3H2ZA 4N7MA 4EFNA 5A0VA 3CLVA 3IPYA 4GP9A 4R2WA 1OZFA 4MAAA 2CXHA 1JIIA 1U3CA 4KZPA 5HE9A 4RIFA 2IKSA 3HXQA 1PW7A 2C9OA 4WCFB 5DB4A 3ZKAA 1R0KA 1XIVA 1O6ZA 2CWDA 3CVOA 1O2DA 3GPCA 3O4JA 1S6YA 3DHVA 2FMTA 4DXDA 2M6RA 5AM1A 5FYQA 3WP0A 2ZRBA 3OPXA 2XGJA 1N7HA 4HUQA 4CETA 3KFLA 5IPFA 2C7VA 2FPMA 3GPLA 5JANA 1NBMD 3QXHA 1ZPDA 5K8LA 3HZOA 3GRKA 3JVDA 3MOGA 1DXHA 1SD2A 5FV4A 5ALVA 1H8HD 2ATEA 3U3MA 2AN5A 3NNSA 4OQFA 4CZ2A 1GAQA 2I76A 2CD7A 1ISIA 3EVCA 2VNSA 4EITA 2DFNA 1KY5A 4C06A 1RJWA 4F4JA 2XT9A 1I7DA 1UC5B 3HA2A 4KO1S 4MCJA 1Q0TA 3RHZA 2V7PA 3P4XA 3TZQA 3BS4A 3W7BA 1UL1X 4HH1A 3Q8KA 5EA2A 7REQB 4P7JA 5TMDA 2Q2WA 4LCBA 3UTCA 2VQDA 7MHTA 4YQYA 1MH9A 1V39A 2BISA 4MW4A 3E7FA 4OK3A 2QAJA 2PS3A 3QMPA 1J0DA 4R3UC 5TIIA 3HBFA 1GFSA 5C37A 3LE8A 2R5NA 3V33A 2NU7A 1WZUA 3QM1A 4LZNA 1DXOA 3V7YA 5KX5B 2R0QC 2IFTA 1Q74A 3FTDA 1U1DA 1WSWA 4BE9A 5JD6A 2MR5A 1G5FA 4JEUA 2XUIA 3L9WA 1YDEA 1E1YA 1AKUA 1TJPB 3BJMA 1ZIYA 3CLKA 4GRAA 4LJ6A 2CMGA 3OQIB 4G0MA 4KWIA 1KYYA 2W0MA 4NMLA 3N05A 1R5BA 3U7IA 5KTKA 3D5TA 3L0ZA 4PIMA 2R6R1 3AR6A 4IFEA 1EGVB 2AJCA 2IODA 2RGNA 5J4VA 2GDZA 3T9CA 3S8EA 1XJ0A 3B12A 4QJ3A 2NUAA 5E8RA 3AHIA 4CCWA 3H1BA 3CZ5A 5CW2A 4UAGA 3RG2A 1SC4A 5BSMA 4JLWA 3F9CA 5K6RA 2AMJA 2WG1A 4KK3A 1HR0B 4DTIA 3HYRA 2FR8A 5HZHA 1HL3A 3CG4A 4MJLA 1K6IA 1XAJA 1QVWA 1PWZA 5KNDD 4R1MA 1Q0QA 2YQ4A 3DDSA 4UU8A 1RLJA 3O4HA 4IZ6A 1NKSA 2FDRA 2VNKA 4RZHA 1BE8A 2AXPA 2H65A 3H99A 4P4TA 2W90A 1ZJWA 3EXEB 4K8OA 3ZQ6A 1XRNA 2OGWA 1J0AA 3HB4X 3MELA 1ACJA 2Z09A 5CUQA 4FYVA 1LFAA 1NJFA 4E08A 3K92A 1JLKA 4DFDA 3MTIA 2OCAA 4O63O 1QTQA 3M5CA 1Y33E 3DOIA 3Q7SA 4XIGS 4YP1A 4OATA 4P4LA 2XBLA 5TF0A 1XA0A 1V71A 3GAFA 4OLAA 1R6TA 2MT9A 1G21E 3DZFA 1KHHA 2X8WA 2GCNA 4UDNA 5IDWA 1HE4A 1MZVA 1VJ0A 2GM3A 1ESZA 1HYEA 1Q92A 2W6JA 1YMQA 5CG2A 4QTTB 1UP6A 2FW9A 3GARA 1R5JA 4IV5A 4EI9A 1S3IA 3YASA 1QQ7A 1W2GA 1A9ZA 4EL0A 2XODA 4FYIA 1UOPA 4HLCA 4BGVA 1B8PA 5FYDA 4RK0A 3B52X 1DG1G 3Q9NA 3TB6A 4KIGA 1NR5A 2ZJ3A 1LGYA 2I29A 2F9MA 1U3TA 4LFAB 3MVEA 4U00A 3TMYA 3V6LA 3QUTA 1G3UA 5CVJA 1C1XB 1ZCJA 3GN2A 4BQIA 3F49S 5IKMA 2ZDHA 2ZU6A 3F2IA 1PJQA 3A70A 1LK7A 1IHPA 3UT0A 5IM4F 1BEEA 3C5EA 3DBHB 1D6SA 4JYAB 3B3QA 3G2QA 4LZAA 1TYCA 4RHFA 4NIMA 1WHSA 1OWPA 4B8YA 4EYKA 5IWCA 1E1RD 5BMVA 2JLRA 2X3UA 3HADA 3IELA 1AS3A 3O4RA 3QX3A 1J7JA 1P62B 4M0PA 2GTIA 1WWKA 1T4CA 2PX0A 3FCAA 3QFTA 4IJ6A 3UFXA 1KPHA 3K1AA 2W4QA 3FLEA 3G2OA 4WTOA 5JI2E 2VOJA 4HH3C 2REOA 4BO4A 1L8QA 1M7GA 1OQAA 1IY2A 2VA8A 4PGGA 3T7TA 4D0SA 2GBCA 3GMDA 3MTDA 1UFKA 2A57A 4L3VA 1LBQA 2I3DA 2JLCA 3CSDA 3CTMA 3IAM6 2XKAA 2GEJA 2ZUVA 1UBEA 3HKCB 4NULA 5AQ1A 2WJAA 5IHXA 1Z68A 6ADHA 3HJNA 1FYWA 1YAJA 4P1ZA 3KJZA 4GYKA 1RRFA 1OPXA 3LO5A 3C8UA 3FTQA 4MICA 2ZYHA 2VDVE 1NN1A 1IOZA 4OGFA 1TM5E 1W4BA 2GAJA 1PR5A 3VKWA 2QN9A 3T8YA 3C6XA 1AC5A 3X2FA 1AURA 3M3DA 2Z6AA 3GW8A 1BW9A 5LOVB 4YAFA 4P98A 2LD4A 2E21A 3D2AA 4GI3A 3T7SA 3TQFA 4L5AA 4DLKA 5IU6A 3T5MA 4QEDA 4CNQA 1X7YA 3AHFA 3DQQA 1OA0A 4YJFA 4Z86A 1IPEA 4TS3A 4H77A 4UDXX 4B45A 3Q3JB 1TUBB 4X7PA 3D8NA 4QU0A 3EEYA 4JI8B 3SYNA 4MK4A 5DH9A 2WKSA 1DAOA 4PO9A 4FFRA 1TMOA 2YFYA 2WA1A 1RMTA 4N5DA 1QPGA 3R3JA 1E69A 3QFFA 4KAAA 3UHJA 3EAGA 3NWPA 1TA9A 1Y48E 2OFWA 2CLOB 3WBJA 1U7DA 3CNQS 3V7NA 821PA 1KFCB 4J9VA 2PCJA 1GUDA 2C42A 1LFDB 3EQ8A 4K0RA 2BEJA 1YZTA 2WTEA 2DBQA 1ZVMA 2W2OA 3FLAA 1DQSA 5F21A 2CMFA 3GX1A 4XGRA 4ZCQA 5C80A 1U8EA 3KJFA 1NI5A 2O3TA 3DTNA 3G13A 4KRXA 2BOVA 4RPIA 3MWEB 4RPCA 5BR7A 5BSEA 2NP6A 2EFGA 2C2WA 2WM8A 3URMA 5B55A 2HNBA 2ZWOA 3PHBE 3RSHA 3DLCA 2LR0A 5IDVA 1JR2A 3Q0TA 5ANRB 1EK5A 1Z6YA 5FHRA 2I34A 1MJFA 3UNXA 4HMPA 3OPVA 1W7AA 1D8AA 3QLEA 4RNDB 5AW4A 3A4YA 3HBNA 1QQTA 4MVWA 4B3FX 5T67A 4LMAA 4BVEA 2YJ4A 5FNZA 2HMYB 4J8PA 3QU9A 4LSMA 4LC0A 3BQMB 2CDRA 4Y2UA 4EJSC 2GEKA 3MMNA 1P6QA 3LRTA 3OY2A 3LPDA 4EFMA 2XNSA 4BX9A 3TECE 1MVOA 3OLQA 3OMLA 5DNEA 3BRCA 2C7PA 3E9DA 4GECA 1SOVA 3AFGA 3KKLA 1JALA 2VWGA 3PEEA 1NN5A 4HADA 4Z0TA 2H06A 4YMGA 4YO8A 4BYMA 3VPGA 2H31A 1R9MA 5ALEA 4QQKA 5K9ZA 1W36C 1H65A 1QP4A 3BPSA 1ZNXA 1HI9A 2OO5C 1HE8B 5IKXA 2IU4A 1A04A 3GP5A 2XBUA 3PYXA 5G1OA 2WHYA 2HNAA 3FOBA 3L6OO 1UBJS 3QVWA 3FI9A 5DTMA 3CUKA 1RAIA 2QMQA 4JX9A 1XPJA 2P7IA 4V24A 4LC9A 4CJXA 5KQRA 1GGVA 3MMPA 5EN4A 5FWNA 3HXPA 2TMDA 4JROA 2PR2A 3WLLA 1ZK4A 3ZS9A 1N2JA 4PAWA 1EM8B 4CMIA 2OGZA 4F4DA 1VL2A 2ZTSA 1ADFA 1JL3A 2EARA 2LRHA 1J20A 3DE7X 1QZ3A 2RMKA 4WVLA 2HR1A 4X24A 5LKAA 4KGZA 3W3AD 3HZHA 4HEJA 1CWUA 1N8SA 7MDHA 5KOHA 1DRJA 1TO1E 2ZI3A 4WFKA 4QZVA 1QNFA 4MLCA 2BZGA 2FEWB 4NL4H 8ADHA 1EINA 1W6RA 2F1OA 5EESA 1W0KD 3UZUA 1AMOA 1J2JA 4DLWA 3FWKA 2W9XA 4Y9RA 4B4KA 5ICMA 5E4FA 1NZJA 3R0QA 1FMFA 1DDIA 1L5MA 1ZW6A 4MCAA 4MVXA 2IH5A 1GZHB 1BEUB 5EE1A 2IYZA 3PRJA 2Y68A 1KKUA 4F2WA 2OV3A 4XIIA 4B6PA 4B6GA 3NW9A 4DMRA 2VF8A 5SY6A 3HE3A 3NYWA 4HQNA 4MEJA 1SUSA 3KXIA 4EJMA 5I3CA 3TH5A 2E3JA 3GMSA 2VYCA 1E0JA 2B25A 1KZ9A 4IS3A 4OD0A 4LN1A 5HCUA 3I0ZA 4MUHA 4YB8A 5FUVA 4P7KA 2A58A 2WAOA 1KRXA 3ND6A 1BDJA 1HEYA 3N74A 1HQCA 2ZJ7A 1V35A 1ULUA 2YDYA 4F2PA 4DB4A 3E5RA 1R4AA 2IUUA 2FEKA 4FE3A 1ZZGA 2P4UA 1AKRA 4I7EA 4GE0A 4WXYB 2REXB 3BWMA 3LA6A 5AI5A 4ZMSA 1FSZA 3SJZA 1A8IA 3LBYA 2GA9A 2Q49A 3KJNA 3A05A 1LK5A 3NBXX 4WXPA 3JQBC 2W6MA 2ZZMA 1Z26A 4N6OA 3I42A 2I33A 2QN8A 5AM3A 4M22A 4I9FA 4OHRA 3SF0A 2HCRA 1USKA 2DWPA 4LGMA 1VHLA 5EZ6B 2ONJA 3U1TA 4PR0A 1E2HA 1FOEB 2NACA 2GFQA 2JFQA 1UC8A 1Y0BA 1PYDA 4V0LA 4Z4GA 3L40A 4WDQA 4P58A 4ACBA 3I6MA 1PG5A 2CL5A 3O1HB 3ZV7A 3O1IC 4PQRA 3TQOA 5BWOA 1CW2B 3BE5A 3O93A 4J2HA 4JMPA 3SXUB 1FQKA 3JRNA 3AETA 3L7KA 4WCVA 5GONB 3T5AA 3P27A 1M8JA 1N2CE 1PS0A 1GAEO 4M36A 4KQHA 3GJ5A 1I0LA 3GRZA 3KQQA 4RVUA 2QY6A 1J97A 1TAGA 2CVHA 2IDKA 2R66A 4L9RA 4ZC8A 1GYQA 1P31A 2WOJA 1F5NA 3NV7A 2ZVPX 5EINA 2KYRA 2NZUG 5HKKD 2JARA 1L4MA 4L15A 1Y8RA 1JEAA 1UXIA 4B4DA 1VLMA 1MXHA 4IX9A 1QVRA 1VE3A 2FQQA 1VBNA 4Z2AA 3W1VA 4XVRA 5JZ9A 1AKMA 1B23P 1FRNA 4BMSA 1WL8A 5FR2A 5DBFA 4K6CA 4OYYA 3WLHA 4Z99A 4TM7A 1TO2E 5IK2A 2JFXA 4JBLA 1Q84A 1D2CA 3PDCA 5H0IA 2W0SA 5JJCA 5B36A 4BBJA 1XZDA 1FFYA 4NOKA 4WXMA 3LY5A 2J33A 1XD8A 3JYPA 3WGKA 1FQJA 2FF5A 3SXPA 1OZHA 5A7FA 3K9HA 3VDRA 3PQDA 5F77A 4FDAA 2C5BA 3UK7A 2AWNA 1QIMA 3MQFA 1BHO1 3NIBA 4J7XA 3I9V1 4MRNA 1FUKA 3JQQA 1IEVA 4QATA 1O0BA 2CXOA 1EZ1A 2VDNB 2VKTA 1I4TD 4H0CA 3K31A 3NRCA 5TMPA 4I8IA 3RS7A 4AKIA 1OIWA 4KODA 1SOWA 1YS7A 1ZRHA 4BLWA 1ZOOA 3NHMA 1BTOA 2FK7A 1H5NA 2FRDC 4Q1EA 4TWRA 4AKTA 3LUGA 1E5DA 1KP3A 5I7SA 4OXIA 4U9IS 2IPLA 2CBZA 1D2HA 1OXVA 3I34X 2JLVA 2IOYA 4FCWA 3ZU4A 2ZB4A 1NW6A 3R3SA 1U81A 2BFNA 3VSBA 4YX9A 2XHZA 1Q0HA 1MX1A 2XAAA 5CW1A 4JC5A 3V8EA 5EHXA 4JJ6A 2EF1A 4OOEA 3H2SA 3K09A 1EXDA 4FFVA 3A3KA 3UPUA 1M1XB 1ZR2A 1IY1A 2CW5A 4CMGA 2BKUA 2UUOA 1K88A 3F2VA 5FQOA 3JQCA 1XPUA 1LI7A 2FFQA 5TEWA 1YFLA 2QTVB 3GDGA 5AM0A 1CY4A 3HVKA 3O8OA 3KR0A 5A4IS 3ETDA 2EGUA 2XLCA 2BF7A 4WINA 2QBYA 4YAUA 1HZZA 3H3JA 2FEAA 1TECE 1GCAA 1OCEA 1Q6ZA 5BN3B 1J2UA 4Q24A 2UYOA 4P2BA 5LP1A 1UWKA 1VHWA 2ACWA 3FJOA 3H5IA 5JJBA 2RHGB 4S12A 2RCNA 4BBPA 1SBCA 3D6MA 3LUBA 5LR6A 1S0UA 4HZUB 3KQWA 4AB1A 3ZQJA 1ZIPA 4PHGA 5F9FA 1Y9ZA 4MHTA 2XGGA 3UWMA 3VKUA 2H17A 2RAUA 3HMQA 5KJFA 2DFKB 1B6TA 3THRA 4CUJA 4HLNA 1P33A 4LHVA 2E37A 2ISQA 4GGPA 2RI1A 1L5KA 3VU1A 2QYOA 1X9IA 2HWYA 2JI8A 3F5MA 4RIGA 5CDYA 4LNUB 1ODKA 5NULA 3BOSA 4MW5A 1DEKA 4TMZA 1HFEL 4URUR 3TIGA 4N5LA 2QI9C 4UKDA 3MLAA 1EK1A 2QE6A 1SH7A 3T3PB 4XWWA 4XOUA 3K72B 4M0CA 5DM4A 4P22A 1TU0A 2XWSA 1E63A 4M1SA 1T26A 3M9XA 2BTOA 1GNQA 1HE5A 2BUBA 2IX3A 1JJBA 2VHCA 1RZRA 1DOAA 4Y2JA 3GEMA 3R5SA 1RRVA 4XOIA 2XV1A 3ZOZA 5KNBA 3U4MA 1EP1B 4AJJA 5MF6A 4YJGB 1TEHA 5FI3A 3QXCA 3I62A 5CB4A 3L93A 1RC1A 5ERXA 5JJLA 1IK4A 4IUYA 3QE9Y 2VHVA 3EPRA 4EBFA 4CM1A 2WSSD 4JR1A 1YJ8A 2IY9A 3JZIA 2B8JA 3FKSD 3FNGA 2ZPTX 3CN9A 3PQCA 1EA5A 2VWPA 1Z0IA 2Y66A 4B76A 1GNTA 2OD2A 1EK2A 4BVKA 2C9DA 4IQ8A 2XWJI 4XDHA 4FUTA 3TSWA 1I4OA 1M34A 3DE6X 1LC3A 3KLNA 1LVGA 1YIOA 4J0IA 4ATNA 1GLVA 4K9OA 1YCGA 4X92A 3IXQA 1L4BA 4L85A 1VPLA 1R3UA 3WQSB 1NGSA 2AHOA 2C4MA 1Z5WA 3B13B 1ZVQA 1QG2A 1BHJA 2EFJA 3NORA 2P30A 1J8YF 1E7YA 3A7DA 3WGJA 2XTZA 4Z3OA 1RI1A 4OGGA 4ZARA 4AX8A 1JEYB 3ZDDA 3W3AH 2G08A 3E22A 1L7AA 3MTEA 4PX2A 1OYYA 2Z2KA 5IXJA 1PGPA 4BVFA 2PZ8A 1M6VB 3HCBA 1KSHA 4TTQA 5K01A 4EQ6B 1EEXB 2FUEA 2WM9B 4BBAA 5JISA 1GGMA 1R12A 1J2YA 1SCDA 2FNAA 3KB1A 2FUKA 3A9CA 1A8UA 1LX6A 1U7UA 2B0CA 3P9KA 4UUNA 4CLHA 2DHQA 1J25A 1R0SA 4HCJA 1PT9A 5FUYA 5HMLA 3RKRA 4C29A 5A0TA 4FDVA 5JS8A 2HK7A 2FZVA 3DHEA 3EYAA 4DDMA 3DWFA 3L6EA 3MCTA 4KPFC 5AICA 3ZWQA 1R5NA 1AS2A 4AP6A 4IDFA 1U1GA 2OHGA 3RKSA 2C8JA 1JYEA 2OHVA 4MQBA 3SZOA 3ICVA 1N2OA 1CG6A 2ZXFA 2VT3A 1DEHA 3D1JA 4M8LA 5HMMA 3WLQA 1Q21A 2V6MA 4G0VA 1M0WA 1ZNWA 5T8KC 1E5XA 5L3SA 2PWZA 2HDHA 3F3MA 3JASB 5F12A 2J3MA 3WWYA 5JYBA 2QM0A 2QG9A 4ZV9A 3HP7A 2BW0A 2ZBDA 2KJQA 4P4GA 3QLJA 2I6SA 2NU9A 3ELWA 3ZJTA 1WEHA 1KR5A 5DEOA 3HXLA 3A2KA 1A9YA 1U0TA 3HN7A 3IUJA 2VDKB 5B1SA 4BKMA 4LZZA 2BI8A 2WLSA 1OVGA 1ZOIA 2SCUB 1FF9A 3GA7A 4BEBA 4JZKA 4MI3A 3VHLB 1HTWA 3LLUA 2JH8A 1EFCA 1Q20A 5IVPA 4OJKA 3U3XA 4RTOA 1JLMA 1M2VB 4KYVA 1QE0A 3L1HA 1J5EB 4KR2A 3LCVB 5CX1A 3RFXA 3JRXA 1GN9A 4X20A 3R5FA 1NASA 1AD2A 1PQYA 1DCMA 4FSDA 1YFKA 3CFYA 2AUTA 4DNPA 2WJ4A 2ZJ6A 1KC3A 3NTLA 4B33A 5IZCC 1L2TA 2ORWA 3QVSA 2Z56A 1SWWA 2ZOSA 4IKOA 5D3MA 2VAPA 2AQIA 3A9UA 4TTPA 3ZVLA 4HFJA 3WIDA 4KPUA 4K9RA 5IVKA 1E18A 4Q4JB 4Z1MD 3EXHC 4ZO9A 5BW5A 2W58A 2B78A 1R9NA 2V6IA 4II2A 1R8QA 4P9NA 1PFQA 3K8YA 3RS8A 4BO9A 5BMOA 1XP8A 3U7RA 5L4SA 1F06A 2QR2A 3IIMA 2VNAA 1QRAA 2A4KA 3NBAA 1JQJC 4IJQA 5CFOA 1GPNA 3DV0A 3VTKA 4XTCS 2ZU0C 4R31A 2QLTA 4R7TA 3GROA 4AZTA 2QRPA 1KYQA 4QAJA 1X1DA 2B4YA 5EMJA 1NPTO 3UTDA 3EN0A 4DUPA 3H7AA 4ECAA 5F35A 1S89A 3F3KA 4YY3B 3F6SA 1NDHA 1FLAA 3SIPA 4ZYWA 5EQTA 1QHHA 1J2RA 3CPHA 3O3OB 1RWQA 1UBGA 3GXBA 2P2CA 2BKAA 2A9JA 1TMKA 3A1TA 4L9AA 5DI9A 3ZHSA 5HQ3B 1TXGA 1IIBA 1TF2A 4OLJA 1ZGZA 1WV0A 1LWOA 3K0CA 3JQ8A 2OSBA 4PPNA 5K0NA 1E1LA 2I54A 4US0R 3BXPA 4Q9IA 4J3NA 3VUEA 4S0ZA 3ZKWA 2I66A 1PTJA 5JRZA 2BC9A 3FNEA 1R0BA 2PH7A 1NUQA 4FE4A 4EGAA 1NKTA 2IIQA 3QVTA 1Z17A 4JT2A 1GV0A 5ITZA 1BVYF 2C82A 4K87A 4ZKDA 3H2HA 2JIPA 1E4OA 1LTQA 5EXSA 4PPQA 1M73E 1SG6A 2ZUUA 3EWSA 4B43A 1TYAE 2A9PA 1ST2A 1Z5UA 3TLMA 2AEFA 1A5ZA 4UEKA 1RMQA 4DCUA 4GU5A 2VXOA 2UUCB 2H1IA 4EF6A 2Q9UA 4LSZA 4M8SA 4UHHA 1XCGB 3Q6IA 4CMBA 4E6EA 3T52A 3DZKA 1Z5GA 4DMLA 3ZEAA 5J4HA 2PQ2A 2HA2A 1G60A 1ODIA 4IL5A 3EXIB 4D8UA 2AMFA 1LW6E 2IEZA 4NR0A 2ORIA 4AZ3B 1UWCA 2ZWVA 4B3DA 3U49A 1EI9A 1S3FA 4LXHA 2XE6A 4Y30A 4A23A 2IE0A 3NIWA 1N6KA 3AG5A 1U90A 4ALNA 2XD9A 2QZZA 3SQXA 1ZNYA 4G0NA 4QXPA 1XVLA 2G9VA 2O6HA 4DV5B 1NXTA 3UJ6A 3R1IA 2GGSA 3TZEA 3W8FA 4KNWA 5CVTA 1C9EA 4JP3A 3LX6A 4IRXA 4KIWA 1IZ0A 3UO8B 2JGKA 3KKMA 4AY5A 1R0LA 1SKYE 1L0BA 2PGDA 4RDIA 2JB9A 4H6PA 3WGOA 1BG6A 5ICEA 3DSRA 3FCXA 1LSUA 5K4HA 2VF5X 4EVSA 2A7QA 1OUMA 1FNMA 2QZPA 4KVFA 3VSCA 4HJRA 4ZYXA 5IJ0B 2FJPA 5JCOC 4NK5A 1TD1A 3CBGA 3IP6A 4DSTA 2PZGA 4JOQA 4OQQA 1Z62A 2LCQA 1T10A 4HZIA 3MCVA 5JDIA 1CBUA 3E9YA 2P2ZA 1IY8A 1CQZA 2XRMA 2Q28A 3OT5A 3STHA 2Q1UA 3EHEA 3V4FA 3DOFA 3G82C 5ALUA 4YCLA 1WDLA 1H8ED 1WHTB 3AHJA 4HEA1 4LSWA 5DXJA 3KSDO 4BX0A 1MPTA 3ADPA 4F8EA 4OP3A 1OPRA 2QWXA 3ND8A 5HSGA 2WJWA 2G4VA 2WU8A 2Z6VA 5EHQA 1Z15A 4ZYZA 1U8AA 3D3KA 1NUTA 4IDDA 4Z9FA 3WI7A 1G8KA 3ODPA 1W581 4HAXA 2AF3C 2BEWA 2Z1NA 3RS2A 3WWEA 3HJUA 1I2ZA 1WUYA 1UJ2A 2YHIA 2EBWA 2Z2XA 2PL3A 4OG2A 5T57A 3WQBA 3OEWA 4EBBA 4O4LB 3AESB 3K7EA 1Y63A 1QIDA 4KQ1A 3BFXA 3MWFA 2ZTHA 5C53B 2HY7A 5DGTA 2QX9A 1EGAA 3U4DA 2O48X 1Y7HA 1YKFA 4CF7A 3GJXC 4IDAA 3F6EX 3FFTA 3IOEA 5HFJA 1XXLA 2AD5A 2PD3A 3VHXB 4O4HF 5IT5A 4HB3A 5G4LA 1US8A 5LYJF 1G59A 4ECEA 1EAMA 2WJZB 4LJ8A 5GZ1A 4FJ2A 3OSZA 1I0ZA 3H2YA 4ZOLF 1XZHA 2D1YA 1KF0A 3FF1A 2DPMA 1FZTA 5KSYA 1SIWA 1EVLA 1Y9AA 1E77A 2B5WA 1Z8HA 1NF9A 2PU7A 4QQNA 1GR1A 2P67A 3QE4A 5AOAA 2O0HA 5HRUA 3HXMA 3QW4B 4HYTA 2QG6A 2B2XA 3F4KA 1X1RA 3N0XA 3UICA 4BNMA 4ETMA 3Q8MA 1JDZA 1X3SA 2AQKA 1PWEA 2GWHA 3H8SA 3HLTA 1DTSA 3SBDA 3W6UA 4DN6A 1C9MA 2QLLA 1GLGA 2VPPA 1ORRA 4OA5A 1JYFA 3PT5A 1WF6A 2OBMA 3QTBA 2ZB2A 4TN5A 3ZWXA 1ZICA 3FFWA 1GTRA 2R7AA 1J22A 5T6MA 3QXSA 4C4OA 5C7OO 3ED5A 1B8UA 3EEQA 3TTWA 2PTGA 3WYAA 3O2NA 4P53A 5G0TA 3R9WA 4H18A 3RYIB 4LE0A 2PUDA 1OIXA 2C59A 3O84A 1NI4B 1TK2A 1E3WB 3FZNA 3H2BA 3PKIA 3GA5A 4UTXA 1XAGA 2DUMA 3DYIA 3L77A 4XPIA 2B2CA 2O2HA 1VCNA 3RC1A 2YY6A 3P1JA 5K2MA 3O26A 3Q3CA 1EFAA 2QSYA 2CHFA 3I64A 3PNLA 1GG5A 5KPDA 3DAPA 1GIAA 1DOZA 4BEVA 4F8JA 1ID8A 1EDZA 1GSIA 2GMWA 2MSWA 5ALMA 3DBRB 1TOAA 4XVHA 4RH1A 4RVNA 5CB6A 3N28A 1NE2A 1AKWA 1ECJA 4N0EA 4QYIB 2HM7A 1JI3A 2W2QA 4ND2A 3T7RA 2FVXA 5DCYA 1QGZA 1WV1A 3W9UA 1RJ9B 2XQKA 4YRNA 1CZHA 2QJRA 5P8WA 4BGIA 4M46A 1V37A 1I1HA 3FSGA 4QO7A 4PONA 4MVJF 3NANA 1PW5A 2CGEA 1MIHA 1VE6A 3LUJA 3R8XA 4L57A 4HQRA 4UVGA 3P5SA 3JY6A 3V2IA 4PBTA 3KXDA 4YGXB 3W1EA 4K3VA 1XMIA 1JZTA 3G2HA 1NVUQ 2DC1A 1K63A 4L0CA 3O90A 1FU8A 1ORHA 2AH5A 3HSKA 5HQTA 5FH9A 4KHPB 1VLVA 4IYRA 4DIOA 4MR7B 3NHBA 1K06A 3CGGA 1GUFA 2C5FA 5FO1A 4L4XA 1MDBA 1J9ZA 1Z7GA 4Q19A 2QUHA 4J9UE 3KYBA 5F2OA 2ZYGA 4CQNA 4B75A 5TDHA 4PYKA 2YZ2A 3PFNA 1J21A 4XD7D 3FA2A 5FOVA 5C1BA 3MWGA 2EP7A 2IEGA 4KXFB 2X40A 1XTJA 1Y5LA 2YR0A 4RPGA 2X2EA 1SBTA 4UMDA 2XXJA 2I7CA 4FS3A 1PQPA 5JMOA 1PR0A 1HO3A 3KQOA 1QK3A 1N0IA 2J8ZA 2V8OA 4H7KA 3KC2A 1TZCA 5C4IA 1N4DA 2FOXA 2I9KA 2ETVA 1GOTA 3QA9A 3UAGA 3Q3VA 2D3WA 5B7NA 2VP9A 1Y8QA 1RAAA 4N9QA 4YT4A 4GR5A 5KX5F 1IK6A 2AUNA 5CFLA 3ISJA 3UJHA 1G17A 2RJOA 4N0PA 1EH5A 4LECA 4OHMA 3BIJA 4JI3B 4ND4A 4C6RA 8ATCA 3RT7A 2YWRA 2ECPA 3PRHA 1OBVA 1D7OA 1PR2A 4JSTA 4S3MA 1SVUA 2C84A 2CLDX 1LPOA 3DZIA 5H9VA 4BY9E 1A9SA 4NDZA 2UYYA 1UPCA 1GITA 4RMGA 2BRUC 3T54A 5CH3A 1MABB 1UJMA 2JIZD 2WYVA 1U8TA 2I2WA 2X1MA 3DDOA 3FSJX 1AS0A 3OX4A 4JL8A 4L7QA 5SICE 4LPSA 2QYSA 3RS0A 4FR0A 3MJVA 4DHEA 2H52A 3PPWA 3I30X 5AKJA 5JO9A 1MV8A 5FUBA 2POQX 1QH1A 1X1EA 4GRDA 4UCWA 2XDYA 2XVXA 4ZYTA 1SA0B 3BBLA 2JA2A 3FYCA 2H1RA 4I1YA 1P4GA 3W8RA 2EAUA 3U44B 2ZJ1A 1TJYA 4NK4A 2F8MA 4KPYA 1MX9A 3EEFA 4XEHA 4DPLA 2VSOA 1KE1A 3LL7A 4Z9BA 4Q39A 1FDSA 1EFPB 1FS6A 3D6VA 4HNQA 2VP2A 5EPUA 2JGNA 4YUXA 1IQ0A 1NF2A 4AS2A 2BMDA 4E5PA 4TV9A 2F64A 1NIPA 1XEWY 2A35A 3KKPA 1YCFA 1RP7A 4BN4A 2RIRA 3L6DA 5CT8A 4AIIA 5AI6A 2OV8A 2PMWB 2SKCA 2OLKA 1RWBA 1WB5A 1DTWB 2IYYA 4INPA 3AP1A 4MWZA 3FTNA 1O1YA 3CZMA 4RKYA 1OC4A 1XU7A 2CNLA 1JHQA 1Z16A 2A0UA 3BFPA 3HGQA 3IVRA 4M6WB 1X0VA 5HEKA 1ETHA 3NVMB 2NYAA 2A9KA 3EMVA 2Z9BA 3CEPB 5FPHA 5TY0A 5CXQA 2PRYA 3WOVA 3MGCA 3AWIA 1KDVA 2AJTA 3WA7A 1FDRA 1LLQA 1NW9B 3UBMA 6REQB 4PLPA 2SKEA 4LBZA 1LPMA 4G3XA 5ALDA 4MWOA 5LYYA 4DLXA 3ORFA 3NLLA 4MV6A 1ZLYA 3GUVA 3ND5A 2BKLA 2QV0A 4B7AA 4QUJA 1G3RA 2PUVA 2WY2D 2XYHA 1UMBA 3R6GA 5IJ9A 4LYEA 3DL7A 2NZJA 4GI5A 4Q15A 4C0HA 1P7PA 3AIOA 1QIKA 3QUCA 4NKRA 1V3TA 4PZ9A 1N5IA 4WACA 5IBQA 4ZTBA 5ITWA 4RLSA 1NL3A 4CIBA 5AJYA 1MG0A 3ZQUA 1TKBA 2XZDA 4CN9A 4D0NA 1U7OA 4GSYA 5EQJB 4RXUA 4DC9A 1AQIA 3I5UA 5L3VA 2GN8A 2ODNA 2PZMA 1S7CA 3LPCA 4M0MA 4YEDA 3KUDA 5ULLA 3RSOA 2BFOA 3DEKA 1IB0A 1MRSA 2LUOA 1JLRA 2IC5A 3N3AC 3FAKA 5LJIA 3G0HA 3QWHA 4QPNA 4E3WA 2DY0A 4X1YA 3WFZA 3EPLA 3QEBZ 1P9RA 1F2TA 2JLWA 3L3BA 1N6NA 4LGCA 2EC5A 2WTAA 2OY0A 3IGFA 5DIZA 2QEQA 2F90A 5IKOA 3BCSA 1AU9A 3H9QA 4RFLA 1KTVA 5H3HA 1BDIA 3TSAA 4U6NA 2UXCB 5ELMA 2BMEA 2X9LA 1YQTA 4UM9D 3ZDRA 5JSFA 3CRVA 3Q2KA 1WKVA 2FE1A 5ARDA 5GMOA 1BDHA 2DR2A 2O5VA 3GFFA 3PX2A 1QB7A 4YYZA 4RVOA 2BBOA 5J1SB 1A8QA 2JCGA 3IEUA 5KWEA 4BVHA 1GHTA 3HDYA 3R9XB 2VDWA 2B7LA 1P2SA 4PU0A 2VDQB 4RK6A 3S2FA 3WLAA 1OWOA 2AS0A 5LOVF 3NHSA 3PNOA 1O58A 3D02A 2Z08A 3H1EA 2HBQA 4I3HA 1YC5A 3NONA 3RNOA 4AJHA 5K3OA 4MGEA 5BVGB 1Z34A 4TN1A 3GCDA 3DFFA 2F67A 5EIFA 1SOUA 1XRLA 3GLHA 3AINA 2VK1A 4W5TA 4UUBA 1KI9A 1YVDA 2QRLA 1VLQA 4C87A 1R1DA 3CLHA 3C3PA 2I2AA 2E0IA 3M8KA 4EPYA 2BMFA 1G6Q1 4YJ2B 2E85A 2CLEB 2CUKA 3ORRA 4TKLA 1J99A 2AOTA 1OV4A 1HWYA 1CZUA 3CNOA 3I45A 3NDIA 4WESA 2HCBA 2BM1A 2R1TA 2O8NA 4NXMB 5ADWA 3TVDA 3LF2A 4Y1RB 5DWVA 1PBTA 5COQA 1E32A 1T2NA 2BGKA 4NFLA 1P1KA 1YBFA 3M6UA 4PLTA 3GLRA 2WFLA 5LQSA 4XM0A 1F2UB 4GPTA 3L04A 4UQOA 2PRJA 1ZG3A 1OKKA 1X2EA 2BKXA 1R6AA 3L7CA 1V8ZA 4RA6A 4JB2A 1SXGA 2NGRA 3KYDA 4MARA 3VRHA 3PFKA 2VZLA 3CUWA 3GFSA 4N39A 1T2VA 4C9BA 2JAOA 1SUBA 4OQLA 1ZITA 3EJWA 4K9KA 3Q3GE 1X8JA 4WNAA 5AQEA 4BMNA 2GA8A 3ICQB 4GZ3A 4F60A 2FEOA 2QPOA 1M1ZA 1QKKA 2DX7A 4YRSA 4MVJP 5EMKA 2QL6A 4QDJA 4HDAA 3QEOA 1SHJA 2O7VA 2CVOA 2MIIA 1L9XA 1QFSA 1KNXA 3NM6B 3RBZA 3AVVA 2D2EA 4FC6A 3O0TA 4Q48A 3CNEA 4CLRB 3SM9A 1QC5B 3PG5A 2CE7A 4ND6A 3DG9A 3WQRA 1WPQA 2AFIB 3E3OA 4TLLB 2GYWA 3VHQA 2QVBA 1UQUA 3KWLA 1WRBA 2C9YA 1IJBA 2GJAA 3NQ41 2OM2A 1ZD8A 4HB2A 4MGZR 1E3IA 4B2LA 1HFWA 1W5AA 3RRXA 3BZWA 1YQQA 3ZCVA 3D3JA 5D01A 4PZCA 1AA9A 2X19A 4DY4A 4W1RA 2GCIA 3PC4A 1SKMA 5K6AC 4CLRA 2QAGB 1KBOA 3PPXA 3W5CA 3RS5A 2IHKA 3SNKA 2YV3A 2G8LA 1GRVA 4PGFA 1KQFA 1N5JA 1W0JA 2VT6A 3NWEA 1ZD3A 3FYSA 3KEGA 4H31A 4MEAA 4D80A 1YRQA 3MM4A 1BYIA 4IOKA 1BOFA 1JP7A 1XNRB 3CIOA 3HB9A 3H8VA 1PR4A 3WLTA 2PKQO 3UYLA 1KTIA 2X5JO 5INTA 1KYXA 1PJLA 1WAMA 3CJRA 4ER6A 3THWB 4FT2A 4Q1FA 1XVIA 3NHPA 4FPXA 4QSHA 2ZE5A 2BFWA 2ZYAA 3GEIA 3HYCA 4I5GA 3TX6A 4D9IA 3A6PC 1IUOA 2EFYA 2XMSA 2ZAIA 4H2DA 4OMFG 4Y9DA 4ZZ2A 5EJ7A 1GNPA 3FNFA 2X0IA 4PS1A 4G63A 1TUIA 2R96A 4K9LA 1SC3A 4BKRA 4BMXA 3OLVA 4CM9A 4G85A 4CM5A 1IBSA 3HKDA 3IEPA 4IWNA 5JVDB 4BZQA 3EQ2A 2VDRB 5EXTA 2DBYA 3LH5A 1BWSA 4IIGA 5KMGB 1NMEA 2DTDA 1NQTA 2ZE7A 4ILEA 2O59A 4M9SA 1GGKA 3ZJUA 1O5TA 4IO0A 4BFTA 1TO6A 3A1DA 4AS1A 3WDLA 5EHIA 5J1TB 2O2EA 4PCLA 4Q3KA 3KZOA 1QIHA 4LZLA 1MG5A 3EUFA 1RCUA 4QGFA 2LIPA 2JJ8A 3WMFA 4UU7A 4BMPB 4J2OA 1C1YA 2HDWA 2QVYX 3AKDA 4OKNA 2E4WA 3KU4A 2KM1A 2W2KA 3BH7A 3PXUA 2O8VA 1JVBA 1K5GA 4UJ3A 2R44A 1FVHA 2X9NA 3TUIC 1RHMA 1ZIOA 4QG3A 3NEAA 3WWCA 2Q29A 3RU3A 2EYQA 4CCAA 3IBCA 3IMGA 4L5IA 5DBGA 3ADKA 3HR8A 3P19A 3W2GA 4ZK2A 3PEYA 3Q1KA 3QYAA 2NU8B 1N0WA 1QHFA 2ZG6A 4DA6A 3DMHA 1YUBA 2Z3WA 1YOVA 1L5SA 5TB5A 2I3GA 2F8TA 1R0YA 1XG5A 3AUJB 1YONA 4RA9A 5LVAA 1QK4A 2HU2A 3D4BA 1E5QA 4TRMA 1KEKA 2ID7A 4FBGA 1XMSA 1IBCA 5J40A 1WXHA 5GONF 3HLKA 5DI3A 4JY7A 1QOZA 3CW8X 4AF7A 4BN5A 2E2WA 5BN4A 1N33B 4IZOA 4LDJA 1UJ5A 4GHWA 2O8DA 4L3WA 3QOXA 3EZ2A 4FD2A 1E7SA 1RRKA 2PGJA 4N3BA 3E3LA 5L6LB 3QELA 2W6ZA 1R7RA 2GVDC 3N2GA 1T3GA 2ECQA 3T4EA 4OQYA 3RYTC 3TPCA 3VJKA 4FFPA 1ID1A 2E4YA 1YB5A 2ZRFA 3N8IA 4U8HA 1T6ZA 1KY2A 1UC4B 1K6MA 4KQGA 4UM7A 1DJQA 1NDQA 5ERYA 5BR4A 5KYXA 4QL3A 4OQMA 2P4EA 2PLRA 1TKCA 4P35A 5KWIA 3G85A 1N2IA 2KLHA 4CEJA 3BWXA 1SC9A 2F59A 1RJDA 2Y0EA 3WGVA 1XZBA 2VQ6A 4KCGA 2IPNA 1FXWF 3ZBQA 3W9YA 3WB0A 2A9QA 2ZS8A 3AZPA 5LBIA 1JDBC 1K7EB 2Y1LA 5TS3A 4CM8B 2PZEA 4OK5A 1BEZA 5CXSA 4DLZA 4RWEA 2QX7A 1SELA 2HMUA 2QTRA 3QI7A 4GOOD 1T8UA 2H2FA 3I39X 4CDNA 1QQ6A 4MV4A 4LXUA 1P2VA 4UVHA 4AKHA 5H3CA 1ES9A 3KR9A 3PDJA 1E59A 1T9HA 2N46A 5FWYA 3OT1B 4ARSA 1Z4QA 5CFPA 3ZXYA 3N6VA 4OHFA 4I14A 4QA9A 1NPDA 1X1TA 2VC2B 4NX2A 4YRCA 4BKUA 4DBVO 3KQHA 3CZRA 1I2DA 2GHQA 4NH4A 1G63A 5ALOA 4MIKA 1WD5A 2OZLA 3B1KA 3R7AA 1K08A 5AVSA 3IV6A 3C1UA 1F0NA 2V7XA 2D1SA 4UBKA 5EE5B 4KR6A 4QDXA 4AO6A 4QOJA 5HUJA 4PW0A 1DDGA 1NBAA 2OBNA 3WHPA 1KQOA 1YQUA 3D6AA 3PFCA 1G5HA 4X41A 2IXAA 4REOA 1I6LA 1RQNA 1S8OA 1T5BA 4BGDA 1TCAA 5DTJA 4BRSA 2V9ZA 4G0PA 4Q21A 4QJIA 1CIVA 1XTZA 2X8LA 4FLMA 4XZ3A 5I7RA 2HRRA 1NVMB 3FDXA 4B0PA 1D9XA 5AI9A 1AO0A 2HFKA 1ESNA 4HX2A 4HFMA 2HHCA 2WZDA 4QBKA 3QSGA 1WU8A 2OXFA 1VSQA 4DG9A 3KSUA 1UOOA 1EB9A 4KIUA 3FPCA 3ABRB 2MSKA 4MUXA 4NE7A 1BKDR 4X54A 2PWPA 4WFJA 3RRYA 4XR9A 1AX9A 1EJBA 1RACA 4DQVA 2DSNA 5CBPB 4PX5A 3HVJA 1WUIS 1XDSA 4JLUA 1HDRA 4J16C 4PNZA 3GOQA 5TF4A 1V8OA 3OJCA 1UADA 2HHAA 1N3LA 4BP8A 3LYAA 3TG2A 1RXWA 2XJ9A 3NC4A 5TX7A 3PJRA 1OA1A 2AKAB 2A1UA 3T0IA 4EJSA 4G2TA 2XMCA 2A14A 5EC8A 5CA1A 4C0XA 3UAYA 4MWBA 1IBRA 2E6UX 4YJHB 2GDJA 3V8PA 4E22A 1E2UA 1MJHA 1W75A 3AX6A 4X93A 4D9EA 3BX1A 4FZVA 2BJHA 4V0RA 3WY9A 4D0LB 4ZT5A 1GDDA 1PZHA 5LQAA 1TZ2A 2QQ5A 1UXGA 5JZVA 3D8TA 5G1NA 2I2BA 4FB4A 3PYLA 3JQGA 2OO5A 5BWLA 2CYCA 5DNWA 3IH5A 1HRKA 1CX9B 3I2YX 3K4HA 1YGPA 1HKHA 5EWMA 3UQZA 4IIFA 5TMEA 3V1LA 1GPKA 5KVCA 3CUVA 4NBUA 3PL1A 4TRRA 4FXOA 2C1ZA 4YUVA 1H1TA 3TTTA 3IJPA 3THXA 4G0WA 1D2AA 1OYOA 1CUIA 2NQ8A 1L1FA 4Z7OB 4W5OA 4G0ZA 3AT1A 2DB3A 3A4VA 3C3EA 2P9YA 3ELYA 4N76A 2QLJA 4NJEB 3UV7A 3ZE7A 3KV1A 3LY8A 4RZIA 3GLFA 3OTWA 3E5HA 5FLYA 3PHGA 4V39A 2WB2A 2FPOA 3LQRA 4I0WB 1W5EA 1AK2A 1PLLA 2FI1A 1S2MA 3ENQA 4UM9B 1GA1A 3ETHA 3CE9A 4YRQA 3STXA 1KEEA 5CHEA 2DKOA 3I12A 2G07A 2Y0BA 4IXWA 3KB8A 1X8LA 4BWFB 1RBQA 2GETA 3GQBA 2C0QA 1ICEA 4NBVA 3A10A 2P3QA 4UQLA 3N86A 2VP0A 3QVGB 1HPLA 2BEUB 3G88A 4HYEA 5JAPA 4EUSA 1A5BB 1L3CA 3BGIA 3TJRA 2X5OA 3CTPA 3VYRB 4LC1A 3KO8A 2FW0A 3IP3A 4KNYA 2NXEA 1RC0A 4H0NA 1AGXA 4HDKB 4PYQA 2OXEA 2V7VA 3I0NA 2ZR9A 1D9ZA 2WE8A 3NHWA 2VJQA 1GU7A 3QX7A 3H5LA 3A4NA 3VR6A 4NAUA 1N0HA 2HUNA 5T7BA 5DN9A 3DOJA 5LLTA 4KWEA 1EPUA 1TTQB 2JGRA 3O6VA 1QM5A 2D3TA 3H6KA 4D0GA 2DFDA 1G66A 1AJEA 2A84A 5BQXA 4EGCB 2XCOA 1D09A 5JY1A 1K68A 4PWZA 3QMVA 4X8MA 5BN1A 5JTUA 1KQPA 1I3KA 4N47A 3IMEA 5ALKA 5FBLB 2IDZA 3NHUA 5DNDA 1YZYA 2X7HA 4F3TA 2P75A 5GGYA 2EGHA 4LOAA 4F4CA 4I1PA 3P26A 1NP3A 2A1TR 4AO8A 3SIWA 4QT0A 2W2LA 3OIUA 4YQEA 1KAEA 3GD7A 1GKKA 1XAHA 2XB6A 2AQ8A 2YWCA 3TLEA 4CFSA 1L4YA 4M7OA 3RQSA 3BSWA 3FBGA 4O2AB 2F1IA 2G04A 1GTSA 4DWWA 3NOVA 1D6NA 3AL0C 4XYLA 1VLZA 4QXAA 4ALLA 5A62A 1PV2A 2K4MA 3GUYA 3IVCA 3H04A 4UEWA 4XUGB 3SX4A 3VYUB 2EXXA 2AOUB 1EFLA 5LPNA 3Q5GA 3EZFA 4PIPA 4AMBA 3G49A 5F5NA 3CLUC 4GEGA 2YOFA 3KDPA 1MA3A 4QFBA 4BNWA 2XB4A 4ZAYA 5B2EA 1NQAO 1OYWA 1SVKA 4FNOA 2Q6TA 1QHXA 4U9UA 1V5FA 2H2GA 3GU3A 3W4KA 2WG2A 4X6UA 4IKEA 1GVNB 4Q7LA 3V2HA 4BC0A 2FOIA 3Q40A 1NM5C 2V0GA 4HGPA 3I2KA 1KZHA 3FOFC 2P0EA 2Z9DA 1E6WA 2P1ZA 3WDMA 3A1WA 4YRGA 3WJ1A 4F6LA 5J9FA 3LD9A 1XDZA 3P0IA 4PZEA 3RGWS 2O9JA 3IO3A 3R41A 1FVOA 4BUZA 4ZZ1A 1BU5A 3A9SA 1U5BB 3ES9A 3P2JA 2P7HA 5DOVA 5KOJB 1WR8A 2JDIA 1Z4NA 2JBAB 2O3JA 2GCEA 4E2WA 1Z0JA 3BRWA 4WA7A 1X39A 2QG4A 3ACCA 5FFMA 3VZPA 4AZ0B 1ONBA 2V7QA 2GPYA 3G0IA 5EUCA 2NAFA 3QXGA 4GWGA 2G9UA 1W52X 2FRDA 3AKYA 2GLXA 3N87A 4IGEA 1BQ4A 3X1ZA 1GNSA 4CKYA 1KJIA 4NE9A 3VU0A 2P1DA 2W11A 4A2WA 4GQBA 5KEIA 2QJOA 3K6SA 2EOAA 3X1KA 1D03A 5F7OA 1FW8A 4ZOQI 1Y7PA 1WLSA 3PUKA 1N8NA 4U2CA 4FGSA 4A0RA 5DM60 1ZCBA 3DAGA 4FGWA 4TLEA 1SIUA 4L74A 4FONA 1NW5A 5CVEA 5FQNA 2PL5A 4NG5A 1PJTA 1FFXB 3L49A 3WGUA 1N32B 3OE4A 5JJ5A 2KB0A 3TLYA 4ZU1X 1GSHA 1JVNA 2QUKA 4XGQA 1WXXA 2H1FA 2PSDA 2PRSA 4IX1A 4TQUS 9ABPA 1JRLA 3HFRA 1B43A 2G1KA 5JLJA 3ZVRA 2PTHA 4YCNA 3RRBA 2AX4A 3DKVA 1L5RA 3GFRA 5BSTA 3W2FA 3RRMA 5ADHA 1O77A 5FBKA 4HS9A 1XV5A 4I19A 3NM5A 1OFTA 3HBMA 3OZXA 2G36A 4Y67A 5JOQA 2OXRA 1VZ2A 4IV8A 3KYCA 5ECGC 4BQNA 1JWAB 2C8KA 2VI5A 3ZCQA 2DZDA 4NYJQ 3QTLA 3QFCA 2YCLA 4RORA 2DHEA 3ORSA 3V4SA 4OXKA 3FYUB 3KBOA 4MYSA 3WO1A 1Z8DA 4CFYA 4F3YA 2DQZA 1KJNA 4TL7A 4I6GA 5KCMA 5T5QA 3G79A 3LXUX 4Y2TA 5EJIA 3RFTA 3CVXA 4M1ZA 4P3PA 2VYNA 4QGGA 4EW1A 2CT8A 3LUFA 4KX5A 1JEQB 4BLQA 4D6PA 1DU4A 1LQTA 1QGUA 2G77B 3CX7A 1GDTA 4UEOA 3C3AA 3GVHA 3JAKA 5EPEA 4A5OA 2L19A 4FLFA 2IHUA 1S8AA 4O4LF 2Q7DA 4D4GA 3GLUA 3BMXA 4XGIA 3IAS6 4ENPA 3Q1LA 4GBJA 1P0MA 3SQWA 4BEJA 3O03A 4BP3A 1YOBA 4XCVA 3VNUA 4IKPA 4BB0A 2VJKA 3BAFA 2FQYA 1ZMTA 3OF5A 1NZFA 4NBTA 4RKEA 4E6PA 1SXHA 1G2IA 1TA4A 3TG8A 1D2NA 3KQKA 3LCJA 1FTGA 5K1ZA 4XPZA 1SVIA 5GIOE 4KMRA 4GDFA 3HJFA 3UC9A 4HTAA 4OBXA 4U9HS 3UY4A 1CULC 2I1QA 3S7ZA 3WS7A 4ZJUA 2J4FA 3J80A 1DE0A 1U0FA 1EJ2A 4EAAA 1FTSA 1RVV1 2W43A 3HA5A 5LP6C 5CVCA 4IFIA 3RH0A 1TQ2A 1H6DA 3PGLA 4UJ5A 1G5QA 3TTUA 4FYPA 2D06A 1QYRA 3LP6A 3T7IA 4ZDJA 5HOQA 2D5LA 1C3VA 2EJWA 3KZVA 3AYZB 4NQZA 3FFBA 4FHGA 4IFTA 1QS0B 4PAOA 1WIWA 4K28A 5EXXA 1OIVA 5C8YB 4GI7A 4C1BA 3KOZA 1V1RB 2ZDGA 5JWRA 3LPLA 2W6JD 5JCZA 5IJZA 4XQGA 1PK9A 3AF5A 1IPHA 4Q93A 3TJMA 2CFSA 1P60A 5SZHB 1YJXA 2VQFB 1P91A 2O0KA 1PS8A 1ACLA 3E2MA 4PN7A 1DFGA 4DL9A 1XZMA 2EW2A 3BSFA 5IF3A 4ZIRB 4FBMA 2WHQA 5KJ6A 1CQXA 1R27A 2UZ1A 4C4RA 3L9XA 5T8KA 4A0FA 3IOMA 2CJWA 4PX3A 4Q7KA 5JQGB 5K3FA 2G0AA 3GLGB 3BQNB 2J9XB 4PXSA 4K5QA 2C5EA 1XMPA 4GLFA 1E6KA 2C58A 4OA8A 1XLVA 4F3RA 1RXVA 3M6MD 1E7MA 2M2IA 1Q14A 3WMRA 1W9MA 1OLSB 1BU8A 4F5EA 1XZIA 3HKBA 4D5GA 2FW1A 3R9KA 1JKJB 4O0LA 3QNMA 3DLBA 1XA4A 1V48A 2NO9A 2QMEA 3OOHA 5CNIA 3QVOA 4ACAA 2XEDA 3R3WA 1G21A 3JZMA 3MSXA 4C5CA 4CDRA 2ODQA 4GVPA 4TV8A 1HSOA 4F72A 3BMCA 2IHTA 1EIZA 3PZRA 2CBGA 4MUBA 1GKIA 2NSDA 2D5AA 4FXPA 1TJ5A 5C7LO 5EE0A 1C4WA 1A8PA 1QIJA 1T35A 4NRDA 3ZLBA 4BCCA 4EPVA 4F5YA 1Q0PA 1O6BA 2P4SA 1U1IA 2PV7A 2QVXX 2XTJA 2ZBFA 3EGXB 3K0BA 3KKZA 3N8GA 5BW6B 2IY8A 2D8AA 4AMVA 5DCWA 2Z2IA 3KL2A 3G5TA 1R4NA 2NZYA 3R3YA 3VDXA 1XRQA 3NTOA 5CA1F 4NCBA 3EXHA 3KOMA 3SLGA 5A4MS 5AH0A 3JQEA 1BHQ1 1W94A 1RJEA 4Y8VA 2VFAA 1U28C 1JQ3A 1Y6RA 1KXZA 1AZWA 3IIIA 5DPMA 5FBRB 1Y1SA 4Q01A 4KQ6A 2O1SA 1DQZA 2OCYC 2VUHB 3CEJA 3OQBA 2VYVA 1WOYA 1YR2A 4OI4A 4KL8S 4XIYA 4GC9A 3PTZA 3GVPA 4E32A 5F1KA 2ZRQA 3BH6A 3L8CA 4HRVA 1G8MA 1JG3A 2FGKA 3UA3A 3VYWA 5K0BA 4GOND 3OAAA 3OQNA 2P5YA 3BE6A 4ZEOA 1GZSA 2R60A 3KJXA 2CNWA 3LYLA 1ZUIA 4ARVA 1CJUC 2F9FA 4KNVA 2OYCA 4RFVA 4Z7JA 2CCJA 3AUKA 4OXQA 3TOZA 2O0JA 3E61A 2V6BA 3IE2A 1OFUA 2YVQA 2JH3A 3I28A 3DC2A 3RJMA 5B4UA 2Z2YA 3CN7A 4KOEC 3RTDA 2R62A 4QTUB 1YDGA 2RGDA 3C5WP 3WYDA 2B4TO 2HLHA 4ZP1A 3CURA 1L3BA 1NQOA 1OXBB 2WV7A 4TWBA 1TLLA 2GN4A 3B3AA 4OAOA 1AE1A 2NVBA 3CPSA 3KTAA 3X1JA 1ABEA 2Q7XA 3RU2A 4WCFC 1HC7A 5JZOA 1DFIA 1CUVA 1VJDA 1E4VA 1CEXA 3WZ2A 1A77A 3CWCA 5EIAA 1E64A 1D04A 3EE6A 4X64B 1Q95A 2PWBA 3QV2A 3W0LB 1OB2A 2QXYA 2QW0X 1UDAA 3G17A 1Z4IA 5AW6A 2JZCA 4IIDA 5ILGA 2P4QA 3NYIA 1HY3A 3JV7A 4CU5A 1PX0A 1ESDA 5AJUA 3L18A 3TK1A 3QPUA 4NECA 1E6LA 3WX0A 4BFLA 2D1QA 1REQA 4K88A 5DXFA 3PNVA 2VF2A 1ZA1A 4MP6A 4FFBB 3DYBA 1BKYA 4P5EA 4BLVA 4C0KA 3O4IA 1O97C 4DV4B 2XI4A 4YXWD 1RHUA 3G0DA 4IQ4A 4CIAA 3E9ZA 2VHXA 2H57A 2QSJA 3ESDA 4G67A 4U0JA 3IT1A 1SURA 1E92A 2VF4X 2XMDA 5LA6B 1N92A 4ZQCB 5F9HA 1E9RA 4S04A 4YJKA 3KK0A 1IATA 2ZT7A 1G16A 4EA8A 2BGIA 3LO8A 2GILA 1D2EA 3B1JA 3K15A 4PXAA 3CLRD 2PZKA 5A7GA 1PQ4A 1D1QA 2HSJA 2OK7A 2Z2ZA 1XD2B 1OZ0A 4GUAA 2YX1A 5JCOA 5AHKA 4FEEA 4Q1DA 4B83A 5JXWA 3CX8A 3OA0A 1XVAA 2QRGA 4YWHA 1QCDA 2EWVA 3EB9A 2EVWX 3CZCA 3F5QA 3JVIA 3S2ZA 2VK2A 5KDOA 3TF5A 3E9QA 1NHWA 3KKEA 3QWFA 3TMKA 2YYZA 2QT9A 3UGQA 3RV4A 2BP7B 1TFRA 2CL6X 4C05A 3RC7A 2X6RA 2DRIA 3A1NA 3LHDA 1JZQA 3WGHA 4E07A 1UM9B 2QA5A 2HRBA 2BEVB 3ZIAA 4KQ9A 2EX4A 4MRRA 2GKGA 1RADA 3HHPA 3PPYA 4I3FA 4WIAA 5E1BA 4AJLA 3OTOB 1SXQA 3ER8A 3GR6A 1ORTA 1Y4AE 2GZAA 4TMTA 3A4IA 5MN6A 1GZDA 4IXNA 5BV7A 4RCZA 3SEQA 4GXRA 3DV9A 1C4KA 2WD9A 5KDLA 4B4UA 4O4JB 1JFSA 4A8HA 3S1LA 4B3JA 5CYFA 4Z4IA 1Z29A 1EXMA 1Z45A 2FWMX 1NVBA 3NR2A 4GXNA 5HF5A 3T61A 4B44A 4CEIB 3SWWA 2B9VA 1T2FA 1HQKA 2ADFA 4XA8A 1Z08A 1PJZA 1C7FA 1USGA 1ZH2A 2QX8A 1DC6A 4M4SA 1IHXA 1Q17A 1H4TA 4PG5A 3ZDFA 4F8YA 4NOLA 1K66A 1THTA 2XUHA 3CNNA 1JT9A 5SZJA 2OB1A 3J7AC 2JEOA 2ZQZA 2X1VA 5CMLA 4XUEA 4BB9A 1HZJA 2BLNA 3G9ZA 2WWXA 2YY5A 2H7YA 4CM3A 2WSBA 4YUZA 3GDFA 3G23A 5SZKB 4UTPA 4ZCTA 2CMKA 3GMTA 4GM0A 2MYTA 4PV7A 1XL1A 5L6MB 2RBEA 2P2GA 4EGQA 2WP0A 3BWVA 3UJ7A 2UZ4A 1E2IA 2P0AA 3TW8B 2Q8PA 3LPNA 2OOKA 3M4ZA 4TVSA 5FBHA 4HPWA 3TEJA 1EESA 3B1YA 4ZREA 1EEHA 4LJ4A 5EIBC 3WYEA 3A1VA 2WJ3A 1X1BA 2O3SA 2Q27A 2XOEA 4LX0A 5F23A 2EDAA 1VKOA 2PIDA 4HNSA 5B1IA 3U7QB 3UJNA 4QASA 3UUFA 5B1HA 2EQ5A 2Q1SA 3TXYA 1YVRA 1VPWA 2LXNA 3RQIA 3PXAA 5KYKA 3BXZA 2Z5GA 1ISSA 3BXHA 2FR0A 1XQYA 2I55A 2X4LA 3GVIA 3TSYA 1KXJA 3N7TA 3FD8A 3FY4A 2BM8A 3CR7A 4N54A 4TVKA 1EAYA 4F9EA 3GOHA 1GYPA 3MB5A 4KIFA 5HHTA 5FIUA 5FR1A 1DXQA 1SPBS 2AVDA 4HUJA 5E95A 5JADA 3VH2A 2Q21A 3MILA 4JGIA 3RASA 2OT3B 4F2GA 3JALA 3WL4A 1CS0A 4NATA 3LBAA 4XYMA 4HX9A 4E5MA 3ZWYA 2ES4A 3AV3A 1CU1A 4X6YA 1A7JA 3PE4A 2BE7A 3D54D 3EMKA 4OM7A 4PYIA 3OJEA 1E1CA 1WCXA 3WADA 1ISFA 1QGOA 5I9TA 3SQNA 1HNNA 4JBXA 1Y3BE 4L5CA 4OLFA 2RI6A 3K4PA 3UWSA 3MXTA 4C7BA 2FWPA 2C8LA 1P0PA 1YNOA 2H8GA 3BERA 4LY0A 3TE7A 3HDVA 3PGXA 1L7VC 1N8KA 1T9KA 2QN1A 4ZVVA 5IK2D 2IS6A 1JPNA 2AYYA 4CBVA 3CF0A 2O3UA 3GLQA 3NDPA 5K3AA 4X8OA 5TVKA 3BA6A 3WLRA 3ZGZA 2OLJA 1SBIA 1VM6A 2RBKA 1N1GA 4YV7A 2WVHA 3KQNA 1JHOA 2PL9A 2IQ5A 4KYIB 1GDHA 3KLBA 1XK6A 4YP7A 3T3MB 4DM7A 4E7PA 4ZEVA 1MQSA 2FN3A 1TVKA 2FZ4A 2GRAA 3N5CA 5TPZA 3FUWA 5E9JA 1XL0A 1NVDA 4GYYA 3HTXA 2GJSA 5D3QA 2KBEA 2XR1A 4AN0A 5FUQA 1N2CA 2DBZA 4J1NA 4W6ZA 1BYUA 3N3BC 2NU7B 2KLBA 1F1JA 1W48A 3O73A 5DXAA 3S29A 1VXOA 3NNDA 4ASUA 2HSDA 3UPDA 4BNYA 4BNHA 1IVSA 3WKDA 3PNSA 1CB7A 2Q9BA 4CM6A 1K4KA 3PR3A 2VG8A 3L06A 4G5HA 1N57A 2FG7C 2VEOA 5F7JA 4V1CB 4BRZA 4BEWA 4MS4A 2G5TA 1Y6JA 1RXEA 1LKZA 3M70A 1GAXA 3U4CA 4KB5A 5P21A 4I55F 3OLZA 3V7UA 1BCRA 3K70B 4BV2A 4LOIA 4UNQA 5CTAA 5HJEA 1I30A 4FFMA 2NUAB 1IZ7A 2HK6A 1N9GA 3PDIB 5ER6A 3V4VB 5A4DA 2HF2A 4PYOA 2NPIA 1KI2A 4WERA 3K9LA 1H94A 4N3GA 5C34B 3VISA 2FPXA 2BWJA 3NAMA 2M6KA 3I4LA 2G76A 1QDLB 2I3AA 1BX1A 2C94A 3PI6A 1UK8A 3NOXA 4R9SA 2EEPA 5L3QA 2A0FA 1NZDA 1G2OA 1NR7A 2BRUA 5EJFA 3A4TA 5DBHX 2Y1DA 5BRJA 5C7IO 2FWRA 3L7LA 4LMBA 1P81A 2Z1MA 2FFHA 1GTL1 2ZBEA 4WUVA 3DXXA 1DTEA 3F46A 1EVJA 1ONNA 1TC1A 1JHVA 3SEAA 1QRUA 2M32A 2A9RA 1YU9A 3F4LA 1KSGA 4U4AA 5CM2Z 1G8SA 1JEJA 2PZJA 4O2RA 1ZX1A 2ZJZA 2PX5A 4CV3A 2A9FA 1JSRA 1U1FA 2EKQA 4WFQA 3RW9A 2QUAA 3WNDA 1N0VC 3SX2A 4COOA 2D0DA 1CRLA 1DT5A 3MERA 5BXQC 2FZGA 4WASA 4DBLE 4M7RA 1PEDA 2D0OB 5KSWB 5FF9A 5EZYA 4IIXA 3WL7A 3R4CA 1JQKA 4HVTA 3AVQA 3S44A 4D5EA 2ORED 5EGSA 2EG5A 1YK1A 2HA4A 2XADA 3PXXA 4DLPA 2CZQA 2JLAA 3ZN2A 3PVZA 4DR6B 3AGQA 3T35A 2B1RA 4OSEA 3OX1A 4K40A 4YRRA 5AXAA 1V6AA 4X1KA 3KX2A 1RZRD 1V3QE 5ARBA 4MV9A 3PQ6A 3ZEIA 3MRVA 4H1TA 5IVHA 5KNBD 1ZFNA 2X7JA 4IO1A 1NBIA 2OD7A 1KDYA 5A6SA 5IN4A 5AK0A 3GIWA 2OBLA 1O6GA 3I9OA 3I9V6 1NUAA 3WDSA 3WSWA 2X6TA 3HU1A 2YWJA 4BLUA 1L5QA 3ZD7A 1L4EA 3RIMA 3MJRA 4QJBA 1JA9A 1WHSB 5FLXA 2Q2VA 4PSCA 4UXHA 3DLIA 1KJ9A 3DL4A 5BMVB 5MN5A 3OZUA 5U1PA 3BEDA 1G291 1CZRA 1M8GA 1P0QA 3B3GA 1X6VA 4QYXA 4RD3A 3VDMA 2WD8A 3I5XA 4UTOA 2CCGA 2XE4A 2GAFA 1FVFA 1T4CB 1U98A 4GP6A 5DWDA 3UFXB 3TNJA 3K1AB 5J4YA 1ND6A 1VLHA 5LWHA