4P83A

Structure of engineered pyrr protein (purple pyrr)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
165
Chain Sequence
b'KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered PyrR protein (Purple)
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transcription
total genus 50
structure length 165
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p83A00
4LYGA 4LYYA 1BZYA 4QRIA 3OHPA 4RACA 5BQOA 1L1QA 5JV5A 3ACBA 4RAOA 3OZFA 1XTTA 1GPH1 2WNSA 5IAOA 2E55A 2H07A 1JLSA 3DEZA 4F8EA 4WMLA 2PS1A 1DKUA 1W30A 1DKRA 3G6WA 1QB7A 1QCCA 1XZNA 3HVUA 3QW4B 4PAWA 5HIAA 4P86A 2VFAA 2P1ZA 1JLRA 3DAHA 4RAQA 1WD5A 1VDMA 3OZGA 1D6NA 1HMPA 1HGXA 1QB8A 4RADA 1R3UA 1OPRA 1TC2A 2C4KA 4RHTA 1I0IA 1DQPA 4JITA 3M3HA 1UPFA 1P17A 4OHCA 1O57A 1VCHA 1BD3A 4TWBA 5K51A 3MJDA 4RANA 4RQAA 1I13A 4RV4A 1IBSA 4X44A 1BD4A 1Z7GA 4P84A 2IGBA 2AEEA 1ECBA 1QCDA 3KB8A 4MB6A 1XTUA 5ESXA 1ZN7A 4RHUA 2GEBA 5IPFA 2PRYA 4FYMA 4IJQA 1OROA 2JBHA 5BQPA 4RHYA 2PRZA 2XBUA 1UPUA 1FSGA 1G2PA 1NULA 2JKZA 3GGCA 1A96A 2JKYA 5ESWA 2H06A 4M0UA 3S5JA 2EHJA 4QYIA 1CJBA 1OREA 1A98A 2YZKA 1I0LA 3N2LA 1UFRA 4RQBA 3MBIA 4LZAA 3LRTA 1Y0BA 1DBRA 1ECFA 4LZOA 1G9TA 3ACDA 1ZN8A 4P82A 5E38A 5KAMA 4QYIB 2HCRA 4JLSA 2JI4A 1J7JA 3GEPA 1V9SA 5BSKA 1ECCA 1MZVA 2FXVA 4Z1OA 4P3KA 3DMPA 3LPNA 1NONA 3H83A 1L1RA 5EUCA 4P81A 1I5EA 1PZMA 1ECJA 4RABA 5JSQA 1DQNA 3GGJA 3O7MA 1YFZA 3NAGA 2H08A 1GRVA 1P18A 5BRNA 4PFQA 1ECGA 4LZNA 4P83A 1P4AA 4M0PA 1XTVA 1P19A 1XZ8A 3EFHA 4KN6A 4ZFNA 1A95A 1TC1A 4RHXA 1A3CA 5HKLA 5KAPA 1I14A 1QK4A 1O5OA 1LH0A 1U9YA 1QK5A 1ZN9A 4X45A 2DY0A 4S2UA 1A4XA 1VSTA 1QK3A 3ACCA 4P80A 1U9ZA 1G2QA 1STOA 1A97A 1AO0A 4WN3A 1G9SA 4M0KA
chains in the Genus database with same CATH superfamily
5AT1A 2MYNA 1F7UA 2PPVA 1E9SA 2R68A 1O77A 3DD1A 1ZPDA 4JNKA 3C87A 3COSA 4YUWA 1IN5A 1USUA 5GINE 2EBFX 2E49A 5E3IA 4CU2A 2SCUA 4YY3B 3TBKA 3WB9A 1V2HE 5EHGA 2HR1A 3IP7A 3QKRA 3EC1A 4ZP1A 3RD5A 4BGEA 4LFBB 3HI4A 3O0DA 1J9ZA 4L95C 5EMNA 4XDHA 1IWBB 4ZGGA 3HR8A 4HFJA 1W87A 5EWJA 3UHPA 5F7JA 5EXSA 2WPNA 3ORSA 5G1NA 4B2IA 3LF1A 1WTCA 1XWFA 1MR3F 1N8NA 2AS0A 4FNAA 1D6NA 1DAHA 2E18A 1EX6A 3KFVA 4UOQA 3QI2A 4KWHA 4G0XA 5KTPA 5BP7A 1YT5A 4QYSA 4MEBA 4NHEA 2PV0A 1R9MA 4QJ3A 4RE6A 3JYQA 1T1SA 1XZJA 1IM2A 2H2AA 1GKYA 4OHCA 4TTPA 4WFQA 3JD0A 3V3TA 4BUCA 1CFZA 1NRXA 1QHFA 2E4YA 2XMQA 4BXOB 1J0EA 1PFGA 2O23A 3F4LA 4M9UA 3RFCA 4BVAA 4H7JA 4DCNA 3ABQB 3O8BA 3TZHA 3MYRA 3NIDB 5LP6C 3ZCTA 3PJGA 2JVIA 2OEPA 1W29A 4XQGA 1U65A 2A67A 3AEXA 3HBMA 4I50A 4ZQEA 4Z3DA 2O4UX 3DCIA 2FSGA 4DLYA 3K6RA 1N6KA 2JAXA 2XKBA 4TKVB 4Q1AA 5HF8A 4X3CA 1ZX1A 4AROA 4ZEOA 4LSZA 4DV6B 5A0VA 1P4JA 4MYSA 4YJHA 4RHYA 4XWKA 2ATEA 1MPXA 1JYEA 5GWXA 3GGCA 5LD2B 3GPBA 4HGOA 4NBKA 1UOOA 3CUTA 4DBLC 4BS9A 4URWR 5KI6A 1OW3B 5BXYA 2IYAA 2G1AA 4GSKA 1GNPA 2PRSA 4BEJA 1JGTA 2AR0A 4B7AA 1R0XA 4K2AA 4NZMA 4C0QC 5KCZA 4L0QA 4J0IA 1ICEA 4ZIRB 2KM1A 3EOAI 2XYGA 1N6LA 2WR8A 3CVYA 4D8WA 4DMFA 1M66A 1V43A 1QQAA 5D00A 1EUDA 2ZDQA 2AF4C 2R8YA 1OFGA 4B79A 2WD9A 5G1OA 2P9QA 2Y2UA 3R7AA 3PJFA 4OBWA 2JJ2A 4EEKA 4HVCA 2O2GA 3K8ZA 3MA0A 4AB1A 3KNZA 4AKSA 2Z6VA 4HB4A 4NMHA 5IZ4A 3KOOA 4XE5A 2I99A 3DE2X 4EGCB 3SS7X 3N6XA 3ZOZA 5BNTA 4BVFA 3I1FA 2BZ1A 4LW8A 5J43A 1IHXA 1NJ5A 2WSLA 3LT5A 1J8FA 4YN3A 1P0MA 4IOJA 1OZAA 4Q7MB 3FROA 1XROA 2OHVA 3TVDA 1HFWA 4PF1A 3UV3A 5KNDD 4LZNA 1GPJA 1HDEA 4Z2AA 1P5HA 4JJKA 4ZANA 4CCYB 2CL7X 4WL0A 5IJZA 4C2BA 2J9RA 1JHQA 1NVEA 1NI4A 4HWOA 3QFCA 3IP6A 2O20A 4O2BF 4G0VA 3SF8B 4BNDA 3VBEA 1TGYA 3DHVA 3S8EA 4CCSA 2ZJAA 3FPBA 1YF3A 1E3JA 2ZR0A 1KY3A 4I81A 1XCMA 1N0IA 2DG2A 4F2PA 5DHPA 4IKEA 3R5KA 5LOVA 3GH3A 3HY4A 4G4SP 4GF5A 4MRVA 4G85A 1D7OA 2OAGA 4K6OA 1X7GA 2R4UA 4N65A 4OK5A 5KWSA 2ZM5A 4FFRA 1EP2B 5BUQA 4BTLA 3BMQB 4OIMA 3L93A 4PTLA 3NI2A 1O0SA 1ENOA 3MD9A 4C0LA 3ROTA 4ESHA 3KO8A 1SA0A 3M8KA 2C2OA 3F8WA 1Y3DE 2D5BA 4RD2A 3D4NA 4U63A 4XI9A 3GJ4A 3FI0A 4MPTA 4F11A 1NU8A 4XPIB 5JXWA 2SCUB 1ODTC 5CXSA 2Q4EA 3T0GA 3U37A 3SZRA 3QKRB 2QTWB 4B6OA 2ZVQX 4NYJQ 3LGXA 4ENPA 4N5LA 3AVWA 4C76A 1E6UA 1C50A 4F85A 3DMTC 2CZCA 1EWRA 5EWJB 1V71A 4E13A 1PL0A 3GPLA 2JIDA 1FRFS 1IAVA 3A3OA 4D46A 3UKDA 3Q15C 2PL5A 5DNWA 4DDMA 1O95C 3FA2A 1SIBE 3PXGA 1TGVA 2GCIA 3CISA 5IAKA 2NO9A 4OUDA 1ZK1A 4PCLA 1PVOA 5F9FA 4DDVA 2A3NA 2IEBA 3C3MA 3I2FA 4IDHA 3ZXIA 4RZUA 3O75A 4PZYA 4FYMA 1MCZA 3WOHA 4IEFB 3ONFA 3W2HA 4FFOA 4QQKA 4R8SA 3S2EA 1AQIA 2J3MA 3OPYA 3UK1A 1T91A 4I50B 4UMFA 1T9HA 4MRSA 4IUBS 1CJCA 3NHLA 2A5LA 3WMWA 3ITDA 4QBKA 4PYMA 8ABPA 2VP6A 3QOWA 2RD2A 2BBOA 3JQPA 3OP4A 2D1SA 4WQMA 2QLBA 5ECYA 1TM3E 3UCFA 4YJHB 2VCEA 1PR0A 4X00A 1HSOA 4K9NA 3K0CC 4MLCA 3DULA 2ZAMA 4MPJA 5JNVA 4R3WA 3NUQA 4HK4A 4V3BA 2FPOA 3WQBA 1QGED 1HYHA 4L6AA 2XZOA 1GLVA 1Q12A 3OD1A 2E4WA 2ZJ5A 3A14A 3A11A 1VLVA 4WVLA 4XB1A 5KQRA 1ECCA 4JNCA 1FRZA 4NOKA 1EXNA 4WWHA 3V8QA 2XXAB 2QDXA 1HX7A 2RDMA 3DMPA 4CMEA 1PQUA 3PRHA 3FCUB 4AYTA 1JKMA 4LHVA 4BLVA 5IVPA 5CFQA 1NR5A 4P5DA 3ND9A 3U39A 1DUSA 2QGZA 1O9HA 3GLFA 2VNHA 5A4FS 3TFWA 1EUDB 3WBJA 3IP5A 3K96A 3MQ2A 3HFRA 3IKJA 1H5QA 3BL6A 1Z17A 2Z1DA 3VYRB 1Q1QA 4O5AA 3L1VA 1A5ZA 1V11A 4EB8A 2PKYX 1KU6A 4CIDA 1UH5A 3MCAA 2CUZA 2EGGA 1YS4A 4NLLA 3EA0A 3SMQA 1QTQA 4J7UA 4MV5A 3AHHA 4OK3A 4JLVA 4JC8A 4F2DA 2ZI6A 4EG7A 3IUJA 3QV2A 5C8DA 3T06B 2XVYA 4FJ0A 1YJ8A 4XDGA 3LKBA 3HADA 2QR2A 2B2CA 1ZZEA 1VSBA 3C4QA 3DLCA 3GC6A 3NRJA 3KZXA 4FKMA 4YUYA 2WY2D 3T99A 5HUJA 4D8TA 3O8LA 3DHWC 1XTQA 1M2WA 4J94A 2ZTLA 4MQLA 5JI2E 4IINA 4O2AA 3CZQA 5IAEA 2WYOA 4S1VA 3JWPA 2A5YB 3W6NA 3JQ6A 3U16A 1YAJA 2C42A 4BNDB 5C32A 4LRSB 1QYVA 1BXRA 2ID9A 1QG4A 1QMGA 4CMIA 5DSTA 3R4VA 3ET4A 4U7TB 4NATA 5CGQB 1Q14A 2EKPA 2Y1CA 1KQNA 3ZJYA 3T7DA 4GICA 5LA6A 4RYLA 3RABA 2ZSAA 4D5GA 2XGOA 5LOVB 2E55A 3P0IA 2AC2A 2H11A 2O2DA 4GKVA 4XFJA 4X7MA 4II3A 1NVGA 2KBEA 3D6FA 4DCVA 3DOIA 1QTRA 1L4KA 1NURA 2FUG1 2LWIA 4MPDA 4B1FA 3CTMA 3F6BX 3G0HA 1I94B 4PTYA 1EUQA 5A5EA 2HDNB 1II8B 2VC2B 3UMRA 5LXTF 4PWYA 3H9QA 4ZV4A 1IVYA 2P2LA 3UCEA 4WV3A 4F1JA 5GZ1A 5SYNA 3RLIA 1GDHA 1K08A 1Z0FA 3R0ZA 3PPVA 2C98A 4YRQA 3OKFA 4H0NA 1HURA 3GJ6A 1S4QA 1F38A 4HYYA 1UEJA 4LRWA 1EB8A 3TOVA 1RJGA 1U7WA 2Q8QA 1HXHA 1RD4A 4KQCA 3ISVA 3WVNA 1XWIA 2QVZX 2ZJ8A 4E03A 3NJ4A 2G9UA 3K5IA 3AV0B 3C1OA 4ER5A 5CA0F 3WFZA 1GZSA 2F9FA 3O9ZA 2Q0HA 1F51E 1O94D 1B0PA 3G1UA 4I3FA 3JQBA 1AKVA 1VHTA 3M1IA 4TSRA 1XNGA 2FP3A 1LBHA 2AG5A 2EKBA 1JEOA 4PFJA 3L7KA 4OEHA 5H3CA 1WZCA 4IIJF 1BRMA 4QIHA 3QEAZ 2O3JA 4L8YA 1TAQA 1CJMA 3H2IA 2AJBA 1L4EA 3ONEA 3CPHA 4H35A 3PG5A 4ZWNA 1G98A 3GT0A 2NV6A 2ROQA 4J3FA 1HE5A 1W76A 1ZO8A 3IX7A 1FNCA 4MWCA 3CRW1 3N8GA 2JI7A 4N0QA 1G8HA 2QUJA 3ZIAD 3MXOA 3OCUA 3TTUA 4XLLA 5P21A 2PRKA 3ADOA 1YD7A 2BJWA 3AP3A 3BICA 5DGDA 3WRYC 1RWOA 3PUVA 3RSSA 1PKXA 2J6HA 2I8AA 4L8WB 3AO0B 3L7JA 2DJ5A 2CYCA 4WUVA 5FA8A 1C1DB 2Q5LA 2ZJ0A 2JZNA 3DOUA 3IHWA 4RZ2A 5F12A 5UKDA 1GHTA 1NM5A 3DFKA 4INJA 4IW3B 3OZAA 3RC3A 1OJLA 1ISPA 2KW5A 2Q21A 1J90A 2I67A 2XGMA 2YHSA 2FEPA 3RRZA 2MMGA 3S4YA 3RFFA 3PC7A 3WMXA 3GLFB 1ONSA 5IC5A 1UMDA 4GKKB 4LCBA 3ZE1B 4QICA 1NJSA 4DNQA 3WP1B 5L7WA 4OREX 4Y2SA 2CVOA 1OLUA 2IUSA 3JZDA 4FEAA 4PFSA 2G5TA 5SICE 1C8VB 2DU8A 4JUBA 4FYJA 2H54A 4G01B 3D7SA 3MILA 4JJFA 4P34A 1N25A 4P32A 4R1QA 4TPKA 2JLAA 1E59A 1I4LD 1VLLA 1T34A 1VPVA 2Y9MB 4OI0A 4J75A 2R8EA 4HDNA 3UAZA 1E5TA 1KYZA 3DO5A 2CJWA 1VA5A 1Z5WA 3STUA 2CUTA 3BMCA 3T41A 4OP3A 3TQIA 4LF5B 2NLOA 4MGEA 1BYUA 2FI1A 2ZBFA 5E1MA 5KNBH 3I9LA 3NBKA 2O8CA 2ZTMA 4CR6A 3CLSD 1SQ6A 3EG5A 3RM3A 1SQ0A 1O03A 4FC7A 4O2AB 2YW9A 5EHIA 2O0LA 4DRYA 1Q0TA 1L5LA 3X1DA 4CMIB 1BXRB 3G2QA 2QORA 1E9AA 5ES3A 4CEIA 1R0SA 2FRDC 3IKLA 1WQ1R 1B8VA 1QO9A 4Q1DA 4NXMB 1KEEB 1N2GA 2MMCA 5IK2D 2YFHA 2YV1A 5LA6B 3KSAC 4ZHQF 2XQFA 3OLQA 4QQFA 5CLHA 2IDMA 3JTEA 1JR2A 4PNHA 1UJ4A 5KVCA 1CHNA 1J21A 2HLPA 2O1SA 3OEWA 2W43A 3OI7A 4G0NA 2C00A 2NM0A 1WF3A 2Q1WA 4MKFA 5L40A 4IRUB 5ENVA 3NKVA 1SUCA 4CR7A 2Y68A 1QSGA 2R6ZA 4PGHA 4TWBA 3DEIA 1K92A 1VJDA 1UZUA 2JDID 1ZM3A 4M4SA 3TOCA 4ISBA 2VTBA 3FCAA 4H6XA 1WWKA 3WLHA 3RJMA 3AVUA 4CNBA 5BN4B 3F8TA 3VU9A 2CLCX 2JHGA 2P5UA 2KLBA 1S5PA 4JKOA 5K0ZA 1TD9A 5FWYA 1PDWA 1QCDA 1AS3A 3MFQA 4HLQB 3C5VA 3OKPA 4RHUA 2EZ4A 4W7SA 5KCMA 3ZW9A 3DCNA 2FPLA 4BLWA 4D4LA 3TF5A 2J87A 2L2QA 3M70A 3ZHQA 1OWPA 2PX2A 4ZOAA 5AP9A 4AG6A 4EJ0A 3GRCA 4RSHA 4YP1A 4BIIA 5LZ2A 2LUOA 4OQNA 2ZPTX 4AQDA 3C1AA 2GF0A 2YJZA 4EATA 1CUHA 3WP0A 4M0UA 1ZN2A 4ADSG 3F7MA 1FFWA 5LZ8A 2GN4A 4NKRA 3FETA 3ZOKA 1DC4A 1Z28A 3D2AA 4ZT2A 1MQ9A 1NUUA 1VJCA 2XB6A 3Q72A 4OQ4A 5HWSA 5I7RA 1FP7A 1F4PA 3PQDA 1T6ZA 4X3PA 3D6UA 5CVEA 4XEUA 5AM4A 1J07A 1OH7A 1KI7A 1ZN8A 4I14A 3K2IA 4J1QA 4KFCA 1F60A 5CJPA 2HCRA 2A3RA 2XW6A 2GWHA 1UFKA 3GDWA 4HAXA 5BSKA 2ZI3A 3DDOA 3KFXA 3ZGYA 4CIYA 1I5OA 3QMWA 1N9GB 1PI3A 1RRFA 3B70A 2DH6A 2HXSA 2BSXA 1V1MA 3W3AD 4J0KA 3BORA 1AD2A 1F6DA 3KP1A 5KYKA 1OFUX 2R6R1 1USGA 3B2QA 3T15A 2RGNC 1SUBA 1X7HA 1QU3A 1MA0A 3N6RA 1CT9A 2XQIA 4JL8A 3ZNOA 4V1CI 5I4IA 3GL9A 4DUZB 1XPOA 3AUUA 1E2UA 2EATA 4JB0A 1EVLA 1Q20A 1HI9A 2JJMA 4CODB 4N41A 4DAEA 4UKDA 3UJPA 3GY0A 3UYLA 2HFKA 1AB6A 1RJEA 2ZRAA 1WMAA 4PO1A 4WLOA 2GUWA 4YS6A 7MHTA 2HSZA 4QTTB 4B3XA 1A3CA 1IOVA 5CVDA 4DNXA 4F06A 1R8QA 1UMCA 5JT1A 1H4VB 1GO2A 4AXBA 3IHKA 4MHSA 3T4UA 2V7QD 1JQBA 1KR2A 3PWKA 4TSFD 5DGCA 3WICA 4F3RA 2CWWA 3ICCA 1ZN9A 3OG9A 4DMUB 2GZSA 5CM8B 2EKZA 4ZTBA 4BYMA 3H1BA 3Q6IA 1J6UA 2V9ZA 1XVVA 1QRTA 3FLEA 2GBLC 1UIMA 1JKFA 3ZWBA 1V2GA 3SEFA 2ES4A 1YVUA 3SPXA 5KYXA 3CC8A 3VC3A 6ABPA 3WIDA 4Q7EA 3VR1A 3F0TA 2X0IA 1M0EA 4FMBB 5G1PA 1YOVA 5ILGA 2QE6A 5CEJA 1PJLA 1Z08A 2BAGA 4FGKA 1OKKD 1Z6AA 3WLEA 4KQ1A 4WCFC 4WN9A 2CMKA 3IA7A 2WIFA 4PZCA 4UHEA 4HDNB 1E20A 3IV9A 4EPXA 1CRLA 3OOYA 2OUKA 1FDSA 2VSFA 1OILA 3P5BA 1OBHA 2H1CA 1QIIA 4WY2A 5FR2A 2F17A 1N1MA 1QS0A 2RE8A 4HWGA 1I9CA 5D1NA 3RHSA 3U09A 2R00C 1MTOA 1FP6A 5KOIA 2IP4A 4L0CA 3R7NA 4CEIB 1R3UA 5EXPA 2FUEA 4GGOA 4JI0B 4LOHA 2BFFA 1MAUA 4ZO6A 4DC9A 3PHHA 3EEQA 2YXDA 5I9LA 5C18A 4C2TA 2GI4A 3AXTA 5EJFA 4EBFA 1QZZA 5JCOA 3H86A 3OIYA 3UW1A 2GLXA 4OM7A 2XCUA 4ZQCB 4Y2PA 2LZ0A 4EMBA 1PGQA 2R8OA 1V3UA 4AP9A 3OOEA 2SICE 4G5FA 4DF3A 1DRVA 1CC1S 3S1LA 5ESXA 4NCNA 3FF1A 2HHAA 1PFVA 4NBRA 1HC7A 2VTBB 4MPPA 4X65B 4R84A 2I1LA 1XIVA 4UUMA 4UPDA 5A03A 1E7MA 1X1SA 4IHJF 4NU6A 4RFSA 1HNXB 1KMQA 4O59O 2P9HA 2X42A 5FWYB 1NATA 2C8JA 5INTA 2G77B 2ZCJA 4P98A 1KJYA 1P7VA 1QANA 3SIPA 2VBFA 1W8DA 1QFJA 4Q9IA 3JAMA 3R23A 3I64A 4FD3A 3K5WA 2NYAA 2RGAA 3JPWA 1HR0B 1MNAA 1LSSA 3JATB 1B43A 1POXA 3X2EA 1M2GA 5T4BA 1R74A 2VZEA 1SUWA 2UYOA 4K9LA 2WKWA 1MKYA 2JFVA 4P7GA 2QM3A 1P62B 2EIXA 2VJYA 2AQ8A 2IOQA 4UFNA 2MSDB 3CB4A 3FBTA 4K6GA 3SXPA 4YC7A 2RKBA 2HRDA 1RFLA 4GM4A 4JVSB 1T2EA 5CX4A 3ORHA 4MSUA 5JYCA 4UTOA 1T6NA 2CVHA 2F1OA 3QPDA 4D9IA 3TNFA 3EW9A 2OV8A 1NLFA 1RWVA 3LUAA 4J76A 3KQUA 2YMPA 1HYEA 4H3SA 1EVEA 1RXIA 4ITVA 4ETMA 3RFTA 1V1MB 2R7KA 1SY7A 2PH5A 1JJ7A 4GP7A 1KZHA 1MO3A 4DR6B 1LNZA 3CRMA 1ESMA 2FW9A 3P9CA 1T5LA 3MLBA 4ALMA 3CA8A 1Z82A 2YZ7A 2EYUA 3HDQA 2CNOA 2JA1A 3ZBTA 3E48A 1ONNA 3AP2A 2EXXA 2HZBA 5CUQA 4U2BA 4DIEA 4Z53A 1N5IA 5K8CA 4CUKA 3A4NA 4M7PA 1OA0A 1CY7A 1DRUA 3O9MA 4DJJA 1ZICA 4J7XA 4IIBA 3ZGZA 1FSPA 1N1EA 1XMJA 1NTOA 3OLYA 3NV9A 1UMCB 1JX6A 4M87A 3IP3A 4BE4A 3L0ZA 4H17A 4DDKA 2H4ZA 4RMNA 2MSLA 2REBA 4DR3B 3GLQA 2B30A 1VL6A 1LBQA 2PFSA 3K16A 2LBPA 3FGOA 3ESRA 1DBSA 3FVWA 4RVDA 5KYXB 2BKLA 4ND7A 1L3CA 1Q77A 1JPNA 5G3ZA 5K09A 4ZQBA 3A9WA 1YOVB 4C0SA 4FFMA 4ZCMA 3HLTA 1RQNA 1KJ9A 4C4OA 3ELWA 4JVMA 4WN9B 1KP2A 2PXXA 3DFIA 3O3CA 3PHLA 3PQEA 5CNMA 3STXA 3U1BA 3LUCA 4G3XA 4NI5A 1T24A 3CX8A 3M9WA 2Q0QA 1S89A 3H4TA 4FJ1A 3HKEA 3HUUA 5HQJA 1QFXA 5EKXA 2PH7A 3CZMA 1QX4A 3OPYI 2Y05A 4ZTUB 4QFMA 4P0PB 2IHKA 2SHKA 1DHRA 3IQDB 2QN3A 3UA3A 4HQ0A 4ZCLA 3NV7A 3BK7A 4AMZA 5E95A 2H63A 3C3WA 3DEYX 5J2TA 3TPCA 3A1FA 3Q3CA 1Q11A 3FE2A 4NBNA 1EMDA 1D03A 3RFVA 16PKA 5B3JA 1OXTA 2BFFB 4X9XA 4FYVA 3KB8A 1SC1A 2C95A 2YXBA 2Z43A 2G0NA 3EEFA 1AC5A 3KJEA 3DZHA 3QNUA 4HYTA 3LKVA 3WMEA 1QGYA 3HCFA 4CM1A 2IPOA 3VZQA 3ZQUA 3JD4A 3WG9A 1K8QA 3JAKB 3JSXA 1Y6FA 4JX9A 2HHLA 1A7UA 3TIFA 4RTMA 3QEBZ 3MTGA 1RP7A 4R5HA 2RB5A 3PQ7A 1E2QA 5A3SA 3GJQA 2QTHA 4QUEA 2ZYGA 3OT5A 1FFYA 3AG5A 1GQSA 2VXBA 3BCHA 2XTAA 3LLSA 1IULA 1TM5E 4RFSB 3QEOA 5E8RA 2NXWA 5T6BA 2HCTA 2I9PA 1D7AA 4EEXA 5HK8A 1L9XA 4C3ZA 3EIWA 4LDQA 3L4KA 1JFRA 1VG8A 3ESQA 2Q3CA 4QREA 4C78A 1KVQA 1K68A 5J5VA 3OZSA 3ANNA 4XLTA 2R11A 4EPRA 1EGHA 2GK6A 3RASA 1HT0A 3EZGA 4FHCA 5JDCA 1S6YA 4ENWA 1HFEL 4B35A 3FKQA 4C87A 1UKBA 2J5XA 2JHAA 2X2PA 4GMKA 1SCBA 3QJGA 1O6GA 4WZAA 1PZMA 2ZB4A 1W19A 1JFVA 2ARKA 4FDUA 3WLFA 2C4TA 2J48A 3EZFA 4B3FX 4UUPA 2KI5A 4HX5A 4UVGA 1DTSA 1EFDN 1KI6A 3C7DB 3O7MA 4RZIA 1AKRA 1KO5A 1O1YA 2VSXA 2W2XA 4OSOA 3TE7A 1XTVA 3Q12A 3PHGA 4PR3A 3DFZA 5C1PA 3SE0A 4DM4A 1QUFA 2ZSIA 4QLAA 1DQZA 4G84A 4DQXA 3Q5GA 4YRIA 1YR2A 2ZAIA 3RANA 3GP5A 4B80A 5C8ZA 1KMHA 2NX2A 3O73A 1GL3A 2YHUA 3EW7A 2I6XA 3OZBA 1UBFA 1XVAA 1MORA 4J0GA 4PYKA 4TS1A 1VSTA 2A4MA 2YJ4A 4RL6A 5DDIP 3RYFA 3N0VA 3VUEA 4J0DA 5CAEA 3PEYA 4LBVA 5DZSA 4UTVA 3M6LA 3P2IA 5AM5A 1ADJA 3UA4A 1Z5OA 1Z4KA 3DBLA 3ENVA 4NCXA 3T5GA 3U6KA 4X3OA 2WILA 1FDUA 1FS6A 3NHRA 3FFWA 4PICA 5FBQB 4B34A 1B8UA 3RUDA 4HXGA 4ASUD 1NVBA 2YFQA 4F4FA 4FEEA 4TTAA 1DWPA 2X4IA 3E8MA 2ZI5A 3AHDA 3GGOA 2WU4A 4HEQA 4K46A 2FLWA 3PE3A 3NVMB 4EVIA 4DNOA 1GCIA 2OE2A 1XRMA 3ENNA 4QDTA 1E9RA 3L6BA 2BELA 5HUHA 3GVPA 1CBUA 2AHRA 1VTKA 3QW4B 5BSHA 5GJCA 5K20A 5K0FA 3TG2A 4UCXA 3R5HA 4YFVA 3FOZA 1FVFA 4Y7CA 2JAWA 2WINI 1XRLA 2WPDA 5DTEA 4BLPA 2CJPA 3DNMA 3OZIA 1PWEA 1OGIA 2FU5C 4M60A 3EISA 2ALJA 1TUBB 3FY4A 4AJLA 1F0YA 1H2HA 3DC7A 4MLZA 4M8KA 2WSSA 3A0UA 4K8OA 4L28A 1U7DA 3K5HA 5D3KA 4PS1A 1KPGA 4UM9D 1VG1A 2FEKA 3B8HA 3HKEB 3GFRA 4RUKA 2O2SA 5EP1A 1Z0ZA 3VR5A 2ZJOA 4WLUA 3O1HB 5JMWA 5J23A 5CDUA 2ZAOA 2WUEA 1XTKA 1OJ7A 3PR2B 1XGKA 2D3TA 2QJRA 2QW8A 4KQWA 1ULTA 2H3EA 5BPHA 3RAGA 4ENQA 4K05A 3G89A 5DH9A 1YB1A 2H1OA 3EMVA 4X1OA 4NNOA 3TEMA 5CDSA 4EFLA 1HDOA 3ETNA 3PNBA 2VDJA 1QPGA 4W5WA 3TR6A 4Q7JB 3ND6A 3LBYA 4RS3A 4C2AA 3LDAA 1HDXA 3Q5EA 3FZGA 2EOAA 2NYRA 3E15A 3BD6A 3DKPA 1B6RA 1TEHA 3DOCA 5LYYA 1H9BA 4RGYA 4QOHA 2ATIA 2X14A 3ACDA 4NV3A 1QIDA 5AICA 2IP1A 4MHTA 1R0KA 1U8AA 2JGJA 3X1XA 2X8AA 3E4CA 2OBBA 4IIUA 4JHXA 2J0QA 4UNSA 3BXOA 2R1VB 1DLJA 1OFIA 3REGA 2NVUA 3ZNPA 3L7MA 3WRVA 4GSLA 4ZVLA 1V26A 1YJAA 4C89A 4D8XA 4JLNA 3I28A 2KSQA 3L49A 2P91A 2D1FA 4JJ8A 1IQPA 1SU8A 1S01A 5CA0A 1ULZA 3RYIA 1NUPA 4KGZA 4EUHA 2H8KA 4JI6B 2BFDA 4QG3A 2HSJA 1OVGA 1U04A 4PPNA 2EZ9A 1OX5A 4DYVA 5JSFA 5KEIA 3F6PA 5CCEA 1Z6QA 5A5FA 1L0BA 3TGLA 1NC3A 1HKUA 4LRTB 4MQFA 3TMYA 4HGQA 3AVVA 3WSVA 4P54A 1OAAA 1Z2OX 1H5UA 3QEKA 4JP1A 2HZ7A 1OZGA 1VZ2A 3A1SA 1KETA 4B9EA 3NYIA 4CN8A 5C1OA 3B89A 3R09A 1JPUA 1BVHA 4R8MA 4UMEA 2YVAA 2YZGA 3NHMA 5KHAA 1NQWA 2O7SA 3H5WA 1BFDA 1QZXA 2M9MA 1GKKA 3ZV3A 1ZIYA 2LW7A 5DX0A 4B48A 3SBOA 3G3EA 1ZH6A 1KFKB 3CUVA 3KE9A 4TTIA 1HEUA 2YQZA 2F8LA 2YS7A 3NDJA 4NENB 5D85A 2JK1A 3ZV6A 1VXRA 2CXSA 1PP4A 1H69A 4X6XA 3RYFB 3A10A 4UNRA 5AVQA 5CAEB 5AJHA 4RW0A 3C16C 4JP8A 2Q1YA 4CYMA 2ERCA 3ANTA 2QV7A 1RWKA 3DBLB 5E2BA 3FBWA 2CLEB 4D9NA 5B2FA 3FSEA 3WAJA 2BGTA 1XCJA 4TSKA 3G6WA 1C3VA 1QZTA 2HJGA 3G2LA 1CIVA 3TLBA 4Q93A 4WOJA 2CEAA 5IYZF 3ROZA 1I30A 2FUNB 121PA 1RI5A 1NPYA 1EP1B 1BEZA 4JIMA 3K3PA 4HCJA 4JUDX 2ZETA 4YACA 3ZQKA 2XB4A 2DAPA 3FR8A 4BNKA 2X0KA 3T5PA 1IZZA 1I0IA 1K7SN 4Q66C 2R25B 4G6ZA 4S24A 2PU5A 4UEQA 2C4VA 2JAQA 1IRXA 3OPNA 4WEOA 3RS0A 2AN4A 3M4XA 2J6IA 3LW8A 3N8IA 2OHJA 4W5HA 1SURA 1NBAA 3E4DA 4HUQA 4JEHA 3FYDA 3G2IA 3B9PA 5BT9A 1EUZA 3TAXA 3STHA 4EHKA 1R6TA 1UJNA 3F9CA 2BHTA 3D6NB 1NYLA 5A3RA 5KSZA 2DYKA 4BKQA 4PZEA 1UPTA 5FPHA 2YUIA 3B2NA 1YZNA 4FK8A 4N5MA 3UMGA 3MGBA 4D45A 2IKQA 2ZVJA 1W2WB 1N2OA 3PC3A 1NBWB 1E5LA 2DR3A 2PMWB 5D8DA 3SYNA 1JQEA 4TLLB 5HX7A 2EF1A 1UFOA 1TZJA 5LC1A 1YRBA 2XUHA 4TN5A 4XIIA 3AIMA 4UHFA 4B3BA 1UP6A 1NN3A 3VVLA 4XA8A 2CVFA 1AXEA 3CW2A 3TMAA 3ZWNA 2PL9A 1EDZA 2ETVA 5FQNA 1P4HA 1O0CA 4NOMA 1FNNA 1YMVA 1YS1X 2WTNA 3C1UA 3IXMA 3A4IA 4W1QA 2Q2OA 1VKZA 3KBOA 2VZ9A 5CX1A 3UXMA 2X6QA 2HJ9A 3QPAA 2W8ZA 3LECA 4O1IA 3SMVA 5AW8A 1YZVA 2O0HA 3LIPA 2BFCB 2ZYWX 5ALHA 3CW9A 5AUOB 3IEMA 1SKYB 1SKBA 2HGSA 1IJKA 2OTCA 1H8HD 2FZGA 3HY6A 3Q3JB 1IZ0A 5ER6A 4F6LA 1JHPA 4LGCA 2I0FA 2PX4A 1FNSA 1M76A 1THMA 2QTMA 3HJRA 4LSMA 3G23A 3NBAA 2GS9A 2G25A 4GUDA 4ZOCA 4KE7A 3NGLA 2VJQA 4G8BA 4QDOA 2Q1UA 1N2ZA 3ONDA 4PINA 4LHSA 4G5QA 1XXHE 3QENA 3L8ZA 4Z6KA 5JAPA 3R7DA 3MWFA 3FMIA 4B75A 3GFVA 3G2NA 4EY7A 5CA0B 3CRVA 2JI9A 3UQYS 4EHJA 4YPOA 3QUBA 2BFDB 1WMEA 3SQMA 4RTKA 3O38A 3ROKA 1PZNA 5JROA 1QHYA 1W5BA 3MJVA 1E98A 2MWMA 4XXHA 4NFLA 1QK5A 4YP7A 3SS8A 3NM6B 1YE8A 1Q50A 1TQ4A 2FPUA 2ZG6A 4MQFB 2PO7A 5FRDA 5H0IA 3RJ9A 3RJTA 1BHQ1 1REQB 1ZK2A 5FI1B 2Q9UA 5CW2A 3VPSA 4BQEA 4IIJB 4A82A 1AQJA 4JKYA 3DO6A 3INNA 2OYSA 3OQPA 3P94A 3PDCA 2D54A 3QF4A 3VYTB 3EHEA 1DOZA 5DTQA 3R75A 3RVBA 5BN3B 4DSZA 1BHSA 5JHHB 3EN0A 3RRYA 3S2FA 2E4AA 2G63A 1QYWA 3HDTA 4XSVA 5ALMA 2VYVA 2FXIA 3H9UA 2QX8A 3HGTA 1ZM2A 4RCZA 5EUBA 2VUIB 2VSOA 2R60A 1DKMA 2FFRA 3LD9A 3NNNA 5ARCA 3NHPA 2PXHA 1L5MA 3TUJC 1LXCA 4H1UA 4AF8A 1G60A 3CO5A 4RXUA 5L3SA 2NZXA 1NW5A 2RHWA 3IDQA 4MJXA 4I1OA 4Y9DA 5AKZA 3RVOA 5DM70 2HA5A 1P1JA 2I2XB 4RF4A 3NBXX 4E1AA 3ZDZB 2HMTA 4V0ME 3VVCA 4PFKA 2X1MA 5HM6A 4C6RA 5BQ5A 1N9KA 3TW8A 1WP9A 4FHEA 3AU9A 4QLOA 1VLZA 2HQ1A 1I4TD 1U2RA 1JE0A 3R5JA 3WLPA 4EHAA 5JAMA 2QM7A 1UKZA 3FRHA 3PFWO 1JP7A 3KHKA 4I4NA 1ESNA 1NLUA 4M0CA 1Z88A 2BYTA 1U2DA 2FHPA 3DONA 3IOEA 2FPWA 2WYUA 3S44A 2HBRA 3EC2A 2DCMA 1PVVA 2XMCA 3U4QB 3B53X 5ALIA 3EPRA 3D2CA 2GLTA 4O4JA 3K5PA 2P2YA 4P4LA 2BE9A 2ZI7A 3ITNA 4JGGA 2VAPA 3UB2A 5I8WA 2H9YA 1C29B 1M67A 4PLGA 1BXGA 2ILVA 1XPJA 4LJ8A 4LRYA 1N6PA 3U31A 2UYQA 2HWWA 1M7BA 2BGRA 4ER7A 3AF5A 1H2AS 1YB4A 1CLEA 4L5IA 4YALA 5BWNA 1ESZA 1XTPA 3BWMA 3ZH9B 4M99A 5HKKD 3E2PA 3O4HA 4TMXA 4YCJA 4P0QB 2GJSA 1LK0A 5GGXA 4GBMA 1G9TA 3A9SA 3DVQX 4MW6A 1R6DA 1GXSA 4WGGA 3V8VA 4I2NA 5I7VA 2R3SA 2SKEA 4IZ6A 1QORA 4QECA 4ZHQB 4LZLA 1FS5A 5AQEA 1TQ8A 2D0OB 3KYDA 4AWAA 4H4DA 3LZDA 1ZIDA 3GT4A 1QVZA 3Q6MA 1SUAA 3NBMA 4MHOA 1YASA 1LSOA 1J8QA 2C03A 5CX1B 3T5TA 3DZFA 3ZWOA 3ZWCA 3X1MA 1KEWA 4MUYA 3KPUA 1F6WA 2O3TA 2RGYA 3GQBA 1HMYA 1E2KA 1LDBA 2HTFA 1DBQA 3IH5A 2OA0A 5IVKA 1IG3A 5EIHA 4UEOA 1U6KA 4LXIA 1WB4A 3ZI7A 2GVNA 4X20A 2R5WA 1PJ8A 2DJIA 3PE4A 4IHJA 1G0OA 3NNSA 5M7EA 2APJA 2JRLA 2R1TB 2NWQA 3RWOA 4GNKA 4MS3B 2ORED 2P35A 3TW4A 2YWCA 4ER3A 3U3RA 2WWGA 3DL2A 3EXG1 2CY0A 4ARSA 3PLRA 1IK4A 4ZMSA 4Q05A 1FX0A 1WY7A 4J1SA 4J2TA 1IN1A 3TMKA 4ALIA 1APBA 2H00A 2PXCA 1M6NA 3HNRA 4QXQA 3RQSA 3S2IA 2C5SA 2IIPA 4J9UE 3SDBA 4N01A 3QU5A 3QHQA 1OX4A 4D1YA 3WWCA 1B3BA 3KT0A 1U5BA 1WSAA 4X94A 4LHEA 1XN1A 1BCRB 2ONKA 1MJFA 4P36A 1XOIA 1O58A 1X7XB 2IE8A 2WRZA 4O08A 5KWEA 2PA3A 3FGPA 2PYZA 4FUTA 4LJLA 3V1MA 5JV5A 4LF7B 5DHUA 2GJKA 3WHPA 1XCOA 2A30A 2HA0A 1P2DA 9ABPA 2VRNA 3QF4B 4G0PA 4LF4B 1KYVA 2GK4A 3OHMA 4O2LA 2WIJA 3CLKA 3FFBA 4KXFB 1WCWA 2IYPA 1L7NA 3LOUA 4E5DA 5GZ6A 3W5DA 5E0OA 3HB1A 1FMLA 5HE9A 1QO0A 2PE5A 3D3WA 4GAEA 1SVWA 1XDBA 2REOA 3LVQE 1SKUA 1YUNA 3BWBA 4FLMA 4UAGA 1KRWA 3GN1A 2VAXA 2ID4A 1OXBB 1UBCA 1SXJA 4FR0A 4K9RA 4MWDA 1W34A 1SVSA 4D4JA 4YUAA 2FH5B 3WQRA 3TSAA 1ADYA 3E8XA 4CZ2A 3R7BA 4QG7A 4S12A 5L3SB 5C8XA 2WJGA 4RF5A 3C1TA 5F3RA 2JIZD 3DT6A 2YNMC 3ICOA 4MV8A 4B6GA 4B3RB 4M8IA 1V5GA 2IJGX 4GGPA 5F21A 3Q0IA 2QNIA 4A2PA 1B23P 4HTFA 3I34X 2NTYC 1MO6A 2AW5A 2O4CA 2EHDA 1RC1A 2X1HA 4JROA 4DA8A 3IJPA 4NZPA 3I2GA 3CUYA 2GEBA 3WIUA 1ZAYA 1J39A 4QOFA 4ABTA 1G5PA 4PG7A 1Z8FA 1ZZGA 2W0MA 3IDZA 5CM2Z 5IBQA 3V8NA 3H1FA 1CEYA 1G17A 1EE9A 3CKYA 3MWLA 4C5AA 4CKCA 4MDEA 1C3EA 4BCCA 1UPBA 5B1HA 5KNCH 3HDHA 3QVOA 2PEYA 2W6PA 2QG4A 3RRNA 1TLLA 3BDAA 1WY5A 3HABA 4IGEA 3CGWA 4O4JB 1DHTA 2C8LA 2GEKA 2JLQA 3CCCA 4Q7KA 4XAQA 3QE9Y 5H70A 1MVLA 4XVCA 3A2MA 4R8KA 1VG0B 3DL0A 1E1QA 2VO1A 3R6LA 4X61A 4LJ7A 5FAXA 2PJZA 4ME6A 1BXGB 3EDYA 1U4NA 1RCFA 2Y0BA 4H15A 4YV7A 4RK4A 4PXSA 2F8MA 4KQHA 1VJRA 1ZCJA 2XSZA 4CV0A 4DLVA 4EUNA 1KY2A 4JLPA 4X84A 1P1HA 2FN3A 1TDJA 2BSAA 2XADA 3LDFA 4P53A 2BTQA 4EB6A 3EWAA 4DR1B 4ZT7A 2VK8A 3B9RA 2W9XA 2VZLA 4FS8A 2C4MA 4FPXA 3V4ZA 3GJ8A 3H83A 1GXSB 4U7JA 2XA2A 2QSJA 4AIIA 3ZHBA 2B7CA 2ZYHA 4GSYA 4DA7A 1I8TA 3ND5A 2O7NA 1U8CB 1XUOA 2C2WA 2C99A 3IDOA 3KYDB 3PXCX 3R6WA 4H2DA 4NMMA 3UATA 4DW8A 3VSBA 2BM0A 4BP9A 1DRJA 4WZBA 1VSUA 1BX1A 3VR6D 2VDLB 1RKVA 3GQBB 5FWDA 3Q8KA 3AF1A 3S0JA 5ADVA 3H7AA 4OU4A 2QL9A 4Z51A 5IBPA 3BXGA 3L43A 3QFFA 1ONBA 1KRXA 4JH0A 3K09A 1JG7A 4N39A 4BFCA 2I6SA 3M82A 5LDHA 4X20B 2X4GA 1L7PA 4IHJB 1BS1A 3T4XA 4F8JA 4E14A 4A0HA 1YFJA 5HFNA 5FPYA 1MV8A 2JFYA 3ZY3A 2YWDA 1QBGA 3PGA1 1MHPA 3LY9A 4DM3A 4MKHA 2GM5A 5KPJA 2EFDB 1E77A 2PN1A 1FX0B 3V2UA 2HK6A 1P91A 4KIUA 4PC7A 2UZ4A 4A6PA 4INAA 2DETA 2BWJA 1GFZA 2WP0A 3M4ZA 2J41A 1JJIA 2E0IA 3BDVA 1ZOPA 2K7ZA 4HNQA 3VR4D 4B40A 4FINA 1Y8QA 1A69A 3HDJA 4BC0A 1PFUA 5AUQA 4ATNA 3LT1A 4IRMA 4FCVA 4OXQA 3SYKA 3T95A 1RACA 1HUQA 2QTBA 4N5HX 3JWGA 1KAQA 3IAM1 2Q5EA 3COJA 3L7CA 1Q0ZA 1KEVA 2FB9A 1CS0B 3EG9A 2ZB7A 2N1MA 1NF3A 3C3KA 2ABWA 3G7SA 4XM0A 3C97A 2ATCA 3W5HA 1OAKA 2B83A 5GPBA 1DT3A 4HLCA 3QKTA 1Y3HA 3K1YA 3M3PA 2VIIA 4AY6A 3SKYA 3D5TA 3I04M 1IBLB 4RKWA 3HS3A 3I4FA 2BGGA 3CCFA 3GAAA 1M8KA 5AJZA 1F2TB 1W44A 4FBLA 1T4DA 3LH5A 3FCOA 1AQYA 3M34A 4U5XA 5HG0A 3DVAA 1KO4A 2B37A 1SXJB 1USIA 4FT2A 4G0ZA 4NAVA 4B6QA 1Y5MA 4J91A 1UZMA 1ZD8A 3A04A 3H8JA 4N7JA 4KR0A 3L7YA 2P77A 1N34B 2CLMB 2H9IA 4ZC8A 1YR7A 2B99A 4RESA 5CYOA 2HHJA 3WL7A 1DWOA 3V00A 2W42A 1W1WA 1IN4A 1DT5A 1QM5A 3DSRA 4EKEA 3CE6A 5CBPA 5JSHA 4B4VA 3FXAA 3T5MA 2LE0A 3U9LA 1UOPA 2H06A 3OC6A 3OLVA 1YVPA 3WRWA 4IHAA 3HU1A 1SC4A 3EBPA 2JIPA 1W35A 2Q41A 4DV1B 1EX7A 4J7CA 2XDWA 3KSZO 3QYAA 4S1OA 2OPHA 2PSEA 3QX8A 4QJBA 3T7SA 4CKCB 4P35A 3KJQA 2WYWA 4I5FA 3FGNA 1XNJA 2R8RA 2GEVA 1KERA 1ZISA 2HXYA 5E38A 2HRRA 3ZV7A 1RABA 1FEZA 4HRXA 3V7UA 3CO0S 4F5YA 2PL1A 1SIOA 4IKOA 5CU7A 4ZYTA 5HCNA 2CNLA 1P6XA 1K4YA 1JWAB 2A78A 1H22A 2I80A 4M3NA 5JOQA 2RGUA 1WW2A 4D56A 1EDEA 4G5YA 4WXMA 1FUYB 1NONA 2P9TA 2Q2QA 2VK4A 3AZQA 3MTIA 3SU8A 4ZKDA 4KXYA 3SJUA 2AOXA 1Q16A 3ICWA 3THOA 1XTZA 4J07A 2C0QA 4C4YA 1RBQA 2BTQB 4EB6B 1QO7A 1IUKA 2GZ1A 4DCCA 5KNDA 1K7CA 4RF3A 1ISFA 3FG9A 3VYVA 3DGFC 5TPWA 1UBRS 3N86A 5F23A 3BWDD 1YR1A 2JJ1D 4KZKA 4XVQA 2YCLA 2NUTA 2OB1A 2QTFA 2A0XA 1GFSA 1H2BA 1I2MA 4DLLA 5KTTA 4EQZA 3KUDA 2GARA 4OI2A 3AY6A 1XZAA 1XTSA 2QTAA 3AFOA 3OQBA 4WFJA 4Q9HA 3H1AA 1IUOA 5AKGA 3VDQA 5ABPA 2ZUWA 3BQMB 1FQWA 1NXOA 4RMHA 1AO0A 2HMVA 2IEIA 3PFFA 1MOQA 3JQQA 3NYRA 2ZS7A 5GADl 1UEXC 3L1UA 1SRRA 1W5TA 2F67A 4BNZA 3CZPA 1D8AA 1YRQA 3OKCA 2XOEA 5LQCA 4KDRA 3R3UA 1NW8A 1V3TA 2F1KA 3BXEA 1BJKA 1SU7A 1V37A 1YU6A 1CYDA 3HRKA 4I4IA 3QKIA 4ILEA 4DA9A 5IH7A 3HCWA 3A6ZA 3M83A 3QNMA 4TQUS 2JH8A 1JYSA 3HN7A 4HQLA 1HEIA 3MN1A 5F2NA 1R8JA 3DZIA 4HMPA 4E2ZA 3PKJA 3GJRA 4YCDA 4E2YA 2IHVA 4RLSA 3DO8A 4UHDA 4BV3A 1F0NA 4IG4A 3ZBUA 1N2CA 5I7OA 2GPNA 1YL5A 3OZEA 3IE2A 2IU3A 4HN4B 4AI6A 3I72A 1TM7E 4EJSC 3DLTA 4YRMA 4Y6QA 4D3SA 5CXQA 4TXLA 3EG9B 4FSDA 1XJWA 4RVNA 3LJKA 3TQHA 1FDOA 1P3DA 3NKFA 3WGNA 1V4VA 1PZXA 3MJSA 1D1TA 1RCTE 3UKOA 5IJ0A 1Z4OA 1T6YA 4MVCA 2GCEA 4CLHA 3CLTC 4Y9TA 4KCGA 4B17A 1M1NB 1WULS 4HDKA 3AUJB 5L3QB 2H1LA 1XMPA 3EGEA 4GI1A 3DVAB 5ALYA 5EKDA 5KYTA 1I2BA 1FSZA 1SKAA 3BOSA 3B38A 3X1JA 1IN6A 1BMFD 1I4EB 3E8SA 3TM4A 2FEOA 1PJCA 4O2RA 5KNBA 1B76A 4CF5A 3N2EA 4NDZA 4A27A 1CEEA 1IOWA 1U3DA 2R84A 4MULA 4ND4A 1P2BA 3FDIA 2QRGA 2KWIA 3WDKA 1Y6GA 5CBPB 2N3ZA 1VGVA 5I9TA 2Y0CA 3RSHA 3HEMA 3V97A 1VL8A 5BN5A 5BRAA 1J2YA 2QLFA 5DOVA 2G1JA 3RVNA 1KMIY 4NBUA 3KQLA 4BNXA 3I01A 2ISCA 2QAGA 1ZNQO 1YL6A 1GUZA 1Y6JA 2B69A 3V7NA 3GZNA 3TL3A 4KQIA 2VNSA 3CF4A 5IM4A 1T6BY 1ZL0A 1NSFA 3DGEC 1TVKA 2O14A 3MS4A 2W2LD 4NCIA 4CKWA 2AFRA 1HQKA 4BU1A 1ID1A 2VNJA 4RV9A 3MOSA 3VYUB 4AY3A 5JSQA 3ADKA 1D6SA 3HEAA 3PL1A 3ISTA 4R69A 1JECA 2ZE6A 4NJEA 5J2UB 2ISQA 3RRXA 1GSOA 1QLHA 5KU1A 2WJHA 3FWKA 2FJ0A 3M1YA 4RV5A 5TEWA 5CT8A 5GP1A 2FF5A 4FMDF 3U0BA 5C34B 3ROFA 2ZYAA 4BFTA 2ZIAA 1X92A 3QMVA 4P4SA 4F4JA 5MDHA 1L6RA 1X2EA 2Q6VA 4KAJA 4LQLA 4CFSA 4F9TA 4KWCA 2X5NA 1DC7A 3NGMA 2PJDA 3HV2A 1FP1D 3LFUA 3AVXA 4KRFA 4F4DA 2RHDA 3LQ4A 2VXCA 3KXDA 3ZU5A 3OLWA 4ZYUA 5IUJC 1U9ZA 4HH1A 1QF7A 2OGTA 1SQFA 3IUBA 5THXA 3REQA 2WQ7A 1QU2A 2NUTB 3T61A 1XMXA 3FUXA 4NBVA 4KFSA 4BQQA 2QAIA 3TEJA 3ZE7A 1P81A 4D0SA 5KS2A 1LBEA 2VT2A 3UTDA 3TIGA 1W2HA 2XMSA 2HOQA 3KX2A 4OP1A 1JDNA 3K1JA 4S0XA 4FE3A 1B1CA 3Q7RA 1E0SA 1S8OA 4RX1A 3UPDA 1BU8A 3VC7A 4IM7A 5ETJA 3QITA 5AKKA 1DKRA 5B37A 2YWXA 3FUVA 4IHQA 4LDAA 3CR3C 1Z5GA 2RAUA 3K4HA 4YVFA 3UJ9A 1T2NA 4NDNE 1JQAA 2CMHA 4EHLA 3O3OB 4Y2XA 2ZSBA 1J97A 4AURA 1RI4A 3T1QA 1EVYA 2VAWA 4JAVC 4E30A 1XRJA 3DAYA 3RE1A 1SOWA 2Z83A 3BWVA 4B6PA 4WBNF 2V9PA 3SSAA 2NO4A 4IF4A 4UNIA 1H2WA 1N2CB 1J09A 2P2NA 1FU8A 1YB5A 4JLUA 3N2GA 4KQ6A 4L4ZA 1AHPA 1DQSA 3F46A 4KO8A 1DU4A 2BONA 1JVBA 4AJ9A 3MT7A 1VJ5A 2EKDA 1EIWA 4MICA 3LHKA 4X44A 4S0ZA 4YRZA 1SG0A 1NN1A 3RVKA 3WXBA 5DHRA 2MYUA 4DIKA 5BR1A 4C7JA 3A2LA 1E2BA 4MB6A 2WIBA 1FTWA 2WG0A 5EZ6B 4BEVA 5ALQA 2X0FA 3KG2A 3PE6A 3KOYA 4DCPA 4KNVA 1HE3A 4JX8A 4BJ3A 4LK3A 3I1JA 3F98A 3QLTA 4I4CA 4MMZB 2ZSJA 4JVOA 4MWSA 1A96A 1XKXA 1W6RA 4HDOB 4IMIB 4HDKB 2OC4A 3LPLA 5GV8A 3SIRA 4NCJA 4D8VA 3K53A 1Z2DA 4R2IA 1C1YA 3AJ9A 3IALA 4HQKA 4M1MA 4YMGA 1W52X 2G76A 3COZA 4RL4A 3V4OA 1R5BA 4DV0B 1U8EA 2O2XA 1J2UA 2OSBA 2VCYA 1MB4A 2BR4A 2QOEA 4OHKA 5JJIA 1U98A 3N1UA 4MDHA 4JB3A 1UWLA 2O2EA 3OMXA 3IAM6 3I9FA 4JQYA 4X0EA 1DVRA 2BHNA 3FUUA 3ITEA 3ZIAA 2F64A 1NLYA 1FJGB 5IYZB 1NMSA 1HZJA 2HNAA 2RK3A 2W0SA 1T1IA 3SXUA 1WB9A 4JP5A 1ETHA 4MQEA 1MH1A 1JDBB 4AP5A 4C03A 2JLWA 2PG3A 1E1CA 3OJFA 4PG8A 1PZGA 3TNYA 4TTTS 3KSDO 1SEVA 1ESDA 4F9GA 2PZLA 4A0FA 5AW9A 3BWXA 1A2KC 3HRHA 1PFYA 2P2GA 2YC4C 8GPBA 2FEMA 3A3KA 3T1HB 1UDBA 3BQ9A 3K94A 1TVKB 2QN9A 3VOTA 3P8ZA 4KXVA 3VZBA 5C37A 1ODKA 2FLKA 2ZIVB 4N9QA 5IBRA 2C7PA 4G25A 1FQKA 2FSVA 5A3QA 4HKTA 1RYZA 5JWOA 5TGZA 2UUCB 3UG6A 5KAPA 3SIXA 4TUYF 4NJEB 2VJCA 5BOSA 1XZEA 1MZPA 3IVCA 1G1AA 4MUXA 1PJZA 4B9AA 3CZ9A 4ZQHA 2XHEA 2G07A 1E4OA 4ID3A 3U4AA 3TR5A 3R3ZA 1A50B 4ZOEA 4B3JA 1KKMA 2GPJA 1VKOA 4P4SB 5K3AA 4K6FA 1RJ9A 4ZPJA 2HUNA 5DBEX 1P6UA 1KOGA 1MO5A 3BRWD 1NE2A 4LV5B 1HOXA 3O83A 5T8KC 3TB4A 1KKLA 2BZ0A 2FJUA 1A9QA 1GG8A 2NUPA 3PVZA 3QBEA 4B4WA 4F3YA 5CB6A 2BRUA 2XIJA 1VFNA 1UFVA 4Q1BA 3REQB 3VZRA 4H1HA 5T64A 1TYCA 2P41A 3JALA 4B6EA 2DUMA 3M49A 4TYNA 2YV2A 1J5EB 3EF0A 2PJRA 1CF4A 2WWFA 3AR7A 2IPNA 1CRWG 3NASA 4O3FA 3FCCA 4DIUA 3DDSA 4G0QA 2FW8A 3S8YA 2VAMA 4K7JA 4BFSA 4F84A 5DMXA 1VKRA 4MIOA 1UAYA 4MEJA 3WJ1A 4CMBA 4CF3A 3PXXA 3THXB 1HQYE 3G0OA 1GKLA 2I7DA 2UDPA 3AILA 3ZW8A 4TVSA 2CCKA 2L18A 3TLXA 2GXUA 4C4RA 3EDRA 4LE0A 2ZT6A 4N3AA 1TT5A 2HQRA 4US0R 2G08A 3TI7A 3TLCA 1UXKA 4FEYA 3VSDA 3ZHCA 2HLNA 3FNQA 2J0VA 3GNSA 2NO5A 2JDIA 4AUEA 3HM2A 3L79A 1YACA 4GVPA 2PTHA 2V96A 4IJKA 1V16A 4PSCA 3I9OA 4CMJA 1QYIA 3MW8A 2KHZA 3O94A 4MVJE 4BO3A 1HTBA 1C7QA 3IVGA 1M74A 4IF6A 4GC5A 3N2GB 4URHA 3EZNA 3PUIA 5D01A 2YHAA 5EE5B 3BMNA 1N5LA 5SY6A 1P2GA 2JL1A 3H0CA 1UXJA 1Z07A 3QVMA 2YX1A 4HVAA 3VR3A 4BBPA 1DCTA 1Z7WA 1LS6A 1GA1A 4MCHA 3I0MA 1ABFA 2OD7A 4R4JA 5ERXA 4GFDA 1GR0A 1VPEA 4CG1A 3GRYA 4L6IA 4DLKA 1AQNA 4GGMX 3F7TA 4JL6A 3N74A 4FGWA 3IC5A 5ECWA 1WNFA 2C4UA 3VJRA 4PM4A 2AE2A 1ORVA 2GCOB 2WF8A 1SCUA 1A7AA 1PT8A 2BMAA 4GOJA 4JENA 4RU1A 1OLSA 2H5JA 4TYYA 3FM9A 2WJ4A 1L1EA 2H1FA 3AJDA 4YRSA 4EB3A 1NI3A 1YNSA 1P9WA 2XYRA 1W4AA 3GLKA 3IULA 4M8SA 3SAJA 1H3EA 1E3EA 2A4KA 5A4IS 1C4WA 4BTEA 4E70A 4YUZA 1W36B 1YI1A 3O4JA 1TKAA 1TLTA 3KQYA 3ZW7A 3V9AA 4EW3A 1WVMA 1RIFA 2YYAA 1COWD 3K8OE 4NARA 5DYIA 3INTA 3OQ6A 1EVZA 3L0IB 1KHHA 1GRQA 4OLFA 2JGAA 3P9XA 4O0LA 1CUFA 1QAQA 2GNPA 3R3YA 4XR4A 4C0JA 1BWPA 2WJPA 3OT1A 1Q91A 4J8PA 3D7RA 1B6GA 3SGLA 1TJNA 3PTZA 2FG6C 3BIOA 1OU4A 4MQEB 1XHEA 1FYDA 1HY3A 2IW3A 4Y18A 3PJRA 5EXEA 2IS4A 3D2BA 1P1FA 1ZCFA 4JUIA 1UBJS 3IUPA 2XQJA 4ARUA 1GPDG 4ZCRA 3TFOA 2QRQA 4RHXA 5AVYA 3LRPA 3B6KA 1KDRA 4R0NA 3RC1A 4HY3A 5DMHA 3ZQ4A 2V7QA 2GH1A 1DEAA 2G71A 4TSFA 1C1HA 2WTEA 1E2MA 3N8DA 1DV2A 2C0PA 5I8PA 5EI5A 1VRVA 1PN3A 3DR3A 1UQTA 4HADA 3ZXYA 3MHTA 1A5SB 3GDHA 4IH9A 2A92A 2B94A 1LQTA 4KXQA 4LHYA 4TXNA 2JD0A 4EYKA 3WZMA 4HPWA 4A5SA 4BFZA 4LGYA 1J8MF 1Q3TA 2Y92A 2Z95A 3IBTA 5BOSB 3I5XA 1G4AE 4X60A 2IXGA 1FSSA 3L7OA 3BYZA 5T3UA 2QUKA 1N2BA 5CLLA 1OKKA 4MAAA 4KH1A 1EFCA 3RJZA 1MX9A 1NMXA 3OZFA 2H7CA 3RYTC 4UTZA 3HEBA 2G5CA 5F1OA 1G8KA 3NC0C 5JQGF 1RJ9B 4LNUB 4HR7A 3NWJA 4GDMA 2MR5A 1BRTA 2QTVA 2VJOA 1JMYA 1RSZA 1YS6A 2AN3A 2W93A 1NVAA 4UHHA 2OXIA 2GAFA 2OLJA 4RIGA 2NUPB 4P2GA 1JSXA 4HGZA 3R9WA 2YICA 2VFAA 3BL5A 5F3DA 4LGVA 5KSPA 3WGJA 4XEHA 5JFOA 1U5CA 3DFMA 2XRYA 2WMOB 3JALB 2ENWA 2D7DA 4D6XA 1KJIA 3G9QA 3HCNA 2AWOA 1XCGB 4LX0A 3FPHA 2RHJA 5F33A 3RV4A 4PQRA 2KLHA 2ZCUA 3K0AA 4NYJR 1WTAA 4KWTA 2NPFA 4D9EA 3AK4A 2JK0A 2C7QA 3ROEA 4WGFA 1JKXA 4BB9A 3GD5A 4PG5A 1HG0A 1EM8B 1J2RA 3SQWA 1RMQA 3E0XA 4Z2YA 4BQRA 3ZDEA 4HVTA 3OTWA 4AY4A 1T9ZA 5B6JA 1N92A 4KI7A 3OM9A 4AU1A 2W6ZA 3JQRA 1HLFA 4Z4HA 1E7YA 1V16B 2ORYA 2AMLA 3AFMA 3DEJA 3KQPA 4F2GA 1YH3A 1CDZA 5I7SA 4MP6A 4OU5A 1G55A 2VZ8A 1TI7A 1IHYA 2VDOB 2ZI4A 4Y2VA 4NTZA 5HOQA 1XP8A 2OLKA 4PBSA 4S2EA 3LO8A 4CDNA 1GPAA 4I8XA 2FZEA 2EFJA 1R88A 1OXUA 4JBIA 3KXPA 3DMDA 2OCBA 3WNZA 3IQGX 5IKEA 2VRCD 2GHQA 3DTTA 1KDTA 2GRUA 4UM7A 3EF1A 5E9QA 2W98A 3EIUA 1FDWA 1G7CA 4L7VA 3JVVA 1JG6A 1WIWA 3JXEA 3WGGA 1KWGA 1UBTS 2YMMA 3DTYA 4H3HB 1RZRA 1NYTA 2ZIWB 2R86A 1YXMA 3H99A 2PKWA 5JQWA 3ZZMA 1L5FA 4R0VA 5BR7A 2LDBA 4UQOA 1S96A 3OQ1A 1UM8A 1VJ0A 3LPNA 1B0AA 3IUSA 3HUTA 1PK7A 5C4GB 3U7JA 2GZ3A 3WS7A 2IY7A 1TJYA 3PPXA 4G97A 3RARA 1Q7CA 4Y6RA 4Y9SA 3K9GA 3QWIA 1QIGA 3GLHE 3QRWA 4UCFA 5H68A 1NJ1A 2I7TA 2ZKLA 3ESYA 2PGOA 1CSEE 3EH2A 3BD8A 4GWGA 1K3UB 4BFVA 2DFVA 3OPQA 4UUAA 4Z1MD 3VBCA 5HJ5A 2XGGA 3OT1B 1TMOA 4IXWA 5J47A 2NMVA 1H0SA 1TC1A 1EXMA 1XD8A 3ZCPA 4IRXA 2CBGA 1KC1A 3ILXA 1L7BA 1QNLA 4L73A 1L5QA 1PJQA 1IY8A 3K72B 3UAXA 4PSVA 1H9AA 3C70A 1CDOA 4UJ3A 1XMIA 4Q3AA 1DC8A 1WDWB 1SVIA 3GBVA 1PNTA 4G24A 4U8HA 4WFKA 4PHTA 1DBIA 3AW8A 2XDQB 5IC6A 1G5RA 4XFDA 3PD7A 4II2A 3A70A 4V0SA 5JZMA 1NVVQ 1YQ9A 2J5RA 2OM6A 2PPLA 1Q17A 2NQTA 4AW9A 4F2WA 1UDWA 4TTJA 1E32A 1XA3A 4I1YA 4Y6LA 1EK0A 4IL5A 4Y6GB 3QPBA 5EHNA 5JARA 3OU6A 1WCIA 1QHHA 5CHEA 1JT2A 4F8EA 5HQ3A 3DAGA 1Z35A 1XU7A 1GAQA 1RWWA 2WMNB 5BXQC 3ZD6A 4E11A 4WKOA 1NNUA 3TX2A 4DFDA 2EWMA 1E60A 1Y9ZA 5ENDA 2MDTA 1Z4QA 2IITA 2JANA 4YCCA 4IDEA 2P6OA 4JOSA 4PNPA 4MR8A 2PWAA 3EVCA 3RHFA 3UJHA 4XDYA 2VL7A 3BE6A 1HDIA 3HA3A 5KC9A 2WA2A 4X7RA 1I6WA 4B8ZA 5BW6B 2G4VA 3N9IA 4GU5A 4RY0A 3UC9A 2YBDA 1WCXA 3SEAA 4WBXC 4QZVA 4LYAA 2F3UA 1P1IA 5F52A 4XWWA 5LB4A 2GPBA 5I4KA 1ZVKA 3Q88A 3QLJA 1OMOA 3C8ZA 2HFJA 5EQFA 4BFXA 5BVHA 4TYWA 2VS1A 1PS0A 5FHRA 1SUPA 2NOAA 4LHXA 3V9PA 6GPBA 3VNUA 2KBFA 3GZ4A 2P6PA 2Z6QA 4QYTA 3GRZA 2QVXX 4G5GA 4QRDA 4MIKA 3EXFA 4CM9D 1GZHB 1G2PA 2W2KA 4Y7DA 1OOEA 4W5TA 3S27A 2WZDA 1WU8A 1L5YA 3AP1A 4I0WB 2O52A 5JRDS 5TPZD 3FSJX 4J4BA 4L8VA 2CDNA 3C15C 2EHJA 4N54A 2I3DA 3ZK9A 4A2CA 3O82A 3PF9A 4I4TF 4MRNA 1KK3A 4AXXA 4D41A 5AW4A 5JNLA 5JVDA 3DB1A 5BQXA 4LOKA 1CR6A 4K6HA 5JMOA 1E1MA 3A6HA 4IQ4A 3SYRA 4ZYXA 3Q7IA 3K4PA 5F7ZA 5ALWA 1IC6A 2QPLA 4X64B 1YHZA 4LX8A 2IQ5A 4XGNA 3ZQ6A 2EQAA 2OBFA 2G9ZA 4M1YA 5EJ8A 3ZCVA 1B6TA 4KQJA 3IJ5A 1XDDA 4DDWA 4KREA 1MP0A 3ZWMA 4EGFA 4B5LA 3RAEC 1Q21A 1Z4NA 2JIBA 4D3XA 5E9WA 5DX1A 4EJ6A 1R5OA 4UQLA 1O6BA 2R8BA 1IZ8A 3BGVA 3RSLA 5BMVA 4V0NA 1WXXA 1T25A 1ML3A 4FCCA 2C07A 1IG0A 2QX9A 3A2NA 4JYCA 4K86A 4BE7B 5CG1A 1HLDA 1QP0A 1K63A 3JY6A 1SMKA 4C06A 2WQZA 5L4SA 1PVDA 4HJXA 4IMPA 2ZVPX 4BZXA 5BYKA 1COZA 3U61B 5J9FA 3OEHD 3NTRA 5FPQA 4CTOA 3IBFA 1EM6A 1ZGHA 3BMOA 4OHOA 3E2IA 3KQHA 5CGZA 1E7SA 1B8NA 3TS1A 1NJGA 3P2EA 1RMTA 4G67A 1MX3A 3B6EA 1KZ1A 4KRGA 1RJDA 4Q9NA 1Z6XA 2ADOA 3GPIA 5EIOA 4TT3A 4P80A 1G2QA 2GM4A 1JEDA 3KQWA 2Z1MA 4AQYB 3OQVA 3JQAB 3MBKA 1D2CA 4HB3A 1RYDA 1PR6A 3L4EA 2YN0A 3O8QA 3WQHA 3NWOA 3TSYA 3WKEA 1T0PA 5B2EA 2BMVA 4M1KA 1X39A 2G7MC 2G5PA 1PIWA 2DB3A 3IQZA 4BASA 3JVEA 5KX5A 9GPBA 1IH8A 1XDWA 5JU6A 5LMNB 2E6KA 2ZS8A 5AI8A 3OTIA 1GAWA 2YTZA 3DVRX 1GD1O 1JDJA 3HUEA 3VAAA 5MN4A 1CUEA 2VRBA 1YK0A 2H7YA 3AOEA 1OWMA 5CT5A 2NTEA 5TRTA 4ILKA 4KLCA 1WCIB 3BTOA 3HA2A 1JLLA 2OO5A 3PWSA 2OGWA 3BIJA 5E7JA 1L5SA 5HQ3B 4PLHA 2ESRA 1DELA 4PZUA 3AM4A 1QUEA 2V7UA 4R51A 1GGJA 3F2IA 3PHBE 1AZLA 4HWPA 2D1RA 3WGYA 3PGLA 1Q15A 4R2XA 4TYQA 3RF6A 1HWYA 1N0HA 3L92A 1ZMRA 2JEOA 3REOA 3NP7A 4IZIA 4WZ6A 1OCEA 1QQ6A 2OK8A 2ERYA 1LRJA 2V65A 3PXUA 2NU9A 4LVUA 4RV4A 2A5GA 1V8DA 2FRVA 2HAEA 4M88A 1U2TA 4J2HA 1IJEA 1W0CA 2ECQA 3CBGA 3F78A 4NK4A 5ALNA 5K6AC 2IYZA 1XRSB 1RKUA 4C3UA 1L5ZA 1XTJA 1KHTA 1PLKA 4YRPA 1MT0A 5H59A 3FB1A 4LE2A 4QU0A 2FZLA 3A7EA 4LXUA 1KPIA 1P2UA 1LI7A 5BVHB 4CMAA 4DV5B 2ZXEA 3VNBA 2IXFA 3GEBA 2GBGA 3QUCA 4MP3A 5K05A 2PUEA 5JJKA 2GILA 3DYBA 1NUAA 4BTVA 4P3XA 1X9GA 5JANA 5JS8A 2FX5A 4H4CA 4BPRA 1EDOA 5BQ3A 1JA1A 2OKCA 3EXFB 3KELA 4LZAA 2GHIA 2W2KB 3H5TA 5IN5A 1OC2A 2FN7A 3BJIC 3FFTA 4YAWA 2QPTA 3O8CA 1TFUA 4LF6B 1T9GS 1XT6A 5CMLA 3FPLA 1E8MA 3W9SA 2PA0A 1PQPA 4FJ2A 5KJEA 5LP6A 1Y4UA 3FHLA 5JVDB 4F21A 3IDFA 3AVTA 4HOYA 4TTRA 4LJKA 4P7FA 1T6XA 1O87A 1SPXA 4GMHA 3EK2A 2H6EA 1B3RA 3IT2A 1ORHA 1DMSA 3K7EA 1BROA 2NXNA 4HAZA 1HDRA 2AGVA 3A6EA 4QEZA 4ZYLA 5HBRA 2WVHA 3PQ8A 4HYQA 4ENSA 3QSYA 3WC4A 1OF1A 2UAGA 2BFAA 2X5KO 1DIHA 1E6MA 2Z57A 4JGIA 1WZEA 1D6JA 2OV1A 4IDGA 2GN6A 4V2UA 3MRTA 4INZA 4AYXA 2IIBA 1NF9A 3PPIA 4TLAA 4B46A 5LNK1 1NPTO 3K30A 3H9JA 4B32A 4FYIA 5FLXA 1YA4A 4Y9RA 1Y4SA 3PZBA 1KSGA 1GARA 3NTXA 1O6FA 3WDLA 1W1UA 1C7ZA 1AUOA 4BPBA 4IJ5A 4D4IA 5AIBA 4WNCA 1UBLS 2DWPA 4D4MA 5DHAA 1X1TA 3L4BC 1CR2A 2COEA 2CYBA 5A71A 2P0AA 3V6LA 2H5EA 3T9FA 3OEYA 4L5JA 4QEDA 4POOA 2JGNA 3KBBA 1RZRD 3GH1A 3BMOB 2B7LA 4ENRA 1HDGO 1P3Y1 2J9FA 1VG9B 3W6UA 3BE8A 1UC8A 2HA4A 3MPUA 2FUCA 2OZLA 3G8CA 2GNAA 3KTDA 1QVRA 2J5KA 4LYYA 4LYGA 4LY9A 4Y2UA 3QBTA 2LIPA 3SKXA 1YR8A 1N8SA 2ASVA 3GRAA 3W78A 4E0BA 5EHQA 1IZYA 1U99A 4OBBA 5IAOA 5B1EA 4HLNA 1PFWA 4MUNA 5E9JA 4D57A 1QZ3A 5JMPA 1B93A 1Z6GA 3O0TA 2PLFA 2BMEA 3SFVA 3SJCA 2Q3HA 3UBMA 2ZIGA 4F9FA 5BSEA 1K5PA 3DV2A 2GMWA 1YE3A 621PA 2QQGA 3D3KA 2CSUA 4KR9A 1P5JA 3LC2O 4XYBA 4CT4B 1IWPB 1FS4A 1XNQB 5M2QA 2P90A 2JFOA 1P4GA 3CMCO 1JIVA 4RJTA 5EJ9A 1YFKA 1RFGE 3LRXA 4G4JA 5TMDA 4JC4A 4HH4A 2CCGA 1WETA 3KYCA 3W2GA 2NO0A 3I05A 5F73A 2OGZA 2PUWA 3HY3A 3ZZUA 1JLLB 2A86A 3HO1A 1MDFA 1K8XB 3ANXA 4KODA 2RHBA 4EECA 1DKQA 5DGXA 1G6OA 4IXDA 4Z0TA 1OAOC 4X93A 1XB2A 2GPSA 2IDKA 2ZQYA 3OEED 4NOJA 1X0XA 2F2TA 3QWFA 1MC4A 2Y9PB 3M4YA 3OTHA 4TZ0A 3QYFA 1EFVA 2WBLC 3H2JA 4XGQA 4FONA 2BW0A 2H2IA 1EYZA 2FF7A 3KKPA 4JT8A 4LGMA 3U3MA 2PKRA 3GBSA 1CF9A 1ZU4A 2Z6UA 1DEHA 1NOKA 2NU9B 2G72A 3WNBA 1FFBA 3L1KA 1BNCA 4M0MA 2WK1A 1R8XA 4FMPA 4O5OA 5HFJA 5JS6A 1J49A 1NT4A 3EXHB 3GHHA 4ZCPA 3DMTA 5LQSA 3KPWA 1LPBB 4DQKA 1HK7A 3KRTA 4CLOB 3ESDA 1K75A 2P3QA 1JH8A 1MNQA 3AVQA 3GFTA 3NO4A 4RKYA 4AN0A 5AJTA 1E89A 2AVNA 4CL3A 4EH1A 4QNRA 2B35A 1O95A 2CNWD 4OMFG 1WQ3A 1QE0A 1BIFA 2VHUA 3ZBPA 2VYCA 1KFEB 3I9NA 5D1HA 5K6RA 1QIJA 2B9VA 3BS4A 1DIRA 3D6HA 3HV0A 4MKIA 5ED0A 1D5CA 4IV0A 1Q0LA 4LTDA 1MB2A 2B92A 4RPLA 1H8HA 4I6EA 1U31A 5C35A 4LXGA 2O07A 4F6RA 5LN1A 2QTGA 4CMHA 5IU6A 3F5QA 5LP6B 1TEXA 1XQ1A 3Q41A 4PV7A 3EVGA 2F8TA 1P1BA 1KAMA 1SHTX 1C7RA 2FNAA 2OD9A 1Z13A 3KJHA 1NYQA 4M9RA 4M53A 1SHLA 4YMWA 5SZHB 2F7SA 2Q46A 3NB0A 4WNIA 5J4YA 3QBJA 2GF2A 3H5VA 4PFQA 4GR5A 5EY5B 5IMSA 1H2ZA 1P4AA 2CBXA 2OXRA 2PUTA 3K0CA 3P9PA 1FTYA 2WJAA 4D98A 2QQ0A 3QOYA 1XNHA 5HIJA 1U7ZA 4YEDA 1M2EA 4A7PA 3ASVA 3OICA 2PGNA 5TMEA 5C4IA 5L6MB 4WZZA 4DQDA 3KT8A 3GGGA 2JGDA 2WMDA 3BHJA 4MVJD 3JWHA 1VCIA 3ECSA 3G49A 2QDKA 4ND6A 2AX4A 5KNCA 3Q11A 5FPKA 1RRVA 1V1JA 2Y0PA 3U19A 2XMRA 3HCDA 5LJIA 3T5DA 4TL7A 1YBFA 3PGXA 4DLAA 3VA7A 2ZRCA 1LGYA 1QQBA 2AXQA 2JNWA 2JIMA 1PQ4A 4C4PA 3ZCUA 4ZICA 2C61A 3FYUC 2A1UA 1XN4A 1GPH1 1U4SA 3FMOB 2GN0A 3G8YA 1VCMA 1JLSA 3R3SA 1PO7A 2OZLB 2BLLA 2TS1A 5TX7A 5HS4A 2VYND 4UREA 3G5UA 3Q8WA 2P6NA 3W5SA 4A6EA 3ZXUB 1JLMA 3JZMA 3I92A 3OE7D 3UJ3X 3DHYA 5G2OA 1R18A 4K26A 1W581 1KMNA 3U4IA 2NT4A 2WICA 3EQ8A 1NBIA 2WFZA 4NABA 4WOCA 5TQ2A 1N7JA 3VU8A 2Y6VA 3PQ4A 2NAFA 4QO8A 5IDXA 5JCJD 4FHDA 4PLVA 3CR8A 3EAFA 1V3VA 3FDZA 3CZAA 4K1LA 3UB4A 2EJCA 1SM4A 2DFTA 2C2ZA 2FPIB 3W04A 5LQAA 2E1PA 2O57A 5AHRA 4WECA 1Z39A 5J3JA 3H2HA 2A9OA 4OV6B 4ZYYA 5K7SA 1O6ZA 4BMNA 1V5IA 2HIMA 4LJSA 1SNYA 4F86A 2H1SA 1DGQA 2QIOA 3AIKA 4CM6A 1RYEA 4GOXA 3UAGA 2RH5A 3VISA 1T3ZA 3H2ZA 3KR9A 4GX0A 4FFSA 4PR0A 2M6LA 2G1KA 4B3IA 4N48A 5AVRA 5DN9A 4KPYA 3TZQA 4U7DA 2J3QA 2ZYVX 3H3FA 1P7WA 1EFVB 2WJYA 2YINC 3P4XA 2Y66A 1N8KA 1QRSA 5IM5A 3LLVA 1M10A 2YJ3A 2DHCA 2Y93A 3UPUA 2XNJA 4QQ8A 5HKKA 5CFMA 2ODPA 4AJPA 2OL4A 4AQ7A 4ONEA 4DMHA 2ZTSA 3WK4A 4LZOA 4MV6A 1U81A 4P3PA 4H7PA 1OC4A 4HDQB 4YT5A 2CUKA 5FQOA 1U4OA 1DOAA 4KN8A 2GK7A 2AOUA 3TLGB 1ZM7A 2ZT8A 5DBIA 4K87A 1GTZA 3H13A 1PT5A 2OQIA 2PGXA 3C0KA 1A76A 3IOCA 1XC7A 1ZOOA 1CUUA 4HEA1 4GS5A 5CFLA 2HMUA 3D6AA 1RYNA 1GKUB 4K40A 3W8NA 4TLEA 2WM8A 5ELMA 4DOMA 4JI8B 1RXEA 1YJ5A 2VDPB 1M33A 3ENQA 1QVAA 3OFND 5COBA 4DT1A 1R9JA 3D7KA 1DEOA 1FTSA 3SHWA 3SYMA 1IN8A 3KOMA 3VDRA 1NF2A 1UAGA 1T9AA 3MQFA 3PWTA 3R8FA 2IUTA 1GNSA 1U7TA 4CG0A 4F6RB 3EWSA 3U4DA 1VRWA 2I4MA 1I2CA 2V6JA 1GG5A 2TMDA 2HX1A 3OE5A 4W8HA 5DLQC 5EQJB 1NY6A 3AESA 3N0XA 2YJ5A 1O4VA 5EIWA 3SM3A 4F04A 1KMCA 3LS2A 1JG2A 4GR4A 4M1ZA 2J3HA 3GA0A 5FI5A 4BV8A 4P7KA 1R37A 2V74B 5HZMA 2QBYA 4MUKA 3N87A 3S2UA 3WRYA 4B4DA 4AYWA 4HZIA 1I6MA 4A23A 1USVA 4QGAA 3RYCB 3DZ8A 4FSHA 4HEHA 4JQSA 5D84A 1O2DA 4F92B 1Q7EA 2Q8NA 2A5JA 4ARZA 2R8XA 2C04A 5DGTA 5TGTA 3RT9A 1STOA 3IO3A 4UU0A 4ZU6X 2DFLA 3WK5A 2ZOSA 3MOIA 1ZH4A 4L6CA 2D8AA 4N3GA 1MGOA 2JGDB 2EL7A 4UNNA 3RU3A 1PRYA 2PY6A 3D0RA 2ECFA 1PS8A 2DPHA 1VPDA 2EGHA 2HA3A 2N0SA 3C39A 3TKYA 1WZNA 4JSYA 3WNDA 3ZD7A 2WE7A 1K5GA 2MYTA 3ZWKA 3NC4A 4C5CA 3M6XA 1UEIA 2PT5A 4RVSA 3STWA 2BLNA 2PTGA 3IERA 4MX8A 1J00A 4PAWA 4D0RA 3X1WA 1EK1A 1DKLA 1Y7PA 2A1UB 3ERCA 2O7RA 3DM9B 3P2OA 5JTUA 4W1SA 2P4SA 2QMYA 1T36A 4GYWA 5DK4A 3K6SA 1J9EA 1GV0A 2SBTA 4AMBA 3CWCA 3P7MA 4JLJA 4MV4A 4D25A 1OPRA 1DX6A 5EERA 5LBTA 3W05A 1R4NA 3DE4X 3EQ2A 5TQ2B 4YYZA 2RH8A 4MMYB 4ZAGA 1HNNA 1P75A 4P22A 1GKIA 5K51A 4ERXA 3C6BA 5H4GA 1SUDA 5EQTA 1NP6A 4Q9DA 1LLDA 5LMZA 3PEWA 2E6UX 4US2R 3DTVD 3JWJA 3T4PA 4B33A 1XWWA 1RQPA 3LHIA 3UT0A 4HNRA 2DX7A 3P9SA 1E8NA 5BV8A 4OQEA 1G8MA 2QUZA 3H19A 4NEQA 2FRDA 2QLNA 3TL2A 3OQIA 4ZYVA 4DIMA 4XVHA 3TCKA 4PO8A 3VYWA 2E5WA 5FLEX 3V8MA 2FMXA 1J8YF 1ZU5A 5EJMA 3WNCA 1DX4A 3B2EA 5A4KA 3E1GA 3R8CA 4HPJB 3LHDA 1U8UA 2VEOA 2BSQA 5BV1A 2ZBVA 2PH3A 3EXG2 3KK0A 2WWRA 3PIIA 1XQYA 4H3VA 1NJ2A 2IBSA 2FZCA 5JQGB 3EUAA 3NHZA 1RM3A 2XTMA 4RKRA 3TIIA 4EYEA 2RCYA 2H2DA 5KWIA 3N0TA 4WE3A 4B09A 1L8XA 1GFWA 4GPIB 5JRZA 1TUEA 3EGCA 3IL2A 1U1GA 2PO5A 2YHBA 4HUTA 1WEKA 2HRZA 3OF2A 3G59A 1SXHA 5F35A 4RMJA 4JC5A 4TGLA 2Z2KA 4I1IA 4ZYWA 1NJFA 1FK8A 2HPVA 1YJQA 3ZXXA 2G67A 2D06A 1D2EA 1QOQB 3A31A 2AOUB 4X1IB 2J9YB 1Y1LA 3MUEA 3I0ZA 1TEZA 3O3NB 4Z86A 4NCAA 3QPWA 1VJTA 1PYDA 5B5SA 3SG0A 2EKLA 1U7OA 2EWWA 2XVZA 2A9PA 4UVDA 3VR6A 3HB5X 5KDLA 3O1IC 5LQDA 2PUCA 3LX6A 4ED9A 3E9CA 4TM8A 1P72A 3Q9SA 1ZH2A 2PKXA 1NKSA 3HPQA 1AN0A 2DFPA 3JYPA 4JN6B 5EKSA 4RPIA 2Y1OA 3SR3A 2AUNA 4BMPB 1MENA 1YDHA 3EDQA 3IIKA 5FOTA 2HL6A 4I4TA 4CJXA 1FTNA 1JYFA 2F9MA 2J4CA 3GLIE 1JB9A 3MJFA 4CDMA 1N3IA 2ZZMA 1H94A 5EN4A 4MR9B 3V80A 4OXIA 3CSDA 1BC5A 3NOXA 4WXPA 1G8SA 5H83A 1RU3A 2XR1A 4CLXA 3OIDA 2RGNA 5MFZA 3TLJA 2QBYB 1BFKA 3ZZ0A 3FOWA 3KAKA 1G2IA 1F8YA 2WD7A 3W5IA 1MIHA 3VR4A 3I30X 5I47A 2PD6A 3GRUA 2WTBA 4EI8A 1TUIA 1DIAA 1HA3A 1WHTA 2JFBA 2ZQZA 3QU9A 5EP2A 3QNWA 1EBUA 1IXRC 3IDSA 3SQNA 3WK8A 3DR5A 3L6UA 4QVGA 1XPRA 3AC0A 5LJLA 1R4MA 2HTEA 3DOHA 3LCUA 2G40A 4WOPA 3V34A 2DY1A 3PDHA 4R9UC 5JLAA 5LQJA 2XJ9A 1EK5A 4IXTA 3UVEA 1QNFA 3LWDA 1ABBA 4KK3A 3L84A 1X1BA 3U9SA 3A9CA 1A5TA 2DKOA 2K2WA 1V6AA 1HE8B 1HGXA 2GBLA 2W11A 3K1ZA 4FVTA 4IGIA 5IFKA 4Q1VA 2UZIR 4B0OA 4BAZA 1MQ8B 4HWRA 4JP2A 1JW9B 1SGWA 1T36B 2H16A 2Q07A 2JGMA 3K6SB 2RGXA 4D99A 1S2NA 4WCFA 3IQFA 2UUAB 5FTNA 2HF7A 1UMKA 3BG5A 3KUUA 4M1SA 4X5OA 5AJUA 5HFAA 3S40A 4N47A 1N5KA 3I6IA 1BVUA 5LD2C 1ECBA 4M1TA 5ERYA 2XRFA 1ADGA 1KO8A 1R4NB 2FSSA 3G85A 4WKBA 1K4MA 4XX1A 3D4IA 1FW6A 3HE3A 1MQSA 2VHQA 2ZWAA 1KPHA 1MRZA 2IZ6A 3R7LA 3T34A 2V1XA 1Z5PA 4MNTA 1Z12A 2R00A 3PA8A 1KAGA 2UUPA 4W1RA 4D4HA 5LMUB 1P1RA 2W83A 4JODA 1F12A 1SQ5A 3RRJA 1O08A 4A3SA 2HHCA 5HS6A 3FVVA 1YQTA 3OQIB 1AU9A 2OZEA 4CV1A 4EUSA 2Z4RA 1II9A 4I3GA 3FZEA 5J59A 4FDTA 2XUJA 1M2VA 1SD2A 1Y37A 2BF4A 2KJQA