4P83A

Structure of engineered pyrr protein (purple pyrr)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
165
Chain Sequence
KAVIMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGAPVPVGEIDITLDEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAGMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELDEVDQNDQVSIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transcription
molecule keywords Engineered PyrR protein (Purple)
total genus 50
structure length 165
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p83A00
4IJQA 5IAOA 1DBRA 1G2QA 4P3KA 1JLSA 5ESWA 1HGXA 1P17A 5E38A 1XTTA 1DQPA 2E55A 1JLRA 1O57A 1U9ZA 4S2UA 1OREA 2H08A 4P84A 5K51A 2WNSA 4RADA 1QK5A 2FXVA 4LZAA 2JKYA 1A96A 2GEBA 5JV5A 4RQBA 1TC2A 3LRTA 2YZKA 1GPH1 1CJBA 3H83A 4P86A 2C4KA 3N2LA 1I5EA 2PRYA 1QK4A 1QB7A 2PS1A 5BQPA 3QW4B 3GEPA 2EHJA 1W30A 1QCCA 1BZYA 3EFHA 4LZNA 3MBIA 5EUCA 4WMLA 4M0KA 4QYIA 5IPFA 1XTVA 1G2PA 1QB8A 4P80A 3MJDA 4LYGA 4Z1OA 4PFQA 1P18A 2XBUA 2DY0A 4X45A 1ECGA 4LZOA 5HIAA 3DEZA 4M0UA 4QRIA 2JKZA 1Y0BA 4MB6A 3HVUA 5ESXA 4RANA 5KAMA 3M3HA 3ACCA 1UPUA 4LYYA 1XTUA 1ZN7A 1L1RA 4KN6A 1MZVA 4RABA 3ACDA 1J7JA 1ECCA 1DKRA 1VDMA 4ZFNA 3OZFA 4RHXA 1P4AA 1DKUA 4JITA 1ECFA 1HMPA 5JSQA 1ECBA 1A98A 3OZGA 1BD4A 1UFRA 4RHUA 2VFAA 3DAHA 3GGCA 4FYMA 4M0PA 3S5JA 1XZ8A 2JI4A 1A3CA 2H07A 4OHCA 4RHTA 1DQNA 3G6WA 1G9SA 3LPNA 4RACA 1AO0A 1IBSA 3OHPA 4P81A 5BRNA 1VCHA 5BSKA 1NULA 1P19A 4P83A 1Z7GA 1ZN8A 4X44A 4P82A 5HKLA 1I0LA 1XZNA 1A4XA 1OROA 1I13A 4TWBA 1O5OA 3NAGA 4JLSA 1VSTA 2AEEA 1I14A 2HCRA 1NONA 2PRZA 3GGJA 3KB8A 4RAQA 4RQAA 4RHYA 1L1QA 1WD5A 1D6NA 1TC1A 1UPFA 3O7MA 4PAWA 4F8EA 5KAPA 1ECJA 1BD3A 4RAOA 2P1ZA 3ACBA 2IGBA 1A97A 4WN3A 1ZN9A 1STOA 1A95A 1QCDA 1OPRA 4RV4A 4QYIB 1QK3A 5BQOA 1FSGA 1PZMA 1U9YA 1GRVA 2JBHA 1V9SA 3DMPA 1R3UA 1I0IA 1YFZA 1LH0A 1G9TA 2H06A
chains in the Genus database with same CATH superfamily
2P0YA 4BNGA 1NI4A 4V1CI 1M1YE 2XGOA 2P62A 1PNQA 3JZAA 2BMDA 3QM1A 4C3OB 4U6QA 5G0VA 2H1HA 4S35A 3WYEA 3ROZA 4X1YA 3MTIA 3F9IA 2ZT7A 1WSWA 1GLVA 1H22A 3M8KA 1L3CA 4N0EA 4MICA 1ZIXA 4TMFA 2COKA 1J1ZA 3HQ4O 1HNZB 3CIOA 1G4AE 3AGPA 1H8ED 4UQOA 3P0IA 3QTLA 3ZXIA 2O8FB 2IUYA 1BXGB 3FYTA 3ZZ1A 1N2CB 5CT5A 2CSUA 2YMMA 4M60A 4N5LA 5JRDS 3TOSA 2QR5A 1FYVA 2WIGA 4OHKA 3ZV3A 3KG2A 3QX3A 1UMCB 2ACVA 2XUHA 2H8KA 2QYTA 4IGFA 4R98A 4N12A 5P21A 1EP3B 5J2TB 4R2WA 5SZKB 4RFVA 4KVZA 3IT3A 5FX2A 3AL2A 3PFNA 1I36A 3LK7A 2Y1FA 2JIMA 2ZUBA 2PZFA 3E61A 5JWOA 4PFQA 3QBDA 4QOFA 2JBWA 3CNHA 3ZYCA 1YV9A 2RBEA 4JHLA 4CDGA 5TVGA 1Y6GA 4PTYA 4HN2A 1MXFA 3EXHB 2HT1A 2A1TR 2DQZA 1H2EA 1OXTA 3MRTA 4RANA 3V5NA 4XVUA 5KAMA 3JQ7B 2I6FA 3NHWA 3KU1A 1UEIA 3PPVA 4GYYA 4F6LA 4LJ5A 1FSPA 3ZX4A 3OEWA 2E89A 4RIHA 2D2VA 2VJAA 2YNMA 1GO2A 4WLNA 1WDWB 2RAVA 3AW8A 3WGOA 2A0WA 4BNWA 4QTZA 3KBBA 5JSQA 4BPBA 4KBGA 3LWDA 2CUZA 4CFYA 1D07A 4RENA 2VRNA 5A4JA 5TB5A 4A23A 2GO7A 1V1MB 1XVTA 2C1XA 3PPWA 5KYWA 2F8MA 4LOKA 4CV3A 1H0HA 2O2YA 3ITNA 1MB9A 5LOVF 5AJWA 5C1PA 3UGTA 1PHPA 3ENZA 3IKJA 5C32A 2IX9A 5TS3A 3ROKA 3TRDA 4GKAA 3PHLA 3VYWA 5CDFA 4AS3A 4DHWA 1UM9A 2CWWA 3KQYA 4OGWA 2Z98A 3PVCA 4H1VA 4RKRA 4AY5A 2VP9A 4CKBA 4CJXA 4DLBA 5HKKD 3R23A 1XTIA 2LCFA 1F2DA 5AHXA 5DI3B 2EJCA 3IUNA 2FRVA 2PS0A 3NHLA 4H7KA 1QH0A 4J4TA 5ELMA 1A71A 1TZCA 4LGVA 5FOXA 2OC4A 1RNLA 4ZALA 2Y9MB 3BGWA 2VWPA 1T5SA 4MQUA 4FOLA 4XSHA 1NP7A 1JXOA 1TVMA 1V16A 3M4NA 1OE0A 4HDMA 4II7A 5IBQA 4DXDA 3O4GA 3EFOA 1TVEA 3I2HA 3UOWA 1M34E 5T64A 1PSDA 4QQ8A 3BL6A 1XN4A 3ENNA 4TQ9A 3C43A 3GLIA 4IH9A 4IZ6A 3F9CA 5EMKA 2NTJA 1T5BA 1M34B 1IJBA 2TMYA 2ID9A 2V7PA 4NZZA 4LXUA 1ACJA 4JVLA 1QTRA 3EWSA 3OO0A 5E7MA 4I36A 2BW0A 4TTPA 4PICA 3DFZA 5KYUB 3IS3A 1DMRA 3M2PA 1PL7A 1UWCA 2WQZA 3WQSB 1G8YA 5I47A 3T7JA 4LWPA 1W5BA 1LDNA 2O4CA 1X7YA 5IBRA 4JYAB 3VZSA 1NBHA 1R3UA 4NMLA 3M1IA 4LSGA 2AQHA 1M7BA 2HSGA 3H5LA 4D42A 4AZSA 4V02A 6LDHA 4J3JA 3ST7A 3IUSA 1PFWA 2KS6A 1E79D 4YJ2B 4Z0TA 3B9QA 3KUXA 2FOIA 4GR5A 1P2SA 5AI9A 4J0GA 1V7QA 1VL1A 3GBPA 5G40A 3ELBA 1OI3A 4RVHA 5MF6A 4C78A 3CNOA 3PYLA 4A0SA 1DAMA 2XKBA 3VDRA 1T9HA 3GPIA 1C9KA 1A9QA 1T4CA 1QYCA 1TU3A 5KYVA 1N5LA 1KXJA 2IP1A 3OP1A 1RPNA 3KM0A 5E6SA 3JWJA 3IQWA 1NURA 1YBHA 4TL8A 1Y3BE 4QUIA 4DCNA 1S1MA 3MD9A 1SUFA 3DOUA 3AC0A 5FUBA 4O2AF 4JNCA 4Q9DA 1RBZA 3NFRA 4OL0A 3QPWA 3M5PA 1M1XB 3AO0B 3UJ3X 4A2PA 3I3SR 2AFVA 2PSHA 4YJDA 1VJ5A 1BW9A 4FJ0A 3U7IA 2XD9A 5IS2A 1GGKA 1PGPA 1TJYA 3F4BA 1S02A 5BNZA 3F71A 4O4JF 1BVYF 1EQUA 3DOJA 1V3VA 1ZXXA 1QIJA 3QMVA 4GP7A 4CL2A 4QTUB 4NCAA 4PCUA 3QHPA 5CT9A 4ZI5A 4JJ6A 1VJDA 3ZDQA 4D5GA 2CFCA 2EYQA 3IMFA 1DV1A 3BXOA 1C7EA 3DL2A 3JU3A 3C39A 1WSAA 2BEJA 3BMCA 4M1EA 1P3Y1 2FLKA 3ANTA 3QLVC 1RIIA 2PMKA 4IOMA 4LHZA 4R05A 2B94A 1OOEA 2IOQA 3OZRA 4RZ3A 1L4YA 5LDHA 1JPVA 2G4CA 3TQOA 1AHHA 5ECGC 4LHEA 4MPPA 1I51A 3RAGA 1YL6A 3QKSB 2EBFX 3FMPB 3N0VA 4OFZA 3M7IA 1BYIA 2R6GA 2WD7B 4CUZA 2PSDA 1NR1A 2J3KA 1MC5A 1A04A 3D1LA 1PR5A 3TQFA 1TCCA 2XUIA 1UR5A 2OT3B 2I62A 5J4YA 1XD9A 1BVUA 2XIQA 4ABYA 3IP8A 2P9TA 4XPIB 4AWBA 3SQWA 1I1OA 1ZZGA 4IQGA 3RSHA 3SHTA 4EB0A 4O59O 1T5IA 3G79A 3R5SA 5L9AA 4R8SA 3EZYA 3O8OB 2Y93A 3S5UA 2ZJ4A 4UBMA 4WX2B 2ZDQA 4DCCA 5J2UB 3OQHA 1KEKA 1A9XB 2I3DA 2D1FA 3WYFA 1RPJA 5K05A 2J46A 2R65A 2V58A 5LA6A 3KHSA 4OGKA 5HMMA 2JFZA 2VZ0A 1C9YA 2X86A 4DJJA 1YDEA 3DUFB 1UIRA 4MHSA 4D4JA 4IDNA 3VHXB 3PG5A 1VIMA 2MIIA 1I4LD 1YE8A 4JV5B 1FNCA 4AJIA 5EERA 2X23A 3O4RA 2IZ5A 4Y2HA 1L4UA 2N9UA 4A6PA 5CIYA 3OZTA 1FSFA 4DDUA 7GPBA 3NEYA 2K87A 5KIAA 3PE4A 2C99A 5AM4A 1V47A 3AZOA 5G1NA 2NLOA 3HUTA 3SNKA 1G59A 2Q2QA 1AUVA 4B7CA 1YE3A 4JP3A 3JWEA 5GONF 3W3AA 2WJGA 1N0IA 3SJAA 5K8VA 1G21E 1GZ7A 2PJUA 5FL3A 5KBYA 3S40A 1DAFA 1Z62A 3COYA 1FNNA 3VVMA 3FYCA 1C80A 2UZ3A 4PC2A 1OWNA 3P2EA 4DYHA 5F3RA 1PLJA 2HNBA 2EATA 3X1WA 4TXJA 1C3LA 5ESWA 3QYPA 1P17A 1A8IA 5KB3A 5C51B 3W6NA 3D3QA 2R60A 2QYOA 3D3JA 3FLEA 1D2NA 2PGDA 1TEVA 1M0WA 1MT0A 1YQDA 3ABZA 3K0EA 3FPBA 3N7UA 4L0DA 2QA5A 1DEAA 1MW9X 3DKPA 4DV3B 3ADDA 2J3DA 2JFBA 2QD5A 1W19A 3MB5A 1SG0A 5AHRA 5JV5A 2WTUA 3LRTA 1GQYA 2VZ9A 4YP5A 4GMFA 1HOXA 4EI8A 1W96A 1H66A 2BFBB 2OQRA 4PCLA 3W7VA 4BQQA 1B0PA 1X7WA 3KYJB 3OMWA 1SCBA 3QE0A 3ZOKA 1ZYUA 2EKDA 5HF6A 4FLFA 3M9WA 2Y77A 1CC1S 1OX4B 4YK7A 2G9RA 2VAXA 1YDHA 3DS8A 1GGMA 3PNSA 2XF2A 3AW9A 1XAGA 4QYIA 4BECA 1YE5A 3ERCA 1IHPA 4XLLA 1OLSB 4Q34A 3R3ZA 1FDWA 1T9GS 3ABIA 3JYQA 3SMQA 2UYHA 1TMOA 1YZNA 2O5CA 1KDRA 3DBLB 2HD4A 1DOHA 1NQXA 1L5KA 5L51A 3O8BA 1SHUX 3QVMA 2GA8A 1NF3A 4TQUS 1KY4A 1Y0BA 5E2IA 4JLPA 4P31A 5JAPA 3GVIA 1VJ0A 1E6LA 3DOHA 3JAWB 1D2EA 3OICA 3R5TA 4ZANA 1RWOA 2C1EA 1WWKA 2FRDC 4RIFA 3V97A 4FLMA 1WCIB 1RJFA 1ZGHA 1WUJS 2VWQA 3QE9Y 3X3HA 1FSSA 3LCUA 1F38A 1U2TA 3EEOA 4DC0A 2ZIEA 5IUKC 3UAGA 4AIIA 3OZFA 1USVA 3DBRA 2EERA 1W52X 2XRMA 2RH5A 4COOA 1J5XA 1LJUA 3KIPA 4P98A 3O3NB 2NP6A 5ILQA 3RB8A 1IQRA 1YCHA 3B38A 4GBED 5LQCA 4YPFA 4URYR 2ES4A 3IEUA 4ND4A 3AJ9A 1KYQA 2V5VA 2RHBA 1YZFA 1JHUA 2A3RA 2C9OA 4DA0A 1GRNA 3A10A 3ITDA 1GG8A 2QTVB 1KE1A 4B8WA 2WILA 4J75A 4YQFA 2ZPAA 3I9KA 5AJVB 2QM3A 3WLKX 2YS6A 2ONKA 3X2SA 4A5OA 2C4MA 1KK0A 2Q4BA 4WK0B 5EWLB 4C9BA 3W8RA 1Q7TA 3W6ZA 2XCQA 3PQ3A 1JR3D 4B3DA 2P35A 4J2OA 4QFCA 1P2BA 3R0JA 3USCS 5JNVA 1T3ZA 3KC2A 4W9NA 1GPDG 3BD9A 4HNVA 1NMXA 3AQIA 4NMXB 3RIYA 2FWIA 3HU2A 3I9FA 3IHLA 3FBGA 1G2IA 1PQ4A 3IP1A 4UXJA 1WB6A 3SBEA 4JFAA 2IV3A 3U9LA 4BPRA 1WXWA 1WXHA 5BW5A 3KOXA 3H42B 4K9QA 4ZU1X 3IV6A 2FAXA 4LDPA 3K6JA 4P5DA 3WMWA 4BKPA 4JR2A 3H6GA 2BGTA 2EVWX 5AKYA 2HIAA 3FZQA 5IARA 3ZWXA 1DGQA 2I8CA 2PT7A 2H2DA 2W6JD 1DWOA 5DTIA 2J5KA 1TQ4A 4D5EA 1NXXA 4EHBA 4YRKA 4HDOB 3CMMA 1O3YA 1XB2A 4MQ4A 4CF6A 2BHTA 2GEVA 5LLDA 1P44A 3TEFA 5BN3B 2AUMA 2IHZA 4UBIA 1Z6ZA 3EIWA 1KMNA 2SKCA 1L9KA 1VYUA 3FJYA 1GPWB 4AKGA 2GBGA 2CDRA 5KSZA 2Q9AA 4REQB 3IAS6 4RK1A 3AY3A 2G67A 2JFNA 3PC7A 5CB0A 4MK4A 5E1OA 2W2PA 3LHDA 4IO1A 4QQNA 4UC0A 5EXSA 2XHZA 1RQLA 4PHGA 1FRZA 3GRVA 4LOHA 1CRZA 1KPGA 4JY7A 5DCWA 5DXAA 2GYWA 4BLSA 2PPVA 1U3UA 3EXEB 5AR1A 2L2QA 5E6RB 5HJEA 4JC4A 3ZE2B 4N3CA 4JR0A 5IZCA 3NAZA 2QRNA 1Y5MA 2VF7A 1H4VB 1T4GA 2FSFA 1BU8A 2D2XA 4DSNA 1M0SA 5JS2A 1Z15A 4WXRA 1XF9A 3KALA 3OFKA 4EB8A 1XRMA 2QTZA 2YQZA 2O59A 3LD9A 4NZNA 3PQ5A 3PT9A 4CMBA 2P9QA 3KHTA 4JI6B 4CQMB 2ZE8A 1OFUX 4U7WA 3KWFA 2AMYA 3K0CA 1I7QB 1YRHA 2W2LD 3K3PA 2HCBA 3Q2OA 4WZZA 3VX4A 1U8UA 3BJEA 2BSXA 5TPWB 4YT5A 2YZ2A 4I8DA 3QMPA 1E7MA 1Q19A 4P35A 4JT4A 1NBMD 5K3FB 3IE0A 3VISA 5BV1A 4TL9A 1ZVVA 1G18A 4EVIA 5BV0A 1J5EB 1Q7RA 3HMQA 4WNIA 3MIIA 3U7JA 1YAJA 2I78A 1TVKB 1KBQA 2CJXA 2W58A 4W7IA 4MW5A 2IP2A 3G59A 2EZ4A 4LSZA 1WL8A 3ZJ4A 1OLUA 1B1CA 4O5AA 1DO2A 1N6RA 5H5JA 3VNAA 4JBWA 4XPZA 1C9EA 1CZKA 4U7JA 3V4LA 3HJAA 2IXBA 3QKIA 4D41A 1QPGA 2VN8A 3MOSA 5JBQA 1B3RA 3H5TA 4DCOA 1WDLA 1G8FA 1FDOA 4ZT4A 5BOSB 4J49A 4ZT3A 4MWDA 5E1DA 4BC0A 4IUDS 3FTCA 3FXAA 1W5TA 3GMDA 4JJAA 3ZJTA 4JQZA 3W04A 4LWQA 1Y3CE 2FA9A 4LXTA 1ULZA 1GNQA 3VHQA 1E6UA 1BO6A 1P19A 4RE5A 1M1NB 3QUQA 3UH0A 4OO3A 5L53A 3CZ9A 3EXFB 4KR3A 2X6RA 4N03A 4MWBA 2CJYA 4EY7A 2X1HA 2JAWA 3HN2A 2BY4A 2ZB8A 3KQLA 3ZUGA 4HNQA 2O05A 2WNIA 1XRRA 1V6CA 3CGGA 5C3MA 1ZITA 1P74A 5LCXA 4J7UA 4ZQBA 2AF3C 2A9FA 3KTDA 3L8EA 4TSFA 3GLIE 4H7FA 3R0VA 3D6NB 5H3HA 4MWGA 1AMNA 1E1CA 2PZAA 3G68A 1WLYA 3OLYA 4GPBA 4MUNA 4RAOA 5CNIA 2WJYA 4B73A 1Z34A 4RH0A 1Q7EA 1XXLA 4K05A 3KOMA 3EA0A 2CLOB 3PDJA 2VF4X 4D80A 4YRNA 2DBZA 1Z5WA 4HB0A 2FZVA 4XYBA 4BGUA 4OXYA 2P4EA 2CXPA 2OGZA 3WKBA 1J21A 3UGJA 1JSZA 4R01A 5ALJA 5BMVA 4X85A 4OYHA 3TKAA 5K20A 3OJFA 4B3IA 2XKKA 3FCEA 2BCEA 1LB1B 3V6MA 5EJ4A 1G6OA 2I34A 4HWSA 1IUPA 2I7CA 3AUKA 3RRZA 5CCXA 2ID8A 1FDUA 1JEYA 3T3HA 3B3QA 4AJOA 4YPVA 1SOVA 3VPGA 3AI7A 3GT0A 2GXQA 3BJMA 1EXWA 2NADA 1MH9A 3PL5A 4BO0A 4R6WA 3F98A 5JY1A 4HAYA 5DWVA 4F11A 2NO5A 3O74A 2QX6A 3N05A 4AKIA 3HACA 1TCUA 3JARA 3PRHA 1C9MA 1MFZA 1KJZA 1R7RA 3MUFA 2M6LA 2DTXA 2VLIA 1SKMA 3ILYA 1NRXA 1SWVA 1WUIS 2ATXA 3C3WA 3CM0A 3G02A 1U81A 3NJRA 3WSWA 2YHAA 3DDHA 2BCJQ 2V9ZA 1W29A 4M98A 5AVXA 1IAVA 4ESVA 1D4AA 3CQ9A 1O95C 3ND9A 4M89A 2W6ZA 4CEJA 4PG4A 3DEAA 1EE2A 4QHTA 4BFVA 1ISRA 3VUFA 4DE5A 1DPGA 3HBNA 4MYSA 4FFNA 5HIAA 4Y2SA 4NHEA 1YSCA 6CHYA 1E9FA 1BFKA 1MEEA 1ZCBA 2FPUA 3TQRA 1HQYE 4CRWB 1CIJA 1N25A 4OJTA 5JI3E 4JODA 4IYJA 5MFZA 5ICCA 1UAAA 5A06A 1U8CB 5H4GA 3ULKA 1Z07A 3LI2A 1NVEA 3TB6A 2A9PA 5GP1A 4BQSA 3CLVA 1GA1A 2VP0A 1VL8A 1PYDA 2VOEA 4AZVA 1YFKA 2HPAA 3JASA 4O2RA 2CEAA 3FB4A 3DHEA 1JGTA 4MRRA 2XRFA 1Z29A 4NDZA 1BQ4A 4ZZ3A 1RXSA 2QZ9A 1CVIA 3KSBC 1QRAA 4TRMA 3V9AA 2X7JA 4ZZ2A 3TJZA 4GRDA 2EKPA 1OSNA 4Q12A 2WF7A 3SIWA 1CZNA 4A0FA 2HC9A 5AW6A 2R11A 1UM8A 4HDSB 1C29B 1SZCA 1U7UA 1XMXA 2YYAA 3CONA 1X8JA 2O3TA 3NOOA 4NV3A 1ZNYA 4C3UA 3WGHA 3G6WA 3URKA 4B6FA 2ANCA 3JD3A 1OAAA 5BURA 2EZTA 4LFBB 2XQIA 1P6QA 3G2QA 4H3SA 4JUIA 3BE5A 1QP4A 1A8PA 2G82A 3TW6A 1KMIY 4NS4A 4UULA 3VKHA 1TKRA 3ZBTA 3DT6A 1AOXA 4F5EA 5K7SA 2ZCUA 5JFTA 2J32A 1LA2A 3ZGLA 5C7IO 4TTQA 3J81A 1R16A 1RQPA 1QFMA 2OV8A 1PX0A 2Q45A 2WUGA 3AUFA 3FGZA 3MRVA 5IN5A 4C21A 1V48A 4I4NA 4YNBA 1AK9A 3U2QA 2UVQA 1KZ1A 2W6PA 5JZMA 1HYGA 3C70A 1EVKA 3E7XA 3UW1A 1XZEA 1OCEA 1WCWA 1GUYA 3TNFA 1U7OA 1EK5A 5L7YA 3WGIA 1QU3A 1KIAA 1PJLA 3FNHA 2VP6A 2H2HA 4ITRC 3Q3EA 2CNBA 4N40A 4ZOCA 1IWBB 1FMJA 2F67A 3GRFA 4L1KA 3TIXB 5E9AA 4V2UA 5HG0A 4AECA 4E88A 3GLKA 4JC5A 4IIEA 4YP0A 2W22A 2J3HA 3IEIA 4XLZA 4EHAA 4MDHA 2V7WA 1XU9A 3EODA 2ZE6A 5FJJA 2ZRKA 3NHPA 1DNPA 1TU0A 1VJ1A 3FVWA 3H65A 3LGAA 4MYHA 5H1YA 5TF0A 3VR5H 3ASUA 1XPUA 4PZPA 4HX2A 3AHFA 1VLVA 2VDWB 4BV8A 1KJIA 1WZCA 1Z5VA 3CNLA 3DB1A 1RKQA 3ORYA 2B8WA 3DWFA 4R1UA 5LR6A 2D5CA 1DBRA 2RGCA 2C2GA 2CE7A 2I2WA 1VIAA 1UC8A 2UUPA 4H60A 4OM7A 4BFYA 3T1YB 2VDUE 3QFFA 9GPBA 3QKRA 4I14A 1YL7A 1Q0RA 4V24A 4OHZA 1H1TA 1ZVQA 2P8SA 4UZEA 1LSSA 3TR6A 2GO1A 3E4CA 3WK9A 4DIFA 1G4UR 4EQZA 1NP6A 2ZEJA 1DE0A 1FTSA 5EQFA 3NUZA 1FFYA 3AETB 3K0KA 4YN3A 5JMOA 3SE0A 1NQWA 4NTZA 3OY7A 5LDDC 1GG2A 4R31A 1VZ2A 3FPSA 3PNLA 3D81A 1QYWA 4FJ1A 4FKBA 1EB8A 1N7IA 4MRVA 4OUDB 3T35A 3TW8B 3U4DA 2QI9C 4CM9A 4OU5A 2IELA 3AILA 3OCZA 4QDXA 3VU9A 3WGNA 3WAJA 4LJRA 4ED9A 2R4QA 1RW4A 2NNLD 4BV9A 1TJPB 1ZL0A 3PE3A 1EM8A 1W4AA 1QVZA 4DLUA 1SXQA 4BX8A 1XZKA 5CDSA 1FDSA 4BO5A 3QNUA 3GIDA 2VJCA 4M7RA 5KVQA 3OEYA 1PI3A 2DOKA 2VAVA 2HYDA 4R7ZA 3C4QA 3P9NA 3FOEC 4KRGA 1JFVA 4UDYX 4AYWA 2FR1A 1KS9A 3DQQA 2JK1A 4I9UA 4HAIA 1C2YA 4TYPA 2E49A 3HVKA 3K4PA 1R6XA 1G55A 2V6JA 4BVHA 5E0KB 4MKIA 5C8XA 2ZANA 3SZRA 1LNQA 2XDAA 4KDEA 4L6AA 1R64A 3MJ4A 4FUQA 4R7TA 4EJFA 1QRTA 3U13A 4NXMB 4Q82A 1Z0JA 2JH9A 2XYRA 1A5SB 1MZVA 1N32B 5TT1A 2PIDA 2ZUWA 4DREA 1COZA 3FTFA 2WAXA 3AF3A 4J7CA 4DBLE 3ZHSA 2HJSA 3ODGA 3ZHYA 2QRKA 2YY5A 2Q28A 1TZ2A 4ZREA 3ZS9A 1Z2EA 1N3IA 2R8BA 3V1YA 3QWIA 4JP8A 3BOSA 2BHSA 4QOHA 3Q72A 2G76A 2RHMA 1NLUA 2BUBA 3LT4A 4N3GA 2NT4A 2Q9BA 4UAUA 1V45E 2X3FA 3AF2A 3B3JA 3F7NA 2CXXA 2QP4A 3E5NA 3E22A 3G5TA 3P9PA 2P6NA 3IB6A 4KXFB 4OTZA 2FG7C 4R9VA 3P20A 4Q48A 2JAXA 1S3GA 3U6KA 4QGFA 3TFWA 3T4EA 1EP1B 5FBHA 1HYQA 2HK8A 2XJ9A 1FDTA 1ZHFA 4DIOA 4ZYVA 5JXHA 1P7VA 1OIVA 1AKNA 3ORQA 4RD2A 1U8ZA 3KAJA 5K0TA 3CHYA 1Y8AA 1O5OA 3IOYA 4BBZA 1Q22A 4DMHA 1T2NA 2YWRA 3VR2D 4B5LA 2Z9BA 3CO5A 1DARA 1LPAB 2AEEA 2G5GX 2H17A 4ZI3A 1F60A 2XUQA 2Z2KA 3GRUA 2O07A 2ZREA 3FFBA 4BU1A 4RAQA 3SM9A 2BR4A 4PYJA 4PX2A 1GD1O 2XUDA 3TE6A 3KSAC 3H75A 5DJ5A 5K0EA 1X2EA 4XB2A 4QL3A 3SHFA 2HRRA 3GLFE 5CD9A 4O4JB 4KUEA 4HEQA 1GFSA 1EX1A 4KAJA 2BFPA 5EOVA 4PVCA 2JCGA 4RFSB 4WCVA 4ZO4A 5J4HA 3V8BA 1LW6E 1DJQA 2NVUA 4Q4LA 3WO0A 4Z7OB 2O7VA 2ZJ3A 3D7LA 1YVRA 3PJDA 4XGRA 1JQKA 2YIVX 5FL7D 3Q5DA 2W42A 1JG7A 5TGTA 3KZXA 1U1IA 5K6AA 2DLCX 4A6DA 4LWOA 2OCPA 2JIQA 2D59A 1B1AA 2JIZD 4IEIA 2Q6LA 2GYVA 3HJNA 4YXWD 1EUDA 1O57A 3EVFA 1JMYA 3IR6A 3NHSA 3R8FA 5DGDA 4B34A 1Y9AA 2C4WA 3HZZA 2I71A 4JU9A 3U80A 1E2BA 3GAFA 1M72A 1YS1X 3QPVA 3VZPA 2ZULA 2YN2A 3LDHA 1YKFA 4CFZA 2XZPA 4G0PA 4P86A 2X5NA 4OKSA 4ZU6X 3G3EA 2IUTA 4EEKA 1GKYA 4H7IA 3MCTA 4Z4HA 2H1RA 2OZKA 3PQ8A 3LPMA 1U8AA 1R00A 2X58A 2ZYIA 3NP9A 4JGIA 3FBTA 2IY9A 4PLPA 5CITA 3V7YA 1W6UA 4EARA 5DYGA 2XVYA 3HRIA 3BHJA 1DZIA 3BZBA 1E1YA 2JVJA 3DBIA 1Q20A 2RGAA 1HOTA 3L9WA 3L7BA 4FFWA 4E15A 3ZH2A 2FETA 3G9UA 3CR8A 3LT5A 4O4JA 5BW8A 4IUBS 1DTWB 2J7KA 3G2NA 3MB8A 1SAYA 2AVDA 2AYZA 2XADA 1LV8A 1Z0AA 1GQFA 2PSJA 2AWOA 1K4MA 3SU8A 5IC6A 1EFRA 1R4NB 4EFNA 5B3LA 1QH1B 1TZBA 5A7FA 1N77A 4H7PA 2X4GA 1PG2A 2DPLA 4YI5A 5DYNA 3PEWA 2GJ4A 3OKCA 2J3LA 4X66B 4FLEA 1J7JA 1NAHA 1NGSA 1U31A 2WHYA 3P32A 3OAAA 4NVRA 5EC8A 1JIJA 4RV5A 2F62A 4WBXC 1NVWQ 5AJZA 4KLCA 1PWHA 2G9ZA 4KGXA 3UUEA 1A9TA 1D5CA 1UKEA 1Q44A 4K03A 2YMQA 4Q9JA 4F1JA 1DC5A 2WSSA 2LTAA 2RGNC 3RYTC 4OMCA 1J20A 3MIZA 4RVSA 1IN8A 3SVZA 1J99A 2VRWA 2XMGA 5JXJA 2CVQA 3HCOA 3QFSA 5I7FA 4M87A 3O1LA 4Z49A 1SD2A 1SKAA 1JFSA 1AUPA 4HNHA 1MOZA 2GLXA 3QVLA 4FZRA 4Q4AA 4F3CA 4P38A 1WABA 1O95D 2DLNA 2VNKA 1J56A 5A4IS 5LUBA 4RTRA 2BHLA 5EMNA 1DTEA 3S6JA 3BJZA 1NQAO 2G40A 4G8CA 4I2VA 4KCGA 1UKBA 4MVCA 4TN5A 4BTEA 5K4GA 2BUCA 4DUYB 1PV2A 2HQSA 1OH6A 2XCOA 2RAFA 4O4HB 4ER5A 4YIHA 2D3WA 3AJAA 5LA6F 2GCNA 1FE8A 2I2XB 2HJGA 4U5XA 1CR1A 1VCIA 3H0CA 4W7SA 3CPEA 5FAXA 4CIDA 1RAFA 1M74A 2IL1A 2VPPA 3AG5A 4CMEC 1GQ2A 2R6R1 1HL7A 4JFRA 3BFVA 4G0QA 2X4LA 4CCYA 1TCAA 2B3DA 2RKOA 1R4NA 3GLUA 1L1QA 2ZVJA 3OETA 3LNTA 4LVOA 3V33A 2P4QA 5FWYB 2PX5A 4PAWA 4O4LB 1SA0A 3HP7A 1SOMA 5FI5A 3W1VA 4EGQA 2BISA 2NPIA 4JIGA 3U26A 4WK4B 1JXQA 3AU9A 3SK0A 2H59A 2P9JA 2XGGA 3AWDA 1MA3A 3ADPA 4JI5B 2B2XA 4MLZA 3L06A 4GUAA 4KW7A 5KWJA 5DGXA 3M0EA 1Y6ZA 1XKTA 2BJHA 1R6DA 2X40A 2Y1EA 4I6GA 4JEUA 4KLZA 2PNJA 3RFTA 3V1KA 4A73A 4F8EA 5EFZA 3K0BA 2JBHA 3EOAI 3G8YA 1CG6A 4H18A 3LBAA 3ZWVA 5KOIA 1MHTA 3QEKA 2H06A 3GJ4A 2MU1A 2DKNA 2VNHA 4NZ9A 4N41A 3JZIA 3ODPA 1XJCA 1E9VA 2CVFA 4NESA 4XDHA 4HNTA 4LECA 1X1RA 3LX6A 5JHHB 1HE4A 3EVDA 2ZOSA 3MCUA 2CNOA 4UTOA 5BVHA 1ZLYA 2A59A 5LIPA 2BE9A 3AL0C 3Q9NA 5KOJA 2JAHA 5FXMA 5JRJA 1ELOA 4Q9NA 4G9BA 1FTYA 3HA5A 1V39A 5K0BA 3DHNA 1PE0A 1CR2A 3VYSB 1LJ8A 1I5OA 1ZH8A 1HZZA 3O8QB 3BD8A 2F48A 3OX2A 3UJ7A 5F12A 1L1EA 1XDUA 2EIHA 4INPA 4UHJA 2XTZA 1JILA 3IULA 4JOSA 4BVGA 4D9HA 4F5DA 2I6XA 4JT8A 3SZUA 1WOMA 3GHYA 4TTRA 3WLJA 4PBSA 1U63A 3SBDA 2VBCA 5CA0B 4GZ5A 4C7XA 2DFNA 4QVGA 4PZLA 4XX0B 2ONZA 2Y66A 1L1FA 4BFUA 3EX7C 1G2PA 4MW9A 3WLQA 3BK1A 4LYGA 4FDTA 3FFXA 4UM5A 2X14A 1QRRA 3ML1A 1UEJA 1X7WB 3H5AA 1N8TA 2XTAA 1J22A 3GRRA 2ZIAA 1RLOA 2NSYA 2WWFA 1FNBA 2H4HA 3M82A 2OB1A 4MB2A 3FPCA 4ILEA 3I5XA 3MINA 5BV7A 2ORWA 2X8WA 3CNNA 3QEAZ 3BSSA 1P8AA 4ETIA 2IHTA 2CYCA 3I1IA 1KQFA 3S2FA 2RARA 3OU2A 4AU1A 1JPNA 1KH2A 1Z17A 2R6HA 2VJDA 4I50A 3CO0S 4BQFA 4S1WA 4RTMA 4MGYR 1WO8A 2BKUA 1SUCA 3JYNA 4P3XA 4YALA 4JI8B 4KK4A 2RK3A 2P40A 2HF7A 2HEGA 1EDBA 1L8OA 2GN4A 3BDVA 3GARA 1OR8A 3G13A 3F47A 4R1OA 4IUCS 1YB6A 3NT5A 3DYVA 2XZDA 2F64A 4GRAA 3HXPA 5CEFA 1G7RA 3TSOA 2XCUA 5EMHA 4I2NA 3F96A 3WZLA 4KWHA 1CUGA 3L0SA 3PEEA 4Y3UA 2FUCA 2VS1A 3P96A 4P3OA 3TD6A 4C0LA 4TYMA 3PGXA 1IBCA 2VSYA 1YQXA 1VI6A 3BM5A 4BEBA 1SOWA 1LVHA 4R81A 3RIEA 2UV8A 5IP5A 4E5MA 1JHPA 2Z1NA 4AP6A 3C5WP 3D8BA 1ZW1A 2XI4A 1AXEA 3VKFA 1B76A 5DZSA 3BILA 3KQNA 3WIOA 2WJZB 5KVAA 3EW9A 3NBUA 2O5RA 1CCWA 1B23P 1G20A 2CMDA 3SHWA 3VYRB 4XJVA 4RD1A 4P7GA 4BV2A 1HFJA 5DVZA 2JCBA 1CD5A 3DMRA 4O63O 4KMOA 1FYEA 3H8SA 3ZLBA 2KBEA 5DP2A 5F21A 4ZC8A 1GV1A 3ZK8A 4GX2A 4NG5A 4AUMA 2PLRA 4HTFB 4RGYA 4X90A 4AN0A 5PGMA 1KGSA 1W49A 2MINB 4CQLB 1GOTA 4C4AA 1L5OA 2WLTA 1LEHA 3HL4A 2HA4A 3OT5A 1V26A 1Z4KA 3D8NA 4MVJH 3RRBA 2XMQA 1SNYA 4RELA 5I4BA 1LXCA 3IMEA 1O9HA 5IZ4A 3HUUA 5LXTF 1GPBA 5CVJA 2OE2A 1KAGA 1WHTB 2BFCB 1J07A 1U9YA 4NCNA 1N6OA 4ZQHA 2WD7A 3L7OA 1L7DA 3GFBA 1QO0A 4FZ5A 4EHIA 3KQOA 4JQCA 4XH9B 3F8TA 1JFLA 1BMDA 3T61A 3UHAA 2Q3CA 4LFCB 2QTCA 4S2UA 1I24A 2AG0A 2AMFA 5CVCA 3FZNA 1NJ1A 1VKJA 2QAJA 3ZDEA 3K9HA 1JSLA 3HS3A 4FKMA 4NJEA 1U2RA 3P0EA 3K20A 2WA1A 3CJRA 5A5EA 3DYBA 1JHOA 1H0SA 1UKVY 4L75A 4ZARA 1Z68A 3HUEA 1OHHA 2P6OA 4COKA 4ML3A 1R6TA 1KHTA 1D7OA 4AJEA 4XIGS 4M8IA 1KO7A 1SQFA 1EVJA 4QPPA 2ALJA 5B1SA 5HHTA 4DUZB 4Y18A 4Z4EA 2ZJ0A 5GJBA 4MW4A 4CTNA 2D3TA 2ZBQA 4ZAFA 3VUEA 1RABA 5LWQA 1SXJE 4LC1A 1HDRA 1NBMA 1BFUA 3OZIA 1KQOA 2I29A 4MQEA 2J5BA 3L07A 3ONWA 3P9KA 4B17A 3EVTA 4FOTA 2XMBA 2JKZA 4B6GA 1HF3A 1V9CA 3OPQA 2W2LA 1QO0D 1Z5OA 1JR3A 3KYDA 3PKZA 3ZI0A 4NEHB 1EA5A 1DBPA 3I76A 2IOHA 4NC9A 4LVCA 3BE6A 4XYEA 5EXEA 4ZT7A 3ZWWA 4WCFC 4Z4QA 2IV7A 1P4RA 1E0KA 1ZAKA 3F3KA 3LWZA 1NMEA 4INAA 5AVSA 3KCQA 1QV7A 1RR6A 2BEWA 1QG2A 3BICA 3EULA 4QASA 3ZKAA 4MR9A 5H7XA 1CZLA 4FX2A 1VHLA 2OKGA 2QZJA 3UWDA 1PL6A 1MLDA 4RNCA 4D6YA 5A0VA 4NCXA 3PXDA 1DWUA 4MS3A 1SXIA 3RYCB 2HM7A 4NDAA 1XCPA 4DJTA 4G4SO 5CJJA 1UK7A 3W3ZB 2VQDA 4FB4A 4M0LA 1JDUA 2R87A 4Q01A 3VPAA 4PC3A 4EDHA 2V7QD 3DE1X 2IOFA 3HLYA 2N47A 2VBIA 1FEZA 2ZBUA 3GLSA 2QBYB 3H2IA 3I30X 4ETNA 2ASVA 4ZV4A 3ZU6A 4JI7B 2FJ0A 4D26A 1F20A 4HG2A 4RSMA 5ALVA 3FGNA 5CFOA 2JDIA 4RM3A 1USUA 3JRNA 5D1HA 2G1JA 4PR3A 3CUUA 4PRZA 3SQDA 1RAHA 2C7QA 4WKGA 3NALA 3FMOB 2JLVA 3E3AA 4H0FA 4W5RA 4E31A 2IU4A 4IIUA 2ECOA 1YRLA 4DUGA 1IVYA 5HSGA 4FGLA 4AZ3A 4GGMX 4IXDA 1MAVA 4KPUB 3FWNA 1EGMB 4POAA 2CW5A 3GA7A 1FY2A 1K63A 3QE3A 2OCGA 3M2TA 4PGHA 4XLTA 4Z4FA 2QUZA 5FIUA 5KJFA 1P4SA 3N2GA 3A2LA 3U6BA 2XOKA 4TLMB 3U4GA 1B8OA 1WHSB 3LT0A 3CX6A 2FZKA 3MJRA 1D2CA 1Z88A 4GDMA 2C2BA 2MMCA 4N3BA 4D4MA 1F8YA 4MI9A 1E7RA 3PT5A 1LY1A 3S2SA 3DEYX 4WDQA 3HSKA 4G97A 1YDWA 1XEAA 4E5UA 3H1EA 4XYLA 2JJ2D 3SDZA 2NV2B 2AN4A 1OWPA 3JWGA 1DXOA 1OW3B 2P2ZA 3AVPA 4DJDC 1GTZA 1GCUA 4M8LA 4PXSA 5I7EA 3FCYA 2ZZKA 2QYSA 3O8DA 4AKHA 2W00A 3GLRA 4HUQA 4UUOA 4L0CA 1D0SA 2HV9A 4NK4A 2MSWA 1PP4A 1F9AA 4I08A 4O5OA 4WY8A 1P45A 1W2GA 2IXDA 2JGEA 1TUGA 1SG9A 2B98A 2HCJB 1C9DB 4RTNA 3H0KA 4JWKA 1OZAA 3DR3A 2DY1A 3R3WA 3QXXA 2C7VA 2VK4A 5KMGA 1EGHA 4E5NA 4JD5A 5BWMA 4RF4A 1CNMA 1UBUS 2HQRA 2PGLA 4ZVOA 4ZYWA 5I9MA 4ZO9A 2PV7A 3E8SA 1FFHA 4CF5A 4UUMA 4YAUA 1D1TA 2GWHA 1XRQA 1ZUHA 2CZGA 1D9ZA 3RK0A 4B09A 4JBGA 3VZBA 2FKNA 3OH8A 1TA4A 1Z4IA 1RLTA 1C4KA 2PTGA 1OX5A 2PYZA 2R79A 4DWWA 4P2GA 5C9ZA 4H35A 3K5WA 3PD0A 1ADYA 2X22A 3DE3X 1SCNE 1QZXA 3OCYA 3ROEA 3RS2A 4URVR 3UBMA 4A2CA 4UPVA 2KW5A 5IULC 2JFQA 2XUZA 3D6HA 3IPYA 1I7LA 2MDTA 1E3QA 1P9NA 3OZGA 3PYXA 4WJLA 2CHVA 3PJEA 4ARSA 1KMCA 2B21A 1V8BA 1N2EA 1A5BB 3HV2A 2Q5IA 1HLFA 2ZSDA 3GQVA 5LM3A 1UXGA 4PRKA 5KDOA 1WW2A 3KLBA 4RESA 2ZI6A 4YLEA 5DX1A 3WL6A 4MWSA 4KHZA 2ETXA 3C74A 2GFQA 3LCCA 4FQ5A 2A0UA 3PJRA 5JJLA 4JUCA 5D3ZA 2R1TB 2AD1A 1I7NA 3NTXA 3ZVNA 3IXLA 1ZW6A 2GK6A 2H3HA 3HWSA 3LZ6A 3K2EA 1CW2B 5CFLA 3AVYA 1E59A 2ZVPX 3F46A 4JP1A 4OMFG 4O2BF 3KT3A 3EUWA 3SN6A 5BN5A 1B0AA 5SYNA 1NC1A 1M6NA 1QUFA 4I46A 1TVCA 3ABQB 2D1RA 1QCZA 1UMDB 3OTHA 2DQSA 7MHTA 3SLGA 1QE5A 4UE3S 3UUGA 4BVEA 2EFEB 5KOHB 3CKYA 2CL6X 1JQDA 1WD5A 3NBZC 4MGZR 5K6RA 4KO4S 1NW6A 5CVTA 4Q93A 1HDXA 3KJXA 2NUTA 3ZOZA 4B32A 3BMNB 5GJCA 3HB4X 4EF6A 4F0JA 4XR9A 1YOBA 1OGYA 3EE6A 2NXCA 1CY6A 1IIBA 1XVAA 1EFDN 3ZHXA 2HADA 1RQXA 3DUWA 4D57A 4L85A 3ZCUA 2PFGA 3AHJA 5KNLA 1GR1A 5F51A 2GQ0A 2B36A 4BYGA 4BEWA 1SRQA 1YDFA 2X41A 4GVLA 2PSSA 4JJIA 2BR5A 4NSNA 4FHDA 1QR6A 3HV0A 4XEUA 1RWVA 2VPWA 5AXBA 3SS7X 4ZKEA 1Z16A 3Q3HA 4P4LA 4Q9AA 4REMA 4C7MA 4CEIB 3IDFA 3UPUA 1T9GR 2IXGA 3LBIA 3H13A 3W7BA 1W6RA 1FXUA 3QVJA 3C3PA 2IC5A 1RHRA 2QIPA 3QRWA 2P79A 4HQ6A 3PEVA 4I9GA 5JUWA 2P7HA 1EDZA 1KZ4A 4Y2XA 3HXQA 5FWAA 4FYIA 5HOQA 2O8BA 4FK8A 4DMRA 3RT1A 2FW8A 4QU5A 3ZY5A 1XEFA 1ECLA 3U40A 4I4TB 1WPXA 2AQIA 2YASA 3FTNA 4I1OA 4PF1A 5ALXA 4EY5A 1RYFA 3NH9A 3KEOA 2X1LA 3GZNB 4NZPA 1K08A 4E03A 2XUJA 4P4TA 5JD3A 5JOQA 2PS9A 3C3MA 4AJHA 2V7VA 1FYXA 2H2IA 3GUVA 4YP1A 1OC2A 3SOPA 4EWLA 2ZBPA 3WDLA 1R66A 2JGMA 3WK8A 1ZNXA 1Y81A 1F12A 3ONFA 3WLOA 2CC2A 1FYWA 1LUAA 3RJMA 4BX0A 3MSXA 1MC1A 4EH1A 4C2AA 5KNDA 2ZPUA 1ZISA 4G4GA 4EB6A 4W5OA 1F4LA 5KJ1A 4E22A 1E77A 3R8CA 3VQTA 2BRUC 3KVNA 3LU1A 4J0KA 3VTFA 3OIYA 5BV2P 4OQMA 1FLDA 4CKZA 1P4JA 2SECE 3NKLA 3OKFA 4XIIA 1JB9A 2REBA 2O8EB 1DRJA 3W5UA 4EVSA 4BKOA 4D82A 2Y0CA 3OKPA 3QF7A 4NZOA 2NOAA 4PBRA 3ZHCA 4CN9A 1I80A 1N7HA 1JSCA 4II2A 2O2JA 2WP8J 1ZA1A 2WG0A 2YW9A 3WA7A 4GEKA 4ECEA 1QF9A 4G5FA 4F12A 1VJRA 2IW1A 3TRKA 1YDGA 4JJ8A 4KNVA 2H8GA 3OD1A 3C3KA 2OSBA 3AV0B 5GAJA 4FDLA 1DAIA 2AJLI 2I2AA 4KXNA 3H9GA 1X7YB 1QS0A 3PUIA 4YRBA 2WTXA 2V45A 2W2NA 3OWOA 4ZYYA 1T2UA 3NHYA 1P62B 3AR4A 1TYDE 2AV6A 4JLJA 5FLYA 5G0UA 1NSFA 1Q2UA 2IU3A 3HB1A 3W5JA 4QTYA 2NZ8A 2J6BA 4JDUA 3HKDB 2OM2A 3B3FA 3MINB 4ALNA 3B12A 4JQOA 5DM0A 2C3YA 3QELA 1P6UA 4OXNA 4G0VA 2A57A 3K15A 1SZPA 1NONA 2D8AA 2VKQA 3GCGA 2ZSJA 4FI3F 4GOJA 4TTJA 3AOEC 1B2RA 1GNPA 1ZOLA 3IVXA 3CW9A 4FFDA 2HBYA 3ONVA 1D5WA 2H2AA 3I34X 4YT2A 1D4OA 4D4GA 5KHLB 4PLYA 4HZUB 3T5AA 1KO5A 3WQBA 2CFIA 1QAMA 1BMQA 1EWVA 1T1RA 2QPLA 1NW8A 2P69A 3LHKA 4KWIA 3BXHA 3IC5A 3BIXA 3O8NA 1IXSB 2H1VA 4KV7A 5EP4A 2F6RA 3B70A 4B35A 2X15A 4IRUB 1QYXA 1DIBA 3UB2A 1OZHA 3ZHUA 4IVRA 1LBSA 1ZGAA 2Q1SA 3P26A 4LDAA 2JEZA 2VYND 4QDUA 5K0ZA 3KE8A 1E60A 1O0CA 3V8NA 1G6Q1 1U0HC 3JVUA 1DS6A 2BIFA 3DLIA 4X20A 2PXHA 1SIUA 1D1QA 2WD9A 4G1EB 3HVJA 4L02A 5KDLA 1G5IA 2VC2B 2DH5A 2XWPA 2VJKA 4DLRA 2YUIA 3H2HA 4JC0A 4TPKA 4ETWA 2V8BA 3RC1A 2Z8XA 2WKWA 3QWBA 3F6BX 1G5PA 1PFKA 2F4NA 4H7EA 5BN1A 2GYYA 3AKDA 3SJZA 3FW1A 1RI5A 5TMPA 2YHSA 3DPIA 1NNSA 4IXNA 4B4VA 4IQ0A 4MUYA 3C6BA 1GRCA 1YB4A 2GWRA 2ZBFA 1G3UA 2VWGA 1BXRA 3K0AB 1HNNA 4PZZA 5CPBA 3U3MA 3QNMA 1R1DA 4V0KA 1G0OA 2YCLA 2EHJA 3N3BC 1G291 4QGGA 1B8UA 1DRVA 3FIUA 3VMMA 4D8XA 4ZTBA 3TX6A 1WF3A 5BVGB 1GN9A 2RGDA 3CLSC 2AOVA 1MEOA 3U3KA 2HRCA 3ECSA 3K9NA 2RE8A 5C3UA 3NQ41 4J4BA 4MCHA 3BKWA 5EZ5A 4TXMA 2CV0A 4ARCA 4J0HA 1JLLA 4R9NA 4MB6A 3SQXA 1EX6A 4A4DA 2PD6A 2C2HA 1MG5A 4DF3A 1RXEA 4JXXA 1SWWA 2GEDA 3BF8A 3OAAD 4U2KA 4OEHA 2JEOA 3OWXA 4A6XA 1AKTA 3FTQA 3GHHA 4YR9A 1OBCA 1ZK1A 4Q3EA 2VJPA 4I4IA 3R9WA 1GTVA 4AW9A 1SC6A 1SELA 4RXUA 4WGFA 3MLBA 2LGJA 1PGNA 1WY7A 1DO0A 3BDAA 3HJTA 5HK9A 4BXOA 1LPPA 5J3JA 3LGXA 3WLLA 2Y92A 1A9ZA 1J42A 1E5LA 2Q5FA 2ECPA 3BH0A 3NYQA 3Q9UA 4FINA 1G1MA 4KBYA 3W9YA 4BWYA 4DDMA 2ZUCA 4G63A 2OVBA 2DRIA 4JEMA 3WGZA 4WESA 1U0EA 2ODQA 1PEAA 5EXTA 2GPSA 4QUHA 1H4QA 2HTFA 5KWIA 1A77A 4TV9F 2UYQA 4O4IA 1ID8A 2CJWB 2OV4A 3P0HA 4ZCLA 1LTQA 3JSAA 5A4MS 4X3PA 4EUKA 1SXJD 4KQMA 4MA4A 1KYWA 2QJFA 5K0LA 5HKLA 3TB4A 3U61B 3I5YA 5G4LA 1G5RA 3GF4A 1O7JA 1HDOA 3H2GA 3I4CA 2II6A 1NNI1 4JLSA 1ODJA 3HZOA 4DXHA 4GNRA 2FFBA 2VXCA 4KE6A 3I0ZA 2DULA 4JMPA 1Y48E 4R41A 2JCYA 3DOCA 1DUSA 2X8AA 3CRQA 3LH5A 4MARA 3CXRA 4RO0A 2PMBA 1CHDA 2ERCA 3EIFA 3O7MA 3WKCA 1AK2A 1AVTA 1D2MA 4EGCB 1QF6A 4LYHA 3RABA 3ESAA 3AESA 1QGZA 2XOXA 2HA6A 2HLDA 4J2TA 4CUJA 3GYGA 2DETA 3FAZA 1MGPA 3JCZA 4F2HA 4Q9LA 3G2IA 2X0FA 4KX3A 2CYBA 4GMDA 4JLWA 3S55A 4D9GA 1AY0A 3TDNA 1IHUA 1WPGA 2Q27A 3K6SB 1JEYB 4Q4DA 1W93A 5E1MA 5EGSA 3ZIAD 2H4XA 2TECE 2G9UA 1TT5A 4B7ZA 3B5IA 3ZUPA 4JXZA 1L3IA 4Y6OA 2RH9B 3PPIA 1ZEMA 3QVGA 3A6EA 1CVRA 4IEFB 4L51A 3L8DA 1QX4A 2X6QA 4MUJA 2J9XB 3JQQA 1ZM4A 2CL0X 1E9DA 2XQJA 3QUAA 1SBQA 4WECA 3DMTC 1XAIA 2PMCA 5G4KA 3WLTA 4N65A 2O8VA 3PI6A 2C7GA 1GKKA 1K5DA 1ENPA 2WMYA 3ICPA 3O3OB 4UU7A 1ADBA 2PMFA 1OTXA 3WJ7A 2W48A 3R4VA 3E7FA 4DANA 1W36D 2OZPA 2P1RA 4H9GA 5ALIA 4WUVA 1HQKA 1VPVA 4ZQFA 1FNMA 1FCJA 4QELA 1KYTA 5ARCA 1B0ZA 1C7IA 4N7RA 2N1BA 3VOSA 1DQYA 4CMCA 1EWRA 1NVXQ 4XQEA 3MERA 1BZYA 4O1HA 3MWDB 3TPCA 3FBWA 3FYUA 1QG4A 4KPUA 1JKXA 4M6WA 3T7EA 2B4YA 2PM8A 3F1LA 4MEJA 3P8ZA 1P7PA 1OZFA 1RZRA 4CMIB 4QZVA 2XZLA 2J09A 3NG1A 4D25A 4MQBA 5GV7A 3FZEA 2C00A 3BULA 1XXHA 3A1SA 3WDMA 4F4FA 3LA8A 1DKLA 5B6IA 3ICOA 4RK4A 4B6QA 4DG9A 3FCUB 3N59A 3QXCA 2J4CA 5JCJD 4MSUA 1DAGA 1QSGA 4H0CA 2QRMA 4C6TB 5DE3A 3GNQA 1XYGA 1RI2A 3KFLA 2FN9A 3ZQKA 2FSPA 3E7DA 4KV9A 1AS2A 1OXMA 2WINI 3IMGA 5A5GA 1S2DA 4I5IA 5E4TA 1CRWG 2QNIA 2YJ3A 4DCTA 3NHJA 1FDVA 2N46A 1Z4QA 1BCRB 3KL2A 4U9UA 1RWNA 5EIBC 3DXZA 4E5SA 1NXWA 2O7NA 1OFUA 4HUJA 2E5LB 5J23A 1Y82A 1JXAA 3A32A 4FHFA 4EA6A 3RTAA 5KU1A 2Y6UA 1L4EA 2W83A 3CVVA 1G38A 2JVIA 2A5DA 1LVUA 1M2HA 2PX0A 1CUYA 2DJIA 3Q3VA 5KPJA 4DR2B 3M6IA 2COEA 1SULA 4W8GA 4N54A 2R62A 5CX1A 4R8RA 1A76A 1AO0A 5TPZD 2F1HA 2O6HA 4XVQA 1VLLA 2HQBA 1W36B 2V6FA 3RU7A 3NDJA 4LNUB 4Z9AA 1H9AA 1FU4A 1P1HA 2GZRA 2W2QA 4XD2A 1GUDA 2ZYDA 4HWOA 2I6SA 1DRUA 1PV4A 2R6CA 4CPDA 1KWKA 1U2QA 4B82A 1EFPB 2Y1OA 1DVRA 3TMYA 5CCBA 4JROA 3FZGA 4V0LA 2DB3A 4WEOA 1XEXA 3EMVA 1CJSA 1YS2X 1VB3A 2NSDA 4TWBA 4YWHA 4E1AA 4EY3A 4J1SA 5E7QA 5K0SA 3TKYA 2AT1A 3ELWA 5FH9A 2FCRA 2G1AA 1N1EA 1RYHA 3L1UA 5BWLA 4L72A 3ZVKA 2XDQB 3OPXA 4X6UA 3MGGA 1KDVA 1I4TD 2W8BA 2ZWVA 4FQ7A 1Q7BA 1XMPA 1XMVA 3O3CA 4I66A 4QFMA 1QIKA 7ABPA 2E7ZA 4MKHA 1KJWA 2ZRHA 2IFTA 4PE5B 1NYRA 4MS4A 2AF4C 3FTDA 1JA0A 1M8JA 2GN8A 2E4UA 1M7GA 1SBNE 2BZ0A 3EIQA 5GONA 5JBIA 3IKVA 2ROQA 2BKLA 2EG9A 4DL9A 3LHIA 2NTEA 3DE4X 2GPJA 2JI8A 4Q24A 2WM9B 1N6LA 5BOSA 1XDDA 3OF2A 4ISBA 4L5BA 1ZSYA 2YMLA 4NLLA 2G0TA 2Z6VA 1C7FA 1YS6A 2P67A 2X0IA 3KJFA 5K3EA 5EP3A 2C5BA 4ZN6A 1U5BA 4YA6A 1JE1A 1SVLA 2ZSHA 5J47A 4B8ZA 3A3PA 2ZRBA 3AR5A 3FKSA 1P2FA 3EXFA 3IJRA 4ZMBA 2VTBA 1UFKA 3STVA 1QIHA 4OK6A 5M7EA 1X8KA 4C06A 1E0SA 2OAP1 3K1ZA 3QH4A 3TH5A 1TLTA 3DFUA 2BEVA 1FYDA 1X2BA 2GHIA 2E5FA 2OL4A 3RUEA 4MWEA 4YLYA 1GTL1 2H4FA 1T25A 2PS1A 2QJWA 1E2JA 4K9LA 2IRWA 5BW4A 3CH4B 3K0FB 4DMGA 5C1IA 1PEDA 4RX1A 2L42A 4HGZA 2R6FA 2HSDA 1C81A 3CX7A 2QG9A 5FO1A 4F9EA 5FWYA 3INNA 2V0NA 5B37A 3MJDA 3RTEA 4OQFA 2HAEA 4DCUA 2C2WA 4PXYA 2XQKA 5KTKA 2H7XA 5JAOA 2FDRA 2G7ZA 2VJOA 4M0UA 1JJ7A 4N82A 3FCXA 4LV6A 5FKJA 1AGNA 1ZS9A 1NU6A 1O89A 1CBUA 4NJMB 4OK3A 3W5AA 2REXB 3L6BA 1GFZA 3O21A 8ABPA 3OZXA 1U4OA 2BBOA 5CVUA 5I51A 2Z58A 3OPVA 3C45A 2XDWA 5L6LB 1LPOA 4ZTUB 2V6IA 3SIXA 1A8SA 1Y5IA 1V3UA 4PZDA 2ODBA 4ZU3A 3FSJX 1BMTA 5AW5A 1VYTA 2P30A 3SX2A 1RHKA 3CFYA 3KZNA 1NBIA 2GETA 2W6JA 1QPBA 2CT8A 4EHNA 3GP8A 4TZ6A 4S04A 1ATZA 5KOJB 3BFXA 1UQRA 3ZV7A 2IPMA 3H86A 3PXXA 4GGPA 4F85A 1P7ZA 1ZJYA 2ZQ5A 1G64A 4HDKA 3S1AA 1YU9A 1P29A 4EO7A 1LDYA 1O94A 3R5JA 1C30B 1NT4A 2H63A 3UMBA 3LHSA 1THZA 1D4ZA 2J7PD 3D7KA 4PSVA 2F17A 2CJPA 1PNRA 2R6ZA 4M88A 4REOA 3NRBA 1WCV1 2G83A 1JJAA 3OT4A 4JBLA 3TR5A 4ROTA 3RAEC 1FTNA 3LX8A 1YJBA 2I9KA 4IQFA 4QC2A 3C3CA 1EWKA 1SEPA 2HDOA 5JXGA 4C4RA 5BNIA 3M9XA 4BL5A 4F9TA 4IFIA 5JO0A 3DYIA 4FYHA 4U6SA 3C1AA 4Y2VA 2HPHA 2WVJA 1JIIA 4UEJA 1E94E 4DRXA 1CRPA 2ZIFA 1W581 1FOEB 2BGJA 2R00C 1P4HA 2E6UX 1JG3A 3Q85A 4UHKA 2ZBGA 4Q3CA 2QLTA 1GNTA 2RH8A 3MQ4A 3DGEC 3AI3A 3P4UA 4JYCA 5T5QA 4LRYA 3D2BA 1RTTA 3RDPA 4LBZA 4QEZA 3EBOA 3ZWCA 5EIAA 1E6EA 1DKMA 1CQJA 3ETNA 2AZ4A 3DH0A 4ZRMA 3WNDA 1HYHA 1YJQA 2P2LA 3T4PA 4EGJA 3AEKB 4FCTA 3NIWA 4NJEB 3SYLA 3C48A 4OXIA 3O47A 4UAGA 4X93A 5DXFA 1TM1E 5LIRA 1N78A 3FKSD 1TAQA 4B43A 5AKZA 1NV8A 2Y1LA 4FOOA 1ZK4A 2AOTB 2OR3A 5FOVA 4IFEA 4GXRA 4DLLA 5JMTA 2J4FA 4FWIB 3K4QA 3TG2A 2C78A 2J7PA 5I7RA 4AICA 8ATCA 1OFIA 3ZHTA 1I7DA 3NJ8A 2GEBA 2QG4A 2Q7DA 4KQIA 4RD6A 4HNAB 3WX0A 1EU1A 3QNWA 4KJZA 4CKWB 5K4AA 5CDHA 3LTEA 2OXTA 3R7SA 3NX4A 3GG9A 3QY0A 4OF4A 1V2GA 3V9PA 1ZH0A 4NBTA 5JC8A 3LLVA 2FYTA 4GLLA 1LRLA 2JIDA 4OHWA 5TS2A 3VC7A 1X3LA 3N53A 5J59A 3W6PA 2J33A 4M0KA 3RUFA 1N0HA 2PLFA 4QTXA 3SQNA 1O8BA 1SIBE 1UT8A 2YUTA 3JY6A 3PQ7A 4H27A 3ZZTA 1M5UA 2OWEA 3PJGA 4GOXA 1IQPA 3MJVA 2O2CA 4PLGA 2ZJOA 2OXCA 1M10A 4BQRA 3RTCA 2CXNA 2GNPA 2WEKA 3AQ4A 2HHAA 3A6HA 3TTVA 4BO2A 3WB2A 1F2UB 1SXJB 1GAEO 2R9VA 3ANMA 2GF2A 1V41E 4Q6BA 3WHKA 1C14A 4WASA 2VTEA 2V0CA 3FMVA 1RM3A 2IP4A 4EPTA 5CXXA 3TL3A 2IYFA 1P0QA 4Q3NA 4M37A 2BFFB 4IDBA 3UO8B 4UU0A 3AETA 2WIKA 5AHWA 3L04A 4OQXA 4B76A 2J67A 2KQUA 2ARKA 3QVWA 2VJMA 1H2BA 1EE1A 4J0CA 1D6SA 5AI5A 5GPBA 3WGMA 1TTHA 4BMCA 7REQA 2F8TA 4WSOA 2ZTUA 1YQGA 2YMPA 3A6GA 4PNZA 2UKDA 4X8HA 3EBPA 4UBOA 1NIPA 1ZXLA 3LPDA 4CM8B 3MWEA 1C1XA 1S6YA 5K01A 4LPKA 3ND8A 4RMHA 1UH5A 2IYVA 3JQEA 2VI5A 1NI5A 4DRYA 1E0JA 2RGXA 4X92A 3I2KA 4HO1X 3D8TA 5IHPA 4ZAZA 4IMPA 4KL8S 5AQ1A 5JU6A 1QYRA 2HV8A 2OFOA 2PN1A 5DHQA 1H1DA 2NUPB 4XUDA 2AK2A 1L4KA 3GJ0A 1WNTA 5EZYF 5TT0A 3EGDB 2C8JA 1A7JA 2RG1A 3BTSA 1EFVB 3TBFA 4ENPA 3B82A 1TAGA 4QPDA 2G8NA 5JCJA 3TF5A 3S4YA 1QGED 3P71T 1HLGA 5EGNA 4B81A 3V42A 3JQPA 3VVLA 1KI7A 3MCWA 4X60A 5ALNA 1WZ2A 5BR4A 3HNPA 2NUPA 3RARA 3UAVA 1K27A 4WNAB 2Z2ZA 3DAGA 2PZBA 4WLUA 4L8FA 1GPUA 1YB5A 3O5AA 3TIFA 3BA1A 3T8YA 2OO3A 1O0SA 5CB4B 1BROA 1PJBA 2YXDA 3DLAA 4OHBA 4QG7A 1XNHA 4MDYA 1NW9B 1D9XA 1EP2B 1T9CA 3CXUA 4FNMA 3EZXA 4KX5A 2F3QA 3AOGA 1RZVA 4EY4A 3EGWA 5AUOB 3Q9LA 1F51E 1M54A 3D6MA 1HX7A 3ZBPA 1N6PA 1L4MA 1GYPA 4YCNA 3NFYA 4GP6A 5CR9A 1EGVB 3KTAA 3OT1A 3RUAA 4JVNA 4TVOA 4P2BA 2NU8A 2FPGB 4ZI7A 4BDTA 2IUEA 5I4KA 3A28A 4IHJA 2O8FA 4IICA 3DVLA 2PWAA 2WNSA 2C57A 3A14A 2O2HA 1Z12A 2W8ZA 2P75A 2REQA 5FTKA 1KYVA 3PU6A 4IZHA 1HFEL 2CMHA 2MYNA 2UYYA 5GQSA 3AOEA 1RYYA 3KKOA 5HGXA 2OMEA 1Z33A 2BSQA 2ZRMA 3UFXA 1Q5PA 1Q7GA 2C04A 1BHQ1 1KERA 2NUAA 3UMFA 4C0QC 3K9QO 4KN5A 5AOAA 1PK7A 4GECA 5AUNB 5K0GA 4OP1A 2IZ0A 2F1JA 2WWTA 1QLWA 2JZOA 1RRGA 4FEYA 2EGGA 2DWOA 3FROA 1XJ5A 3CLSD 3EK2A 1TGVA 5AKEA 1BHO1 3R7FA 4EHJA 3NV9A 1CDEA 2DY0A 2QGZA 2PE5A 1C7JA 1MKYA 3CS3A 2IEZA 4RD0A 1K9VF 1OWOA 3LKZA 3RJZA 1U3TA 2FW6A 1RRCA 2C2ZA 1FNSA 1WVMA 2GFHA 4IDDA 4YASA 4N5HX 1Y1RA 3GT3A 1QF7A 5BP7A 1VC2A 1YNOA 2HJVA 5G0SA 4AZ0B 3ZGYA 4DR3B 1DAEA 3EIHA 1NFRA 3LP8A 4PYOA 1JWLA 2GT1A 1IEWA 1X1TA 4GS5A 3MMXA 1U9IA 2NP7A 2GK3A 4YFVA 3ZWKA 3QYFA 2OHOA 3Q7QA 2XMRA 5AVKA 2C54A 2N42A 4LF9B 3AJ8A 3ADKA 2RK6A 1V35A 3BXEA 4E5PA 1Y3FE 1X7DA 2C29D 4KQXA 2JJYA 3F7MA 5DH9A 4EKGA 4KQJA 1U2DC 5FTJA 4TVBA 1F9EA 1AN0A 1HKHA 1DT5A 1GPYA 3I1FA 4HMOA 4YRSA 5BT8A 5J2TA 2QRGA 1PR6A 3HDHA 3O8RA 4QGHA 4YDRA 1PO7A 3HBJA 3QXHA 1YR7A 4H08A 4W5JA 1V1MA 2FPRA 5KYWB 4EYEA 5IH7A 4JWTA 4X64B 2I4IA 5KOHA 2XYVA 2R8RA 3BBPA 1KDTA 2C42A 3KSDO 4HB2A 4LC9A 3IH5A 4M9QA 5KYYB 1Y1PA 1QFSA 2AFIE 1GNLA 2A9KA 2ZRGA 3RGGA 4MHTA 2FZ5A 2GPNA 3D3EA 2HWUA 1O1YA 3UJAA 2QORA 3OESA 1R4AA 1PFGA 4KZKA 4IIDA 5CLGA 1JEQA 3V7FA 2UZ4A 3A3KA 1SVUA 3PC8A 4CIXA 5JZOA 1PL0A 2R68A 1LQUA 4NYIR 1SOUA 3N8NA 3JS5A 1KH1A 3II6X 4MO9A 5JALA 1LI5A 5MFPA 1XMIA 5ICMA 1IY0A 3R74A 1SCAA 4ODIA 2ZTVA 5JD4A 1CY8A 1T1SA 3ANYB 4US2R 2O54A 1Y4AE 2XMCA 1FFEA 2XAAA 1S8FA 2F9FA 5I8WA 2OFWA 4EKIA 4NFLA 3TIGA 1Y4UA 3KTOA 4YJGA 4YPOA 1A2OA 3S8YA 2VA9A 3IUYA 3BGOS 4YCMA 2WABA 1YJ5A 2PKQP 3AM4A 3CSSA 3G17A 2QXTA 2VT6A 4NCBA 3GFOA 3M6LA 5T4FA 5J2UA 4XGQA 1CXZA 1AQLA 4MVJE 5IAAA 3C15C 3TTYA 1TYAE 1S3IA 1R0CA 4Y9SA 2VTVA 4YJ2A 3SX0A 1NU8A 5B1IA 2J5XA 3W3AH 3X1ZA 3EZFA 3E82A 1G66A 3FUVA 2GJSA 4OQZA 1SVKA 4LJYA 3ZQUA 1PR4A 4E2YA 2X8JB 3G8BA 4D9FA 3UH1A 1K8XB 2QUHA 3QWAA 1SEVA 5IC5A 3OBBA 1M1UA 3ZVLA 2O1SA 3HLKA 3Q10A 1E61A 1EFLA 1WMEA 1S3FA 4MS1B 2I4LA 2CE2X 3CTPA 3FGOA 5KNCH 4UTNA 1I3CA 1FU8A 1Y1TA 4O1IA 4I1VA 1KNXA 2NZXA 4O8ZA 4HDRB 2GBLA 2C3MA 2AEMA 2WMOB 1J00A 1OH5A 4RPKA 4G5GA 4MWCA 5F1PA 3TBKA 5CB8A 1QVAA 2AR7A 1BU5A 4OFXA 5ALHA 3WKAA 4X62B 4J0FA 5IABA 1B6SA 3EGCA 3OQNA 2BHNA 5EMMA 3KETA 4I8IA 2F00A 1SN7A 3UC5A 4B83A 4JU8A 1CUIA 1YRYE 5A3QA 5LYJF 3BH6A 2QW0X 2J0QA 4WVFA 4EMUA 1DXHA 1XEWY 4ATNA 1V5WA 1WUYA 3IHTA 2BWJA 1A69A 3O31A 3GFSA 1PFUA 3KQHA 2ZR9A 2J6HA 4BZQA 3ROTA 2H85A 3B7GA 4EA9A 1MT3A 5C80A 1E5TA 1V8FA 2ZAOA 3IYLW 3UIEA 3GL9A 1MABA 3VKWA 5B4TA 4LWZA 1P0MA 3RS4A 2VTKA 2R1ZA 4CIWA 4ZEOA 4CN8A 2FY8A 1LLCA 2QTAA 5IG2A 3LUJA 1XTZA 2NXEA 4DM7A 3QVUA 4LQDA 1AZLA 3DWEX 4RLSA 3UKDA 3RVOA 3VYTB 1Z6TA 2QL5A 5DLDA 3EQ7A 3VPSA 1SQGA 3I32A 4X9XA 4ZCQA 2BCGY 4B48A 1NDQA 1ZOOA 4BLRA 1KKUA 2ENUA 4HQFA 5ICGA 3JALB 1OFTA 3OHPA 2YRXA 4JBIA 4TV9A 2PYIA 4ZHQF 3CUEF 3JR3A 3QLVA 4DIUA 1HRKA 1ONNA 5F7ZA 3VV2A 4DLTA 2HYIC 1O6BA 4BZWA 1V7ZA 2IIBA 4HZUA 3DO5A 2WM3A 1VL0A 3N28A 5IYZF 1TMKA 2CFTA 2HGSA 3WICA 5ER6A 1CUHA 1UBNA 1Y7HA 4EX6A 2FSIA 4HAOA 3HR7A 1NVKA 2AN9A 3IA7A 1QHEA 3R9IA 3T5GA 3OIUA 3OHMA 1YB1A 4YRMA 1ULAA 4TKVA 1O0BA 4RJ2A 2BH2A 1TA9A 4JL6A 4RVCA 4E08A 4BV3A 1E3MA 4HMQA 3ZGNA 4F5ZA 5F2NA 1Z4NA 4NMHA 3O4IA 3HDGA 4XW2A 4ZOLF 1AHIA 2AC2A 1E1QA 2GPYA 3FNIA 4JB3A 1FB5A 2QVBA 2EKBA 1VKHA 2DCMA 2NXWA 1CQZA 2Y1DA 4LYFA 5AI8A 4A0RA 1A95A 3FPEA 4WI1A 2YCBA 2RHRA 4MUXA 4FW8A 2QNBA 4RTJA 3NTVA 5LMZA 3ZJVA 3CLTD 1TPZA 2YOHA 5H70A 5K3DA 3U7GA 4DLAA 3PB3A 3SEQA 4MR7B 1IWOA 5ECDA 5SY4A 3C5HA 4HGOA 4NMMA 4DBZA 5JQGA 3TCNA 4TWAA 2V54A 3W8FA 1F3OA 2H92A 3O1HB 2VF2A 3WRYC 5BYKA 1HDEA 1P31A 1CQXA 4IG4A 2B6HA 4ZO8A 5IVKA 5TMEA 3U3XA 3FI0A 3NBQA 1REQA 1W88A 4FXPA 3S2EA 4AJ9A 4H31A 5GZ6A 2P9YA 2QLMA 5KI6A 5EN4A 1S4QA 2WWGA 3GGPA 3LYUA 2XNHA 3O38A 2FWMX 1WTCA 2B1JA 2YXLA 1PWYE 2GLUA 3I73A 2QF7A 4DLZA 1J4AA 1FS6A 2WB4A 1IZYA 3KDSE 1DU4A 3RFUA 3BWDD 3L7CA 4KU4A 1H2WA 2BFMA 4X7PA 3VNSA 3EXG2 4HAZA 4U2BA 5F7JA 4CIBA 4MUMA 4PPQA 4RK7A 1WCYA 3NHKA 1AIPA 3PNKA 5TV2A 4LUCA 4EFDA 1NKSA 2BM8A 2CN1A 3H8WA 3RNOA 4CDRA 4F4DA 5JH7B 3EHEA 5HDQA 4DV7B 3SLRA 2O7RA 4HZGA 4IRXA 3NUGA 4ZXPA 5KQPA 3N2KB 4PVDA 1YCGA 1FTQA 2VCYA 1OFHA 1HEIA 2O0HA 4G36A 3SDSA 2XVAA 4WKPA 3VDNB 1QGOA 5AW8A 3ZDFA 1G20B 3TQSA 4F1KA 5IT9A 1QYIA 2Q5QA 1D0IA 2P65A 1JU4A 4D1YA 1WZIA 4YACA 2IEBA 2D0PB 2CXOA 1I7SB 1IIRA 1CZOA 5EIFA 5KKNB 4HFMA 1YI8A 1ZESA 5ITVA 2FUNB 2BOVA 1JL3A 3BXFA 1DI0A 1R12A 3OZVA 1UMBA 3D64A 1SCUB 2RB4A 2KX7A 1Z8HA 3CUSA 3UMCA 1K66A 2OILA 4XRRA 3GFQA 1ECFA 2Q41A 5C5IA 3EDCA 4Z8XA 3PTLA 3ZD6A 1SC4A 4E5DA 3OM0A 3I62A 1Z6GA 2DUUA 2P1DA 5ALMA 3RFXA 4PHFA 3SC2A 1Q2XA 3TNJA 3KWJA 4GX1A 3T5BA 4AC9A 2FR8C 1MUUA 4LEIA 4FYXA 4X63A 2ZJFA 4YBZA 3UJ8A 2Q46A 2Z43A 2CLMB 1TK3A 2HF9A 1BCRA 3A11A 3B1VA 4I4CA 4RH1A 4WN9B 2RBKA 5DK4A 2JLYA 3FI9A 2HL6A 3D0KA 2F1IA 3JRXA 2QSYA 4YP7A 2B8JA 2R1VA 5BNWA 1K98A 3OURA 2WZBA 4XSVA 3DW1X 4K81B 5EQTA 5K8IA 1Q84A 3ZWAA 4F93B 3A9WA 4GLBA 4OAQA 4YJKA 4IDEA 5ALOA 3TTWA 2WSMA 1L5HA 3L9XA 5I9LA 3GY0A 2ZSFA 3LC0A 4RPIA 1UFOA 3EC2A 4NBNA 4HFNA 2RGEA 5EJGA 1XMOB 1VBMA 1XTPA 2GDJA 1WXQA 5CDUA 3GCXA 4RIEA 3LJKA 4IJ5A 3A37A 1SUEA 4LS3A 3CWQA 1A9OA 5C34B 2YIJA 5ELLA 1NF9A 4OBWA 3ZE6A 1ZJ5A 3FMGA 4DA8A 3DZDA 4WQMA 5JAQA 4WNYA 3T52A 4ZVLA 4K3UA 4A1OA 5A3RA 1N36B 1CQPA 1A5AB 3OOJA 4BYMA 1TCVA 4KVFA 3WGVA 2N3ZA 2XUKA 1F2TA 2ZRIA 5C35A 3E7PA 1AKUA 1S5PA 2GUGA 4CCYB 1QGDA 3THYA 1JI3A 4QYIB 4NATA 5EJFA 4B46A 3A26A 1XPOA 1DIRA 3VBEA 2VBGA 3OFNA 3OTWA 4HLCA 1NNEA 1SA0B 1VRCA 2QUBA 3S2GA 4IKPA 2X0EA 3ABSB 1G8MA 3PHGA 4QM6A 1XCJA 1MP0A 3VSEA 1DFIA 3JQCA 3K0HA 4AXXA 1JX6A 4W1QA 3PNMA 5JO9A 1FP7A 4N0QA 1VPTA 1YQEA 2I66A 2MOKA 4J91A 3EXEA 4CCWA 2ZJ2A 4QWWA 3M4YA 2R66A 1ZNWA 2Y3IA 3L0CA 4R2XA 5H16A 5T7BA 2C5SA 2QQ5A 1EX7A 1PTJC 1TT7A 3A06A 4MLCA 4EENA 4K3VA 2GK7A 1LWNA 2RHDA 1ZRHA 3M49A 4D0LB 2CB9A 2PSFA 4IGIA 2GEKA 4LVNA 4DA9A 2B2NA 1YHYA 3LQ4A 3TM4A 3T38A 1SRRA 1CY2A 5IT4A 8MHTA 1Y4ZA 4RVNA 1P0CA 1ZD2P 3IAM6 3LWBA 3KR0A 5GV8A 1Z7EA 1ZR2A 3E53A 3WL3A 4TUYB 2OTCA 2ZIVB 2QJTA 3BD6A 2WIDA 3IUQA 2VHWA 4FFRA 3UV7A 1PNTA 4B2LA 3I6MA 4HR7A 1HFKA 2EQ5A 2V55B 3R7AA 4AJNA 3DLCA 2Q5JA 2WF5A 2GCOB 5HGJA 2FE1A 1H3NA 2W93A 2X13A 2V59A 2ZK7A 2A1TS 2XPCA 5FBKA 3UY4A 2XQGA 2XXBA 3G9TA 5EEGA 4DLXA 5CA1B 3NVDA 3T3EA 4D9CA 4U4AA 1EK0A 2FFJA 1GXSA 3E23A 3C8HA 4IR7A 1UDWA 1QQ6A 4OQEA 5F9HA 3L6OO 5F52A 3DTVD 4YX9A 4LSWA 3BQNB 1UBFA 3ICCA 5BSHA 4ZAXA 3LF1A 4NCKA 3ZTYA 1N1GA 4I0WB 4ZI7B 5JXIA 5CVDA 1X38A 1U7XA 2Z2JA 1Q83A 4L8WB 4K6KA 5JXWA 1VLJA 4WVLA 3NI2A 3HI6A 1VL2A 1R50A 1B8VA 2OOSA 4DN6A 3O91A 2CBZA 3QF4B 4HDNB 5HQ3A 1RYDA 1XZMA 2YWGA 1HKUA 2IF2A 4FFBB 4DV0B 4DV1B 1YZVA 1W7AA 4CGYA 3V8MA 1QHYA 2VJNA 4RFLA 2MSKA 4I1PA 3BL5A 2R48A 2OESA 3FIJA 4AROA 4HB3A 4GL4A 3VPXA 1F0KA 4LPSA 5ALYA 2ZT6A 2PUHA 4IF4A 1G9SA 3FLMA 4HB4A 2G80A 4MOWA 3O1JC 1JDZA 3UV6A 4WKBA 1ST2A 3RRYA 5FULA 4YXFA 3G0IA 1L4BA 3OQVA 3DTTA 3QMMA 2XWBF 4FFBA 4DSZA 4YC7A 3OY2A 4TZKA 3A1UA 3CB2A 4I81A 4WA7A 4X1KA 3SXUB 5L3RA 3PUVA 3I6QA 2EFYA 4MQFB 4N7BA 3I2IA 2F3RA 3JTEA 4JUDX 4YO7A 4KPEC 4G4JA 4NYMQ 1AX9A 1I6WA 1AT1A 3MTGA 1PZXA 3PNVA 4FXOA 4BC1A 2ACWA 1CR0A 1FP1D 3GEEA 4S12A 5JR3A 5I9BA 5GM2A 2GF0A 1ENZA 5JSZB 1USIA 1WMFA 4NABA 4Q7LA 3KT0A 1C7QA 4K6OA 1P5FA 4DLYA 1CY0A 1MG0A 1RQGA 1UZMA 4J9VA 4Z86A 1MW8X 3DTVB 3G1UA 1EMDA 3EWAA 4AF6A 1UT5A 4N76A 5K45A 3ZG6A 1T4DA 3ZX5A 1OV6A 3EUEA 1Y37A 2XWSA 1NASA 5AJTA 2GM4A 1ZD1A 1CR6A 2FWAA 1CF2O 1FSGA 3DZGA 2WHPA 4O0LA 4PFJA 1IZ0A 5K5EA 2RAPA 1WMAA 4PY2A 3DLBA 4ARIA 1ULTA 2GS9A 5LU8A 5CYOA 1NBEA 2AG1A 3EPHA 5K9ZA 1ZM7A 3DAYA 5LQNA 2RHCA 3SIPA 1YUNA 2H4ZA 1NDUA 4KXYA 2PT9A 1LPSA 1N2CA 1VQ1A 5F33A 1RXVA 4IIYA 4B6EA 4CFSA 2V6GA 1IN5A 3RVKA 3DXYA 2LW7A 3VXKA 3OZBA 5K6TA 1Y8CA 5K1ZA 2O4UX 4F71A 1M5TA 3O4JA 3AUUA 2KHZA 3GFRA 3Q8XB 4IV0A 4YQEA 3GD5A 3SNHA 1S4MA 2ZYUX 1M2OA 4WK6A 5JNTA 2Y71A 5HUHA 1I7PA 4QUBA 1FP4A 5I3CA 3ELDA 3ZZUA 1ZK0A 4U02A 2YDXA 2N0SA 3B7PA 4OPMA 2YL2A 3CRW1 4KXLA 3THOA 1MJGM 2EKLA 1NUTA 2PZEA 4XJSA 2FWPA 4W5WA 1Z2NX 3BORA 1EFRD 3UJCA 2NUTB 3BB1A 4YCJA 1DIHA 1ZFNA 1W47A 3KDPA 1HA3A 1ML3A 4KQHA 5AJHA 2NQTA 3EB9A 3N2IA 2IU0A 1PJQA 4X97A 3F49S 4M7PA 4G1MB 2PKCA 4NNOA 3CV3A 1NLZA 1N0VC 4DZZA 4ECAA 4ZKDA 4L9WA 5B2FA 1I5RA 3BSYA 3DZHA 5KHAA 3DTNA 2AFIA 3PNOA 4AXBA 3PTZA 1AMOA 4TVSA 2RGGA 2ZIWB 3VTAA 4ZPJA 3M5DA 3ZVRA 5ES4B 4GMHA 5FBQB 1PQWA 4E12A 2X76A 3M4JA 4KMSA 1JYEA 3PHCA 4NBSA 1RBYA 4BGDA 1ZEJA 4HX9A 3PC8C 1LS1A 1G8JA 4GSYA 1D1SA 1C9JA 1TOAA 1MV5A 5CLHA 4YDHB 4EJSC 1CP3A 3TZCA 2Q2OA 1H2YA 3AF0A 3EAFA 5EJ6A 3U7QB 1VZ3A 2C5GA 1RCFA 1CEQA 3ONEA 3C5EA 3AZQA 1ADFA 3WFIA 4LBWA 1SU7A 4KPYA 4D0RA 5BUCA 4CXMA 4CKBB 1E8NA 4RHUA 3SGLA 2PQ0A 1O95A 5F5LA 4QXRA 3BL8A 5HA5A 4B6PA 1H23A 4ZYTA 3HH8A 2TYSB 3R6TA 4X00A 3TSAA 3VHLB 1O08A 4M21A 3QWHA 4LV5B 1QGUA 3QPDA 5JC1A 1E6KA 2I6QA 4N9WA 2OO5C 1VPLA 3NAQA 1NSTA 3DW3X 1GR0A 2P2NA 4AG3A 1I4OA 3IAEA 4HXYA 4JA2A 5DNWA 2O3SA 2XCLA 2QV7A 4C03A 4CR8A 2QQ0A 3BGDA 4YDSA 4AJLA 4A82A 1T26A 3PD1A 1Y4DE 4XA8A 2BF7A 5L7TA 5ALZA 2Y1KA 4PXAA 3C3AA 3ET5A 3O4FA 2RKWA 1J8QA 1I0ZA 3T99A 2QI9F 2VUIB 4RACA 1FMFA 3K2IA 3CVUA 2Y4NA 1CS4C 5FI1B 1TXGA 4YUVA 4CI9A 4L5CA 5LQRA 2O0JA 2W98A 4EQ6B 4EEZA 2JHCA 2NSHA 3RU2A 1DT3A 3RGWS 3ZE1B 2EX1A 1EG7A 1YHZA 4LVUA 5ALKA 3W5VA 4TRJA 2HMYB 4M53A 3EGXB 3O2NA 1K2VN 3C3BA 4XXHA 4HEHA 1VHJA 4QECA 2UYOA 3UMSA 1DDGA 2Y27A 3ZGOA 1AGXA 3I9OA 1NTRA 1G17A 2ERXA 1XELA 3ETGA 3OZAA 3DT9A 5E4JA 1K88A 2DX7A 5CPFA 4C5BA 1ESZA 1EUCB 1Q74A 1WZEA 4U7PB 3ZNPA 4DPKA 2LKDA 2Q0SA 3MWGA 3OQPA 1WKCA 3WHPA 4RVFA 3FSRA 5BY2A 2J6CA 1NE2A 1Z13A 3DKKA 1P8JA 2FCAA 5J9FA 1KQPA 1D4FA 1HDCA 1JS1X 2XJ4A 3LUHA 5T4EA 4CM6A 5BMOA 3FNQA 4YI3A 4K88A 1XQXA 3DFKA 1FTGA 3AHCA 3N0TA 5EQDA 3EMBA 3QE4A 1GYQA 2F43A 2G25A 3Q1LA 4NU5A 3V7WA 3DE6X 3BRQA 3TLGA 3ZXSA 1VOTA 2GZAA 1UP6A 2C88A 4NULA 2CLSA 1TO1E 1YC2A 4O8CA 1NZFA 2QPTA 4KRXA 4ZVMA 1NC3A 3TW0A 4ZAVA 1X94A 1Z0KA 3P5SA 4BLUA 1ZUWA 4D9EA 4UTRA 4PQGA 1I1QB 4C7OA 4WA8A 5AI0A 3G0BA 1KFCB 3GRPA 3OJCA 3NYRA 4JMLA 2LKCA 4CKEA 4HMPA 3QUSA 1DBQA 4B3FX 5E3JA 1GEGA 4JJ4A 3HCFA 1GFIA 4V3CA 3JQRA 1IEQA 3JZMA 3CSDA 4R84A 4I1SA 3IT1A 2WDZA 5JY6A 2YHIA 1T2DA 1NLMA 3KQPA 4K9RA 3CZ5A 4HWTA 3G0HA 4YRGA 4LJLA 2V5UA 3AEZA 3I9NA 5DNYB 1I8TA 1X80B</