5SZIA

Structure of human rab8a in complex with the bmerb domain of mical-cl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
174
Chain Sequence
b'KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 46
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5sziA00
4Q19A 4NMMA 1VG8A 2QT0A 3EARA 3I92A 4R98A 1SZPA 2FJUA 2OUKA 3WBJA 3BC1A 5J4KA 3RRNA 1QHIA 3TVDA 4YC7A 4L15A 5KU1A 1P62B 4AC9A 2ZI4A 1E0JA 4WOPA 3AKCA 3BWDD 4EPRA 5KUTA 1HQYE 3FMFA 1XF9A 2PX3A 2QTHA 4NCKA 5HTKA 4QJ3A 2O8CB 4B34A 1N5LA 2CK3A 2W00A 1VYUA 2WWYA 1D9XA 4K8OA 2VHQA 1E79D 1BS1A 4PHFA 2ZSAA 4Q4LA 1ZUHA 2NZJA 4RD2A 5UKDA 3UWKA 4JBYA 3AVPA 3PEYA 1Z0KA 2ZRNA 4NDZA 4A6XA 1X8KA 2W2XA 3KUCA 1R8SA 1IJFA 3V00A 3H1TA 5KDLA 4CEIA 4HDCA 1UDWA 1YZUA 2H92A 1ZM3A 4AG5A 3TRFA 4A0HA 1O87A 2FX3A 2EQBA 1G3MA 3QKRA 5K8IA 2QMHA 3UXMA 1KGDA 4D0NA 2OFXA 1T91A 1JPJA 3A1WA 2ZYWX 1CULC 1IJEA 1S0UA 2ZI3A 3VU9B 5C2JB 4M1TA 4F4JA 5DI9A 1NJGA 3W8RA 5JCPA 5CK5A 1YZNA 3PR1A 1VHLA 4HAUA 2YOGA 1YR9A 4TYQA 2B21A 3EZ7A 5FUXA 4TQAA 1DAFA 1N6PA 2R44A 1TEXA 4NCNA 2BVNA 1G7TA 4BFUA 3ZS8A 3CLVA 5KYKA 4BFVA 3NDBB 4XWAA 1E9DA 2ZI5A 3DM9B 3LQQA 5CM8B 2GCNA 3R7WA 2D4HA 2JLYA 1P75A 3D7MA 2H17A 2SHKA 2ATVA 4YDHB 1ZIPA 3IHLA 3NXSA 4A0FA 1TTTA 2ODWA 1W36D 1ONBA 2XB4A 1LTQA 1X86B 2FGKA 1NI3A 4BLPA 4DUGA 1XPOA 1EFTA 3NIBA 1XXHE 1E2IA 5EUMA 5HR5A 3KL4A 4MDFA 2PLRA 2VSOA 4M9QA 3CX7A 4Q4JA 2FV8A 5FPHA 4NONA 3ND8A 4TYWA 4TTQA 3F0TA 2AFHE 4HI0E 2OLJA 1JQJC 4LHZA 4Q4HB 5FTJA 1QF9A 1DVRA 1KK0A 3KXIA 3B5JA 4TQUS 2A2ZA 1CS4C 3AKYA 4GBMA 2X8AA 3VR1A 3GJ0A 1SVOA 4ZCMA 1N0VC 1KDPA 2WV9A 1F5NA 1G16A 4OI1A 3I62A 2ZETA 2G9NA 2WWIA 3A36A 3ZJYA 5AUPB 1R6BX 3B1VA 1S4QA 4KCGA 4B3GA 2A5JA 2O52A 2QAGB 2R9VA 1CTQA 1I4LD 1U2RA 2I1VB 2JJ1A 2BJVA 3MMPA 4IOMA 4X8OA 3VX4A 1G20E 1T0JB 2ZRFA 5GJCA 4BWYA 4LJ7A 2XTZA 1KO4A 2NIPA 5EXXA 4LPSA 1RYFA 4PQFA 4QGGA 4Z1MD 3IBYA 2GBLC 3PFIA 4M0LA 1KJWA 2R2AA 1N2CE 2QL6A 4O0MA 1G8PA 1SXJC 1Z6AA 3SHFA 2BCJQ 4B3BA 3TQCA 4L4UA 2OXRA 1W4RA 4JLKA 2OILA 2QRZA 3A58B 2YINC 3PV0A 1Z0JA 3FWYA 2OG2A 4US1R 4HZUB 2GA8A 4KFTA 4IRUB 2OAQ1 4UJ5A 4TLBA 3ASZA 2F43B 2OV2A 5TARA 3OIWA 1UPTA 2J59A 1W2GA 3GJ7A 2QAJA 2REOA 1LVGA 1YZQA 2KBEA 3AVOA 3FPAA 4Q1DA 5IK2A 4DLVA 4AI6A 2FU5C 4RSGA 2GJKA 2IXEA 1KMHA 3L8YA 4ZPXA 4B3DA 2IYYA 2XEXA 4M1KA 4JVMA 4RZ3A 2VHUA 2XGJA 3EPHA 1ZCAA 1XZPA 3TMKA 4AG6A 4RCZA 1W47A 2OBMA 1W4AA 1XMSA 1WBDA 1N0WA 2WJVA 3BS4A 3D3QA 3EW9A 4D0LB 1E32A 2WSSA 2C78A 1WQ1R 2R65A 3RDPA 4PHGA 3NC1C 3AVUA 2YWFA 4QG7A 4F92B 3TUIC 4XH9B 4KSCA 2XNDD 3E5HA 3VX3A 3BK7A 1HE1C 5SZKB 3K09C 1WBBA 2Q6TA 1P9NA 3PENA 2WJGA 1FQJA 2QT1A 5DYIA 1AS0A 3K0EA 3KQLA 4BE7B 1OB2A 5EP1A 5F3WB 1Q44A 3IGFA 3OEED 2DFTA 4A8JC 3QF4B 4IFBA 4D80A 3P20A 3GLIA 1S9DA 4K46A 5KNBA 1KDOA 2FEOA 3ZD7A 1XTRA 1KJYA 1F60A 5KSZA 4G5QA 2NO0A 3RRZA 2O8EA 3U6KA 3Q5DA 2VIIA 3LX5A 3PQCA 2HXSA 4L16A 2IYZA 1ZBDA 5EXTA 4FW9A 5FTKA 2VQSA 1G21E 4B6EA 4B76A 3K70C 3T1QA 4UXIA 4BLTA 4LV8B 4KU4A 4MRSA 5HPYB 4LI0A 3GLGB 1U0JA 3EIQA 1P2VA 1Z83A 2CE2X 3AP3A 4RFSB 3AF0A 3WYAA 1DAHA 3KJHA 2GILA 4RKFA 1LS6A 2VYFA 3UANA 1NP6A 3OFND 4A0RA 5TXGA 3LXXA 4UQOA 1GNQA 3CRVA 2DFKB 2C77A 1HV8A 1NJFA 4DIDA 2IS1A 1Z0IA 4B48A 4D0GA 2F1HA 1W4CA 3AH8A 1NVVR 1MRSA 2G0TA 4I99A 4A6PA 1K5GA 4BLOA 4E09A 1II8B 4WXRA 4HAZA 5JJIA 3DEFA 2D06A 221PA 2YOHA 1J2JA 1WCV1 3Q5EA 4C3ZA 3FE2A 1FTSA 2ZRLA 1M2OB 2FFHA 4KITB 5CJ2A 3NWJA 1T8UA 1SVKA 1QRAA 4JS0A 2LWIA 4H9GA 4V0OA 5J40A 1Q22A 4ASUD 3SE0A 1GM5A 3SS8A 3WP0A 3TJZA 5FTNA 4G1UC 1OKKD 3P27A 2NMVA 1FUUA 2ZPTX 3ZYCA 4A8JA 4IDNA 2WM9B 3LQRA 4HDOB 2WICA 2YNMA 1BIFA 1TUIA 1C9KA 3MG9A 4BFZA 3WP1B 1S2MA 1GL7A 1XD8A 1AQYA 2DFLA 5DHAA 2ZVPX 3LBIA 4F7WA 1ZP6A 4NE2A 1B23P 2QQ0A 3ADKA 4E5UA 4EQ6A 1P61B 2W2VA 3MRSA 1EFRA 4I1VA 2DWOA 3U60B 2G1KA 3RVBA 3BBPA 1O3YA 1E9RA 3ZVMA 4E22A 2G0NA 4BLQA 1E2PA 4TL6A 1P2UA 2QORA 3FKSA 1ODFA 4U00A 2D3WA 4QNRA 1NVWQ 1CP2A 1U0LA 4Q66C 4QM7A 2HLDA 3BGWA 3KFVA 1U99A 4B3XA 4B3FX 5JHHB 3THWB 2O8DA 1RKBA 2JDID 4PC6A 3AVXA 2VH5R 1Q3HA 4QL3A 2ERXA 2AWNA 4PR0A 3SYNA 2J7KA 3RHFA 1OPXA 3I61A 4OQNA 2X2FA 1Z8FA 2GEUA 4NHOA 1TX4B 5H68A 1CRPA 4MKHA 1JQLB 1N6NA 2PZGA 4DLRA 2PMKA 2YWHA 3I73A 4DLYA 3BH6A 4QBFA 2XXAA 4C0SA 4QKQA 1P73A 2VF7A 3A1SA 3DKVA 3MJRA 3T34A 5JFGA 5FPYA 1OIWA 2ZIAA 4O2RA 4JJKA 4RCYA 4C2UA 1TL7C 2FNAA 4Z8YA 2V6IA 4TWZA 1G9XA 3PJRA 1W36C 2WIBA 4RJLA 4JT2A 1YRAA 1ZIOA 3EZ6A 4R2IA 3C15C 4JYCA 3S1AB 3CWZA 5DNYB 4AKGA 1NBMA 3AVQA 3TH5A 4Q9LA 5A0FA 1GRQA 4LRWA 2FSHA 1IXRC 3K9GA 4HATA 4FMDB 1MKYA 4CF7A 2DY1A 2TMKA 4JLVA 5LB4A 1VG9B 1FX0B 1T3SA 1E2DA 3CIOA 5FR1A 2NGRA 3W34A 5IT5A 1E99A 2PT5A 3RABA 2REBA 4YMSA 5CB8A 2PEZA 5FTLA 1SXJB 1E2GA 1XDBA 3F3YA 2G88A 2OSBA 5TY0A 5EZ5A 2ZYTX 4PC7A 1P9WA 4OHXA 4PHHA 1DG1G 1VG1A 4JL6A 1OXVA 5EZ6B 4JLNA 4PQYA 2Z5FA 3UIEA 3CBQA 4A36A 5KNDA 3R20A 5KOYA 2KE5A 1SQ5A 1JEEA 3HU3A 5FUVA 4JVLA 4N0EA 2WOJA 1CRQA 1DAMA 1SVSA 4LX0A 4AD8A 1Q1ZA 1WA5A 2YWGA 1I4DD 3K0FA 3ECCA 3MWKA 2ZANA 3DOEA 3HJNA 3L43A 5AWFC 4I1UA 3THYA 1P60A 1XEXA 3LBHA 3QBVA 4DKXA 3CX6A 5CK4A 3LWNA 4FINA 3GLFB 2CNWD 2IYQA 3BB1A 1G4UR 1UEJA 4RD0A 4OHZA 3Q8XB 4WIAA 4DCUA 2V1XA 4A15A 3LAWA 1KI7A 2EYQA 5EP2A 1N3BA 4M9XA 5ELXA 3RYTC 1Y63A 1ZU4A 2H16A 3DVLA 4A9AA 1KHTA 3H86A 1XMVA 2GJ9A 3LY5A 4PHTA 5SZJA 3SEAA 1MH1A 2IUTA 1R2QA 1T6NA 1ZD8A 4Q01A 1UKYA 3PEVA 3KKMA 3ZS9A 5FBWB 2ZSFA 2DB3A 2HYDA 1AKEA 2OBLA 2F7SA 3QOFA 3AKEA 3BAFA 4DIEA 3IIJA 2VP6A 4LJ9A 2FEMA 2FSIA 3EIHA 4GOXA 2CL0X 2V9PA 2FA9A 2W6IA 4M1WA 2VRWA 1LB1B 1UBEA 3P4YA 3C8UA 1N5KA 5FL7D 3CO5A 3FMIA 4DSOA 4KVAA 1ZCBA 2QG6A 3GJ5A 4LOAA 5AUOB 3DM5A 1GNRA 2VPPA 3TUJC 1VDZA 2EW1A 3L2OB 3K70B 2KSQA 3O8CA 3U4QB 1GTVA 4RY2A 4TZ6A 1KY2A 2XJ9A 3AP2A 3T5DA 3PITA 1IY2A 1TQDA 1X3SA 4URVR 3X1YA 2VF8A 3TSOA 1G1MA 1LV7A 4ARZB 2NG1A 2FPKA 1Z2CA 4AYTA 1U81A 3I72A 1ZNYA 2R6AA 4V02A 3SJBA 1ZUIA 2QA5A 5D3MB 3UMRA 3WMFA 1U94A 1KK2A 4EPYA 1Z63A 4PZYA 5DI3B 2QY9A 5JZVA 2AFIE 1F2UA 1JAHA 1PLJA 4HLUC 2RGNC 3VNUA 2IYVA 4MUAA 3KB1A 2G77B 5FL3A 2IEYA 1F6BA 2HYIC 3A1VA 4NL4H 2VP4A 2H8KA 2Q9BA 1LNZA 4D82A 4DDTA 2X77A 4GFDA 5L8VA 1D5CA 3BXZA 1BO6A 1PJRA 2E9SA 1A5TA 2JIZD 4MUBA 4PC2A 3ZZ0A 5JBQA 1AJEA 2UVQA 2GF9A 1W7AA 2GJAA 4URWR 3B60A 4BFTA 2O8CA 1AS2A 2PT7A 3EA5A 3FVQA 1DO2A 3IEUA 3FMPB 1XCPA 4TSFA 4WAUA 4EDHA 3QPUA 4TMXA 3W90A 2LKCA 3TK1A 1W0JD 2D2EA 3ZZUA 2N1BA 4LJAA 2GJ8A 3AEZA 1OFTA 2H18A 1OHHD 3AVYA 2RH5A 1JR3D 3KXLA 2XNDA 2VHTA 2IWHA 3X1WA 2RMKA 3AV0B 1T4GA 4A82A 3K9HA 1G41A 1U0HC 2VSXA 3ASYA 2FSFA 2Z4SA 3CNOA 2ZSDA 4WBSA 3IPYA 4B2IA 4ESVA 2ZYUX 1UKEA 4Q9KA 2ZUBA 4PSKA 3ZVNA 2JLSA 1RC8A 2ZE6A 2AD1A 1KI6B 2BBOA 2ZVQX 4LJ6A 4IVPA 5CJPA 3RSLA 5BN4A 3OEHD 3FHOA 1JBKA 1FFHA 4ZDWA 1BMFD 4B2LA 4M9SA 4MYTA 1E0SA 1I4TD 2A30A 4FMDF 3GLHB 1XZQA 5DIFA 2FH5B 3IPXA 4HLUA 4GP6A 5KDDA 5H70A 2RGNA 4MRNA 3W3ZB 4YDSA 4PO9A 1RW4A 1ZU5A 2ZJ5A 2ZS9A 3CW2A 4B43A 1FNNA 1OXTA 1S3GA 2QGNA 3QUSA 2GVZC 2MSEB 1YZTA 2P3SA 4QBIA 5FOTA 5B58C 4A2WA 2AX4A 3VFDA 3KQHA 3OIYA 1MABB 2WKRA 3QXHA 5DHFA 1QHSA 3RRYA 8OHMA 2RHMA 4Q4HA 3U61B 2D2FA 5C18A 4MH0R 2ZAMA 1G5PA 4YMUA 1Q0UA 1FW6A 2DPXA 3MUFA 1PLKA 4HAXA 1KZGB 4DEXA 4EAQA 2GETA 3N5CA 2W6JA 3BJIC 2GWHA 4LBZA 5BN3A 3A1UA 4JSTA 1SHKA 3NH9A 3B9PA 3K0CC 4Q47A 4HB3A 1JR6A 3K0AB 3SJCA 4KODA 2EFHB 1DEKA 2P0EA 2DCUA 1EK0A 2PH1A 2VA8A 4TTPA 2QAGA 3OE7D 4JKIA 5E7JA 1LF5A 3W5IA 4DHEA 4PZZA 5JJKA 2DFNA 3HU1A 2ZRCA 4G0NA 1DAIA 1A2BA 3I32A 2CDNA 1FNMA 2PZFA 4LYAA 3PEWA 3KDSE 3NHAA 1KTVA 1AZTA 1DOAA 4DB2A 2W0MA 1E2FA 1KAGA 2ERYA 1COWD 3WRXC 3ADCA 2JEOA 4NBSA 2P5TB 2VTKA 2P5SA 2WIAA 2V55B 4BUJA 1IN7A 2IF2A 3SOPA 2GAOA 1KIMA 5BW8A 5DYGA 2ONKA 3I5YA 1AGRA 2F43A 1WXQA 3FDIA 2FFQA 4AY2A 1XTIA 1N6OA 3IQXA 3KQNA 2ANCA 2JDIA 1EESA 1OXSC 1HEIA 1WDTA 2YHSA 3CRMA 3NKVA 3UKDA 4TTRA 2H1LA 2Z4RA 4QGFA 2JJ2D 4PPQA 3OAAA 2XITA 3LNCA 1E1RD 3NBZC 4DLUA 3U3JA 4C4PA 1PUIA 3KQKA 1SULA 4LCBA 3EXAA 1IN4A 4RZXA 4PSAA 4V0MA 1GVNB 1DTSA 1XEFA 5SZIA 5AK0A 3B2EA 1E0KA 5SZHB 4Q1CA 1GL6A 1DO0A 2GZDA 4TMTA 3HDTA 1DBSA 4WZBE 2JLUA 4TLDA 4OYHA 1V43A 2F3RA 2IA5A 4US2R 2X19A 2XOKA 3QKSB 4BZQA 3UMFA 4GRAA 2DR3A 4Q1BA 1KI2A 2E87A 4IVRA 4LHVA 1CIPA 1K8RA 4KV9A 5KHOC 4A1FA 1HUQA 4MKIA 3KX2A 3DDCA 2YJTD 1NF3A 2WJHA 3CNNA 3CPEA 4N1AA 3OF5A 4LHXA 3QF4A 3TLXA 4X8MA 1US8B 4OI0A 3FFAA 4ZKEA 1Z47A 4PQRA 4OQLA 2G83A 4H1VA 3UWOA 5DLQC 4YXWA 3Q3JB 3U3RA 2FDCA 1Z0DA 3LA6A 4LBYA 4U02A 1A7JA 4E03A 4OBEA 3LXRA 1Z07A 3T61A 1NNEA 4NH0A 4DT1B 1ZM2A 3REFA 4Q00A 3FGNA 3UMSA 1R5NA 5CLQA 4LK2A 4XVQA 3GD7A 5GADl 3GLGA 2ZI6A 1ANKA 2Q3FA 2XSZA 4C2TA 1VHTA 1M74A 1Z6GA 4KFUA 2B7BA 1UDXA 4OQFA 2CLSA 2GAAA 4RFSA 3TKLA 1G8FA 2P67A 5B64A 1A2KC 2IYRA 4R2HA 2BBTA 3JZMA 2FOLA 1OH6A 2GTPA 2FZLA 1XTSA 4XIGS 3NBXX 2QE7D 1JEDA 2KI5A 2BMJA 4Q4AB 3EAQA 4GNKA 1G8GA 1E2QA 2QMUA 2QUZA 4GDFA 4YMTA 3H84A 4TL8A 2NO1A 4QBHA 2XZOA 1TPZA 1OH7A 2EFGA 2YVUA 1II8A 4HUQB 1QG4A 3GJXC 3VR3A 1DAEA 1ZM7A 1XD9A 1KK1A 2CNWA 3CH4B 1OSNA 2WZQA 2JLRA 3UG6A 2C9YA 2Q9CA 5TB5A 1G8HA 2IT1A 1OE0A 2IYXA 2C95A 3PEUA 2WPDA 5DGXA 3EZFA 1OYYA 2C2HA 1AM4D 1TADA 3CPJB 1IBRA 4KYUA 1KNXA 3SZRA 1G17A 5JSZB 1DPFA 2ODEA 2ZI9A 3NTUA 1NN0A 4ZCIA 2J1LA 2HV8A 1SHZA 2ZI7A 3KTAB 3CR8A 3WNBA 3QBTA 3I8SA 4ACAA 1Z29A 5TDHA 1MRNA 3EC2A 2CCJA 1KOFA 5FTMA 1NSFA 2IUSA 1XJQA 1HTWA 2ZRAA 3DL0A 4CW7A 4I81A 3ZIAA 3VR4A 2PCJA 3EPLA 5J4LA 4R9UC 1MOZA 1MO5A 1G6HA 2ZTSA 2A5DA 1KI8A 4ACBA 1DG3A 3THWA 1XNJA 4Y0VA 2ZM5A 1OXUA 4TQ9A 5E3HA 5GJBA 4N3NA 2IYUA 4Q5IA 3TNFA 2C03A 4AYWA 3SYLA 4AKHA 4DSNA 1KDRA 4Q7MB 5FUYA 3T35A 4PC1A 3L82B 1E2NA 2V8OA 1CR1A 1G291 1SKYE 3CPHA 2WWGA 2H5EA 5HE9A 3IEVA 2Z43A 3HYTA 3X1DA 2LCFA 5EE5B 2GCOB 3WNDA 2ZRGA 5F9HA 4KXFB 1GNPA 1KK3A 4DCNA 1XPUA 2BC9A 1D2MA 1K5DA 4HAWA 4LJ5A 3P32A 1W1WA 3W6OA 2YKGA 3L0IB 2OCAA 2HF8A 2WAYA 3S1AA 1OFUX 2VHCA 3QJYA 1CLUA 1II0A 1ZC4A 1X1SA 1W49A 1LW7A 5TVKA 4P0TA 4GZLA 3QSYA 3T1TA 3ZH9B 1W0JA 3FYHA 3R8FA 2GHIA 2HT6A 4DLTA 1XB2A 2RGAA 1D2NA 3QG5A 2ZREA 1JR3A 2JA1A 4F93B 1FX0A 1GZSA 3B1YA 4M21A 1Z2AA 3KKOA 2GBLA 2MMGA 2MMCA 1M6NA 3W5JA 1GG2A 2VBCA 1R0WA 4FWTA 3M1IA 2IYTA 2GF0A 2QENA 1SXJA 2RGBA 4MKGA 3VMFA 4XVRA 4MGKR 3A1TA 5IHPA 3ZVLA 1NLYA 3QEJA 2EWVA 1XTKA 3GLIE 3Q7PA 1F48A 1ZNXA 3TAHA 3U7GA 3WXMA 4MDEA 2BHRA 2I4IA 1L7VC 2ZSEA 3OEHA 1QVRA 4OJKA 5EXPA 5J47A 3DMDA 2F9MA 3A37A 1BMFA 1H8EA 4WA7A 5BXQC 1XEWX 2GXSA 4G3XA 1P5ZB 5A5GA 4KJZA 4IXMA 5JS7A 2OXCA 3B7GA 3MFYA 5JS8A 4FCVA 4EFLA 2G6BA 5TV2A 1DELA 3FB4A 4B32A 2ZROA 3GLFA 5C4MA 1Q12A 2V3CC 3ADBA 1FP6A 2ZE8A 2FGJA 1TF5A 2Z0MA 2ZSBA 1RZ3A 3CX8A 4BASA 4GT1A 1VIAA 4IW3B 3PCRB 4MQBA 5EUQB 4LYJA 3E70C 4DB4A 3QXCA 2AK3A 2VP2A 3WYGA 1XXHB 5F9FA 1R0XA 1XD2B 3K09A 3E1SA 3VR6A 4IXNA 4DLXA 1H8HD 2IXFA 3WMGA 1A1VA 3U6BA 1TF2A 4UNQA 4O3MA 3AGPA 2O8FA 1SGWA 4LJ4A 4CGZA 1RIFA 2EFDB 1E94E 3CKLA 3ND9A 3M0EA 3RC8A 2GNOA 4TMZA 2J0QA 1VCOA 3KXKA 2EWWA 3THXA 2MSCB 5KSOA 3ZGXA 3LVQE 4C0QC 1KO1A 2OLKA 1D6JA 1YR6A 3OE7A 4HEJA 2QM7A 4C0BA 4CRWB 4QBGB 1NN3A 4AURA 4DDWA 3VR2A 3U4QA 6Q21A 4NCJA 4NZYA 5J4HA 3SQXA 5IDVA 4PAMA 2KJQA 3GJ4A 3IKJA 5JJLA 1U8ZA 2ZS8A 4I4LA 4MITA 2ZUDA 4QC2A 3FHTA 3NEYA 3T15A 1T3HA 4NCHA 2NPIA 4U5XA 4ARZA 4IEEA 1VKJA 2HJGA 4DLZA 2B6HA 3D6TB 4G5RA 1KI9A 5B2ZA 1GILA 1E1QA 1COWA 4FXPA 5D3MA 4W5JA 2ZEJA 2GZAA 1OLOA 2DWQA 4R71A 4HLQB 4HDQB 5DI3A 4PSVA 4BZPA 3QIAA 3FMOB 5E4FA 1FMLA 1WMSA 3G5UA 1HE8B 1P9RA 2VL7A 1VPLA 4QJ4A 5DN6A 4ZV4A 2DHRA 3OIVA 4JZKA 2A9KA 3SHWA 1IHUA 3DO6A 2O0JA 1E2KA 4Q7JB 4B2PA 4GMDA 4JLMA 2W83A 4LHWA 4TMKA 3U5ZB 4UKDA 3V4FA 1XJCA 3K9NA 4EJSC 3O8DA 3ADDA 4HB2A 3CONA 2CMKA 1OXXK 1E1RA 5AJYA 4BFWA 4B35A 2AWOA 4DLWA 4F38A 3E2IA 2AK2A 1RRCA 3G82C 3AF4A 3K0SA 3U3MA 1FMJA 421PA 3U7FB 1FQKA 2J0UB 2YZ2A 3GFTA 2CJWB 4FMCB 3PG5A 4Q9JA 4C0HA 4Z54A 5EE9A 5TMPA 1G64A 3BB4A 3TR5A 2IBMA 1E79A 3PXGA 4IKEA 1W44A 1N6KA 2FPLA 2ZXUA 1HT2E 1OW3B 2CK3D 2F9LA 3K9LA 4CEHB 4ZIRB 4M1YA 4GOKA 5C1BA 3RS0A 3OZXA 5M04A 1YU9A 4P31A 3VHXA 3U7HB 1CXZA 1C4OA 1BOFA 1NBME 1KI6A 1G8YA 3X1XA 5LPNA 4LY6A 1S96A 1FP7A 2CEAA 3X1ZA 4GZMA 2IEZA 4KVGA 5FBLB 1I2MA 1IM2A 1JALA 1M7GA 2A5GA 1CR0A 1R7RA 2WJYA 2Z6VA 4JBXA 1DAGA 2PCLA 1G3RA 3LFUA 4KBFA 5FH9A 5FPTA 4FMBB 4TN1A 3TR0A 3GLHA 3AM1A 1P2TA 4C30A 1G3UA 5FOVA 4M4SA 1Z06A 2ZJ2A 4XJXA 2HCBA 1FL9A 3QPWA 2G3YA 4DXAA 4OI2A 4MKFA 2WMNB 1QHXA 3CH5A 4NP6A 1MV5A 4HYYA 4D2IA 1XP8A 3JZAA 3UATA 2F55A 4DJTA 4TMWA 1YR8A 3HYRA 2QE7A 4IVQA 1YJ5A 4DSUA 1EWRA 1MABA 2D7DA 4G5GA 2WWHA 4OHYA 4W9MC 1S1MA 3KFXA 5JCZA 2P6RA 2REXB 3EG5A 3VKGA 3V9PA 2A5YB 3ZLJA 5HCIA 1BKDR 1UFQA 3IO5A 3BH7A 1QHNA 1QVAA 1AK2A 3KB2A 4GOJA 2F3TA 4OQMA 1E2HA 4P32A 3MWJA 2EFEB 4TZ0A 1MT0A 3VKWA 4A4DA 2OZEA 2PJZA 3K0AA 4FCTA 1E0AA 1UM8A 2VEDA 4B6FA 1KAOA 2CHVA 2OO7A 1CKEA 1N5IA 2VP5A 3QXJA 1G7SA 4TYPA 4W5HA 2XZLA 3DPUA 2BKUA 3DOFA 1DAKA 1KI1A 2B8TA 4MGZR 1OV4A 3NBYC 1T5LA 1UKZA 3HP1A 5CDFA 2WWXA 3W6PA 3BOSA 1JJVA 1QHHB 1C1YA 1HYQA 2BMFA 2R6DA 5BYJA 3Q7QA 2F1JA 2J46A 4BFYA 2HJVA 3NDPA 1XMIA 3FFBA 2ZRDA 4TMVA 4JLDA 2QTVB 3QPVA 1IY1A 4CIDA 1J7KA 1M8PA 1N6RA 4ZI2A 1GKUB 5CM9C 1AIPA 4DBLC 4KFRA 1KJZA 3SR0A 3FHCB 1CF4A 3L8ZA 2E1RA 4IOLA 5DH9A 4TYYA 3MCAA 4Z1MA 1XCMA 2YYZA 4CT4B 2MSDB 3RS3A 1TQ2A 5LD2B 1GSIA 4A2QA 1E9FA 4EPXA 4LSGA 3A4LA 1CJMA 1Z6TA 2HCJB 4LBWA 1CEEA 2R6GA 1Z0FA 4GL2A 2BEJA 3THOA 3M4YA 4JVSB 3SQWA 1ZAKA 4P4SB 4Q9HA 2BOVA 2ZE7A 3TE6A 3GEIA 5FOWA 1UAAA 2BBWA 1VYVA 4QNMA 1F3OA 4XVUA 5JLJA 1LFDB 3CB4A 1ESMA 4DCTA 4G5OA 3RS7A 3KKNA 5IK2D 2I3BA 2IYWA 3SU8A 4AKIA 1MO3A 2ODNA 4AIIA 3JVUA 4Q02A 2FG5A 1H65A 2ZS7A 1TAGA 2ZE5A 1RRGA 3I3SR 2OFOA 5FBVB 5AJWA 4O25A 5FPKA 2R6FA 3QKSA 2C9CA 4W7SA 2JLZA 3BD9A 4FD2A 1T8TA 2Y8EA 5FOUA 2HT1A 4ABYA 4URZR 1YQTA 2WSMA 1ZW6A 1EWQA 1NLFA 3GJ3A 3L0SA 3MAAC 5H1YA 1X1RA 1US8A 2JATA 1UJ2A 2ZRBA 1KNQA 4IOJA 2IWRA 4MYCA 2FZ4A 3PUVA 3LW7A 3C41J 3D8BA 2P65A 4QHTA 2F1IA 2PL3A 3K53A 1KI4A 2ZRJA 3OEEA 1Z08A 4CVNA 4URUR 3ZVRA 3VU9A 3RAPR 3REGA 1CJTC 1NLZA 1I2DA 3KJIA 5JRJA 4FMCF 4WZ6A 1SVIA 2DYKA 4CEJB 1RFLA 1LY1A 4NKRA 3Q85A 2RGGA 2A7QA 3AQ4A 4HLCA 1RVDA 1ZVQA 1PUJA 2WKQA 4LUCA 2LKDA 3QEOA 3HU2A 1GITA 1M1YE 2C8VA 4Q1AA 2JLXA 3C7KA 1U8YA 4LPKA 2IS2A 1RYHA 3ICQB 3G0HA 1OIVA 1E9EA 5JI3E 1T3LA 3AVWA 1Z0AA 4Q4AA 2RB4A 4M22A 4XWKA 4Q48A 5FFMA 4IHQA 2ORWA 2VSFA 3RNLA 5HE8A 4ESHA 1RRFA 3LRPA 3OFNA 4HUQA 4EJSB 1U9IC 4N0DA 2RKOA 4Q7KA 3F5FA 2AN9A 4PZLA 2NPFA 2KB0A 4GMXA 3AUXA 3EZ9A 5E7IA 3RLFA 2V1UA 1XJ0A 4D25A 4EKDA 3EX7C 4RZ2A 5P21A 1VCMA 4L9SA 4IOKA 4A2PA 3MGCA 3AVVA 2QTFA 4TT3D 3BFKA 1GP2A 4A0GA 5J4VA 2ZAOA 5FOSA 5LDDC 3KZ1E 1JAIA 1D8TA 3LLMA 3OIUA 4L8GA 4ASUA 2QMOA 1H8HA 1TMKA 4D4MA 4QFMA 5JSZA 1HT1E 3SDZA 4ZDIA 1YZGA 5LBIA 1OKKA 4Q21A 3O8RA 4FIDA 2HF9A 5GJVC 3KTAA 5EE1A 3M6AA 2AXPA 1VG0B 2N42A 4CT5A 2NTYC 1E4YA 3U3OA 2JCSA 2YC4C 5EE3A 1U90A 3P1JA 4S2EA 4PPNA 4PPFA 5J4YA 4ZCLA 4FCWA 2HDNB 2RHDA 3QENA 4LV5B 2EU8A 3PUXA 2GKSA 1R5BA 3KJGA 2WWFA 1G7CA 1GDDA 4JLJA 1E2LA 4HZUA 4PPGA 4DRZA 4C0JA 5E95A 4GPTA 4OQXA 1IONA 3BB3A 1N6IA 1EFHA 4ITRC 5J5CA 1Q1EA 5CYPA 3LD9A 1GAJA 3ZDQA 1R8QA 4BPBA 4JMPA 2Z83A 5A4JA 2GEDA 2D74A 1ZD1A 4M53A 1U9IA 2GRJA 3WMEA 3AVTA 2ZRPA 1CJKC 4TLCA 3SNHA 4V0NA 2QPTA 3K8YA 1RRPA 3DKPA 1YVDA 1SVWA 2GCOA 5EXSA 2CBZA 3UK6A 3SC3A 2HEIA 2JGNA 2B7CA 2YV5A 3K0CA 4HB4A 2QROA 4ON9A 1J90A 5GVRA 1F2TB 4LWZA 1G6OA 4ERNA 4P4UA 1U8AA 1ESNA 3IDQA 4PXAA 1AN0A 2QRNA 3SBEA 3C14C 4DSTA 1JPNA 1NIJA 4OK5A 2RGCA 4V0ME 5HKKD 2IHBA 3BRWD 3C16C 2CL6X 1T5IA 4KHZA 2OAP1 3A8TA 4NU0A 3VHLB 5IRCD 3TVTA 3Q72A 1E9AA 2GEVA 4HAVA 2ODBA 5FPSA 3SN6A 3I1FA 3TW8B 3WHKA 4W5WA 3ETLA 4HZIA 1R4AA 2PBRA 1RJ9B 1NBMD 1GIAA 1GWNA 1UKVY 3PUZA 1OF1A 1W0KD 3AGQA 4K81B 1G4AE 3IO3A 4NCIA 1EFUA 4LBVA 2ZU6A 3GCGA 1B0UA 4B33A 3R9WA 4C0LA 4NYMQ 3AUYA 3P4XA 4B47A 5E7MA 1N25A 1E2JA 4I1OA 2GVDC 2VP0A 4EPWA 5BWMA 3KQUA 2J87A 2ZJBA 4MYHA 1ZD9A 1FTNA 3KUDA 2V4ZA 4X8LA 1VTKA 4TLEA 2P2LA 2FSGA 4R7ZA 4OI4A 2OE2A 3RWOA 3B85A 1IQPA 3PUWA 1ETUA 2CLDX 1NMXA 1EFCA 3F8TA 3GLGE 3QF7A 1HA3A 4URYR 5G3YA 4P3YA 3B1ZA 4JL5A 1G3IA 5JHGB 3CWQA 3T06B 1CJVC 2XTNA 4F4IA 5EJEA 3FOZA 3TUZC 4TYNA 2BM0A 2AR7A 4NYIQ 4G01B 3IBGA 5JRZA 1XXHA 1XD2A 1TU3A 4PFSA 1G5RA 1YKSA 1GRRA 4QGHA 5AJVB 1UBFA 2WTUA 4JKYA 4C7OB 1UF9A 3B9QA 1AKYA 1DE0A 3IIMA 4XTRA 2C96A 1TEVA 5F98A 2Q9AA 2OBNA 1Q20A 1JECA 1M7HA 4RKEA 5K8LA 2BWJA 4TL7A 2JLWA 1VIYA 4ZKDA 1OYWA 3VTKA 2WVJA 5L3SB 3SFVA 2O8BB 1IY0A 4JLPA 4QM6A 1KO5A 1NL3A 2GK6A 3H0KA 4WW0A 5KTYA 1BYIA 3NVAA 3IUYA 3A6PC 4DVGA 3IIKA 1NMYA 2FFAA 3RC3A 4BEBA 1TUEA 3ICEA 1VECA 3DHWC 2QBYB 1G3QA 4QGAA 1P72A 2QSZA 1Y3AA 3MSXA 4CYMA 2CHQA 3N70A 3KKPA 4QHSA 4Z51A 4G5SA 5AUQA 2ANBA 2ZITA 2GCPA 1E98A 4XWOA 4NPHA 4EFMA 2J45A 4MGIR 2W6ID 2ZUCA 5FL7A 3SFZA 3U44B 1S3SA 1ELOA 2FPMA 1A4RA 4PAQA 1NIPA 3WBKA 1UBGA 1IXSB 3FKQA 3N2IA 4AK9A 4Q18A 3UPUA 2IK8A 1N6LA 4E07A 4MRVA 3TIFA 2ZU0C 2CLCX 3FTQA 2WJJA 2K5UA 1R5OA 4MRPA 4XTCS 2RGEA 1GFIA 5L3QB 2P6NA 1W46A 3N2EA 3QE0A 4LV6A 2XAUA 4IFEA 3UG7A 2ZYVX 5L3RA 3OESA 3BH0A 2QGZA 4M1SA 5L3VA 3IHWA 5FUWA 2A78A 1Q21A 4B74A 2QI9C 5C46F 4UNPA 5ANRB 2CVFA 1IN6A 2PLFA 5F2EA 3R9XA 1QHGA 4RFVA 3B8HA 4EPVA 3SJAA 1ZNZA 4HUTA 1JI0A 5JWHA 2R8RA 2CHGA 4AYXA 2JIZA 5CIQA 2F6RA 2A3RA 5H8WA 1NG9A 1D9ZA 2J0UA 5FI0B 4DDUA 2CJWA 5KO2A 4OK6A 3HR7A 1A82A 3B1XA 1YZLA 4V0KA 2JJ8A 3QY0A 1U98A 2P6UA 1E9BA 5EP4A 4CDGA 2QNRA 1NKSA 1OHHA 3BIFA 4TSFD 1WE2A 2CE7A 4ZIRA 4CEHA 2X1VA 3SYKA 1S8FA 2QEQA 1KO7A 1YE8A 1E9SA 2B8WA 2ZJYA 1JJ7A 1NN5A 4D26A 2PX0A 4JSYA 1KYIA 1AS3A 1ZJ6A 1IOZA 3H2YA 2GZHA 1ZYUA 2J3EA 1TQ4A 1G18A 3L0OA 2J0SA 2V7QD 1JR3E 3LH5A 4B3CA 721PA 1XEWY 1AQUA 3CF2A 3T1OA 4LJ8A 5DO9A 5HZHA 2IS4A 3R8CA 1NN1A 1JXOA 4CEIB 1SXJE 1NRJB 1CU1A 2C5LA 2O5VA 2XX3A 4HB0A 4KO8A 1W5SA 4LZZA 5B30A 2RAPA 2IYSA 2HXYA 5LD2C 3IILA 3GP8A 4IDOA 5JWOA 1PV4A 3QKRB 1FOEB 4RD3A 4DC9A 1OT3A 1UEIA 4NYJQ 2ZJOA 1N5JA 1HQCA 2KWIA 4IJMA 2GXAA 4UNRA 821PA 3TGPA 1KSFX 2GESA 5AJZA 1GRNA 4B71A 3AB3A 3HPRA 1E9CA 2AKAB 2WKPA 5G40A 3GLFE 1SVLA 2O0HA 3BE4A 4D81A 2CVHA 3JVVA 2J7PD 3RRMA 3EPJA 2ZJZA 5JEEA 3QVVA 1XMJA 5G3ZA 3R7WB 3LV8A 3ONWA 1Z3IX 2QP4A 3GFOA 4OHVA 3ZZTA 1FPMA 4BQSA 2NO9A 2NZ8A 4FN5A 1FZQA 4C9BA 5GJWC 4DEYA 4LYHA 2BM1A 3NC0C 3GPLA 1WB9A 1Q3TA 3RWMB 4DCSA 1XTQA 4TT3A 4KSBA 3VQTA 3GEHA 4Q4JB 2QMEA 2ONJA 1VCIA 4ILEA 2W6JD 1QHHA 1SVMA 5CIWA 4NTZA 1X8LA 2KBFA 4PX9A 3MWLA 2EFCB 4QJ5A 3ZD6A 4OHWA 3I4LA 3NH6A 1UBCA 1P3JA 2ZRMA 4OL0A 3HWSA 5D3QA 4BEJA 5FI1B 4AKEA 4B75A 1KY3A 2GJSA 2CL7X 4X8HA 2OM2A 1TNDA 1OFHA 3EZ2A 4RD4A 1BH2A 2NO6A 3GFPA 3LBNA 3CF6R 2BMEA 4PO1A 2WBLC 1ZC3A 2CCKA 2JLVA 1XPRA 3EWAA 2JAQA 521PA 4XD7D 3B6EA 1HY3A 3A4NA 2IS6A 4P4SA 5DISB 1HURA 3DZ8A 1WP9A 2W2TA 4D4LA 4IDHA 3LO5A 1II9A 3B13B 3AKDA 2QP9X 2RCNA 1S1CA 4HLDA 4L5BA 2YWEA 1Q1QA 4P33A 4BFXA 2FF7A 3LW8A 2IUUA 1XWIA 1NMZA 4JVNA 4PC3A 4KAXA 2J5XA 1M7BA 3B78A 3EASA 1SKYB 2A5FA 1KO8A 4NYMR 4QHYA 2XZPA 4TL9A 4C0AC 2JJ2A 3QNUA 2ZJ8A 2ZJAA 2RGXA 1J99A 1G7RA 2PMDA 1KSHA 3AP1A 4KLZA 4POAA 4QOSA 2BMDA 4J0QA 4LC0A 3SI7A 1NSTA 3OAAD 5HZKA 2GDJA 1JB1A 1Q57A 5GVSA 4DLSA 2IC5A 1S9HA 1ZNWA 2ORVA 2OHFA 2PZEA 1KMHB 1W2HA 2NOAA 4PANA 4ZO4A 4YMWA 5CITA 3EWSA 4DWJA 3QXSA 2WJIA 3KKQA 2V6JA 2PEYA 2J41A 3CNLA 4GSYA 3PUYA 3QVUA 1EXMA 5HKKA 4JL8A 1R0YA 1DS6A 2XOKD 4YMVA 3ZQJA 3GJ6A 4YONB 2AXNA 4F4CA 2RGDA 4LDJA 1PVOA 2C9OA 4NYIR 2DWPA 1N6HA 2YC2C 4UNSA 3IQWA 4DCVA 1Q1BA 4CEJA 1Z28A 5B57C 2W0SA 3O47A 2QPOA 4QRHA 5JEDA 1MO4A 1OIXA 4KI0A 1W0KA 3BFVA 3PIRA 3WHLA 4YXWD 1E2MA 3GMTA 3CRQA 2CXXA 1E4VA 1ZMXA 1FUKA 1PLLA 1GUAA 2J0VA 2BCGY 3EC1A 2Q3MA 3TW4A 3B1WA 4JBWA 3GLIB 1LS1A 4D6PA 2IF0A 2ORIA 2NQ2C 4KLNA 1MR3F 1CBUA 2ZR7A 2O8EB 3CZQA 3WNCA 4OJQA 1XU4A 3U7EB 1OH5A 3PVSA 2OT3B 2XSZD 1XBTA 1D2EA 3TQFA 3GLHE 4FWIB 1XFAA 2I1QA 2ATXA 4UNNA 3QXXA 4EJSA 2AL7A 1QDEA 2Q21A 2ZRKA 4OK3A 4Q03A 2J9RA 3D31A 3W6NA 2QP3A 1R0ZA 1E6CA 4BFSA 4DDVA 3BORA 2V54A 5KDOA 5IF9A 1Z6XA 121PA 3RSOA 5BYKA 3LLUA 4V03A 4DUGD 5DSZA 1W4BA 3P26A 3A4MA 1WRBA 1Z6YA 2QSYA 4JT4A 3RANA 4C0KA 4EIWA 2BKEA 2JASA 2XJ4A 4BLRA 3VAAA 2PJRA 1RPZA 5EE0A 2IHYA 1K6MA 1E69A 2QZ4A 2ZRHA 3V4RA 2N46A 2XNSA 5AUNB 4I1SA 4US0R 4JLAA 1EGAA 1T9HA 3HR8A 5AJXA 1EG7A 1ZRHA 3WYFA 4CZ2A 2BBSA 1W5TA 3CRRA 4JJZA 3KJEA 3QG1A 4YLGA 3GQBA 3CUEF 1G5TA 4M2LA 2WPDD 3DMNA 5DE3A 3X2SA 4PTLA 3EIEA 4WVFA 2Q0HA 1QBKC 5FOXA 4JLBA 2ASEA 1IN8A 4GP7A 4MRRA 2Q3HA 1OJLA 1J70A 1GL9B 5CDFE 2O8FB 1NVUQ 4ZDKA 3HPQA 2JJ1D 4A8JB 3VKHA 5K8UA 2F1RA 1YHNA 4IDPA 4YQFA 1CR2A 2R6CA 3THXB 1UADA 3NG1A 5K8TA 1AZSC 5CLLA 3TAUA 1NG1A 3B82A 1GKYA 1DARA 1KDTA 3LVRE 3ZIAD 2ZQ5A 1KSGA 2W58A 4EQ6B 2IL1A 1ZM9A 5JI2E 1JNYA 2IYLD 3BERA 1TQ6A 1PZNA 1SKQA 4JYBA 1V5WA 4BRWA 4BRUA 2WWWA 5FR2A 2BIFA 3QKTA 1J8YF 4UXJA 5KSPA 1L4YA 3NBFA 3U2QA 2IX3A 3VNVA 5JECA 3I5XA 3GEEA 5CB6A 1LF0A 3MLEA 1AA9A 1KZ7B 4M9ZA 2O8DB 4Q1FA 4RD1A 4KYIB 4WXPA 1IAQA 2ZR9A 3T1VA 1QZXA 1VMAA 1Z5ZA 5C4GB 2D62A 1F2TA 1E96A 3AF2A 2WOOA 1ZM4A 3C4JA 2O0KA 1WF3A 5EP3A 5BQ5A 2OCBA 1GKIA 1P2SA 2C98A 1OFIA 1Z22A 2XXAB 1TU4A 1E3MA 3Q9LA 5BN5A 2C99A 2D7CA 2WSSD 5AR1A 4NYJR 3O8BA 3W8NA 2HUPA 2UZIR 4LHYA 3EPKA 4LC1A 3NEJA 2IW3A 2ECKA 4EFNA 2ZR0A 4B73A 3I8XA 2C04A 1XRJA 3K1JA 2EYUA 5G53C 1NVXQ 4LGMA 4HSEA 3WY9A 2GXQA 2BEKA 2GK7A 4V0LA 1RJ9A 2FE4A 4L9WA 3CF0A 2OCYC 2UKDA 4O2LA 4URXR 4DT1A 5HCNA 3J81k 4RVCA 2FFBA 4BECA 1TF7A 1XTJA 4JLOA 3TSWA 4XSGA 5JWRA 2FN4A 1IN5A 3TBKA 3WRYC 5KPDA 2EVWX 3SJZA 3AF3A 4M1OA 4EPTA 4IEIA 1HH4A 3T5GA 4F91B 3OHMA 2R62A 3MD0A 3MJHA 5CYOA 1SXJD 2V7QA 4II7A 2YOFA 1RE0A 2QAGC 4MGYR 1L2TA 2GXUA 2XTMA 1NY5A 3RS5A 4AWXA 3RS2A 2BJWA 1CJUC 1KSJA 1P4SA 4D4JA 2VHJA 1VYTA 1XX6A 3T12A 2X2EA 5LB2A 3VR5A 2AKYA 621PA 3W3AA 1XCGB 3AF1A 4TLAA 4UJ3A 3TSZA 1H8ED 1YZKA 4UXHA 3R9IA 4BZXA 3C5CA 4JIMA 3U3KA 1EX6A 1KI3A 4RZUA 4Z8XA 1OH8A 1L8QA 1W48A 1QHYA 3CM0A 4M8NE 2WMOB 3CR7A 2NO7A 4C7OA 1CR4A 4IDQA 4A92A 4BGDA 1P6XA 3LX8A 4PO8A 3K0FB 2OFWA 1AGPA 3MWYW 5L3SA 3THYB 1P7CA 2O8BA 1VCNA 1XEXB 2J7PA 1L4UA 1KKLA 1NY6A 2AHOA 2XB2A 4BLSA 2OESA 1E2EA 4LYFA 2WAXA 1X8JA 5EQTA 1OB5A 3C5HA 2CCGA 3CRW1 4Q9IA 3ZQ6A 4XSHA 1W36B 4Q7LA 1R10A 5KNCA 1EX7A 4FI3C 2QBYA 4EUNA 1X6VA 4XOIA 5FBQB 4HAYA 4H1UA 3CZPA 4S35A 5G41A 2L0XA 2UZ3A 4M1MA 4DZZA 1YR7A 1M34E 2QQEA 2ZRIA 2H7VA 3W9YA 3U44A 3QI2A 1IXZA 4D4KA 1KKMA 2B92A 4Q1EA 1KMQA 4MYUA 2IXGA 4P4TA 4PAOA 2JLQA 3SBDA 2QM8A 1EFRD 4MA4A 2VLIA 2DBYA 2VP9A 1G19A 3K70D 2FMXA 3RS4A 3DZDA 4GI7A 4KFSA 1BYUA 1ZUNB 3FKSD 5L3QA 3EA0A 2AD5A 3H4MA 2OEPA 4ZI3A 2QU8A 2HLDD 4RD6A 1NVVQ 4LJYA 1N0UA 3L0PA 4ZDJA 5KPJA 1NKTA 2WHXA 4XD7A 4U7DA 1E1QD 5FBRB 4WZAE 2OCPA 2VO1A 4QXAA 1GOTA 3QQ5A 2H57A 1ZINA 4KBGA 4OKSA 3QKUA 2BV3A 1MO6A 5JMTA 3LDAA 1YRBA 1J8MF 2QN6A 4Y0AA 2FWRA 5DN6D 2QPAA 2G1JA 1QG2A 3BFXA 3GJ8A 3NHBA 1DADA 1T0HB 2BDTA 4B44A 5KSYA 1F2UB 1JXMA
chains in the Genus database with same CATH superfamily
1KIAA 1UMBB 1VG8A 2OHJA 3Q87B 4QEZA 4CCAA 4E5SA 4R98A 3IXMA 3VO9A 4IZIA 3U4MA 1SZPA 2L2QA 2FJUA 2OUKA 3IV6A 3R3UA 1J24A 1ETHA 3OD5A 1IULA 4B5LA 3WQQA 4F6RA 4MPJA 4YP7A 3UC9A 5C8XA 1JQEA 4L15A 4DV2B 3CH7A 4NY1A 3SKXA 1AU9A 3IBCA 1GKKA 1NVKA 4G26A 3KHKA 3VVCA 4YCSA 2ZI4A 1V26A 3BWDD 4U7HA 3COJA 4YPOA 2BGTA 1HQYE 1OZGA 4DN6A 1ZJ4A 1WW8A 4XIFA 3BXHA 3PQDA 3RBVA 4JLSA 5K20A 5K0EA 1BS1A 1T43A 1EYZA 3R0JA 4Q4LA 4B4VA 5JJLA 1ZUHA 3AEQA 4IMIB 3C3XA 4RD2A 5JXIA 3LWZA 3UM9A 1NQ5A 1CUIA 4CHTA 3AR7A 4JBYA 2IUYA 3RHTA 4KP7A 1AH2A 3GUUA 2X0EA 4UM8B 1GGVA 1VJGA 2C0QA 1VJCA 5DSXA 1R8SA 1IJFA 1MG0A 2WIJA 2Y66A 5DXJA 3FVWA 5BOSB 3BCSA 2V7EA 4WK2B 4QLBA 3QFFA 4EFLA 4AG5A 3TRFA 2J3MA 3DTVA 3DZJA 1BA2A 5FNVF 3ZDYB 3E9ZA 1NDQA 1BEEA 3H13A 3LY8A 4M8IA 2FX3A 4JUCA 1HDEA 4B0PA 4D9EA 1TOAA 2QVZX 4CKWA 1E7RA 4YROA 2A1UB 3VU9B 2P3OA 3N9IA 2YJ4A 4KMOA 2IIBA 1UL1X 4M1TA 5EQFA 1NJGA 4M7RA 5JCPA 2B30A 5CK5A 4P82A 2WP0A 1VHLA 3RTDA 1RLUA 4R1SA 2YOGA 4DA9A 1SOMA 2B21A 4EEXA 4RH0A 2P30A 2Y2VA 4QLOA 3T7AA 2CNLA 1AD2A 3MA0A 2JEYA 1Y1KE 1TEXA 4NCNA 2BVNA 2QLBA 5JNVA 3K15A 3S0JA 3W9SA 1R5JA 1CJCA 2C5GA 3TRJA 2CDRA 2PMBA 4BFVA 1YMQA 6REQA 1CZNA 2D4HA 3FY4A 1P75A 3R0QA 2R8XA 3D7MA 2H17A 4UEOA 3R24A 2VBGA 3JWGA 4P0PB 4ZAZA 3NXSA 3KAQA 2Z58A 3KO8A 2I6QA 4JU8A 4A0FA 4B82A 1ONBA 4Q1VA 4BLPA 1QP8A 5I8WA 4QXOA 1XPOA 3NIBA 4FFBB 4WUVA 4H4EA 2JGFA 2LDXA 1WCXA 4ES6A 2VSOA 1S2NA 4Q4JA 5JR3A 3THYB 4ZOBA 4OBWA 4L76A 5JISA 1C30B 5DBFA 4LHZA 1JQJC 4OUDA 1Z8HA 1QF9A 3CXRA 1KK0A 3GJZA 2NSDA 4IX9A 4NBVA 1TLTA 1JBQA 3NO4A 1NURA 1LBHA 2ZYHA 1FDWA 1QAMA 3VR1A 3JRXA 1NWHA 4YWHA 1NVBA 4X0EA 1AOXA 5CFZA 4M6WA 3OU6A 2ACEA 4WGGA 3I6MA 4R5HA 5JAHA 1CUHA 3I62A 5LQAA 5KB3A 2OYCA 1DV2A 5L6LB 2HWYA 1R6BX 2CLIB 5EIAA 5E6UA 1S4QA 3RUPA 5B1HA 1V8ZA 3S3TA 2O52A 1VFNA 4PZEA 1YS7A 3P0HA 3M6WA 3E22B 4I8DA 1GLNA 5DOZA 2BJVA 3UH0A 3HLTA 4BX0A 1PE0A 4IOMA 4EUEA 3KT6A 4X8OA 3VX4A 2Q6VA 1RWBA 1G20E 1T0JB 2V45A 2ZRFA 4BO6A 3CKKA 5EXXA 4ZYXA 4LPSA 1RYFA 4BZZA 4RSHA 2NT4A 2WHPA 3MCZA 4U2DA 4UHFA 3IBYA 2GBLC 3RC7A 4A5OA 5ESWA 1GCOA 3OMXA 3RROA 4QELA 3Q2IA 3PPIA 1N2CE 2XB6A 3QLJA 4O0MA 1G8PA 1RWNA 1CY1A 4MIEA 5JD4A 2BCJQ 4B3BA 3TQCA 1QC5B 5K0NA 2HRZA 4J43A 5I7EA 3OFSA 5DN9A 3OZGA 3I58A 3I9OA 4HDNA 4YRTA 4YBRA 1Z0JA 2BGUA 3FWYA 3ZIDA 2OG2A 4BB5A 1J00A 3O92A 4F04A 3UHAA 4NOJA 3DZGA 4TLBA 4LWOA 2F43B 3DMFA 4HWGA 2I22A 3K96A 3Q0TA 1JIQA 4H6WA 4S1OA 2J59A 5LXTA 1YWGO 2NNWB 1K6JA 3AVOA 2HHJA 5HJ2A 2FU5C 3FUCA 5CTAA 3V1KA 3L8YA 3LF2A 2YS7A 3M6LA 4G25A 3QLVA 4PZ0A 5GM2A 1C3EA 2XEXA 2D5IA 4M1KA 3BWEA 1R0CA 2RK3A 3R44A 4RZ3A 2VHUA 4DCJA 5BOVA 3TMKA 3NEPX 4RCZA 4AG6A 5FPQA 1U3TA 5AK3A 1WF6A 2RARA 4OATA 4HVLA 2BDEA 2X4DA 3T7EA 3TZEA 1F4VA 1M6VB 3DFUA 3IALA 1VKHA 3OZSA 4RV9A 4PHGA 1CHDA 2X8JA 3NC1C 1O08A 2FPSA 4QG7A 4QREA 3CZRA 2QN2A 3AFGA 3BK7A 1RHMA 1NG9A 3HVJA 4KH0A 3SEQA 1UZUA 2ZTMA 4YEDA 3FOEC 2QT1A 2CLOB 2XMCA 1AS0A 1ORTA 3K0EA 5G4KA 3RTBA 4GVXA 3WKCA 3L49A 4BE7B 3EPPA 5CFQA 3KQLA 4RK0A 2R8YA 1TEZA 1BW9A 2GHQA 2WYIA 1FYEA 2W6QA 2DFTA 4A8JC 3QF4B 4W1QA 3P20A 1X9GA 2C3YA 3ZD7A 2OK8A 1RYNA 2P40A 1F60A 4OGFA 5EESA 4WFKA 1WMFA 1ZK3A 1Y8ZA 4KLCA 4X41A 3RRZA 2O8EA 2R68A 1IMJA 3KPVA 1LPAB 2BZSA 3LJKA 3R2JA 4FT2A 5IASA 4G0XA 3PQCA 5F3DA 1RPJA 2PXCA 4EKIA 4L16A 4BRSA 1HYHA 3NOOA 4BNNA 1CX9B 1TZCA 2AHRA 2ZFUA 1G9SA 5FTKA 4B6EA 2JBWA 2R2GA 4CIXA 1CV2A 2H0AA 4MHOA 3K70C 2EBFX 2NVBA 1I5RA 2X40A 4MRSA 2C59A 2WHEA 2G07A 2EGUA 1H85A 1WMDA 1YNSA 2HRDA 1U8TA 1UP4A 2CE2X 2X3UA 1ISRA 1DAHA 2ZYGA 1MOPA 4PYLA 4FTWA 4OA8A 4FYHA 1UDBA 2I2AA 2Q0QA 2GILA 4RKFA 5LR6A 1Y3HA 2C2XA 3W7AA 1PNVA 1H2AS 5A3JA 4A0RA 3ASUA 4Z9XA 3LXXA 5TXGA 1GNQA 3CRVA 4IG4A 4MW0A 1NVEA 3C74A 1KH1A 4EYOA 1TVKA 4B48A 1DEAA 1ICEA 3BA1A 1ESDA 2FVXA 1M2NA 3R5JA 4E09A 2XZTA 3H42B 3UENA 1BC5A 3TTXA 4BLOA 2BEVA 5K0GA 3OTHA 1S8AA 2WU3A 5JJIA 4UVHA 221PA 4YT8A 3Q5EA 4LTMA 1FTSA 2ODTX 1M2OB 2BTOA 2FFHA 2ZRLA 3BK1A 3FDZA 3U7QA 3ZHXA 4R8LA 1T8UA 4KITB 3FX2A 3KEOA 1QRDA 1QRAA 4JS0A 4KR0A 5J40A 3ACDA 4KOEC 1ISHA 3Q8KA 2MTBA 1F0PA 1LLCA 1XCLA 4FHFA 3U9LA 1JA0A 1GM5A 3BD7A 4C4TA 4IINA 5FTNA 3TJZA 5HKLA 2NU8A 5MF6A 4RWZA 1O94A 2B36A 2JFBA 1J5XA 1V7CA 1A8UA 4A8JA 2HJHA 4IDNA 2G82A 4IGEA 3SK0A 2WICA 4F2WA 3SJ7A 1N32B 5EIWA 3GDGA 1J21A 3WP1B 2NSHA 4RABA 4XQ0A 4NMXB 1PS8A 1KU0A 1AQYA 1NWCA 3QVOA 4IRXA 3T3OA 2ZVPX 3BFJA 3LBIA 4UPDA 3H7AA 3IHKA 4F7WA 2XKKA 1QDUA 5JPCA 1I7QB 3ADKA 1AGNA 3MB5A 1VSBA 4ZJYA 1OI2A 1C7RA 2RC5A 1RAGA 1Q0PA 2W2VA 2Z3ZA 2OZPA 3LUFA 4KIWA 4MVXA 1N92A 4NZZA 4B6PA 1SY7A 2NUTB 1U02A 2OZLA 1UPCA 3HJCA 3MOGA 3RVBA 4UBLA 3ERCA 2G0NA 1W94A 2IZZA 4FQ5A 3FKSA 2D3WA 5K0BA 4OF4A 5DSTA 4D74A 2HLDA 3I0MA 4LEIA 4U39A 5ENZA 3KFVA 1WEHA 3JQFA 3MCWA 3QQPA 4A8TA 4C4OA 3GQVA 1QGOA 4FYPA 3VV3A 3F73A 2VH5R 3WL8A 2ERXA 3EH1A 2J7KA 4FWBA 4P9NA 1IYZA 1N8NA 1Q50A 3U44B 1T0BA 1OI4A 1E5DA 3JQQA 2NPOA 3U4AA 1TVCA 4CUZA 1N6NA 2R25B 3BGOS 4DBVO 3QE2A 1NYRA 2YWHA 3I73A 4IJUA 5HF9A 5CXQA 5AVWA 2P2SA 3S8MA 4QKQA 2HX1A 1P73A 3DKVA 3MJRA 1WOMA 1SQFA 3F6RA 5AK5A 5FPYA 5G1PA 5H9VA 4ZVKA 2ZIAA 2UYGA 1I36A 5F1KA 4HO1X 1N9KA 4Z8YA 5AHKA 4E46A 1J2TA 1QHFA 1H6CA 1RYBA 2IH5A 3KWMA 3C6ZA 1M6WA 3AL0C 2Z5VA 1XKQA 1U63A 1JSXA 1UUFA 3ONVA 4E7OA 4GI2A 4J0JA 4GIBA 2G9ZA 4ZJPA 4JUDX 4R2IA 3QPAA 4JC0A 5EWMA 2A7XA 4JYCA 3S1AB 1HE3A 3LHKA 4NHEA 1YMVA 4XEUA 2FUEA 3OPXA 3I0NA 4IDDA 4BWGA 5HS4A 4CFSA 3KKLA 2P5UA 3E7WA 1ZMBA 1IL0A 4JD5A 1HSZA 1I2CA 2D5AA 4F5ZA 4X63A 3Q7EA 3CLTD 4MVJP 3WOHA 4PYRA 2OCGA 4N18A 5LB4A 2C3UA 1O2DA 2H7YA 5JS2A 4E2ZA 3IBFA 1P29A 4JOCA 1D2HA 5AK6A 1MGPA 4WOBA 4N5HX 2PEZA 5FTLA 2H11A 1E2GA 4JJ6A 5LMUB 3HNOA 4MUXA 5TY0A 1MGOA 3RU9A 2PGNA 5KS2A 3D5TA 1SXGA 4PC7A 2PIAA 1DG1G 4RDXA 4DG9A 5CXSA 1SUDA 2KS6A 1E4OA 1TECE 4ZOCA 5EZ6B 4E08A 4KLRA 5AQEA 2E82A 2KE5A 1ECJA 5B1IA 1SVNA 2G5TA 4Q39A 5HJ5A 2DQ4A 1QGUB 4TUYB 5ALYA 4L07A 5I8ZA 4D9GA 1DAMA 1SVSA 2IPLA 4AD8A 2YWGA 1XPJA 1JLMA 1P5JA 3DOEA 3L43A 3MN1A 5AWFC 5ITSA 5KWEA 5E2IA 1NDUA 2CYBA 1NJ8A 1RYDA 2VZLA 3CX6A 3LBHA 3LWNA 4JELA 5CK4A 4CU5A 1FJXA 1P4GA 3WAKA 1C8KA 2IYQA 4L73A 2X7XA 5HQJA 5BQXA 5IBCA 1RRVA 2ZJ0A 4UBNA 2JK0A 4DCUA 5LWQA 1P7WA 2V1XA 2VA9A 1QX3A 3OF2A 5HIKA 5EP2A 2QMZA 3DOHA 1N3BA 3SXUA 3T0IA 4AJLA 5K1ZA 3W1WA 4QU0A 4EKNB 4C06A 3O95A 2GBPA 1ZU4A 5K3OA 1TJPB 3PVZA 2FW6A 4DM7A 1QPGA 5DW3A 1KHTA 2Z2YA 3H86A 1U65A 2G67A 2HMAA 1VLMA 4PHTA 2I6SA 3OVMA 4RXMA 1U7OA 1MH1A 4W7IA 3SEAA 4KYTA 3V8EA 5JYBA 3D6MA 3GA0A 5A7GA 2X2PA 3NI2A 1YONA 2VPYA 3KKMA 4LW8A 5ARDA 3W5DA 4NSNA 3G59A 5CRIA 3L4JA 2WD7A 2IHZA 4XYLA 1AKEA 5AI4A 1GCAA 2BEUB 3FPEA 3MJEA 3PHGA 2YHAA 2F7SA 2FRDC 4KQKA 4DIEA 3KAPA 1L7RA 3FPFA 3LDFA 3NHZA 4MVJF 4LJ9A 3TR6A 2FSIA 4U6QA 3EIHA 2CL0X 2V9PA 2W6IA 2EZ4A 2LPMA 2OM6A 2ADFA 5CG1A 1H0HA 1JPUA 2ADOA 3RTCA 4DGQA 3OICA 1K4KA 4BZWA 4D45A 3RIEA 1ZUNA 4BXOA 4PX3A 3E1KA 1IB0A 3A26A 5FBZA 2RHCA 3H7IA 2HRCA 3AO0B 4D0RA 2FMTA 4M89A 2VPPA 3GT0A 4UTZA 5DT2A 3TZLA 4NJOA 5JZOA 1ZJYA 2X3FA 3LGAA 3BHNA 4ZYWA 3U4QB 4EG4A 3AJ9A 2C2ZA 4JNKA 3T5DA 1L5HB 1X3SA 1DIOB 1WSBA 2C1ZA 1MEJA 1WHTA 3HV0A 4MCJA 2VF8A 4K1LA 3EFBA 4YJDA 4RMJA 3DTNA 3O0DA 2FPKA 1Z2CA 3HA7A 4CDNA 3MUEA 2WU1A 2R6AA 2P2ZA 2OHHA 2QA5A 5D3MB 2I7XA 1DKOA 4YX9A 1NHWA 2LUOA 5HIAA 1U94A 2R6JA 3OY2A 2WHQA 2GM9A 3NW9A 3MILA 1ZX1A 3VO2A 5JZVA 1VLZA 2H59A 3GXOA 5K51A 2IXDA 1HLDA 1PNTA 1PR9A 3VKUA 4Y6QA 1CY4A 5CHYA 5CB0A 2QTZA 4O2BB 4ARSA 1EUZA 1HL7A 1TM1E 1LK5A 1JN0A 4LE0A 4YY3B 1N1DA 4E7PA 3EOBI 1D5CA 3BXZA 4CLEA 4Q15A 4WTOA 3WLOA 1PJRA 2BHTA 2JIZD 3R0XA 4J0CA 4X97A 4XQGA 3V8BA 2UYQA 3ZZ0A 3O8OA 3A2NA 1EHCA 2GF9A 3JSAA 3EVDA 1FYDA 3ABRB 4MV8A 4Z7NB 3QYAA 4E0BA 3FOBA 2A1IA 2YMPA 2ZAYA 4WEQA 3VTZA 1QQBA 3INNA 4TSFA 4WAUA 4EDHA 1QOPB 2FRDA 3KBOA 2GD6A 2H85A 4ENTA 1THZA 2XMPA 3P9PA 2GJ8A 3AEZA 2O2IA 5A06A 1PDOA 3PHCA 1OHHD 3LGSA 5KUTA 4DE5A 2XNDA 4MB6A 2AG6A 4WT7A 3AV0B 3X1WA 5K8JB 3K71B 2C7PA 2R1VB 1P5FA 4FDVA 4L6CA 1L4HA 2ZRQA 3CNOA 3P97A 3C5WP 3IPYA 1Y9DA 4B2IA 4NS1A 1GSOA 4Z4QA 2ZYUX 2OO3A 3GVXA 4CM4A 3ZHRA 1U3WA 1JFSA 3QFHA 2V97A 3EAGA 3HSYA 1RC8A 1TYCA 5LQJA 4Z86A 1KI6B 1Q2XA 1M72A 3EG9B 4RX1A 2OO5C 2ZVQX 3ORHA 4WY5A 4TXLA 1Z33A 3WQHA 2QPLA 4N3AA 3A31A 4PNHA 4L5CA 3B53X 5FQOA 5BN4A 1L3IA 2A57A 1JEYA 2IEAA 1N57A 4HPWA 3WGYA 2R1TB 1SMKA 3GFRA 3LCRA 3U4GA 3PFNA 1AKQA 4B2LA 1DJOA 1EVKA 1ZJ5A 1IPFA 5G0WA 2X6TA 4KXMA 4YI5A 4EM6A 2JBAB 3ADPA 5LCXA 5KDDA 4MRNA 4ZT7A 1CNFA 3MWEA 2IOFA 2WTXA 1RW4A 4MV1A 2Z98A 4HMPA 1A77A 2HJSA 4L85A 3BM5A 1A72A 4MP8A 1FBTA 4RXUA 5DM1A 3WLEA 4B43A 2WD9A 4COKA 5K03A 2ZUSA 2QGNA 3PC4A 2MSEB 4GZ6A 1YZTA 3VPFA 4BQFA 4B7AA 4LVOA 1VXRA 3DMYA 1MABB 2VSQA 2XXJA 1O6BA 1X13A 2YVKA 5DHFA 4ZVUA 4M1ZA 5C18A 5ALZA 3MQFA 2ZAMA 4NV3A 3HCCA 2W70A 1C7IA 3M1LA 5E38A 1PLKA 4EAQA 3LLSA 4DEXA 3IA2A 2C7BA 1R4MA 3N5CA 3OURA 2HIMA 1U3VA 4JGBA 3O8QA 4J0DA 2W6JA 1XQVA 5BN3A 4JSTA 2I9KA 4Q05A 3NH9A 4UDYX 2ZT6A 4GR4A 3C6QA 1W8DA 4KH1A 3KOMA 3K0AB 3SJCA 2X0RA 3AI2A 3SMQA 4KE8A 1FXSA 2K2WA 4X85A 4XX0A 1JWLA 5CJJA 4BAUA 5AKEA 1CEYA 3ZU4A 3C87A 1UOEA 2NSJA 1AZWA 2QN1A 4P83A 5K99A 1U7DA 4AZ0B 2XA2A 3AIIA 2BYTA 2HBRA 2AMJA 1K8ZB 2HA5A 4U0JA 2XADA 2DFNA 2OO5A 2F3QA 2FVYA 4G0NA 4MB2A 3WBFA 3IKLA 4ZVOA 4DNXA 3IXLA 3I32A 4KXYA 4ZRMA 3U4CA 5AVQA 3EXHC 3RFTA 3K73O 1FNMA 2EJBA 2L17A 1ZUD1 1UIRA 4JJ8A 4TWAA 2IYPA 3NHAA 1WJGA 4NU8X 4RVDA 1PW7A 1KTVA 2BD0A 2Q6KA 3CF4A 3ENWA 2JHFA 3M3PA 2CUNA 4Y6SA 5ALDA 1Z2NX 3RC1A 1XDDA 2E6KA 4DB2A 2HQ1A 3UOAB 1F12A 1KAGA 2M1XA 2D4AA 1WDKA 1THGA 2DKNA 3ADCA 5CFLA 2QD5A 2R7KA 2P5TB 2VTKA 1R6TA 3L46A 2WIAA 1X7HA 4GX2A 2A0KA 3JD2A 1IN7A 4I1IA 2ZYIA 4KO2S 4XKJA 4BUJA 2GAOA 4DY6A 2XAAA 3PJDA 3PDJA 5BW8A 5DYGA 2ONKA 4PYOA 3W2IA 1AGRA 1YQGA 5DOVA 1USVA 4D3FA 3VM6A 4GI5A 4J1QA 3MJCA 4LXHA 1M67A 2W2KB 2J6CA 3F90A 3I9MA 1IHXA 1I4OA 2JDIA 4M86A 1IEVA 1XK6A 3BN3A 1EVIA 4D97A 4RAQA 3FYCA 2ON6A 1GTRA 4MVJH 2EJWA 2FX5A 2ZPUA 3PKJA 1UBRS 1W19A 1ZS9A 2Z4RA 3FCXA 4NH4A 4PPQA 1APBA 1DJPA 2JFNA 2JFOA 1Y9EA 3LNCA 4DLUA 3ZHZA 5CDYA 1O95D 4RTNA 2B69A 1VHDA 2POCA 4DR2B 2ZWAA 3KD3A 4UAGA 2NZVG 1IY8A 3KAJA 3NNDA 2Q1WA 4V0MA 4YJGA 4ND4A 2YCBA 2CKDA 3C8HA 5D7NA 5AK0A 5SZHB 4JEMA 1GL6A 1DO0A 2AXQA 2DHEA 5LLDA 1U2PA 4WZBE 1DBSA 4N8EA 1ZN8A 2NT3A 3I23A 4IIJB 4QX6A 3NM6B 1XAHA 1URPA 1Y7PA 2X19A 2OGZA 2XOKA 3P9XA 3UMFA 2DR3A 3IIEA 5AVJA 1HGXA 3ZV5A 4JUAA 5KHOC 3SZMA 4A1FA 4GS5A 1IN1A 4IQGA 3ZHVA 5C31A 4DARA 4O2BF 1RMTA 4XIIA 4YQZA 3CNNA 2WJZB 3KDAA 3FFAA 1XDGA 1NC3A 1DBQA 3PLRA 4GXQA 4BO1A 4OQLA 4H1VA 1ZCZA 4DNQA 3OLVA 4JJ4A 4PXYA 3P9ZA 3Q3JB 1Z0DA 1X7WA 4XWWA 2IE0A 1A7JA 5ELLA 2ZBRA 4MZXA 2HRQA 3T61A 4FLFA 4XR4A 1C50A 1XYVA 1E3SA 3EXIA 5LYJA 3DWFA 3REFA 4QT4A 1H9CA 3HWRA 1DU4A 4W4TA 4BNFA 5JV5A 4GOOD 4C2BA 5HUQA 5K0CA 1ULUA 4CM7A 2W6PA 3DV2A 2YY7A 3AONB 2I91A 2HR1A 2FOXA 2XSZA 2FWNA 4C2TA 2GPJA 4YRQA 1UK7A 1ZL0A 2OBFA 4KFUA 3ZQKA 3PXDA 1LA2A 4CV0A 5B64A 2CVZA 1Z88A 2XUQA 2BBTA 5LZ2A 1NBAA 1D04A 1VZ2A 2YR0A 4Y8VA 4DZRA 5AW3A 3JATA 1SC6A 3BHIA 4XIGS 4CLRB 5K7SA 3DPSA 1FDUA 1KQ3A 1L5GB 3KU4A 1BGXT 1NULA 3SF0A 1P31A 2CKMA 2PYZA 4C6HA 2XGSA 4KPUA 4C22A 2NO1A 3A7DA 3WYBA 2XZOA 3CVJA 3OZWA 1B8OA 4I50A 4JWKA 4QJIA 1QG4A 2WE7A 4HDMB 3VR3A 1ZM7A 1TT5A 3IMEA 4V39A 2CNWA 1PZEA 3RYFB 1QO0A 3F6BX 1XGKA 5JASA 2H1OA 3D1VA 2PFKA 3UG6A 1X80A 2VCHA 1QK3A 5TB5A 1JRLA 1G8HA 3EYWA 3TIVA 5L4NA 1GRVA 1JEQB 1SCNE 4MKRA 1E2UA 1H2YA 2IT1A 3ESQA 3VPSA 3ZW8A 3V8VA 6GPBA 1LQTA 3PEUA 4BMXA 3DBHA 2ZIXB 3EZFA 5FP0A 3T5BA 2GM4A 3BTVA 1L7DA 2HU2A 2R79A 1UXHA 1D4AA 1KNXA 3NHYA 2X4IA 3DGFC 3SZRA 4DIBA 3NJ8A 2V3VA 2HQOA 1NN0A 1U1FA 2BHNA 2IP4A 4K3UA 4E13A 1EDEA 1V0JA 2HV8A 3EOAI 2HNBA 5C8DA 3I8SA 5HEKA 3DFZA 3FZYA 4PLTA 4UMEA 4AP5A 3OT5A 3ZWBA 1GQRA 1ECFA 4RTQA 3RBAA 1JSZA 2LV8A 2IUSA 5F76A 4RC9A 2CXPA 1KEVA 1XJQA 2ZRAA 4B8YA 3SHTA 4M55A 3ICVA 1F1JA 3CLRD 3H75A 5ECWA 5L9AA 4NE9A 2JIBA 1MW8X 1MOZA 1DFHA 1G6HA 1OYVA 3QTLA 2A5DA 4J07A 2HWKA 1KI8A 1QANA 3MC1A 3K8ZA 1UMCB 1DG3A 4ACBA 4Y0VA 5C8VA 2ZM5A 1N2SA 2ZB3A 3RASA 3HWX1 2PWAA 2PXXA 3P19A 3K6RA 3PFBA 4L9RA 3OQ1A 4TQ9A 5GJBA 1CRWG 2C03A 1WCYA 4QXQA 4AYWA 2PYDA 3PP8A 1KDRA 1TLLA 2JZNA 2G6TA 2HPZA 2H0QA 2IPNA 3GA7A 1L6IA 3L82B 3LCUA 4C1BA 2DWCA 4ZCPA 4C1NA 4H0FA 1YXMA 3GAMA 1CR1A 3A9SA 3HN2A 2GM3A 5MFPA 1V2HE 2WWGA 3BWXA 1NFRA 2H5EA 3IEVA 3SXPA 5BNTA 4BNIA 3WV4A 3KJNA 3IR6A 4UUMA 3TNLA 2FE1A 4EABA 2HMTA 3GHYA 5EE5B 4GH5A 3IPRA 1A7KA 3SWWA 5A9SA 1XRQA 5F9HA 5F51A 3JQRA 3B3JA 5ICMA 4I5IA 2ZVJA 3GAZA 2XV1A 5EQDA 3D3WB 4JYAB 2BC9A 1CVLA 4HAWA 5KCMA 4G24A 5FUQA 5HSGA 2QSJA 3CW9A 4FONA 3HLYA 3AYXB 3OE4A 3B3GA 1OUMA 1YC2A 4AICA 5HF5A 2PSEA 2H5JA 4GI3A 4BNUA 1PL6A 2OCAA 3KK0A 4F0JA 1ULSA 4OLAA 2HCFA 2VHCA 4MVJG 3QJYA 1C41A 1MCZA 1O6ZA 2MIIA 3KD2A 3R3SA 5IXYA 5JXWA 5BR1A 1K1EA 4ISCA 4ZZ2A 5CG2A 3QSYA 2C2WA 3T1TA 3JR7A 1GPJA 1W0JA 2YTZA 2Z9BA 2GN8A 3IAS1 3MVEA 3MTEA 4K9OA 3QG5A 2ZREA 5EGNA 1A9XB 1LK0A 3G9UA 1GZSA 4M21A 1Z2AA 1DQSA 2MMGA 3E05A 2NU7A 3AEYA 3UHFA 1R0WA 2VZEA 3ZV7A 1UOOA 4Z3KA 3J7AC 3T4EA 4TKMA 4TPKA 4U2BA 4ZT5A 3NOXA 3WK6A 1ST3A 3PWZA 3E1GA 3VC2A 3S44A 4N9WA 1XZFA 4YJFB 3P9KA 2W8ZA 3VZQA 2YHIB 3MT8A 4D3ZA 4BB0A 2QDKA 1X14A 4JGIA 4WLVA 2MSKA 4L8LA 3THRA 4MUMA 4RE5A 1ZNXA 3TAHA 3U7GA 4UM9B 2R8BA 4LJRA 2BHRA 4BNXA 1WSDA 1YUMA 1T3ZA 2C2BA 1KEWA 1PR2A 4I08A 3ZWNA 5IPFA 1CT9A 1P17A 5J47A 1OBVA 4WPGA 3DMDA 3N2NA 4WA7A 3Q1LA 5BXQC 2GXSA 2F8MA 1Z5UA 4KJZA 4IXMA 1I5EA 2D1FA 2DF8A 1GEEA 2OXCA 3C3CA 2B1JA 3MFYA 3OF3A 3QLTA 4LGCA 5DCLA 3C7AA 3ECAA 2G6BA 3QBEA 3AW9A 2C54A 5TF4A 4MR7B 2VUHB 2NTEA 2CNDA 3B89A 3OZUA 3W78A 4Z4EA 4RZIA 1XWFA 1KZ1A 1QJ4A 1U2EA 3A3PA 1K7SN 5JCOA 3WK7A 5C4MA 1JDZA 4RPHA 1E4EB 1LTKA 5AW9A 3E5NA 4QDTA 4QFDA 4BASA 3H1BA 3UTCA 1OX5A 4PBSA 3AEXA 5EUQB 4DB4A 3QXCA 3SKVA 1SCUB 2XEDA 1XXHB 3B1JA 4OP1A 3WYGA 3M8KA 3E1SA 4UTRA 4I4NA 5E0KB 5B1DA 1E7WA 2PKXA 2R87A 3CSSA 1W34A 1EA5A 4JA0A 4IXNA 4AJ9A 1H8HD 1KQPA 1LW6E 1Y1RA 2E4UA 2NXWA 2WM2A 3OM8A 3WMGA 3U6BA 4HWKA 1OASA 3SEFA 4CM1A 2EFDB 5KNCD 2YQ4A 1RAFA 3RC8A 1WB6A 2GQ0A 2V03A 1L4KA 4PLHA 1YIOA 1VCOA 3QBDA 2CJFA 1TZBA 2PM8A 5KSOA 1UKCA 1UANA 4DXDA 1GU0A 2FUNB 4EEKA 3ZUPA 2CJPA 1KO1A 3FOCA 1ZZEA 2OLKA 4KRXA 3I04M 4CUJA 4WMLA 1QYXA 4L0CA 1YR6A 1T4CA 3JQ6A 3OE7A 4UMDA 4CRWB 5EIBD 2IBSA 3L7OA 3NV9A 4KREA 1D6NA 3VR2A 4NCJA 2Y6UA 1ZICA 3SQXA 1RBQA 3U62A 1ODKA 2DM6A 5IDVA 3MXOA 1KQOA 1YDFA 3ZVKA 3V97A 4L3WA 1BX3A 4MITA 1XT6A 2QXTA 1HETA 3NEYA 3K5PA 3QWFA 1T3HA 1Z4OA 3BMXA 4NCHA 4RZSA 4IMPA 1JYSA 4U5XA 1VKJA 4ARZA 2BI4A 5B2ZA 3AL2A 1E1QA 2WU4A 1YOVB 2GRUA 5EJ6A 3C6YA 4HNQA 4LZOA 1OLOA 1QZZA 1FQWA 1XV5A 3T41A 2VH1A 3ZDBA 4HLQB 2NSLA 3WZMA 2O50A 2PX5A 1MNQA 2AQHA 2V3WA 3EHDA 2AN5A 1JZQA 1FMLA 3B70A 3VNSA 4B09A 1VPLA 4W1RA 3UOGA 2BUAA 4YRKA 4XM2A 4X1YB 4JZKA 1S6YA 2B25A 2VJNA 5DMXA 5FLEX 3SHWA 1P0CA 2X9GA 1EQ2A 3KEFA 1I13A 3UN1A 1NNUA 1YFLA 1IHUA 1L4FA 2C9MA 5KSWB 4QODA 3D9QX 4B2PA 3GI1A 3L6RA 4JLMA 4LFBB 2X9LA 4Y6PA 3EQZA 3TXXA 3INYA 1IXKA 2YBEA 3BWVA 1QFJA 1X2EA 1XMPA 4IEFB 4UKDA 3K9NA 5ECGC 4AY6A 3QEKA 4DR1B 3O8DA 3ADDA 4HB2A 3CONA 5MGBA 3R9XB 2CMKA 1BNCA 3PJFA 3D6VA 2WM8A 1YCGA 5AJYA 1BVYF 4P4GA 3WNDA 1WBJB 4GE0A 3NWBA 3RAGA 3JQ7A 1XNGA 4IDBA 1L9KA 2P77A 2YXLA 3FRIA 1L5NA 4BYMA 4E12A 1JHOA 1FMJA 4GUAA 3K0SA 3O1JC 4QPNA 2HXGA 3OHSX 1ESZA 3U7FB 1MP0A 1E66A 3CNBA 4FMCB 3PG5A 4OU4A 4Q9JA 4YJ3A 4QYXA 1PWYE 3TJMA 4Z54A 1P9OA 4R31A 3AERA 3HHEA 1GDTA 4I2VA 3DEIA 4CUKA 1G64A 3BB4A 4M37A 2IBMA 1MD9A 3PXGA 3DTTA 4V24A 4IKEA 1WCIA 1YVRA 5GONA 1N6KA 2XA9A 4OOFA 4MCHA 1BMDA 3JRWA 4U7GA 4X91A 3JAMA 4ZIRB 2H2IA 5K6TA 5IJ0B 4M1YA 4MI1A 5C1BA 3FPKA 3H1PA 1L8AA 1Z5OA 5L4LA 5AICA 2HFKA 3VHXA 1NBME 4BO4A 1BOFA 1XA0A 1K5HA 4FQ8A 3CUVA 1G8YA 3E15A 5KJ1A 5LPNA 4LY6A 3DYVA 4B3MB 1QBGA 1FP7A 2CFRA 1QQ5A 3R5SA 4AX8A 3FMGA 4INPA 2LBPA 3X1ZA 1G2QA 5LQKA 5FBLB 3G0GA 16PKA 1I2MA 5TQ0B 4B6OA 1IM2A 4QXPA 1M7GA 4AUNA 4BQPA 1R7RA 3AUAA 4JBXA 5ALQA 3FIJA 4QPZA 5JCXA 1ECBA 1ZJWA 5FH9A 1D1QA 3OZCA 5FPTA 1IVNA 4FMBB 4TN1A 2I4MA 1BFKA 3GLHA 4UDXX 3G79A 4CTKA 1WKCA 3WS7A 4M4SA 1HFJA 2HCBA 3HUDA 4MYDA 4HH1A 4OI2A 4MKFA 5J58A 1WO8A 4N48A 3VAYA 1JP7A 2W6CX 4HYYA 1QR2A 1O54A 4I3FA 2DBZA 4MPTA 2BJHA 2FZVA 4JOBA 4KTTE 3KYCA 3USZA 4DJTA 1EK2A 1JFVA 2FCRA 2P6PA 4GPIB 4TMWA 3MINB 2ZCVA 1V3TA 2ZOSA 2EFYA 3KU1A 2QE7A 5DRYA 1YJ5A 4DSUA 4DQVA 2FW0A 1XE3A 5BP7A 1T29A 5AOVA 3VZCA 1R37A 1S1MA 3O73A 4EF6A 5KWJA 3EG5A 4KQIA 1OAKA 3ZLJA 4FZ5A 5AK4A 5B6IA 2GEBA 1ZXXA 5F7ZA 1UFQA 4GOJA 1KAQA 1QVAA 1AK2A 3H5TA 2C8LA 4OCZA 3JX9A 3MWJA 4F3TA 4TV8A 3BICA 5AKXA 1R8YA 1Q0HA 4MYSA 2GBCA 4OQ4A 3VKWA 4CJXA 5B4TA 3GXBA 1XU9A 4HTFB 4M83A 4QRDA 2J9FA 2OZEA 2WT4A 3TM5A 3W05A 1RQRA 2PJZA 3FCCA 3I2YX 3NHWA 4K3VA 5TEWA 1T9KA 1QB7A 1XRMA 4B6FA 3DOJA 2QMQA 5E7QA 1A9PA 4HAIA 4CLHA 2OO7A 2JRLA 2ZSKA 3VA7A 3QXJA 3CTPA 4LQLA 1G7SA 1YKGA 4C07A 5LFAA 2G71A 4JB3A 3ELWA 4PTYA 4BJHB 5TEVA 1KI1A 1BZYA 1OV4A 2FXIA 3PQ2A 4NPAA 5AKYA 5B3AA 3DXZA 9LDTA 3BOSA 3FPSA 1N4AA 4IHJA 2R6DA 3Q7QA 1Z37A 1NR7A 2HJVA 2J46A 4BFYA 3CN9A 2ZRDA 1AXEA 4JLDA 4K88A 1IY1A 1DKMA 4I8XA 1WEKA 1M8PA 3ZXYA 5CM9C 1LLDA 2M2IA 2X41A 1CHNA 2RHLA 5J9FA 1GARA 1KJZA 1CF4A 2OHOA 3KSRA 1RCTE 2CL5A 5ALNA 4HWPA 4A10A 2QRMA 2I4LA 5DH9A 2N75A 2RI0A 3VYSB 3PB3A 3KVRA 1M2VB 2QU7A 3GN1A 3PFWO 1R8JA 4OV6B 4TRMA 4ZHSA 3DLCA 1TQ2A 1IC6A 5A4AA 4Y6LA 1KVRA 1ZR2A 3VKFA 4NARA 1GSIA 1NW8A 4OMCA 5EZYB 4A2QA 5C8YB 4IIVA 4LSGA 3G85A 5BWNA 3M5DA 5B2EA 1CQWA 1TCAA 4LBWA 2CV0A 3GFBA 4Q3AA 1EQUA 2BEJA 1GR1A 4XCXA 1EA7A 2LW7A 1B7GO 1GPH1 1JE0A 1ARZA 4P4SB 5I7OA 2PN1A 1TVMA 2ZE7A 4PXSA 2WYOA 3GEIA 4HVCA 1T0PA 2HNAA 3ETJA 5FOWA 5B4UA 1GO2A 1UAAA 5LP6C 4PE5B 1VYVA 1RXEA 3VPHA 2H9IA 4NEQA 3WGQA 3WSVA 3KJZA 4XVUA 1LFDB 2ZSJA 3FGOA 4QRIA 2PX4A 4DCTA 1O4VA 4G5OA 1T9AA 3AUFA 2LTAA 1W6UA 3H2ZA 9GPBA 3A14A 3NKLA 2AMLA 4TXJA 4LZPA 4W63A 2Q7DA 3SHVA 3SSMA 4AKIA 3F5DA 4K9SA 4R1QA 3UJ8A 1CC1S 1DC6A 1QSGA 1MB0A 2FG5A 1LDYA 3EODA 1DJNA 2QN9A