5SZIA

Structure of human rab8a in complex with the bmerb domain of mical-cl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
174
Chain Sequence
b'KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
molecule tags Endocytosis
source organism Homo sapiens
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
total genus 46
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5sziA00
1AS3A 2IYWA 4GT1A 5KUTA 5CJPA 1IXZA 2ZRIA 5EP2A 4OL0A 2GXQA 2ONJA 1M7HA 3SE0A 3W9YA 2PJRA 4WZAE 4UNNA 1NMXA 1RJ9A 2V1UA 5E7IA 1MABB 3EIQA 1ZAKA 4OQNA 1KZ7B 2JJ1D 4EFNA 3DMNA 1VYTA 4V0OA 4YMVA 2R44A 3B1ZA 2ZU6A 3MWJA 3QNUA 1YE8A 3BIFA 4NHOA 1QHSA 2FH5B 2WM9B 3QPVA 2C98A 3B6EA 3KXIA 2PEYA 2YOFA 2IYRA 2WJVA 4ESHA 5IRCD 4LDJA 5ANRB 1YZQA 1XEXB 2O8DB 2FFAA 3AF0A 3TVDA 1EESA 4GZLA 3KKMA 4A15A 4EKDA 3DDCA 4LHVA 1F2UA 3KFXA 4XVQA 1XJCA 2GETA 3IEUA 4DCVA 4BFYA 2NZ8A 2ZJ2A 1U9IC 1CJKC 4BECA 4PC2A 1XD2A 3LDAA 1J99A 4KFUA 1TX4B 4DCTA 4DLRA 5CB8A 4NCIA 4HB2A 4G1UC 4JBYA 1SVOA 5TMPA 5LB4A 3DL0A 3FMIA 4M0LA 3SOPA 3R8CA 3KL4A 2IXEA 2ZR0A 2BWJA 1FUUA 3RSOA 3K9GA 1J2JA 4LV6A 2B92A 4OQFA 3NEJA 1AK2A 4YMUA 1XXHB 2J41A 1TADA 4OI4A 2ZI6A 3PFIA 4BFZA 4QGHA 1E9DA 1P9NA 3PXGA 3GLFE 2YC4C 4JKYA 3CX8A 3BC1A 2QUZA 3L8ZA 2WJJA 2WVJA 5DHAA 2G0TA 2BMJA 2CK3A 2OAQ1 2X2FA 4CVNA 5BQ5A 3FMPB 3ASYA 2QN6A 5CK5A 4LBVA 4V03A 4GBMA 5CIQA 3IGFA 1S3GA 4B47A 4NYMQ 5L3SB 2YKGA 4DLWA 4CGZA 4OYHA 1M34E 3Q72A 1GDDA 4Q48A 5TARA 4F93B 1RRCA 2FEOA 1RJ9B 3RS7A 4MRNA 3DOEA 3C15C 3X1ZA 1XJQA 3HP1A 1KK1A 1AJEA 2JJ8A 4C2TA 1GRQA 3SBDA 2ANBA 1MKYA 3Q3JB 3ZDQA 1YZLA 1ZD8A 4CF7A 5FBWB 1MH1A 4BEJA 3U6BA 3R9XA 1XMSA 3CZQA 2NPIA 3F8TA 5JZVA 4AG5A 1YQTA 2C5LA 2GCOB 1RPZA 1Q3TA 1EX7A 2H8KA 5CYPA 3CZPA 4TT3D 3W6PA 3PUWA 5FH9A 4A36A 1TEVA 2X19A 4D82A 1P60A 1T91A 3LLMA 4C0AC 3W5IA 1Q57A 3GMTA 1GRNA 3SNHA 3N2IA 2ZS7A 3WRXC 5HKKA 4OI0A 1G6OA 2HJGA 1E79A 3B1WA 4DSTA 1JR6A 1Y63A 1OH5A 5FTKA 5AUOB 3IBGA 1D9XA 2QP9X 4HEJA 2VP6A 4JT2A 3DZDA 1I4LD 2FEMA 2PX3A 3B5JA 4N1AA 5JCZA 4B3FX 2V6JA 3QIAA 4V0LA 2QT0A 5AUNB 1WP9A 821PA 1XTSA 1Z47A 4V02A 5E95A 2LWIA 1OH7A 4LX0A 5JEDA 2VP5A 4Q4HB 4AI6A 4ZDWA 1KI7A 1W0KA 1II8A 4P3YA 1BOFA 2IHBA 5JHHB 3CKLA 2P2LA 1ETUA 1PJRA 4W5HA 1AQYA 3CX6A 1AQUA 3A1VA 1RE0A 2BCJQ 1DO0A 4OHVA 2FGJA 4DHEA 2EWVA 5HCNA 4QBIA 2D2FA 3IEVA 4B34A 3ZZTA 2JJ2A 1XJ0A 2ZRAA 5F9FA 3B85A 3I8SA 2J7PD 2OBLA 3ADCA 4EPRA 4LBWA 2JLUA 2O8CA 3VMFA 3T61A 5DGXA 5GVSA 3L0SA 4RVCA 1NNEA 5FR2A 2Q9BA 1UKVY 2XX3A 5IDVA 2DB3A 2F43A 4RZUA 3LAWA 4XIGS 2WJIA 4ZCMA 1HEIA 2ODBA 1HV8A 3LX5A 2Q21A 4BFVA 4QFMA 3W3ZB 4TLEA 2GVDC 3BB1A 4QGAA 4XSHA 1G7CA 4E03A 1D8TA 1YZKA 2WPDD 4HATA 4TMTA 4LPKA 2RMKA 1GTVA 3GJ7A 4MRSA 4QJ4A 2WWXA 3CM0A 3PJRA 2CLDX 3LQRA 2RCNA 3QKRA 1AKEA 1RRPA 2ZIAA 1HH4A 2IYTA 2MMCA 3BJIC 1Z5ZA 3A4NA 1O87A 1VCMA 1UFQA 2GA8A 2GAOA 2EVWX 1KSFX 2GRJA 4FCTA 1ZUNB 4CEHA 1GG2A 1G5PA 2A78A 4EQ6A 4Q7MB 1ZD1A 1UAAA 4GDFA 4NBSA 3BWDD 3GJXC 3RANA 2FWRA 5EE3A 1DOAA 5DI3B 5G40A 4ARZA 1US8A 4FCWA 3IILA 3KXKA 5LPNA 5G3YA 1FQJA 2Y8EA 3F3YA 1PUIA 1NMYA 4M4SA 4EJSB 1IQPA 2G1KA 2ZQ5A 4NKRA 4Z1MD 1HUQA 2ZJ5A 1XTQA 3ZYCA 2K5UA 2MSDB 3MWLA 4NYJQ 2ORVA 5AR1A 1M8PA 3FMFA 1COWD 2YWHA 5D3MA 4GNKA 3I4LA 2D06A 3H0KA 1KMHA 3KQLA 3X1DA 3LRPA 3VX4A 3WYAA 3LXRA 4HLUA 1AZTA 4OKSA 1LVGA 2QZ4A 1BYUA 3ETLA 4LC0A 4Q9JA 2DFKB 3HPRA 2Q9CA 3RVBA 1XX6A 1QG4A 3ZD6A 4BWYA 3ND8A 4MGZR 1RRFA 1IBRA 5HPYB 4JLBA 1XDBA 3RS5A 3UK6A 4EPWA 2PH1A 2V55B 4PC6A 4CW7A 4Q02A 2ZS8A 4ZI2A 1PLLA 2F1HA 3ICQB 3T5GA 1OSNA 4H9GA 1VIYA 3ZLJA 1I2MA 4W7SA 5H8WA 4E09A 3I32A 1P73A 4ABYA 3PUXA 2NMVA 4BGDA 2IF0A 3W8NA 2H16A 2VEDA 3GLIA 2V3CC 1CBUA 3RSLA 6Q21A 1UM8A 1Z0FA 2FMXA 2Z43A 4OQXA 3G82C 4UKDA 1E2EA 2VBCA 2ZUCA 4POAA 4ZIRB 4BLQA 5E3HA 3AF2A 3LO5A 4JVMA 2ZVPX 2W83A 2GCPA 1LNZA 5FOSA 3TUJC 1FNNA 4BASA 4Q4JA 3CBQA 1E9SA 1NKTA 5CJ2A 2G9NA 4LI0A 3U3JA 3V4RA 2YINC 2VRWA 5FBLB 1WRBA 3RRMA 5GJBA 1S0UA 2DWPA 2JAQA 3BORA 1YZTA 1EX6A 5EP3A 3TVTA 1QG2A 2ZRHA 5GJCA 3OEHD 1VG1A 5AJYA 4PPNA 2RH5A 3TJZA 4M9QA 2ODNA 4Q66C 4B3GA 5JS7A 1R8SA 4HAUA 1CLUA 1DTSA 1GL7A 4LV5B 2AN9A 1CU1A 1F5NA 1XBTA 4Q19A 1LS1A 2D74A 2BV3A 4MYUA 3K70C 2PLRA 5JECA 4GPTA 3LVRE 4IDNA 1OYWA 2GZHA 2HYIC 1XCGB 3AQ4A 3EPKA 8OHMA 4DDUA 2REBA 3OEHA 3IIKA 4CEHB 4BLSA 4MQBA 2YOHA 4PAOA 3FHTA 3GJ8A 3IHWA 5C2JB 2O8BA 2CL0X 1E2PA 1D6JA 1NG1A 1WDTA 4D0GA 1FX0B 3V4FA 2NIPA 4TQUS 2KB0A 2JLYA 4MKFA 1B0UA 3NBYC 2XJ9A 1OXSC 1CJMA 4YC7A 4G5SA 3B1XA 5K8IA 4IVRA 1D2EA 3K0AA 1C9KA 1RRGA 3I92A 2ZSDA 2R6CA 5LDDC 1XD8A 2W2XA 4DT1A 3CO5A 2DY1A 1Z06A 4Q7LA 4URWR 2GXAA 3AVYA 1NF3A 3ND9A 1XB2A 4NYMR 1IHUA 2F1IA 2QAGB 3RDPA 1RIFA 2J59A 5CK4A 1NI3A 1D5CA 3E1SA 3AP2A 1H8ED 4KV9A 2ZJZA 2XOKD 1AIPA 3MWKA 3BFKA 4WIAA 3NC0C 3P32A 1KSHA 2ZYWX 3NBXX 2O8CB 2E9SA 2PEZA 2UZ3A 1EGAA 1N6RA 3U3OA 2GDJA 2AK3A 4AG6A 1MRSA 1ZJ6A 4DLVA 5J47A 1ESNA 3AUYA 4D81A 3A8TA 4CT5A 2QA5A 3PUYA 4MGIR 5BWMA 3KQHA 1IY1A 2PZGA 1M7GA 3LXXA 5EJEA 3U7FB 3EC1A 3KKNA 1MOZA 4LCBA 1SVMA 3GJ5A 3QSYA 5HKKD 1DARA 4AYTA 3C7KA 3M0EA 4GP7A 3SJAA 4EAQA 1TQ4A 4RZ3A 5FBVB 2W6IA 1KNXA 2QPAA 2EFEB 4M1SA 1II8B 1KAOA 4G0NA 4ASUD 3IO3A 1JQLB 3VNUA 3EPHA 3GPLA 2IYXA 2FGKA 1ZM4A 3VHLB 3EPLA 1Z07A 1S2MA 2PX0A 4Q00A 3ADKA 4C9BA 4MUAA 1ZCAA 2PMDA 4JVLA 1W0KD 3EPJA 2BM1A 3GCGA 1SVLA 3R9IA 4A8JB 3P4XA 4IVQA 4NH0A 2OO7A 3ZVLA 4B2PA 3AKYA 2MSEB 2AD1A 3THYA 4DCNA 1MO4A 1E9AA 4QOSA 1Y3AA 1U8AA 3UXMA 1E1QD 4Q4JB 1WA5A 2IEYA 3R20A 3CRW1 4TTRA 4V0KA 1ZM7A 2GEVA 4KHZA 2A5DA 3REFA 4IHQA 1KAGA 1KOFA 1KY3A 3CWZA 4CIDA 2ZE7A 2ZROA 1E0KA 3QXSA 4KCGA 4WZBE 4I1UA 3SJBA 1GNQA 2WOJA 3LBNA 1E2QA 3SQXA 1KIMA 4G5OA 2WWIA 3N5CA 1MRNA 4RFSB 1BIFA 1RZ3A 3BK7A 2ZS9A 1KI4A 2ONKA 5KOYA 2SHKA 4F7WA 3LFUA 4DLYA 3RYTC 4A2QA 1ZNYA 2XSZD 1FMJA 2Z6VA 2ZJBA 1ZNXA 1XMVA 3RRZA 4C4PA 3PCRB 4BPBA 3HDTA 4A0HA 3IQWA 4Q1AA 4KVAA 5B2ZA 3UKDA 5K8UA 4JS0A 1GIAA 2IHYA 3B9QA 4KFTA 421PA 3L0PA 1OV4A 4KFRA 2GKSA 2QM8A 2QNRA 2WWFA 1A5TA 1R10A 5EXPA 1T4GA 5J4YA 1QHNA 4QL3A 2Q3FA 1V5WA 3QPUA 2WIBA 1E9BA 4LGMA 1J8MF 2O8EA 2BJWA 2WAXA 2IWRA 2QEQA 4TL7A 4EFLA 2XB2A 1CKEA 4V0NA 2HEIA 5J4HA 4KBFA 4L9SA 1DAIA 2HV8A 3GD7A 3D31A 1W48A 3RWMB 2IXFA 4Q01A 1W0JD 2X1VA 1F60A 4OQLA 2CL6X 4KYUA 4EJSA 2QTVB 3U2QA 4QKQA 4JLKA 4DCSA 4DB2A 4M9SA 4NMMA 2JLXA 4L15A 1TMKA 1FTSA 1GAJA 3T5DA 1L8QA 3MCAA 2WMNB 1IY0A 3Q9LA 1XD2B 5SZKB 5CIWA 3SR0A 2LCFA 3W6OA 3IIJA 5DI3A 3HWSA 4NP6A 5JS8A 4QC2A 2JLWA 2BEKA 3I72A 4CEIA 3U3KA 4B73A 2W0MA 1HURA 4EQ6B 3R9WA 2X8AA 2CDNA 2RGCA 2ANCA 2VIIA 4QNRA 4Q47A 2RAPA 2B7BA 3H1TA 1L7VC 1ZUHA 3RS4A 3BH0A 2XTMA 4IW3B 4K46A 1SXJA 4A0RA 2GBLC 4M1TA 3FFAA 5DIFA 1P61B 5JLJA 4HB4A 1SZPA 5AK0A 2I1QA 4QM7A 1D2NA 1U9IA 1Z2AA 3FGNA 2D7CA 4GRAA 2LKCA 2ZSBA 1U0HC 521PA 5P21A 3N2EA 2VHTA 4B32A 5FTJA 2BBOA 4B35A 3VR5A 3LBHA 4S35A 4ZPXA 3BH6A 4DVGA 1QBKC 4B3XA 3H84A 3EA0A 4MYHA 3TUZC 4FD2A 2QTHA 1MO3A 3GJ6A 1AM4D 2OXRA 1G5TA 4LZZA 2YHSA 2WJYA 3BRWD 4PPFA 2YOGA 4P4UA 2P67A 4LJ9A 4NL4H 4V0ME 3C14C 3V9PA 4Q1CA 5JEEA 1G16A 2EU8A 4OHZA 2PZFA 5KPJA 2IA5A 1GL9B 4NE2A 3TK1A 3RC3A 4PQFA 1E0JA 1SULA 1VPLA 1OB5A 4ILEA 1YR6A 1P4SA 4LHWA 4C3ZA 3IBYA 3WYGA 1SXJB 4GOJA 3H2YA 3K70B 5H1YA 4DSUA 4K81B 2XITA 4I1VA 2IUSA 1S9DA 4D4JA 3PEVA 3FKSA 3A1SA 2WWYA 2J45A 4TQ9A 2WJGA 1LTQA 4DLUA 2L0XA 2NG1A 2I1VB 3G5UA 4HAWA 5DH9A 3SYNA 1E98A 3D8BA 2OESA 1CEEA 2WAYA 2ZM5A 1CJTC 2CJWB 4E22A 3AGPA 3PVSA 1KI8A 2QGZA 4NYIR 2C95A 4HUQA 2NO1A 1T8TA 3ZZUA 1J70A 4JL6A 4C30A 4A6PA 1U0JA 3QQ5A 2Q0HA 1WMSA 3VKWA 3QKUA 1NKSA 1AKYA 2IBMA 3EWAA 1UF9A 2OSBA 2AD5A 4QJ3A 2EFDB 3UPUA 3GJ4A 2KBFA 4WXPA 1W5SA 3GLIE 1ZIPA 1ZC4A 2QAGC 3NWJA 1XRJA 1PLKA 1QHGA 2H57A 1AN0A 3LH5A 4KSBA 1OPXA 4TYWA 221PA 2VPPA 2QP4A 5FPTA 4BQSA 3D3QA 3ZVMA 4BLPA 4AD8A 5E7JA 2UZIR 2ZJ8A 3MRSA 2XNDD 1XTKA 4Z54A 4EDHA 3Q5EA 1DAKA 3X1XA 1XTJA 2GVZC 1UBFA 4O0MA 4X8OA 3ADDA 1VECA 1XF9A 4P33A 3OHMA 5C18A 4P0TA 4RD2A 4TTQA 1TU3A 1D2MA 1UDWA 4WXRA 4ZKEA 4Q1DA 3AVOA 3A4LA 2QPTA 1UBEA 2IYYA 3BAFA 4RD6A 5A5GA 3T1TA 2HXYA 2ZRKA 1IN8A 1E1RD 3EZ7A 4LJYA 2GHIA 3EAQA 3SHWA 5KHOC 2BMDA 3GFOA 4JLVA 4RY2A 5FI1B 3ADBA 3PV0A 5JBQA 3A1TA 3K0SA 3SJCA 4LBZA 4AKIA 4A6XA 5FL7D 4RZ2A 3BBPA 1GKUB 4D6PA 2A5YB 3U4QA 3QPWA 4B76A 4JLOA 5EE5B 4X8MA 3ZQJA 1JR3D 1SGWA 2BMFA 3OEEA 4EPTA 1E2MA 2IS2A 2DWQA 3B60A 2MMGA 4EPXA 2VP2A 3M4YA 1X1SA 3DPUA 1MV5A 2E87A 4UQOA 1KO5A 3A1WA 4K8OA 4Q18A 4ZDKA 4HUQB 2RHMA 2Z4SA 1EWRA 2HF8A 4D25A 2A3RA 4CEJA 3GLGE 2IS1A 1F2UB 1VMAA 3CX7A 4ZI3A 3NG1A 3A6PC 4DBLC 2FDCA 2XOKA 2Q3HA 1SVWA 2ZRCA 1KY2A 1NVVQ 4HSEA 2NPFA 4URVR 4I1OA 4UJ3A 2P65A 1P3JA 1OHHA 3K0CC 4W5WA 1Z22A 1G21E 3BERA 2QGNA 4LJ5A 3RRYA 5G41A 4R71A 3I62A 3SN6A 3HU3A 1G8HA 5CLLA 4M1MA 2WKRA 4IEEA 2JASA 3RAPR 1L2TA 3ZVRA 3WMGA 4BLTA 1E69A 2ATVA 4WVFA 3CRRA 1KSGA 3T1VA 4H1VA 3SZRA 2QQEA 2IS6A 2O8FB 4URUR 5JMTA 1E2GA 3TRFA 3K53A 4I99A 1W2GA 3PENA 2IYSA 1GFIA 3TR0A 1W4BA 2DFNA 4HYYA 1E2DA 3M1IA 4F4IA 3LA6A 1SKQA 3CPEA 1WB9A 2JJ2D 2ZI5A 3LQQA 1IXRC 1G7RA 3VHXA 2QI9C 2ORWA 1S1MA 1JJVA 2JIZA 4ON9A 1F2TB 5EE9A 1VCIA 1YRBA 2XZPA 3FKSD 3LBIA 4AURA 5AUQA 5C1BA 5JJIA 2GWHA 2FV8A 2ZREA 4TMZA 2O8FA 1EXMA 3P4YA 3WYFA 1IN5A 2ZR9A 4TSFD 2ZAOA 4NYIQ 1GILA 1PUJA 2JLZA 1L4UA 3QJYA 3GLHB 1ZVQA 3BB3A 4PO9A 3DMDA 3QEOA 4B43A 4FW9A 4Q7JB 1QRAA 4LUCA 4XWKA 5CDFA 2UVQA 1W36D 1GKYA 1LFDB 3AKDA 4FMBB 4PR0A 1D9ZA 2Z83A 2PT7A 1G19A 4DIDA 2QPOA 2I4IA 1EK0A 2B7CA 1WCV1 2A9KA 4PX9A 3RLFA 4HZUB 1W7AA 4CEIB 2GF0A 1JBKA 1T3SA 2GK7A 5BN5A 4JVSB 1W49A 1NVXQ 1PVOA 3IKJA 5GVRA 2QE7D 3MUFA 4FMDF 5LBIA 1ZM9A 2OILA 5IT5A 1KO4A 1TL7C 1XMJA 4B74A 4DIEA 5C46F 4QBFA 2FOLA 3QENA 2F6RA 2A5FA 3OE7A 2ZI7A 1WBBA 3KJGA 1P5ZB 3TH5A 4LPSA 1QVRA 2ERYA 2OLJA 2VF8A 5J4KA 2WV9A 2IL1A 1IAQA 1Q44A 1U8YA 1SXJD 2XTZA 3TQCA 4CDGA 1R0XA 4W9MC 4ZKDA 2DWOA 2O8EB 2G77B 5KO2A 2OZEA 3L0OA 1X8LA 4DUGD 2CCKA 3J81k 3U4QB 1G3UA 1UBGA 2WIAA 4M22A 1R6BX 1OT3A 5F9HA 1OH8A 3SHFA 3U60B 1R0ZA 4HLUC 1SVSA 2DBYA 1J90A 1ZM3A 2NQ2C 4KO8A 3U3RA 5KNCA 2C78A 5JRZA 4BLOA 4QGFA 4XOIA 3LNCA 1M6NA 2NGRA 1MO6A 1XWIA 2EYUA 4MKIA 4Q5IA 4P32A 2P6RA 2WTUA 3EG5A 3CF0A 3QXCA 2OCYC 2OM2A 1OXTA 1T0JB 4R2HA 3QF7A 2FA9A 4RFSA 2R62A 2ZJYA 4CYMA 1P7CA 1OFIA 1JPJA 2PCJA 4P4SB 4TTPA 3OEED 5HTKA 1R0WA 4D4KA 3CLVA 4L9WA 1RYFA 2J87A 2ZANA 4JKIA 3EX7C 4LC1A 1WBDA 4LYJA 1H65A 4UNRA 2CBZA 2Q9AA 1HT1E 2XZLA 1KMHB 1S4QA 4M1OA 5D3MB 4XTRA 4AYWA 4KXFB 3CNLA 2GXUA 3LY5A 1B23P 4HAXA 2XXAB 1A4RA 1FFHA 3I73A 4DXAA 2IS4A 3MGCA 5DISB 4NCJA 5B64A 3THYB 2VH5R 4PHGA 4Q1EA 4B6EA 4A2PA 1E2NA 2QT1A 3D6TB 4ACAA 1T3HA 5K8TA 3AM1A 2F3TA 2R65A 3OFND 1M2OB 1DAMA 2FSIA 1H8EA 1OB2A 2IT1A 1G1MA 2CJWA 1NBMD 4ARZB 1W4CA 1VYVA 3BS4A 1CJUC 3HYTA 3MG9A 1G7TA 1SVIA 2ZSFA 2ZXUA 1CF4A 3R8FA 3NBFA 5L3VA 1A82A 2R9VA 2NOAA 4G01B 4LSGA 5KDOA 4NONA 3KQUA 4URZR 1G3RA 2JEOA 5HZHA 1N6KA 2IYLD 4HAVA 3EARA 5J40A 3W8RA 1GP2A 3NTUA 4IFBA 2JLSA 4YMTA 1XPOA 2AFHE 3UG7A 1QZXA 2HLDD 4LOAA 1Q1ZA 1N5IA 2GZAA 1W44A 2XSZA 4R98A 2GBLA 3AP1A 3NDPA 1KJYA 4DSOA 2Q3MA 4HI0E 4YLGA 2AKYA 2ECKA 1CS4C 4KYIB 4TN1A 3I5XA 4PZYA 4M1WA 2GK6A 2YYZA 3ASZA 4A0GA 1N0UA 2BM0A 2KBEA 3NKVA 5FTMA 1JXOA 2QAGA 1P9RA 1W4AA 3EZ2A 1EFUA 4JYBA 3GJ0A 4KVGA 1CR1A 5JSZB 5B30A 1JJ7A 1COWA 3QXHA 1R7RA 3REGA 3S1AB 1EFRD 2O5VA 2A7QA 3NHAA 4N3NA 1TQ2A 4WOPA 3R7WA 3K0AB 2H5EA 5DYIA 1VCNA 3A1UA 1SQ5A 3A36A 4MH0R 2B8TA 2IW3A 3DM5A 4MKHA 4TZ0A 2JLVA 4HDCA 2FZLA 1HE1C 4TMWA 3DO6A 1G8GA 4QBHA 4JYCA 2EFGA 2GILA 4LYAA 3QE0A 3K8YA 3FDIA 2AFIE 1HE8B 2AXNA 1NLFA 2V7QA 4DZZA 3OFNA 1S1CA 3E70C 3QXJA 5EQTA 2ZYUX 2V8OA 2ASEA 5JJLA 2A2ZA 1P6XA 4KITB 3KKQA 3VFDA 2FZ4A 2O52A 4US0R 3DVLA 1ANKA 3VKGA 1H8HA 2DPXA 3HU1A 2ZUDA 4HAYA 1YZNA 4OJKA 3L82B 4JL8A 5FBQB 1UKYA 1T5IA 2HCBA 2FF7A 2D4HA 3AGQA 3HR7A 1DAGA 4BZPA 1KI6A 1TEXA 4DDTA 2XXAA 2P6UA 4M1YA 3LX8A 2QP3A 4GMDA 2W2TA 2ZI4A 3K0EA 2VLIA 1XFAA 1T6NA 3KJEA 4PZLA 3GP8A 2FFHA 2VSXA 2XTNA 2ATXA 4Z8YA 5EXSA 4O3MA 1NRJB 1EFRA 4LHZA 4ZO4A 2YC2C 4KU4A 3CH5A 4Z1MA 1NN0A 5CLQA 1NSFA 1YR8A 3K09C 3DKVA 3Q8XB 4JLAA 4ZIRA 3KTAB 3SJZA 4Q9IA 2CMKA 2V4ZA 4NCKA 4D80A 3RHFA 1CULC 1FL9A 2ZYTX 4IEIA 2GCNA 4HDQB 1KI9A 4RFVA 2F1RA 5AUPB 5FL7A 5L3SA 5TB5A 3QI2A 1OE0A 1HYQA 2VP0A 1M74A 4A4DA 4DUGA 4Q9LA 3VX3A 2PT5A 3F5FA 2QRZA 2N46A 2F9MA 2VP4A 1K5DA 3NBZC 1ZRHA 3GEIA 5EZ6B 2G0NA 3GLGA 2ZUBA 3KJIA 5IK2A 3RRNA 2OUKA 3GEEA 1KKMA 4OK5A 4N0DA 1LF5A 3FWYA 3LWNA 1Q22A 1J7KA 1GKIA 1ZC3A 2AX4A 2EYQA 2I3BA 1IN4A 2P3SA 1SKYB 4TMVA 1G3QA 3MD0A 1I4DD 4R7ZA 4JLMA 3JZMA 1C1YA 5EP1A 3MAAC 2V1XA 1N0WA 1KNQA 1N25A 3EXAA 4Q4LA 5EUMA 1II0A 3TIFA 2PCLA 4O25A 4YONB 3CRMA 3WMFA 1E0AA 1CR4A 1G4UR 4A8JA 1XTRA 1ZUIA 3MSXA 4PO8A 1NVUQ 2W6JA 1NJFA 4C0QC 1JNYA 3NXSA 3RABA 2XB4A 1A7JA 1U99A 1N6IA 5AJZA 5FPHA 3ZS8A 3EC2A 1X8JA 3T06B 1Z8FA 4LHXA 3BE4A 4HDOB 5G53C 1T0HB 1US8B 2P6NA 2XNSA 4MGYR 3B8HA 4IDPA 2GJAA 3VR3A 2DYKA 1G7SA 1U94A 1I2DA 3SS8A 3SFZA 2J0QA 5M04A 3CNOA 1CIPA 1DBSA 3FHOA 1Z63A 3C8UA 1KI3A 1Z6XA 4BUJA 1KJZA 3PIRA 2FSGA 2KJQA 2ZRFA 3E2IA 1W46A 3AKEA 4TLCA 2CL7X 3SEAA 2PBRA 2KI5A 4WZ6A 1GUAA 2VHUA 1NSTA 1HTWA 5FOTA 3AF4A 3EIEA 1JAHA 4N0EA 1P2TA 4ESVA 1Q21A 4P4TA 3LLUA 4PC1A 3K70D 2JCSA 721PA 4YQFA 2ZITA 3JVUA 4DCUA 2RGXA 5GJWC 2ZRJA 2ZI3A 1JR3A 2UKDA 1KJWA 4Q21A 1T8UA 5C4GB 4YDSA 4KJZA 4TMXA 1FMLA 3EZFA 4EFMA 1N6LA 2CK3D 2H18A 1KDRA 4F38A 3B1VA 5UKDA 3TAHA 5K8LA 1BKDR 2IYVA 4R9UC 3ZZ0A 3AB3A 4PTLA 3PQCA 3ONWA 3TSWA 3KJHA 2HJVA 4I81A 4RD1A 1NIJA 2D3WA 1XEFA 2C8VA 4QHYA 1E79D 4DC9A 4LK2A 1LY1A 3MFYA 4TL9A 2BBSA 4NCHA 1G6HA 5FTNA 1QF9A 2QMOA 2IUTA 5B57C 4MRRA 1Z6GA 2W2VA 2VQSA 3OAAD 4XVRA 4Q9KA 2OT3B 3DM9B 4GOXA 3VU9B 1N2CE 2ZRDA 1TTTA 2DR3A 2AL7A 3BGWA 4EPYA 4A8JC 3CB4A 1EWQA 2O8BB 1ZNZA 3AVWA 2BCGY 3CPHA 1BMFD 1E2LA 5L3RA 2QRNA 1E9RA 2V6IA 2Z0MA 2CVHA 4US2R 2WPDA 4Q4HA 2O0JA 2GESA 2PLFA 2ZVQX 3B7GA 2QE7A 1KTVA 2CHQA 2HLDA 4FWIB 4URXR 1E4YA 4MYCA 4DEYA 2YWFA 1N3BA 3W3AA 4RKEA 1NMZA 4PPGA 2QMHA 3RS3A 4TQAA 2XEXA 1JPNA 1UBCA 4M53A 1QHYA 5IF9A 1GM5A 2O0KA 5BW8A 5B58C 3MMPA 1G8PA 2WJHA 3U7GA 2ZPTX 4HB3A 3AF3A 4LJ6A 3AVUA 4U7DA 1E2KA 3CW2A 2GCOA 1N5KA 3JVVA 5JI3E 5E7MA 2DFTA 4D4LA 1GRRA 4TWZA 4Y0AA 2W6JD 4RCYA 1A2BA 4AWXA 2Z4RA 4DLTA 2BBTA 2XGJA 2JA1A 2HYDA 4P4SA 3O8BA 1OLOA 2XAUA 5FUVA 1JALA 1ZU5A 1Z0DA 2JLRA 4JBXA 3WNBA 2C77A 5H70A 4QHTA 4ACBA 1N5LA 3B9PA 4LJ8A 4UNPA 2ZJAA 4B2LA 2AHOA 5AJXA 1VHLA 3CR7A 4KBGA 5JHGB 1ZP6A 4BRUA 4OHXA 1AS2A 2IXGA 2WSMA 3RS2A 2B21A 5TY0A 1ELOA 1V43A 2QBYB 2JIZD 1TQDA 2OCPA 3THWA 3SDZA 1KI1A 4DDVA 4GMXA 1OKKD 3CF6R 3NDBB 3ZQ6A 2QENA 1UPTA 2V54A 3SBEA 3H86A 3VR6A 3BD9A 4L8GA 2FSHA 4TLDA 1R0YA 2ZRMA 1ZW6A 3U44A 4A92A 1XXHA 1IN7A 2P5SA 1E96A 3WY9A 1NBME 2F9LA 3HJNA 4YMSA 1E2JA 5LD2B 3UWOA 1C4OA 3L43A 5FI0B 1UDXA 2F7SA 2VHJA 3F0TA 3KX2A 4C0JA 5EXXA 1RFLA 4YXWA 5DYGA 2HT1A 2X77A 4IDOA 4ERNA 2D2EA 1QHHB 1BS1A 1DS6A 4B3CA 2R2AA 2NTYC 4PC7A 1FNMA 1Z0IA 2NO9A 1KSJA 2X2EA 5KSZA 1NG9A 3WP1B 1VTKA 1KO1A 5JWOA 3I1FA 3QXXA 3AVXA 4JBWA 2O8DA 3DKPA 4OI2A 3KB2A 1YJ5A 2QM7A 1X3SA 2CHVA 4E07A 1NN5A 1KI2A 2QMUA 1E0SA 5EZ5A 4M2LA 1Z29A 1CP2A 1U8ZA 3I3SR 3B13B 2G3YA 1AGRA 1DG1G 3U61B 4YDHB 4Q9HA 3FB4A 1JQJC 1CJVC 3OIVA 3RWOA 3LW8A 2F1JA 5FPSA 2GZDA 3ICEA 1LS6A 2XZOA 4AIIA 3FHCB 3K09A 4GP6A 3UMSA 5AJVB 4E5UA 1SXJC 1R5BA 3HYRA 2EQBA 3LVQE 4NZYA 2RKOA 1G3MA 1U81A 1E9CA 1GL6A 3GLFA 5JWHA 4AK9A 1W0JA 2FNAA 4A2WA 1SKYE 4CRWB 5J4VA 4IJMA 4ZCIA 4LYFA 4MA4A 1W47A 3KDSE 1G20E 3EW9A 4G5RA 4UJ5A 2CE2X 1IJEA 5BYJA 5FPKA 4LY6A 3W6NA 3MJHA 3AKCA 2HT6A 1OIXA 1IONA 3G0HA 2F43B 4IXNA 5IHPA 1GZSA 1SXJE 3NH6A 2XJ4A 2WSSA 3Q5DA 1U2RA 1KK2A 4JLJA 1JXMA 4XJXA 1J8YF 3VR2A 4B2IA 1FUKA 2ZRPA 1CRQA 1VG8A 1HQCA 3CIOA 2XNDA 4MKGA 1IM2A 4QG7A 1BMFA 1EG7A 3A58B 1NP6A 4RJLA 4DWJA 1YZUA 3MJRA 4JL5A 5E4FA 2CCGA 4H1UA 5FUXA 1GOTA 1OYYA 3UANA 2VO1A 3C41J 3GEHA 3NIBA 4PHFA 2RGDA 2FE4A 4IFEA 1Z83A 3TMKA 4L4UA 3RNLA 5KSOA 2P0EA 4I4LA 3PEWA 3AP3A 1FP6A 3BB4A 4TYQA 4A82A 2DFLA 4FN5A 2RHDA 3IHLA 4Z8XA 4TL6A 3IDQA 2G6BA 5TV2A 2QMEA 4C0KA 4Q1BA 2QQ0A 2GTPA 2DCUA 4B3BA 4BEBA 3UMRA 2TMKA 2JLQA 5KYKA 2J0SA 4BFTA 5KSPA 4DLXA 1Z0JA 1KDPA 1VG9B 2RB4A 3DOFA 4UXJA 3VU9A 5J4LA 2W58A 4FIDA 4HUTA 4X8HA 4M1KA 1TQ6A 2HF9A 5SZIA 5KNBA 4F92B 3QKSB 3CRQA 5FOVA 3B1YA 4B75A 5J5CA 5EXTA 4B44A 1L4YA 1KHTA 4DB4A 2ZI9A 1XZQA 3T1QA 1YVDA 4DRZA 5TDHA 1E1QA 1P2SA 1GVNB 2GEUA 1OIVA 1Z08A 2VSFA 5JRJA 2RGAA 3TNFA 2R6DA 3K0CA 4JIMA 1AS0A 3K9NA 4HLCA 3GLFB 3QBTA 1Z28A 1JEEA 4IRUB 4XSGA 4C0BA 2VA8A 2ZAMA 4JZKA 2LKDA 3BH7A 4Q4AB 1EFHA 1YRAA 2WKQA 3L8YA 2QAJA 1KYIA 1QHIA 4WA7A 4TMKA 1G18A 3FVQA 5DLQC 1DAHA 2ODEA 3PEYA 2VHCA 3SYKA 1UEJA 1HT2E 2GJKA 1MT0A 3AVPA 2HUPA 2WICA 4PSAA 2FFQA 2IUUA 4TYPA 1E9EA 3M6AA 3T34A 5BN4A 4LV8B 1RYHA 2C9CA 5SZHB 1RW4A 4PSKA 4B33A 2GXSA 4GI7A 3AVVA 2IYZA 1S9HA 1G4AE 2J5XA 1QHXA 4FINA 2CLSA 4GOKA 3EZ6A 4TZ6A 2J3EA 1NY6A 1SVKA 2WZQA 4MYTA 4AKEA 4G5GA 4WAUA 1ZU4A 4U5XA 3EWSA 3SI7A 3WP0A 5JWRA 3A4MA 1SHZA 4IOMA 5EP4A 1FTNA 2BJVA 4XH9B 1OFTA 2J0UB 1JI0A 2G1JA 1K6MA 3KUDA 4KODA 4A9AA 3PUVA 2JGNA 4FMCB 4D0NA 2BOVA 3TQFA 4C2UA 1JR3E 1Q20A 3U44B 1WF3A 4RZXA 3CRVA 3OE7D 4JLPA 1PLJA 1EFTA 2OV2A 4RSGA 5HE8A 1Q0UA 2Q6TA 1Z6TA 2WWHA 2NO6A 1KKLA 4G3XA 2FSFA 2QU8A 2ZJOA 3D7MA 3IQXA 4FI3C 1ZMXA 4FXPA 1Z2CA 2IYQA 121PA 5DI9A 1KO8A 3BFVA 3VQTA 1KDTA 2HXSA 3ZIAA 3U7HB 1TF2A 4BZQA 4JJKA 5JFGA 3KFVA 4IOLA 3WBJA 4HLQB 4F4JA 4Q7KA 1GWNA 5TVKA 1CR2A 5KU1A 1XD9A 5ELXA 3FFBA 1MABA 1LB1B 2F3RA 1QDEA 5D3QA 2QTFA 1NIPA 4FMCF 2C96A 3THOA 3T15A 1VCOA 2AWNA 3UATA 4CZ2A 2FPKA 1YZGA 4WBSA 2OFWA 3LV8A 5CM9C 1G5RA 1DAEA 2YV5A 1FOEB 4JJZA 5BYKA 2OEPA 3ECCA 2WBLC 3FKQA 2C99A 4C0SA 5KSYA 1OH6A 4RD0A 3VR4A 3ZJYA 1P2UA 2NO0A 2RGGA 1XZPA 2RGNC 3KQKA 4PC3A 3KQNA 4QBGB 1JECA 4IOKA 2PMKA 2OXCA 4RKFA 4V0MA 2FFBA 5GJVC 3VKHA 3W34A 2J0VA 3PUZA 1TF7A 2PZEA 3WNDA 5A4JA 4D0LB 4MDFA 1KO7A 4RD3A 4JVNA 2FU5C 5AWFC 2ZRGA 2F55A 2A5GA 1FQKA 2QROA 4TLAA 2WHXA 2AK2A 1FX0A 2JDIA 2OCBA 3TGPA 4DKXA 3U6KA 2OBNA 5KDDA 2BEJA 2GAAA 4QXAA 1WE2A 1ODFA 2ZU0C 1GNRA 4QNMA 3VTKA 2BMEA 4LJAA 4YMWA 1ESMA 2R6GA 1W4RA 5LB2A 2J46A 3P27A 3NVAA 4A1FA 3WHKA 2J7KA 1CXZA 2ZETA 3TUIC 1CRPA 1G64A 5KPDA 2ZEJA 2D62A 4LHYA 1R5OA 1G8FA 2ZSEA 3EIHA 4ASUA 4CT4B 3VR1A 4OHYA 1OHHD 2CVFA 1FZQA 4GFDA 2NO7A 4IVPA 2W6ID 3JZAA 3R7WB 1OFUX 3SYLA 621PA 3S1AA 4LJ7A 3PG5A 5BN3A 1EFCA 1U90A 3DZ8A 2BBWA 3GFTA 1E3MA 4B3DA 1VHTA 1ZBDA 4DSNA 4PQYA 4FMDB 2N42A 2IYUA 5FPYA 3AH8A 1VDZA 3V00A 1DELA 4TLBA 4B71A 4D26A 2WOOA 1XTIA 3HU2A 1DPFA 4XD7D 2OCAA 4C7OB 4F91B 3GLHE 5DN6D 1VIAA 4BFWA 4IKEA 3IPXA 3QOFA 4GZMA 1Z3IX 1GNPA 1NLYA 1JB1A 1MR3F 4EJSC 3GLIB 3RC8A 2GJ8A 4LYHA 1KMQA 2BHRA 3RS0A 2PJZA 4GL2A 3P1JA 2GEDA 3FPAA 3QF4A 4W5JA 4D2IA 2HCJB 1QVAA 3T1OA 1OJLA 1AZSC 4QJ5A 5FUWA 3ZH9B 3KZ1E 3U3MA 1ZM2A 3OAAA 1OF1A 1KDOA 4PHTA 3AF1A 4UNSA 4HLDA 1G8YA 4PAQA 1FW6A 5L3QA 2Z5FA 2R6AA 5BXQC 5JJKA 1S8FA 1JEDA 2GJ9A 3W5JA 1G3IA 5CB6A 4Q1FA 1E99A 1XNJA 1AGPA 1BH2A 4FCVA 3TE6A 1RVDA 2C2HA 3UMFA 4M8NE 4M9ZA 3FOZA 1DG3A 3DEFA 4IDQA 4Q03A 1G41A 3K1JA 3OIYA 3C5CA 2QSZA 3QVVA 1PV4A 1YHNA 2G83A 4MRVA 2BC9A 3LW7A 1GSIA 3CPJB 1S96A 3U7EB 4JT4A 1KK3A 1UKZA 2VHQA 1R5NA 5L8VA 1W2HA 1F3OA 2BDTA 4PZZA 4XD7A 1TF5A 1NY5A 4P31A 2OHFA 3Q7PA 3CWQA 3H4MA 3I8XA 4GSYA 1NN3A 4TT3A 1BO6A 2BKEA 1F6BA 3EASA 5HR5A 3GLGB 2WWWA 1N6HA 2H7VA 5L3QB 1IN6A 4OJQA 4O2LA 4PSVA 1IY2A 3OF5A 2WWGA 3FE2A 1Q12A 4KI0A 5DSZA 3SU8A 3HPQA 5KNDA 2JDID 2ZSAA 3TBKA 3QKTA 4UNQA 4EUNA 4IDHA 3K0FB 3TR5A 4EPVA 4KLZA 1LV7A 1ONBA 4NDZA 2CLCX 3KTAA 4LBYA 3O8DA 2GJSA 4BFUA 4TYYA 3BOSA 1Z0KA 3QKRB 2C04A 2WMOB 3E5HA 4PHHA 4OI1A 1DAFA 1ZYUA 3KKPA 3NC1C 4YXWD 4C7OA 4BFSA 1NLZA 4QGGA 4US1R 5HZKA 4D4MA 4DLSA 4G5QA 4LJ4A 3ZVNA 5CDFE 3OIWA 3VNVA 1ZNWA 3MWYW 2IK8A 3THXB 1YR7A 1Q1BA 4C0LA 4MDEA 1UJ2A 1YU9A 2QORA 3FMOB 1KI6B 2CCJA 2P5TB 4U02A 4F4CA 1CTQA 2OE2A 3Q85A 4DT1B 2CXXA 5G3ZA 1NVVR 2EFHB 4QRHA 3U5ZB 1XEWY 1YKSA 3QG5A 3AEZA 2N1BA 1I4TD 4KFSA 1E4VA 4WW0A 1XEWX 2RGEA 4KAXA 4R2IA 5EUQB 4OK3A 5FUYA 4ZV4A 3CUEF 2AWOA 4S2EA 1U98A 5HCIA 1M1YE 1M7BA 5LD2C 2QSYA 2IEZA 5A0FA 2KE5A 2WSSD 4L5BA 4B6FA 2IF2A 1TNDA 3P20A 1G17A 2ZRLA 3SQWA 1FPMA 4URYR 1N5JA 3KB1A 2A5JA 1H8HD 3B2EA 3TKLA 1VG0B 2GF9A 4HZUA 3UIEA 2H1LA 3AV0B 1U0LA 4L16A 3FYHA 1P75A 3OESA 3X1WA 4NYJR 1G9XA 1O3YA 1KGDA 3TW4A 1UKEA 1PZNA 3QY0A 4PPQA 1S3SA 1E2HA 3CH4B 2VP9A 3O47A 4B48A 4XVUA 1OFHA 3GLHA 5F2EA 1K8RA 1P62B 3K9LA 2A30A 4ZCLA 3B78A 2G88A 1IJFA 3T12A 4JSYA 4TYNA 1N6NA 1RC8A 5JSZA 1W36B 1TAGA 2VYFA 4RCZA 1II9A 3N70A 3P26A 4M9XA 1X1RA 1P72A 4MITA 2J9RA 1F2TA 5FBRB 4PO1A 4Z51A 4MUBA 4NTZA 1E1RA 2ZTSA 2DHRA 1HA3A 1OIWA 2KWIA 3ZD7A 2ZE6A 3THXA 3GFPA 2AXPA 3WNCA 1HY3A 2CNWD 2C9YA 3X2SA 3AUXA 1W36C 3TSZA 3C16C 4LRWA 4AC9A 1LW7A 2V7QD 1A1VA 1R4AA 3LD9A 1MO5A 1XCPA 4PAMA 1OXUA 2FG5A 3EZ9A 4PFSA 3B82A 4JLNA 3C4JA 1LF0A 3QVUA 1E6CA 2WKPA 3SFVA 5CM8B 1X6VA 1NVWQ 3K0FA 2RGNA 4KSCA 2IC5A 4NPHA 3K9HA 3QUSA 1R8QA 3NH9A 1NL3A 2FPLA 4EIWA 1WXQA 2OFOA 4JMPA 3AVQA 2YZ2A 2ZYVX 1YR9A 1T3LA 1UEIA 4X8LA 2FPMA 3W90A 3QEJA 3WBKA 2R8RA 1OXVA 4BRWA 2GNOA 1AA9A 2VF7A 3PR1A 3I5YA 1OKKA 2AKAB 3HR8A 4HAZA 1DE0A 1ZCBA 2JATA 1N6OA 3CONA 5KDLA 3UWKA 1E2FA 4DDWA 5EE0A 4ZDIA 3O8RA 4CEJB 5CITA 5FOXA 3TSOA 2HDNB 5IK2D 4AY2A 2J0UA 5F98A 4A0FA 2VSOA 3X1YA 1QHHA 3IUYA 5FR1A 3WHLA 1T5LA 1P9WA 1X8KA 3A37A 2CE7A 3O8CA 3OIUA 2NZJA 1HQYE 5FFMA 3L0IB 2MSCB 1BYIA 5DO9A 2R6FA 1DVRA 2VTKA 3AVTA 1VYUA 1TUEA 2OG2A 3C5HA 2QG6A 3DHWC 2H17A 4NCNA 1OW3B 4QM6A 5AJWA 3TLXA 4ITRC 4PQRA 1XEXA 1VKJA 2H92A 1GITA 2PL3A 5H68A 4PXAA 5DHFA 3THWB 1Q1QA 1XCMA 1XXHE 1DO2A 1XP8A 1W1WA 3KKOA 3I61A 2QBYA 5C4MA 3QF4B 2E1RA 3T35A 2IWHA 1NBMA 4DLZA 3L2OB 4OK6A 1JAIA 5FOUA 2YNMA 1DEKA 3PEUA 4Q4AA 2BKUA 3NEYA 2QL6A 3WRYC 2ZE5A 4Y0VA 1Q1EA 2YJTD 5FL3A 2OLKA 5JI2E 4XTCS 3ZGXA 4XWOA 3BXZA 4MRPA 4KLNA 3ZIAD 4AKGA 1W5TA 4BLRA 2B8WA 3OZXA 2ZE8A 3GQBA 4JLDA 1E2IA 5FTLA 1P2VA 4BZXA 2ERXA 2O0HA 1N6PA 1XU4A 4UXHA 2KSQA 2V9PA 2ODWA 1N0VC 5HE9A 3ZS9A 1RKBA 1IXSB 3QBVA 4DEXA 4DJTA 3MLEA 2EWWA 1XMIA 2J1LA 3CF2A 3KXLA 1XPUA 2QY9A 2FN4A 1OXXK 3QKSA 3UG6A 1R2QA 5EE1A 3GJ3A 5DE3A 4HB0A 2ORIA 5SZJA 1E9FA 1T9HA 1CR0A 2CNWA 1TUIA 3NHBA 2REOA 1Z6YA 4OBEA 3SC3A 3EA5A 3TAUA 3PITA 2B6HA 2BIFA 4I1SA 2D7DA 2ZRNA 4IXMA 3TW8B 2OFXA 2VL7A 2CEAA 1G291 2AR7A 3CR8A 5FOWA 5TXGA 1KZGB 2EFCB 5DN6A 2YVUA 1E32A 4LWZA 4NU0A 2IX3A 3IPYA 5KTYA 4U00A 3IIMA 1FP7A 1Z0AA 2FJUA 2OBMA 2W00A 2REXB 1KK0A 3BFXA 4OQMA 5GADl 3VAAA 1ZD9A 1TPZA 4BFXA 3CNNA 1IOZA 4HZIA 5F3WB 2J7PA 1Z6AA 4QHSA 1DADA 4FWTA 1E94E 4M21A 1ZIOA 2EW1A 1TU4A 2ZR7A 1X86B 4TL8A 1ZINA 5CYOA 1NN1A 5JCPA 3Q7QA 4ZDJA 2C9OA 4OHWA 2FX3A 4XWAA 5DNYB 2CHGA 1NJGA 3FTQA 3WMEA 2YWGA 1F48A 4RD4A 4MGKR 3IO5A 3WXMA 4BE7B 1SHKA 1UADA 2BVNA 4O2RA 4TSFA 2ZRBA 4IOJA 2JJ1A 3QG1A 4AKHA 2OAP1 1Q3HA 4II7A 2C03A 2RGBA 4AYXA 4J0QA 4UXIA 2W0SA 1XPRA 4PANA 4C0HA 3KUCA 2YWEA 1WQ1R 1K5GA 4JSTA 1A2KC
chains in the Genus database with same CATH superfamily
1V7PC 1AS3A 4GT1A 1K97A 1IXZA 2FB9A 3ESBA 2RAFA 3IUNA 3HEBA 1DFIA 2ZJ1A 4UEJA 3SE0A 3EMVA 3RJTA 4RXTA 4UASA 2LCIA 1NMXA 4ZVOA 1XTBA 2IDKA 3ORQA 1VFPA 3KCNA 4ZT3A 5A71A 1PJ2A 2V1UA 2B2CA 5JYEA 1FZTA 3EIQA 3R6GA 1TU0A 5CFOA 3RKSA 2GS9A 1VYTA 1WDWB 4N0QA 4V0OA 5E6SB 3BD7A 5A5DA 2Y1XA 2I6FA 3AW9A 1I8TA 2R44A 1MAHA 3B1ZA 2QRVA 2ZU6A 4H1HA 1LZLA 1YE8A 4AZ0B 3K2EA 1XO1A 2FP4A 2JFHA 1LV8A 4CV3A 4HFRA 1DQNA 1ODIA 2WM9B 1KU6A 3QPVA 4RBNA 5F7JA 2W70A 3HP4A 4HDAA 3TDKA 1REQA 2YOFA 4DJFC 2WJVA 5JY1A 4G4JA 4ESHA 5IRCD 1TAQA 3ZK7A 4L85A 3OG9A 2O8DB 4MWDA 1WHSB 1W75A 2VQEB 1H5UA 4EKDA 1WL8A 4A15A 5IDYA 3R4CA 2ABWA 4XVQA 2GETA 1YAJA 3L7NA 2JAUA 2Q5QA 3IH5A 1XVLA 3L6OO 1L5MA 2NZ8A 3A6DA 2ZJ2A 3CZ5A 3MTGA 4R4JA 3RVJA 4BECA 1HF3A 2OZVA 4KFUA 3WL7A 4OD0A 1O5TA 4HB2A 4NICA 1PGJA 3JWPA 4J9UE 4JVOA 2YHUA 3E05A 3PYMA 1KVQA 2HZBA 3DL0A 4M0LA 4EX6A 1AG9A 3K4HA 5B58T 1H9CA 1X94A 4ZO7A 4PNPA 2NU7A 2CHUA 1QX3A 5AW0A 1IC6A 1T9BA 1FUUA 2BDUA 4TWJA 3P0FA 1NW4A 3H0EA 2B92A 3IOCA 4O02B 4C43A 3NEJA 1K4MA 2V7PA 4YCAA 3M82A 3VDQA 4NHEA 1GEGA 3OA0A 4OI4A 1GADO 1TJPB 4RHEA 4RENA 3UK2A 5CUQA 3CHYA 3OCWA 3E0QA 3R3ZA 2YC4C 3VHQA 1WR8A 4Q24A 3PHHA 1SQGA 3AHEA 4ZOBA 2WJJA 4MUIA 1WZIA 4RDHA 3H3FA 2G0TA 2OAQ1 4GG1A 4RK4A 3EZGA 4ALKA 4MUEA 5JZMA 2ZBFA 3BIXA 5K01A 4LBVA 4RH0A 4GBMA 1JWAB 1MDBA 1NUQA 4WY5A 5HP4A 4GE0A 2Y27A 4N9WA 4XARA 4OYHA 1M34E 5J1SB 1GDDA 4G65A 2PK3A 1SU8A 1Q6ZA 2PKCA 2BFEB 2HSWA 3R5FA 4QTZA 5CFLA 1RJ9B 3FTFA 3E3MA 2FX2A 2FCAA 4MRNA 3JASA 3LRTA 3GRVA 1PZMA 3HP1A 1PV1A 1KK1A 3H7IA 1UC5B 4MJ3A 4FCCA 4C2TA 1PFGA 1AJEA 1KETA 1AHIA 3NT5A 3AILA 1S02A 3PJDA 4IY1A 4HQNA 3RIEA 2WLSA 5TLSA 1YZLA 2ZUUA 4OXRA 4F1WA 1L8AA 1VGQA 1J49A 4MCIA 2XMPA 4E46A 2HO5A 3ZXYA 3OX3A 3CZQA 3F8TA 3WICA 1ZZGA 4ZHQB 1YCGA 1ZI8A 3I2KA 1HFJA 3L7BA 2NXWA 1J0BA 2IU0A 1Q3TA 2X22A 1V1JA 2FPRA 4HDMB 4F5ZA 1AN9A 1VHQA 4AKTA 2V59A 1ULTA 1TVEA 2NO5A 1LBIA 3DHNA 1PBTA 3S81A 4BUZA 2X19A 4NV0A 4FLMA 3X1MA 1XZIA 3DOOA 3UK1A 2IY9A 4XIJA 4YRRA 5CBPA 1QIHA 1QRRA 1G6OA 1Y5IA 4K40A 4NJEA 3CLTC 3PDHA 2SCUA 1N9ZA 2UXDB 1OH5A 3IBGA 4RYLA 3U48A 2QP9X 2Y6VA 4X41A 2JHAA 4DF3A 2FEMA 5ALVA 2I87A 5I7FA 4DPKA 1M1NA 3KT6A 3O82A 4EJ0A 1DXQA 3DUFA 3ZVKA 3V2IA 4FB5A 4K6CA 2QE6A 1E7RA 1K98A 4NZPA 3GLSA 2PGIA 4Q4HB 4ZDWA 3OLYA 4P3YA 5JHHB 4BB5A 4W5HA 4Q16A 1OBHA 4BATA 2HDOA 2JVJA 2QVCA 3I04M 3GEPA 1I3OA 1OBCA 1G0NA 3TEFA 5EKUA 1DO0A 3IP6A 1Y1SA 2WIFA 3DMYA 4OHVA 4AF8A 5CURA 2J3MA 2EWVA 3FYDA 5JNUA 5EFZA 3IEVA 2WC1A 2O3UA 4AMGA 3BBLA 3KZCA 2VDLB 3TEJA 4RELA 3OM9A 4BP1A 1YZYA 1Q7GA 2ILTA 4FDLA 3JWEA 1VSTA 4KXUA 3ADCA 3E1KA 1MV8A 1W87A 3QH4A 4LAFA 2X9NA 1D2GA 1TGVA 4WZBA 1JDNA 1P8AA 5AKKA 2ZSIA 4D3XA 4DZTA 3L0SA 4ADSG 1TVMA 3G0DA 1PTKA 1QH0A 4BVJA 3CLSD 4RF5A 5DGDA 1L1EA 2F43A 2OB2A 4FYHA 1NF8A 2WJIA 5DHQA 2ODBA 3MCVA 1NG9A 5KNBH 4R2WA 4EB0A 3LX5A 5C35A 5JLAA 3PLAE 3MM4A 5DTRA 5FO0A 3ZY3A 1ZK0A 1XHEA 2ISCA 3SX4A 3Q7SA 3VOSA 1MMFB 4DZRA 1T4MA 4XSHA 3RSGA 4HATA 2WPDD 3K6KA 1Y7IA 3LT0A 3MT9A 2Z2IA 2B34A 3ORFA 5JYCA 1VGVA 4AJ1A 1WCWA 3GJ7A 4RDIA 1QIEA 2WWXA 2ST1A 3GGCA 1G8SA 3DEZA 3V9AA 3QE9Y 4IJVA 2F4VB 1ECFA 2RCNA 3BQMB 3C6ZA 3K8QA 3QKRA 1AKEA 4Y9UA 5ECYA 1HH4A 3UH0A 2PSFA 3QVMA 5G0SA 2RARA 2MMCA 1Z39A 3DTNA 2ZZNA 3WKEA 2J0EA 1K92A 3KJXA 1E3JA 4QUAA 2IH2A 2GA8A 4YJ2A 3LHDA 2GAOA 2I4MA 4HHEA 4ZI5A 5D2CA 3OTIA 3ZBTA 4EWLA 1PFWA 1ZUNB 2DLNA 4QXMA 3OCYA 1F5SA 3WLJA 2FFJA 2Z95A 3HKBB 4DCPA 3Q15C 4EQ6A 2FSSA 4CL2A 3QEMA 4HS9A 2RK3A 3IESA 4QODA 4MPTA 3V6MA 4JI2B 3A4YA 1Q77A 1A1SA 3EVNA 3GJXC 3SQLA 2FWRA 3C4QA 5EE3A 3WWOA 1PWEA 4XR9A 1US8A 4FCWA 3H7AA 4AY4A 2PE5A 1V96A 5KTNA 1CZKA 5GZ1A 1O89A 5IYZB 1DQYA 1EHYA 3BIWA 2XUOA 4HYTA 4DIFA 5ALRA 1DP4A 2OZKA 1E20A 4TKUA 1CZHA 4X97A 4F8EA 4OSEA 4XUGB 2A1TR 2HMUA 4ABTA 1SCUB 1FVHA 3IA2A 4H4EA 1BCRB 3W4IA 1E1YA 2M6KA 2WF7A 1PJLA 2HU8A 3O1HB 4JENA 4KDRA 4Z1MD 1YQDA 2YFKA 3BSWA 1HNNA 1THMA 4ED9A 1XTQA 3ZYCA 2K5UA 2MSDB 2REQA 2X58A 3GROA 1VI2A 3M33A 3ZQKA 2ORVA 1M8PA 3FMFA 2NU8A 3K96A 2YWHA 3SXUB 2D06A 3KYCB 3X1DA 3LRPA 4OP1A 2HA2A 3D7LA 2JHGA 1T26A 3O4GA 2JGLA 1BYUA 1T5TA 3DTTA 3HPRA 4G0QA 4I55A 4J94A 2Q9CA 4R40A 3RVBA 3S2YA 4EHJA 2VS1A 3UMMA 2R11A 1IZ9A 2ACWA 3D3JA 5AK5A 3RAFC 3FKJA 4HEA6 1MQ9A 4MQEA 4MGZR 4WKPA 1ZH6A 3ZTWA 3FNBA 2EBFX 3M6LA 4EF4A 4OKIA 3ROGA 2VYQA 4J75A 2I2BA 3NOXA 1WPQA 4P82A 4UE2A 3FMGA 3ICQB 5CCBA 1UR5A 1G8KA 1I2MA 5H8WA 1XL1A 4HTFB 3B7PA 5T67A 2G7ZA 3KR9A 1MQSA 1W8DA 2VPXA 3EZNA 4WY2A 2DZDA 2P9TA 2DE0X 2V3CC 1NVDA 5KMGB 3RSLA 1UM8A 2X0RA 2OOKA 3IERA 4JMLA 4RVDA 3BD6A 1QK3A 3CZRA 2DHCA 3VA7A 3G2OA 1EFVA 1ZZEA 4QX6A 4OLHA 1M2VB 2AQKA 4JVMA 1POXA 4AQYB 1EG2A 2Z6AA 2GCPA 2DM6A 2WILA 4K9NA 1Y3CE 2P9CA 2ODQA 3LWBA 5ALFA 1E9SA 2G9NA 5DBGA 4DG8A 1DQSA 5AP9A 1DTWA 2FEXA 3GNLA 1BMTA 1V5GA 5GJBA 5EHXA 2ZYAA 4KHPB 3LF1A 1Z4JA 4WXEA 5JH7F 4W5QA 1YZTA 1LLFA 2EIXA 4TRRA 5EP3A 4C5CA 1SZJG 1JB9A 2B25A 2ZRHA 1NFQA 2TMGA 1VG1A 3OEHD 3R6LA 3U31A 4DNQA 3MWEA 2RH5A 1WD5A 2WAMA 3F90A 4LVOA 4NVRA 1X1DA 1R6VA 1DC3A 1E8NA 2H2DA 1ZVKA 4RK6A 4M9QA 4DJDC 3CRZA 4OQYA 4QYIB 3RS9A 1J8VA 1L7QA 2F4NA 1GGHA 2XCTB 2B1RA 5DK6A 3GGGA 3BCRA 1DTSA 4FZJA 1NQXA 1KZ9A 4H08A 1QLJA 2D74A 3BX1A 3GO4A 1OAOA 3RBVA 1YBAA 3TYXA 3W4KA 1RXVA 4G1FA 3K70C 2PLRA 5JECA 3TTSA 5HQ3A 3TWOA 4IDNA 4MCJA 4FMPA 3K1AB 2N0SA 2CMHA 1V2GA 4FNGA 5FAXA 5JCJD 3GUHA 5BWNA 4H77A 2REBA 3OEHA 1NKVA 4X45A 4BLSA 4J6EA 2JFNA 4PAOA 3FHTA 3GJ8A 2XGSA 1NW8A 3IHWA 3K0KA 2GCIA 3PQ2A 1P6QA 4XLLA 4AXXA 2C8JA 4JI4B 3FY4A 2CL0X 3JD1A 1D6JA 1DMRA 1Y9AA 4C4OA 1KRWA 3GRZA 3C3CA 4U2GA 3A7EA 1CC1S 2KB0A 4MW6A 1B0UA 1JQ5A 2HA6A 2NNWB 1V4NA 1Q3KA 1SRRA 1VKHA 1YJCA 2XJ9A 3AUFA 1CJMA 4LNUB 4G5SA 4LXHA 3TZCA 1FFDA 1KQPA 2YV4A 2QMZA 3K0AA 2Z8YA 7AT1A 4GX0A 1NWHA 1KF0A 4Y2XA 5F2NA 5LDDC 5T8KC 3UENA 3CO5A 4EY4A 1W9MA 2JGKA 3QMWA 2Q8PA 2XCLA 3LHSA 4D9FA 4YAOA 2ZYRA 5BMVB 5LJIA 1GGVA 2GXAA 3VVCA 3ND9A 4NEQA 4YMIA 1XB2A 5JC8A 1WMDA 2F1IA 3WL6A 3GAAA 2NUTA 1UXJA 5CK4A 3T41A 4HN4B 3E1SA 1YB4A 2O6HA 1LPSA 1N2JA 2IQ5A 4MWCA 3RREA 3O7WA 1SKUA 3DW1X 2XOKD 1BEZA 1AIPA 1ID1A 1UBHS 3ETCA 4WIAA 4U7JA 1CDDA 4U2BA 4K6GA 1Y9EA 3UT5A 1P1CA 4CIAA 4CUZA 3LPAA 2XWSA 2APJA 3CUKA 1IK6A 1N6RA 3U3OA 1RAEA 1FQOA 1IQRA 1N9GB 3AEUA 2YWBA 4AG6A 4KWHA 5JR3A 1ESNA 4DR1B 1GTRA 4CT5A 1Z2OX 4KK4A 4XM0A 4W8HA 5EA2A 1NQWA 2PZGA 2PZBA 1M7GA 3E3AA 4DR2B 3U7FB 1TTPB 3UHOA 4B4VA 3KKNA 2AC2A 3K0HA 1E4EB 3C24A 2JS7A 2YMLA 1DARA 1MDFA 4J0DA 5T6BA 4AYTA 3C7KA 4BMVA 3GCXA 2R1VA 2W6IA 1KNXA 4TUYA 2EFEB 1IXKA 1C80A 1CUBA 1QQ7A 2O3QA 3UHJA 1DDOA 1KAOA 3V1KA 3A7DA 1A71A 4G0NA 4ASUD 4D9BA 3CH6A 4YDQA 4P93A 3B5IA 3F8SA 3ERCA 1NYTA 3FPSA 3JSAA 3L8HA 1R9NA 1IHPA 3A3PA 3AHJA 4MA5A 2FGKA 1Z7BA 4FBMA 4A27A 2O14A 3TW6A 1EAYA 4D79A 3BEOA 3WLIA 1L1FA 1S2MA 5K3EA 4MKRA 1YJAA 2PX0A 4FJ2A 3ADKA 4Q00A 2WF9A 3ZR4B 2QL7A 4XPIA 4UBOA 3TB6A 2HDWA 3B51X 2BM1A 3GCGA 1SVLA 3OZSA 4KX3A 2QRGA 3VSEA 5KYVA 4DMCA 2DHQA 2AD1A 4WNAB 1FDWA 1THTA 3ABZA 4JFRA 1MO4A 4JJIA 2C4HA 4ILKA 4WHMA 4YRJA 1E9AA 2GM3A 1CWUA 4QOSA 1U8AA 2VZ0A 1E1QD 2BAGA 2PZLA 3PPIA 3CRW1 1EP9A 1SIBE 1ZJYA 3A3NA 2WUVA 5TR9A 1SA0B 4OQPA 3ZXXA 2A5DA 1T2UA 1KAGA 1KOFA 3BJZA 3RVPA 3CWZA 2G63A 2ZE7A 1KVTA 4CIDA 4J76A 3FG9A 4KCGA 1N7IA 1W59A 3SJBA 4LRXA 2I2FA 3NHZA 5HMLA 1FSPA 3LBNA 2FR0A 1MRNA 5BN4B 1LH0A 1BIFA 3BK7A 2GAFA 1ZBQA 3CJTA 4GSKA 3W5VA 3GLUA 1SHLA 3LFUA 4DLYA 1NFFA 1EIWA 1I10A 1YR2A 3QU9A 5FA6A 1ZNYA 2VXBA 3C3DA 4BX2A 1K7YA 2RBKA 1FMJA 3LCUA 5EXDA 1RXEA 2IHZA 3NR2A 4NBWA 1ZNXA 5K45A 4C4PA 3B9RA 3S8EA 3IQWA 5B2ZA 1TLTA 2I3AA 3V4PB 5LN1A 1E18A 3OMXA 2C4NA 1GIAA 4JS0A 5EJMA 5EIAA 3SMQA 421PA 2FQYA 4ND5A 4JP1A 1UPBA 1IK4A 4EL0A 4RPHA 2QHXA 4RJJA 1T4GA 4R9RA 1QHNA 5B6IA 3KP1A 3WL3A 3NV9A 4BQQA 3MERA 2IXTA 1QGDA 4FYXA 4PZPA 5ADHA 3FDJA 3R3VA 3WXBA 3Q8KA 1M1UA 3RYIB 4R31A 3GWZA 1RVV1 4EF5A 4HWPA 4YIHA 1CKEA 1QYCA 3JYOA 4KNVA 1P9LA 3EVTA 4OU4A 4EGAA 3SZGA 2R68A 5F78A 2HV8A 3JALA 4L9RA 3LYUA 1XUOA 1RWVA 2CLKB 4KR7A 2RHBA 3W1VA 3HS3A 4KXMA 4K6MA 4Q01A 2CL6X 2NT4A 5KQPA 1XLUA 2QTVB 3U2QA 4LXYA 1UZUA 3ANXA 4G4SP 1BXRA 2XUQA 4G0VA 4BX9A 2UVPB 5JPDA 1UBJS 1PZHA 1ZI9A 2MINA 3T5DA 1JLRA 1YOVA 2JHPA 2VFAA 3COVA 1IULA 2WMNB 3MCAA 4UHJA 1B74A 3KRTA 5CFZA 5JH7A 3GQVA 2BKXA 5CIWA 5M7EA 2GI4A 4ROTA 5F4BA 5DI3A 2WT4A 5G2OA 3HWSA 3W6OA 1TIBA 2C1EA 2VF4X 4OUDB 1E5LA 2BD0A 5I5EA 2BEKA 1JGTA 2VNSA 2Z5VA 1QZUA 4P08A 1APBA 1H2RS 3U4IA 1RC0A 3SR3A 4YRFA 3ZHCA 1FXWA 3M5CA 5BSWA 1THGA 1RPJA 1KYQA 1QRDA 3DMRA 4D5EA 5JNVA 4DV1B 3LT5A 5DN9A 1GZ5A 4D9IA 4QO8A 2JVIA 3G7NA 4ZVSA 3ZIDA 1FSSA 8MHTA 4EY7A 1XNHA 2B7BA 1L7VC 3RS4A 1MFZA 5BSEA 2PWPA 5HW0A 5DULA 2VZ9A 1NVAA 4O4JA 4P7JA 4F0JA 4A0RA 1ZOIA 3FWNA 2Q8NA 2WYWA 3HLKA 1EE2A 1QK5A 2Y68A 1Z5VA 2BR4A 1SZPA 3SBOA 5AK0A 2W2OA 5K0LA 4J16A 1VMEA 2WG0A 1VI6A 4JOSA 4W1SA 2VJLA 5P21A 3W77A 1HFKA 1U2EA 4XA8A 2D1TA 1P6UA 3BXXA 1H85A 1VP3A 3S28A 3EQ6A 1KZ1A 1QBKC 3NTLA 4B3XA 2QUJA 3ZWNA 1WHTA 3M3HA 1LQUA 3B7WA 3QBJA 5M3BA 2IHVA 3HUTA 3EEYA 5A4AA 4MPRA 1FU8A 1ZGBA 2B99A 5HM8A 1KQOA 4ALNA 1G5TA 3JQGB 5DXJA 2D5AA 3EVZA 3LP5A 1B8PA 4EKNB 2KHZA 3KT8A 3SS9X 2YOGA 3D4PA 5EESA 1U0NA 2RBEA 4CM1A 1OVMA 3K20A 4LJ9A 4RYDA 3C14C 5JEEA 3AF5A 5KCZA 3IR5A 1G16A 4OHZA 2PZFA 1WUHS 2IA5A 2AKEA 3H0CA 3RC3A 4PQFA 3ANLA 1BX0A 4LHWA 4C3ZA 5JT1A 5JANA 2VZEA 4GOJA 2L19A 1EKXA 5ILQA 3K70B 2P7IA 1ZD5A 3PJFA 4UUOA 3WHIA 3F6CA 3W5DA 1BKSB 5U9CA 1Q14A 2YY6A 3FCXA 5E3IA 2B8NA 3ELDA 3T3IA 1LI5A 3K4QA 1BHO1 2KQUA 2WJGA 4EI8A 4HVLA 1MX5A 4NNJA 5B1YA 4X6XA 4JYPA 4KIUA 5AVVA 2JG3A 2AC4A 1CEEA 1EBUA 4MW4A 4YWJA 3DAFA 1GZUA 1KMMA 1KI8A 1YQEA 2QGZA 4NYIR 4HV4A 1HZZC 4YRDA 5ILGA 3CVUA 1U7ZA 1V3TA 3EJ6A 4P2GA 1E6WA 1T8TA 4YROA 5IG2A 3AKZA 3SSAA 4EGFA 4ID3A 4A6PA 2Q0HA 3LQYA 3CCCA 2IBMA 4FEAA 4D3YA 2WNHA 1EGMB 1XYYA 3AWDA 3FJ1A 4QBTA 3THSA 2A9VA 1OZAA 2AD5A 4FGZA 2IH4A 2C57A 4NFLA 1H3NA 1H9BA 1AKMA 5HFAA 4P9NA 2CV0A 1ZC4A 2R85A 2WDZA 2XGMA 5LQRA 4J03A 5CGQB 1RI5A 2FPPA 1PLKA 1QHGA 1R12A 2EKPA 2H57A 2VXCA 1AMUA 2W2LD 221PA 1KYZA 2QP4A 4PLTA 5DBEX 1RQPA 4FZVA 1JIQA 3TRJA 4PG6A 3RPEA 1ZCJA 4EDHA 2AOWA 3D6AA 3Q5EA 3GQBB 3QFRA 3C7TA 4LQ4A 1UBFA 4MWZA 2JGEA 1VECA 1XF9A 1VJRA 3OHMA 5C18A 1J9GA 1NC1A 1SUSA 4P0TA 3A3YA 3ZHBA 5A5VA 4KXLA 3AR9A 5KYUB 1USGA 1GL3A 4JUCA 1QH8A 4Q1DA 4ISBA 4EITA 3A4LA 4YN3A 3NUQA 4FIZA 4LXXA 5TEWA 1ILEA 2ECFA 2YXLA 5B7PA 2AW5A 3KSDO 4WN9A 2BFBB 3NASA 3EZ7A 4E5NA 4LJYA 2GHIA 2QX6A 4IDEA 4JLVA 3A3KA 3L0BA 1D3AA 2WAOA 2XF8A 4YPFA 5DX0A 3PV0A 1F20A 4BNVA 4ZGGA 1WM1A 1KXZA 2V4MA 2ID4A 1UJMA 3MXTA 5FL7D 4GX2A 4RZ2A 3SSMA 3QGMA 3RNOA 4I4IA 2A5YB 3QPWA 1JG3A 3N28A 1X1QA 4HKTA 4JLOA 4A10A 3V4ZA 1SGWA 3UFXA 1VSUA 5IX8A 3UJNA 3V7WA 1MW8X 2G04A 1CY1A 3ESQA 1F9AA 5LP1A 1RAGA 2VP2A 2X76A 2RJOA 3PL1A 1X1SA 3HLTA 2GH1A 4ZARA 4I1PA 2UDPA 2AZ4A 2QTMA 2E87A 3KJNA 3P2IA 4L1KA 5IHXA 4UHDA 4K8OA 4FGJA 4Q18A 1X7YB 2C7BA 4MQ6A 5H83A 4D25A 2HF8A 4PFJA 4FGWA 3IXQA 2G25A 2MDTA 3KSZO 1F2UB 4ZI3A 3ZCUA 3U19A 3NG1A 1JJFA 2GCGA 4DBLC 3OX4A 1YJ8A 4LDQA 2OC9A 2XUJA 4BLVA 4F21A 2FDCA 3WLTA 1WXEA 4XX0B 1SVWA 3HN2A 1BEUB 1TA4A 1YQQA 3KHSA 4RADA 3S68A 6PFKA 2Q1XA 3X2EA 1M2HA 4DR7B 1PYDA 3QWFA 2GF2A 5A2GA 2QW0X 1G98A 2P65A 1OHHA 2QDXA 2ZJ7A 3DR3A 4M3NA 3V33A 1V48A 4DQ0A 4UBIA 2W2KA 1TAHA 1TM7E 5G41A 4MYSA 4BUCA 1C30B 3K1YA 1G8HA 2D1SA 5CLLA 1DEXA 3TQSA 4D0RA 4EUHA 5I8PA 2QLFA 2I6QA 3H05A 3RAPR 5C51B 3ZVRA 3WMGA 2Q2WA 4UCQA 2ATVA 1M2FA 2YR0A 3B2QA 4WVFA 3JVIA 5F35A 3ZEAA 2V6BA 1KSGA 4H1VA 2UZAA 3IYLW 4EHHA 4YCBA 5LQCA 3D1LA 3TLYA 3HO8A 3CURA 1PSDA 3RS8A 2QKYA 2BHTA 4R1LA 4I99A 3RR2A 1W2GA 3VC7A 3T5MA 3JU3A 2H9AA 4TS9A 4D8XA 2HC9A 2QPLA 3HGMA 1T0IA 4C2BA 3RU7A 5JO0A 1GTSA 4OIFA 1ARZA 1POWA 3CPEA 2OY0A 4MR9B 4R16A 1I5RA 1IXRC 2VUIB 1AB6A 4XJSA 3VHXA 1YIAA 1JJVA 4RWEA 3EXIB 1QB8A 1TO1E 5AOAA 1NASA 4HNRA 5CB4A 1RJGA 2JPDA 4DJJA 4X20B 3RUCA 3FKSD 3USZA 2AOUB 2VDWB 4ZV7A 1MNQA 4TMZA 3IBCA 4P7FA 3Q10A 3NJ8A 3MIIA 2A94A 3K5IA 4B7AA 3OECA 2GX6A 2YV1A 5IMSA 2GEKA 4LZOA 1ZVVA 1X0XA 4ND2A 4XQGA 5D8DA 2BTEA 3HY6A 3BB3A 2W4IA 4PO9A 3WZ2A 4EJ6A 4QOEA 1U9ZA 1SXQA 10MHA 3NHRA 4B43A 4Q7JB 5NULA 4XWKA 4D45A 3WTBA 1EVKA 1ZGJA 4XQ9A 3AKDA 4ER5A 1GQ2A 2JIDA 2ASVA 2HJRA 3D4NA 1D9ZA 2Z83A 4D9GA 1UH5A 2QPOA 3L84A 3T3NA 1WCV1 1SOWA 1W7AA 5I3ZA 4FT2A 1M2JA 3Q6NA 3DAOA 2GF0A 1NPDA 1ZVMA 2BY4A 1JBKA 9GPBA 2MSLA 3DZJA 3WKDA 1O0SA 4LK3A 2VT7A 5JROA 1L7DA 1NVXQ 1T3ZA 2IVFA 1WXXA 3K6JA 2QE7D 1J39A 3O4JA 4J16C 1SC4A 1ZM9A 5FQOA 3KSAC 1KO4A 2RGWA 1W9HA 3Q3HA 2X0DA 5FLEX 4DLLA 5FLXA 1WUTA 1Q5PA 1QFYA 1QZTA 3QENA 1FP4B 3AY6A 4QBFA 1WBBA 3KJGA 1AGXA 4I4TF 4BO7A 1QVRA 2OLJA 2VF8A 4WERA 3S44A 1EFLA 3I23A 4Z6KA 1UP7A 4M0KA 1MUUA 3CXRA 4R9SA 2IELA 1SXJD 2VPYA 3C3JA 3W6UA 4CDGA 4W9MC 3C1TA 1KEZA 4X1KB 3IOYA 1IWPB 1FNBA 2YJZA 3EGDB 4I5IA 4Y2HA 4M7OA 4YQEA 3J81k 3MAJA 3SMVA 1T4DA 4M22A 4B9AA 4ZQGA 1R6BX 5KWVA 3CFYA 1OT3A 5F9HA 4O0LA 3VJRA 1JEQA 1SUPA 4X3CA 1FRFS 4NBUA 4Q12A 3QSGA 3ONVA 3WDMA 1YFLA 3HVKA 1SVSA 1E6MA 1T0PA 4UBJA 1J90A 1DQPA 4CR7A 4GRIA 5IWCA 1FMFA 4E5VA 1DJQA 2O9JA 4QGFA 3QVOA 2BFBA 2Y9MB 1MO6A 2EYUA 3L93A 1WXGA 2F64A 3MSCA 3JQ6A 2QRHA 3NVMB 4P32A 1NBAA 3RU9A 1QKJA 1BE6A 3ASVA 1GPNA 3CF0A 1Y5LA 5HG0A 2NUAB 1Z8HA 3Q9UA 2ZQYA 2WHPA 4RQTA 3HB9A 2R62A 4J2OA 4E5PA 2ZJYA 3IEKA 3QFSA 4GKKB 1QFMA 3DGEC 1P7CA 1TMYA 1O5IA 2GKGA 3DLAA 4P4SB 4TTPA 3OEED 5BURA 1R0WA 5JQGB 3CLVA 4FBLA 4L9WA 2ZANA 4JKIA 4BHTA 3EX7C 4MARA 4LC1A 1WBDA 1H65A 4IGKA 4DJEC 1ADYA 4G5XA 2Q9AA 4E5SA 4G36A 1QGED 4XTRA 1VJTA 2LGJA 3CW9A 1Y9JA 2WUGA 3QYFA 4HAXA 1JFLA 2WT9A 1N5DA 4ZVVA 2PL1A 5C37A 4B79A 1FFXA 2GO1A 5K0JA 1F17A 5CDHA 3KHTA 3MGCA 4I5DA 2GN1A 1I80A 5DISB 2UUOA 1E1DA 3THYB 1W5EA 2XIJA 4WRRA 4F3CA 1X7WA 1QH1A 4H7JA 1DCMA 4A2PA 2XE6A 2FHSA 1EEHA 2QT1A 3D6TB 3CXUA 3L49A 2R65A 4N6GA 1ZUD1 1DAMA 1QO9A 1C50A 1JEJA 1T8RA 3IQHX 3MT0A 4KG7A 2NZYA 3JRWA 1ZN2A 2DPLA 3WB9A 5BNIA 4QQNA 1OB2A 1SHJA 2P4UA 3GRYA 3HXLA 4R9VA 3TJMA 4QASA 1NUSA 5HIJA 5DM70 3OJLA 1W4CA 2AS0A 2JKZA 3MG9A 3WWCA 4GUAA 4MVJI 1G7TA 4BKOA 4F12A 3WIUA 3R8FA 4G8JA 1FFAA 1UM9A 1CVRA 2DR0A 4G01B 5CTJA 4F3YA 1G3RA 2JFBA 2JEOA 3FN4A 2QXTA 3PRYA 4GOLD 3BRCA 3ILHA 2W2LA 3FI0A 3NM6B 3ACCA 4OL9A 4PXSA 5KKAA 2ZWMA 1LNSA 1SELA 1XVVA 1Y4SA 5CCXA 1GP2A 2QR2A 3SC4A 4BXOB 2ZBVA 1YOBA 4IFBA 2JLSA 1EVJA 1OWMA 4YMTA 2G4CA 1M54A 2BUCA 4L5JA 2WYUA 4G4SO 4LOAA 1Q1ZA 3ABOB 3GLKA 1K9VF 1U3TA 4O1HA 5TGZA 2ZBUA 5EIBD 4EKIA 4OX9Y 2GBLA 2J9FA 3NDPA 5AW1A 4GU5A 4DSOA 1RFGE 1WPXA 4HI0E 3BGIA 2O4CA 3OUTA 3SPXA 1QDLB 1O57A 2ZWPA 1AHPA 5JJ5A 4WLNA 2BHNA 1R8YA 4N03A 3COZA 1KVSA 5EYPA 4M1WA 1XMQB 3PX2A 2YYZA 2AJ8A 3QU2A 1JHPA 4ZVTA 2BM0A 4MO2A 1QP8A 2KBEA 3WKCA 3COWA 3P94A 3S1LA 3VH2A 3GLTA 4ZCPA 4CKZA 2VJPA 2PUTA 4I8DA 5DB4A 1E5QA 2Q6LA 2R00A 1CR1A 1S8OA 1JJ7A 1COWA 1C1HA 1ISRA 2OP1A 5E1DA 2G08A 3LUFA 3S1AB 3T9DA 1WUIS 1ZD4A 2O5VA 3NHAA 1E9VA 1ZPDA 1Q0LA 3W5BA 2CXTA 2JIOA 1C8KA 2F9FA 2ICAA 2IOFA 2G40A 4ZQEA 1F1JA 1KMNA 4P3XA 4QXRA 4TV9B 4AW9A 1F9EA 4L2IA 4J9VA 4KN5A 4ZEXA 1G8GA 2EFGA 2GILA 2CVOA 3ROXA 3WLHA 2D4AA 3MTAA 3WADA 4EI7A 1Q2UA 1WLSA 1HE8B 1NLFA 2ZYIA 1RRKA 3LLVA 4ZQFA 5M2QA 1E6UA 1J5PA 3E70C 5E6UB 4WJLA 1ZR2A 3B2NA 5EQTA 1LU9A 4KQEA 1QQTA 3BCUA 4CKBB 3HP7A 1P6XA 1TJYA 2K2QB 3KKQA 2OFFA 4KITB 1HG1A 2FZ4A 1RDFA 1M3SA 2O52A 4MPDA 4O08A 3VNSA 4XGNA 5AK6A 1IB0A 4B46A 3ISTA 1G9TA 4JBGA 2C29D 3R5KA 4Z1OA 2EZUA 1DOHA 1YQXA 2FZEA 3MNFA 4U8HA 3G1TA 3QPDA 2JARA 3N2GA 4JQSA 1W36D 3HU1A 1PG2A 4KE7A 2DKFA 5SV2A 5EKDA 4LJLA 1NF9A 3K94A 3FYUB 4HQ0A 1HE4A 4JL8A 1T2VA 1UKYA 1Z33A 3TTUA 3U4GA 3V8MA 1KI6A 4KH0A 3OMWA 1TEXA 3FRIA 4DDTA 1PR0A 4XDZA 2X0NA 4M1YA 5BVHB 2VEOA 3GJTA 3K0EA 4HDSA 1U1EA 2QT9A 3RQSA 4W1RA 2FUG6 2GBFA 1P0PA 2VSXA 3GT4A 2ATXA 2Z1MA 2Q4TA 1NRJB 3QMVA 1GV1A 4LHZA 4MQLA 4ZO4A 4E7PA 2YC2C 3RU3A 1TVKA 3KVVA 3CH5A 7GPBA 3A2MA 1DWPA 5D51S 3BXPA 3AIKA 2VJKA 2ZRQA 3L40A 3ONDA 1NSFA 4PSDA 3PR2B 5AO9A 5IAJA 4FOSA 3OPMA 3L8EA 3HDHA 4ZAXA 1RZRD 4KQCA 2NSJA 3AQIA 4E7OA 2Q6VA 4QGBA 3R7FA 3KTFA 4GZ5A 1CULC 3RHFA 4M7PA 3O2JA 4DW8A 2DSNA 4GMKA 4IEIA 5HILA 3NHSA 2J5RA 2BR3A 2Y0PA 3PPXA 4HDQB 5AUPB 5FL7A 2BEUA 5E4TA 1ND6A 1OE0A 1HYQA 2O3JA 1M74A 1Z5OA 2VP0A 4IV5A 1CHDA 2DHDA 3OHSX 3VX3A 3HI6A 2AMLA 1WKBA 1YZVA 2N46A 1U4OA 2VP4A 2C07A 4KH1A 2XQVA 4WFKA 3QWAA 2ZJ3A 3BWVA 3I0ZA 1ZRHA 3LQ2A 4YRAA 3GLGA 1VJ0A 2CUNA 1OWOA 1HM5A 3G9QA 3RRNA 1LSJA 4FTWA 4HUJA 4N0DA 2P9QA 3WIVA 3ZE6A 2AX4A 1E0DA 4E30A 3OFJA 5BVHA 1SKYB 1K4YA 2WUWE 3OFKA 4QA9A 4TMVA 1AKWA 1EUCB 2PUJA 3HN6A 3LY8A 3IR6A 4EUSA 2XQIA 1P1FA 3EXAA 1DIHA 2D2VA 3M8KA 4FHCA 2ZW9A 4JX9A 4YT5A 4O25A 5JSYA 3G1UA 3WMFA 2VJDA 4F04A 1J00A 4J91A 3GT7A 3RI3A 3EDQA 5FWYB 3V8PA 1I5OA 1XTRA 4IZ6A 4KUEA 4YRQA 4KOEC 5LQKA 2CNOA 1FVXA 2G4LA 1B43A 2BI4A 1JNYA 1H3FA 3H1BA 5EIOA 1QDUA 3NXSA 3ZHUA 1HNWB 1JDJA 2OO3A 3P52A 2K7FA 3T7JA 3UVEA 3T06B 4LHXA 1S2OA 4UAUA 4HDOB 3N74A 4UDNA 1JIIA 5JBIA 1DC4A 3EY4A 1BW9A 4L3OA 5CAEA 3FHOA 3C8UA 4ZJZA 3V8EA 1LRLA 1TCAA 2H2GA 4BUJA 3UTCA 3WZMA 4KJXA 3PIRA 4KRXA 5I8WA 5INTA 2V7VA 2QXUA 5HIKA 1ZI6A 1B3RA 1IIRA 1MW9X 2CL7X 2G4VA 2O8VA 2VP3A 3HDGA 3JQDA 3PNKA 3SEAA 1E5VA 3L7DA 2AQIA 4G97A 1OV6A 2XBLA 4JLWA 3IMEA 4PLCA 2VYND 4TV9A 4ZJUA 1NSTA 4I66A 1CQZA 5DGTA 5LVAA 4JUBA 4N0EA 4WXHA 3SBXA 4CMGA 5IAOA 5TQ0B 2X15A 3QTBA 4P4TA 1T1GA 1P2GA 3K70D 2OYSA 4EO4A 1NUUA 3RC1A 2JCSA 1Y5RA 1T2CA 4ZPJA 1CEXA 4DCUA 1Y1PA 1DIAA 3PLNA 2TS1A 2X9QA 2WJZB 2ZI3A 4KWIA 4MI6A 3ZNOA 4PG7A 4GX1A 4CTKA 4OREX 4Q21A 2OXTA 4ZVKA 1ABBA 3NGLA 4TX1A 4C22A 1HORA 1U3VA 1KL7A 2CK3D 5EZYF 4EFMA 3B1VA 5L6MB 4U2EA 3TAHA 1PWXA 2A14A 4R9UC 5EYPB 1XAHA 1WUKS 3NIGB 4C0XA 4DTCA 4PTLA 3ONWA 2QUHA 3WAGA 3Q0TA 1L8OA 2I2CA 1FRVA 1X1CA 3HKEA 4RD1A 1NIJA 2D3WA 4CTJA 5KOHB 4DA4A 4QHYA 1E79D 3E81A 4TWAA 3W9BA 1ZKDA 4RAOA 4NCHA 1G6HA 2XVMA 4H18A 4HNVA 1RLJA 2IUTA 2Q7XA 1K6IA 2YV3A 4MRRA 4AMBA 1XTUA 2VQSA 1EYZA 2W2VA 3E3LA 4NI5A 1R4ZA 2BKLA 4QQ8A 3VUFA 3OLVA 2A1TS 1K0FA