5SZIA

Structure of human rab8a in complex with the bmerb domain of mical-cl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
174
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords Ras-related protein Rab-8A
total genus 46
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5sziA00
1E79D 3K0FA 4NKRA 2I3BA 2HV8A 4MGIR 4JZKA 3TQFA 3W5JA 3RS5A 4CRWB 2C03A 2ERXA 4M9SA 2XZLA 1QG2A 1WDTA 1ZUNB 5KUTA 4I81A 1IN5A 4B32A 4TQ9A 3H1TA 1MH1A 1DEKA 4DDUA 1U0HC 1G3UA 4KYUA 4NE2A 4QNRA 3UK6A 4ZDIA 1DADA 3LAWA 1FNNA 2GAAA 4IEIA 1NF3A 3P20A 3RYTC 2O8EA 3Q9LA 1PV4A 2QMHA 1FQKA 1SXJC 2L0XA 3CPHA 3AP2A 4LYHA 3SN6A 3U7FB 5KDOA 3KUCA 4IW3B 1C1YA 4BUJA 2VH5R 2W0SA 2HCJB 3X1YA 1TEXA 5AJVB 1G3MA 4QHTA 3LWNA 4TL9A 2C2HA 1LF5A 2EWVA 2NO7A 1ZIPA 4Q21A 1ZW6A 1KI6A 1A5TA 2CK3A 3K9GA 4EPWA 3B1XA 2CVFA 2QT1A 2VSFA 1KK3A 2P6NA 4AY2A 4F4IA 2VHTA 1JJVA 1Z6YA 1NG9A 1SHKA 2RH5A 2ODEA 5FPYA 1H65A 1SVOA 4IHQA 5FL7D 3A1VA 2OZEA 1RRFA 3K53A 3NIBA 4IJMA 4PSVA 4YMTA 4WXPA 5CM8B 1E3MA 1ZM9A 1G3IA 5BW8A 1VCOA 3LLMA 4G5RA 2FPMA 1OXVA 4FCWA 3B1YA 4YONB 3BXZA 5UKDA 2GXUA 1NNEA 4Q5IA 3DO6A 4MGYR 3OHMA 3WBJA 4II7A 3TNFA 4D26A 4TTRA 4DDWA 2FX3A 2JLXA 4OQFA 2VHUA 4GDFA 1BKDR 3H86A 1YHNA 5FI0B 1K8RA 2ZRHA 5KNDA 2QBYA 2WKRA 2FG5A 2WM9B 1WMSA 4HAXA 3AV0B 3U60B 5TV2A 3SBEA 1OFHA 1XTQA 2YJTD 2FSIA 1R2QA 3EIHA 4BLPA 2C99A 3VFDA 1NL3A 4N3NA 5EP2A 5FTKA 3LVQE 3OE7A 4JJZA 1P73A 2ASEA 3GJ3A 1OFUX 4OL0A 3EZ7A 4UXJA 2RGEA 5JSZB 2QRNA 3QE0A 4V03A 2LKCA 2NGRA 2WKQA 4PQFA 3SI7A 4AKIA 3QXHA 4FWTA 1YZTA 1CU1A 3KXLA 2Q9CA 5DI3A 1AQYA 1AGRA 2N42A 2FFBA 3A4LA 3K0EA 1KNQA 2QTHA 4BLTA 5FBRB 1OT3A 2DHRA 1NY5A 5HE8A 1XTJA 2OXCA 3QG5A 1W4AA 1T9HA 3B85A 5C2JB 1A4RA 3U3MA 5CITA 1P7CA 2ZS9A 2WIBA 4XVQA 5C4GB 3EA0A 1V5WA 2X8AA 3FMPB 1NN1A 2V4ZA 3BWDD 4EQ6B 4Q66C 2KJQA 4U02A 1N6KA 1J7KA 1IAQA 3R9IA 4O3MA 3RABA 1LTQA 3GJ7A 3B78A 4GFDA 5AR1A 1E4VA 3IIMA 3RS3A 3ZZ0A 4OKSA 4H1UA 2OHFA 1G17A 2XTMA 1Z22A 3CNNA 4JL6A 2C98A 4TWZA 3SJZA 2QMUA 3UIEA 3VNUA 5C4MA 4D4MA 2QAGB 1YZLA 3P1JA 1QHIA 1E4YA 2BDTA 4TMVA 1DG1G 2VP5A 5KSPA 4Z1MD 3FYHA 2KBEA 2NMVA 4NYIR 2RAPA 3TVDA 4ZIRA 2IX3A 3GEEA 5AJYA 2IUSA 2PLFA 4IDHA 3SYKA 1KZ7B 4NYMQ 3ND9A 1BOFA 4EJSB 3T34A 1XB2A 3A36A 1G18A 3VX4A 1Y63A 1P62B 2DFTA 5HZKA 2NOAA 4D0NA 3THWB 2VP9A 2BCJQ 4ZDKA 4TYNA 1E9FA 2HUPA 3MWLA 2FF7A 3TGPA 4NYJR 1OYYA 4S35A 2HJGA 4W5WA 4LHVA 1P60A 1W5TA 2WMNB 3LV8A 1KIMA 1T91A 2HLDA 1W0JA 1AQUA 1Z2AA 2WOJA 3AKCA 4ABYA 3PXGA 1CTQA 1IHUA 1JEDA 3QY0A 4PZZA 4URVR 2W58A 3QXCA 4RSGA 1XD2B 3ZQJA 5BWMA 1JB1A 1FQJA 2QBYB 4CGZA 1CULC 1KJZA 5JI3E 3CKLA 2IC5A 4B43A 2BKEA 3SHFA 5EQTA 4D25A 1NRJB 1TX4B 1H8HD 1JXOA 1SVWA 5D3QA 1VG9B 1IN4A 4BLSA 2IEZA 4LC1A 1GIAA 1GKYA 4WZ6A 5DI3B 1GFIA 1Q0UA 2W83A 3AKDA 1NG1A 4QBIA 2IS1A 3K0CC 4EIWA 2Z83A 3LW8A 4MITA 3VR2A 1HY3A 2FZ4A 1BO6A 3DEFA 1MABA 4LJ6A 3P27A 1EG7A 3IPYA 4QKQA 3LH5A 4NYJQ 2QE7A 3VR4A 1KI4A 1OSNA 1J8MF 4FW9A 3T1VA 5FBVB 4CEHB 2XGJA 2H57A 4B3FX 4JYBA 2JATA 3V4FA 1MO6A 1XEWX 4TLAA 4ASUD 2P5TB 5B64A 4B73A 3I5YA 1ZMXA 5EUMA 4A2PA 3ICEA 2D3WA 4GNKA 2GETA 2QRZA 1P5ZB 4O2LA 2O8BB 2IWHA 2ZU6A 3LXXA 2QQ0A 4WZBE 2IHBA 5FI1B 3D31A 2A9KA 4EJSC 2WVJA 1XCPA 2CCKA 1HQYE 1ZD1A 3W6PA 2P6UA 4GOKA 1YE8A 5HKKA 4YLGA 2UZ3A 2GJ8A 3Q3JB 3QVUA 4P4TA 4MH0R 3ZYCA 4V0LA 3U6BA 1KDTA 2O8DA 1Z08A 1KJWA 4HLUA 1IXSB 1WP9A 2VSXA 3DDCA 1AK2A 2XB4A 1YRAA 3VU9B 1UDXA 1JALA 1U9IC 3FGNA 4B33A 4G1UC 2ZE5A 2JJ1A 2FGJA 4G0NA 621PA 4OQXA 3GLFE 2WTUA 2QA5A 4DLSA 4Q1BA 2GF0A 1OH8A 4LK2A 721PA 1L4UA 4V0NA 1N6IA 3KTAA 2O8CB 3VHLB 3CRW1 1OLOA 1Q44A 2QSYA 2D74A 4QG7A 1ZUIA 4Q00A 1KO7A 5KSZA 4M1KA 1RRGA 1CR0A 2CDNA 2FSFA 3BB1A 2ERYA 2HF9A 4A0GA 1Z63A 2RHMA 2P65A 4MKIA 4Q4AA 2D2EA 3WNDA 2PZGA 1CR2A 5CIWA 2DFNA 4NCJA 4RCZA 1KI9A 4AKEA 5BYKA 5AWFC 2V1UA 4D4JA 1JPNA 2ZJOA 3NWJA 5JI2E 3R8FA 3IILA 3LBIA 4JIMA 5DYGA 1WA5A 5DI9A 3ZIAD 1XPUA 4DKXA 1XXHE 4AWXA 1MO5A 2ONJA 2BIFA 2ZRMA 2NPIA 3DKPA 5CLQA 3B5JA 3VKHA 3QXXA 3FE2A 2OFWA 2YVUA 2ZI9A 4LV6A 3FTQA 3D7MA 2W0MA 2ZRDA 3G82C 4DEXA 3UWKA 1G7RA 1Z0IA 3QUSA 3KJHA 2WJHA 1PUIA 1OE0A 1KSGA 3AB3A 4E5UA 2IYLD 4MKHA 3RC3A 2EFEB 5C18A 4LHYA 2Q9AA 2QUZA 4P32A 1GRRA 3FKSD 3OIWA 4OK5A 5FUXA 5J4KA 1UBFA 1RIFA 3UG7A 2ZE8A 1VG8A 4A36A 3CNOA 4M0LA 4KODA 3SU8A 1Q22A 2GEUA 5EP4A 5JRJA 1E2EA 1N0UA 4IXNA 3TW8B 1RPZA 5IK2A 1I4TD 1XMIA 2Q0HA 5JWOA 2VYFA 1TL7C 4JKIA 5G53C 5EE1A 1W0KD 3NBYC 4JLNA 3TR0A 1GTVA 1QRAA 4Q7JB 2XZOA 2TMKA 3K0SA 2VQSA 3RRYA 4JJKA 1RZ3A 1T8UA 1PJRA 2XSZA 3AEZA 3IO5A 3LX8A 3WRYC 1KDRA 4Q1EA 2J0QA 2AXNA 2DB3A 3RRZA 2F1IA 4A2WA 5EP3A 3VU9A 3O8CA 5ANRB 2IYTA 221PA 4B2LA 4QBHA 1NMZA 2DFKB 1GITA 3BH6A 1KI1A 1CRQA 4A0FA 1GP2A 4C2TA 1DARA 1PUJA 1OXUA 1VDZA 1LNZA 1XWIA 4PANA 4TLCA 4L15A 2P2LA 1RJ9B 3VR3A 2YV5A 4X8LA 1E32A 2ZYVX 1EFRD 1KJYA 4HLQB 5C1BA 4C0HA 4JLDA 2QT0A 4TYYA 4HYYA 4Q9HA 1E6CA 1OHHD 1ZC4A 3QKRB 3FHOA 5CK5A 3WMEA 2GESA 3QF7A 4B3BA 1R0XA 1KY3A 1AZSC 1ZNWA 3NEJA 2ZJ5A 3EC1A 3AKYA 2YOGA 3GMTA 5IF9A 1WXQA 2J59A 2GCOB 4ESVA 3DM9B 3MWJA 4PPNA 2OESA 1XMSA 1SVIA 2RMKA 3GPLA 1KMQA 1VCIA 4DEYA 1US8A 1DBSA 2FOLA 4IXMA 4Z8XA 2GVDC 4KCGA 2IS6A 2LWIA 3W3ZB 3T1TA 1Q21A 2YINC 2IS2A 3I61A 2B7BA 4IFBA 2O8FB 2OCBA 2HYDA 3AF2A 2JEOA 3MUFA 4HZUA 4C4PA 5JBQA 1JI0A 2ATVA 1Z0KA 4YMUA 4EQ6A 5J4VA 2IK8A 4FIDA 4NPHA 5GADl 1N5LA 2V1XA 1E1QD 1X1SA 4U00A 1PLKA 1S8FA 3BE4A 3QKSB 5H8WA 1Z3IX 4M2LA 4URXR 3QJYA 3GLGA 1E9AA 3K0CA 1GL7A 4R9UC 2ZANA 5BN4A 2PMKA 2ZRLA 2VEDA 5FUYA 1H8HA 1OXXK 1E9EA 1LF0A 2KWIA 3LXRA 4HB3A 2JJ2A 2ZYWX 3MJRA 3HU3A 4PAQA 1D2MA 2V54A 4I99A 3KB2A 5J5CA 4Q7MB 4TMKA 5GJVC 1M7HA 1SHZA 2VF8A 1DPFA 2JLSA 3B1WA 3KFVA 2CL0X 2J3EA 2VIIA 5KHOC 5FTJA 1Z6AA 3NBXX 4Q9IA 1W0JD 1EESA 1VMAA 2IYUA 4DSTA 4DVGA 2REBA 1HEIA 2WJIA 2IEYA 3TW4A 2ZJ8A 1U2RA 3CONA 4JLJA 2BKUA 3NG1A 1P2VA 1GNQA 1XEWY 2LKDA 1DS6A 5AUOB 2E87A 4GBMA 2NO1A 2J0VA 1KI7A 4Q1DA 1G3RA 3THYB 2RB4A 2D7DA 3O47A 5HKKD 3UXMA 3W8RA 5L3VA 2BV3A 1NIJA 2QENA 4A8JC 5DGXA 1JJ7A 3H2YA 2IT1A 1WQ1R 1B0UA 1XMVA 3SS8A 1G7TA 1E2KA 2GRJA 1UM8A 3UMFA 4A6XA 4BRUA 1C4OA 1R8QA 1T3LA 2CHVA 3SZRA 1FTSA 1H8EA 2ZS7A 5BN3A 2F1RA 3EPKA 2J41A 2GJKA 2W00A 2DY1A 1W36B 2OG2A 1VIAA 4C0AC 3Q85A 4DIEA 1FP6A 4PO8A 1XEXA 4W7SA 5LB2A 1BS1A 1DAGA 1HH4A 5FUVA 4IOLA 2CE2X 3X2SA 4M1YA 2ANCA 3GLIB 2FWRA 1EFUA 3Q8XB 3GLHE 5FPSA 3GLGB 2B6HA 1OIVA 3L0SA 1YZNA 4LWZA 5E3HA 1LVGA 4PO9A 4NDZA 2P5SA 4Q9LA 4AYXA 2WPDD 1GDDA 3TUJC 1FUKA 3W8NA 1P2SA 1LY1A 1VYVA 4TL8A 2OCPA 4JT4A 3QF4A 2N46A 4CT5A 2VSOA 1CRPA 2DWOA 1R0ZA 2ECKA 3F8TA 2WWXA 4YMSA 2BVNA 2D4HA 1E1RD 3GEHA 4M1OA 1G20E 2VTKA 4A0RA 3TUIC 2WHXA 3VR5A 4LGMA 1FUUA 4W5JA 2AFHE 3E70C 3LQRA 3R7WB 2B8WA 2H8KA 1CS4C 1NVVQ 3BJIC 4DC9A 2R6FA 4NCHA 2NTYC 3UATA 2BC9A 4G5QA 2PJRA 3ZVLA 3NEYA 3RS4A 4G01B 4LHWA 1ZYUA 4RVCA 1ODFA 3DM5A 2F3TA 4OHVA 1CR4A 2ZSEA 1JQJC 3I4LA 3CW2A 4BFXA 4TQAA 4AK9A 2X19A 2QMEA 2GAOA 1R10A 3PUXA 3AVVA 3CH5A 3ONWA 4NYMR 3TSWA 1ZNZA 3P4XA 2VHCA 3IQXA 3A37A 4HLUC 2QGNA 4LV8B 2RGNC 3GP8A 1MABB 2I1QA 4ZO4A 4DLRA 2C5LA 4L5BA 1G41A 4M1MA 1E2IA 1GNPA 1OFTA 2J1LA 1UBCA 5KNCA 4MUBA 2DCUA 2KI5A 5KSOA 3EW9A 2GF9A 5FH9A 1YZUA 3FKQA 4ESHA 4LHZA 1TMKA 4LC0A 3AGPA 4WXRA 4DDTA 1E0JA 4LBVA 4LV5B 1SVSA 1UBGA 2PBRA 4L4UA 4YDSA 2OAQ1 1U90A 5FPKA 1OH7A 2GZHA 3B82A 4DSOA 3CRQA 1Q3TA 1G8HA 1FP7A 2ZRCA 2FA9A 4OQLA 5DE3A 5IDVA 1XU4A 4WIAA 5FL7A 2ZXUA 1KO8A 1XNJA 4GT1A 1H8ED 4DCSA 3RDPA 3F0TA 4MA4A 4Q9KA 3AVYA 2J87A 1IQPA 4UXHA 4KYIB 4EPXA 2IYVA 3C5HA 4YDHB 1R0WA 4BGDA 1T8TA 4BEBA 4QHSA 1SZPA 1IOZA 1OV4A 2WMOB 4ZCLA 5JFGA 4TZ0A 2YOHA 2ZRKA 2PCLA 1DAHA 3FB4A 4MRSA 2G6BA 3WYGA 2E1RA 1AKEA 1NBMA 1P75A 4KSCA 3TH5A 5SZIA 1BH2A 1TF7A 2MMGA 1MO3A 1TADA 4HUQA 1ZIOA 3OEHA 2J7KA 3BFXA 4H1VA 3R8CA 2J9RA 1GAJA 3UANA 1P6XA 4KSBA 1YR8A 4KFUA 5E7MA 5GVSA 3U4QA 2GK6A 3KKOA 2ZRAA 1W47A 4P0TA 4PPQA 4RFSA 4DHEA 1LW7A 3K70B 3TSOA 1EWQA 3ZH9B 3CZPA 2ZS8A 4MDFA 1WE2A 4GZMA 3ZD7A 3PENA 4HSEA 3N2IA 1E2GA 4X8MA 3REFA 2CL6X 1QZXA 1YVDA 2A30A 2G9NA 2ZSBA 5JWHA 3UMSA 4W5HA 4KJZA 1V43A 3UG6A 1IN6A 5L3SA 1U8YA 4MGZR 3A1UA 1XEFA 3MFYA 1MR3F 1F2UB 1NMXA 4FMDB 2QEQA 4GMDA 4PZYA 5GJWC 4JLVA 1X8KA 4RD6A 1QBKC 2R9VA 3FHTA 1UJ2A 3E2IA 2ZRPA 2XOKA 4CEHA 4BWYA 3GJ6A 2QP4A 1O87A 3R9WA 1K5GA 2JDIA 2HXSA 3CO5A 3TIFA 4XTCS 1BYUA 2F3RA 2QPAA 3CUEF 2FFAA 2PL3A 1VECA 4TMXA 4PSAA 1AZTA 5JEDA 2XJ4A 2WAYA 5CJ2A 4B75A 2PX3A 4JSTA 3FFAA 4NZYA 5L8VA 3NDPA 5EUQB 1P72A 3EXAA 2ZRNA 1J90A 5JMTA 4RY2A 2OBLA 2H16A 4DLWA 2QGZA 1NP6A 3KUDA 3QBVA 3A8TA 2GXQA 4YXWA 2C9OA 4R71A 4OJQA 3S1AB 1OW3B 1VCMA 2OUKA 5B57C 1G291 2R62A 2XNDA 3JVVA 4G5SA 1OHHA 2B92A 2BJVA 3KXIA 2F55A 2SHKA 2N1BA 1JECA 3KZ1E 3PIRA 3QKRA 1R4AA 5CK4A 1AGPA 2BCGY 4A8JA 2IBMA 1ZINA 1IY0A 2GJ9A 3MCAA 2ZE7A 4TN1A 3RLFA 4JLPA 3EA5A 4HZUB 2NO9A 1QF9A 3H0KA 3EPJA 1YJ5A 1KOFA 3H4MA 3VAAA 4QM7A 4OBEA 5JCZA 5F98A 1S3GA 1LS1A 2OFXA 1G21E 1F2UA 1S9DA 1KYIA 2HDNB 1VTKA 2H7VA 4FD2A 4I4LA 4Q48A 2ZU0C 4I1UA 2FNAA 3RS7A 4K46A 521PA 2YWFA 2ZI7A 3TAUA 1IXRC 1Z8FA 4ILEA 1VKJA 5J40A 2ZRJA 4OYHA 1OXSC 5TMPA 4QGAA 1NVWQ 1GUAA 3SDZA 4C3ZA 3PQCA 4DLZA 4KFSA 4PAMA 3V00A 1OJLA 1N6NA 1ZAKA 4IOKA 1O3YA 3PUWA 4N0DA 3JZAA 2KBFA 1ZC3A 4TSFD 2QU8A 1A2BA 2KE5A 4FXPA 4HAZA 3T12A 4RFSB 4G5GA 2RGCA 3AUYA 2GXAA 2OM2A 4M9XA 3S1AA 5H68A 3C14C 1Q57A 1KK0A 1M8PA 1L8QA 3CRRA 4Q18A 3LQQA 3IBYA 1FPMA 2R6AA 2VBCA 3CF2A 4LPKA 2D2FA 2OE2A 2VL7A 1JXMA 3CIOA 4Q4HA 3VR6A 1G4UR 3DKVA 4HEJA 3K70C 4AKGA 1XZPA 2P6RA 2BWJA 5CIQA 4NU0A 4JLMA 3WYAA 4EPYA 4TLBA 3ADCA 5D3MB 4US0R 1E2NA 5ELXA 5TDHA 3K8YA 2EVWX 2JLWA 3U3RA 2DBYA 4LJ9A 3LBNA 4L9WA 1A2KC 3QBTA 1Z83A 2WJJA 4MYHA 2YC4C 4YXWD 4NTZA 2ORWA 4E22A 5DHFA 2GNOA 1XF9A 2ONKA 2AD5A 2RGNA 1KHTA 1XD8A 4MDEA 1TUEA 1HE8B 1K5DA 2VA8A 3K9NA 4HB2A 4OHZA 4US2R 4OI4A 4PO1A 4EFLA 1Z29A 3PG5A 1CBUA 1RFLA 4BQSA 1JAHA 1KKLA 4NL4H 5FOTA 4QM6A 2CNWA 1OH6A 1G64A 1CR1A 2F43B 3K9LA 4A9AA 3FPAA 4DUGA 1KO1A 3N2EA 1E96A 2ZSAA 5EP1A 4FCVA 1D2NA 5FFMA 1ESNA 1RKBA 2O52A 2ZVPX 3FHCB 1XD2A 4KHZA 5A5GA 4RFVA 4AC9A 3HJNA 1II8B 1KSHA 3UMRA 1U81A 1UAAA 1T5LA 2QI9C 3V4RA 1YR7A 1AJEA 2BEJA 4TTPA 3D8BA 3SBDA 5JZVA 3MRSA 3L82B 2V6IA 3D6TB 3HYTA 3MJHA 1Q20A 2VP2A 3Q7PA 1SVLA 1NI3A 2IYXA 3AP1A 3KJIA 1NVXQ 3F5FA 5GJCA 4PHHA 3OIVA 4WA7A 3FMIA 2QROA 4HLDA 1IXZA 3UWOA 2XX3A 4LBWA 2OSBA 3D3QA 4GP6A 5AUNB 4QXAA 3ZJYA 4PHGA 1NLFA 2F1HA 2RGBA 4BFVA 3ND8A 3NHAA 3O8RA 2IW3A 1HQCA 2CVHA 3GJ4A 2C77A 2FN4A 3L8YA 3M4YA 2OLKA 1ESMA 3OEHD 3GJXC 2NIPA 1N25A 1IY1A 4RD0A 3OIYA 2PZEA 4O2RA 4LCBA 1Q1BA 4KFRA 1NBMD 1KK2A 3EAQA 1XPOA 3W6NA 3SHWA 1P9WA 1G7SA 4ASUA 2ZJZA 3V9PA 1GSIA 4AYWA 2QNRA 1JEEA 1FMJA 1J8YF 3I32A 3QEOA 2F6RA 3AF0A 2ZITA 1SGWA 2QY9A 2R44A 2FZLA 5HR5A 4TYQA 1SKYB 3VNVA 3LA6A 3AVUA 2GZAA 3T15A 1AKYA 2ZI4A 3QIAA 2R6DA 3F3YA 4Q9JA 4ON9A 1FOEB 4AURA 4ZI3A 2UKDA 4BASA 2QSZA 4GZLA 3I62A 4DBLC 1II8A 1ZUHA 2VHJA 1S1MA 2ZYUX 3OESA 3RNLA 1Q1EA 1Y3AA 2D62A 2EFHB 4D4KA 2P3SA 4PHTA 4FMBB 1NJFA 5KDDA 4NCNA 3QXJA 1EFTA 3I5XA 2WSSD 1ZP6A 4B74A 3KJGA 5EE9A 3Q5EA 1SVMA 1F5NA 4RKFA 4KVGA 2R65A 4Y0AA 1W48A 2BBOA 2Q3HA 1WBBA 4LDJA 4GPTA 4ZKDA 3MD0A 3RAPR 4ZCIA 2QPOA 2V7QA 5SZHB 2YC2C 3B2EA 2RCNA 2XAUA 2BM0A 2O0HA 4QOSA 2AN9A 4UNQA 4EPTA 1J99A 3ZZUA 4D6PA 2ZEJA 2FSHA 4Z54A 2O8EB 5JCPA 5TARA 1R5OA 3P4YA 3K09C 3VKWA 3ETLA 1CJUC 1TQ4A 1XJCA 3WP0A 2ORVA 5SZJA 5JECA 1G6OA 3BB4A 2G77B 1XDBA 1NIPA 3BERA 2VP4A 4PC3A 2JLYA 3BOSA 2HF8A 3THXB 4LY6A 5P21A 1Z0JA 2QM8A 4D0GA 2IF0A 1VHLA 3BIFA 4GOXA 3GLIE 421PA 4PFSA 2AR7A 1TPZA 3CWZA 5JSZA 3FFBA 3U3OA 4A0HA 4DLTA 4JVSB 4KV9A 5DHAA 5LPNA 4P3YA 4FMDF 4TZ6A 1FL9A 4M8NE 4TL6A 1F2TB 2GZDA 4QGGA 1EFHA 2AK3A 1S0UA 3WP1B 3EWAA 3IDQA 3HU2A 1QDEA 3EZ9A 3RWOA 3EARA 3FMOB 1GRNA 3PUVA 3L8ZA 2PCJA 2CE7A 3IGFA 1CJVC 1KAOA 4Q1FA 3C5CA 3WYFA 4CT4B 4DLUA 2W6IA 2YYZA 3CNLA 4I1VA 3MG9A 1KY2A 5BYJA 3AF4A 2B21A 5AK0A 4Q4AB 4PSKA 3DMDA 2ODBA 3CX6A 1XTSA 4AI6A 3SQWA 3ASZA 1W4CA 4HAYA 3DZDA 3Q5DA 4NCIA 4DSUA 2P0EA 2J45A 1KTVA 3A1TA 3OF5A 4Q47A 2A7QA 1EXMA 4Q4LA 4UKDA 2CLDX 3CX8A 2A5JA 3RSOA 5A4JA 5EXPA 3EASA 3CRVA 4LSGA 1E2MA 1NKTA 1Z0AA 2ODWA 1P3JA 3N70A 3CX7A 2GK7A 3QOFA 2XB2A 4XSGA 1TAGA 4BEJA 2A5FA 4ZIRB 4XD7A 1QVRA 2WICA 4KBGA 4S2EA 5K8LA 3BAFA 3IIKA 2HT6A 3DHWC 4C0LA 1W36D 4FWIB 2V3CC 3PR1A 3U44B 2BMEA 1UPTA 5JHHB 2JLZA 4V02A 2Q3FA 1YZGA 3B6EA 5EXXA 4FN5A 2PEZA 4GOJA 1TNDA 4X8OA 4C30A 5B58C 2H5EA 3BB3A 2X2EA 1JQLB 4NMMA 2EYQA 2OO7A 1JAIA 1A82A 1MKYA 1OIWA 2NO6A 3KKQA 5EXTA 2XTNA 4RD3A 2IWRA 1FW6A 3U3KA 3IQWA 1Q1ZA 4FCTA 3X1WA 2GCOA 4ZCMA 2NG1A 2ZE6A 2ZJAA 1I2MA 2ZRGA 1EX6A 2WIAA 3BK7A 3DOFA 3K0AB 5JWRA 1HT1E 4PQRA 5EZ6B 3ICQB 5CM9C 4WW0A 2EQBA 4KO8A 5LD2B 1YZQA 3U2QA 4WAUA 3NH9A 4XWKA 1NN3A 1GVNB 1KAGA 1N6HA 1SXJB 3PEUA 4IVPA 1N0WA 4LJ7A 2CK3D 4B2PA 1NLZA 4IEEA 3PITA 2NZJA 4YMVA 3HDTA 1JPJA 2JIZD 1Z6GA 2BJWA 3KQHA 1IBRA 4UNSA 3CWQA 1R5BA 1A7JA 1DAEA 3SOPA 1W36C 3GLFA 3GEIA 4KLNA 1NVVR 1KI3A 5FOWA 2CEAA 4MYUA 1T5IA 4HDQB 4CVNA 4DCNA 1T6NA 2F1JA 2IF2A 4IDNA 4DIDA 3B60A 4E03A 1N0VC 3ZLJA 4GP7A 4DLYA 1OF1A 3NXSA 2MSDB 1QG4A 3TJZA 3KB1A 3A4MA 4M1WA 3W34A 3WRXC 3K0FB 4GRAA 1F2TA 2GBLC 2CJWB 4U5XA 2OXRA 5L3RA 3TBKA 2AXPA 4LX0A 4IRUB 2GWHA 3GLHB 4IOMA 1KDPA 1R7RA 4K8OA 1G3QA 1UEIA 4TLDA 4TT3D 4LUCA 1F48A 2KB0A 5FR1A 1M7BA 2ZI6A 1E79A 5K8TA 4B3GA 2C96A 4C7OB 3KX2A 3B9PA 1KSFX 1ZNXA 1DELA 3MWYW 5GVRA 3PEYA 3GJ5A 1VCNA 2A5DA 3I8SA 4DUGD 1G5PA 1JR3A 2CNWD 3KKMA 4A92A 1X1RA 4JMPA 2WBLC 4B3DA 1ZCBA 1ZJ6A 1XCGB 1Z0DA 3BFKA 3LO5A 4Q7LA 1HA3A 3FDIA 2ZUBA 2VPPA 3L0PA 4B35A 2J0SA 1VIYA 3CF0A 5DN6A 1D8TA 4B6FA 1ZBDA 2UVQA 3RS0A 2BM1A 2F43A 2CLCX 2FH5B 2IXEA 5LD2C 4HDOB 3U7GA 1K6MA 1DO0A 4NH0A 3KL4A 4D2IA 3L0OA 4JVLA 2JJ8A 3GLIA 3ZVRA 1X8LA 1T0JB 2OBNA 3MAAC 3T61A 2G3YA 1OH5A 3PCRB 5IK2D 2O8CA 1Z06A 1N2CE 1TQ2A 2QM7A 1G7CA 1UBEA 3NVAA 3TMKA 5FTMA 3LBHA 1DAIA 1ZCAA 1XBTA 4XTRA 2FSGA 3WBKA 3OAAA 4DWJA 1W7AA 1RE0A 4GI7A 1UADA 2XNDD 3J81k 2WWHA 4V0MA 4HUQB 4R7ZA 3FKSA 1C9KA 3U61B 2ODNA 1XXHB 3HP1A 5KO2A 1COWA 3K09A 2CHQA 5TB5A 1IN8A 2Z43A 4BE7B 1HV8A 1WCV1 3GQBA 2AD1A 5JEEA 4K81B 4MQBA 4F38A 2G0NA 3TK1A 1XEXB 3K0AA 4H9GA 4BZPA 2OCYC 2ZREA 1OPXA 2WJYA 2HEIA 4TLEA 1YU9A 2GA8A 4OQNA 4TSFA 4HB4A 5TY0A 4F4CA 4P33A 1SKYE 2EYUA 3NH6A 2W6JD 2JDID 4DZZA 4DB2A 2XEXA 4PPFA 2ZIAA 4Q03A 4NBSA 3TRFA 4L9SA 3T06B 3VKGA 2GKSA 3AF3A 5L3QB 1GKUB 1CF4A 1G5RA 3ZD6A 3O8DA 2IYRA 4OI2A 2WWGA 1MRNA 1G5TA 1NBME 1RRCA 4Q4JB 3WNBA 1N5KA 1SXJE 1L2TA 4C0JA 2YWHA 5DYIA 5FBWB 4JSYA 2H18A 3BH0A 1OXTA 5HTKA 4URUR 1EK0A 4C2UA 5IT5A 4HB0A 4IDQA 2OAP1 4DDVA 4LJ8A 1KO5A 4V0OA 4CYMA 2BBWA 4EKDA 3GLHA 5FOXA 2X77A 3WHLA 2GEVA 3QF4B 2VHQA 2WJGA 5FPTA 5GJBA 3IHLA 4AD8A 1D2EA 5E7JA 3IUYA 1E2FA 2BMJA 3TQCA 2V55B 3W3AA 2CLSA 2X1VA 4CIDA 4EDHA 2C9CA 3PFIA 1N6OA 2QAGA 4UJ5A 1A1VA 5CJPA 1ETUA 3I72A 4Q01A 4D0LB 2RGGA 2YOFA 2C78A 3QKTA 1E2QA 2REXB 3RC8A 1XP8A 1F60A 2ZTSA 4IDOA 4ARZB 4JLKA 1DG3A 4NP6A 1RRPA 4HUTA 3QPWA 3CZQA 3ADDA 2A2ZA 1FFHA 4Z51A 4ACAA 4B71A 2GDJA 3T1OA 1P2TA 1ANKA 4HDCA 5JRZA 1OB2A 1G8GA 4M9ZA 5HPYB 1BMFD 2DYKA 3QSYA 2O5VA 4ZKEA 4YMWA 1HT2E 1NY6A 1N5IA 3ZGXA 1PVOA 2BMFA 1FMLA 3OFND 3I3SR 3RANA 3OZXA 2I1VB 3WY9A 2ZUCA 3OIUA 4L16A 1TTTA 2W6ID 4P31A 4OHYA 1UDWA 3EG5A 3W5IA 2EFDB 3WHKA 2Q3MA 4M1SA 4BRWA 2J0UA 2OILA 2A78A 4JVNA 1W44A 2VP6A 2FE4A 4B3XA 3MMPA 2AL7A 1JBKA 2NO0A 4KFTA 1UKEA 1SULA 2A5GA 5KPJA 2CHGA 2XTZA 3RVBA 1NN5A 3PVSA 3RWMB 2QAJA 4OJKA 1TUIA 6Q21A 3VHXA 2GJAA 3Q72A 1Z47A 4DCVA 2IS4A 2W2XA 1PLLA 1R8SA 3B7GA 1QHGA 3E1SA 5SZKB 1Z28A 2AKYA 4XD7D 1ZNYA 2ZETA 2Q6TA 1J2JA 4HATA 2ZI5A 4QGHA 4B48A 1Z07A 2A5YB 2Q21A 1CP2A 4TTQA 1AS2A 3G5UA 1E98A 1GILA 5BQ5A 4CW7A 2HLDD 2RGXA 3QKSA 4Q4JA 1HYQA 2KSQA 4KVAA 4Q4HB 3GJ8A 1VYUA 5FTNA 3KKNA 4XIGS 2BBTA 1MRSA 1YR6A 1KI8A 2E9SA 5L3QA 4B47A 2GBLA 4ZV4A 2AK2A 4R2IA 4XWAA 4B34A 2CL7X 1W49A 8OHMA 2V6JA 4RCYA 1IJFA 3BGWA 5D3MA 1T3SA 3AGQA 3BBPA 3QI2A 1RYFA 5FOSA 2V7QD 2ZSFA 2WWYA 1E1RA 1WF3A 1T4GA 1Z6TA 2FMXA 4Q19A 2PJZA 4M21A 3JVUA 4XJXA 4B3CA 1E9DA 1KMHA 2G0TA 1US8B 5KDLA 4B2IA 3EPLA 2LCFA 4IOJA 2O8BA 4MUAA 2YWEA 3W6OA 2WSMA 1YR9A 1UFQA 1YRBA 1HUQA 1HURA 1ZRHA 2ZJBA 2GVZC 1S4QA 2YZ2A 4LOAA 4C0SA 1N6LA 2OCAA 2QPTA 4UJ3A 1M6NA 1CJKC 1XMJA 2WOOA 3A6PC 2W2TA 2ZSDA 1W1WA 4LYFA 5FUWA 4A4DA 1ONBA 5JHGB 3THYA 4BPBA 1L4YA 2H1LA 1TF5A 3OFNA 3AP3A 1GRQA 1U0JA 2WWIA 4UNRA 2QQEA 4JT2A 5CDFE 4KBFA 1P9RA 4JL5A 2Z6VA 1R0YA 3K1JA 3U44A 2QMOA 2MSCB 3EZFA 5F9FA 1OFIA 1U98A 4Q1CA 1S2MA 1E94E 1OYWA 2ANBA 3L43A 1G8PA 4URZR 3SNHA 4A2QA 3AF1A 1VPLA 3KXKA 1AS0A 4KAXA 1E9RA 4F92B 5EZ5A 2W2VA 1TU4A 5KSYA 4DXAA 5B2ZA 4QHYA 1CJTC 1TEVA 5KU1A 1RW4A 4OHXA 2DPXA 4CEIB 4DSNA 1QHNA 4RZXA 2GJSA 2JJ2D 5KOYA 3LNCA 1M1YE 1BIFA 2Z0MA 3ASYA 3CB4A 3BFVA 4PC6A 3A4NA 4B44A 3WNCA 5HCIA 1E2HA 3TE6A 2J46A 1ELOA 3L2OB 4ZPXA 1E99A 1I4DD 3AVTA 4GMXA 1P9NA 3OEED 4PC2A 3QG1A 3MLEA 5CLLA 4ITRC 2QG6A 1EWRA 1DAKA 4DJTA 4EAQA 1Z0FA 1GM5A 4BECA 4X8HA 3VX3A 3ZVMA 4UNNA 1F6BA 2PT7A 2ZVQX 3BS4A 2REOA 1GWNA 2ZRIA 3IHWA 4WVFA 1CIPA 5DLQC 3PJRA 3GFTA 4G5OA 4NHOA 1ZD8A 4QJ4A 2H92A 1KK1A 4V0KA 4JS0A 4HAVA 4AG6A 1Z6XA 1BMFA 4LJAA 4JBWA 2RKOA 1FX0A 3SFZA 3CBQA 4F91B 5EJEA 4Q7KA 3N5CA 3ADKA 2C04A 3SEAA 3IIJA 4TL7A 5AJZA 1S3SA 2Q9BA 2RHDA 4ZI2A 1LV7A 1IY2A 3R7WA 4Q02A 2GILA 2FJUA 2G1JA 1UKVY 3HYRA 3A1WA 1HTWA 1S1CA 1G1MA 3CRMA 3CH4B 2OLJA 4OI0A 1ZD9A 2HXYA 2Z5FA 4EFNA 1P61B 3NKVA 2H17A 3LLUA 4PZLA 2IUTA 4URYR 5FR2A 2QTFA 1Z5ZA 4JLAA 2GTPA 3MSXA 4LBZA 1XXHA 4TMTA 2PX0A 3AUXA 4CZ2A 4C0KA 3P32A 5H1YA 4OHWA 5JJIA 4TMWA 3U7EB 1CEEA 1CKEA 3LD9A 4KI0A 4E07A 4HLCA 1SQ5A 1M2OB 3AH8A 3KJEA 3P26A 5FBQB 2BHRA 3FWYA 4NONA 3NC1C 2IYWA 4KITB 1T3HA 4PR0A 2EFGA 3T5GA 5DN6D 1R6BX 3R9XA 1TQDA 3LFUA 1ZU5A 5E95A 2ZAMA 1E1QA 5EE0A 3I1FA 4TYWA 4CEJB 5JS8A 4O0MA 1N3BA 3TUZC 3QEJA 4JKYA 1AIPA 3THWA 4M4SA 2UZIR 1U8ZA 2YWGA 5J47A 5FOVA 5JJLA 3ZDQA 4XSHA 2QN6A 5BN5A 4RD2A 1YZKA 2K5UA 2GEDA 3EPHA 2FEMA 2F7SA 3BH7A 4OK6A 3GD7A 5G40A 4CEIA 2GHIA 2ZROA 4PC7A 1DAFA 2Z4SA 2D06A 1E0AA 2O8FA 2F9LA 2XNSA 1W4RA 3C7KA 1QHHB 3EIEA 4AKHA 3SFVA 2GXSA 3KKPA 4ARZA 1XFAA 2JLVA 3QQ5A 2HYIC 3C15C 4D80A 4JBYA 2HJVA 1B23P 3I8XA 3HPRA 2WZQA 2XITA 1XZQA 3O8BA 2Y8EA 4C0QC 2ATXA 1Q12A 4PPGA 3REGA 2DWQA 1TF2A 1ZM4A 1RYHA 4MRPA 3ZIAA 3TAHA 1BYIA 3KQUA 3ZZTA 2IXFA 4C0BA 5TXGA 3MWKA 2IYSA 3AVOA 1FX0B 2IYQA 5EE3A 1E2LA 1CXZA 5KNBA 2FGKA 4PX9A 2C95A 4LJYA 2QZ4A 4UXIA 2IYZA 4DLXA 4LI0A 5LDDC 5DH9A 4PXAA 1D9ZA 4XH9B 2VP0A 4XOIA 4LHXA 4QJ5A 2OFOA 1JNYA 4P4SA 3CPJB 4QFMA 3KFXA 5AJXA 1G9XA 2FDCA 2R8RA 4TQUS 2JAQA 3LVRE 2ZR0A 1W0KA 4R2HA 1E0SA 3EIQA 4D4LA 5HZHA 1E2DA 4TT3A 1G6HA 1KSJA 4JLOA 4RKEA 3C8UA 1ZM7A 2VO1A 4RJLA 3DMNA 4BFSA 4IDPA 1NJGA 2HT1A 1W4BA 1S9HA 1YQTA 1G19A 1KNXA 4BFZA 3GCGA 4JBXA 4BLOA 1EFCA 1EGAA 2FV8A 3C41J 2AHOA 2C9YA 2MMCA 4PQYA 4BLRA 4O25A 5IHPA 3SQXA 2D7CA 3AQ4A 3GJ0A 4M53A 4BLQA 1L7VC 4KXFB 1VHTA 3SJAA 5HCNA 1W2HA 1MT0A 5FOUA 1MV5A 5DNYB 4DRZA 4AIIA 4U7DA 3HR8A 3TKLA 5F9HA 4CEJA 1WBDA 4JLBA 5FTLA 3IKJA 5E7IA 3T35A 2JIZA 1DE0A 2ZR7A 2XOKD 1N6RA 5C46F 2O0KA 1ZU4A 2G83A 2RGDA 4F93B 4FMCF 1X86B 3QENA 2GCNA 1SKQA 1GOTA 3PUYA 3PEVA 2XXAA 4C7OA 3PV0A 4PC1A 4V0ME 3RHFA 3OEEA 2WKPA 3B13B 3CPEA 3VTKA 5AUQA 2B8TA 2CCGA 1KKMA 2ZR9A 4JL8A 1UKZA 4A1FA 4QC2A 1QHHA 1KI6B 4PAOA 1G8FA 5DISB 1QVAA 4LBYA 4E09A 1DO2A 5TVKA 4LPSA 3HPQA 3IEUA 2JJ1D 5JJKA 1TQ6A 2JLQA 5KPDA 3WMFA 2IXGA 1DVRA 1FNMA 1GKIA 2DWPA 1KI2A 4BFTA 3HU1A 3SYNA 1DAMA 4BZQA 4LRWA 1XTRA 1N6PA 4POAA 1MOZA 1YKSA 4QL3A 4XVUA 3ZVNA 2FEOA 5CB8A 3RRMA 5F2EA 3KQKA 1XTIA 4Z8YA 1QHXA 1M74A 5G3ZA 4WZAE 4IVQA 3AVWA 1CLUA 1VG0B 1ZM3A 4XVRA 2JA1A 2VLIA 2HCBA 1DOAA 5JLJA 1W46A 2ZYTX 3GLGE 1GL9B 5CYPA 2PH1A 1AN0A 2FPLA 3WMGA 3WXMA 2WSSA 4G3XA 2PT5A 1PLJA 4GL2A 3LX5A 3VQTA 1U94A 1X8JA 4AG5A 3G0HA 1N5JA 5HE9A 4ERNA 4Z1MA 3ADBA 3KTAB 2QE7D 4NYIQ 1GG2A 1XPRA 3DPUA 5FBLB 3C16C 2ZM5A 1RJ9A 3GFOA 3SE0A 1II9A 1TU3A 821PA 1U0LA 3MGCA 4BFUA 3HR7A 2G88A 4IKEA 4MRNA 2PLRA 4RZ2A 1OKKD 1G4AE 1KZGB 3B9QA 1OKKA 1EX7A 4XWOA 2CCJA 3RS2A 4DLVA 4ACBA 1G8YA 1UKYA 3W90A 3B1VA 3A58B 2WJVA 4HZIA 1AM4D 3BORA 4DCTA 5G3YA 2JASA 2JCSA 5L3SB 2IA5A 2ZJYA 2IYYA 3BD9A 1F3OA 1XD9A 4HI0E 3H84A 1HE1C 2FFHA 4RZ3A 4A82A 5AUPB 1XCMA 1Z2CA 3LY5A 4QNMA 3SJBA 3HWSA 3TSZA 2C8VA 3FVQA 3X1DA 4OK3A 2AX4A 1Q1QA 4IVRA 1OB5A 2ZJ2A 3SC3A 2ZQ5A 1NLYA 3DZ8A 3EZ6A 3SR0A 1RC8A 1NMYA 1S96A 4BZXA 4F4JA 3EZ2A 2QP9X 4EUNA 4RD4A 1P4SA 2CJWA 3ECCA 3PEWA 4QJ3A 4OI1A 4JVMA 2ORIA 5DO9A 2XXAB 2OEPA 3QNUA 5AJWA 2CBZA 121PA 4TYPA 3QXSA 2FFQA 3L0IB 4UNPA 1KMHB 4ZDWA 3KQLA 4I1OA 4QBFA 4DCUA 1IN7A 2R6CA 1JR6A 4R98A 1FZQA 1NSFA 1XRJA 2EU8A 2WPDA 2XZPA 4OQMA 4F7WA 5IRCD 2V9PA 3LW7A 1E69A 1LS6A 2G1KA 2ZPTX 3EWSA 3NC0C 3UKDA 4A15A 1E2PA 4MKFA 4M1TA 4MGKR 3THOA 3DOEA 1NVUQ 3FMFA 3QVVA 2J5XA 3AKEA 4URWR 2ZRFA 4A8JB 1FTNA 4C9BA 4LYAA 4MRVA 4B6EA 3NBFA 4YC7A 5JS7A 2WWFA 1QHSA 3CF6R 3R20A 4FI3C 3IPXA 3EX7C 4QRHA 1U99A 2PEYA 2BEKA 3X1XA 1XTKA 2J0UB 4TMZA 2I4IA 4NCKA 5K8IA 2YHSA 2Z4RA 3BRWD 4PTLA 5K8UA 1W2GA 3FOZA 3T5DA 3NDBB 3THXA 5J4YA 3A1SA 1VYTA 2JLRA 4LZZA 4RZUA 1U8AA 2YNMA 4A6PA 4LJ4A 2P67A 1KO4A 1NKSA 1I4LD 2AKAB 2FPKA 2F9MA 2QP3A 4L8GA 1ZM2A 3BC1A 1JR3E 3U5ZB 4DT1A 2RGAA 2B7CA 4MRRA 2QORA 4BFYA 4WOPA 1SVKA 1XJQA 5J4HA 4EPVA 3IBGA 5G41A 1I2DA 2OV2A 3AVQA 4YQFA 3EC2A 5J4LA 1MO4A 2OT3B 3DL0A 4IFEA 5EXSA 3B8HA 3X1ZA 4EJSA 4N1AA 4EFMA 2CXXA 3OE7D 4P4UA 1UEJA 3E5HA 3NTUA 2EFCB 2EW1A 1U9IA 2WV9A 3NHBA 4MKGA 2JGNA 1Q3HA 3QKUA 4D81A 3LDAA 2XJ9A 3I73A 2ZUDA 3AVXA 5KYKA 2WWWA 1GNRA 2ZRBA 5M04A 4UQOA 5DIFA 3TR5A 4I1SA 5CDFA 3SYLA 1WB9A 1EFRA 3KDSE 4J0QA 4P4SB 5CB6A 2IL1A 2R2AA 3ZS8A 2QL6A 1M34E 2WAXA 4W9MC 3KQNA 3SJCA 4JYCA 3TLXA 4FINA 1P2UA 4PHFA 5LBIA 3LRPA 2IUUA 3UPUA 5F3WB 2O0JA 2PMDA 4B76A 1OIXA 3CR7A 2QTVB 2JLUA 2ZI3A 5LB4A 2NQ2C 4D82A 4QGFA 2VF7A 4KLZA 2W6JA 1IONA 1D9XA 1IM2A 2BBSA 2AWOA 3QPUA 1LFDB 5EE5B 5KTYA 1IJEA 1KGDA 4KU4A 3RSLA 3QPVA 4M22A 3RRNA 3W9YA 4CDGA 3IEVA 1XJ0A 1AA9A 2XSZD 2CMKA 2J7PD 2DFLA 3B1ZA 1T0HB 2AWNA 1CJMA 4WBSA 3IO3A 2FU5C 1D5CA 2V8OA 4QBGB 4M9QA 2AFIE 5A0FA 5FL3A 3CR8A 2NPFA 1COWD 4MYCA 1VG1A 1E9BA 3GFPA 1D6JA 1G16A 3CM0A 3U6KA 2DR3A 4FMCB 1NSTA 2A3RA 3OAAD 3I92A 2NZ8A 3C4JA 1SXJA 5DSZA 3JZMA 3U4QB 1X6VA 2PZFA 1M7GA 2ZAOA 1GL6A 1SXJD 2O8DB 3VMFA 4US1R 2QAGC 1AS3A 1RVDA 5H70A 2OBMA 3NBZC 5CYOA 3TVTA 3K70D 1NN0A 2YKGA 4Y0VA 1J70A 1UF9A 1XX6A 5B30A 3VR1A 4EPRA 1ZVQA 3ZS9A 3U3JA 2MSEB 3CLVA 5E4FA 3DVLA 1E9SA 1DTSA 1E9CA 2VRWA 3ZQ6A 4CF7A 1W5SA 4LYJA 4Q1AA 2EWWA 2J7PA 3M6AA 3Q7QA 1GZSA 3T1QA 3AM1A 4AYTA 3M1IA 5BXQC 1WRBA 3PUZA 5FPHA 4N0EA 1E0KA 3U7HB 4ZDJA 1E2JA 4GSYA 2BMDA 3M0EA 4HAUA 4LJ5A 2BOVA 2IHYA 1JR3D 4BFWA 2R6GA 1II0A 2GCPA 4DB4A 4RD1A 3GLFB 1R5NA 1LB1B 1QHYA 1KDOA 3K9HA 4HAWA 4DT1B 2X2FA 4MYTA 1PZNA 1X3SA 3AVPA
chains in the Genus database with same CATH superfamily
1WZCA 3K0FA 2NYVA 2I3BA 2HV8A 3O82A 4MGIR 4BAZA 3EF3A 3AY0A 1REQA 1LV8A 1RI1A 4M98A 3GAFA 2CUNA 1E7WA 3L6DA 1C30A 2QN3A 5K3CA 4DQVA 1ZUNB 1E8NA 4ZXFA 1UBMS 1K7SN 3RRXA 2J3LA 1OILA 1QIDA 3IJEB 4R1OA 2VYVD 4QNRA 4H59A 5LA6F 3MGKA 1P3Y1 3A6JA 3HDGA 1DBQA 3OC6A 4ZTBA 2HRRA 4J16C 3W5VA 3L8DA 3BBLA 3KQOA 1YK0A 1CUVA 1N9GA 1PAUA 1ZK0A 4U2CA 5D6OA 7YASA 2O8EA 3KOUA 1FQKA 1SXJC 5FHQA 2QMZA 5LKRA 2AEFA 1E63A 3Q7TA 2WNIA 1T6XA 1WPRA 1C1YA 1GG5A 1DKPA 3B53X 4R41A 4QASA 3W4JA 4A5OA 5EGSA 3IRUA 2VAMA 3QKWA 5CT9A 4RKWA 4BNKA 1MAUA 5FAXA 3ROKA 2HJ9A 2YMLA 1B0ZA 3B36A 2AG5A 2BTOA 2VXOA 3NWOA 2EWVA 4Q3KA 4YCBA 4X6LA 5CBPA 2AC7A 4D8YA 1WAMA 2FWAA 3B8EA 4EL5A 2CDAA 3DE1X 3G85A 4EFDA 1HZZC 3W5BA 1R9NA 1RM3A 3KLNA 4KLCA 3UC5A 3B1XA 2CD9A 2QT1A 1TGYA 2QVXX 4J1NA 4MWDA 4AY2A 2X76A 4ZOQI 4F4IA 4B0OA 1U11A 1JJVA 2BR5A 3DV0B 3E1KA 3S8EA 5ELLA 3QTBA 1IVNA 2ODEA 3T3EA 1YBFA 5K0TA 2FX2A 3DQPA 1J25A 3ENZA 5ICMA 4PSVA 3S5JA 1I8TA 5CM8B 3ZWVA 1HDGO 1G3IA 5BW8A 3AF6A 1DB3A 4ID3A 2NUTB 4NOLA 2HIAA 4ILKA 4E14A 3ZWKA 3ZW9A 4W6ZA 1XK7A 3B1YA 1GZ3A 1STOA 2XWPA 1FYWA 1U4SA 4MMYB 1NC1A 4YP0A 2VRCD 2K6GA 4MGYR 3OHMA 1Q74A 4MS4A 3D3JA 5I51A 4BO7A 1SVNA 3MEQA 2FX3A 4O5OA 4TRJA 4OQFA 4Q24A 2VHUA 4P7BA 5A2GA 2JLXA 4PLYA 3TXXA 4FD3A 4AMBA 1YHNA 2DPYA 3B7WA 3TEFA 1M6VA 2F8SA 2QBYA 3CZ4A 4HN9A 1NC3A 1RXEA 2A0YA 3AB8A 4NJEB 5G0UA 1CX9B 1WMSA 2GH1A 1O9GA 2Z09A 2UUAB 2OO5A 1R2QA 1RYYA 2C07A 4LQDA 2C99A 1HPLA 4N3NA 3EXIB 3QFFA 1A9QA 5JCJD 1O2DA 3PFCA 4QXMA 4RF2A 2EKZA 1UDCA 4GWGA 1H6DA 3GJ3A 1OFUX 2Q6LA 4DJFC 5AK5A 4U3JB 3GP3A 3VO2A 3ROFA 2C58A 2JGEA 3JVDA 1U2ZA 3SI7A 1NVMB 4MJ7A 4FWTA 2P9QA 1PQ4A 3OKPA 3O4HA 4N6NA 5IVKA 1AQYA 4X7MA 3CLKA 1AGRA 1Z25A 3H5VA 3KCQA 4NQZA 1ZMTA 4OLHA 5FKJA 1KNQA 2FW1A 2QTHA 4G0QA 4PRZA 4E5PA 1MJFA 1Z7YA 2DHRA 2O1XA 4JROA 2X40A 4ETNA 4HNTA 1W4AA 2G71A 4DBLE 4C76A 4C4AA 3EQ7A 3B85A 4C0WA 3AJ9A 4CTKA 1A4RA 1V8BA 4IUYA 1LPPA 5BYAA 5CITA 2F8MA 4OUDA 1VP9A 2ZS9A 2O20A 5C4GB 3EA0A 3VXKA 2X8AA 2M1ZA 4YCDA 1K5PA 1NN1A 4Q66C 3DUWA 4TWIA 2QRKA 3STYA 1IAQA 3ZIDA 3DFUA 3BRWA 1LTQA 3GLKA 3OIFA 1G20A 1S5PA 2JIBA 3ENVA 3QU2A 3B78A 4NJOA 4PGFA 4P9NA 3ZJVA 1T1SA 3VPFA 1ZGJA 5F1KA 2J3DA 1G17A 1IWOA 5J9FA 1PEYA 1F9AA 5THXA 4J3FA 1AKRA 2X9LA 1YR1A 3I9JA 4FPXA 2WNHA 3UUWA 3U62A 3WI7A 5I4IA 3TSCA 2HKIA 2ZBDA 5K4AA 5KQRA 4FYVA 5E1BA 2ZIEA 4NG4A 3OPQA 5JXGA 1XAIA 3GYGA 4D4MA 2QAGB 1Y3DE 1YZLA 4Y6OA 5T4EA 1NQTA 2BDTA 2ZUWA 3TLBA 4LX8A 4TMVA 4F04A 2VP5A 3IKTA 4NCAA 1L5OA 1LZLA 2YXLA 1MC4A 3UMMA 2G8NA 3IDAA 2NMVA 2RAPA 1UXOA 4IRMA 2WYVA 1BFUA 1PQYA 4C01A 1I6LA 3AHFA 3FZGA 3LUBA 3LC7O 5BYBA 4Z0NA 4IDHA 3U3ZA 4BBAA 3EDYA 3VOSA 4NFLA 2YR0A 4FEEA 5JQWA 3CNEA 1QVZA 2VNJA 1C4XA 3GMIA 2XKAA 1BOFA 1PQUA 2EKBA 2KLBA 2UYYA 2YHAA 5FA6A 10MHA 4HTFA 1TD1A 4ZVNA 4BQEA 2DFTA 2FQ1A 5IABA 2QV7A 1GYQA 3BJEA 3LCRA 1YVEI 5KYUA 4TYNA 1E9FA 2RHGB 3AYZB 3E9CA 1HF3A 3MWLA 4O4HB 2WZBA 1QANA 3R7LA 1PW7A 3GZ4A 1PVDA 4LHVA 1LJLA 1YFZA 5EIWA 3NYWA 4F86A 3MINA 2F4VB 1TVEA 1W0JA 1Z2AA 3PXGA 4PFQA 2RGUA 3QY0A 1YQ9A 3C6KA 1NBOA 4PZZA 4AF6A 4DJAA 3RT1A 2XCSB 2FQYA 5ETJA 5FWDA 2QBYB 1YNSA 2OD9A 2QM3A 4QOEA 5KQPA 3U09A 3CKLA 3P5BA 1XZCA 1ZN9A 2BKEA 4P86A 4D25A 5IEBA 3PDIB 3A6ZA 1NRJB 4EG3A 5D3QA 4BLSA 5CPBA 1NXQA 3EXHB 4WZ6A 1GFIA 1H0SA 5DI3B 2BGRA 2IXDA 5KNDD 1YT5A 3AKDA 5EIHA 4QBIA 4QWMA 2JHGA 3A9CA 4EIWA 3LW8A 1QGDA 3MB5A 2HK7A 3TE7A 1ZA1A 5CD1A 4L8LA 1BO6A 4ARVA 4LJ6A 3M7IA 3S7TA 1V1JA 3LH5A 4M3NA 4NYJQ 1TTPB 4RJ2A 1J06A 1NRWA 5IDYA 3T9FA 2JLAA 1KI4A 3VR4A 1P7ZA 3ZHCA 4KOAA 1CUDA 3N0WA 3T5AA 4CEHB 3T1NA 2H57A 4B3FX 3V4FA 2OV3A 1MO6A 3ITEA 4ASUD 3CX3A 4IUCS 4TVKA 2OCXA 4G56A 1CZOA 4JT8A 1G9TA 3BTSA 3WQRA 5B64A 3HMQA 5AQEA 1UPXA 4BNNA 4A2PA 2OGZA 3PHIA 3Q7EA 3DAHA 4E6PA 3ICEA 1P5ZB 5B1SA 5AW2A 4OJTA 2GASA 3WMWA 2ZU6A 2AYXA 2W4QA 2AMFA 4E32A 2CNBA 3F7MA 1KU6A 2C2ZA 4NV3A 4PTYA 5EHNA 2IHBA 1VZ2A 4KIFA 4Z0PA 1Y6QA 3OPNA 2PQ0A 3D31A 2DOKA 5DBIA 1FYXA 1XNHA 4EJSC 1PZGA 4Z9YA 2PWAA 2CCKA 1ZD1A 4G23A 2WINI 4GOKA 3T8YA 1O08A 1KEWA 1JR2A 1YE8A 3GQBB 2UZ3A 2GJ8A 3D0QA 1NXSA 4D0SA 2I3ZA 4MH0R 2WUEA 2IOYA 2PUWA 2ZBQA 1JKJA 2J0EA 1KU0A 2HTFA 3U6BA 1ZR4A 3C97A 2DKNA 1GGMA 2EAUA 3ZGZA 1GQFA 3MMNA 4AP5A 1JNXX 2XYQA 1H2HA 1U3VA 4HLUA 3DDCA 5JCOC 1AK2A 4GPAA 3ZK8A 1PVVA 4RESA 3VU9B 4B83A 4JELA 1UDXA 4ZVQA 5T8KA 5L4NA 3I2IA 2OUIA 1E3IA 2DC1A 1Z6QA 3TLZA 1VYHA 2H52A 1SXGA 1K3TA 3HN2A 2OHXA 621PA 1BVHA 1XR3A 4ATNA 4DLSA 1OH8A 1GPBA 2ZT6A 2O4UX 4OLJA 1ND6A 1XL0A 1XMOB 1HYGA 1L4UA 4V0NA 2X8WA 3KTAA 3Q12A 3CRW1 4P98A 4U2GA 4OGGA 4EOGA 1Q44A 3RH0A 4ZU3A 4IEFB 5F2NA 4RVHA 3O83A 3FI0A 1KO7A 5CT6A 1RRGA 2CXSA 1IY8A 2FSFA 3DR3A 3H11B 4JT9A 4RCVA 2A92A 3WLJA 1I24A 5G02A 1X80B 4KPEC 1QKKA 2P65A 3BIWA 3CF4G 4MWGA 5D7BA 5L6LB 3NHWA 4Q4AA 4Y2UA 2D2EA 4EY5A 2J6IA 1G0OA 1V3QE 5ADVA 4NCJA 3H1EA 4YAUA 1VL2A 4L08A 1Z39A 3GW8A 4UEWA 3AERA 2ZJOA 3CEAA 1H69A 3IOEA 4YDRA 1N8SA 3AR9A 4KQ6A 3LBIA 5H3CA 1ZJ5A 1XPUA 1WA5A 3GDFA 4L8FA 2F67A 4ND4A 1MO5A 5EFZA 2ONJA 3DKPA 3MT0A 2CFCA 3FE2A 1QKJA 2OFWA 2YVUA 1XCBA 2AZDA 2W0MA 2ZRDA 2P77A 2B9VA 3JYNA 4LQLA 3AI2A 1XQ1A 3PXDA 3UWKA 2AF4C 1G7RA 1Z0IA 4Z1OA 4IGIA 5LA6A 2Q07A 1EK1A 2QG9A 4JI0B 2PQ6A 3IEKA 2HRBA 3OCXA 4MKHA 3NM5A 5TGZA 4R54A 2NU8A 1AHIA 4OAOA 3RC3A 3GEGA 4AUMA 1E6LA 1GRRA 3ICWA 1CQJB 3OIWA 5FUXA 4RPJA 1UBFA 1O58A 3ENQA 3P2YA 1XV5A 2O48X 3K8OE 3KQVA 5HDQA 4BQQA 4LJKA 4FWBA 2GPBA 4HGZA 4RF4A 2NU9B 4A36A 4HDNB 4D46A 1AKNA 3HB0A 4RV5A 1DXOA 1V16B 2CGEA 1ZJ4A 3KU4A 4WXMA 2OC9A 1Z4PX 3EXG1 4PGHA 4IXNA 3TW8B 1L4FA 4GRIA 3SKXA 1TYCA 2V03A 4GLFA 1RPZA 1Q91A 2C1XA 1I4TD 2C20A 4EATA 2I7VA 3ORFA 4ZVTA 1Z5PA 2Q0HA 3AY3A 4MUNA 3TZCA 2VTBB 2B1GA 2D0OB 2ALJA 2Q41A 1H2XA 3MOIA 4WLFA 5G53C 1V11B 3S3TA 3T3PB 3TR0A 2A9VA 3H8VA 5HJ2A 3G8YA 1EKXA 5PGMA 3V2HA 4RGVA 1QRAA 4DV6B 3DL4A 4OJNA 4K9NA 2OTCA 1K7CA 3E15A 5AKZA 3K0SA 5CT8A 4JJKA 1J5EB 3IJ5A 3AINA 3N2YA 3LX8A 2I2BA 1KDRA 4Q1EA 2J0QA 2F1IA 3KWJA 2MWMA 1SIBE 4MR8B 4MWBA 4BQFA 4X93A 3E5NA 3BMOB 1RADA 2ZSJA 2YX1A 1ZH8A 2HK8A 2GM9A 4ND2A 1P7PA 3L01A 1U0TA 1XTBA 4WNYA 1CE8A 3EEFA 4XAQA 5J2UB 3ZV3A 3FZYA 3BH6A 1GITA 2FPIB 4TWAA 5CGQB 4H1WA 1CRQA 3WHPA 1USUA 1CIJA 2ONZA 4KVZA 1BN6A 4HY3A 5DZSA 3FDZA 4FHGA 3ZDRA 1JN0A 1Y89A 2C2XA 3JAKB 4LZLA 4PANA 1VDZA 3MSCA 1LNZA 1XWIA 1V1MB 1TLFA 4KP7A 4XQEA 4RKYA 4XYGA 4EA8A 2AN4A 1PI3A 1QFZA 1JDBC 5EHQA 5F76A 2Q4TA 3WYCA 4TYYA 2PZKA 2OD7A 1E6CA 5IBRA 3TNJA 1X1QA 2GS9A 2RBKA 7REQB 3WMEA 1PEDA 4PV7A 2GESA 3AB7A 4B3BA 2ZWVA 1E58A 1PZXA 3ZDXB 3GNTA 3EC1A 3Q8WA 5BN5B 4WINA 4AJ4A 4D57A 5IF9A 3WGIA 3CVVA 1QV6A 1T8YA 3KUXA 1C41A 3W2TA 4RULA 2NADA 1E9VA 4GU5A 3DM9B 3I01M 4LWOA 5DVZA 2WYOA 4DC0A 1DBWA 1GPAA 5LCXA 1FSFA 1XWFA 2X7XA 4DA7A 5AVRA 1HLGA 3GPLA 5LP6B 4DEYA 5KC9A 1PYDA 1US8A 2P9YA 3UF0A 4IXMA 4XGQA 4KCGA 3ZY2A 4CLDA 3KVYA 4X1KA 2LWIA 3W3ZB 1AO3A 1Q21A 3SX4A 5AW8A 1YI8A 4LZOA 4XCQA 5IXYA 3KR9A 2FPGA 4GC5A 1WOMA 1M0EA 3HV2A 3OJXA 2ZIGA 3ZHBA 2JEOA 3MUFA 3NB0A 2NU6A 2Q0SA 4X65B 1IUOA 1EFAA 1Q0ZA 3GCXA 4D41A 4OU4A 3ZJ4A 4YMUA 3KL2A 4I66A 1P29A 4IHJF 2PXAA 3ND6A 5E7QA 3VGPA 4MLZA 4U00A 1PUXA 3G5TA 1JR4A 4EGQA 5JAPA 3QKSB 4MWSA 4M2LA 2HOQA 2WT4A 3ERCA 3QJYA 3GRPA 2HR1A 4XM0A 3DFFA 5T57A 3CTMA 2ZANA 5BN4A 1KRWA 3RYHB 1QRRA 1OC4A 4O4JF 2VEDA 2Z9BA 4KPFC 3RO7A 2DLCX 2WD9A 2WFLB 3VU1A 2VXCA 5IHXA 4RK1A 1FYVA 1T9DA 1UXGA 4H3KB 1VSQA 3MJRA 2XT0A 2FMKA 3HL0A 2P9JA 1D2MA 2BFCB 3HU3A 3I83A 4HH1A 3KB2A 4I99A 1EDZA 4Q7MB 2C0PA 5BVHB 3TBFA 2WTBA 4EH1A 3EPJA 1ZY2A 4FEAA 1SFRA 2IPAB 2JLSA 3LZCA 3KFVA 2YHBA 3LT5A 3I30X 1W0JD 5E9QA 6REQB 1SCIA 2REBA 5IN5A 2QX9A 3PWSA 1YONA 2IEYA 2OPHA 4WQMA 3CONA 3LLVA 2D8AA 1YS2X 1P2VA 1QOQB 1GNQA 5E6SB 2J0VA 1KI7A 1G3RA 2F8TA 3RIMA 3O47A 2PO7A 3Q2KA 4B6OA 5BNFA 4R6XA 5L3VA 2P9HA 4ZO8A 1K66A 1NIJA 2D5AA 2DPHA 2QENA 3CVJA 4N5LA 3GJZA 1WQ1R 4QO8A 3SS8A 4A8JC 2HJWA 1U7HA 2OB2A 1XLTA 1CVLA 1E2KA 2YZ7A 3FYSA 3OQIA 4PBSA 3T7AA 4YRIA 1XNRB 3F4KA 1U5CA 2E0IA 4E4TA 1PHPA 3EVCA 1Z0SA 1H8EA 4CKBA 2EX1A 2OG2A 3HK2A 3MGAA 4OTZA 1JTFA 1XCOA 3Q85A 2YJ3A 4A03A 1HC7A 4EHHA 1WMFA 2XQJA 4W7SA 3EXG2 5LB2A 1E18A 1ESZA 2CLOB 5FUVA 1P39A 1F3LA 2XVAA 4C06A 4M1YA 3FTNA 3KT6A 3KWLA 4YAIA 1QIJA 2FWRA 3OMWA 3E2MA 5BT9A 4OFWA 3L0SA 3CSUA 4CM4B 4DE5A 1U1DA 1DFHA 5K0JA 1QP8A 2OBXA 2P5SA 5HZGA 4W9RA 1P77A 4GUAA 1FU8A 2BSQA 4AYXA 2WJ4A 3QUCA 3TUJC 3UCEA 1F8FA 4UM9D 3W8NA 3Q0TA 3KSMA 2N46A 5AW5A 1QYWA 5A1JA 4YMSA 5BR8B 1YZHA 2OWDA 2YVAA 1RQRA 2I8AA 3DMGA 4M1OA 5AH0A 5FB3A 1WV1A 2VTKA 2J08A 4A0RA 3LO8A 1NVAA 2B8WA 3DMHA 1Q7CA 4DC9A 3D6UA 4QODA 4OX9B 2H11A 2NTYC 3UATA 4XFDA 2PJRA 3RGWS 1LFAA 4RZIA 1DBPA 2PO5A 4GBJA 4G01B 4BBJA 4WRRA 2J4CA 1M0SA 5F2KA 5HF6A 4DW8A 3CY6A 1EFLA 2ASVA 3KKEA 3F4LA 1YNOA 3DM5A 2Q5EA 2JCGA 1CR4A 4OHVA 1JQJC 4OOFA 1R6TA 4N6OA 3E22A 3KKLA 2Z6QA 5C7LO 1HDRA 3CNBA 2X19A 4H3HB 1RKUA 1JLLA 4RL6A 3QFRA 5EUBA 4NYMR 1ZNZA 3G89A 3A37A 1U1IA 5HTOA 1DV1A 5DRYA 1MNQA 3QWIA 2AG8A 4N40A 2GR9A 3QE4A 2DLDA 3RJ9A 1SHTX 4GR9A 4Q0MA 2VPYA 1G41A 5JDIC 1GNPA 4BATA 2A0WA 2P6PA 4X91A 3CLUC 3T9EA 1LI5A 3U7JA 3M6IA 3ZPXA 3MRTA 3OT4A 2B5OA 1V8PA 2F17A 3DTVA 1FFSA 1L8LA 3F49S 4B4KA 2BGGA 1BMQA 5K0BA 4GL4A 4GSLA 1P74A 5DU2A 3TF5A 2R1VA 2X2PA 1E1DA 2DF8A 5HKBA 3S99A 1D3AA 1CD5A 2GA9A 4M1EA 3RYIA 5K3EA 3G6KA 4YAWA 2PBRA 4XEHA 2NSHA 4L4UA 5CRIA 3OX1A 1EUQA 4MKXA 1QE5A 2GZHA 4RAQA 1DJNA 3B82A 1KP2A 4MZXA 1RZUA 1F0YA 1D6NA 1NAHA 2FA9A 1AQJA 1FYFA 4TS1A 5HIJA 4WIAA 5C31A 5HX7A 5ITVA 1KO8A 2VQDA 4A6DA 1XNJA 3BK2A 4NK5A 3WZ2A 3IE0A 3Q3HA 5FV4A 4HOYA 3UMCA 3R1IA 3R3HA 2Y71A 4MA4A 2J87A 2VT3A 4O29A 1ORDA 3C7TA 3PD0A 4KYIB 2IYVA 3C5HA 1UT5A 4UXHA 4YDHB 2CFOA 2X8LA 4XLLA 3G6WA 1T8TA 4BMOB 3D2LA 1SZPA 1RVV1 1CERA 3UO8B 1B8OA 5IJZA 1U3FA 2M9MA 2ZRKA 4NZ9A 2PX6A 2LV8A 3RU9A 3FB4A 4EVRA 4CKBB 2G6BA 2E1RA 1SPBS 1AKEA 2RBGA 1NBMA 2V5AA 3L0ZA 4ZOBA 2TMDA 1R0RE 2I03A 1TF7A 1VE7A 2H9IA 3RYFA 3ZXYA 5C34B 1LWNA 3OEHA 5K09A 2JA2A 2AT1A 3KTFA 1TB4A 3ZDFA 1PFQA 5TLSA 1W6RA 4L27A 1GAJA 3UANA 3L05A 4LGYA 3W1WA 4KSBA 3F97A 5K05A 1ML3A 5AW6A 5ESRA 1NZJA 4TS4A 3GRAA 1Q0HA 5EA2A 5ENZA 5DNWA 1RJWA 1TRKA 2B37A 1W47A 2FI1A 4PPQA 5IKEA 2ACVA 4BKRA 3COSA 3CMCO 3CZPA 1QCZA 1WE2A 3ZD7A 1HLFA 2I62A 4HSEA 3N2IA 2J9FB 5DM4A 3STXA 3UAXA 7MHTA 3REFA 3EFOB 4BZZA 1S2IA 3S2SA 1L4NA 4X64B 2ZSBA 1JKXA 5JWHA 2FN7A 4PO3X 3AFHA 4ZVSA 3UG6A 5L3SA 3HP4A 5FLKA 3ANSA 3I45A 4M49A 3WE7A 2HDHA 3PQEA 5GJWC 1MR3F 3IOBA 5L53A 1TO2E 3WL7A 4JJ6A 3JQ6A 3HZZA 3QPDA 1AXEA 4RE5A 4I9HA 3DF9A 1QBKC 4WK6A 1UJ2A 3VH1A 4IY1A 3JWEA 3RAGA 3UPTA 1JEQB 2QP4A 1O87A 3DE0X 1L4LA 1B1CA 1K5GA 1J00A 2CL5A 3GFVA 5EMKA 2Q3LA 1IOWA 3CUEF 3E7FA 1I3LA 4L74A 2B94A 2COEA 3BSYA 4ECEA 4EUEA 2GEJA 4NHEA 1S8NA 1QMPA 2OHOA 3OZVA 5AW1A 4JSTA 3L7DA 4NZYA 3WKAA 2HMAA 3JVEA 4WEQA 3DOCA 3R6LA 4OLBA 1P72A 2C97A 1NASA 2BFBB 2ZRNA 3AEQB 3EXAA 3FTCA 4KQGA 4RY2A 3F5DA 2XNHA 3GAZA 2OXTA 4MJXA 1XIVA 1YOVA 4YXWA 1UAYA 3USES 4QYIA 5LQUA 4OJQA 1BQEA 1F0PA 2YXNA 4B84A 5CDYA 3G8DA 5B57C 1G291 2XNDA 2CLIB 2ID9A 3NMUF 3KXIA 4S1TA 4IO1A 4KXVA 2SHKA 1UK7A 3INNA 2G9RA 4WJKB 1XLTC 5EEGA 4PF1A 5LBUA 3UXEA 4ZQFA 1IUKA 4I6EA 1P81A 4DR2B 1EVEA 2DQ4A 2FRDC 4I4TB 1HDIA 2IBMA 1U7TA 1ZOPA 4QFDA 1X87A 2PQMA 2GN1A 3RBZA 1E64A 4JLPA 5AIAA 3BG5A 3L4BC 3SK0A 4CQNA 4HZUB 2TECE 1XROA 4JJFA 4UNIA 2QW1A 2GN4A 4L8VA 5JE8A 2AG0A 1XAHA 3H6KA 4YBZA 3H4MA 2L2QA 4K8RB 5FCDA 4W7HA 3WSVA 3REOA 4FYPA 2O1SA 3WLEA 3GRYA 5IDWA 1S3GA 4N5NA 5JCZA 1LS1A 1QPGA 2ISQA 1V8ZA 4C07A 4G84A 4F6LA 2DQZA 4QPCA 3D1JA 1VTKA 2H7VA 1LBHA 3N58A 4I4LA 4Q48A 4P81A 2WU0A 3N0VA 4W1RA 5CP8A 3MVEA 2AE2A 1YULA 4PBRA 4X7BA 3TAUA 3RVPA 2IH2A 1NE2A 4INOA 1B74A 5JS2A 2LIVA 5FWNA 2CMDA 5BY2A 1VKJA 1ZN8A 2AOTB 2ZJ0A 3CURA 2X4LA 4BNDB 1J0BA 3UJNA 4OHMA 5M3BA 3SLKA 3VC7A 2HWUA 5KMGA 2XOXA 3ISJA 3HVRA 1NVWQ 2B5VA 2PRJA 2PTHA 3B9BA 3EDOA 3HP7A 5ECGC 3VO1A 2UYOA 1QYXA 3V00A 3X1JA 2O2CA 5BW5A 2X15A 4RWEA 2JZCA 1N6NA 1CUGA 4IOKA 1Y8RB 2EGGA 4UEOA 3OJWA 4DANA 3IUQA 2R3SA 3JZAA 5C8VA 1QRUA 4L4RA 4AWBA 2QU8A 1WZIA 2KE5A 3DEAA 3HBFA 4HAZA 5K0SA 1AGNA 2R4UA 4RK0A 2HA4A 1CY0A 3KVNA 2OM2A 3OOYA 3C14C 4P83A 3W7BA 2ZPUA 1EG2A 3T95A 1T24A 2PY6A 5GPBA 3IA2A 4JI6B 1AB6A 2R6AA 4LPKA 3CF2A 2F48A 4QVIA 1JDNA 3VR6A 1JXMA 2AOVA 2X2OA 2XE6A 3EUEA 3OX2A 4KWEA 3PD1A 3WLNA 3ZE0B 3I9KA 4C3OB 3K70C 1KMMA 4AKGA 3ANLA 3ITKA 4P0PB 1P18A 2IDMA 3C1TA 4RK6A 3W2IA 4DHWA 3QU7A 3MMZA 2Z56A 2MCFA 3OHSX 4ZAZA 2IV3A 3B51X 6ABPA 4GM1A 1DC8A 2EVWX 3HN6A 5CG1A 2WE7A 2JLWA 2DBYA 3IVCA 5D5HA 2O5RA 3LBNA 4IH4A 1U2EA 3QBTA 3OE4A 1ZOIA 2IFTA 1OX4A 2WJJA 5AJHA 3F3KA 3RF7A 2QX8A 2ORWA 3O1LA 5EKDA 2FPPB 4YASA 1XF9A 2RGNA 2XUGA 2H9YA 4KQXA 4M8IA 1H1DA 3P0IA 5EJFA 2X0FA 4F11A 1DJOA 3G0CA 4BPRA 5JXIA 4KRYA 1TUEA 1HE8B 1K5DA 3K9NA 1DZIA 1LDMA 4O4LB 1J1IA 4UPVA 1SY7A 4O2AB 4PO1A 4EFLA 4EKNB 1UQRA 1U3TA 2VUHB 1RTKA 1RRKA 3BGSA 3CKYA 3M6MD 4L72A 5DM1A 2XQGA 4FIZA 1CBUA 3ZCRA 1EP2B 2OV8A 1BDMA 2BEVB 4HRAA 3E4DA 2VWHA 3P9NA 3EMDA 3NP7A 1NUUA 1YC2A 1CR1A 4OHUA 4A9AA 5AW9A 3IAM1 2ZSAA 2WFMA 5ITZB 1H2WA 1X7DA 1ZBQA 1D2NA 1FDSA 4FCVA 3FUUA 1J2RA 3GNSA 1ESNA 1T8RA 2O52A 1HE5A 2WSYB 1L8AA 3MBKA 4RFVA 1ZNQO 2ZWPA 3JD2A 3LG2A 3IYLW 3OPMA 1II8B 3UMRA 2WV7A 5L7YA 4K03A 1UAAA 3A6LA 3FG9A 2C3PA 3OOWA 3OTGA 1AUOA 2BZ1A 2GPYA 4TTPA 5E9WA 1HI9A 2V6IA 3D6TB 5H4HA 1CIVA 3DULA 1OX6A 5KOHA 4MWEA 1NI3A 3AP1A 5EESA 5IKPA 1NRIA 3F90A 1NVXQ 3LC0A 3OIVA 4WA7A 3FMIA 3ZNPA 3KVOA 4JOQA 1JIVA 1GCGA 4HLDA 1ESEA 1CSEE 1YVRA 4TKUA 1IWBB 4EO7A 1Y8QB 4EJ6A 2CNOA 4QXAA 3WGGA 3ZU3A 4BFVA 1KAQA 1M2GA 2OQIA 3GJ4A 5ALMA 3L8YA 3D2CA 3M4YA 3LWDA 2C2MA 3PQ4A 3SS7X 4NOMA 4FBLA 3GJXC 4RD0A 1CUYA 3R0QA 1NI4A 1FSSA 4FKZA 4MV0A 1YHZA 3WGMA 1PKXA 1EXWA 4AULA 2EWMA 1QLWA 2XB6A 1QU2A 1G7SA 2ZJZA 4DXHA 4YFYA 3T94A 2HDOA 4ZCTA 6NULA 1S2DA 1T6ZA 2QNRA 2WP8J 2H2GA 5JXJA 2AF3C 3QEOA 2R1VB 4XIJA 4M0KA 3QBEA 5M5BA 3OQOA 1LJUA 1SGWA 2QY9A 2ZBRA 1P0IA 2EERA 4P34A 4C04A 5ITSA 3DV9A 1U1FA 3AOEA 2GZAA 1GFSA 1AKYA 1RPAA 4IV8A 4JCOA 1O97C 3DCJA 2CKDA 2W6OA 2ZI4A 1TKCA 3FLMA 1ZGCA 1EDEA 2KS6A 4ARAA 5DJ5A 3R24A 2QSZA 4GZLA 1ADGA 1Q7BA 4RFLA 5DYYA 3L79A 2HEGA 4DBLC 2K7FA 3T52A 4IX1A 1WZ2A 3I6YA 6AT1A 5I47A 3RU2A 2BTQB 4E0BA 1S1MA 1XYVA 2ZYUX 1OD6A 4IJVA 5B7QA 2X0IA 1CQXA 1Q1EA 2D62A 4O59O 4RU1A 1WXXA 3FETA 1MDBA 2R85A 5GMOA 3KV3O 4DV4B 2VNAA 3SLRA 4DABA 1Q1AA 1H1LB 3UB2A 4EVIA 3QXJA 1EFTA 4OQQA 3PK0A 2ENWA 3HSSA 1ZICA 5GZ1A 4ND3A 5EZYB 3U19A 1OUMA 5EE9A 3WDSA 5JNVA 3O2SB 1GL3A 4G5FA 4GM0A 4IF6A 1J5PA 4F84A 3FNFA 1WBBA 4LDJA 4GPTA 4ZKDA 2BM8A 2H2WA 3OSZA 4FLEA 3RAPR 3WB2A 2P9CA 2YC2C 1OA1A 2VAPA 4WVLA 1U31A 1ZESA 5AI9A 2GUWA 4JZYA 3I3OA 1VRVA 2CLEB 1S3IA 1BEEA 3T3MB 3ZBQA 1UQTA 2FSHA 1Z5OA 4FE3A 2O8EB 1CFZA 1GNSA 3K09C 4MR7A 3HJAA 3WB0A 1CJUC 4D43A 3ENKA 3WP0A 1V1RA 1WZEA 3U7QB 1G6OA 3DD1A 3WFJA 4NJMA 2KPOA 3BKWA 4MUHA 1NIPA 3E2PA 3NTVA 4L6AA 2G5TA 2JFOA 4CLXA 4EG0A 3N7TA 3IP3A 5KREA 3PHGA 3QWFA 1PFVA 3GUZA 4HF7A 4KN6A 4YQZA 4BNXA 3E18A 3I9NA 1ENYA 3IT1A 3U1BA 3BIFA 2FXVA 5JPIA 3EPPA 4AMVA 1M1NB 2GN0A 3ABRB 5TS3A 1U6KA 4AJIA 4BO1A 5GZ3A 3PRHA 3W5UA 3U3OA 5JSZA 1XZJA 3DZKA 2J9YB 5DHAA 1N2ZA 1LNSA 4G97A 4R3UC 1L1EA 1T8SA 2PZBA 5WRFA 1F2TB 2GZDA 3WP1B 2R68A 3N0RA 3TQHA 2PX8A 2IEIA 3AIKA 3ZQUA 3RWOA 3CVXA 3EARA 2GLTA 5IM5A 5J58A 3GXBA 4AZTA 3L8ZA 2GD0A 3UGJA 3GLUA 2ZAYA 2PCJA 4FT2A 2BKLA 4NFYA 1VL0A 1KAOA 3WYFA 2PUBA 1PT6A 5HGJA 4YUVA 3U39A 4PRKA 1KY2A 3G5AA 5EHGA 1Q17A 1QPBA 4MVJA 4Q4AB 4PSKA 4PCLA 3CX6A 1MZVA 1BD3A 1XTSA 4KQCA 5JMWA 3SQWA 2W2KA 2ZPAA 1QDLB 3Q5DA 3QLVA 4HAYA 1KQPA 4FGSA 2KLHA 1JVBA 1ZD2P 2B2XA 2M2IA 4HNHA 4Q47A 3U3XA 4UOZA 3AWIA 3C3CA 3QITA 3I9FA 1PD0A 1QXSA 3O8QB 2HBZA 2VDPB 1WCIB 4MHSA 4B17A 3EASA 2VK1A 4NNPA 4L1KA 1A4XA 4KEAA 1P3JA 3N70A 4XGNA 2XB2A 4MVJG 3WDMA 1LLQA 1TAGA 4XSGA 4R8SA 2VJYA 3ZOKA 4MGEA 4WFKA 1VE3A 1UIRA 1BAPA 5JCJA 3A9VA 5EIFA 1MT3A 1X2BA 2HAEA 4KBGA 5C3UA 1PU2A 1JQ5A 2FWJA 3M9XA 2H3EA 2K87A 3AWDA 3EQ6A 4MW6A 3RQIA 4CV2A 1WXHA 3PGMA 4KQIA 2XD4A 4JH0A 3FZEA 2FEXA 3GJSA 2G9QA 3SZLA 5EXXA 5EJMA 3H16A 4FN5A 1FP4A 1FZTA 4CLRB 1DKNA 4A1OA 4EUHA 3AKZA 3AETA 4X8OA 1ISSA 1Y7HA 1AMNA 3I2YX 3BB3A 3EK2A 3FPCA 3VMMA 2PLAA 4B40A 2OO7A 1UFKA 1FK8A 3EZNA 4AY5A 1EFKA 3F98A 1NXVA 3Q87B 2IWRA 5TPZD 3IQWA 2C59A 3NX4A 2GCOA 4L0QA 3X1WA 4NV1A 5C8YF 3L7YA 2ZE6A 4DTIA 2ZRGA 1Y80A 1EX6A 2WIAA 3BK7A 3DOFA 5IAKA 4D5EA 2P4QA 3ANNA 4YRMA 5JWRA 5KB3A 4PQRA 2ESRA 4DMGA 5I8PA 5DPMA 2G08A 2EQBA 4AY4A 3V48A 1SIOA 2FKNA 1GV1A 2WQZA 3NH9A 1K7EB 4W8GA 1C0EA 2QUIA 1GSHA 4XWKA 4LVOA 2FKAA 1N6HA 2P69A 4IVPA 4LY3A 5CR9A 1THMA 3LS2A 2P35A 5EIAA 1N0WA 2NXEA 4GOLD 4GSKA 3B20A 4GYJA 4NULA 4B7UA 3H2BA 4EMSA 5BMVB 2QRQA 4TUYB 4BMVA 4MVJI 4R6WA 3HDTA 2JIZD 1Z6GA 3MTIA 4M37A 3H4TA 4RHUA 3QFCA 2Z95A 1R5BA 2FPIA 3E53A 1A7JA 2Z9DA 3VR6H 1W36C 1GFZA 1GEEA 2XMDA 3GEIA 1RJDA 4PSUA 3SSMA 4LKOA 2JGIA 5I7AA 3Q4GA 3FJ1A 4WN9B 5CVJA 4DRXA 5BQFA 1T4BA 3CV3A 4G4IA 3EZXA 1PJCA 3MXTA 1GUDA 2I87A 2X23A 4ZALA 5IC5A 2JGFA 1L7XA 2GMWA 2CXUA 3AZPA 2J33A 4QD3A 5ALXA 2EZTA 3RIGA 2JIDA 5FUMA 4GP7A 3WIEA 1WUKS 4ZMBA 2HWWA 2XQVA 2DSTA 3DP9A 1HDZA 1EM8B 5GV7A 3M6UA 2VDNB 3R74A 4EYEA 2GBLC 4J7UA 2CJWB 2OXRA 5D00A 5L3RA 2AXPA 4LX0A 3AC0A 4YK7A 3GLHB 4QYMA 5ALYA 1ZOSA 2YMPA 4RDHA 3UAGA 4TLDA 1UEIA 3U9SA 4B3JA 1F48A 1Y81A 2GNAA 5IKOA 5FR1A 5INTA 1A8IA 3AJRA 3QW4B 3TRDA 2A59A 4MEBA 3S55A 1KSFX 3PEYA 2VZ9A 1LD3A 3HEMA 4XWYA 1J33A 1VCNA 1I2CA 1IZ7A 1GTJ1 5GIPE 1VE9A 2FDXA 2Q7XA 3WRYA 1NQVA 1TVMA 1G5PA 4PNZA 4ZT3A 1Q0SA 2C0QA 4D9KA 4DY4A 1GPYA 4OU5A 3LO5A 4Q7LA 1XCGB 4CBVA 4ER5A 5BV7A 4OMFG 4Z7JA 5EWMA 2J0SA 2VPPA 4D1YA 1NU6A 5DN6A 4B6FA 1CQZA 1D8TA 4GDMA 1NX6A 3RS0A 3SF8B 2F43A 2CLCX 2FH5B 5FJJA 5LD2C 2XV1A 1ORTA 2V5VA 1G21A 2BFDB 4HDOB 4X6UA 1VHJA 4LSMA 3RVJA 1K6MA 3CUYA 2VPXA 1ACMA 1RXIA 3BM5A 3G0IA 4MVWA 1QE3A 2XRMA 3KL4A 5CNJA 5DTEA 3DO8A 3L0OA 1CR6A 2GAIA 2CFRA 4DIUA 4FNAA 1Z4LA 3ZVRA 4CIBA 1X8LA 1T0JB 1SUIA 3BCUA 3N0T