5SZIA

Structure of human rab8a in complex with the bmerb domain of mical-cl
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
174
Chain Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Ras-related protein Rab-8A
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5sziA00
2YOHA 3VTKA 4M22A 3AGQA 1TQDA 2ZS9A 2J0UB 2PL3A 2HCJB 1KK0A 4MGYR 4Y0AA 3O8BA 3DM5A 4DUGD 1Q1BA 1HA3A 2YHSA 4NE2A 1PLLA 4X8MA 3THYB 3FFBA 4BEBA 1TUEA 3KB1A 1DBSA 4KVGA 3B82A 2ZRBA 3N5CA 3KQHA 4HAWA 3X1YA 4DC9A 4P4UA 4TTPA 5H70A 3SFZA 3WNBA 3ONWA 2ZRJA 2Q9BA 2QA5A 4GBMA 2FPKA 4IKEA 4RD0A 5GJCA 1N0VC 1NG1A 5FOXA 2FPLA 3TAHA 1WP9A 3WBJA 1QHXA 3DVLA 1FW6A 1OH8A 4KI0A 1A5TA 3CX8A 5K8TA 4LBYA 4JSYA 2ZRCA 1IY2A 4CIDA 4WVFA 2ZSBA 4DBLC 4JKYA 4PFSA 3KQLA 3EARA 1R5NA 2VBCA 4LYJA 1KSHA 1KI6A 4P4SA 4KFUA 1LY1A 1LFDB 2O8CB 4OJQA 3MWYW 1YR8A 2IYSA 5E3HA 2QBYA 1Z8FA 1W48A 2ATXA 1XCMA 1FFHA 1XBTA 1G20E 2C04A 1P7CA 4G5QA 3AVWA 2P3SA 5EQTA 1ZAKA 1AK2A 4NZYA 1AZSC 2EWVA 4WW0A 1JI0A 1HUQA 2AHOA 1T9HA 4P32A 2ODBA 3TBKA 2QP3A 1KI2A 4WZAE 4M1SA 3M6AA 4CEHB 1F6BA 3EWSA 2ERYA 1TEVA 4LRWA 1DAMA 3IUYA 3SBDA 3SEAA 3B85A 5B64A 4MKFA 4XSGA 4GRAA 3QG5A 2WBLC 4Q03A 2WJHA 4LJ6A 4B43A 2OCBA 4B32A 3CRRA 4KSCA 2EFGA 2W83A 2CCKA 1S8FA 2NZ8A 2O0KA 4M53A 3CW2A 4C0QC 3Q7PA 1IAQA 1Z6XA 5E95A 1NLZA 2C5LA 4OHVA 1NSTA 4DLSA 5J47A 4UQOA 3F3YA 5AJVB 1W0KD 1AS3A 3EIQA 3I32A 1EFUA 3PFIA 2VL7A 4IEIA 1JR6A 1XEXB 4R7ZA 2B7BA 4RZ3A 4NYJQ 1S1MA 2GAOA 2H5EA 1SQ5A 1XU4A 3HPRA 1A4RA 3CR8A 4I81A 3WYAA 3EWAA 3ASYA 3V4RA 3CNLA 1GSIA 4D2IA 5L3QA 1X86B 5AUPB 5JECA 1XNJA 2JLWA 2W2XA 4NPHA 1CXZA 3M0EA 1D5CA 3PEVA 4QL3A 2IUUA 1GKUB 4P3YA 1GG2A 2F3TA 3KJGA 4JSTA 4US2R 4LV6A 4LDJA 4GPTA 5CB6A 1XCPA 3FMFA 1ESMA 1W49A 4US0R 1N5IA 1KI8A 1X3SA 1FP6A 2IC5A 2QT0A 2VIIA 3AKEA 3BK7A 1FX0A 1W36B 3PEWA 3AVUA 3AF2A 3L0SA 4Q7LA 1OHHD 1XD9A 2C96A 3KDSE 3WP1B 1KY2A 4HZUA 3UWOA 5DIFA 1IN5A 2A30A 4KODA 1X6VA 2LCFA 1G19A 4EKDA 4NYIQ 1G3RA 1JECA 5L3SA 1VCOA 4XTRA 3KXIA 3JVVA 2O8BB 3ZZ0A 2BBOA 3QXJA 1SXJC 2DWOA 3T1OA 3BB4A 3THOA 1Z0IA 1FOEB 5HR5A 3SQXA 2Q3HA 3T1QA 1HQYE 1E9FA 2BMJA 3KJHA 3HR8A 3MUFA 2ZRIA 1JALA 2QN6A 4Q9KA 4HB0A 3FMIA 4JLOA 2AX4A 5A4JA 3LRPA 5FTJA 1BYUA 1CKEA 1COWD 1H8HA 1OXXK 3HP1A 3MRSA 3QKSA 3SYNA 4JLMA 3VU9B 2DR3A 4EUNA 1ZM7A 1GWNA 2ORIA 1IXRC 2AK3A 2J7PD 2NO9A 1AA9A 1MO3A 4JVSB 3SOPA 1W36D 3DL0A 3DM9B 1KI1A 4RD6A 4M9XA 1UKZA 1TNDA 2AFIE 4TQAA 2PCJA 2MSCB 4NHOA 1O87A 1Q3HA 1K5DA 3NEJA 1E98A 4LHWA 4M2LA 2WWGA 3I8SA 2KSQA 3WRXC 2PT5A 2KJQA 1ZCAA 3A36A 3JZAA 2G6BA 2F9MA 1ZUHA 3W8NA 4OK6A 2IX3A 1ZP6A 5CDFE 2HF9A 2R6GA 1JPNA 2RHMA 2XSZA 4G5SA 2PJRA 4FMDB 3Q85A 4EQ6B 1PJRA 4TLCA 1U8ZA 3UPUA 4CEIB 4URZR 4DT1B 3VR6A 1OLOA 1KSJA 1CJVC 4TMWA 4GZMA 4B34A 4RKEA 1E2LA 2BCGY 3QVUA 4L15A 4ZDIA 2BBTA 2ZRAA 4HDCA 4DCNA 4OQXA 3OEEA 5TDHA 2ZS8A 3LXRA 1YRBA 4JYCA 4IOJA 4WOPA 2WHXA 4B76A 2ZRFA 4LHVA 4EPYA 1D6JA 5BYKA 5HZKA 2Q9CA 2R65A 3AP1A 1SVIA 2ZANA 2YWEA 1JJVA 1XRJA 4DLYA 3TVDA 3BE4A 1IQPA 3U6KA 3AF0A 1XJCA 2BKEA 4BRUA 2X2FA 4EPVA 4QNRA 4C7OB 1KNXA 1UF9A 4QG7A 3X1WA 3MMPA 2HLDD 1OF1A 1OYYA 2QPAA 4BLPA 2IEYA 4M1TA 3U6BA 4LHYA 2BCJQ 2JASA 3DMDA 4IVPA 4A0RA 4B2PA 3I92A 3R20A 5AUQA 5KDLA 2CDNA 4MRVA 1QG2A 1C4OA 1Q21A 5L8VA 5J40A 3REFA 2R8RA 1G21E 3RWMB 5DH9A 1TQ6A 3GQBA 4BZPA 4Q4JA 2WPDA 1ZNZA 1EWRA 3BIFA 3Q5DA 3QF4A 4JVMA 4IDHA 2OHFA 3CWQA 4MGKR 4LYFA 1T4GA 2EW1A 2GVDC 2K5UA 4DDWA 4YONB 2QMHA 2N1BA 1S2MA 2ZPTX 3VFDA 3P4XA 4XD7A 1E0KA 2ZREA 1RIFA 1II0A 3E5HA 3BRWD 1J8YF 3CIOA 1YZTA 4GOKA 4OHXA 6Q21A 1KZ7B 4GL2A 1E32A 3CRQA 4C0SA 4KFSA 3IO3A 3BC1A 2QEQA 3V9PA 3QXSA 1TU4A 1UBFA 1BIFA 1C9KA 1NSFA 2ANCA 2CLCX 1E2DA 3H0KA 4HAZA 1DEKA 5ANRB 4A4DA 4DLZA 2AKAB 4OQNA 2MMCA 2GBLA 1JR3E 2YV5A 1YVDA 4WBSA 4OI1A 4BLOA 4P33A 1E1QA 1IN4A 2ZU0C 3VMFA 2GJKA 1JJ7A 4D81A 1WB9A 2QQEA 4IRUB 1D9ZA 1F2UA 1RYHA 2H17A 1XPRA 3VNVA 3OEHA 4AKGA 1GOTA 3CBQA 4MKGA 2NG1A 4F4IA 1XEFA 4YXWA 3U7FB 3LV8A 1BYIA 1UFQA 2WTUA 1T3LA 2CK3D 2QM8A 2CEAA 1X8JA 4FMBB 5EXXA 5FPSA 3LLUA 1FNMA 2J3EA 1N6NA 3SYKA 1TEXA 1Q20A 3QEOA 5EZ5A 5IK2A 1GUAA 4Q4AA 5F9FA 4A15A 3EZ9A 4S2EA 2H8KA 1OT3A 2QE7A 1HQCA 4PPQA 3GJ6A 3IHLA 2HT6A 3S1AA 4YMVA 3KJIA 2RGNA 1W47A 2OZEA 3EW9A 1E6CA 2VP9A 2WKRA 3B7GA 4IHQA 4AURA 3SQWA 2FPMA 1YHNA 1KDPA 1P2SA 4C0KA 1Q44A 2ZRKA 2ZJ8A 2R6AA 3A1SA 5CDFA 3U7HB 1FPMA 1MO4A 4ACBA 2G77B 3P26A 1HY3A 1E2HA 1M74A 1SHZA 3DHWC 4MRRA 4NCHA 4AYXA 4TTQA 2B6HA 3C4JA 4CVNA 1P73A 1X1SA 1KOFA 3K8YA 3VKHA 5TV2A 4IXMA 2C99A 2O8FA 3A1TA 3SJZA 1OJLA 3I8XA 1WQ1R 1I2DA 4D4LA 2IA5A 1OSNA 2PJZA 3QIAA 3SBEA 3FGNA 2OG2A 5JRZA 3OIWA 1NN5A 4K81B 2CHGA 4A8JA 3T12A 2P5SA 1KO4A 1LV7A 2JJ1A 1E3MA 1RZ3A 3EAQA 4O2LA 5BWMA 3FDIA 3CNNA 2ODNA 3OFNA 4XVRA 4KYUA 4YMTA 2P6RA 2QG6A 2W6JA 4PC6A 4PXAA 2JLXA 3W90A 4IDQA 1IONA 4QJ5A 4TL8A 2ZSEA 3WY9A 4M4SA 3PEUA 3PR1A 4TLAA 5CLLA 1JB1A 2F43A 1Z63A 1P3JA 5SZIA 4HATA 2G88A 3LVRE 3E2IA 4GP6A 4Q1AA 2FMXA 3TJZA 4X8LA 1TX4B 3NIBA 4ESHA 2DYKA 1W46A 1IOZA 3M4YA 2WWHA 5FBLB 3LY5A 3RWOA 1CJMA 3C5HA 1Z6GA 1RW4A 2Z5FA 2DFNA 3IO5A 2HF8A 5CJPA 4OYHA 2QRNA 3T34A 3CX7A 4YMWA 3AVVA 4R2IA 2GJ8A 4DWJA 1F2TA 2ONKA 3CLVA 4XD7D 1GRQA 4MKIA 4ON9A 5KNBA 2YINC 4LC1A 3ZD7A 3AVYA 1II8A 3K53A 1Z0AA 3IIKA 4EJSA 4JLNA 2GDJA 3EPHA 2OCPA 3AF1A 3O47A 1JR3A 3RYTC 3CWZA 1DAKA 4RZXA 2VLIA 1LS1A 2GXAA 5JWRA 1FUUA 1OXUA 1KO7A 2QMEA 1VCMA 1AGRA 4DSOA 4G1UC 1G8PA 4M9QA 2BVNA 2QP4A 1P9NA 2FFAA 4HUQB 3R9WA 2KWIA 5FBVB 5IHPA 3S1AB 4LZZA 1G7RA 2VP0A 5FPHA 2BEJA 1EFRD 2ZI9A 3I73A 2CE7A 4ZIRA 2EVWX 2RB4A 3LD9A 4AG6A 1N25A 4FIDA 4DEXA 1R4AA 1DELA 2BIFA 1J90A 2AK2A 3GLHA 1OFUX 3TLXA 1W36C 1W7AA 4LYHA 1YKSA 2ZSDA 3CRVA 1T3HA 2G0TA 1VDZA 4HLCA 5CM9C 5FOVA 3UMSA 1DE0A 2WJYA 3CO5A 3KTAB 1P60A 3DEFA 3GLGB 4MITA 4TYPA 2AXPA 1AS0A 2ZE8A 2QTFA 1VG9B 4PC2A 5DGXA 2A5GA 5EP3A 2O8FB 2IUTA 2EFDB 4ARZA 4B44A 3NVAA 1AQUA 1TF2A 1NG9A 3DPUA 2F1IA 4CT5A 3Q5EA 1GP2A 1RC8A 4M1OA 1R10A 4TT3A 2GWHA 1JQLB 4DLXA 3MLEA 2IF0A 1IXSB 4Q00A 4O2RA 2BJWA 2GZAA 4DSUA 4ASUA 1G8FA 2XXAB 2IYWA 1NKSA 3CB4A 4QJ4A 1ZM9A 1K8RA 2R6FA 2CE2X 1J2JA 3FKQA 3A1WA 4Q18A 1VMAA 3RDPA 3TNFA 2KB0A 3HPQA 3TW4A 4C0LA 4DCUA 2IYLD 3B1YA 5GJWC 4M1WA 4FWIB 2JIZA 4QHSA 4WAUA 2ORVA 1HYQA 2NO6A 2WICA 3TAUA 5AUOB 5FTLA 3IIJA 5JSZA 3I62A 1GNPA 5EP1A 4EPRA 1UAAA 4X8OA 3IGFA 3TE6A 1K6MA 3FVQA 5DN6D 4F92B 2ZUBA 3EG5A 5E7MA 5JJLA 1EFTA 4UXHA 5AJZA 3B78A 2GVZC 4CEJA 4B3GA 1XWIA 2QPOA 2ZE5A 3B5JA 4JJZA 3WHLA 4XVUA 2O8EA 1ZNYA 4PZLA 1XD2A 2H57A 1ZUIA 2QROA 4JL6A 4G3XA 1E79A 3FMOB 1J7KA 3ND8A 4UNPA 2UZIR 2ZVQX 2IYRA 1E2KA 1FP7A 2R62A 2REOA 2QGNA 4BLRA 4DIEA 3FE2A 3D3QA 2ZYUX 1RVDA 4BFYA 5C18A 1Q0UA 1MH1A 1WRBA 2FFBA 2R2AA 2RH5A 3A4LA 2C95A 1XPOA 1U9IA 2A5DA 1II8B 2VHQA 5DYGA 2ZS7A 3AVQA 3MCAA 4HLQB 4JBXA 3GFPA 3EXAA 3SZRA 4EFMA 2NO7A 4QNMA 3LAWA 4ZKDA 2BC9A 1G5PA 1UJ2A 4L5BA 4LWZA 2BOVA 1XZQA 4JT4A 1Z07A 4AK9A 3ZZUA 4ZDJA 3Q7QA 2VH5R 4JBWA 5KNCA 4KU4A 3SE0A 1W2HA 2WWXA 4Z1MD 3WHKA 4NYJR 4TLDA 1H65A 2A3RA 2ZJOA 3ZVRA 3DMNA 1XTQA 4TYWA 1MABB 1RRFA 3PVSA 2DWQA 1M7BA 2IUSA 1GL6A 3QF7A 5GJBA 3CRMA 3GLHB 5CIWA 4BQSA 2F1RA 5EP4A 4A2QA 2CCGA 3C8UA 2VPPA 5CYPA 1KDOA 3T5DA 4HAUA 4J0QA 2QAGA 4OK5A 4RJLA 1M7GA 4AD8A 2G9NA 4LUCA 2WWYA 1T3SA 1G3IA 1OIWA 1ZCBA 3GFOA 1G291 1RJ9B 3VHXA 3ADDA 2OE2A 1N0UA 4PAOA 1OFTA 4LOAA 4A1FA 1EFCA 4UNQA 1B0UA 1AZTA 4LCBA 4R98A 3LX5A 3ZH9B 3H84A 4LJAA 2FG5A 1DARA 2W6IA 4Q4LA 3TR5A 4OHWA 2J87A 4QOSA 3GFTA 3THXB 4JS0A 2O0HA 1QHHA 1SULA 4ABYA 3KXLA 4FW9A 2GILA 1BS1A 5JEDA 1ZIOA 1J70A 2UZ3A 4TMKA 2JLRA 4C0HA 1W1WA 2HT1A 3L0OA 4BRWA 2NO1A 5HPYB 5J4LA 2W0MA 4Q1DA 4KYIB 4KFTA 2FJUA 4D25A 1EX7A 2EFEB 2MMGA 3OAAD 2V4ZA 4RD3A 2VHUA 2ZUDA 5HCNA 3CZQA 2V6IA 3NC0C 4DIDA 1A2KC 1VYUA 2AWNA 4M21A 4PAQA 3W34A 2OLJA 4PSAA 1XXHE 3MWJA 5K8IA 4DZZA 1Z0JA 4TT3D 5FUVA 5C1BA 2XAUA 4G5GA 1CIPA 2A5YB 4U5XA 2ZJAA 5FFMA 1LW7A 2ZR0A 4OKSA 1AJEA 1D8TA 3DZ8A 1N6LA 3QXXA 1VTKA 2QORA 4BFUA 2I3BA 5KNDA 1U0LA 1ODFA 3QOFA 2QM7A 4L8GA 4RFSB 1Z2AA 4I1VA 1L8QA 2PH1A 3TMKA 3NWJA 1OPXA 1MT0A 5FPTA 1DADA 2VYFA 3UMFA 2C2HA 4PO1A 1GNQA 4NP6A 5EE1A 4C30A 3KXKA 4CGZA 3NHAA 5DISB 1JXMA 5P21A 2CHQA 4G5RA 3WMEA 2XNDA 3ECCA 4AY2A 1ZMXA 3VR5A 4V03A 2EQBA 1XMIA 4NONA 3THXA 2C9OA 1MO6A 4FMCB 4W9MC 5JI2E 2YWHA 1U90A 1KI3A 4D0LB 2CNWA 1E2PA 3JVUA 1ZD9A 4ZV4A 1VCIA 2Q0HA 4NCKA 2AD5A 3PV0A 3HWSA 1W2GA 1HV8A 3D6TB 1ZJ6A 1KYIA 2DFLA 3R7WA 4JVLA 2GEDA 2GJAA 4B75A 621PA 2GAAA 2OAP1 3SHFA 3QPWA 2P5TB 2AL7A 5FL7A 1CLUA 3IEUA 1NIPA 4O25A 2B8WA 1RFLA 1AGPA 1QZXA 3GLIB 4AKEA 2YZ2A 1XTIA 4ILEA 4IOLA 1NMXA 1E2JA 4HLDA 1GRNA 2HJVA 3AQ4A 4XWKA 4AI6A 3FPAA 4PO9A 3AKDA 1BMFA 2JGNA 2ZTSA 1S9HA 5EXPA 2FZ4A 4W7SA 2QNRA 2D3WA 3IBGA 1AN0A 3T1TA 4MRPA 3RVBA 2G3YA 4PHGA 1FTSA 4PO8A 4Q48A 3ETLA 1TF5A 3K0FB 2Z0MA 4MYHA 3AV0B 2GBLC 2ZJBA 4F93B 3GJ4A 4ZCLA 1U94A 5JZVA 4GT1A 4C0AC 1T5IA 5CM8B 2WSSA 2IS2A 3KKNA 4OL0A 3GLFE 4PQFA 3BAFA 2EYUA 2IYZA 4NCJA 5KO2A 3T5GA 4QGAA 3U3KA 3AP3A 4B33A 3AB3A 3K9LA 4EPWA 2ODEA 5J4HA 4PZZA 3VKGA 2JJ2A 1FQJA 4QBFA 1CF4A 2IYXA 3RNLA 3NEYA 1SKYE 2OSBA 4V0KA 2V7QA 3W6PA 3FWYA 1V5WA 3KKQA 1Z6AA 3NC1C 3KUCA 2XB2A 1ELOA 2ODWA 1UM8A 1HT1E 3HYRA 3EPKA 1CJKC 2ERXA 3ZD6A 2GXUA 2AKYA 1II9A 4W5JA 3F5FA 1SZPA 4D0NA 1I4LD 2GF0A 3OE7A 2J5XA 1JEEA 1AM4D 2VQSA 3T1VA 4FCVA 1D2NA 2OILA 1JNYA 1I4DD 1IM2A 3B13B 4PX9A 4A6PA 2QY9A 5JRJA 3ZZTA 4A82A 4P31A 5EE5B 4HYYA 2QL6A 5E4FA 4FINA 1GRRA 3X1DA 2G83A 1U0JA 1XXHA 5D3MA 1GM5A 3N70A 1NF3A 2N46A 2JLYA 2WJGA 2G1KA 5CJ2A 5J4KA 1CR4A 2AFHE 4N0DA 3ZQ6A 4HZIA 4AYWA 1E94E 1KAGA 1XJ0A 4KITB 2NO0A 1QBKC 1KI6B 4P4SB 5CK5A 1NVWQ 1U8AA 4GZLA 3T06B 4V02A 1RRCA 1KK2A 2QBYB 1WMSA 3BJIC 1W44A 4TL6A 3W5JA 4B47A 5K8UA 2VP6A 5KSYA 4M9SA 4JIMA 4L9WA 1UBGA 1U2RA 2B8TA 3UK6A 1CR1A 2ZEJA 4E03A 2WJIA 3UKDA 1NN0A 3O8DA 4I4LA 4XIGS 3BD9A 5JLJA 1ESNA 2WZQA 4B2LA 1KK1A 2ZI6A 2XTNA 4LPKA 1ZD8A 3BBPA 3ZS9A 3HYTA 2CLDX 5SZKB 2ZR9A 3BFKA 2C9CA 3QSYA 1GAJA 4TMVA 3L8ZA 4MRSA 4FN5A 1SXJE 3K1JA 4C4PA 1HURA 1XD8A 1R0WA 1R6BX 4XOIA 2IBMA 1DVRA 3TH5A 1G7CA 3WYGA 1GDDA 4PC7A 2C98A 1HH4A 1IN7A 4LJ9A 4BFVA 4OQFA 2RCNA 1E9AA 2ECKA 3U3RA 1TF7A 4BECA 5GJVC 4TYNA 5FBRB 1YQTA 4HI0E 1K5GA 2ZAOA 2FZLA 1NBME 1X8LA 3ADKA 4QRHA 3MD0A 3QQ5A 4JZKA 2ZM5A 3EA5A 4TMTA 3FOZA 1OB2A 2WIBA 3F8TA 2AN9A 1KJWA 1QG4A 3SN6A 5L3QB 2IXGA 2Z4RA 2A2ZA 4O0MA 5C4GB 4HDOB 1XEWY 2VRWA 2WV9A 1XTSA 5KU1A 5AJYA 1HE8B 1Z08A 2ZRLA 4LBZA 1KMHA 1Q22A 1E4YA 3FKSA 3UATA 2OBMA 4PSKA 1RE0A 4LK2A 1E96A 4Q9IA 1P2VA 4NYMR 4RCZA 2JLVA 1GNRA 3A4MA 1NLYA 5FR2A 1HT2E 1G8HA 5F9HA 1Q1QA 4CF7A 5EE0A 2Z6VA 5LB2A 1NJGA 1G17A 1ZNXA 1E2GA 1QVRA 3VAAA 2ZRGA 3DKVA 3THWA 4TZ6A 1IY1A 1FX0B 4QHYA 1P2UA 1XZPA 2CMKA 3ZQJA 2LWIA 4PSVA 3VQTA 1LF0A 3ZIAA 4HZUB 1WE2A 2Y8EA 2J7KA 3GJ8A 1IXZA 1N6PA 3U7GA 3K09C 5L3SB 4B48A 4TZ0A 1Z6YA 1ZVQA 3GCGA 2EYQA 5UKDA 3SR0A 1P5ZB 2QMUA 2ZI3A 3L2OB 4A0GA 2QT1A 4B3DA 4OJKA 2XGJA 2VO1A 3IILA 4C3ZA 1JBKA 4FD2A 3ZGXA 3QPUA 5AR1A 2ZXUA 5IF9A 5HKKA 4LI0A 4UXIA 4A2PA 1VG8A 5EJEA 2XEXA 3CM0A 1AKEA 3NG1A 3SI7A 3QKSB 3U4QA 2BMFA 4QGGA 1NKTA 4XSHA 3J81k 4BLQA 3EC2A 2J9RA 3U5ZB 4GOJA 4JJKA 5JWHA 3P27A 3HU3A 3TSWA 2IYYA 3P32A 2RGDA 2XOKA 4ZI2A 2RGBA 2JLZA 4MRNA 4ESVA 1H8EA 1XFAA 2Q9AA 2F6RA 3B1VA 4D26A 2PEZA 4DDUA 2IS6A 2FFQA 5J5CA 4MYTA 3EA0A 5KPJA 4ZKEA 1OKKA 1E4VA 2BWJA 3LA6A 1H8HD 4IXNA 5B30A 5JI3E 1OH5A 3B9PA 3HU2A 2E87A 2QZ4A 4PTLA 2H1LA 2DPXA 4NBSA 1US8A 1M2OB 1FMJA 3CF6R 4QM7A 4BFTA 2JDIA 5EXSA 2CCJA 2IWHA 3K0AA 3QKRA 1TQ2A 2XJ4A 3SC3A 4H1UA 4DLTA 1CP2A 4OI0A 1OXSC 3E70C 2XZPA 2IXFA 3PXGA 4AKHA 1NN1A 3EC1A 4E5UA 1TPZA 4XVQA 3RSLA 1CULC 3AM1A 2BEKA 2FE4A 5DLQC 2QRZA 5CK4A 1BOFA 1L4YA 2XSZD 1KNQA 1OFIA 3KKPA 2FU5C 1SXJA 3TUZC 2O5VA 1M6NA 2GEVA 1KJZA 4XTCS 4QBHA 3AVTA 1HTWA 5JMTA 4Q7JB 421PA 3I5YA 4Q21A 1PUJA 1RRPA 3JZMA 4PC3A 2O8DA 3LH5A 3ZVNA 3M1IA 3OEED 2GF9A 2WWIA 1U9IC 5KDOA 4Q4JB 3EPJA 4TL7A 1RPZA 5F3WB 1B23P 1DG3A 4BGDA 3G0HA 3QF4B 3SJCA 1NBMA 2C9YA 2IHBA 1UPTA 2A9KA 2D74A 4MH0R 3KFXA 1G5TA 1P9RA 1X8KA 4II7A 3IEVA 1PLKA 3OF5A 3GP8A 1XX6A 1XCGB 4BFXA 1G18A 1ZU4A 1NY5A 2F1HA 1N5JA 4IFBA 3VX3A 4EDHA 5JFGA 3IKJA 1KY3A 5DE3A 5GVRA 1YZUA 4LPSA 1F3OA 3U7EB 3NH6A 2QGZA 1GKYA 3ND9A 3LW8A 2ORWA 4KO8A 3RAPR 4RD1A 1A2BA 4Q9JA 4CYMA 3H1TA 2Q3FA 2WPDD 721PA 3R9XA 1U98A 3IPYA 3A4NA 4JLDA 4NMMA 3WBKA 1R5BA 2NPFA 3U4QB 1FZQA 1OXVA 3U3MA 3I5XA 2FDCA 1QRAA 4QBGB 3CR7A 2R6DA 4EFNA 2QENA 3CH4B 2YOGA 3UWKA 1YJ5A 2Q21A 1F2UB 2ZRMA 1WCV1 3I1FA 1XPUA 4AYTA 3VR3A 1KJYA 2H7VA 2ZVPX 2UKDA 5HE8A 4ZDKA 4D80A 3WNDA 1W5SA 4R2HA 4RZUA 4B3CA 1DS6A 5CYOA 1ZM4A 2VHCA 3VR1A 5HKKD 2GCOA 3PQCA 2BMDA 1N5LA 3DOEA 1LNZA 4U02A 1S4QA 3GPLA 4Q4AB 1IBRA 5BXQC 1E1QD 3UG6A 1NVVR 3BH7A 4OHZA 1ZU5A 4ZO4A 1ZUNB 3OEHD 3CONA 4M1YA 4LHZA 4DKXA 1N6KA 1T91A 2IYUA 3QBVA 1AIPA 4YXWD 5BW8A 3U61B 4YLGA 1YRAA 5HE9A 3LWNA 1OH6A 2R44A 2OBLA 1G16A 1G3QA 4V0ME 1YR6A 1YU9A 4DJTA 2A7QA 2VHJA 1KO1A 2W2VA 2HXYA 3EZFA 3NTUA 2WKPA 3KX2A 4B3FX 1SHKA 1YZLA 2ZU6A 5IK2D 2OV2A 2YC4C 1CR2A 2RMKA 1FUKA 1G3UA 1G7SA 3LNCA 5KSPA 2WMOB 1GFIA 3EX7C 2ASEA 1ZC3A 1GKIA 1JQJC 2QE7D 4XJXA 1KHTA 4IDPA 3CPEA 4US1R 1E9RA 1CRPA 1KGDA 3C5CA 1UEJA 2F7SA 1YE8A 2XB4A 2P0EA 1Z0DA 2PZEA 4MYUA 4XWAA 5LBIA 3QG1A 4HAYA 4ZI3A 2A5JA 3TQFA 4MYCA 2ZRDA 1IN6A 1Z28A 4A8JB 4F38A 2L0XA 3X2SA 2LKCA 4Q19A 3DZDA 2CVFA 1W0JA 1ANKA 3NBYC 5L3RA 3QY0A 5G3ZA 2RHDA 5LPNA 2FGKA 1G9XA 1G4UR 5G3YA 4Q01A 2VA8A 4Q47A 1Z22A 1RYFA 4DUGA 4XWOA 3PUYA 4JLJA 4RD2A 2KI5A 4TL9A 4AG5A 5F98A 3QENA 3MFYA 2F43B 4OQMA 4URVR 3WMFA 1YR7A 2MSDB 2I1VB 2BMEA 5D3QA 3T15A 3GJ7A 2CL0X 1S9DA 3LQQA 5J4VA 3FHCB 4KAXA 3SDZA 5FTKA 5M04A 3RSOA 4ITRC 2ZI5A 1RKBA 2ZETA 2JJ1D 3IPXA 2QMOA 1FMLA 2GTPA 4KBFA 4U00A 1UDWA 4BWYA 2DB3A 4FWTA 3OFND 3PUVA 1IY0A 3FHTA 4WXPA 5AUNB 1T8TA 5TB5A 2ZI7A 2W6JD 2I4IA 3MG9A 2J0UA 2IEZA 2NIPA 1ETUA 4GMXA 3OHMA 1JAHA 1T0HB 4GFDA 1QDEA 1Z0KA 1N2CE 1ZC4A 2ZJZA 4TQUS 2V6JA 1F2TB 1UADA 1KO5A 3THYA 4BE7B 4OI4A 5IT5A 3B6EA 5LD2B 2OFWA 1N0WA 2HDNB 2GESA 1XMVA 5SZHB 3N2EA 4I1OA 4EJSB 5TMPA 3SHWA 1OB5A 2OM2A 1Q1ZA 3TIFA 2ZE6A 4FXPA 1PV4A 1W4CA 3LVQE 4HLUA 2BDTA 5JCPA 3PEYA 1XTRA 5KPDA 3KB2A 2GA8A 5EXTA 1G3MA 1JXOA 4Z51A 4NL4H 1L7VC 4Q5IA 1BH2A 3K70B 3HU1A 4UJ3A 2D2EA 4I1UA 3R9IA 2RKOA 4RKFA 1DG1G 4BLTA 4OBEA 1LVGA 5FPKA 4NCIA 3B1XA 2JCSA 3K0EA 4QGFA 4ZIRB 5E7JA 1ZD1A 3L82B 4GOXA 2R9VA 3RC3A 1YZGA 1UKYA 1YR9A 2GNOA 2E9SA 3B2EA 5TVKA 3VR2A 2HYIC 5KYKA 3KUDA 3ICQB 2IT1A 5A5GA 2IS1A 4HB3A 1JR3D 1E2MA 2EFHB 4AIIA 4Y0VA 1T0JB 3L0PA 4JT2A 3RRNA 3TSOA 1W0KA 2BBWA 2VP2A 3BOSA 3PITA 2GK6A 4IEEA 3R8CA 4BZQA 4URWR 4D4MA 1QHNA 2SHKA 3VNUA 4PPFA 3K70D 4DDTA 2CHVA 4CEHA 1VHTA 1NIJA 4ARZB 2ZRPA 3I3SR 2ZROA 4KLZA 2BV3A 8OHMA 1TUIA 2BM1A 4KVAA 1NNEA 2XITA 4AWXA 3SU8A 2OESA 4V0MA 4EPTA 1E0JA 4NYIR 5EZ6B 4C9BA 1EK0A 2EWWA 1D2EA 3B8HA 3WP0A 1QHYA 1EG7A 1ZM3A 2IXEA 2YC2C 3KQNA 1NL3A 2RGGA 1G1MA 1QF9A 2UVQA 2C8VA 2JLQA 1LS6A 2QSYA 1PUIA 2GXQA 3HDTA 2BHRA 3I72A 2YJTD 4MUAA 3PG5A 3GEIA 4O3MA 2ZRHA 4TLBA 1G7TA 4PHTA 3QJYA 1XEXA 4HB4A 3EZ2A 1GL9B 1VHLA 821PA 1UBCA 1OHHA 1GVNB 221PA 1E9CA 3CUEF 1G41A 1TAGA 3IQWA 4IFEA 3TK1A 5JSZB 1D9XA 1J8MF 3A37A 4ACAA 2FF7A 4M0LA 1R8QA 3GJ5A 3U3JA 1E9SA 1VYVA 2GKSA 2KBEA 2GCPA 5A0FA 2ZUCA 3ADCA 4G5OA 3MGCA 4AKIA 4IDOA 4CEJB 4ASUD 5C4MA 1LF5A 4MDEA 2PLRA 3WNCA 2IK8A 1XD2B 1COWA 1VG1A 1VIAA 1SVSA 2RGAA 3EIHA 5FI0B 2CXXA 1X1RA 1FL9A 2VSFA 4MA4A 3TUJC 5FH9A 4LBVA 1YZQA 2J7PA 4B3BA 5CITA 3U44A 1F60A 2FX3A 4NCNA 3CRW1 2JIZD 2GJ9A 1PVOA 1E99A 1PZNA 1AQYA 1I4TD 1VG0B 1XTKA 2WSMA 2O8BA 2D7CA 1JEDA 2ANBA 3LBHA 2OCAA 1MV5A 2ZI4A 4V0NA 5B58C 3EPLA 1TTTA 2D62A 4W5WA 3SJAA 1IJFA 3BB3A 1E2NA 1P4SA 2GHIA 3NBFA 2J1LA 4QXAA 5DI3A 3VHLB 2E1RA 2ZAMA 1NMYA 4POAA 5CB8A 4CZ2A 4PANA 1E79D 3VU9A 3KQKA 2JA1A 2IYTA 3ZS8A 4LGMA 1DAGA 2PMKA 2V1XA 5HZHA 5KTYA 1M1YE 5FUXA 3PJRA 3CKLA 4RZ2A 1BKDR 4DRZA 1XP8A 3WMGA 3UG7A 4Q9LA 3AVPA 3RS7A 5JCZA 1ZNWA 1A82A 4LSGA 1M34E 3LBIA 2FGJA 4OI2A 5EUMA 2I1QA 3KKMA 4JL5A 3K9NA 2QAGB 5KHOC 2TMKA 1Z29A 3BH0A 2J59A 2H92A 1Q57A 4DCVA 1N6RA 3QE0A 1WF3A 5FPYA 4Q02A 3R8FA 1KSFX 2O52A 2A5FA 3OIVA 4PQYA 5G53C 4HB2A 4EQ6A 1TU3A 2H18A 2VSOA 4CEIA 4IJMA 4DT1A 4Z54A 3BB1A 1BO6A 4HDQB 3RHFA 2HLDA 3PIRA 5C2JB 4RVCA 4BEJA 3EZ7A 1LB1B 4PR0A 4DCTA 4RY2A 2ATVA 1NLFA 1YZKA 2V9PA 3CX6A 2BM0A 2HUPA 4LBWA 3A1UA 2D7DA 3W3AA 1QHHB 3IDQA 3NKVA 4RCYA 3RS0A 3HJNA 2HCBA 1MO5A 4QKQA 1CTQA 3K0CA 4G01B 3VX4A 2VHTA 1ZINA 2IYVA 3QXCA 1W4AA 1GTVA 1FNNA 3CZPA 1UDXA 2OEPA 1ZYUA 4TQ9A 3UMRA 4QHTA 2IW3A 2ZYWX 3AF3A 2CL7X 1XTJA 1T8UA 1XMJA 1U8YA 4MDFA 3C15C 3FFAA 4JKIA 4KCGA 4C7OA 4TYYA 2DFKB 4P4TA 1J99A 2PT7A 2OCYC 3BGWA 2V54A 4IOKA 3ZVMA 4H1VA 3UANA 2D4HA 2PEYA 4FMDF 4Q1FA 3V00A 5JEEA 1TMKA 2W6ID 4B2IA 3BS4A 4M9ZA 4L4UA 1KTVA 3T35A 4Q7MB 4DB4A 2JAQA 3RS5A 4UKDA 1Z5ZA 1IN8A 2N42A 4TSFA 2DY1A 2RGNC 4PC1A 3OESA 2OFXA 4N0EA 2BKUA 1NMZA 3W5IA 1G64A 5BYJA 2DBYA 2WOOA 1XF9A 3ADBA 3CPJB 1EWQA 1M7HA 4EAQA 3U44B 1SVOA 4GNKA 4IDNA 2C77A 5FBQB 4D0GA 2XZLA 4BFSA 3ZLJA 2NGRA 2VF7A 5DHAA 1R0YA 4DLRA 3QVVA 1LTQA 3LO5A 4L16A 1UKEA 1U0HC 2CK3A 2VP4A 2WJJA 2OXRA 1Y3AA 3GMTA 3NH9A 1KIMA 4FI3C 2HJGA 4KFRA 4TLEA 4ZCIA 3AF4A 1Q12A 5G41A 2W00A 1G5RA 5DI3B 2YWFA 5FI1B 4LHXA 3KFVA 5DHFA 5FUYA 5SZJA 1XEWX 3CF0A 3GD7A 1OFHA 2WAXA 3WXMA 1TADA 3QPVA 3TSZA 2CLSA 4JYBA 4A8JC 1JAIA 3R7WB 3O8RA 1E9EA 4Q66C 2ZYVX 5FBWB 5AJWA 1D2MA 2REBA 3NDPA 1S1CA 4N3NA 4MGZR 4UXJA 2XNDD 2ZQ5A 3G5UA 1NJFA 2FOLA 3U2QA 5C46F 3D31A 1KI4A 1N5KA 2V1UA 2DHRA 4DLVA 1YZNA 3EZ6A 5FUWA 3W3ZB 4B73A 4DVGA 5JBQA 1F5NA 2CNWD 4JLAA 3TW8B 4OQLA 4V0OA 1Z06A 1M8PA 3K0SA 4MQBA 1KMQA 2Q6TA 3BWDD 4TTRA 3LLMA 2FFHA 5KOYA 2IYQA 3NBXX 4Z8YA 2JJ8A 2OO7A 1L2TA 3EIEA 3SS8A 2WJVA 1HEIA 4M1KA 3NBZC 3GLGE 1C1YA 5FL7D 2FSIA 2Q3MA 1KSGA 1SVLA 4GP7A 3REGA 1O3YA 2VEDA 3FMPB 4HSEA 4TN1A 1KI9A 2OBNA 3TVTA 3MWKA 1CS4C 2CBZA 2HYDA 3Q72A 2NPIA 4JLBA 3U3OA 2IF2A 4HEJA 4URUR 2OT3B 1NRJB 1SGWA 1BMFD 2WVJA 3KKOA 5LD2C 5ELXA 3I4LA 4YMUA 5DI9A 1Y63A 3LW7A 1DTSA 1ZRHA 3MJHA 4EJSC 1E1RA 4IVRA 4F91B 1CEEA 1JPJA 5H1YA 3P20A 4LJYA 4ZPXA 1CR0A 1FTNA 3PUWA 4UJ5A 1Z3IX 2BJVA 1T6NA 4I99A 2OFOA 2QPTA 4LJ8A 5LB4A 3SNHA 4Q4HA 1Z2CA 5FL3A 3A1VA 2W58A 4KSBA 3K70C 5HTKA 1E9BA 2G1JA 2Z4SA 4LJ7A 4C0BA 3CPHA 3GLFA 3KZ1E 5CIQA 4W5HA 1W4RA 1VKJA 3BXZA 3BERA 4MGIR 4NH0A 1KKLA 3FHOA 5HCIA 4XH9B 1OXTA 1Z47A 2WSSD 1NP6A 2ZE7A 5TY0A 5CLQA 5IDVA 4B71A 3GJXC 5JJKA 2HEIA 4TMXA 3TKLA 2WWWA 4LV5B 2XZOA 2P67A 2FSHA 2WOJA 4A2WA 2JJ2D 3H86A 2GZHA 4B6FA 1S96A 4E22A 1GZSA 1XXHB 2ZSFA 2RGXA 3PCRB 5D3MB 2V7QD 4NTZA 3BFXA 4WXRA 4C2TA 2PBRA 4ERNA 4S35A 2PCLA 3X1ZA 1Z83A 3GJ3A 5B57C 1G8YA 5GVSA 4E09A 5FOWA 5IRCD 4LV8B 5F2EA 3A58B 4PPGA 2X8AA 2FNAA 1CBUA 3RRMA 4F4JA 3ZYCA 3OE7D 3Q8XB 3L8YA 4URYR 4BUJA 4CRWB 4TSFD 3W9YA 4DLWA 3TGPA 1L4UA 3RRZA 5JJIA 4A36A 2PLFA 2PX3A 2GZDA 4DSTA 2IWRA 4QFMA 2V3CC 1KZGB 3BH6A 1MKYA 2DWPA 4QJ3A 1T5LA 4P0TA 3AP2A 1EFRA 2REXB 3KL4A 4JLKA 4YQFA 1ZW6A 3P4YA 2QU8A 4UNNA 4DDVA 3RLFA 2ZITA 4PHHA 3EASA 5DO9A 3L0IB 2QSZA 4TMZA 521PA 2C78A 3OIUA 3TR0A 5LDDC 4LJ5A 1P2TA 2WWFA 3GLHE 4DEYA 1DO2A 3A8TA 3C16C 5FR1A 1GITA 1TL7C 3LX8A 2NMVA 1KDRA 1CJTC 4AC9A 4ZCMA 1KAOA 4YDSA 3H2YA 1R7RA 2ZJYA 1KDTA 4HUQA 3PENA 2PMDA 2MSEB 1IHUA 5AK0A 2H16A 3AEZA 4DB2A 4OHYA 2B7CA 1VPLA 3CNOA 2YYZA 4NDZA 3QKUA 5EE9A 2YNMA 3KQUA 4NU0A 3P1JA 5FTNA 4BZXA 3X1XA 2CJWA 3ZJYA 2D2FA 5TXGA 4R71A 2J0SA 2W0SA 2B21A 5DNYB 4KHZA 1E69A 4R9UC 1AKYA 1KMHB 2J0QA 4BPBA 2G0NA 3QUSA 1PLJA 2J45A 2Z83A 2GCNA 3KJEA 4PPNA 4A9AA 2AWOA 2X2EA 3KTAA 3GLGA 1G4AE 3MWLA 2XTMA 4QGHA 3RRYA 3AUXA 4HLUC 4OK3A 5EE3A 3THWB 2J46A 4D6PA 1GIAA 4Q4HB 5H68A 4B35A 2QTVB 4D4JA 3E1SA 3LBNA 3LQRA 5KSZA 1OV4A 5G40A 1XDBA 2VTKA 3WRYC 5L3VA 1WXQA 3K9GA 3GLFB 2EU8A 4DXAA 5JHGB 2WKQA 4G0NA 1ZM2A 5DN6A 5EP2A 2LKDA 1E0AA 1A7JA 1N6OA 2QTHA 3C14C 3FTQA 3AUYA 4RD4A 2GRJA 3FKSD 4M8NE 1DOAA 2WAYA 2XXAA 3OZXA 4EFLA 1SKYB 4CW7A 1QVAA 1E1RD 2VSXA 3PUZA 5B2ZA 3RC8A 1VYTA 3B1ZA 3QI2A 2GEUA 5AJXA 4V0LA 1N6HA 1OE0A 1ZBDA 2AXNA 2QAGC 4KBGA 4LY6A 4CT4B 2RGCA 3SYLA 1NVUQ 4Q1CA 3NDBB 1R2QA 2OAQ1 4BFWA 3QXHA 1P72A 1OIXA 3V4FA 3HR7A 4FCTA 3ZIAD 2QAJA 4TWZA 3CF2A 1W5TA 4JL8A 1DO0A 4B3XA 2GXSA 2OUKA 2F55A 2KBFA 3WYFA 3F0TA 4A6XA 1MR3F 2JEOA 4C0JA 3IBYA 4NYMQ 4IVQA 5KUTA 1UBEA 1E2EA 1HE1C 4LJ4A 3DKPA 4Z1MA 2NZJA 2FH5B 1KKMA 1Q3TA 2XJ9A 2FWRA 2V55B 3IQXA 1US8B 3MSXA 3VKWA 1NY6A 4F7WA 3H4MA 3MJRA 3T61A 2XOKD 2XX3A 3K0AB 1Q1EA 2D06A 3QKRB 3ZDQA 2OLKA 5H8WA 3GJ0A 1H8ED 1NI3A 3GLIE 2X19A 4Q7KA 1VECA 1E9DA 1EFHA 4DCSA 4DHEA 5J4YA 5KSOA 2X1VA 1R0ZA 2JATA 4WZ6A 2QI9C 1A1VA 4CDGA 1OKKD 3AH8A 5FOTA 1IJEA 1WBBA 3K09A 4MUBA 3TQCA 3D8BA 1SXJB 1DPFA 1F48A 1RRGA 1MABA 4WZBE 3L43A 4M1MA 2Z43A 2JDID 4DLUA 3D7MA 2BBSA 2CJWB 5GADl 1Z0FA 2O8DB 1N3BA 3OIYA 2CVHA 2YOFA 3AGPA 5FOSA 4KXFB 2XTZA 1S3GA 4L9SA 3FB4A 3RS2A 3U60B 3Q3JB 3QBTA 3DDCA 4HAVA 4NKRA 2GETA 2HXSA 3C41J 4B6EA 3W6OA 1WDTA 2RAPA 1P9WA 1QHIA 1GILA 1U99A 3UXMA 4D4KA 2FEMA 4RFVA 4BASA 3O8CA 3OAAA 1RJ9A 4I1SA 4RSGA 4Q1EA 2B92A 2IHYA 1OYWA 3LXXA 4F4CA 3I61A 2AD1A 3ICEA 2NOAA 1SXJD 1QHSA 1XJQA 3DOFA 4LYAA 2HV8A 5E7IA 1DAHA 2F3RA 4U7DA 4ZDWA 4Q9HA 2FV8A 1GL7A 1MOZA 1FQKA 1S3SA 1SVWA 1OW3B 3IIMA 1EESA 1TQ4A 4JLPA 2JLSA 1V43A 3FYHA 2DFTA 1W4BA 4A0FA 2QP9X 1S0UA 1VCNA 1NBMD 2PZGA 2ZJ5A 3GEHA 2A78A 2XNSA 4A0HA 4QBIA 3W6NA 4JVNA 4PQRA 3SFVA 3DO6A 4X8HA 1G6OA 1R8SA 4WA7A 1QHGA 2ZYTX 4GMDA 4PAMA 3AVOA 2JLUA 1U81A 3LDAA 3TUIC 4EPXA 1KI7A 2WIAA 3IHWA 1OH7A 2GJSA 1SKQA 2FSFA 2VF8A 4KJZA 4URXR 1UEIA 1E2IA 3K9HA 2ZIAA 4KLNA 1CJUC 4EIWA 3CH5A 4PZYA 4QM6A 4E07A 2GCOB 4IW3B 3MAAC 4RFSA 3QEJA 2R6CA 2ZJ2A 2F9LA 1E2QA 2CL6X 1NVXQ 5JHHB 3K0CC 2FEOA 5FOUA 2FSGA 4D82A 2C03A 4UNSA 3AKCA 5K8LA 1KK3A 2DCUA 1WA5A 1E2FA 4YMSA 1ZIPA 3LFUA 4BFZA 1AS2A 2O8EB 4GSYA 4TYQA 121PA 3NHBA 4Z8XA 2YWGA 3AVXA 2O8CA 2GK7A 4BLSA 3UIEA 2W2TA 1DAEA 3B1WA 1EX6A 1SVKA 2ZRNA 3RS4A 2PZFA 2PX0A 1MRSA 4YC7A 2YVUA 3RABA 1EXMA 1DAFA 1R5OA 2KE5A 3NXSA 2NTYC 1P75A 1CRQA 1CU1A 3G82C 4WIAA 5DSZA 3SJBA 4QC2A 2ZSAA 2J41A 5DYIA 1G8GA 2P65A 3GEEA 1KO8A 5BQ5A 1EGAA 2ONJA 3RS3A 4GI7A 2AR7A 5KDDA 2J0VA 4DSNA 1XMSA 2WMNB 3GLIA 3W8RA 3AKYA 1ONBA 2EFCB 4FCWA 1OIVA 2VP5A 4C2UA 2ZR7A 4N1AA 4UNRA 5BN3A 3B60A 3TRFA 5EUQB 3ZVLA 4K46A 1DAIA 1E0SA 2FA9A 2QUZA 4HUTA 4H9GA 4JBYA 3ASZA 4KV9A 2QQ0A 4YDHB 1NN3A 1UKVY 4FMCF 1P6XA 1Z6TA 1SVMA 2YKGA 3C7KA 1N6IA 4K8OA 5JS8A 2IL1A 4IOMA 4LX0A 4Q1BA 3QNUA 2OXCA 4HAXA 2IS4A 3K0FA 1NVVQ 3QKTA 2P6NA 2P2LA 3VR4A 5TARA 2WM9B 4JMPA 5AWFC 1XB2A 4JLVA 5JS7A 2P6UA 1WBDA 2NQ2C 5FTMA 2V8OA 4PHFA 5BN4A 5JWOA 1G6HA 3B9QA 2O0JA 5BN5A 1P61B 2X77A 3N2IA 1VIYA 4B74A 2F1JA 1W0JD 2FN4A 1MRNA 3Q9LA 4MKHA 3RANA 1P62B 1R0XA 3BORA 4GDFA 3PUXA 4A92A 2RGEA 3A6PC 3BFVA 1I2MA 4LC0A
chains in the Genus database with same CATH superfamily
2YOHA 2PA3A 2PL3A 2EBFX 4GEGA 5LSAA 1NWHA 4W8GA 2WRZA 1KWKA 3DM5A 1YS6A 4DUGD 4U9UA 2Y92A 4NE2A 2YFKA 4X8MA 1JI3A 2V03A 4HWKA 1DZIA 4HGNA 4KVGA 3ODPA 4U2GA 2W2NA 3B82A 2C3OA 2ZRBA 5HUQA 4HAWA 4J90A 2HM7A 1CUEA 3X1YA 4F5WA 5FNVA 1U2QA 5LXTA 3DUFB 4P54A 1PJTA 3N7TA 4FD3A 2QRGA 3AZPA 2A3NA 3RM3A 2R7MA 4MV6A 4NMHA 1E1CB 1LQ2A 1QUEA 2C5SA 2CZCA 2Q1TA 1ECBA 3II6X 1RAHA 4RD0A 5GJCA 1UXOA 3GK3A 5E4TA 3JRNA 1FZTA 4ND8A 1QIMA 4JEHA 3E03A 3WYCA 3F74A 5GINE 1WP9A 2C2YA 1FW6A 3IQFA 3UGJA 1RE1A 2ZK7A 3DQPA 4NENB 2UDPA 4I50B 4LBYA 4LIPD 4PWYA 4XX0A 5JATA 5K8TA 4E7PA 5CLIA 5DTJA 3SJ7A 3HNRA 1MRZA 2JLCA 4BO8A 3UHOA 5AXAA 5CDTA 5G0VA 3EARA 2VBCA 3IDSA 1BMDA 5FFFA 1KI6A 5BXYA 3KQLA 1OZGA 1PZGA 1LZLA 1RTKA 3UYLA 3V55A 4OJQA 2ZUTA 5AVVA 3HRIA 4G9BA 1QLJA 4EVQA 2X5NA 2X42A 1Z8FA 4RGBA 3JTEA 4TLLB 1NZJA 1XBTA 1G20E 2VJLA 2SKCA 4G5QA 5REQB 4EUSA 1A8UA 2P3SA 1T2FA 3PQDA 1LJUA 4DQXA 4CHGA 4MR8A 3H99A 3IE2A 5ALKA 1GY8A 3BD7A 1MJGA 2H8GA 4YMLA 3HWWA 2IUFA 2ODBA 3K6KA 3OO0A 2QP3A 3OT5A 5JUWA 1WPRA 5JBNA 4X6YA 3N75A 5IABA 4UQLA 5AM1A 3EBOA 5KWVA 2ERYA 1TEVA 2X8BA 3V1LA 1BNCA 1WXDA 3ZU5A 3IUYA 1YI0A 4EH1A 4EO9A 4MKFA 1VL8A 1S02A 3VTAA 4Q03A 1CJSA 2Y0DA 1JVNA 2ESRA 4KAJA 2RI0A 3VRHA 2OCBA 1R15A 4B43A 2P1DA 4BNNA 2Q1SA 5CM2Z 2QLNA 4KSCA 2VUHB 1VSBA 2CN1A 2WNHA 4JGGA 4Q3OA 5GV7A 1S8FA 1LRLA 2O0KA 4M53A 4OYRA 5JC1A 3CW2A 3AI7A 3EYAA 4C0QC 1L1EA 3PS9A 4CTJA 1NLZA 1HDEA 2V7BA 3PWTA 4F8JA 3PIDA 4AULA 1NSTA 1LA2A 1DC5A 4DLSA 4UQOA 2FR8A 5I4IA 2O06A 2D6FA 1EFUA 4B0OA 2GM3A 4FYXA 2VL7A 5AW3A 3NGLA 5COQA 3G2MA 3ZHUA 5COAA 5ICEA 4BY9E 2B7BA 4RZ3A 5DBHX 4UEJA 4NYJQ 1S1MA 3FNEA 4GR5A 5JD4A 4F56A 4O1IA 5AMXA 1A4RA 2BMAA 2J5QA 1RJWA 3CR8A 4I81A 2AI1A 3WYAA 1A8QA 2Q4OA 3ETDA 3ASYA 3JWJA 2YVAA 3CH6A 3V9AA 2P2DA 3C1UA 5KCZA 3FCEA 4PRZA 1WCXA 3M0EA 3EZYA 1LNSA 1DPGA 1GKUB 1I1OA 4JOBA 2IUUA 1JLKA 1GG2A 2F3TA 2EP8A 1VHWA 2JK1A 4JSTA 4LEIA 3SQOA 4CKZA 1B0AA 4KQHA 3CEJA 1XCPA 2M1ZA 5BMVF 2QVZX 3VA7A 2FQXA 4US0R 5C53B 1WDWB 4GE0A 2PXCA 1KI8A 4R1TA 1I2BA 1RBYA 4RGQA 4AJNA 4D0SA 3F1LA 3ZJTA 1XZ8A 2IC5A 2Q1YA 2QT0A 5CFMA 5JZOA 1EHCA 1VRWA 2VIIA 3FDZB 3PEWA 3AVUA 3NI2A 4NNJA 2WHEA 5IJ9B 1XD9A 2JJYA 2JVKA 2ZB8A 4Y9RA 4CLHA 1KY2A 2R1VA 4QU5A 4OOFA 5L7YA 1NR7A 3EMKA 3O4JA 5DIFA 1IN5A 4EKDA 2FG7C 2DH5A 1G3RA 1WXEA 5I7RA 1I14A 3G23A 1QVZA 2FMHA 2DWOA 3S3TA 1Z0IA 3PKJA 3ZZ1A 3SQXA 2UZAA 2YWCA 5EESA 1V2GA 1JVBA 1BCRA 1R0SA 1TCVA 3KJHA 3VOSA 4WCFA 2PMBA 4F45A 4B3MB 2WSIA 1SD1A 4Q9KA 4X1YB 4HB0A 3TEJA 1ZUWA 5IDYA 1CKEA 5ECYA 4ZT2A 5ENZA 4U2CA 3MRSA 1OTYA 3SYNA 2DR3A 5DYWA 1V48A 4BLWA 3D3WB 4YREA 2P9CA 1N4AA 4BQNA 1CUSA 3KL2A 2BUCA 1MOQA 3GUZA 1W36D 3O3OB 1MO3A 3GRFA 3OT1A 3SOPA 3DL0A 3WIOA 4AJJA 2EJTA 2ICAA 1WW3A 3VKVA 3PFFA 1SKUA 4FJ2A 2AFIE 2XKJE 3WLIA 3WLOA 1IHDA 4AW9A 5BOVA 4HN4B 5IJZA 4JLSA 1OBOA 3ICCA 2AMLA 1Q3HA 4HN2A 3NEJA 4LHWA 4LRQA 1C41A 2KSQA 2HK8A 4PNHA 2BW0A 4KWHA 1ZCAA 3A36A 2NUTB 3WLAA 2G6BA 3JYHA 1MLDA 2CHFA 4OK6A 4K7JA 3AILA 4V0QA 5CXSA 2JS7A 2WT9A 4B6SA 4GQIA 5CT4A 2R6GA 1JPNA 1BU5A 3NEPX 1DIOB 2I4TA 1J9EA 4G5SA 4EEKA 3PGJA 1P3Y1 1U2ZA 1PJRA 4TLCA 4U2EA 4O3FA 1C3XA 1GZ6A 2YIDA 5K0ZA 3NAZA 3VR6A 4CMIB 1AU9A 1I7LA 1EVQA 2Z9DA 3QVWA 1EP3B 1CJVC 3MJDA 4NH4A 2J6IA 2CLOB 4GZMA 1NUHA 3FWNA 1EWVA 1HLFA 4CKEB 4L15A 2A5LA 3BD6A 3LPNA 2ZRAA 3RDPA 1KQFA 4B82A 4BNUA 1CQPA 3UAXA 4V0RA 1YQEA 1YRBA 5A06A 5HVNA 1WP4A 2WHXA 4K0RA 4LHVA 4ZT7A 4CIVA 2Q9CA 5A4FS 5LP6B 1J0DA 5DMHA 2ASVA 1U8FO 2C5AA 5K0LA 1TM4E 1T9AA 2XVXA 4GMHA 3QVMA 1QZZA 5F1YA 4B8ZA 3LKZA 4I4TF 4C14A 1XJCA 5G1PA 4NESA 4CR6A 5HJEA 4EPVA 4HCJA 1U4SA 3VVLA 1JKMA 2ZYGA 3MMPA 5EIEA 2VJBA 4JMLA 4DGSA 5EMKA 3IAUA 1OF1A 3KD2A 1MNQA 1XZKA 2IEYA 2JH9A 2B2CA 4M1TA 3TMYA 4R9VA 5FWDA 4A0RA 1U1GA 4ZOEA 3I92A 3E9ZA 3H2IA 5KDLA 4EL5A 2Q7XA 1QG2A 3W3AD 1XTBA 3QUTA 5K9ZA 2C8JA 3RAGA 3MCVA 3LWBA 1ZNZA 2XUAA 2XF2A 3WGUA 1NULA 3DTVB 4O4JF 3BIFA 3H5VA 3Q5DA 4RF3A 1RRVA 1SZJG 1UPFA 4JVMA 4UTVA 4G56A 3PC3A 1FS5A 3KVVA 2R8YA 3CWQA 4L2IB 5G0TA 4MGKR 1L4KA 1P1FA 3CLRC 1FY2A 3HJHA 2FN7A 3UJ9A 5KOHA 1I3OA 1T4GA 1Y4UA 3GIDA 4A5SA 5KZMB 4IH9A 3TR6A 3KAKA 1QAMA 2N1BA 5BN4B 3VFDA 1M6HA 3B9BA 4MAAA 3P4XA 2Z9BA 5C5IA 3KR2A 3Q8KA 1RIFA 4IBOA 4XGIA 3ZX4A 1Z0ZA 1P1BA 1J8YF 1P3DA 1PGJA 3ZTYA 1A97A 4JI2B 5I9TA 1X70A 4JJ7A 4DGQA 5LQUA 4GL2A 1E32A 3CRQA 1TZBA 4KFSA 4C0SA 2HNBA 3IO3A 3L0CA 4AT1A 4CFSA 4CKBA 2BSQA 2QEQA 1VGQA 3V9PA 1U5CA 2O7NA 4LK3A 1TU4A 1FUEA 1X7XB 2PMFA 1C9KA 4IDAA 3OJEA 3N8IA 2XDAA 4IH1A 4L7VA 5IXJA 5AHWA 4HAZA 1E5QA 2AGVA 1YZVA 2WJPA 5ANRB 3UV6A 1RQRA 3YASA 4CM5A 4KIWA 2G76A 4BLOA 4DIUA 6LDHA 5KJ1A 3R1IA 2ZU0C 3VMFA 1BCSB 2VOEA 2QLMA 2GZ1A 2X8JA 3Q87B 1ZXBA 1RYHA 2H17A 1XPRA 4WPGA 3OEHA 3PQ2A 5FLKA 1J8QA 2ISSD 4MEJA 4MKGA 1V3TA 1L6RA 4F5DA 4YXWA 2R7AA 3QMWA 4ENVA 3TS1A 2W2LA 5DSTA 5I7EA 4F96A 2WTUA 1DLIA 1I80A 4X60A 3TN7A 2CK3D 4OSOA 1X8JA 3PXAA 1T1SA 4PSCA 1AKQA 4PIVA 4EY5A 1Z6QA 3G0OA 4AO8A 3LLUA 4D3FA 2B1IA 5DV9A 3G8AA 2FLWA 5EHGA 2SNIE 2RHTA 4FS3A 4U1RA 4CKCA 4BNGA 2CNDA 4OP3A 2R6JA 2UVDA 3P4UA 4QYIB 5I48A 2HWKA 3WIDA 1ZOPA 1JDSA 2GN2A 2I3ZA 1KJQA 1N2IA 1WUTA 2CJFA 2RBEA 2Z2YA 3EVAA 3JRXA 4LMAA 5TC4A 3WNZA 4BBZA 2QE7A 3GGJA 4BTVA 1IXYA 3ZJ5A 5BVHA 1B41A 5BNFA 5I4KA 4YMVA 3KJIA 5DNWA 1T0UA 4HUTA 5DM0A 3EW9A 5E6SA 2WKRA 3R6TA 5ES3A 4AY4A 4B80A 5EQJB 1S6YA 2CLKB 1JILA 3AL0C 3K9QO 4BU0A 3HN2A 1P2SA 2Z3VA 4DS3A 3BA1A 2ZUVA 3A1SA 3OPYB 5KYXB 1MO4A 4OAPA 4XGQA 2EGGA 2P0YA 2G77B 4MRRA 5B36A 2ZBQA 3HU5A 4AYXA 5AESA 1ZWKA 2G28A 3AZOA 4J1SA 1JH8A 2LDBA 4TV9A 4Y2JA 3VSAA 3ZV3A 4C5AA 2VZ8A 2POQX 2QTRA 3NM5A 1E3JA 4QOEA 1P73A 2AZ4A 4PYKA 2PKWA 2PUDA 2B99A 1FFDA 3AJEA 1USIA 4JYMA 5A5DA 1TJ3A 4BATA 1X3LA 2OVBA 1OJ7A 4QECA 3NM6B 3WLJA 3LBFA 1UWCA 2REQA 1X7GA 4D4LA 5DASA 1IBSA 4AS1A 1H69A 1TUGA 1QS0A 3SBEA 3UH0A 4AXBA 2C9BA 4COKA 5JARA 4CLOB 1IBLB 2W90A 3OKPA 2QL5A 3H9QA 5K5EA 3GQBB 1Y5RA 3MRXA 3TTVA 4E31A 3B9RA 4B5KA 1TVKB 4N5MA 2JBAA 3ZE9A 1OWPA 1QQAA 3PGA1 5IJ0A 1NV9A 3EAQA 5AHKA 4EX6A 5K6AC 2ODNA 4MQ4A 4WOBA 1XJWA 3HA3A 2QAIA 3I6YA 3QK7A 5AH0A 1RI4A 2K4MA 1B2LA 1QKKA 4TL8A 4XIJA 3HP4A 1YBFA 3DE0X 4X97A 2FI1A 1M72A 3MD9A 2F43A 1Z63A 1P3JA 3ZOZA 1Z73A 4PX5A 4HATA 1XQVA 1KC1A 2QY6A 5FEMA 3QVGB 2VRNA 1FFAA 3VR0A 1B6TA 3LVRE 4YJHA 4GP6A 1TQHA 2QLTA 5BW6B 1A7UA 1Y7HA 3FCYA 5CDHA 2XUHA 3TJZA 5KQSA 4X8LA 1CUDA 1TX4B 3K9BA 3LX6A 2D0IA 2GYVA 5F2OA 4ESHA 1R9GA 1W46A 3JATB 2DSNA 1IOZA 1S2NA 1JF8A 4N03A 1N32B 1SXQA 3K30A 3ASUA 2O3SA 4YP0A 4S1WA 3GOQA 2CV2A 2PE5A 4IIJF 2HF8A 3FSGD 1C8VB 4ZODA 2QRNA 3BCHA 4ALKA 4KZPA 1SRRA 4BO4A 4F4UA 4P7JA 3AVVA 2HU7A 4R2IA 5J43A 2BDEA 3B51X 5ADWA 1DV1A 2EHJA 2PKEA 1BXRA 1FQWA 1NVDA 1GRQA 1YQWA 5KNBA 2FX5A 2LD4A 4LC1A 3L46A 3N58A 1E7YA 2QTTA 1KY4A 2GERA 3AVYA 1CWUA 2P1RA 3I9JA 3ZWKA 4BX3A 2HFKA 3E9MA 2BFEB 4ID3A 4IIHA 3H9BA 5E8JA 3OHSX 2NYVA 2XE8A 3AF1A 4FDLA 1JR3A 1FP4A 4P3NA 4BNFA 3CWZA 1DAKA 4RZXA 4P3OA 2ZRQA 2VLIA 3I9KA 3PC8C 2GXAA 5DGDA 1OXUA 2BFWA 1BG6A 2I2BA 1VCMA 1AGRA 2IYAA 2QMEA 3H5IA 5IYZF 1FUIA 1JT9A 1O6CA 2YJZA 3E81A 1WABA 4LNUA 4DLKA 3BXPA 2FFAA 3RBXA 3ZQUA 1GAEO 2WHPA 4KH1A 5FBVB 1NNLA 1YC2A 3L05A 4LZZA 4BDTA 5JPCA 4RTJA 2EVWX 1UK7A 2V7PA 3LD9A 4K2HA 1R4AA 1DELA 2BI8A 2H65A 1OFUX 3NM4A 3TZEA 4CEHB 3KQOA 1VSQA 4MWSA 5F7OA 5KYUB 1N2SA 2WJWA 3L0DA 2C4KA 4QXRA 5GGYA 3R7BA 3RH0A 4DNOA 1ZJYA 1HZZA 1DFHA 4FYKA 4MUHA 4JDUA 1VDZA 3E5MA 4OFBA 3ZWWA 3UXHA 2J8ZA 2AHRA 3IVCA 4R8LA 3WLKX 2WVAA 1P2GA 1DE0A 2WJYA 4C4AA 1P60A 1Q14A 3U4HA 4IIXA 4MITA 4IYJA 2JH8A 4TRRA 4UTNA 2PRYA 4U7PB 3IEXA 4ZOCA 5EP3A 3T9AA 5B3KA 3FSRA 4ARZA 3WAKA 4IDEA 5FO0A 4UUQA 4YVFA 2WYVA 5C8VA 2R25B 3PNKA 1TF2A 4CT5A 4DIKA 3Q5EA 5L51A 2PS0A 1TYDE 4TT3A 1YS7A 4AZSA 3L7NA 2IF0A 2XY4A 1IXSB 4I8DA 4L6AA 4PLCA 5AOAA 4M0CA 4LRXA 1NUSA 5KCMA 4DSUA 2BKAA 4D9IA 3IOYA 4BVJA 1G8FA 4N5DA 2XXAB 1X1DA 3O9MA 3H3FA 4ZVMA 2X8WA 5CD1A 4QJ4A 4ZYYA 4RPIA 1NVKA 2NZYA 1A5SB 2DTXA 1AZWA 3A1WA 1VMAA 4C1BA 3FUVA 1URPA 3TNFA 5IJXA 5A1JA 1M33A 3FHJA 4QE3A 4WVLA 2A33A 2DQ4A 2IYLD 3TIGA 5JZ9A 1SUPA 4B4VA 2N9UA 3FUUA 2RK6A 4M1WA 4FWIB 2JIZA 4WAUA 1UPXA 2ORVA 1HYQA 2NO6A 2R85A 2VH1A 1N2EA 4S3MA 4I3HA 4F2GA 3BE5A 2NV0A 3P7MA 4PX2A 4JOCA 4RC9A 4BUZA 1A1SA 1UAAA 1SHTX 1K6MA 3LY7A 4W9NA 5ITVA 3B6IA 1JMVA 2ZUBA 5GOZA 2V4MA 5JNLA 5JJLA 3UC5A 3M6IA 1TLLA 1CZKA 2C7GA 3F71A 4WASA 4HNAB 4BCCA 2VHXA 3BWBA 1OZAA 2V5AA 2ZE5A 3RU9A 2QRUA 3WHLA 3HDHA 3TJRA 3JVIA 2VXYA 1XD2A 5I9SA 1ZUIA 3QFRA 1JZTA 1U7ZA 1IHYA 2XYHA 4FSDA 2ZWAA 5KJCA 2DR2A 3FAZA 1PP4A 1VI6A 1ECCA 3NANA 4G5FA 3D7NA 1BGWA 5KOIA 2R62A 3K9FC 3WGLA 1KWGA 2CUNA 1DQNA 4CUKA 1HDIA 3D3QA 3NALA 4NJMA 4OM8A 5JYCA 1MH1A 4EEXA 1QPBA 1ORDA 4E1AA 5LP6C 4OCZA 2C95A 5DNUA 1XPOA 1N1EA 4O4IA 1II8B 4BQOA 4JB8A 1LI7A 3DW1X 3VR4H 1VL6A 3TQTA 1CYEA 3BXGA 3TPCA 1CS0A 3QXGA 2V7VA 3GFPA 3AFIA 3EXAA 1E3TA 3LY8A 2YJ3A 4LF9B 1W25A 4QNMA 4YGYA 1DXYA 1NBEA 3CLSD 4NLLA 2CNBA 3CJRA 4FEGA 4D9BA 3MXTA 4B5LA 1SC4A 2IVFA 2W6ZA 2XIQA 3K94A 2NU9B 2QMQA 3QLUC 5HIAA 5F12A 1ZNQO 3N6VA 1ILEA 1U31A 3LUJA 1Q0ZA 4G9GA 3STXA 4MI3A 2P11A 1GU0A 1FC0A 2B25A 1CRZA 3G1WA 4PEVA 2C57A 4GM1A 3PD1A 4NYJR 3WA6A 2A3RA 3WHKA 3MHTA 3LI2A 1CQJA 3WQQA 4BNIA 4JJEA 1MAVA 1PR4A 1XTQA 2EZUA 1RRFA 2JKYA 2IUSA 1M7BA 1GL6A 4YJ2B 3KQQA 4Z53A 1IYZA 3KQTA 3JQAD 4UMDA 4FLEA 3Q10A 3TLGB 1ZOIA 3DL4A 1QAOA 3C8UA 2JAOA 2VBIA 4DBVO 1DB3A 3PFNA 3A9WA 1DU4A 1PV1A 1EFPA 3EEBA 4YASA 5JJBA 5KC8A 5AW7A 3D5TA 1E3LA 2DTDA 2NAFA 1ABBA 1M7GA 4QQKA 1QGAA 2AOVA 1OGYA 4LXUA 1VCHA 1DT3A 3BGIA 3NGMA 5DTIA 4AF8A 2WWYA 1V1MB 2V7UA 1G3IA 3DYIA 1RJ9B 1E6WA 3ADDA 2OE2A 1N0UA 2X2OA 3KDPA 4PAOA 1O4VA 4A27A 1W35A 5JNVA 1S5PA 4FYYA 4UNQA 3R9KA 1AZTA 3A6EA 3ZDAA 2J31A 3T7DA 3LX5A 3W06A 2PBFA 2IX9A 4LJAA 3CSDA 1JIVA 1HDXA 1DARA 2W6IA 3FZYA 3WL3A 5JRDS 1A2OA 4UULA 4C5CA 3HCFA 3HP7A 4QOSA 5FOQA 1PEYA 2R48A 2O0HA 1QHHA 4N5NA 3OQBA 2WYUA 3QPAA 4ABYA 3ET5A 1NE7A 2OCLA 4FW9A 1XTTA 5IXSA 1I7SB 3BK2A 3KAJA 4KI7A 1GEGA 4WK2B 1UC5B 2G67A 4OA8A 4YJ3B 1IOVA 1K3TA 1PQWA 4D02A 4BRWA 2NO1A 1GGHA 4R1UA 2W0MA 1U2DC 4NJEA 4IHAA 3A9CA 3QVXA 3AJ9A 4YJFB 3CZQA 1X0XA 4RV9A 1AGXA 3B3JA 3KT8A 2BKXA 4FIZA 3DTNA 4RLFA 4XDHA 4AY6A 3TX2A 4QT0A 1XXHE 1GO2A 4MPJA 2C3YA 3UTCA 5KYGA 3MWEB 1M1ZA 2XAUA 1RI3A 5IJAA 4OUDB 4G5GA 4R0NA 1CIPA 4HQLA 4X7RA 1L1FA 5FFMA 4KUHA 1KRXA 1YQGA 1KJJA 3HKEA 4IIDA 1AY0A 4D4GA 2C3MA 3QXXA 4BO2A 1Y42X 2QORA 5AVUA 4U9IS 2VPQA 5LLTA 2I3BA 1SBZA 3CMMA 3D7KA 2RK4A 1IMOA 1EVKA 2QM7A 4LMBA 1K9VF 3NBUA 2I4LA 1SXPA 4NZOA 3SYTA 4HMPA 1NT4A 3GNSA 3X0DA 5AVYA 2V0GA 3PQ4A 4LZOA 4PO1A 5F9MA 4BO0A 4C30A 4EB3A 5IUNC 1PT7A 5ADVA 4CGZA 3NHAA 5HBGA 5F52A 4UUOA 4ZVVA 2QRKA 5B55A 1NQ5A 3WZMA 3ROKA 1RXVA 4G5RA 1NXOA 1A5ZA 4LHSA 2UYGA 3WB2A 5DGTA 3ECCA 1RKXA 3G79A 3B1JA 3VR5A 5A02A 4NONA 4HDNA 1YB6A 3DFUA 4R3NA 5JI2E 2FWBA 1F12A 2YWHA 2VT6A 4I2NA 2I9PA 2UZ4A 4D0LB 3GN1A 3ZZMA 1TO6A 4AMBA 4EJFA 1O4WA 1ZD9A 1U6JA 2HAEA 1VCIA 1AXGA 3WK8A 1AKTA 4AICA 3OZDA 1HRKA 1JKFA 3N0TA 1JHYA 1UKAA 3DCNA 1ND5A 1OX5A 5DCWA 1BA2A 2VPYA 4J1NA 4KE6A 2GJAA 3DMYA 4B75A 621PA 1FYFA 2J4FA 4G8CA 3H11A 1RXUA 3USZA 3C3WA 1TW3A 2O05A 4O25A 1UPBA 4C29A 1RJFA 4BNKA 1OC2A 3HBJA 3MIIA 3GLIB 4XJVA 2YZ2A 4OQEA 5HDQA 3K2EA 4MWTA 3TW6A 3NIGB 1P1CA 1RBMA 5SY9A 2GKGA 3T9BA 3TIXB 2B3DA 3I2YX 1KIAA 4FBLA 1JFRA 2WQ7A 4IJQA 4PO9A 5BMVA 2PKRA 1BMFA 4TRMA 1XP5A 5HKBA 1S9HA 2DPGA 5D2CA 1VI2A 3P9KA 2NU8B 5KNCD 4W7SA 4A23A 1AVTA 2D3WA 2QNRA 1WMEA 3IALA 3IAAA 3H6KA 4ZP1A 5JZMA 1AN0A 2CLLB 3T1TA 5L6LB 4B7UA 2OMKA 2R5NA 4RIGA 4PHGA 2C7VA 4RYDA 4Q48A 3V7UA 3FA2A 3CTMA 4P92A 1TGYA 2XZTA 2FEWB 2ON6A 1RACA 3RAJA 1E7SA 3WAJA 1XZBA 2GBLC 3NBQA 1MX9A 2EGUA 4GMGA 4F93B 4ZCLA 1U94A 3A04A 3OM9A 3SKVA 2YQ5A 4LYGA 4C0AC 1YF3A 2JFPA 5KYWA 7ADHA 2H2WA 1T5IA 1NTRA 4H16A 1GCIA 3HCWA 2EX1A 4YR9A 3QWHA 3ZBQA 4F60A 5C4IA 3GLFE 4YTEA 3BAFA 4MVJI 1WNTA 3WK9A 3GQVA 4BP8A 4NCJA 5KO2A 1QU3A 1QZUA 3AW9A 3VV2A 2V7GA 4B33A 5CFNA 3M6WA 4NATA 4LY9A 4DQLA 2XT6A 1EUDB 4PFQA 2DPYA 2NUAA 2ZTVA 3OURA 5U4QA 3U16A 1D4OA 2IYXA 3BWVA 3N3AC 2I5PO 4JJ8A 4N5HX 1SKYE 1XQ9A 3AI2A 3OIDA 3Q11A 4U7FA 3RNLA 2B69A 4DREA 1JDJA 3FWYA 4RVDA 5KYNA 5JALA 4IIEA 4C5BA 2OGWA 3VR4D 1U9YA 3HYRA 3L7IA 4EGFA 4K6FA 4Q3LA 3EPKA 3ZD6A 2AKYA 1VGVA 2EQ5A 4B8WA 5FNVB 5LXTB 2PFGA 3F5FA 1T8SA 3RBVA 1O97D 1I4LD 1IBCA 2P9HA 2Q4RA 2ETVA 3OE7A 4FZRA 2JC3A 1DJMA 1JEEA 4WGFA 1AM4D 2C2MA 4G0PA 2YNMC 1VM6A 1N3LA 2FN9A 3PPYA 1JNYA 4RULA 1NXXA 3AJ8A 3HZZA 1IM2A 5EHNA 1F3LA 1LTKA 4ND8B 4BNXA 1P9OA 2QY9A 1CVIA 4PX3A 2EL9A 2VDKB 1QH1A 1GU7A 2WFAA 2YCBA 2VF5X 2G83A 4XX0B 2PR7A 1GM5A 3N70A 3PFGA 3GRRA 2G1KA 2JKZA 3WJ7A 4MQ5A 1R9JA 2XVYA 1CR4A 4KDFA 4AYWA 5J4KA 3GF4A 1XJ0A 4BNVA 2PRIA 2Q5OA 1KI6B 3D3JA 3OHPA 4BKOA 1NVWQ 4EHHA 4PU0A 2CXTA 3PGVA 4Q05A 2YRXA 1OREA 5L6MB 4Z4QA 3BCRA 3OQOA 2GQ0A 3KIPA 3PWKA 1KK2A 3LPCA 1WMSA 2ZT6A 1YDWA 1W44A 1RKVA 1KC3A 1YACA 1V11A 2VP6A 4IZ6A 3DR3A 1TCCA 4YAFA 5DCUA 1AGNA 3NRCA 1RP7A 5FKJA 1HDRA 2YYAA 2WNSA 4I4TA 4X95A 1ZGGA 2FW1A 1NN0A 4I4LA 5H81A 1ESNA 4RYLA 4F06A 2WZQA 4RJKA 4B2LA 1KK1A 2PUVA 1ZHFA 3C5VA 1B3RA 4MPPA 4ZAVA 4AN4A 2E4UA 2CLDX 2HO5A 5SZKB 4D9MA 3BFKA 4J7UA 4OSEA 3ITEA 3ZJVA 3SFTA 1F2DA 1JP7A 1NUTA 2AA3A 3B6KA 2ZKLA 1HLGA 4TMVA 5CAEA 2OL4A 4B83A 4FN5A 2AJBA 3K1JA 1G20A 4RHTA 4AM8A 1FX1A 3G6KA 1S2LA 4GR9A 4O4JA 2XT0A 4H17A 2D5LA 4LAFA 5J59A 4PVCA 5EN4A 3TH5A 3U7QA 2XDQA 3GUCA 1GDDA 3GDHA 4D6XA 3NDIA 4Q6BA 1LLUA 3U39A 4LJ9A 4BFVA 5LR6A 4R3UC 2RCNA 5JNWA 2ECKA 1UJ4A 4BECA 5GJVC 3N6XA 2O2XA 4LCJA 5FBRB 4AP6A 2JGRA 1IIBA 4IUYA 1YQTA 4QRIA 3PWZA 1XQ1A 5FHRA 3COWA 3WOVA 3CVXA 2DETA 2YMPA 3LC1O 4NV1A 2I7DA 1H4TA 1FFYA 3S68A 4R1SA 3EA5A 2I6UA 1YRWA 3A9VA 1RC1A 4X3OA 4EL0A 1JAYA 1UDBA 3JXEA 4R1QA 5C8DA 1KJWA 3SN6A 2PZJA 1SBHA 2IXGA 2OTCA 2HTEA 3D6JA 2B37A 3R40A 2WV9A 4JI4B 1TMYA 1Z56C 1KZYC 3C7AA 5F2NA 3BL8A 2B5VA 5AI8A 2IU4A 2DZDA 3AEYA 3T3GA 4BGVA 2ZBDA 4IDCA 5BQFA 1P2VA 3PSAA 4JC4A 4RCZA 3FJYA 5KNLA 2JLVA 1GNRA 1YR2A 3WYBA 1NLYA 5JSYA 2YIJA 5F9HA 4R40A 4EZEA 5EE0A 5D5QA 4Y67A 1K3UB 2O1EA 3OJWA 4TS4A 2VYVA 3VAAA 3THWA 3N07A 3P97A 1IY1A 2E4AA 2VWGA 3Q9SA 1XZPA 2QTVA 1MZVA 3UB2A 3A28A 1LF0A 5B12A 2WAOA 4YYZA 4C88A 1Z5GA 3TCXB 3A3KA 1WE2A 5IP5A 1G5IA 2DHCA 2J7KA 2XKAA 2Z2IA 2AF4C 3ZCPA 2GN1A 2AB0A 3GCGA 3NOXA 2IHKA 3VTZA 4B6QA 4MIKA 2B8NA 4RF2A 3L2OB 1J4AA 1GFWA 3A7EA 3JAKA 5KS2A 1U7WA 4OJKA 2WMYA 1BCRB 4FD2A 5K4AA 5AR1A 3ZGXA 4WCFB 1MCZA 1T13A 2R8BA 3QX3A 2XUQA 4UXIA 4U7GA 4MDHA 4A2PA 1L6IA 3CM0A 1REQA 1QV6A 3PB3A 3IR5A 1DIGA 2BONA 2HA7A 1CY4A 2JHPA 2GPTA 3M49A 4QGGA 1SVNA 1T8YA 1C3VA 4XSHA 4DIFA 3J81k 1U65A 4BLQA 1L4LA 3EC2A 1YI8A 3T7TA 3HVUA 3A1DA 1A3CA 4RPHA 1W52X 5JWHA 1NQVA 2GPSA 3DS8A 4DF3A 3OT1B 3HU3A 3UQYS 3TW0A 4IQGA 3P32A 2XQKA 4ZI2A 2JAUA 1SUWA 2E7ZA 2PSJA 2RGBA 1B8VA 3L6DA 5GONF 1Z74A 1K2WA 4Q3CA 1GJRA 2Q9AA 2F6RA 3B1VA 4RMIA 5G1OA 4CLEA 1L7AA 1N75A 4DYVA 5DOZA 4BB9A 1X14A 2PEZA 1NDHA 3MMNA 1XK6A 1VRCA 4XYBA 3LUAA 4KQCA 1XTUA 3DDOA 3TRKA 4DW8A 2QLFA 4EKNB 1MX1A 1WWKA 3D8SA 4LGCA 5PNTA 3WAGA 5B30A 1NBIA 2EKLA 3BMQB 1OH5A 3FGPA 4OM7A 3ZDFA 1JDUA 4ZV9A 1SZCA 5LBUA 4I46A 1KVUA 4QO7A 4CQLA 2ZSHA 3QM1A 2H1LA 3I9OA 2AFIA 3AI3A 1GV0A 1QE0A 1S01A 5DNEA 1CQIA 2P79A 4EGSA 3U5TA 3HA7A 4BFTA 1I2AA 1XI2A 3B3AA 2VYCA 1J8DA 4Z4HA 3ENZA 4LRTB 5EXDA 2IIPA 1DAOA 1J6UA 4H1UA 4PLPA 3L8GA 4RXUA 1OXSC 1SCKA 5CYFA 4AFNA 1MO2A 2OR3A 2PGJA 4DMMA 2IXFA 3RT9A 1DGQA 2AT1A 2J9FB 1PD1A 3LYUA 1Z68A 4NWIA 5ILGA 2N75A 4X62B 2X6QA 2C3UA 3HJAA 4IJKA 5HJ7A 4LFAB 1HLPA 1TPZA 2WFLA 2QF7A 2JIPA 4F2HA 3BJRA 3LIIA 3MW8A 4D57A 4A6EA 2I6XA 1FJGB 1D6NA 2B82A 3UK1A 4M6WA 3Q3VA 4RKQA 3EGXA 4UVGA 3D54D 1J2TA 2BTEA 1KNQA 5ENDA 3NHSA 2AZMA 4YV7A 2QLLA 4YP7A 4XTCS 1NW9B 1NJ5A 2GEVA 4ZMRA 4QBHA 3BN3A 1JAXA 1HTWA 4HGYA 1X15A 3KYBA 4Q21A 2HZBA 4HBZA 2X1MA 4TGLA 5T5QA 4PC3A 3NT5A 1RXEA 2O8DA 1JHQA 3ANTA 3K96A 3QV1A 5KDOA 5F3WB 3TLKA 1NF2A 4IIJA 4EA9A 5AVRA 1B23P 4QUJA 3OZVA 4XDZA 3W5SA 1RAGA 1DTEA 3A11A 3FDJA 4YXFA 2D74A 2B1RA 1NM5A 1GLVA 4BLUA 4MH0R 2OGSA 1P9RA 3KFXA 5B4UA 2YMQA 4II7A 1U0OC 1QCYA 1QZTA 3D2AA 1W2WB 3QFSA 3OF5A 2B30A 1SU8A 2G71A 4UEWA 4MCAA 2F1HA 1N5JA 2BAGA 1CZUA 3WRXA 1DJQA 1WPGA 2WABA 4C6SA 3IKJA 1KY3A 3DFMA 2AXEA 4G63A 4QQRA 9LDBA 1F3OA 1W76A 1FSZA 1CNFA 3M5CA 4C7VA 4HC4A 3S4YA 2KX7A 3S6JA 1QP7A 1GKYA 1O9HA 1ZCZA 2ZVJA 3OCYA 1VPEA 3RAPR 2VP3A 4QTTB 1YS9A 3PZRA 5IYZA 721PA 3R9XA 1U98A 3A4NA 4NMMA 2DQSA 3WBKA 1SPBS 2DY0A 3U4QB 4XOUA 1FZQA 2W6PA 5DU2A 3JWIA 4RA6A 1U8XX 3P8ZA 4AQDA 4N6NA 4NBWA 3I2GA 3CH4B 2X8JB 4QATA 2FDRA 1OY1A 2FE1A 4HNTA 3UPTA 2CLIB 4CHTA 1JPVA 1PWHA 2B4AA 2FZEA 1EQAA 1VPDA 1P1KA 2HGSA 4IVNA 4J94A 1V45E 5B3AA 1KJYA 1EVJA 2IEAA 1FE8A 2POCA 2WT4A 4BP1A 3IE1A 4D80A 3NVKI 4B3SB 1GQ2A 4R2HA 1A69A 4ZOBA 5TQ2A 5B1YA 4XA8A 1JDBB 4ZI5A 1ZM4A 2AV6A 2P90A 4AUEA 1CFZA 1VL5A 1DKPA 3PQCA 4CKCB 4INZA 3DOEA 1LNZA 1ATZA 4J6EA 4HV4A 2G5GX 1RBQA 5BXQC 4ZAWA 2Y4NA 3E58A 1AMUA 4MV4A 1E3IA 4QLOA 4B85A 1UXHA 1HYHA 4KYTA 4ZO4A 3RUAA 1YZ3A 1ZZEA 5E6SB 5C5EA 1E20A 4Q3EA 2O19A 4DKXA 1T91A 4KVZA 3RSCA 2V45A 1AIPA 4P58A 3W7VA 1ORRA 4YLGA 2ID4A 1C3LA 1N77A 4J7AA 3U4CA 3F6PA 3D7RA 2R44A 5AHOA 1OH6A 2DERA 2VCHA 4JU9A 5KTNA 1RPTA 4EJ2A 4V0ME 2IH4A 3PTZA 2D4AA 4RENA 1WMAA 2W2VA 1PR6A 1KO1A 4AJLA 4DLBA 2HXYA 2PYIA 3EZFA 3NTUA 5SYNA 3W5CA 1A4XA 1EFVA 1TCUA 1WXGA 2GKOA 3AR5A 1YZLA 1FMTA 2QUAA 3G89A 4QAQA 4TV9B 5TRTA 3FIJA 4UZEA 4ZEVA 3LNCA 3B38A 1SR8A 5EMMA 1V4VA 3E18A 4CMGA 1ZC3A 2VNKA 4EA6A 1KHTA 5NULA 2BFBA 1JHXA 2GD2A 3CPEA 2REQB 3LZCA 2HK6A 4G84A 5ALIA 5EC8A 3D0KA 4P53A 1UEJA 2XB4A 1QS0B 1GDHA 1DRJA 1YE8A 2PWYA 4Z9FA 4ZALA 3V6LA 4UOZA 3ENVA 2I91A 3ZWXA 4ZI3A 3UT5A 1IXKA 3IDZA 5BUSA 2ZRDA 4OXRA 4YCAA 3ABOB 1OAAA 4JGBA 3FWHA 2P2CA 2XVZA 5I7UA 3TIVA 3C3JA 2H07A 3A4TA 3EZGA 3FTDA 3NBYC 4JA2A 2GF2A 2H1FA 2RHDA 4RSMA 3HHPA 4YPOA 5IVIA 3BDIA 3I5UA 4DR5B 2VJMA 1NI5A 3VAYA 3T4XA 1A9OA 2PGXA 2VA8A 4HPWA 1Z22A 2P6MA 4Q47A 1P0IA