4TWRA

Structure of udp-glucose 4-epimerase from brucella abortus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD binding site:NAD-dependent epimerase/dehydratase:UDP-glu
publication title Structure of UDP-glucose 4-epimerase from Brucella melitensis
rcsb
source organism Brucella abortus
molecule tags Isomerase
total genus 112
structure length 325
sequence length 325
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4twrA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4twrA02
1BDBA 1E3IA 4CMEC 2WDZA 4Y98A 3V1UA 3GDFA 4HXYA 4FFNA 2BMAA 4EEXA 4JNKA 2ZB7A 1T2EA 5T57A 5T8KC 3OICA 3W4KA 3HSKA 1N9GB 4XIYA 3RFTA 2O3UA 1EVIA 1ZIDA 4A0SA 1VE9A 3T4XA 3TL2A 4UUOA 5MGBA 4XIJA 3P2OA 3PEFA 5A02A 2PV7A 2QG4A 2X86A 1FDUA 1IL0A 5EPOA 3RROA 2Y1GA 3GVIA 5C5IA 4IGEA 3FPCA 2CZCA 1X7HA 4PLFA 1NTOA 2X5JO 1MP0A 3EGOA 2B69A 1VRWA 4DRYA 1WW8A 3DBVO 4ZGWA 2HAEA 3MJ4A 1Q7CA 2JFHA 5KJ1A 1C0IA 1BXGB 1E6UA 1I3LA 4R68A 2HUNA 1MC5A 3WQSB 4J49A 2X58A 2O3SA 2GO1A 4URFA 4BNZA 1LX6A 3UF0A 7ADHA 4DL9A 4YTEA 4FC7A 4ALIA 2GERA 1YQXA 2YY7A 2CDBA 3RUHA 1RYEA 2PD4A 2FN7A 4DQXA 1MA0A 1U4SA 4YVFA 2WWRA 2UV8A 4YDRA 1D3AA 4QUKA 1EBFA 2PA3A 3K9QO 1B8VA 1CERA 3WGOA 2LDXA 1HDZA 4BOYA 4OOEA 3OIDA 2DLDA 4E2WA 1PQWA 4NK5A 3A14A 3ZWCA 4E5YA 2NLOA 2YUTA 4XR9A 4PCVA 5F1PA 4MO2A 2P5UA 1XU7A 2WD7B 2PY6A 2PZLA 2OP1A 4ND5A 4JXKA 5K6AC 5KCZA 3PHGA 1O6ZA 1DC3A 5JY6A 1GR0A 4HBGA 3GMDA 3ZW9A 1OI7A 5JS6A 4H7PA 1X15A 2CF5A 3ITKA 4CQLB 2YFQA 3FD8A 3KO8A 2C07A 4P8RA 4PLHA 1HDCA 5F1KA 3UKOA 4Q3CA 1U7TA 4JBGA 4R1NA 1ZUD1 4TSKA 4A26A 4BO7A 1HE4A 2PD3A 2ZCVA 4KQXA 4CV0A 5TIIA 4L9RA 5BSHA 5BNTA 3DO5A 3UCEA 2Q2WA 2VT2A 4YJGA 4NU5A 2J6IA 4Z6KA 1AE1A 3JYQA 1P3DA 3EMKA 5JDCA 3DL2A 1EZ4A 1IULA 4FW8A 4U0JA 3B70A 3DBHA 4YPOA 4NNJA 4ZVVA 4KMSA 3RUCA 4CR8A 2JHFA 4EDFA 2ZJ0A 3MWEB 5KJEA 5JYEA 1KEUA 3H3JA 3VTZA 1RM3A 2EF1A 2IYOA 5JCXA 1NQ5A 4U5QA 4N7RA 4B79A 3G79A 4XGNA 1Y81A 3F5SA 4R01A 1FDTA 1VSUA 3H8VA 5EQFA 3UCFA 1GY8A 3W4JA 1KYQA 4RPKA 4WCFA 2BI7A 1MV8A 4G2NA 4W9NA 3LT0A 2G76A 1T2DA 4FFOA 4IXWA 3WGYA 3GN2A 1PWXA 3D4PA 2SCUA 4FFPA 4IIVA 5CFZA 1NX6A 4RPJA 3IC5A 2J3KA 2G0TA 4R3NA 3O8QA 5U4QA 4ZJUA 1XR3A 2F1KA 3ZWOA 5COBA 3PXXA 5KJCA 2EW8A 2AEMA 3DFUA 2EIHA 3RKUA 9LDBA 1JAXA 1ML3A 3P2YA 5HBRA 3IL2A 3RFVA 4ITUA 3GVHA 3FCOA 2C7GA 4TRRA 1QYWA 1UUFA 1J0XO 5A06A 2PK3A 3GHHA 3S2IA 1IHXA 2PKRA 3F1KA 2AXQA 4AFNA 4DMLA 2PWZA 1JKFA 2VN8A 5DZSA 3I9KA 4DQUA 2XF8A 2V6MA 2YJZA 4J4BA 3L6EA 4BMVA 3MZ0A 2W4QA 3W8EA 4GVXA 1R66A 2OBNA 4J3FA 4NJMB 1PS0A 3TSCA 2VOEA 3HADA 5T64A 4PLCA 1KY4A 2D5CA 4E0BA 5CDSA 3DBRB 1KIFA 3VPXA 2IXBA 4EUFA 1U3TA 4P4NA 4J0FA 4IDAA 4MP8A 4KDEA 1XYGA 5JAMA 1GCOA 1NNUA 4QFCA 1VC2A 2HSDA 4XRRA 1CIVA 5DBFA 1YL5A 4CMJA 1GYPA 3IOYA 4MP6A 1HT0A 2UYYA 4CM3A 4HWKA 5FI5A 3SXPA 1ULUA 3PYMA 3OJLA 3PRJA 1SMKA 3GMSA 3DBLB 4IS2A 4OSOA 1PEDA 1KETA 2B83A 5T8KA 3I3OA 3E82A 3QVXA 3K2EA 4RPGA 3BTUA 2EKPA 4CJXA 3CIFA 4B4OA 4UUNA 1V3TA 3BMQB 3GDGA 1D8AA 4XDZA 4C4OA 3AFNA 4IS3A 5DOVA 1TI7A 1E6EA 2P2SA 2ZTLA 3I52A 3OA0A 1LDBA 3KSDO 4DIFA 2HK8A 4GKVA 3GGOA 2NNLD 5KNLA 3VPSA 2ZTUA 3W4IA 2OBYA 3B1FA 3ANMA 1E1KA 3K30A 1WMBA 4IY1A 1B14A 1Q0HA 3SLKA 2GNAA 3BHJA 4O1MA 4BNGA 1RKXA 2DBRA 3ZWVA 4W99A 3CKYA 2WSBA 3BMNA 2GASA 1I01A 3C3XA 2YV1A 5EN4A 3ENNA 3Q1LA 4XR4A 3ZU3A 4NBTA 3T7EA 3BHIA 2DUUA 4K28A 1RM0A 2IDZA 1PTJA 4J2OA 1BXZA 2WYVA 3KTDA 3RUIA 2AE2A 2IZZA 3RC7A 4J16A 3S2GA 4CV1A 3LK7A 4XCVA 3VZRA 1LSSA 2I99A 1PGOA 1B8PA 4FJ2A 3V5NA 3G1UA 1E3SA 3WQQA 4M55A 3E5RA 3ZHXA 4AICA 3TDKA 1DC6A 1LLQA 4YXFA 3UOGA 2W2LD 1UZMA 2EGHA 3EZYA 3H9QA 2O3QA 5K6AA 3MJEA 3RBVA 3GG9A 1H9AA 2D0IA 2E48A 4YJFA 5FEUA 3JQAB 1HZZA 4J1QA 2UAGA 3PQEA 4XYBA 4QXMA 4YT4A 3PK0A 3HDQA 3NX4A 4L8VA 2Q49A 5KJ6A 5ADHA 4QO8A 4EITA 4BQPA 2IODA 3ADPA 2DTEA 3D1LA 3IQDB 3RCBA 4CMGA 1ZO8A 2O3RA 4WASA 4Z0TA 2E49A 4RORA 4AJEA 3GAZA 1ISFA 1JWAB 4ALKA 3F4LA 3SX2A 3GNQA 1S7CA 3H2ZA 1UAGA 4RLSA 1U5AA 3NYWA 4CODB 3OA2A 2GN6A 4YEDA 4TQGA 1LA2A 1DFHA 2YW9A 4FGSA 3WFIA 5B1YA 3ZHZA 2I67A 2O7SA 4NH4A 4K6CA 4NBWA 4MVJD 4A73A 4YJDA 3FBGA 1QP8A 1Y8QA 3JQGB 1DB3A 3GEMA 1X7DA 1I10A 3PZRA 1FDVA 5G4LA 2PH3A 5KOIA 3SJUA 1HDXA 2D8AA 2UUPA 4TVOA 2B0JA 1R4MA 3EC7A 2JAHA 3PYLA 4OXNA 4QO7A 2XAAA 1EFKA 4CUJA 2XXBA 3NJ4A 5JE8A 5IF3A 1J4AA 4OOFA 4GSKA 2GSDA 5HS6A 4AJPA 4CM8A 1KVSA 2V6FA 1ZSNA 3OJEA 4RQUA 4YQZA 1UZNA 3GY0A 3VKUA 3TQHA 3WMWA 2D3TA 4ZQEA 1F17A 1CQJA 2Y0EA 4A7PA 2Z1NA 5C37A 2D5AA 1E3WB 5FWNA 2IXAA 4XQ9A 3JD1A 3ZWPA 1PGPA 1JU9A 4Y6SA 3RVDA 3G17A 3EK2A 3JYLA 3U09A 2Q46A 1KVTA 4CM4B 2AA3A 4L74A 4PRLA 3BIOA 3KYDA 1T2AA 3CH6A 3JQAD 3KV3O 4PLWA 1YB4A 1G6KA 4E32A 3QA9A 4PRKA 1DDOA 1OZAA 2FP4A 1VJ0A 2ZCUA 5KKAA 3WOHA 3GPDG 1CYDA 1RYDA 4UVEA 5A05A 3GZNB 3EW7A 4TRJA 5TQVA 4N18A 4BKRA 3AY7A 4D0RA 4BO3A 1W6UA 4X54A 3JQEA 2X9NA 4FOOA 2VHVA 3KYCA 4O63O 2OL4A 1QV7A 3QVWA 3G1TA 4FD3A 4B7UA 4B3IA 1O9BA 3W6ZA 3NRCA 4D7AA 1D7OA 4RO0A 3AOEA 1ID1A 2Z5LA 3I9JA 3PTZA 2FR1A 2Q50A 2CDAA 4XWYA 3KLPX 3RJ9A 4Q39A 1W0CA 4RV9A 5KTKA 3RUFA 2YHIB 3ZV5A 4J90A 1PJLA 3F3SA 3K8ZA 2PD6A 2V65A 3ANNA 4ND4A 1E1MA 1P1JA 2QZ9A 1E1LA 1BGVA 3KZVA 1E3LA 1EDOA 2VT3A 4CV3A 5MDHA 2ZYDA 4L4RA 4MVJM 1YOVB 3TFOA 1ISHA 1R0KA 5A3JA 2D1YA 4O6VA 5BSEA 3C7CB 1EQUA 3WDSA 1MUUA 2DM6A 3E18A 4KTTE 1HETA 4ONEA 2Q1UA 1TXGA 2OORA 3L4SO 4AJIA 4CMHA 2P5YA 4F3YA 4Q3NA 5KVSA 1M75A 3F47A 3HE3A 4IIUA 1ZVMA 3IIEA 2NTNA 3I23A 2TMGA 1P44A 3IUSA 2G1UA 1DHTA 1PGNA 3NDRA 2ZIZA 1Y1PA 1TT7A 3EUWA 4DLAA 4OQZA 5JPIA 3MCVA 4PVCA 3GEGA 4DMMA 4AJHA 5DN9A 1BTOA 1I36A 3LZ6A 3UUWA 2EXXA 4RF5A 4U6QA 1PJSA 2NU9A 4IDBA 4WLOA 5B37A 2E82A 4BGVA 4FS3A 4GMFA 3IUPA 5DBIA 3RQSA 2PGLA 1HLDA 3JV7A 4CM5A 4FCCA 1HDYA 2JD1A 4JGBA 2VZ0A 4UEJA 3PQDA 2QHXA 4B7XA 4HX5A 3EVNA 4E21A 4QTZA 3GVPA 1LU9A 1X0VA 3WGQA 1XLTA 1EE9A 5L53A 1PZGA 5ER6A 4LSWA 5IDXA 1XIVA 3VH4A 1P1HA 1LLUA 5ENVA 4JLWA 3PWSA 3FF4A 4XB1A 1QG6A 1UAYA 2JD0A 2EJVA 1WZIA 2HJRA 5A9TA 3DR3A 4W6ZA 1GUZA 1YB1A 4N54A 3V1YA 1PSDA 4GL4A 3P19A 1C1XA 1Y9AA 2AEJA 2WM3A 3A9WA 3RU7A 4BKUA 4E5KA 3INGA 2I6TA 4D79A 3H3FA 4KUEA 1Z75A 2OO5A 2Q3EA 4DYDA 3INRA 3WXBA 5HM8A 2I3AA 4XQGA 4FBGA 3FNFA 5T67A 5BT9A 1Q7BA 2PTGA 4YT2A 5IJZA 4BNYA 1E0DA 1EBUA 3ITDA 3D4OA 4HP8A 4AJ4A 4F6CA 3JQ9C 5GZ3A 3FI9A 3DHYA 4J2HA 4BO4A 1A4IA 1H6AA 1YONA 4FOSA 1Y7TA 1B3RA 4WLEA 4BNMA 4KWHA 4Z9YA 1E7RA 2FR0A 3W6UA 3AK4A 4XRGA 1RM4A 3ORFA 2EW2A 3NT5A 5EINA 5CEJA 1UR5A 4IJWA 4JN6B 3WYBA 3U5TA 3DC2A 3HDHA 3DQPA 1O5IA 4PLPA 4KDFA 1YB5A 4IZIA 1NWCA 2QZZA 1XQ1A 4WLUA 4WCFC 3VOSA 1HZJA 3CEAA 1NPTO 1EUZA 2DBVO 1KVQA 3SC4A 4BNUA 4AJ1A 4DC0A 1GL3A 4RF4A 3QY9A 3OSUA 3ZW8A 1ZKMA 4D42A 3NT2A 4K26A 1B15A 4GX2A 3ZWYA 4E2YA 3AUUA 3QSGA 3QJ5A 3K6JA 3TOXA 1E7WA 5I7EA 3JD0A 1M66A 1VKOA 2ZYGA 4OH1A 3WSWA 4HKTA 5BSFA 2W2KB 5CDGA 5LDHA 5ER9A 1LSUA 3JQ8A 5TNXA 1VKNA 3E9QA 3EHEA 1K2WA 1V35A 2H63A 3AU9A 3LU1A 2A9FA 4R9SA 3ROPA 3WS7A 2RH8A 4PZEA 3E1KA 3JQFA 2WMDA 3RWBA 1IZ0A 1J49A 1ZK3A 4YBZA 3MOGA 3R3JA 4D44A 1T1SA 1QXSA 3ICCA 2DBZA 3DHNA 2VRBA 4YWJA 1LC0A 5ILOA 4IDCA 1Y8QB 2O7QA 5H81A 4KP7A 2OOSA 1CETA 2NTVA 1F12A 1FJHA 2HRBA 1LJ8A 4MOWA 1A7KA 5L45A 2IRWA 3Q2KA 2EERA 5G2OA 1GFSA 4I08A 4KUHA 1MB4A 1SB8A 2HMTA 4H16A 2CD9A 5C7OO 4PLVA 1ZJYA 1R4NB 1DXYA 2R2GA 4BV8A 4JP3A 4YAIA 1BWSA 4MP3A 4GLOA 1X0XA 1HXHA 1MFZA 1HRDA 3KOUA 2EP5A 4GWKA 2NM0A 3GUYA 3HNPA 4OM8A 4EEZA 1BSVA 1QYVA 4YT8A 1NAIA 5JW6A 5L7WA 1VJTA 4CUZA 1QYDA 2ZB8A 1PJCA 1VJ1A 3Q9NA 5G4KA 3E9MA 1NVGA 1KEWA 3AW9A 1NQAO 4Z0PA 1U7HA 1UXJA 2Y1OA 2QRJA 1GZ6A 3ONFA 1JKIA 2UVDA 1U9JA 5JDIA 3P5SA 5T6BA 3OQ6A 5F3RA 1ISGA 1HSZA 4HNGA 1HYGA 4N5NA 3F6YA 2WYWA 4R41A 1P45A 5KVQA 1L7DA 1Y5RA 2CFCA 3KUXA 3JTMA 3MEQA 1MLDA 3RC1A 1DFGA 2HMUA 2JJYA 5CHEA 3ADOA 1FDSA 4FPXA 4GX0A 1DRUA 1F0YA 1KEVA 4J7XA 4Y9DA 1DJQA 3FN4A 3VPHA 4CMCA 1XKQA 1ADFA 4YA6A 5B4VA 5IZCA 4J6FA 1JTVA 3S2EA 3H2SA 3ST7A 1ENZA 3VPFA 3M6IA 3PP8A 1TEHA 2GYYA 4XQCA 5CPFA 1SZJG 1A9YA 1ISMA 1IZ9A 2DVMA 2X5OA 3WTBA 3C24A 3E9NA 3F5QA 3VVCA 1Z73A 4J4HA 3KYCB 1CJCA 3WTCA 2YQ4A 4AJOA 2HLPA 2EV9A 3V8BA 1N92A 2VTDA 1PWZA 3GA0A 5A9SA 2PFGA 4L4SA 1B2LA 1X14A 3EVTA 4WE3A 4DREA 3DZFA 4NPCA 3RBXA 3GC6A 1WDLA 4Y6RA 1GEGA 3CSDA 1WWKA 1VL0A 3D5QA 1U3WA 1IY8A 4R1SA 3QWFA 4XB2A 4D41A 5HTOA 1EK6A 5B12A 1WP4A 4GSLA 3FR7A 5JCJD 3OF2A 4HNHA 5JAQA 4BO9A 3KETA 5AVOA 4MIEA 4Z9FA 3JSAA 4TMFA 2X23A 3NEPX 4PLTA 5U9CA 3UFXA 4R16A 3KSZO 4FJ0A 2W8ZA 1GDHA 3O03A 4TRMA 3W8DA 3UICA 2EWMA 3L77A 4NK4A 1LDGA 3JYOA 4K9DA 2C54A 3U4HA 2IYPA 4CLRA 1KS9A 4CR7A 1E5QA 1GU7A 2X0IA 3BMOB 3HHPA 4EUHA 1YXMA 5C7LO 5L4LA 3FNGA 2D59A 4UVDA 3KEQA 5DBGA 1U8FO 4RDHA 4BO1A 3AM4A 1K0UA 4CM6A 4OAQA 3OH8A 2DT5A 1EUCA 1YKFA 2X6TA 1K6JA 4IJVA 4P22A 4XGKA 2QRKA 1U2GA 1I2BA 2IZ0A 1QYXA 3KRTA 5JAIA 2VZ9A 2VYND 1GQYA 3BTVA 2NVBA 3JQ9A 1KVUA 4WOKA 1JDJA 1B3BA 1I8TA 1R12A 2AQ8A 3PPIA 5TRTA 5BNIA 4Q3DA 1ZK0A 1TVEA 1E7MA 4LCJA 1Z74A 1G0NA 1LXCA 1KVRA 4E33A 4U8GA 3BTSA 8LDHA 2CVZA 4DGSA 4PG4A 5JLAA 5AXCA 4GAEA 4XDYA 1Z6ZA 4FJ1A 2VUTA 3GZ4A 1ZZEA 2O4CA 3EY4A 2VOJA 2HK7A 3SVTA 1L1FA 1ZCJA 1NVMB 5A5EA 2ZTVA 1SB9A 3NTOA 2JCVA 1Y8RB 4M86A 2OXIA 4MVJF 4CMIB 2X0JA 4TRNA 5JFOA 1DLJA 3OQ1A 2WD8A 1MC4A 2BFPA 3DWFA 1P9LA 2Y1DA 4YAEA 1MGOA 4IMRA 5TGDA 4II2A 3QP9A 3COSA 2HJSA 4ZQHA 4D0SA 4FDAA 2C5EA 2GUGA 1L7EA 4FB5A 1DIAA 8ADHA 3AUSA 5KJFA 1XWFA 2P4HX 3CMMA 4YJHA 2GCGA 2GN4A 4JQCA 1YBMA 5F5NA 2EEZA 2Q2QA 5I9NA 2Z95A 3M2TA 1R37A 5CEFA 5CG2A 1A5ZA 3NTQA 5HWSA 4PLGA 3D7LA 4B3HA 3AY6A 4TROA 1I5RA 3UCXA 5B4UA 3U49A 5L40A 3B1KA 1T25A 3ZU5A 3TNLA 3U4DA 1LTHR 1PQUA 3S8MA 1YGYA 5HS4A 4KUGA 1RPNA 1KERA 2HMWA 1XHLA 2YZ7A 2X4GA 1CRWG 3EYWA 2OUIA 5KIAA 3A06A 1A71A 3D3WB 4BO6A 3PDUA 1NFQA 1IHYA 1PJ4A 1WMAA 3G0OA 3AOEC 3WQRA 2CUKA 2J5QA 5JMWA 2ET6A 3L0DA 2BD0A 1A27A 2DQ4A 5TF4A 1KC3A 4ND1A 1BDMA 3JQ7B 4PVDA 2V7PA 4ZHSA 4O0LA 3W1VA 5ENDA 4CL8A 3DAFA 1T24A 3HN2A 1Z45A 3OJOA 4YT5A 5B4TA 3CE6A 4ILKA 4HFJA 1ZEMA 3X2EA 4NBRA 1OC2A 1VI2A 3BMCA 3SC6A 4NZ9A 2FMUA 5CPBA 3U9LA 2AQIA 4BVAA 4IZHA 3GLQA 3HB5X 3FR8A 5A3VA 1C0PA 4BNWA 3UHAA 5C3MA 3OEYA 5GMOA 2AEFA 3V1TC 4S3MA 1XGKA 2NWQA 1QV6A 3ONEA 3R6DA 1TA4A 4CL3A 1GTMA 3DTYA 4I9HA 1NR7A 4NBVA 5AXAA 5COQA 1NQTA 2BGMA 4DPMA 3K73O 4GVLA 4NFSA 1P77A 4NR0A 2R00A 1XDWA 1Q1NA 1OOEA 1A72A 1DLIA 3S1LA 1RWBA 3EZLA 3WBBA 4EUEA 3Q6IA 1Z7BA 4EBFA 1HSOA 5I7VA 3QVTA 4OHUA 2I76A 4NQZA 4DC1A 4YYZA 5AOVA 1X1EA 4IBOA 3PGJA 4Q3BA 3WBFA 4CV2A 1XELA 4XZ3A 4HUJA 1SNYA 3PWKA 4JX8A 5IN5A 4E6PA 1YBVA 3CPSA 3ZZNA 1K89A 1HDOA 1LSJA 3DDNA 2D2IA 1VM6A 2P9GA 1E3EA 2C7VA 3NAQA 3E8XA 4Q3AA 4WOJA 1PX0A 2HMVA 1PZFA 3FBTA 2GN9A 4LRTB 4WK6A 4HV4A 1C14A 2VYVD 5L3ZA 5J23A 3IKTA 4XQEA 4CQMA 2EP7A 4RVUA 2VUUA 3I9MA 4P4LA 1JVSA 3RC2A 3NJ8A 2YDXA 1P33A 1I24A 4XKJA 3GDOA 1KOLA 2Q1SA 4E3ZA 6LDHA 4Q3EA 2E6UX 3ROKA 1V6AA 2I5PO 1RJWA 3FSRA 3D64A 2G17A 2VHXA 3LC7O 3L9WA 1EK5A 4BNVA 2Q1TA 4B8WA 3D0OA 4MDHA 2DBQA 1YQGA 5TSDA 3AWDA 4ALLA 4XX0A 1P31A 1H2HA 1IOLA 3UVEA 4BGIA 5I7SA 2CMDA 3SLGA 4CLDA 2G5CA 1WLYA 5BR7A 4NDNE 2NACA 1OFGA 2YQ5A 4DA9A 1N7GA 3HWRA 4FC6A 3PWZA 2FPIA 3KHUA 4UVHA 4HFMA 3I6QA 4J91A 4CLOA 4DPKA 1LLDA 2B36A 1U28A 1HF3A 1EVZA 4OMUA 4W4TA 1GZ4A 5JC8A 2QX7A 1DC4A 2O23A 2O3JA 3OFSA 4E5NA 2GR9A 2ZATA 3PIDA 1BW9A 3OECA 5GY7A 4BO5A 2OZPA 3GFBA 3QE3A 3D5TA 1LNQA 3VPGA 3OQBA 5LCXA 1EEHA 2Z1MA 3D3EA 4IDGA 4YB8A 4Z3DA 3ENKA 3H9JA 1UXKA 1SPXA 4ZQGA 1E7YA 3WNVA 3ZI0A 3PLNA 3PQFA 3I4CA 4F45A 1SEPA 3F46A 2VZ8A 4IQ8A 1NXQA 5DP2A 3VTFA 4CLRB 5A5FA 1FK8A 4IXTA 3ZGYA 2BFMA 4CM7A 2FRDA 5ILGA 4AJJA 1YE3A 1YJQA 1MX3A 4ZU3A 2NUAA 3PHLA 4XJSA 4ZQBA 1V9LA 1ZEJA 1IUKA 3HDJA 2J3IA 4RCVA 1O95A 1BRMA 1KBZA 3A1NA 2DKNA 3GR6A 3S2FA 3ONDA 3KYBA 5HRUA 1D1SA 1JVBA 4RL6A 4YJGB 3ZV4A 1UDBA 4N5LA 4WUVA 3QWBA 3JQFC 2GN8A 1DC5A 4E5MA 4XD2A 3DBHB 3RASA 3AUTA 3BHMA 1A4UA 1Y5MA 4YRAA 4A5OA 1HL3A 1YDEA 4J1SA 3A28A 2Y1CA 2UDPA 3IAHA 4W82A 2DUWA 2IEBA 3WWZA 4QEDA 4E4YA 3WGIA 3LSYA 4NU6A 5TJHA 4JJIA 3Q11A 5TT0A 5A4DA 1JLLA 4EJ0A 3ZHBA 4YACA 3NKLA 3ABIA 3C7AA 2FSSA 3R0IA 4WCFB 3JQBA 2RH4A 1ONOA 3MOIA 3ZV3A 2VYNA 1R15A 4DPLA 3O8QB 1DIRA 1ONPA 1EE2A 2X8LA 1PL7A 5A9RA 3LT4A 1V3UA 2W98A 1EVYA 4MPDA 4XYMA 5AYVA 4UAGA 2E4AA 2PZKA 1C1DA 1YH3A 4U6SA 3PFWO 1P0FA 3DONA 4JBHA 3I9NA 2C2YA 1I2CA 1PQPA 3E48A 3NDJA 2EGGA 5JDIC 3JD4A 4DIBA 2QW8A 2BGKA 4CUKA 4ALMA 1ZMOA 4LK3A 4IDFA 1SEVA 3FWZA 1O0SA 1D4FA 2FPPA 1KEPA 1HE3A 1HEUA 1M2WA 1DAOA 2O2SA 1SO8A 5THQA 5A1TA 4TZTA 2XOXA 1YS4A 3LT2A 4LGVA 2HKIA 5IG2A 3VAZA 1UDAA 4D3DA 1H2BA 3ZV6A 5IZCC 1ZSYA 1GQQA 4IDEA 3VZQA 1QRRA 5AXBA 3X2FA 3VDQA 2DU8A 2PR2A 1VPDA 1SAYA 3DB2A 1N8KA 4WECA 4XEHA 4ALNA 5DCWA 4PZCA 4RVGA 4PLZA 1PJ3A 1XEAA 3AM3A 4IQ0A 3WB9A 4PFJA 1FXSA 3WJAA 3DOOA 2Q4BA 2WD7A 2C0CA 3IJPA 3IJRA 3OJFA 4FSHA 3ZU4A 2JCXA 2FOIA 4JP2A 5LDGA 1E7SA 2YHUA 4DVJA 3A4VA 5BQFA 1ZBQA 3L6DA 3RIHA 3TOZA 1WZEA 4JIGA 5KVVA 2Q45A 3DAPA 1LEHA 4GGOA 4GWGA 3PHHA 2PKQP 2X0NA 4DQVA 1VL6A 3VDRA 1I3KA 4G81A 2BRUA 3DOCA 4H15A 1AXGA 2NU8A 1PZHA 2ZYAA 3L07A 3N74A 4TZKA 4J9UE 4EW6A 4KZPA 5CP8A 5L95A 1O89A 4BIIA 3UAGA 1P1RA 5GZ6A 2YV3A 4B3JA 2Y67A 3T7CA 3PI7A 1KY5A 2DC1A 3SEFA 3QQPA 2CNBA 4Z3KA 3GGPA 4YCAA 3RUAA 4BB5A 1CDOA 5TX7A 3ETGA 4LVUA 3E6AA 4MKXA 2GZ1A 4K6FA 3WR5A 1JAYA 4I5EA 3BMNB 4I5DA 2HCTA 1LLCA 4LMRA 3G49A 1P1FA 3K96A 1T4DA 3GK3A 4ZRNA 1GADO 4LMPA 3CMCO 2H9IA 4OKNA 1T2CA 1H0KA 3FTPA 3O26A 1JA9A 1ZSVA 2RHRA 5L4SA 4JJFA 5A03A 2VQ3A 3W8FA 1JWBB 1NHWA 4HADA 1UP4A 4FR5A 3WIDA 1NVTA 2HO5A 4UVGA 1E77A 1C0LA 2FY8A 2X5KO 3JCZA 4W7IA 4XYGA 4C7KA 1ENYA 2Y1EA 5G0WA 2ZB3A 1WDKA 2RAFA 4B4WA 5JMPA 2QQ5A 3ANLA 3TPCA 4MVJP 1XSEA 4YJFB 3C1AA 2C82A 4BL5A 1EQ2A 3ZCXA 3ZNPA 1F14A 3UN1A 3ZN2A 3JYPA 4R69A 5KVCA 1GD1O 4RVSA 2J3HA 3OEWA 4RPLA 1YO6A 1GCUA 4NJMA 2BKAA 2IZ1A 3BXXA 1IPEA 2X1HA 1DRVA 4M49A 5ITVA 3ZWAA 2VWQA 2QYTA 4GKBA 4MJLA 1AXEA 1U8XX 3DMTA 3ZNQA 2PZMA 4YR9A 2W2LA 3DBRA 1E7QA 5JYDA 4JK3A 1H94A 3LYLA 2RBEA 4NHEA 2NU7A 4GH5A 3GRPA 2ZJ1A 1T4BA 2NADA 2Y1FA 1WPQA 1XQ6A 2ZTMA 2P9CA 4CLHA 2ZK7A 3L4BA 2TMDA 3H9GA 9LDTA 3GQVA 1MFPA 4A27A 4DUPA 1BXKA 4OYRA 2ZQYA 4BKOA 1XG5A 1ZJZA 4KQWA 3ZNNA 3PVZA 5CEEA 5DT9A 4OQYA 2BELA 3NTRA 4L4XA 1K5HA 2PGDA 4XGIA 1BW9B 3ZH2A 3DBLA 3S55A 4DIOA 4WLNA 4DYVA 3AM5A 1R4MB 3GAFA 4ZICA 3STHA 3K5PA 4ZRMA 4IM7A 4RVHA 5DF1A 3Q3CA 1X1TA 2B35A 4BMSA 4CM8B 4L75A 1OC4A 4E2XA 5DDIP 3LQFA 3BMQA 4L73A 4MIOA 1CF2O 2GRAA 4GQAA 1HYEA 3WSVA 4MVJA 1B8UA 1S6YA 2YYYA 1ONNA 2IE0A 3H65A 1NR1A 2Y99A 1MG5A 1K6IA 3DEYX 4UULA 2JFFA 4IPTA 3GNTA 3WFJA 1DSSG 2NQTA 4WLVA 1VSVA 3MJCA 5L9AA 1GV0A 3AI2A 3FWNA 1AN9A 3RJ5A 2F00A 1PJTA 1I0ZA 3CUKA 4B4VA 4BNIA 5KWEA 3B6ZA 3KYDB 4XJTA 2DFVA 4BNLA 4BUCA 3ON5A 1W8DA 4NIMA 3H5AA 2HMSA 1NFFA 5DNAA 3HQ4O 3OM9A 3ZWWA 1I3MA 2DFDA 2H5LA 4Q9NA 3BYZA 2O50A 3RFXA 5CAEA 1LC3A 3FNEA 5TLSA 3VH3A 3VKVA 1ZK1A 3G3EA 2BFAA 1V3VA 2YFHA 5I9LA 4G5HA 5AQ1A 2E37A 2R6JA 1N7HA 3ZWNA 5C7IO 5IDWA 3ZWMA 2R00C 4GI2A 4UEKA 3GFGA 3WLFA 1LRJA 2J5KA 4WNIA 5JBIA 1EMDA 1VL8A 4J1NA 4CM9D 3LVFO 3JQAA 1QORA 1C1DB 2NTJA 5JAZA 3I1JA 5JXWA 3U4IA 3CXRA 3DAGA 1FDWA 4RVDA 1W73A 4OGWA 2O3TA 2EJWA 4M89A 4F46A 4OIMA 3HZZA 5JNLA 4QQRA 2O4UX 4R5MA 5L7TA 4BNJA 4J7CA 3PHIA 1C3VA 2PH5A 2XPCA 3CZMA 3DTTA 1HE5A 3KEOA 1I2ZA 4AG3A 5JO0A 2GF2A 4E13A 4YAKA 2FZEA 4I9NA 4UUPA 3DHEA 5L4NA 3B20A 3NUGA 1ZNQO 3U4CA 7MDHA 4R51A 4R5HA 1QR6A 2WE7A 4CLXA 4XYLA 1DRWA 1Q0LA 4WKGA 4RF3A 1F8FA 4CMKA 4PG8A 4GX5A 3HJAA 1PIWA 5CDTA 2VCYA 3WGTA 4FFRA 1AUPA 2POQX 1DIBA 1TB4A 1AHIA 3FTNA 1HWYA 4RVFA 1OAAA 3L6OO 3E5MA 5K0ZA 4U7WA 5JO9A 3KBOA 3OMLA 3HDYA 5I8ZA 1WXDA 5FI3A 1T26A 3JQGA 5TT1A 5AXDA 1U2DA 2B4RO 1T1RA 2Y0CA 3PZBA 1UH5A 2A94A 1R6DA 4R1UA 5L51A 5KKCA 2NQ8A 4NMHA 4O5OA 2C2XA 4OJNA 4BNFA 4EJ6A 4C7JA 1U4OA 3K31A 4FGWA 4ESOA 3B1JA 4ND2A 4E30A 4E31A 3PJEA 3GUCA 2NVWA 3QWIA 2B4TO 1MXFA 2GZ2A 3WG9A 2GPTA 2I66A 1Q2XA 5DP1A 2QRLA 1GUYA 5IDYA 1QYCA 4BB6A 1E3WA 4BNXA 4EJMA 3MTJA 4N5MA 4NFYA 1P0CA 5G0UA 4CR6A 4MKZA 3I5MA 4U0KA 1D1TA 1ADCA 1PJ2A 3IMFA 5EERA 2X22A 3EAGA 1PU2A 1YRLA 2A35A 3DMYA 3ZHYA 4D43A 5IFLA 4MVJE 4ALJA 2CSUA 4CM4A 2BH9A 2GZ3A 4UEOA 5IN4A 1NQOA 2Y05A 4I9UA 2H1SA 1P1KA 3LLSA 4PLYA 1C1XB 1XCBA 4IINA 4J9VA 2Q99A 3RC9A 2VUSA 4NBUA 2UUOA 3ZWXA 2FR8A 2VWHA 4R1TA 3GZNA 4M87A 1DAPA 1PGJA 2X0RA 4RZIA 1XA0A 4NFHA 1GUFA 2LDBA 4IJUA 4GBJA 2IEDA 4E5PA 2Q1WA 3V2UA 1ZK4A 2NVUA 1LRLA 3DZHA 3HFGA 3NV9A 1LQTA 2JD2A 4JCOA 4LRSB 4JBIA 4MINA 3PFFA 2FHSA 4YRBA 1DIHA 4ZN6A 2I3GA 3DFZA 3AY3A 2YHIA 2GDZA 4PGFA 1QLJA 2JCYA 4BNHA 2Q2VA 4R3WA 3AI1A 3VZSA 1UXHA 1H6BA 3CTMA 3N7UA 3LF2A 1DEHA 1LI4A 3JQ6A 3JQBC 2ZB4A 3WNQA 1W4ZA 3H9UA 3GHYA 2DPGA 4KWIA 1YOVA 3SJ7A 5IDQA 2NSDA 1ZFNA 3KLMX 1BG6A 3IDSA 3WIEA 1YBAA 2AG5A 1R0SA 2NU6A 3K2BA 2FSVA 4DXHA 2RHCA 2B5WA 3O4RA 4ZQFA 4S1VA 5TJ9A 1B0AA 2Y93A 2P4QA 3SBOA 3JQ8B 4ZD6A 3WJ7A 3OIGA 4B7CA 4R54A 2V6BA 1CWUA 4KOAA 5GZ1A 1P74A 2J5RA 1PZEA 2XXJA 2H6EA 3GNSA 3OBBA 4L76A 2YDYA 4INAA 4OKIA 2VWPA 4PG6A 5DULA 3RKRA 3F1LA 4OXYA 5ES3A 3IP3A 1A7AA 2AHRA 1ULSA 4FN4A 4YAJA 4CMEA 4BMNA 3GEDA 4BGEA 1PJQA 3MWDB 1SOVA 4DLBA 1IPFA 1J5PA 3VVBA 3I9LA 2DAPA 1DBVO 2C20A 2Y0DA 1JN0A 1E3JA 1TT5A 3LDHA 4I1IA 3JD3A 3WMXA 1N5DA 2RIRA 1I32A 2VRCD 3FRJA 5EQDA 3TJRA 4M8SA 2CVQA 1FF9A 3H5RA 2A4KA 4HFRA 1QLHA 1DPGA 4OSPA 3GH3A 4CMAA 1LDYA 4FIZA 5G0SA 5G4KB 1ADBA 1H6CA 4WCDA 1LSOA 3FHLA 2QIOA 3RUEA 1K6XA 2HU2A 3QLJA 1PGQA 3RU9A 2RCYA 3M2PA 3CZRA 3U0BA 3RD5A 4WLFA 3WGHA 3BZUA 3C7DB 4OXKA 3Q2IA 6ADHA 2P68A 3MJSA 3FPLA 5EJ2A 2DPHA 3TF5A 4MKRA 3LC1O 1EFLA 2BLLA 3RAJA 4BO2A 4IDDA 1LBEA 1GQ2A 1J6UA 2JKVA 3GOHA 4TVBA 3VZPA 1I30A 4Z9XA 4XYEA 1YVEI 2WYUA 4DLLA 1N1EA 3MJTA 3HFSA 3MTGA 5CDYA 1V0JA 1Z7EA 4BKPA 2PLAA 3ICPA 1BMDA 1E1NA 1H6DA 2J8ZA 4AJ2A 2CDCA 3OETA 5IXYA 2C59A 3WGZA 5A9SB 1R16A 3GG2A 1LDNA 5TC4A 4UVIA 5I8WA 3I6IA 1JKJA 4J1TA 1JQBA 4RDIA 3GT0A 4LSMA 4RJTA 1UZLA 5BNFA 2YV2A 4A10A 4BNNA 4KTVE 3F4BA 4M54A 4GLLA 4J0EA 3QRWA 1M76A 1HKUA 4QT0A 4J43A 2HQ1A 3U3XA 4AJKA 1GYRA 3C1OA 3NGLA 1E92A 2OMEA 1EVJA 1NPYA 1WDMA 2W2KA 3GGGA 3O9ZA 4ND3A 4HFNA 4WEOA 5F21A 3DOJA 3TRIA 3H7AA 4TKLA 4D3FA 3VC7A 4CM9A 1ZH8A 3OHSX 1SC6A 3AFMA 5G0VA 4M1QA 1AGNA 1DFIA 1HDRA 1ZXBA 2FWMX 5DCUA 2PGJA 3ZU2A 3TZKA 3R1IA 4JROA 1ZXLA 1NHGA 3GVXA 1V8BA 2G82A 1E6WA 1PS9A 3NGXA 2B37A 5TS3A 3DZJA 5JCJA 2JFGA 3MJVA 3BA1A 3VH2A 3H6KA 3WYCA 1M6WA 3P7MA 1UJMA 2HK9A 4GX1A 1O8CA 3HG7A 3DMTC 1WNTA 2C5AA 4PIVA 1I33A 3QIVA 2I65A 4L0QA 5ICSA 5L7YA 1U1IA 3INTA 1R4NA 3GN1A 4BKQA 3CINA 1GV1A 1Y9EA 1QKIA 4CMBA 1PR9A 2OFPA 4WPGA 3WWYA 4AJNA 4BQRA 1QMGA 2ZKLA 2GD1O 1YL7A 3L4BC 4H3VA 3TL3A 4FQ8A 3LLVA 5IZ4A 1JW9B 4YQYA 1Z82A 4PG5A 1BHSA 2DTDA 3TZ6A 1K3TA 4MVJG 4BNKA 1DHRA 2AG8A 5JC1A 3C8MA 4NI5A 5F1OA 3VHRA 4IUYA 4I8XA 4MVJH 4FFMA 4ZA2A 3KM0A 4J7UA 1OMOA 2X9VA 1N9GA 4IQGA 1MG0A 4R4JA 4D3SA 3QHAA 3RSHA 3H9EO 2OHXA 1M67A 1LUAA 4DWVA 4MIYA 4DBVO 4A03A 1HLPA 3M1AA 1ZW1A 2Q4EA 4LCEA 5U1PA 3DZIA 4RLHA 3NDIA 1UP6A 2C29D 1CQIA 3ROQA 2O48X 5LC1A 3JYNA 3OJ0A 1F8GA 2NV6A 5DOZA 2OGUA 4RZHA 1SOWA 5G0TA 3TN7A 3U62A 3WGGA 3DXFA 2VHWA 1BXGA 4E2ZA 5ITWA 4BO0A 4P38A 4B8ZA 3RUDA 3PGXA 3C1TA 3Q0EA 4LVCA 3NT4A 5K9ZA 1PL8A 2X7HA 1AHHA 2NVUB 3OP4A 1YL6A 4YJHB 2VNAA 3JQCA 1DJNA 4GMGA 4BHTA 4P4GA 4Y8VA 5F5LA 5IAAA 2EHDA 4QECA 1SCUA 4QFDA 2EKLA 3I9OA 3KSUA 4EI2A 1TLTA 1ISIA 1N2SA 3IP1A 3ASVA 4E12A 2VHZA 1ENPA 4WEQA 3OIFA 4J4TA 4RPHA 1R0LA 3AUAA 4WJZA 5I9MA 1YDWA 2GLXA 2AQKA 1PR3A 2P9EA 1X7GA 3QW2A 4ID9A 2BF7A 1H9BA 1PJBA 4PZDA 1ARZA 3UW3A 4LW8A 1G0OA 1Q0QA 2PZJA 2VTEA 4IJKA 4CPDA 1ZK2A 4EYEA 1FMCA 3DZGA 1GPJA 3ZNOA 4NG5A 2B4QA 2WEKA 1B26A 1F06A 1NFRA 3RI3A 3WX0A 2A92A 2VWGA 2V6GA 3ULKA 4RF2A 3ASUA 1DOHA 4CQLA 3GPIA 3VH1A 1DIGA 1KC1A 2ZQZA 3BMOA 2BI8A 2BHLA 2I9PA 1O94A 5FF9A 1U5CA 1LDEA 2VHYA 5HA5A 1Q7GA 3BMCB 4AJLA 5EESA 1DO8A 2Y68A 2VNSA 2W90A 1BVUA 4A2CA 2B5VA 4I5GA 2EKQA 5BSGA 3ETEA 4PN3A 1T2FA 4GGPA 1U3VA 3UH1A 1EDZA 3PYXA 1C0KA 3ZDFA 1GZ3A 2FZWA 4EGFA 1TT5B 1B16A 3TFQA 1P1IA 5THKA 4BGUA 1XU9A 4EZBA 1UXIA 1M6HA 1ORRA 2WE8A 3BAZA 3HUDA 4GPD1 3I4FA 4TWRA 3IS3A 2BGLA 5DCYA 1GEEA 1NASA 2CF6A 4CQMD 1NYTA 1HE2A 4II3A 3L9XA 3AOGA 4AL4A 1CEQA 4TKMA 2AMFA 2HRZA 3PJDA 1UP7A 4D45A 2Y66A 3PJFA 3PIIA 1ZMTA 3V2HA 3WICA 1H93A 1ADGA 1MXHA 4QSMA 1Y8RA 3ETDA 1NBOA 3DZBA 4CMIA 2PNFA 3QVSA 2X9GA 3TWOA 3E03A 3IKVA 1B7GO 3PJGA 3PDJA 2VRCA 1LDMA 4CLEA 4BV9A 1UXGA 5H83A 3V2GA 3AI3A 2PKQO 1HTBA 1NP3A 1GPDG 3JQDA 4CQMB 4UREA 1YQDA 4FFLA 3EDMA 3RBZA 3K92A 5ICMA 4MVJI 2EG9A 2CY0A 5JDCC 1U3UA 4YAGA 4I5FA 1NWHA 1EUDA 5H82A 1BVRA 5FFFA 4D46A 1ISJA 1IB6A 4B4UA 4BNTA 3BTOA 1HYHA 1Y6JA 1WVGA 4YRDA 4ROSA 4QX6A 4R9RA 2P91A 3QV1A 4WGGA 4UUMA 4NJOA 1UDCA 3AJRA 4AVYA 5JSFA 3KB6A 3DZKA 2VYVA 5EIOA 3TZCA 1LQUA 3LF1A 2JL1A 3O38A 3KXDA 3TZHA 1IE3A 4W9NC 1G1AA 2AE1A 3R3SA 4Y6PA 3I83A 3H4VA 4LISA 5JY1A 3JD2A 4IMPA 4RGBA 3D3WA 3LT1A 1PS8A 4W7HA 5CG1A 5COAA 3C85A 3QWAA 4HY3A 5T5QA 5EMHA 2O2YA 3QWHA 3TZQA 4BO8A 1LRKA 4DBZA 4IGFA 4CLOB 1OBFO 4JJGA 3FNHA 3GF4A 2J3JA 3H5NA 3HN7A 3JQ7A 4WNCA 3ZWBA 5IXSA 3N58A 1A9ZA 1GYQA 3ROMA 1IYZA 1SBYA 1YWGO 3M1LA 4LN1A 4Z0HO 1ENOA 2WTBA 1GAEO 3PHJA 1WAMA 1H5QA 3WYEA 1NPDA 3LC2O 2AQHA 4PG7A 5CDUA 2DTXA 5I7FA 1NM5A 3PLRA 4DTIA 1N1GA 1HDGO 4O59O 3KVOA 3HB4X 4CM1A 1QSGA 4K1LA 2QYSA 3GRKA 4OL9A 4RQTA 4Y67A 3D4NA 3QVOA 3GVCA 5A04A 1VLLA 3UXYA 2CVOA 3Q9UA 5FYDA 2BFOA 4F6LA 3AU8A 1YJ8A 1I3NA 2ILTA 4XA8A 3UGKA 3F9IA 2AW5A 2HDHA 4OO3A 3WLEA 3T4EA 4BS9A 1E5LA 2D4AA 2FPGA 4G65A 2JAPA 1NAHA 1PL6A 1X13A 2GGSA 5EL0A 2OP0A 1RM5A 2JHGA 2WJPA
chains in the Genus database with same CATH superfamily
1BDBA 1ZMBA 1EFCA 1E4EB 1L7RA 2XNHA 2XMPA 4FCVA 3CKMA 4IEEA 4KV7A 3D3JA 4M1OA 3DEAA 2JASA 1DELA 4Y98A 4RHYA 3GDFA 1Q44A 1AA6A 3WDMA 4RA9B 1KE1A 3TUIC 2A9OA 4BN4A 1PV4A 4TMYA 1CUXA 1T2EA 4YX9A 1KDTA 1L8LA 3EVAA 5C46F 2CNKA 2HWWA 3DOHA 4G26A 4NAHA 3SIWA 2ZSIA 2C4TA 3TL2A 4UTNA 4BUJA 3VR3A 4O4IA 1VIDA 2PV7A 4V0OA 3PQ6A 1KAMA 1FDUA 2DHDA 3RROA 4LF7B 2UYOA 2Y1GA 1J23A 3RNOA 1T1GA 5F23A 1C81A 1QK4A 2X5JO 3EGOA 2FWAA 3OBIA 4AKSA 1T10A 5EWJB 1U8EA 3R9KA 1WW8A 4DRYA 3SQXA 1XTBA 4MI6A 4AKGA 4RYDA 3MJ4A 2J07A 2NX2A 1G7TA 2JFHA 2Q3BA 1T9ZA 3TLJA 5ICCA 1EEXB 1E6UA 2QRVB 1WRBA 2ZUBA 3BS4A 4PYIA 4R68A 2WUVA 4ERNA 4CKWB 2ID9A 4H1VA 3COZA 3GQBA 3N2NA 4J49A 2HV9A 5FOVA 1VTKA 1MJHA 2XJ9A 4PO1A 1LX6A 4DQKA 3WKCA 2YFYA 2JIPA 2BFBA 3ESDA 2QG6A 3LXMA 4Y2PA 2OQVA 5IUNC 4ALIA 1NVXQ 4BMYA 2CDBA 1SN7A 2GN2A 2JH3A 2XLBA 1V2GA 3RUHA 3HK2A 1LVGA 2PD4A 2W2PA 5BN4A 1WB4A 3G9UA 1FRNA 2I4MA 2JI8A 3G82C 1IRIA 3U6BA 5LIRA 4Z1MD 2OCLA 2WWRA 3AR5A 3TLMA 1JIUA 4YDRA 3MVEA 1X9IA 1EBFA 4QUKA 3RRXA 2BF4A 3K9QO 5BR1A 2UZIR 2BUAA 3NAZA 1V1JA 1CERA 1N8TA 2OQIA 3JWPA 2B8WA 2WIJA 3O94A 4FFBB 2ORIA 2AJ8A 3K1JA 5BMOA 3HKDA 5IK2D 2XRFA 1D0VA 1D2GA 1IJBA 1RCFA 3A14A 4NK5A 3ZWCA 1POWA 2O8DB 3F5FA 3OPXA 1TQHA 2QTMA 3BF7A 2HBRA 3DL7A 5DGTA 2PY6A 4D8YA 3MTQA 4L02A 2OP1A 4ZT6A 3DYIA 5L3SA 4P1ZA 2VTVA 3HBAA 3F74A 4YCMA 3D8RA 1XEXA 5KCZA 1YKSA 1P81A 4WZ6A 4JJ8A 4BWVA 4KQ2A 4HBGA 1Q20A 2RGEA 2PWYA 3VU1A 3BE6A 3T7KA 1OLXB 1X15A 2RB5A 1RAIA 4CQLB 2HCJB 2P75A 2HPZA 3VISA 1P2FA 4LC0A 3BGVA 4MH0R 2C07A 4PLHA 4DEYA 4Q3CA 1G3QA 1J07A 2QU7A 2CMKA 1YRBA 3EW9A 3FH0A 4M0EA 3ADDA 2QJWA 4JI6B 1RXSA 3RRJA 4A26A 4ISCA 1ZVQA 3ZYCA 4RE5A 4WXPA 4EH1A 2CYCA 1SUBA 4EG7A 3H2KA 3JZFA 4K9MA 2FEOA 4KYUA 2ADOA 3MS4A 1AO3A 4IW3B 3HKBB 3OCJA 1JWLA 2Q2WA 4S1WA 4YJGA 4Z6KA 2P6NA 3QNUA 2BFEA 4Q16A 3T9DA 1PWHA 1Z83A 5C1IA 3H11B 4MEJA 1SA0A 3DL2A 4FDMA 4U0JA 3HNRA 4KWCA 3LC0A 2VRNA 1PFKA 4CF3A 4H18A 2Q5QA 4P7GA 1UBGA 3MGCA 2RHTA 5KYYA 4KMSA 4EDFA 1UXOA 3MWEB 5KJEA 3C5EA 3DPSA 3FCXA 5ULLA 3AP1A 1CUZA 5IWAB 4LZAA 3QTBA 1MABA 2EF1A 4QEKA 2IS4A 1S2NA 1NQ5A 1M73E 1XQWA 2HHLA 5FT9A 4ESEA 3G79A 1AZTA 2JFZA 2JK1A 3ND9A 3SJCA 1H1TA 1COZA 2B6HA 1I1OA 1WR8A 1M5UA 3F5SA 5LPNA 4GOND 4NVRA 3P71T 1XXHB 1MV8A 4LXYA 4D0LB 2G76A 4URUR 2F6RA 4RMGA 1JI0A 2VSQA 4PINA 1QDEA 2W93A 3WYAA 3K0CA 1DCMA 4FFPA 4F2GA 5KYXB 3HRHA 1YJBA 1NX6A 2F3PA 4EJSC 2BJWA 2G0TA 2DY0A 1JG6A 3E61A 5EWMA 5U4QA 4OQ4A 4UOQA 3GLIE 3DCNA 2PVPA 5ICEA 4DCUA 3GJ0A 5COBA 7ABPA 1ICEA 1L7OA 3M6FA 4Y2QA 3LWNA 5IBCA 1ATZA 1Y1TA 1ZUWA 2IFTA 2EW8A 2FQYA 1VRCA 2EIHA 1HOXA 2G5GX 1ML3A 1YQ9A 4MULA 5J2TF 4C4ZA 1K1EA 3IL2A 3ZLUA 4JQOA 3GVHA 3HVRA 2C7GA 1OAOC 2XHZA 1J0XO 4M0FA 3DKRA 1Q91A 2PK3A 1X7YA 4BAZA 3F4KA 3DLBA 2YINC 1J8YF 1K5DA 3NV7A 3ASYA 2AXQA 4RMHA 2WU8A 2IYVA 3REQA 4M6WA 5FFNA 1G5IA 2XF8A 2YJZA 1G20B 4IQ4A 4CF7A 5I3CA 4YHHB 2XCRB 1U81A 4BMVA 1Q6YA 3OIUA 4GP9A 5EWLA 3A9RA 3NM6B 3SCZA 2ZT6A 2ECQA 3P2EA 4D4KA 1DQZA 1PS0A 2DZDA 2RK6A 2C9MA 2VPQA 3O3CA 4W9RA 1MNAA 1NJ1A 1GZSA 2CN1A 1RRVA 3OZ7A 4UAVA 5CLHA 3E2IA 2OUKA 2JFNA 1SHKA 1JLHA 2ZJ2A 4IX9A 4UARA 4JXJA 1N77A 4AY2A 4NU0A 3RSQA 1JDPA 5BUQA 2XRMA 1YR3A 3VPXA 2VAVA 5IJ9A 4PRZA 2NU7B 2EJCA 3ANSA 3TDMA 2M98A 4MP8A 2JGFA 4YAUA 3MLEA 4A6DA 5M04A 2E5FA 1XMPA 1D1QA 1VC2A 1XJ0A 1VOTA 5BSMA 5DBFA 4AY6A 1RTKA 2RI0A 4OQDA 1ZC4A 2Z5VA 3WMEA 4HWKA 5FI5A 4BASA 4IZ6A 5FR1A 3PYMA 2P9QA 4L28A 6GPBA 1SMKA 1Z4KA 4G5QA 4XVQA 3RRNA 4IS2A 4RWZA 5CRIA 1WOMA 1U1DA 4NOKA 3F97A 4K86A 1W34A 4KB5A 5FBRB 4ESHA 1QOQB 2FU5C 2QLBA 1ZI8A 3O4VA 1PDOA 5JCPA 1COWD 3X1JA 4Q4CA 3K2EA 1NRIA 3BTUA 3IEMA 2EKPA 3PTLA 2ZE6A 4B0OA 4U7JA 1HPLA 3I04A 4B4OA 2PSFA 1V3TA 2Q5LA 3T5PA 4IS3A 2P2SA 2X15A 2ZTLA 3M1YA 4PE5B 3RSCA 1IOVA 5AHRA 4BBPA 3U60B 1LDBA 4LF6B 3QK7A 3AVTA 3GGOA 1A9XA 2XMCA 1CUGA 1UPUA 3H5IA 4P7JA 4PX3A 3W4IA 3B1FA 1VI6A 4RSMA 1A04A 2KLHA 3WLRA 4BV2A 3LAWA 3NC1C 3LDAA 3VTAA 3BHJA 2NZWA 4O1MA 5JSKA 1G4AE 3PC4A 2QGNA 1ZMRA 1XCGB 4C7BA 3BGIA 4LOLA 1JGTA 2HGSA 1I01A 5WRFA 1TAGA 2MT9A 3HJFA 5EN4A 3ENNA 3FDFA 5AR1A 3ZU3A 3BJRA 3DJFA 3AO0B 3BULA 1RWVA 4ZZ2A 3T3OA 4KQJA 3BHIA 3WHLA 1PTJA 4JQYA 2H1WA 4C2BA 5CYFA 2Y1LA 2WYVA 3OQNA 3QLVC 2C2MA 2W4MA 1ODFA 3HYNA 3IUQA 3LYAA 1Q15A 3GRUA 5CR9A 1Q1QA 2H65A 3N3BC 2I6UA 3UC9A 1X70A 3H2YA 4D1YA 2PPVA 5ADWA 2HW8A 5ALOA 3AUJB 3MWKA 1PGOA 5EZQA 2IP4A 3IHKA 4OJTA 4TKVA 5I6DA 2DR3A 1E3SA 1B6GA 3IUEA 4IMJB 4NPAA 3ZHXA 3GAMA 3OTOB 4QU8A 2RGRA 1I2DA 3EUFA 1LLQA 1KJIA 1ANKA 4RS4A 3MELA 3EIHA 3I1IA 4RKQA 2VAXA 2H85A 1UZMA 5IBQA 3S2ZA 4UTVA 4YXFA 5K6AA 1JR6A 4LWOA 4ND7A 1YMVA 2J3MA 2D0IA 2E48A 3BSFA 3ZJ5A 2Q07A 4DLXA 4J1QA 3PQEA 1FLDA 4QOFA 3PK0A 4EA6A 3HDQA 1R8XA 2IS6A 3Q41A 1MH1A 4IDOA 7MHTA 2ZYSA 1Z63A 2Q49A 2R3SA 3AEZA 5ADHA 4UUBA 1YB6A 4PPGA 1EYZA 1QS0A 2O05A 2A7XA 2X6RA 2YUIA 3O4IA 4Z8XA 4AI6A 2W00A 4O1HA 4INZA 3RCBA 1JA1A 4B2IA 5EZYB 3B1YA 3PT9A 2FSFA 1A98A 1Z0JA 2ZT8A 1SR8A 3M9WA 2OE2A 4Q3KA 2DERA 2O3RA 1AJEA 3K2IA 3R7DA 4O4LB 3TPFA 2E49A 4AJEA 3GAZA 1GA4A 2GO7A 4F3RA 3CYFA 3G6WA 4LK2A 4IIGA 4NYIQ 3ZHUA 1GITA 2WAMA 4OBXA 3AB7A 3SX2A 4QA9A 3FFWA 5ALZA 4ZTBA 1SC4A 1VE3A 1JR2A 2H7XA 1NA5A 3TIVA 3OA2A 3WKBA 4FOLA 1SD5A 3SR3A 1I7QB 3FE2A 4Q1BA 2YW9A 4FGSA 5EFZA 4QOGA 3WFIA 2DUNA 2I67A 5B1YA 4K6CA 5JRJA 8GPBA 3WWEA 2GM5A 4YJDA 4W7SA 3D2CA 3E9RA 1DT5A 4JP5A 3QKSA 1KBOA 4IIJA 1L5MA 4ZT4A 2ZSHA 2WNIA 3SVZA 4FE7A 1I10A 1J09A 3TJMA 2PH3A 3H5WA 3OUUA 3V4OA 2HSGA 2OSBA 2WTEA 2B0JA 1R4MA 3PYLA 4OXNA 5A3QA 1US8B 1NZJA 3FIJA 3VJRA 1MBZA 2XAAA 5KAPA 2XXBA 3OE7A 5JE8A 1X2EA 5JS2A 5IF3A 4C2UA 3QITA 5HS6A 4AJPA 3BF8A 4ED9A 4E46A 1BH6A 2Q8QA 1LNSA 2FGKA 4MHOA 5K09A 2JZOA 3PL5A 4IV0A 4Q3OA 3ZGNA 2JDID 2RSLA 1BWPA 4KXYA 1D4OA 1L5WA 2EKZA 5GGXA 3HEBA 3WNDA 1TDJA 3B9PA 4Y0AA 3O2SB 5B36A 4YECA 1T2NA 2AMYA 3EIXA 2YVQA 3UV6A 2WJIA 3C4JA 3LFUA 3ZDRA 3VO8A 1E99A 5EXSA 3TGWA 3O73A 1E2JA 3BH6A 1F0NA 3GWGA 4XUCA 1E3WB 3Q5EA 3PFKA 3VPDA 1YMQA 1LZLA 3ZJYA 1KZ9A 2ISSD 4Y6SA 3MHPA 3JYLA 1KJYA 3DQQA 3HU3A 1OLOA 1NU6A 3QEAZ 2XGJA 3GOQA 3KYDA 3N3AC 4QGGA 4E94A 1XF1A 3N0XA 3PQ5A 3PC7A 4C04A 1L5FA 5KQLA 2FW8A 4E32A 3IQWA 1DDOA 1OZAA 1FX1A 1TO1E 1XC7A 2XQVA 1L7PA 2Q0SA 5BQPA 1M0SA 3GZNB 1YA8A 4LY6A 1H23A 5CT6A 5TQVA 4JR0A 2XMZA 3T3GA 4D0RA 4C0SA 1JDBC 3WJ2A 1FS5A 3DMPA 3SQDA 4Z4QA 1XZJA 3U3JA 1Z16A 1RI4A 2ZJBA 1HYQA 3JQEA 1GAWA 2R11A 5DE3A 4O63O 2YHAA 3PNKA 3FPHA 4D0GA 3RTBA 3G1TA 1SUCA 3H8JA 4B3IA 2AYZA 2YXDA 3SG0A 5EJFA 1MD9A 3FXAA 3ONWA 5CGQB 2Q50A 4HRYA 1KEKA 1T91A 3X2SA 3WYNA 4EKEA 1M2KA 5B57C 5KTKA 1WCIB 1KK0A 2HN9A 2VBIA 2WA1A 3BWCA 2Q0HA 2PGNA 2YHIB 3RUFA 3VMFA 3ZV5A 3ZCTA 1PJLA 1WDTA 4BE7B 1KWKA 3S1SA 4M1MA 5FPQA 5AJUA 4MVWA 1NDHA 4U00A 2OV3A 2JIQA 1GAJA 1M1NA 2Y9PB 2ZYWX 3BPSA 3KELA 2OPBA 4G0OA 1BGVA 8ATCA 4JLAA 2H54A 2VT3A 2QRNA 4N12A 3TTSA 2ZYDA 3HYTA 3KR0A 4MVJM 2WWVD 1YOVB 4TYPA 1ISHA 3GLFB 3IP6A 1RXUA 2Z1DA 1MIOA 1TC2A 3ZDYB 5KYNA 1UOPA 1MUUA 1R50A 1Z26A 4OHXA 3O4HA 3UB3A 2NU6B 4KTTE 4N82A 1HETA 4BP8A 3KQHA 1TXGA 2OOKA 2JKYA 4RIFA 1U1GA 4DGQA 2E4XA 4OJQA 3LA8A 5KVSA 1OBOA 4DMFA 2VXBA 3AEKB 3B82A 3IIEA 3LUDA 5LA6F 2NTNA 3FVWA 2RFLA 3RAGA 3TZBA 3GRYA 5SZJA 3NH6A 1GR1A 3V48A 5FAKA 1P44A 2RHJA 2PM8A 2FOXA 2G1UA 2FTKE 3I2YX 1A9TA 2CD7A 3L0PA 4JJEA 4Q93A 1PGNA 3V8EA 3R7NA 3ZYZA 4EG0A 5K8CA 3EUWA 4OQZA 4LNUA 3AFOA 2CLFB 4C4RA 1ZIPA 4UNQA 4ARVA 3QTTA 2XB2A 2BY4A 4MUNA 1P6QA 4HZUB 3STVA 4YCCA 2RGUA 4OUKX 4RF5A 4U6QA 3W2HA 4RKWA 4ZK6A 5CT4A 2VK8A 4K8OA 1ZR4A 3HY3A 3IUYA 4MICA 1ID8A 3E22A 3EEQA 1FPQA 1EP9A 1XTUA 1V5WA 4BGVA 4IHKA 1IWPB 3A2KA 3JAMA 5KS2A 1OX5A 2CXHA 1UZUA 4NSNA 3IUPA 3QKRB 3DL0A 3RQSA 2PGLA 5I45A 3JV7A 5IH3A 4MUKA 4DWOA 5CM9C 1HDYA 2YWGA 3OZRA 3ZHRA 1RMTA 4EL5A 3JWJA 3D4BA 1ZG3A 3GGCA 3T8YA 4PCLA 2FFBA 1G8PA 1C4KA 2PGAA 1XZHA 3NGMA 1S1CA 3ESZA 4CG3A 5C8VA 1LU9A 2BKUA 1KQOA 1JLSA 4YWHA 1H9CA 4RC9A 1XLTA 2ECPA 5L53A 5ER6A 4LSWA 1X92A 1KYZA 5K3EA 4HWSA 3TR0A 1HNWB 1P1HA 1XPRA 3OLWA 4JLWA 4X7RA 3LA6A 1JHRA 2ZIFA 4UJ3A 2XVAA 4ZYVA 2VNJA 3FDIA 2HJRA 5A9TA 1TEXA 1C4WA 3A4MA 3P9NA 4YMHA 4HLNA 1PSDA 4AS2A 3C15C 1ETUA 1Y9AA 4C0HA 1ODCA 2WM3A 4E5KA 3EZXA 2HU7A 3B3QA 1GNTA 4KUEA 4L16A 2F59A 1LFDB 4U7FA 3WQBA 3GLGA 2VH2A 1XRJA 2V7GA 2A9KA 2PX2A 2VDWB 3EA5A 1QGYA 3ZE7A 4DYDA 2ZJZA 4XQGA 1Y4DE 3D3NA 3QE0A 1JJBA 1FS4A 4MQ4A 4XASA 4R6WA 4C0LA 4DWWA 3FNFA 1ZD1A 5T67A 1Q7BA 1N5JA 3QEJA 5K3AA 4A2QA 5FA8A 1W44A 5J40A 4BNYA 4YT2A 4RTSA 5HSGA 1E0DA 2F43B 2WUWE 3FZEA 3ITDA 3LY8A 4HP8A 4OHBA 1NLYA 4UU7A 4ZVSA 4F6CA 4QG3A 2PL3A 4FWBA 4B80A 1H6AA 4S12A 1CULC 1SELA 5T7BA 4Z9YA 3P8ZA 1Y9JA 3AK4A 3RYFB 3U80A 3THXB 2EW2A 1J97A 5JCOA 1YI8A 5K3CA 5CEJA 2ON6A 4C78A 1UR5A 1NURA 1ZNYA 1W5AA 2F3RA 2Q9AA 2XQGA 3HDHA 1O5IA 4UAUA 5IUJC 4RD0A 2JBAA 4D9JA 5DXAA 4F5ZA 1TUGA 2QENA 1PR1A 3TJZA 3CRW1 3FCEA 4UU1A 1HZJA 4EW1A 3PFIA 4DLKA 5FTMA 1Z7YA 1JBKA 5CB6A 1RWOA 3K0CC 2IYFA 1DX9A 1GL3A 4XTRA 3X1ZA 4DC0A 1QYIA 3VC2A 1N9ZA 3KQNA 4MGIR 3IP5A 3OSUA 3ZW8A 5F7JA 4NOMA 5LZ4A 4KXLA 1QHYA 1ZBDA 4H4CA 1B15A 3R7FA 4ZVUA 3AUUA 4FEAA 2D13A 5AW9A 4I4LA 1DU4A 3VPCA 4EYQA 2GK3A 1XQXA 4K1XA 5I7EA 1LB1B 3NBXX 5HEKA 3MQ4A 1HG0A 1M66A 1Q92A 4IF6A 4QYXA 4BATA 4R9UC 2HWUA 5BSFA 1CP3A 4MPJA 2X4LA 2MMGA 2GEUA 5LDHA 1RJ9A 1RKQA 1VKNA 1PUXA 1K2WA 2H63A 3DEJA 3MFQA 4P4TA 3NHMA 1RE1A 2RH8A 2X14A 2RHHA 2ROQA 3E1KA 4FW9A 4OKSA 3WNBA 4F2HA 1VL5A 1DS6A 1URPA 2EF0A 3RG8A 2FEKA 3OPQA 2R6HA 3P9SA 3R3JA 4MWGA 2B82A 1GPUA 4YBZA 1UDXA 2GXSA 2WZBA 3DHNA 1UOEA 3T3EA 4H1WA 1LC0A 3EASA 3ESQA 3MMXA 1Z2NX 5H81A 5KYUA 1F12A 2IHZA 3KYJB 2HYIC 3I1FA 3QQ5A 1XRMA 2CLIB 3TMAA 4RTRA 5L45A 2IRWA 1N2CB 3QUBA 1P5RA 1VLQA 1W59A 3ACCA 4HDSA 5DI3A 3GW8A 5G2OA 4BN5A 3EDOA 4BTEA 4H16A 2CD9A 4UCQA 3UHFA 1KFJB 2BP7B 2CVHA 3H4TA 4BV8A 1JI3A 2WYIA 4OI4A 2WB2A 221PA 1L8QA 2H92A 3RPEA 1DV1A 4GWKA 3VKWA 4DIKA 5AVWA 4HT3B 4YT8A 4EEZA 5JLJA 4NS1A 1VJTA 4CUZA 1QYDA 2ZB8A 3FYCA 4JU8A 2PZ8A 1YE5A 1FFAA 2Q7DA 2FWIA 4ZOLF 2OKCA 2I80A 2IDJA 3OHMA 4RESA 5ALLA 4Z0PA 5JSZB 3THWB 1U7HA 3FDJA 5F73A 4A2PA 4DDMA 4CNBA 3VQTA 4IJMA 1GZ6A 2CJWA 5JDIA 2OD7A 3NNSA 4X1YA 3WRXA 4OBWA 2WPDD 4YP1A 4UTRA 1ISGA 1HYGA 2PEYA 1IWBB 4U7HA 2I7TA 3F6YA 1KDYA 1M2GA 3OM0A 1T5HX 1X1CA 4P92A 2QP3A 3CLTD 3HR7A 3O84A 1P2DA 4DKJA 5KDLA 1TD9A 4M9ZA 1MB3A 2JJYA 3OAAD 4GX0A 4XSVA 3L4KA 4LE0A 2WQ7A 2RG1A 4R8KA 4D4JA 1OYVA 2ZIXB 4C0BA 1ST3A 1N4DA 1OFIA 4QGBA 4QC2A 4B6QA 1K9SA 3CB4A 2H5EA 3GZJA 3PP8A 5CPFA 1A9YA 1V9SA 1XTVA 3C24A 1WZNA 3F5QA 3VVCA 1DT3A 1Z73A 3C74A 5J63A 1P8AA 3ZCQA 2CCKA 3BL8A 2CCJA 3FDZA 1D09A 2YQ4A 1QR2A 2AGVA 4YO7A 1J25A 2B78A 1J7JA 2EV9A 2PO5A 1N92A 4M0MA 4OXQA 2ZUSA 3A3PA 1RJFA 2H1LA 5A0VA 4BX3A 1TUIA 1Y98A 1V1RB 2C8LA 2PFGA 2GAOA 3F6CA 4CTNA 3R7SA 2QD4A 4WE3A 4DREA 1PTJC 1ZHHA 3OG9A 1RKVA 2C5SA 3GC6A 3HVJA 1G3RA 1JNYA 4IOMA 1JHXA 4Q9IA 1QYRA 5B1HA 4CL2A 4WFQA 1DQRA 1WWKA 1VL0A 4M76B 1KOJA 2LR0A 1IY8A 1F2UB 1NY5A 3OKAA 3D0QA 4KXXA 4D41A 4FEGA 3Q3JB 4FHFA 2QY6A 1DQPA 3HVKA 4ZV7A 4R8MA 1JBEA 1WP4A 3FR7A 3KXKA 4FYWA 4OREX 4DIDA 4NNPA 2G9VA 4QIHA 5J2UB 3MGAA 5JAHA 5LWHA 1S2GA 5IASA 4MIEA 3U16A 2VK2A 3KETA 3DXXA 5D5PA 2G9QA 3FPAA 3HZOA 3PE4A 4UPEA 3AERA 2X9LA 2G1AA 2X23A 1F2DA 2CLEB 3AHFA 3FYTA 5EZ5A 4QYSA 3UFXA 1DG3A 2XNJA 3KSZO 3N1UA 4FJ0A 5KYVA 4I4TA 2PLFA 4M9QA 3O03A 4TRMA 3V9AA 2UYHA 2EWMA 2MHCA 1GQRA 1W52X 2QUJA 2Z57A 4NK4A 1CUYA 3EZNA 3I92A 3JYOA 3N2IA 3C39A 3M33A 5HQTA 1SCNE 2WU0A 4WXEA 2JZCA 1QGZA 4DUYB 1NVFA 2XE8A 3HHPA 3BMOB 3LBHA 4YDHB 2DCMA 5DM1A 3VBEA 4CR7A 1UWCA 4RHEA 5ARCA 3K0AB 5IAJA 1X77A 3IERA 3THYA 1T5OA 1Q7RA 2D59A 3ER9A 4IOLA 1ZGCA 4CN8A 1OFVA 3OZVA 4O3FA 2ENWA 1B6SA 4CM6A 3SQOA 2DJ5A 5KB3A 3H4MA 2VKTA 2Y1XA 2J1LA 1ECCA 1NG1A 3H17A 2MYPA 2X6TA 1K6JA 4I5IA 4CQJA 5F64A 4FMDB 3Q0TA 1G7RA 1U2GA 2BE9A 4FILA 1ZVVA 1RVV1 4B83A 4H2DA 4M99A 2VK1A 2X7XA 1JQAA 3IESA 4PICA 1K4MA 3JQ9A 5DGDA 4WOKA 2IBSA 1RXWA 1I8TA 1R12A 3HO8A 3NWJA 1XVTA 1UQTA 1Z0KA 3L8DA 3R8XA 3MMPA 3C8DA 4LCJA 3E2PA 3IH5A 2NGRA 1U28C 3P9QA 4DA0A 1G0NA 2V55B 8LDHA 4WRRA 4FIDA 4B6GA 3UG6A 5BPHA 4EUSA 4AMVA 4U2KA 3U56A 3QTLA 4ZV4A 1WMDA 1Z47A 2BKLA 3GZ4A 3PUVA 1ZZEA 2IY9A 3MA0A 2O4CA 3B6MA 3DPUA 3HP1A 3NIWA 3SVTA 2NO0A 2UZ1A 4DUGD 1P1BA 2AR0A 3CGGA 3RSZA 4FI3F 1L5GB 4DNOA 3JASB 4BMCA 1T34A 1Y8RB 3LX5A 4OFBA 4CMIB 2G9UA 4RZ3A 3T9EA 3ML1A 1A1VA 1CIJA 1XRNA 3IUBA 1TF7A 2BFPA 2Z2JA 1R88A 3Q3GE 4RD1A 4TV8F 2VYFA 2ZR0A 3DWFA 2D00A 4EB3A 3WA7A 4UFOA 1EGAA 3LY7A 4TV9B 4ZXFA 4KR6A 1OFTA 3KZKA 1UBOS 4MUJA 3HWSA 3CVWA 4N0PA 4ZQHA 3IKLA 4FDAA 1SKQA 1A2QA 2GUGA 2ECOA 2C3YA 3DTVA 2IYYA 5E6SA 1LTQA 1WCWA 2A0YA 2LCQA 1I6KA 1S3IA 1YHZA 1EUDB 1I51A 1JIJA 1I13A 5DNDA 4DADA 2D8MA 4YV7A 3FPSA 2VJOA 1YBMA 2G6TA 3F6RA 2CYBA 3Q2OA 3ZCPA 2PG3A 1BXRB 2QE7A 2Z95A 3M2TA 4V1CA 4HDMA 1MPTA 5CG2A 4Q5IA 1AK1A 2E2WA 1BMTA 3C4QA 1TM4E 4V0MA 1HTWA 1BJRE 3A9TA 4GFDA 4LTNA 3AY6A 4CI0B 5HP4A 2WM8A 4HJXA 3UCXA 4F93B 1N0HA 1RLTA 1XZAA 1JTFA 3AF6A 1UWKA 1CQWA 2XUIA 1PQUA 4FU0A 4E14A 4YRZA 1YGYA 3HJGA 4KUGA 4AB1A 1QH8B 5H16A 1XHLA 2X4GA 4D3ZA 2PU5A 2JFVA 5HKAA 3EYWA 1TU0A 2G08A 5F9HA 4K88A 2E4VA 3KWMA 1NKTA 2IQIA 1U3GA 3HHEA 3PDUA 4BO6A 4G4IA 1IHYA 1WMAA 3M4NA 4BPBA 1ZN2A 2PZAA 3IPCA 1YVPA 5DW3A 1E32A 2EX0A 1OGJA 2VDNB 3OIYA 4MARA 2WHQA 3WQRA 5JMWA 4QUEA 1W36C 1RI1A 1J8VA 1NVAA 2YZ2A 4JLUA 3WQHA 4FGJA 2YWXA 4ND1A 2VPZA 5FKJA 1F1BA 1XZCA 2JHPA 4D9MA 3IEXA 4INOA 1O97C 5JZOA 3W1VA 1HKHA 2WJAA 1U5BA 2OO3A 3AY0A 1MAAA 3KFVA 4PZLA 5CNKA 1TC1A 3KR1A 2KS6A 4MQFA 4C1BA 3K3PA 5HDQA 2HBYA 3H86A 4HFJA 1T3SA 3GJ8A 4Q7EA 4NBRA 3X2EA 1WS6A 3SR0A 4HEJA 3UT6A 2PFSA 2DF8A 4NCIA 3PFCA 2Q7OE 3SC6A 2FMUA 4HXEB 1JPVA 1NR5A 5F52A 3TE7A 4CIYA 4IZHA 4IF4A 3UK6A 2ZREA 3UPDA 3BA6A 3FR8A 4QQFA 4AY4A 3QEMB 3FFAA 7YASA 1GGMA 5EJ5A 5B3AA 4JB8A 1GTMA 4P7BA 1W581 4H6PA 2ZE5A 5CA1F 1NR7A 4C89A 4ZI7B 4X64B 3E84A 3EJWA 3WISA 3SHFA 2P6MA 4BJ5A 3K73O 1ULTA 1P77A 5K51A 2MSLA 4JJKA 1XX6A 2JGNA 4KQGA 3UV7A 2JBWA 1HR0B 1W19A 4M37A 3FUUA 5LXTA 1KI6A 3IULA 1S8OA 1MV5A 3SICE 3BE4A 3WBBA 2G1KA 4EGJA 3J80A 3QVTA 2AFIE 4PHCA 3O8CA 3D31A 3KT3A 4FXOA 4NQRA 5AOVA 1OU0A 2YIMA 3PD1A 5SYAA 4YUVA 1PHRA 5DSTA 2A86A 4KIWA 3PWKA 5IJ0A 1OYOA 1IY9A 4QE3A 2B3DA 2PRZA 3DEZA 2GQ0A 3CPSA 3G5LA 4ZANA 3KU1A 4WBXC 3T5BA 1VCOA 5M29A 3AG6A 5H80A 4JSYA 3O95A 3CVXA 1XCJA 4ZO7A 4H1UA 1ZNZA 2D2IA 4ZAGA 2P2NA 1GGJA 2W6PA 4Q3AA 4DLVA 4WOJA 5AKLA 3VDXA 5MN6A 4MUHA 3CONA 4WK6A 4HV4A 4O4IB 1N6HA 5J23A 4RBNA 2Q5EA 2Q4TA 3PF9A 4XQEA 3HCBA 5DX8A 1XLTC 1ZIOA 1CEYA 1PN3A 2QT1A 4R2XA 1Z62A 2VUUA 3I9MA 4H4DA 1WOYA 1QJ4A 3CX8A 4GBED 4P4LA 5FHQA 3NJ8A 3UIEA 1DQSA 3EEFA 5EXTA 5HFAA 3GDOA 4NBLA 4Q4JA 2Q1XA 4UE6A 4JWKA 1SU4A 4NH0A 5LLTA 3FMIA 2C4MA 4ZC8A 4K87A 1TMGE 1QO0A 2HWXA 3GQBB 1JNXX 2BYTA 1J0CA 4LDZA 5JSQA 2GJ4A 5JYCA 3LC7O 1OJLA 2BFBB 3AXSA 1EK5A 3HRKA 2Q1TA 3MMSA 3MWJA 4LAFA 4BNVA 2HREA 3BAFA 1RWXA 4GPZA 5TSDA 1W9MA 421PA 1HLFA 4D5EA 1D6JA 1S2LA 2PAAA 1FBNA 3BWXA 1IOLA 3N7AA 5EP3A 5BN4B 4ISBA 3SBEA 3NEJA 1V7CA 3BXOA 3PQ7A 3WI7A 1UKVY 2CMDA 5PGMA 3ZGVA 4ZIRB 3SLGA 4JYZA 2HZ7A 1GFWA 3V2IA 2V7QD 3AI7A 1QIIA 2C0PA 2CK3D 2NACA 1OFGA 3OZTA 4FZVA 4XDGA 3VVLA 1FFHA 3OWXA 3D6JA 3HWRA 3P0IA 4FC6A 4L5BA 4ZHQF 3PWZA 2B99A 4UVHA 3HKDB 5IF9A 4CLOA 1I0IA 1H69A 1TA0A 2B36A 3U3MA 3UHJA 1Z0ZA 4IHJA 4W4TA 4F9EA 5JCOC 3HWWA 1Z33A 2HEGA 2QX7A 2O0JA 3SKYA 3RVMA 2O23A 4EARA 1E8MA 1Z8FA 4LJ5A 4MMZB 5L3SB 2BFNA 3OECA 1XEXB 2WUFA 4M0LA 3QE3A 3D5TA 2JGMA 3CHYA 5LCXA 3MFYA 3VPGA 3LYHA 2Z1MA 3MBOA 2DULA 5TF0A 5SICE 3D81A 3I4CA 5F3DA 4Z1MA 4F45A 3AL0C 1NXQA 2OHJA 1WSAA 1FK8A 4H77A 1ORDA 4PPFA 3WL5A 2O8EA 1KXZA 4M7RA 1BQEA 5ILGA 1BE8A 1YJQA 3FAKA 3DO8A 3TPZA 2FMTA 2B1JA 3PHLA 1DJLA 4PQRA 1ESEA 4ZU3A 2VPXA 3S1AA 2AW3A 4A91A 1V9LA 1P91A 2IC5A 3HDJA 5DHFA 1P9WA 4H6XA 2OFXA 2RGAA 3S2FA 3VR0A 3U5ZB 4Q7JB 4JBWA 3KYBA 1OZGA 1JVBA 2QY9A 1XZDA 1O0CA 2PUAA 3TW4A 4YJGB 3RO7A 3R77A 3WMGA 1MAHA 2BFEB 3ZV4A 3GEPA 1Q7TA 4N5LA 1V5GA 4WUVA 2FDRA 4RTQA 2ATCA 1YK1A 1E3DA 1NYQA 1SA0B 2GN8A 2YWRA 4YIHA 1FTNA 3R5SA 2PBFA 4YRAA 2PQMA 3ABQB 5KYYB 3FFBA 1HL3A 3DE5X 2VXYA 5IH7A 2UDPA 3ICVA 1IY1A 2DUWA 3H19A 4YJ3A 4KK3A 3WWZA 1MABB 1ZCFA 2C4HA 4QEDA 1JDSA 1PI3A 3G2NA 4C0XA 2RJNA 4M38A 4UPDA 1ZH4A 4IYRA 3PCTA 1OLSA 1DL5A 1LLFA 5TT0A 1XZQA 1OBHA 3O3OB 1V16A 3N7TA 2P35A 3R0IA 4GKJB 5A4FS 2CKMA 2ERCA 4RZQA 2RH4A 3RC8A 2GCIA 4BRWA 1WE2A 3MOIA 4OK3A 3ZV3A 5KSOA 1QPZA 4GXTA 4DR7B 1H2XA 1QHFA 3CR8A 1D5WA 1JLRA 3UMRA 2XAUA 2XADA 1GZHB 5EWMB 4J29A 5L3RA 2FKAA 4UTPA 1PL7A 5A9RA 3LT4A 5B30A 1V3UA 1RCUA 2B8NA 1SRQA 3DM5A 5EIWA 3I58A 3SXUA 1YH3A 3FUXA 1Y7IA 2C7OA 4J8PA 4BTLA 4P31A 1P0FA 1XUOA 4JBHA 3E48A 3NDJA 5JDIC 4DTCA 2D5LA 1XN1A 2V97A 2BGKA 5T41A 1SHLA 3WRXC 1XLUA 1ZMOA 1GSIA 4ALMA 1SEVA 4L0CA 4DA7A 2GRJA 5AW1A 2IUUA 4D9FA 3WK9A 1X7YB 1N6NA 4ETNA 4MS1A 1FC0A 2FLVA 5AVXA 4ITRC 3AJDA 2D7DA 3SBDA 1F8YA 5E2BA 1M2WA 5C8XA 1D2RA 3REQB 1VDMA 2B21A 3AW8A 4M6WB 3REFA 2ZWMA 2FA9A 5FO0A 4CCSA 4R2HA 4X0EA 2DFNA 4HB4A 5EWLB 3BWMA 3T3HA 4JI2B 2O1WA 4HYYA 3A2LA 5TMBA 4PXSA 4OI0A 2DU8A 2C7PA 2GI4A 3DB2A 1H2FA 2P3OA 3EVGA 1B8OA 1EHCA 2JIOA 3EXFA 1KKLA 4K9OA 2RE8A 4MSUA 2DETA 3TCKA 4WIAA 3AM3A 3WB9A 5IT9A 1FP7A 1YGPA 3DOOA 4GOKA 2WD7A 1U9YA 2PS3A 3IJPA 4B6OA 3OJFA 1O2DA 1Q84A 3SBXA 3L8EA 3GLSA 3Q3EA 4FSHA 1XVIA 2E7ZA 1QCYA 2FOIA 4JP2A 4Y6QA 3LCJA 2WMOB 4BJHB 1KORA 2PRSA 1E7SA 3TTYA 4G9EA 3A05A 4P36A 2CXPA 3A4VA 4DVJA 2O54A 2CWWA 3L6DA 2QN9A 1WZEA 4U7DA 5KVVA 3BN3A 2Q45A 3DAPA 1UKCA 1H2WA 4WKBA 1KDOA 1SHZA 1TA9A 4IJQA 4TUYF 2GKOA 4MW0A 4E03A 3QVKA 2CV1A 4XLLA 1EDEA 1YIAA 3BHNA 3PUIA 4KE6A 3I6MA 1YI0A 4WA7A 2VJLA 3L07A 2W2OA 5LYYA 1QG0A 1EFRA 1P2VA 2PPLA 3L0CA 2PSEA 3T1QA 2PBLA 1AKUA 1O89A 1QNFA 2QMUA 2VBFA 2BFFA 4QPNA 2NSJA 4ZCPA 5BSUA 1P1RA 3UAGA 3D1VA 3T7CA 4DB4A 1FXWA 1AKYA 3PI7A 1CUEA 4AK9A 3QQPA 2CNBA 4E09A 3CN9A 4POAA 1W46A 4WK0B 3CNQS 4Q1CA 3HDTA 4R05A 3U0VA 5BW8A 3U7RA 1SXPA 2AH5A 4LXXA 3DDCA 4EFNA 1FDRA 4REQA 5DBOA 3RIXA 4OAPA 1TIBA 1CUAA 3PFBA 4YLGA 5K3FA 1YK0A 1D5CA 3AZQA 3C1UA 3K96A 5BRAA 4QWMA 2EL7A 4N7MA 4MTLA 1GADO 1KR5A 3F3KA 4IH9A 4M9UA 2V3VA 1QF9A 3Q3IA 4Y2HA 2NN3C 4LOKA 1H1LA 3UMBA 1U7PA 4EEKA 3COVA 4G9BA 4LMPA 3CMCO 3WKAA 4JVSB 3SQMA 2PVCA 1R0CA 4OKNA 3U37A 3FTPA 4RZ2A 1NOIA 1ZSVA 2AUNA 4UATA 1U8UA 2V8OA 2RK3A 3R3VA 5FTWA 3PXCX 4AO8A 5EHXA 3A1FA 3NR2A 5A03A 2VQ3A 3W8FA 2ZIVB 1JWBB 5CH3A 5F51A 3RSFA 4FR5A 4D8TA 1V5IA 2O0MA 4TKVB 1E77A 1JSCA 3JCZA 4XYGA 2CFIA 2FUG1 1SIWA 4IDXA 1EX9A 3FTCA 4Z54A 4GYJA 3VR5D 3QUCA 3ANLA 4N76A 2WJGA 4MVJP 5AJTA 3SPXA 4DCJA 3ORSA 1T5IA 1BA3A 3C1AA 1P2GA 2BMEA 4NRDA 4RENA 3WYDA 4EMUA 4GSYA 5F77A 4RTJA 2ZI7A 3IJ5A 5ADUS 3SOPA 5J4KA 2GM4A 1O77A 3UN1A 2VJBA 4CKXA 4ZZ0A 1E1QD 4GZMA 1SK8A 2F1RA 2F3TA 1QS0B 3HCPA 4URHA 3TX2A 2CLKB 2UXCB 2P11A 5DN6D 3O83A 4RPLA 4QJBA 2KI5A 3O1IC 5DHUA 1E4OA 2JATA 1IPEA 4G2TA 2IF2A 5L6LB 3ZWAA 4RJ2A 1WSWA 4PZ9A 5C0OE 2AI2A 4INPA 1AXEA 1E94E 4MPTA 1HT1E 3HEAA 4NCXA 3CUVA 2SICE 3LYLA 3B1ZA 3MIIA 4AURA 2QN1A 4GH5A 2YTZA 4LWPA 2CL0X 2Y1FA 3CRNA 4W5QA 1N2OA 1KK1A 2ZK7A 3OF3A 3RK4A 1IY0A 2TMDA 3N6RA 3PI6A 2F4VB 5FYQA 5CLJA 1MFPA 2QRPA 3KUUA 1VIVA 4TQAA 2II6A 3QPAA 4W5NA 3BH7A 5E0OA 4IFBA 4OSEA 4IIJB 3SZMA 4IEFB 1XZIA 1PT7A 4HGNA 4OQYA 521PA 4BZZA 1MT0A 1K5HA 2NV0A 1K4KA 1BW9B 1UPTA 1Z7GA 3DBLA 4H3KB 3C5VA 4HGRA 4IO1A 1R4MB 4IFTA 3GAFA 4JUIA 4ZVKA 5K4GA 4ZICA 3AJAA 4LHYA 2QRGA 1A69A 1UBTS 2AXEA 3K5PA