4TWRA

Structure of udp-glucose 4-epimerase from brucella abortus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD binding site:NAD-dependent epimerase/dehydratase:UDP-glu
publication title Structure of UDP-glucose 4-epimerase from Brucella melitensis
rcsb
source organism Brucella abortus
molecule tags Isomerase
total genus 112
structure length 325
sequence length 325
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4twrA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4twrA02
2YV2A 4GQAA 1OOEA 1VRWA 3UHAA 4TVBA 1HDRA 4ZU3A 1LSJA 5COAA 5TRTA 1L1FA 1NPDA 3V2HA 4D3DA 4Q39A 3WR5A 3H7AA 4D45A 1DJQA 1X15A 4BO0A 2DUWA 2CDBA 3MOIA 4RVGA 2F1KA 1LSSA 2AXQA 3I5MA 1TEHA 1P0FA 3JQ9C 1QSGA 1RM5A 1NVGA 2JHGA 3DZIA 1JKJA 4GBJA 4EJMA 1C0LA 2R00C 1R0KA 1YJ8A 2ET6A 3JQ6A 1M6HA 3PQDA 2ZB7A 1V35A 5BNTA 5IZCC 1QYCA 2IXBA 3AI2A 3MEQA 1QYVA 2CDCA 1M6WA 1QG6A 4RCVA 2PV7A 4WLVA 1AN9A 1DHRA 4N5NA 5L4NA 1X0VA 2JCXA 3Q0EA 5EJ2A 4A7PA 1YOVB 4OKNA 2Q4BA 1Q0HA 3QP9A 4OH1A 4H3VA 3GZNA 4PLFA 3RCBA 4P4GA 1E5LA 1FDVA 1HE2A 2D5AA 4WKGA 2Q99A 3U3XA 3IQDB 1WDMA 1ZXLA 1PJTA 4M54A 3ZWYA 2ZCVA 2AE1A 1ZJYA 3BMOA 3VVBA 3I6IA 3PI7A 3U62A 3UKOA 2UUOA 2ZB4A 1PGOA 4BNWA 4KWHA 3OH8A 1ISMA 3DBRA 4HUJA 5FFFA 5B1YA 2PR2A 1GUZA 4XIYA 4J91A 5CDTA 2CVOA 2GZ2A 3HG7A 2VHYA 3AK4A 2O3SA 3NYWA 4NU5A 2ZJ0A 4BNIA 4UUPA 4XYGA 3NGXA 1L7DA 5DBGA 1TVEA 5BSEA 1ZKMA 4YAGA 1O0SA 1QRRA 1YS4A 2EKLA 1XU7A 4NBRA 4HFNA 1ADCA 4BUCA 3FCOA 3FSRA 1H6CA 4Q3EA 1RKXA 4QO7A 3E6AA 2NWQA 1VKOA 4O5OA 5LDGA 4PLHA 1ARZA 2CVZA 4FFRA 1GR0A 1PS8A 5KJEA 4ZN6A 4LMRA 4A03A 4JP2A 5F3RA 3HDYA 4BKOA 8ADHA 4CL3A 1Z7BA 1LDNA 1YXMA 1AHIA 2UYYA 4PGFA 1PJSA 5L51A 3RC9A 2JCVA 2WWRA 2J3IA 4R16A 2Y99A 1YB4A 1BVUA 2JFFA 4RF5A 2J5KA 1BVRA 1ZO8A 1MLDA 3UH1A 4D3SA 1NFFA 4A10A 3EW7A 5A04A 1DDOA 1EUZA 1R16A 4A73A 5L9AA 1WXDA 3JYLA 5C5IA 2O7SA 4J4TA 4AJ1A 4EI2A 1C3VA 2Q49A 5C7IO 2Y0EA 4DBZA 2LDXA 1GYQA 3RIHA 3WGYA 3X2FA 2A4KA 2G17A 2FPGA 5CEEA 3MJEA 4CM4B 1HDCA 2FSSA 4BNUA 1Y5MA 2O23A 3ROQA 2X0RA 2ZJ1A 3Q9UA 2VTDA 3PWSA 4XX0A 1LC0A 3IUSA 1KYQA 1DC4A 3NGLA 2JAPA 4L8VA 1GADO 2QZZA 3GUYA 1GTMA 1OAAA 4DLBA 1T2FA 3OQ1A 2IYPA 2X0IA 4RVDA 5HTOA 5CHEA 4HFRA 2HMUA 1F8FA 3ZWCA 1HZZA 5T8KA 3AM5A 5DOVA 5C7OO 4PLPA 4GMFA 1DC6A 1Z73A 2OL4A 4Q3NA 3NT2A 4EDFA 1F17A 2ZATA 3ANNA 2BELA 1SOVA 3NDIA 4GWKA 3VVCA 3WSWA 4BO3A 2J6IA 1F8GA 3ASVA 4W7HA 5GZ1A 1UXGA 4IZHA 4LSWA 4D3FA 4B4OA 4CR6A 5JC8A 2CD9A 4E4YA 1KVUA 4W6ZA 2WD7B 4IPTA 2WEKA 1MG5A 2I65A 3QVSA 4L73A 1DXYA 4KUGA 4CMBA 3E1KA 4PCVA 1NVMB 1T2EA 1U3WA 3PGJA 4GX1A 1DFIA 1U4SA 3FPCA 1HE4A 3TOXA 4YR9A 2CMDA 3K5PA 3H9QA 3TSCA 4L4XA 5GZ6A 1C1DB 2A35A 2NACA 3T7EA 3VPHA 5JW6A 1HYGA 4NH4A 1N9GA 2IZZA 3AOEA 1HL3A 5JO0A 2FMUA 3GEDA 3B1KA 2W4QA 4J7XA 5CG1A 3JYOA 3A9WA 5COQA 3ZWOA 2DKNA 2V6MA 3K8ZA 1I3KA 1IOLA 3Q11A 3AOGA 2TMDA 1O95A 2D2IA 1MP0A 5BSFA 4XYMA 4Z0PA 4XYEA 2C07A 3GN2A 4K6FA 3KEQA 2YQ5A 1D1SA 3KETA 1Y8RB 3MTGA 4BV9A 2R6JA 1V3VA 1ZK4A 1NQAO 3ZV5A 4P4NA 4ZQGA 1LSOA 3AUSA 1ONNA 3E5RA 2EJVA 1DC3A 2J8ZA 1NFQA 3GFBA 3GG2A 3H3FA 4OKIA 4W9NA 4XD2A 3DR3A 4CM4A 1RYEA 2W8ZA 2G76A 3SJ7A 4U6SA 2YDXA 4YPOA 4CLEA 2V6GA 2GZ3A 2BFMA 4K9DA 4O0LA 3WNQA 3A14A 4GSLA 3WFJA 4M89A 1X0XA 1AUPA 1JDJA 1DHTA 1MXHA 2Y1FA 3P7MA 5TS3A 3KB6A 5CEJA 3JQDA 4IJVA 4W99A 3B20A 1G1AA 1ZFNA 2Y0DA 3B6ZA 5COBA 3GVPA 4AJLA 4ALLA 4DXHA 2BMAA 1YH3A 4BO7A 1XELA 3GRPA 4DQXA 4YQYA 1DFGA 2VYND 4E32A 3SC6A 5BR7A 2OP0A 2F00A 2P91A 1U7TA 5JMWA 4C7KA 3E9QA 1ONPA 3HN2A 2GN8A 3CTMA 2OXIA 3GPIA 4BNMA 4DQVA 2ZTMA 1W0CA 2BRUA 4DIOA 3WTBA 4QECA 3W6UA 1GFSA 4XYBA 1YL5A 4GL4A 1UJMA 3D0OA 2NVUB 4XEHA 3S2GA 3AI3A 4R3NA 3SLGA 2WD7A 4ZD6A 3DZGA 3C1OA 3GG9A 1HEUA 1PGQA 1BWSA 1CYDA 1HTBA 3BA1A 1GUYA 3DZKA 3QY9A 2XPCA 1H5QA 2WM3A 3P19A 4IDCA 1FK8A 5LCXA 2VNAA 3VH3A 4NFSA 3ZGYA 3GNSA 3JQFA 3RFVA 2BLLA 4FOSA 1C1DA 3LU1A 2PKRA 3G1TA 4BO8A 3E9MA 5F1OA 2E82A 2JD1A 2POQX 3DHYA 3GF4A 5TT0A 4DQUA 3VZPA 1FDUA 1QYXA 3GZ4A 4I5GA 3G49A 4L75A 1ENOA 3G1UA 4NZ9A 1DSSG 1RYDA 1LRLA 2O7QA 4CM3A 4I1IA 4YB8A 1QV6A 1I2ZA 4FJ1A 2OP1A 3I23A 5JAIA 5HWSA 4EBFA 3D4OA 1BGVA 3KYDB 1WZIA 2IE0A 4XZ3A 1Q0LA 3Q3CA 1Y8RA 1NQTA 3AY3A 1LSUA 4JLWA 3WYBA 5JYEA 3FHLA 3AU9A 3JQ9A 2NSDA 4DGSA 3KLPX 2H6EA 1RM3A 1HT0A 1UDBA 5AYVA 4PG7A 1HDOA 2R00A 3WG9A 5C37A 4NBUA 4E2XA 3G3EA 1EDOA 5KKAA 5IZCA 1HYHA 2ZYDA 1E7SA 3ZU3A 4CLDA 3FI9A 3RQSA 2DM6A 3WBBA 3S2EA 4YJHB 5BT9A 2CUKA 3QIVA 5HRUA 3WGQA 3R3JA 3S8MA 1H94A 3GGOA 4ONEA 3QWFA 4KOAA 5I8WA 4J49A 2NVBA 1UH5A 1ZSNA 3GFGA 2VWHA 1P33A 3JQEA 2IEDA 3IC5A 3V8BA 4XGKA 3OEYA 3PIIA 3WTCA 3GEMA 1ZZEA 2Q1WA 3OF2A 4TKLA 4JBHA 3DO5A 4WLEA 4N5MA 3L6OO 4XQGA 3RVDA 4YT8A 3GY0A 1EE9A 2CDAA 1ORRA 3LYLA 4OGWA 5L45A 3OJEA 5CG2A 4KQWA 2DQ4A 5EMHA 1DC5A 1DLJA 1ISGA 1JKIA 2NVUA 5JO9A 1XU9A 2I99A 4WPGA 4JJGA 2WYVA 4TZTA 2A9FA 4TSKA 1G0OA 3DBHB 4BNNA 3CZMA 4YWJA 5KJFA 2VQ3A 2ZYAA 4PLZA 3ZWXA 3ONDA 2OGUA 1F0YA 1GCOA 1CETA 3NT4A 4BNTA 4ID9A 2X1HA 3FR7A 4LISA 1EVYA 4NBTA 1M67A 3IL2A 1U5CA 2QYSA 3JQBC 1EVZA 3OETA 4TRRA 2NU8A 5L95A 4BS9A 4B4UA 5JMPA 4DA9A 1DIHA 4YAIA 3KO8A 1UDAA 4LCEA 3WJ7A 4R4JA 4U0KA 4XIJA 3VHRA 3P2OA 3PTZA 3UGKA 1I36A 2IZ1A 3ZWMA 2QX7A 5DBIA 1P44A 5AQ1A 1KEVA 4QFDA 3ORFA 1KVSA 1XG5A 4J6FA 4YRBA 5AXCA 1GQYA 3KYDA 3ZH2A 1JKFA 3NRCA 1OFGA 2HAEA 2GASA 3QE3A 4J4HA 3SJUA 4YJGB 1Z74A 2BH9A 2HDHA 3W1VA 2DPGA 4O1MA 1RPNA 1Y5RA 2DBVO 3F1KA 3HZZA 1KIFA 1U7HA 4KDEA 2HK9A 4XYLA 4EITA 5L4LA 1XHLA 4A5OA 5IFLA 5A05A 4XQCA 1H93A 1K6XA 1XIVA 4OL9A 4O59O 5H82A 2PZKA 3EVTA 4FFNA 1SO8A 3NV9A 5G0SA 3H5RA 3DAGA 1CQIA 4YJHA 1KY5A 5FWNA 4J7UA 3HDJA 5DBFA 2RCYA 2UAGA 5F5NA 4Z9YA 1ZW1A 3CUKA 1KEWA 5FI3A 3WLFA 3H2ZA 2X58A 3IP1A 4B3HA 2UDPA 1EDZA 5C7LO 4QFCA 2DBRA 1R0SA 4YBZA 4X54A 4DWVA 1TB4A 4IY1A 1Q7BA 4DREA 2AEJA 1ZIDA 4WCFB 1ZCJA 5EESA 4MDHA 4CMCA 5T5QA 1QORA 1Z6ZA 1PX0A 3HJAA 5LC1A 1L7EA 4OXNA 3ZCXA 2FWMX 2RHCA 4R5HA 3DBHA 4KUEA 4DMLA 4OOFA 1DIAA 3DZHA 1NBOA 1IUKA 3RJ5A 1SOWA 3UF0A 4PLVA 4GX2A 2EKPA 4BKRA 3OJOA 3I4CA 4J1SA 1I3MA 2PZLA 4RDIA 4DPKA 4ND4A 2BFPA 3FNHA 5A02A 1LDGA 3GA0A 2UVDA 3ABIA 3BTVA 3SBOA 2IODA 4I8XA 3ON5A 4PN3A 1PQPA 2VNSA 1M75A 3K31A 1MX3A 2PTGA 4OO3A 5CDSA 4E5MA 2CZCA 1EFLA 3OIFA 3PYXA 2NQ8A 3W6ZA 4FW8A 3AW9A 4IUYA 3RI3A 3TJRA 4E33A 1YVEI 4DRYA 2E4AA 4J4BA 1QYDA 3UOGA 2JCYA 4D7AA 1UZMA 4OOEA 3ANLA 3DTYA 4K1LA 4YJGA 4RZHA 1BXKA 4RL6A 4D79A 1MA0A 1KBZA 4U7WA 3NAQA 1CQJA 3KYCB 4ZQFA 3TQHA 1T1SA 4IJUA 1SNYA 1IULA 1EBUA 3L6EA 4QXMA 1P1JA 2VYVA 5HA5A 2AE2A 1PJ2A 3C1AA 3JD4A 3PLNA 3LF1A 4ITUA 4RVFA 3R1IA 3GVCA 4KMSA 4BMVA 1S7CA 4NFYA 1A9YA 4BKQA 1QR6A 1EEHA 3F9IA 1HE5A 1YDWA 1D3AA 1IE3A 4W82A 1S6YA 4XRGA 4CV1A 4DUPA 3V2GA 4RPLA 4PVDA 4LCJA 4UREA 3GMDA 2BKAA 2DFDA 3JD2A 1UP7A 3DBRB 5U1PA 3PHHA 1GZ4A 2GUGA 2WMDA 4YTEA 3E8XA 3MWDB 3KZVA 1H6DA 2RHRA 1AGNA 3ENKA 2JD2A 1JWAB 3IKTA 3D3EA 4G2NA 1R4MB 4TMFA 4J7CA 3T4EA 5CPFA 1VSUA 2QRJA 2W98A 3M2PA 4M8SA 4OM8A 4NPCA 2VRCD 1XDWA 3WS7A 5KVQA 2W2LD 1U5AA 3HSKA 3OECA 4NHEA 3D4PA 2P68A 5K9ZA 4E2WA 2VHXA 1FMCA 4GVXA 3INGA 2HK7A 3LC2O 3C85A 2HMVA 3KLMX 2O3JA 1E7WA 4CM5A 3ZHXA 4BO2A 3RWBA 2C5AA 1LRKA 3GDGA 1B15A 2NV6A 1OC4A 2VZ0A 2ZQZA 1I5RA 3AFMA 2FN7A 1FDSA 2B0JA 3F5QA 4FBGA 1XA0A 4R69A 1N8KA 4KP7A 4CQMB 3QVWA 5DT9A 1EMDA 1LJ8A 5B4UA 1ISIA 2BGKA 4XQEA 4WK6A 2PH3A 3T7CA 3IS3A 1VJ1A 2GDZA 2P5UA 4PG4A 3TF5A 3ITKA 4XDZA 1YB5A 4FGSA 2AW5A 4KDFA 4IQGA 1E5QA 2ZB8A 3I83A 1GZ6A 2GCGA 1EK6A 3P5SA 4S3MA 4E12A 4NBWA 3BXXA 1LTHR 3LLVA 3QSGA 3JQ8B 3DBLB 4XB1A 1VC2A 4PLCA 3ZDFA 5G0VA 3WXBA 3PQFA 1ZK3A 4B4VA 4I5FA 2Y1OA 3KYCA 1GDHA 4F3YA 4XWYA 4Q3AA 4ZRMA 2VOJA 1BW9B 1U3VA 1DAOA 1XWFA 5TC4A 5IXSA 1O94A 1K89A 2VWQA 1YB1A 1AHHA 4EGFA 1PJQA 2O3RA 4JN6B 4FJ2A 4YAKA 5MGBA 3TFQA 2CF5A 4ND3A 3ONEA 4W4TA 3O4RA 1XLTA 1MXFA 4IZIA 1A4UA 1WDKA 2FZWA 4TRJA 4IINA 2Q2VA 3VZQA 2Q1TA 4IXWA 4Z3KA 4HADA 3KSZO 3LT1A 1GD1O 2D4AA 3AUAA 1VL6A 4XGNA 5JAZA 1I10A 5U4QA 1QMGA 4LK3A 1U2GA 5JNLA 3QWHA 3F5SA 1P1IA 1GY8A 4I08A 2YDYA 3FNEA 4R9RA 5AVOA 1PTJA 4IQ0A 2RIRA 3JD0A 4G65A 1KS9A 1R4MA 3L4BC 5KJ6A 5JCXA 1IPFA 3VPSA 2C0CA 1DAPA 4KWIA 1W4ZA 2VRBA 3AFNA 4WLFA 1I2BA 1GZ3A 2G0TA 4Q3DA 2H63A 2NU9A 4DLAA 8LDHA 4DYDA 3EVNA 3G79A 4XR9A 1PGJA 2QZ9A 3VH2A 1ISJA 3BAZA 5CP8A 4F6LA 3RC1A 4B7UA 1PZEA 4CMKA 1N9GB 4TVOA 2BI8A 2FOIA 1CERA 1A72A 1WMAA 5A3VA 3DMYA 1LEHA 4CUJA 3NJ8A 1LI4A 2YQ4A 1D4FA 2Q4EA 1UAYA 3L6DA 1EQUA 4ZQEA 2YHUA 3SX2A 5IDYA 4K6CA 4HBGA 1PR9A 2CFCA 5FYDA 4BNJA 1EUDA 3ZHZA 4QX6A 3WGGA 3LC7O 4CQMA 1TLTA 3ZNQA 1B8VA 3M1AA 5KTKA 2X5OA 3BTSA 4NNJA 1DEHA 3E82A 2Z1NA 5DNAA 4LVUA 2YHIB 1HETA 4ILKA 2E48A 3JQBA 4NFHA 4UVIA 1ZSYA 4PIVA 3VZRA 2YJZA 4D43A 3PJFA 1ZJZA 1IHXA 4HFJA 1O8CA 3OP4A 4OAQA 2HO5A 1ZSVA 3JQ8A 3DBLA 4CV0A 5I9NA 4YJFB 2SCUA 3BMCA 3W4IA 1HLDA 2DTEA 4FQ8A 5I9MA 1K5HA 1PGNA 3BHMA 5A4DA 5KVSA 2FPPA 1DFHA 4UAGA 3H65A 4JQCA 2UV8A 2YV3A 1UZLA 1BW9A 1J5PA 3CPSA 4U5QA 1GEEA 3AY7A 4BGUA 1GUFA 4DMMA 1E7MA 3QA9A 2X7HA 3FF4A 1MB4A 5IN4A 2FHSA 1MUUA 5JCJA 5U9CA 3I9JA 1JAXA 4YT5A 2ZIZA 3GVXA 3ZI0A 2FR0A 4OSPA 1YO6A 5CDGA 4ZICA 1PL6A 1J0XO 1SBYA 2VN8A 4R68A 3K6JA 4BB6A 3CINA 3OIGA 1E3LA 3O9ZA 4IDGA 4U6QA 3DXFA 3K2BA 4YVFA 1U4OA 2FR8A 3BTUA 1B7GO 3VTFA 5DZSA 2DVMA 4J16A 4PG5A 1CJCA 3TOZA 4AJEA 5H81A 4K28A 5JAQA 3E5MA 1ID1A 1YGYA 4A26A 4UVDA 1LU9A 2VUTA 2XXJA 3RC7A 5K6AC 2E37A 1PJBA 3SEFA 4JJFA 5G4LA 2PY6A 3JD3A 2X23A 2GSDA 3IJPA 4XB2A 1A27A 1E3WB 3UAGA 3K73O 3UCXA 5I7VA 4P22A 1VL8A 1YQGA 3HUDA 2HCTA 1B8PA 1E7YA 1GU7A 4J90A 2OO5A 4NU6A 4XJTA 1ISHA 1N2SA 1N92A 1Q7GA 1I01A 1KVQA 2ZTLA 4GLOA 2C7VA 4Y8VA 3UN1A 7MDHA 2PH5A 4DPLA 4OYRA 3ASUA 4E2YA 2BFAA 3ZZNA 3V2UA 2DT5A 4YRAA 3EYWA 4H16A 4DBVO 2PD6A 2QYTA 3PK0A 4FFLA 3CMCO 1BTOA 3FNFA 4FGWA 4E5NA 1LUAA 1XCBA 3QQPA 3DFUA 4RPJA 1JVBA 3AUTA 4IDAA 4AJJA 5A5EA 1EBFA 2P9GA 1IY8A 2X0NA 1LDBA 2YHIA 1R12A 3FBTA 3GAFA 3I9KA 3LDHA 4MVJA 4RO0A 1R66A 4ZJUA 1SB9A 3WQSB 2LDBA 3KHUA 3RBVA 5EPOA 3UICA 4RV9A 2JJYA 4MINA 1BG6A 3FBGA 1UDCA 1Z75A 3WJAA 2DTDA 3TZ6A 4DYVA 3IUPA 4YJFA 4WEQA 4RVSA 4CQLB 4CLRB 5KOIA 3WMWA 2O50A 1W8DA 4CM8B 3GLQA 4UULA 5ITVA 1LXCA 4J0EA 1ENPA 5G0UA 1G0NA 5ITWA 5FI5A 1XYGA 1DPGA 1EE2A 1M66A 1T25A 2EXXA 3FWNA 4PLWA 1I2CA 2PKQP 4K26A 1ONOA 4MKXA 3OBBA 3ETEA 1VKNA 4FSHA 3ST7A 3I52A 4IMRA 3TL2A 3ZWPA 2JHFA 2Q45A 3DMTC 4IS3A 5B4TA 4UUNA 4EW6A 3WQQA 3A1NA 1ADFA 5ER6A 3ZNNA 5DCYA 2GR9A 3ZU4A 4AJ2A 3L77A 4FDAA 1NM5A 1X7GA 4Y6PA 1HSOA 1U1IA 4UUOA 2EP5A 3OEWA 4NMHA 1E3IA 3WB9A 3JQAD 4LN1A 4AJHA 1BHSA 4QSMA 3JYPA 1NHWA 4YAEA 2JD0A 3ONFA 3ADOA 4E2ZA 1YQDA 2X0JA 3DDNA 1GV0A 4N54A 5A9SA 1KVRA 2GO1A 2NLOA 2I66A 5KNLA 3PRJA 3DAFA 4KZPA 4YCAA 3W4KA 5DP1A 1V0JA 5DCUA 1XR3A 5L40A 1ZXBA 2JKVA 1NPYA 3CXRA 1HSZA 1H6BA 4UVGA 5A3JA 3L9WA 4OHUA 2B5WA 1LDEA 1VM6A 1HLPA 2X4GA 3GOHA 2EWMA 3QVTA 4F6CA 4MKRA 5FEUA 1E3WA 4WNCA 1LLCA 4DTIA 3PZBA 1Y6JA 1AXGA 1NNUA 2PD4A 3HB4X 4XCVA 4BMSA 3ZV3A 3EUWA 4R01A 4ZVVA 3ZWAA 2I3GA 3PP8A 4MVJH 5AXDA 4NDNE 4BB5A 3MJTA 1T24A 4GGOA 2DBZA 1LLDA 1LX6A 3AUUA 3KV3O 1HYEA 3EDMA 4EJ0A 1XSEA 2VWPA 3NX4A 1YKFA 5A9TA 4GI2A 4AVYA 1MC5A 1V3UA 1XQ1A 5KWEA 1HDYA 1I3LA 5L3ZA 1E1NA 1GYRA 3HB5X 2BFOA 2E6UX 3RKRA 4EUHA 3DONA 3ZU2A 4E5KA 1K3TA 2EJWA 2UUPA 3IAHA 4RF3A 1P9LA 4EZBA 3COSA 1T2AA 3GRKA 3VOSA 1YQXA 2JAHA 1LLQA 2O2YA 4CQLA 4ESOA 4HV4A 4CLRA 3W8DA 1WP4A 4CM8A 4CR7A 4I9UA 4LMPA 1T26A 2HRZA 1VSVA 1J49A 2FPIA 3GC6A 4FPXA 3I9NA 1R15A 4PLGA 3I9OA 1RM0A 2EW8A 3H9GA 4R9SA 4JJIA 1KEUA 1NTOA 3RU9A 3HFSA 1KOLA 3R0IA 2WE8A 3Q2IA 2EIHA 5B12A 3KEOA 2PD3A 3PLRA 3PFFA 4FD3A 4R41A 1V9LA 1WZEA 5ICSA 3B1JA 3ENNA 2HMTA 1LBEA 4ALKA 3U09A 2BGLA 2I6TA 4L9RA 3DC2A 2WYUA 4BO9A 4OXKA 2C82A 4O63O 2C5EA 1PJ4A 1KVTA 1K6JA 4INAA 3DQPA 1F12A 3DL2A 3OSUA 2EV9A 2B69A 2VT3A 3PXXA 1DIGA 3F3SA 3GGPA 3I9MA 4UEKA 2YY7A 4E0BA 4RGBA 2V65A 3S2FA 4IBOA 1D7OA 3L0DA 2AQHA 5G4KB 3WGTA 4P38A 2E49A 2WJPA 2ZTVA 2AA3A 1J4AA 5DCWA 3FD8A 3EK2A 3L4BA 1WDLA 5JFOA 5ENDA 3EC7A 3RFXA 5BSHA 2B37A 1P77A 3ZWVA 3VH1A 2H5LA 3OHSX 5BQFA 3VPXA 4E31A 3ZHBA 3NKLA 3IIEA 2JL1A 3LF2A 4I5EA 5GZ3A 4TROA 3WGIA 2OHXA 4R1SA 3MWEB 4YAJA 5JDIC 4C7JA 9LDBA 1I8TA 1N5DA 1VJTA 3JQ7B 3OICA 2X6TA 4OMUA 2XXBA 4PLTA 4J1TA 3D5TA 3CEAA 3DZJA 3IKVA 1ML3A 2ZQYA 4CPDA 1E1KA 3L9XA 5JDCC 1UP6A 2FR1A 2GERA 4RZIA 5BSGA 1JLLA 5JY1A 4BNLA 1OBFO 3OFSA 5JPIA 7ADHA 2AQ8A 1LA2A 5ADHA 3Q2KA 4OQZA 1SCUA 4D44A 1ZK2A 3T4XA 4PRKA 1QKIA 3CSDA 4RPKA 1KC1A 1OZAA 1H2BA 1YONA 1EVIA 3EMKA 2Y1EA 3IDSA 4PLYA 1JAYA 4IJKA 3RBZA 3V1UA 4DIFA 1E3SA 3WFIA 3LZ6A 4U8GA 2Q46A 4YQZA 2GGSA 3M2TA 3DOOA 4H7PA 1Q2XA 5KJCA 3RFTA 3ANMA 3KYBA 2XOXA 3CIFA 4FFMA 4ROSA 3V5NA 4QEDA 5TNXA 3WMXA 3DZBA 4JNKA 5AXBA 1KC3A 3WLEA 3F47A 3F4LA 4IDFA 4ZRNA 5A03A 1PWZA 1BDBA 1RM4A 3D3WB 1B0AA 2AQIA 1HE3A 3LQFA 1C0IA 1I24A 3ETGA 1ENYA 3OMLA 1N7HA 3FRJA 1PIWA 2BHLA 4CV2A 4UVEA 1I0ZA 4RF4A 3DHNA 3TZQA 3VAZA 4BKUA 3EAGA 3HE3A 3OJFA 4CV3A 3FTNA 3PHGA 1I3NA 5TQVA 4J9UE 4HP8A 1JTVA 3H8VA 1DRVA 1EK5A 3ICCA 5G4KA 1B8UA 3HDQA 2NU7A 1ZVMA 1U28A 4DC0A 3PDUA 2PGJA 3JCZA 4O6VA 3DZFA 4H15A 3UCFA 1EVJA 1SEPA 4LVCA 3MTJA 3GR6A 1YL6A 3JYNA 4DPMA 5K6AA 1PZGA 4RVHA 3Q6IA 3E03A 1XEAA 3D4NA 3WDSA 5THQA 4J43A 3PYLA 1C0PA 3RUHA 3V1YA 4XDYA 3JQ7A 5TSDA 1LQTA 4MP3A 3WICA 2ZB3A 1CDOA 2VUSA 4B8ZA 5A9RA 3H3JA 3TZKA 1QYWA 2NTNA 1E3JA 3ROMA 4URFA 2C59A 3TZHA 1YRLA 1ADGA 2BD0A 2PFGA 2XAAA 4GGPA 4BQPA 3UUWA 3H4VA 1JVSA 1Z45A 2B5VA 2Q1UA 4Z9XA 4QTZA 4BNVA 3K92A 4FC6A 1JU9A 1LC3A 1SAYA 3OA0A 3WNVA 1UXHA 2NVWA 2YW9A 3PGXA 5HBRA 2V6FA 3DOCA 4CM9D 4E13A 2HMSA 4WLUA 3O26A 3U49A 5IAAA 5JDCA 1ULSA 1W73A 3QVOA 4LRTB 4NJOA 3OQBA 2CNBA 4S1VA 1A7AA 2VHZA 1FDTA 4ND1A 1OC2A 1JWBB 3QWBA 4IDDA 2YFHA 1H0KA 4PG6A 5LDHA 3HNPA 3O8QB 3PHIA 3Q1LA 1AXEA 4UEJA 4CUZA 2AEMA 3HHPA 4NK5A 3GHHA 3ETDA 4M1QA 1NR1A 4N18A 3ZN2A 2EGGA 5TGDA 1AE1A 1C1XB 4D0SA 2X9GA 1T4DA 3PQEA 2AEFA 3GEGA 4MVJP 3NEPX 4EEZA 1UXKA 5IDQA 3KM0A 4J1QA 4BQRA 4R51A 3A4VA 1NWHA 4WGGA 2C7GA 1LQUA 3D3WA 3KSUA 4YXFA 2PK3A 4BHTA 3F46A 4CMEC 1NQOA 1R6DA 1BDMA 3ITDA 5AXAA 3DMTA 2CY0A 3M6IA 4IDBA 4FOOA 1U8FO 4RDHA 4ND2A 3F4BA 3PPIA 3FN4A 3ZW9A 1NAHA 3EZLA 4RLHA 3ZV4A 1ZBQA 5EQFA 4ALNA 4D46A 3WIDA 1WVGA 1CWUA 3ZNOA 1I33A 1EZ4A 1ZMOA 1ZNQO 1A4IA 3RAJA 4DLLA 4ND5A 4E6PA 3NJ4A 4R3WA 1EFKA 1Q0QA 2VYNA 4Y98A 3RKUA 1FJHA 3L4SO 1JA9A 4QQRA 2CSUA 2YFQA 2CVQA 3NTQA 4JIGA 4AJIA 4AJKA 4GMGA 3HQ4O 4BGIA 3RUCA 3WIEA 3GH3A 1Z82A 4TWRA 3AI1A 3MJSA 3SXPA 2GD1O 2IXAA 1BSVA 1P1HA 5T64A 1YL7A 2DPHA 1QXSA 4MVJI 2VT2A 3VKUA 1PL7A 3D64A 3EHEA 3U4CA 4II2A 1E1MA 5B37A 4YRDA 3INRA 4NR0A 4B79A 5J23A 1VI2A 5G0WA 5EN4A 3LK7A 2OZPA 1E0DA 4RJTA 4WOKA 4IQ8A 3VZSA 2OUIA 4TRNA 3LVFO 3BMCB 3PJDA 4CM6A 3PEFA 1D8AA 3PFWO 1KERA 1KY4A 3JQCA 3BTOA 2NQTA 3NUGA 3CZRA 4IJWA 1YBVA 1QLHA 1K0UA 4PVCA 3WYCA 2W90A 4L0QA 5I7EA 1Y9EA 3GPDG 4FN4A 4IMPA 5I8ZA 4J9VA 1GV1A 1IZ9A 3O8QA 5DOZA 4LRSB 3H6KA 3OM9A 1P3DA 2DBQA 4P8RA 3PDJA 2Y0CA 3GGGA 4FR5A 4CM7A 2GRAA 1C1XA 4BKPA 1NX6A 2HRBA 3AY6A 2PGDA 5GY7A 3VC7A 3DHEA 2JFGA 2NUAA 1B26A 2XF8A 3BYZA 4OIMA 4Y6RA 3RUDA 3ZWNA 3I6QA 2H9IA 2FSVA 3INTA 1V3TA 2PKQO 1DB3A 2J3HA 5JXWA 4ZA2A 1E1LA 5F1PA 2X9NA 3A28A 3GAZA 4RORA 1NP3A 2WYWA 2O3QA 3R6DA 4EYEA 2B36A 4F45A 3OQ6A 2NTVA 4JROA 2GPTA 2A92A 1YJQA 5ER9A 1PJLA 3KRTA 3IP3A 4IDEA 4UVHA 1HZJA 3C7CB 1HDZA 3PJGA 1PQWA 3EZYA 1A5ZA 3HDHA 3ICPA 3B70A 4FFPA 4AJ4A 1DJNA 5L7WA 3OJLA 2Y1DA 4RQTA 1P31A 4R1TA 4Z0HO 3E48A 5H83A 1P1RA 5JLAA 5JC1A 2B4RO 2B4QA 5BNFA 4FC7A 2W2KB 1VLLA 1A7KA 1D1TA 2J5QA 3RU7A 4EUFA 1EUCA 3WYEA 3W8FA 4YT2A 4KTTE 5JE8A 2X86A 3VDQA 4NQZA 3W4JA 4A2CA 4L4RA 4FB5A 1SZJG 3RD5A 4HWKA 5G2OA 3VH4A 1NFRA 1PL8A 1ISFA 2J3KA 3UFXA 2I67A 3GNQA 3IOYA 4IGEA 3ROPA 3JTMA 3PHLA 4MP6A 4GPD1 5TT1A 2HSDA 5JDIA 5T6BA 4AICA 3GK3A 2I76A 5ES3A 3QRWA 1E6WA 1VPDA 2VOEA 1YE3A 1IHYA 4FIZA 1TXGA 1YBMA 2DLDA 1VE9A 2BF7A 4EEXA 3VPFA 3U5TA 2ZK7A 1HKUA 4Z0TA 3UCEA 3KUXA 4OJNA 4N5LA 1MG0A 2D0IA 3GVIA 5KKCA 3MJ4A 1Y1PA 3DB2A 1Q7CA 3PVZA 1NYTA 4WCDA 1RWBA 3QHAA 4L76A 2D59A 1T4BA 3UW3A 3WQRA 4BVAA 3QWIA 1PQUA 3FTPA 2X5JO 3M1LA 4HX5A 2EG9A 4LSMA 3WOHA 2RBEA 3TRIA 3K9QO 2Z1MA 4B3JA 3N74A 4I9HA 2AG8A 1T2CA 4KTVE 2C29D 1YOVA 1ZUD1 4CMIB 2DFVA 5KIAA 2HMWA 1PGPA 1OI7A 3H9UA 2J3JA 3H9JA 1K2WA 4E3ZA 4JK3A 3G0OA 2QW8A 5A9SB 4J3FA 2Y93A 3LSYA 1CF2O 3QJ5A 1YWGO 1C0KA 2GN9A 4MVJG 3U4HA 2NTJA 1NVTA 3BHJA 2QG4A 4II3A 2GLXA 3QWAA 2C20A 3U0BA 4JBIA 2QHXA 2ZCUA 5DF1A 2NNLD 2IYOA 1LNQA 1PR3A 2GNAA 2R2GA 1M2WA 2JFHA 3BMNB 1J6UA 5T57A 3EY4A 2IEBA 4WNIA 3ZU5A 3JQGB 2HKIA 3CE6A 4GKVA 3PWZA 1DIRA 4YEDA 2GYYA 2C54A 3KTDA 1QV7A 2HJRA 2ZYGA 4CL8A 1NASA 2B83A 1R37A 4BO4A 1HXHA 4BNZA 4Y9DA 3UVEA 4M55A 3RROA 3GDOA 3I9LA 5IZ4A 3V1TC 2OBYA 1O6ZA 2W2KA 3BHIA 1K6IA 3DEYX 2O4CA 2BGMA 1O9BA 1E7QA 5CEFA 1IB6A 1N1GA 1XGKA 2HU2A 4C4OA 1NWCA 4ALMA 2PLAA 4PRLA 3H2SA 4JBGA 4PFJA 1E3EA 2P4HX 3LT0A 4OQYA 1KEPA 3L07A 4HKTA 4MVJE 5FF9A 5THKA 2AHRA 2VYVD 3R3SA 3S1LA 3VPGA 4BNXA 1FF9A 4LGVA 2PA3A 1SEVA 4RVUA 2D3TA 3FR8A 5DULA 2Q2WA 4QO8A 2Y68A 2OORA 4TQGA 1X7HA 3C1TA 4IGFA 2OFPA 5KJ1A 4WLNA 4W7IA 1W6UA 4ZQHA 3AWDA 4AJNA 1P45A 1HDGO 4CLHA 3QW2A 4XR4A 1NHGA 4L4SA 1I32A 4MVJM 1P74A 2Q3EA 3I3OA 4HXYA 3JD1A 2HJSA 3KBOA 1X1EA 1X13A 4IM7A 2TMGA 1P1FA 3RUAA 3U9LA 3ULKA 1Z7EA 4NJMB 2Z95A 5JBIA 4GKBA 2DAPA 1PJCA 1CIVA 1FXSA 5EERA 1RJWA 4J2OA 1DBVO 3PJEA 4CMIA 4CM9A 4BNHA 3H9EO 4M86A 4Z3DA 4BV8A 1HF3A 4WEOA 3WSVA 1ZEJA 3KSDO 4GSKA 4U0JA 2OMEA 3DFZA 1UXIA 3K2EA 2AQKA 4JCOA 4RQUA 4WCFC 2D8AA 3QV1A 2ZKLA 3C3XA 3WWZA 2IZ0A 4EUEA 2Y1CA 2P9EA 1N7GA 5KVVA 5TJHA 2EERA 4WE3A 3MCVA 4WLOA 1R4NB 2EGHA 4CMEA 3CH6A 5A06A 5IN5A 3BMNA 4MPDA 4OSOA 4Y67A 2ILTA 3H5AA 3JQGA 4A0SA 4BMNA 1GQQA 5DN9A 4MO2A 4R1UA 3KOUA 2FZEA 3IMFA 4MOWA 1QP8A 2EP7A 1XQ6A 2HLPA 2RH8A 3TZCA 4AFNA 5CPBA 4BIIA 5CDUA 4MVJF 5L7TA 2VWGA 4OXYA 2B4TO 1VL0A 5T67A 3TPCA 3X2EA 3LT2A 4JP3A 3GVHA 3PIDA 1JW9B 3CMMA 3N7UA 4XGIA 1GL3A 2VRCA 4YYZA 1TT5B 1WMBA 4G5HA 1NAIA 1GYPA 4KQXA 2W2LA 2Y66A 4P4LA 4Q3BA 3ZHYA 3EGOA 4B3IA 2QRLA 1IZ0A 1H6AA 4NK4A 3AU8A 2P2SA 2VHWA 3O03A 5JS6A 1IYZA 5I9LA 3NDJA 3U4DA 2EKQA 2X8LA 1U2DA 9LDTA 1KETA 3PYMA 1DOHA 3ADPA 4QT0A 2H1SA 1ZK0A 2G1UA 1ZMTA 4CM1A 1A9ZA 3DTTA 5HS6A 1SC6A 1NXQA 4YACA 5GMOA 2VZ8A 3JYQA 4QUKA 3GHYA 4Z9FA 2WTBA 1UZNA 4RPGA 3WBFA 4PZDA 4JX8A 3ZNPA 1DO8A 1PJ3A 4GWGA 5L53A 1GPJA 4CMHA 5TF4A 4ALIA 4WUVA 3I4FA 2PWZA 1LDYA 4DC1A 4MIYA 3D1LA 2C2YA 3TDKA 5C3MA 1CRWG 3LC1O 3TWOA 5G0TA 3CKYA 1HRDA 2ZTUA 3PHJA 1MFZA 2FY8A 4M87A 1SB8A 1SPXA 3C7AA 4BNYA 3FWZA 2V7PA 4RPHA 2J5RA 1DRWA 1VJ0A 2Y67A 4CUKA 3WGZA 1T2DA 4NJMA 1B3RA 1PU2A 4N7RA 3AM3A 6LDHA 3OA2A 2WSBA 5I7FA 1GAEO 4B7XA 3QVXA 4Y6SA 5CAEA 5JAMA 1U3UA 2GF2A 2EF1A 2NM0A 4Z6KA 2YV1A 3GT0A 2EHDA 2Y05A 3F6YA 2YUTA 3ZWWA 1LRJA 3OJ0A 3QLJA 4HNHA 4IIUA 5ICMA 3SC4A 4DVJA 2Q2QA 1F06A 3BIOA 2DTXA 4B7CA 4G81A 4AJOA 3DWFA 3RSHA 1NR7A 1ULUA 3MJCA 1U8XX 4BO5A 1R4NA 3RUEA 1HDXA 3MOGA 1B2LA 1Q1NA 4CQMD 5IG2A 4XJSA 2GZ1A 5JY6A 4J2HA 3E9NA 4J0FA 4HY3A 4IXTA 5HS4A 1R0LA 2PZJA 3RUIA 3KXDA 1TT7A 4XRRA 5B4VA 4BL5A 3U4IA 2C2XA 1N1EA 4FFOA 1IL0A 4E5PA 4PZCA 4MIOA 3AJRA 3WWYA 3GUCA 3PZRA 4CR8A 3DAPA 1GQ2A 3ROKA 3S2IA 4AL4A 4Q9NA 1TT5A 1YBAA 3D5QA 1WLYA 2PNFA 3FPLA 4UUMA 4CMGA 5F1KA 5JYDA 4CODB 3DBVO 1IPEA 3D7LA 4ZGWA 1BXGB 1P0CA 1E92A 1BXZA 4J1NA 4TZKA 2I9PA 1E6UA 4GVLA 5TLSA 1PZHA 4BNGA 1PWXA 5KVCA 1X14A 4I9NA 1O5IA 1Y81A 2I3AA 4WASA 2VTEA 1ADBA 5AOVA 1V8BA 4HNGA 3S55A 5JCJD 4BGVA 1ZEMA 4JXKA 1MGOA 1DLIA 5IJZA 5ENVA 3ZWBA 1PZFA 2YYYA 4KUHA 4DL9A 1H9AA 2QQ5A 5DP2A 5MDHA 4UEOA 4B8WA 2O4UX 2Z5LA 4BNFA 4MKZA 3AM4A 3O38A 3ZW8A 1A71A 5T8KC 1UXJA 1Y8QB 1U3TA 5IDWA 2VUUA 1ENZA 3PWKA 2DC1A 3I1JA 1X7DA 4L74A 3K30A 2X5KO 1WW8A 3WX0A 1ZH8A 4FCCA 4GLLA 3TNLA 4E30A 5BNIA 1P1KA 3WGOA 4XA8A 2IRWA 4BO1A 4DIBA 2P4QA 4RF2A 1PEDA 3RC2A 5ILGA 2NADA 5DDIP 3JV7A 4ALJA 2EEZA 2D1YA 1UUFA 2VHVA 3OIDA 4AJPA 3VTZA 1MC4A 5TX7A 2RH4A 2OBNA 3RBXA 1G6KA 4A27A 5K0ZA 2P9CA 3E18A 1XKQA 2FRDA 4IS2A 4WOJA 4CLOB 2AMFA 2Q1SA 1DIBA 2CF6A 4CMJA 1U9JA 4YT4A 2X9VA 2HQ1A 1UP4A 3K96A 5ILOA 4BO6A 2WE7A 4PZEA 3NTRA 3TN7A 3BMQB 2X22A 2HK8A 4R54A 4WJZA 3A06A 4TKMA 5L7YA 2PZMA 2YZ7A 3VDRA 3AOEC 2QIOA 5KCZA 1TI7A 4FJ0A 3BZUA 2DU8A 4CMAA 1HWYA 3JQAB 2IDZA 3ZV6A 4YA6A 4B4WA 4CJXA 4XKJA 5EINA 4BOYA 4MVJD 3GQVA 3LT4A 5F21A 4GAEA 4BNKA 2GN6A 3HFGA 4R5MA 4ZHSA 4NG5A 3NT5A 1CEQA 4IIVA 3Q9NA 2V6BA 2WDZA 2Y1GA 5CDYA 1WWKA 3KVOA 1MFPA 4MIEA 1OMOA 2A94A 4JGBA 2AG5A 3C8MA 1O89A 4BGEA 2OOSA 1TA4A 1ZK1A 2NU6A 1UR5A 3GMSA 4MP8A 3VKVA 1BXGA 3HADA 1V6AA 1QLJA 3SLKA 1YDEA 2HUNA 4I5DA 5EQDA 4D41A 2O2SA 5A1TA 4W9NC 1WAMA 1FDWA 6ADHA 4FS3A 3IJRA 3C24A 2B35A 1GCUA 3W8EA 1PS9A 4AG3A 3GN1A 1JQBA 5EL0A 1BRMA 4Q3CA 2VZ9A 4E21A 3N58A 3F1LA 4EJ6A 1GEGA 1H9BA 2O3TA 1UAGA 1WNTA 1I30A 3TFOA 1JN0A 4YJDA 1M76A 2VCYA 3HWRA 2DUUA 1X1TA 2WD8A 4LW8A 1NPTO 5IXYA 1PS0A 5L4SA 1BMDA 2BI7A 3HN7A 5I7SA 3WGHA 1Y8QA 5A5FA 4MJLA 4TRMA 5F5LA 5CFZA 1B3BA 1WPQA 1DRUA 1B16A 2RAFA 4NBVA 4PG8A 5HM8A 4F46A 3GZNB 2P5YA 5JSFA 3MJVA 1GPDG 4GX0A 2EW2A 1E77A 3G17A 1LDMA 2O3UA 3FNGA 2GN4A 3GDFA 3GNTA 3DOJA 3BMOB 2Q50A 4WECA 4CLXA 4ZQBA 3H5NA 1B14A 2D5CA 5IDXA 4M49A 4R1NA 3P2YA 1SMKA 1C14A 2QRKA 5TJ9A 1Y9AA 4GX5A 5TIIA 1E6EA 4CLOA 2I5PO 4XQ9A 3TL3A 4NIMA 4YDRA 4NI5A 1PSDA 1H2HA 2O48X 2FP4A 4D42A 3RUFA 3B1FA 3MZ0A 3STHA 3NTOA 3JQFC 2PGLA 5EIOA 3BMQA 4WCFA 1Y7TA 1F14A 1LLUA 3RJ9A 4GH5A 1EQ2A 3NDRA 1MV8A 3JQAA 3SVTA 2G82A 3LLSA 2G5CA 4D0RA 5IF3A 1E7RA 4RLSA 1NQ5A 4HFMA 3C7DB 3JSAA 3RASA 3UXYA 4E5YA 1T1RA
chains in the Genus database with same CATH superfamily
3CO0S 4F6RA 2WU4A 1XA4A 4RETA 1VRWA 4QREA 3F97A 5FI0B 5JEEA 1QU2A 1G6Q1 2QY9A 1HDRA 2V97A 2XMRA 4OK3A 1RU3A 4XFKA 4ZU3A 4GR5A 1LSJA 1WMSA 4XIGS 5EUQB 1XD8A 4PSCA 3HU3A 1L1FA 4BRUA 1AS3A 1FW8A 1U80A 3H7AA 1DJQA 1X15A 3KQYA 5ED0A 4BO0A 2P79A 3WRWA 4Z0NA 4DV2B 4QGFA 4Q93A 5EYPA 3MOIA 4NATA 1LPSA 4OPMA 1JU4A 2A58A 3VYVA 1Z28A 2QWXA 3QLVC 5LBUA 1DCTA 1OCEA 4ND8A 1MT3A 3HWWA 2I6FA 3B12A 1EYZA 1SHJA 1XZLA 4X24A 3VPDA 5TPWB 3H2BA 4B34A 2O8EA 1CIJA 3R5JA 1M6HA 3QW4B 1N6OA 2OPBA 4DJJA 5BNTA 4K0RA 4JVOA 4PEVA 5FWYB 4UM9B 3QKRB 4M7RA 3EF1A 1IXSB 2EWWA 1FZQA 3FNRA 1XN4A 3O31A 4QVKA 1CY6A 1ZDMA 3A2KA 1QYVA 4DDMA 1MIOB 3QYJA 1QG6A 2Q3LA 4F9TA 2PV7A 3FLMA 4WLVA 4B5LA 5IFKA 1DHRA 5EZSA 5KNBA 1ZCFA 3DLIA 1OI3A 3QUCA 1XPUA 3K35A 4GYWA 4K8RB 5H80A 3Q0EA 5I9TA 4OXQA 5M34A 5FHRA 5MN6A 3FOZA 1L4BA 2D3WA 2Q4BA 4HEJA 2QTZA 4L5YA 1EKXA 4OKNA 4OH1A 5DEOA 1HEYA 3GZNA 4PLFA 5K03A 3RCBA 3NXKA 5DNWA 1NW4A 3MM4A 4QFBA 4WACA 4WKGA 1AO0A 4UKDA 3V4ZA 1L7MA 3UQZA 3SVZA 4M9RA 1U1FA 1ZXLA 2AN4A 2EG5A 4JI4B 4GZLA 1FNCA 2AE1A 3MTEA 2W71A 1YAHA 4MJXA 4WV3A 2V4MA 4EENA 1A9TA 3IOBA 3U62A 4QYMA 2WIBA 2UUOA 2ZB4A 3MUNA 4YV7A 1N8SA 1NRWA 3NNDA 2PS9A 3PNMA 4KN6A 5EHNA 4N82A 4G89A 4JH0A 4Q00A 3AKZA 1ISMA 2AJ8A 4KK4A 3ZGOA 1R0ZA 2N0SA 5A1JA 2BH2A 2ZUWA 2XLCA 1HNWB 2CB0A 1MRSA 1QH0A 1VCHA 1T3TA 4XIYA 5DX0A 4TUYA 5DN6D 4KKXB 2CVOA 2MWMA 5DWVA 5JTTA 1V96A 4ZT2A 2MOKA 1NJ2A 2ZQ5A 4FSXA 1QP0A 5DBGA 4EELA 1OFTA 1TVEA 1TADA 2IPMA 2EKLA 5JSQA 3HJNA 4AQYB 3ZGZA 4PQFA 4OLBA 2D00A 3D6FA 5GJWC 3G2JA 4LDZA 4NE7A 4NZNA 4MYUA 3HL4A 4XM2A 3AX6A 4DJAA 3OHMA 4FFRA 1EJ0A 3D2LA 2YKGA 1PS8A 4H35A 1ZL2A 3RSOA 3VSAA 1EUQA 4YBRA 2A9PA 1UKAA 1WKBA 3E4CA 4A03A 4A23A 4BKOA 5EJ9A 4CL3A 1LVHA 4GP7A 3BILA 5D3ZA 1LDNA 1YXMA 2UYYA 3IUMA 4MUNA 1FFXB 2QMZA 4YMHA 4PCLA 2PS1A 5L51A 1A9XA 3PXCX 4DM4A 1YZKA 4FK8A 1G4UR 2J3IA 3WJ1A 4LFAB 4R16A 2Y99A 2YCLA 4EYKA 3LOQA 4R1MA 1YNOA 3ZS9A 2QQGA 1YA4A 3C8HA 4QPCA 1E5VA 2NO7A 2WJYA 4LDAA 1HL7A 2D0OB 3HABA 2J5KA 3WP1B 3L4JA 1MLDA 1CVIA 1U2TA 3EW7A 1Z6AA 3G9TA 1L4KA 4A73A 5DBOA 4M7PA 3SKVA 5KNBH 4HDCA 4LZWA 1TQDA 3I2YX 1XCGB 3GRUA 4J4TA 3LJKA 4DA6A 1FRQA 4EI2A 5CB4A 3PXEA 1NI3A 4DBZA 3OFVA 2BEVA 2GHIA 2ZSUA 4PO1A 1U0HC 4IDXA 1YFZA 2XY4A 3TRJA 5I45A 4LTNA 1A96A 2E5WA 3GJ8A 2G17A 2FPGA 3HBJA 4LRYA 5CEEA 4JC5A 1UAAA 3MJEA 4CM4B 3IEVA 4NV1A 2PGOA 2X4IA 2ZSJA 3MRSA 3T9AA 1Q83A 1WS6A 2F7SA 3PFBA 2M32A 2QPLA 5L8VA 2ZJ1A 5E4FA 1LC0A 2PBZA 3S1AA 5BN5B 4C1NA 3L7AA 3D8TA 3A9TA 3K2IA 3L41A 2X8AA 3CUSA 1CS0A 2XHEA 3ZQKA 2DQKA 1T2FA 1EXDA 1W7AA 3HJFA 1J8DA 3VYWA 1T2VA 1A4XA 3K4HA 1CPYA 1U7UA 3ZWCA 3SVLA 2OCPA 2JDIA 5KTSA 1USUA 1W96A 3AM5A 1DC6A 1XN1A 5WRFA 1Z73A 3K0AA 3R76A 1NBAA 3NT2A 4JP1A 4CL0A 4EDFA 2KM1A 3K4PA 2Y27A 1I0LA 4I4CA 4L2IA 5EUCA 2CKDA 3E9CA 2EFDB 3WSWA 4BO3A 4FU0A 4TPKA 4BZQA 5FTMA 1HDIA 1OYOA 1M54A 4YMIA 1LVGA 1YZUA 1VOTA 2LKCA 1D2RA 1YSCA 3GT7A 4BJHB 5JS1A 3ROZA 3IKLA 5JVDB 3RV4A 3IKMB 2EJCA 4E70A 3GUVA 5EIAA 5C31A 1ZW6A 2WD7B 3JASA 4X95A 4EAQA 1PZXA 2Z4SA 4GI5A 4AZVA 1DXYA 2HJWA 4TXNA 1G7SA 1UJ2A 1IY1A 3WLQA 1T2EA 3JTEA 4NBKA 3AH8A 1L4GA 3TE6A 1AUXA 4X1KA 3ZU6A 1HE4A 3KT3A 221PA 4FVTA 2YVUA 3IJEB 1IN8A 1JEEA 2VJAA 4GC9A 4MLZA 4QGGA 4QYTA 5AM4A 4I50B 5GZ6A 1C1DB 3T7EA 2M6KA 4IWYA 4L5CA 3TTTA 1EIWA 5KEIA 2RI6A 1HYGA 3TH5A 1IEVA 4NH4A 4BECA 2IZZA 4F2PA 3AOEA 3WGLA 4YIKA 5EXPA 5TARA 2PL3A 2P7IA 3IVGA 5KSOA 2GPWA 4HAXA 2VPXA 4G5RA 4J7XA 5CG1A 1AM4D 1D03A 2PJZA 1NDQA 3E3OA 3G2QA 1GTRA 5H0IA 3JYOA 3A9WA 4AY5A 5FO1A 1SHKA 4TYMA 2VIIA 1W9HA 3RU3A 2QM0A 1Z88A 4BQEA 2A59A 2QX6A 3K8ZA 1IOLA 1L5VA 1GTG1 4LDRA 4IKPA 4MLPA 2EGUA 5BSFA 2J07A 1CUXA 2BCEA 1D9XA 2YQ5A 3VISA 2ZTSA 4ZMSA 4H0NA 3EGXB 1C29B 3CBGA 1ZAKA 3ZV5A 4P4NA 5AM0A 3MCUA 4R05A 1RLJA 1E1DA 2CCKA 5C34B 1E3TA 3GFBA 4J0IA 4W9NA 4XD2A 4YAWA 5A7GA 3W2FA 3W90A 4C0KA 1IHPA 3DR3A 4DLVA 2W8ZA 4PPFA 4JLMA 4U6SA 3M6UA 4YECA 5IJ9B 1R8QA 1OWPA 2GZ3A 5DNVA 2WG1A 1P3Y1 4FQ7A 1KI1A 3UGJA 4IIBA 3BCUA 3B3JA 1TU3A 3NHFA 4PCUA 5HYVA 2Y1FA 3A9UA 4P7FA 4MQ6A 4WNAA 2K7ZA 4OI2A 4U7GA 2YY6A 3JWGA 1G1AA 4YRLA 5JSZB 3EODA 5E1DA 2HV9A 3U7QB 3HCPA 1BGXT 2RBKA 4JBNA 3GVPA 4MYSA 4AJLA 3HCRA 4DXHA 3HXPA 1K3UB 2G1AA 1FNMA 1RRPA 4DQXA 1NYQA 3NHMA 3CSUA 4KC0A 1DFGA 2GPBA 1SUAA 5KINB 2IIBA 5TMPA 5KS2A 4FP9A 5JMWA 4D4MA 1U7TA 4UXJA 1RAIA 4C7KA 4CF7A 2Z8XA 3LOPA 4IFIA 3MCTA 3OQMA 4BNMA 4GUAA 5A0VA 1W0CA 2JIDA 2CXXA 3P71T 4QECA 4D5GA 3DZCA 5TDHA 3V80A 1GFSA 4AW9A 5HSGA 3OEED 1YL5A 5BRNA 1R3UA 2QGZA 2RD2A 4ARCA 4EKYA 1NW5A 4WESA 5EZYB 3GW8A 3VNSA 2XMSA 2YNMD 2V58A 2YVAA 3S2GA 4HAWA 1KYXA 3AI3A 4R3NA 3UEOA 1Z4LA 3OOJA 4RA6B 4MUEA 3THOA 4JOSA 1HTBA 1BHQ1 4B76A 1GUYA 3DZKA 3D6AA 1H3EA 2GOYA 2ODPA 2QLFA 4Q4AB 4BN5A 4D26A 4JY7A 1ZD4A 2RH9B 3VR3A 2KLBA 4DA0A 1L1QA 4FOSA 4I4TA 1AC5A 1MOZA 2KS6A 1RMYA 3LU1A 3R20A 4C5BA 4CKBB 2JFQA 4CIYA 2FH5B 3BCHA 4AZSA 4FX5A 2E82A 3HUUA 5TT0A 4QGHA 1S8NA 3RIYA 3VZPA 2GN0A 1DRKA 3GRRA 3OPVA 1NOKA 4MO9A 4NV0A 5F9HA 4AO8A 2R7AA 2O2IA 4L57A 1L8AA 3NBMA 3CW9A 1BS1A 2NMVA 2O1XA 1WSDA 1RYDA 3DNPA 3KXLA 4YRSA 2G7ZA 1QV6A 4GOMD 4WA7A 1U0GA 3TS1A 5AVXA 5HOEA 4FJ1A 5BW6B 3UOWA 5JJBA 1E2EA 2OP1A 5KWVA 4KNYA 3DXXA 1PAUA 4JA0A 4PYKA 1RJDA 1WJGA 3TEJA 3DO8A 3M7IA 1OLXA 4BWVA 4JYAB 4KQHA 1M2OB 3IV7A 3KOWA 3Q3CA 4PAGA 4BVHA 2VDNB 3NFYA 4ZYXA 5LP6F 3AY3A 4BEBA 1LSUA 4JLWA 3ODPA 4FKBA 4UBIA 1IRXA 4OHPA 2WSMA 3LKVA 3U3KA 3CE9A 2KSQA 3ILXA 2APJA 3KHSA 2JG3A 1GQSA 1RM3A 3B3AA 5E2IA 5LYYA 4PQYA 4YQFA 5HKKA 1HDOA 2R00A 4ZZIA 4NXNB 2O8BA 5AKLA 1P1CA 2GNPA 1ITZA 1TC2A 2WAOA 5KVAA 2ZZMA 1OIVA 4V1CI 1OJ7A 4Z86A 1E7SA 1ISSA 5D7BA 2QE7D 4JKYA 1AMOA 1WKVA 4O2BA 1U2GC 1Z5NA 3M34A 1TUIA 4C0AC 2VDLB 3S2EA 3WBBA 5AVWA 1FA9A 1PK9A 2CUKA 2FXVA 3AGQA 1BX0A 3EY9A 4GIBA 5DXJA 3TR6A 4B32A 3O82A 5IAJA 2I7DA 1BU8A 3U3ZA 3KQHA 5DYWA 1X7WA 1YA6A 3GV0A 1YS1X 2QN7A 1DCKA 1UH5A 4FWIB 4EM6A 3GFGA 4YPFA 2YN2A 5IW8A 5AUOB 1P33A 4ZT7A 5EHXA 5JVDF 3V8BA 4XGKA 1JJVA 3CLUC 1F9AA 2FN3A 3NTVA 3WTCA 2Q1WA 3C8DA 4B7AA 3UPDA 4H1WA 4Q9IA 5KNCA 3DO5A 1SUEA 2GF0A 4UEWA 1V1JA 1UXOA 1W5SA 4PBRA 3A11A 4XQGA 4YT8A 4AKTA 1M7GA 2HHHB 1EB9A 4RFVA 3VX3A 1GTVA 2CDAA 1ORRA 3OCYA 4QRDA 3MJFA 1FYDA 1GT91 4FYJA 2CFOA 2DQ4A 4R84A 3FVWA 2QXTA 1I1HA 4OUDB 3IO3A 1Q20A 2GJ4A 2P9TA 2ZJFA 3LWZA 4IEIA 1JKXA 4B09A 3RIEA 2ISQA 5EP1A 2QTGA 4JJGA 4YCDA 5HF6A 2NUTA 5IEJA 2TECE 5KNDD 1G0OA 2CZGA 4BNNA 2CDRA 2CE2X 4TLBA 4YWJA 3CN7A 2VQ3A 4PLZA 3QVGA 4HB4A 3ONDA 3IIIA 3FGZA 2O2XA 1F0YA 4DG8A 3F7TA 4F86A 4GR9A 4LYAA 3NT4A 5DHSA 4LNAA 1MA3A 3HCDA 1RWVA 3NRBA 1G8MA 4E7OA 4EMTA 2ACKA 2X1HA 2XZPA 1IWOA 1ZI9A 2JFBA 2QXUA 3FR7A 3RYFB 1EVYA 2H85A 1M67A 2G80A 3Q7QA 4MV7A 1U5CA 4NBTA 4C01A 3CG4A 4DCOA 1KR2A 1E3DA 4HPJB 4ENPA 2ZVJA 3R5XA 5JMPA 2GPNA 4DA9A 2YZKA 1H69A 3KJIA 3KO8A 3F49S 4WAUA 3B38A 5DYTA 2QZJA 1CZHA 1EA5A 2GM5A 4GWLA 4U0KA 3P2OA 2FEOA 4HZIA 2J3DA 4MGEA 4Y3UA 3YASA 2IT1A 3DVSX 5LB2A 4F12A 1JXOA 1WSWA 1QBGA 2C61A 1NG1A 1R6TA 3S5JA 2XAUA 1G8KA 3T52A 1M1UA 3ZVRA 2LIPA 1KEVA 521PA 3ORFA 1UCFA 1KVSA 1XG5A 2EQBA 4J6FA 4W63A 1UT5A 4L5JA 2R6DA 4OI4A 4YRBA 3WWPA 3L5OA 4QPPA 4J4HA 3SJUA 2V0GA 3QVLA 1HFEL 2VSQA 2BH9A 2HDHA 3O94A 3HO6A 2EBWA 3O95A 2DPGA 4LV6A 5FL7A 2XB2A 2DBVO 1CQJB 1KIMA 3CZ4A 2V96A 5LQNA 2ONYA 3R5HA 4MGHA 4Q1VA 4J1GA 3MYYA 4HGQA 5FUXA 3OM8A 1XYVA 4EITA 2C58A 1XHLA 4A5OA 3PE3A 3N6XA 5A05A 4XQCA 1H93A 3E9ZA 1K6XA 4AQDA 4BLQA 4OL9A 5LXTB 3GLGA 3DE4X 5H82A 2ZJBA 1H2FA 3KLBA 2D0PB 2FR8C 1YRBA 4IVNA 5AW6A 1PR2A 3RS5A 3DAGA 5KTOA 1CQIA 1DRJA 4J16C 1KY5A 5FWNA 1XTKA 2FSUA 3TR0A 3KT0A 1E2LA 3RRFA 3RSLA 4U7HA 3SBEA 4Z7OB 4IDUA 1Z83A 2F17A 2UAGA 2X41A 3PS9A 1MV5A 1OY1A 2XT6A 5DBEX 5F5NA 5IS2A 1K7EB 5FI3A 5ARBA 2O0JA 3H2ZA 2ZPUA 2IIPA 5ITZB 1AX9A 2UDPA 1EDZA 3L6RA 2PCLA 3T41A 4BEVA 3DDOA 2Q4DA 4QFCA 1UJCA 4X6XA 3FDZB 4PGHA 2ZCJA 3E23A 1P39A 3B5IA 2IQIA 3M4YA 2Q7DA 3T1OA 1ZVQA 3V8NA 1FTGA 4F4JA 2PKCA 2VDOB 1M1YB 2QSYA 4DREA 1KK3A 6AT1A 621PA 2VFAA 4HNAB 4V2IA 1FQOA 5CCXA 4OGFA 5AI4A 2ZANA 5BXYA 4MDHA 2XRMA 1V6SA 3DOIA 1Q6YA 3K0HA 3LLMA 4N3AA 5DM1A 3RABA 4X3CA 2OC4A 1EFCA 1Z6ZA 4IIXA 1XAJA 2AGVA 5IAGA 3LY7A 5C8YF 4G5OA 1M6VA 4ZDWA 3ZCXA 4F9FA 3PG5A 5IWAB 1E79D 1KO8A 1NP7A 3LUKA 3PD1A 1FVXA 4F4UA 1NN0A 3MF4A 3EC2A 4JSYA 3E9DA 3KJFA 1XYYA 2AFIE 2HN9A 4R8VA 3RJ5A 5BW4A 1SOWA 2HM7A 4CEJA 4GX2A 1AN0A 3ELWA 3OJOA 1S2LA 3F2IA 4ARIA 3MAJA 1W1WA 2JLRA 2TS1A 4ER3A 4RDIA 3I37X 4DPKA 5CW2A 2VDWA 3T7TA 5BOSB 1SCKA 5REQA 3TXAA 1FFAA 4FUQA 2LW7A 4B74A 1IVYA 4C5AA 1HTWA 3BTVA 4JX9A 4LJ6A 3BM5A 3SBOA 1V8OA 2IODA 4MW6A 2RK3A 2IXEA 4A0HA 4NONA 3OBIA 3DDWA 3EZ6A 4X97A 5HZMA 3CHYA 4F1KA 2R4TA 3PYXA 4M37A 4DADA 2RHWA 1R9NA 5KDDA 3AW9A 3RI3A 1QC5B 1QWSA 1JX6A 2XQVA 5CA0B 3DVAA 1GRVA 2QX4A 2UVPB 2VP6A 3TLGB 4RMGA 1XDGA 3ZQ4A 1Z5WA 1A2QA 1V2HE 1WOMA 3AKYA 3IERA 4P3NA 4GDMA 1O97D 3QY0A 1XO1A 1Z35A 1X87A 3PCRB 1PNVA 4GMXA 4PYJA 3NAZA 3MXTA 2F3SA 3C5CA 3NW9A 5CFQA 3SDBA 4Q24A 2QENA 3HZRA 1T1SA 3M89A 4I3HA 3L6EA 1IULA 1D0SA 2FF5A 2ZUBA 4FEGA 2DHDA 4MHSA 4QXMA 1R0CA 1P1JA 2AE2A 3RVQA 5C51B 1WIWA 3JVIA 5C46F 3KKOA 4B75A 2OV4A 4ZYTA 3Q0IA 4ZOEA 1M1ZA 2EBHX 4TGLA 1TIBA 3DT6A 3AF6A 4LFBB 2D1FA 5EMJA 4HGZA 3C3PA 3RJTA 1E3QA 3TD9A 1JFFA 4Z7JA 2J0UB 3HPRA 4BMVA 5M5BA 4NFYA 4TMYA 4X84A 2P2GA 1ZL0A 3P4YA 4Y2UA 4BKQA 3F9IA 1JYFA 1YDWA 3IP5A 1IE3A 4ODIA 2Z08A 4LPSA 4QHTA 4Q1DA 3V2GA 4ZRDA 2ZUEA 1EFPA 3JD2A 1T6YA 4GEKA 3HEBA 3PHHA 4QGAA 1M5TA 1E1RD 1DINA 2G8LA 2HWKA 4OQPA 2WJHA 5JASA 5KYGA 5D87A 5DWDA 1H6DA 1RLUA 3VJLA 3OU7A 1UBGA 3I1FA 2XWJI 4TTVA 3WRYC 3HCAA 2XB6A 4F8EA 3ENKA 4DMUB 2JD2A 4TKUB 3TTSA 1CSEE 1D6JA 1IY2A 4G2NA 5LFAA 1R4MB 4IG4A 4TMFA 1U0LA 1VPLA 4P1ZA 5CPFA 1KEEA 4KBFA 4RIIA 3M2PA 4OM8A 1DKNA 3IAM1 1TEXA 5LR6A 1XDWA 3REQA 4QUBA 4GO1A 2P9YA 2Y1XA 4ZVPA 4IUDS 5JNWA 2C9OA 5K9ZA 4EI8A 4E2WA 2WC1A 1XROA 1JR3D 1WUIS 2JIQA 3SZLA 3VYTB 3INGA 2HK7A 3ZHTA 3C85A 3U1VA 3AEKB 5JFGA 4L22A 3SQOA 4OMDA 4D9CA 2O3JA 2O1SA 2WVJA 2VRWA 3ZHXA 4YUAA 1E2UA 3GDGA 4YCMA 1V25A 3IDQA 1OC4A 1ZC4A 1D4ZA 1KYWA 3QEMB 2ZQZA 1U9CA 2P2YA 2RB5A 3HXLA 4CE6A 3OKCA 4U7PB 3EVGA 5DM0A 1VYTA 2PEZA 3ACBA 2B0JA 1F6DA 2M6SA 4OIFA 4ESVA 4FBGA 2NYUA 1CUFA 2C94A 1RBQA 2L18A 4KGZA 1Q1QA 4G1CA 4KP7A 4OYYA 4HWPA 1LJ8A 1UMDB 5DM60 5B4UA 4OX9B 4WK6A 3W5IA 5IU6A 1XTSA 2PH3A 3T7CA 2QJOA 3IS3A 2GDZA 3ITKA 4GOKA 1T3ZA 5CMLA 3GLFB 2R8YA 3GFQA 2IS6A 1GZ6A 3PNOA 5F3DA 1WMEA 2FZGA 2XMQA 4HQFA 1BH6A 4M6WB 1FL9A 2ZU0C 4BFUA 4Y6GB 4M1EA 3JQ8B 2XMCA 3FMGA 1RT9A 3ZDFA 4LJ9A 1D2EA 3SC2A 2QRNA 4FLFA 2HJHA 3PQFA 5JHGB 3K0FA 3W9YA 3CU5A 4B4VA 1G2QA 3KYCA 1GDHA 1SA0A 2ODNA 3MW8A 2VJPA 4XJVA 4XWYA 3P96A 4XX0B 5SV2A 3F0TA 2V59A 4L9WA 4Q3AA 1U3VA 3OO0A 5E7JA 3WL5A 5E9JA 5EXEA 1GSAA 1K89A 2VWQA 4FN5A 4N8SA 2IBSA 1YB1A 2XA1A 2PRIA 1PJQA 3ET5A 2PZBA 3HJTA 2X76A 4FUTA 4JN6B 5MGBA 5LQJA 1SHZA 2B25A 3NP7A 1P8AA 2CE7A 5G3YA 4B4KA 3TYXA 2JCSA 3EXIB 3KZCA 3ONEA 4BP8A 1E2IA 1UMBA 1P2BA 2GBFA 3LO8A 1JG1A 3VR6A 4HDOB 3NH9A 2F8MA 2BKLA 2PYIA 4TRJA 1H5NA 4YRRA 3SQDA 2ZS7A 4IXWA 4NKRA 4KLNA 4MRPA 3WFZA 2D4AA 3AUAA 4AZWA 4XGNA 3BE6A 1Y3AA 1QIHA 3QE9Y 1XCLA 1XD2B 5D51S 2NSLA 4TSFA 2CYAA 2ZBUA 3IOEA 2NZVG 1ZRMA 4GD3Q 2Z8YM 1QONA 1TL7C 1VBFA 2CHUA 1ZXXA 3MWDA 3VV3A 2R7MA 3KIPA 1KRHA 5K3DA 3TW0A 1T36B 3FNBA 4WKOA 4CF4A 2YDYA 4MA0A 2BM1A 1W4LA 2H4XA 3BJRA 2XB9A 4X20B 4JI5B 5C8ZA 4QUAA 5KJ6A 1FU4A 2BM9A 3L4BC 4AWAA 1IPFA 3FLBA 3H5TA 3K16A 1H42A 2RKBA 4J0DA 2C0CA 3S29A 2IPOA 2L19A 2VQ6A 3ZQJA 5DMHA 3VDNB 3TW6A 3IAEA 3RSGA 4C08A 3DFKA 3T5GA 2AD5A 2F4NA 3HNRA 8LDHA 3IRUA 2HR1A 5T3YA 4DYDA 1L7AA 1SULA 2MSWA 1MABA 1PGJA 1BQEA 4ZI7A 1ISJA 1ZJWA 3OI7A 4H3SA 1NVWQ 2JBHA 3FNIA 1CZUA 1QQ6A 1JTFA 2P65A 2FOIA 1CERA 3PC3A 4Z4IA 1A72A 1QB8A 1VLQA 1LEHA 5A3VA 4CG1A 4B6GA 1CU1A 1WU8A 3KSMA 2PT7A 3LXRA 2AMLA 3OE1A 4FHFA 1UEIA 3N8KA 1D2NA 4NYMR 3C4JA 3T5MA 1V7CA 2A5GA 4HBGA 4K6CA 1PR9A 4A92A 1TKRA 2R8XA 4TTAA 4ZEVA 1W59A 1VHWA 1YZTA 3ZHZA 2HQBA 4TTIA 3D59A 1EM8B 3ZHRA 4C0BA 4D3ZA 1Z17A 5JJKA 4B40A 1RJFA 5JH7B 5J40A 3M1AA 4POOA 5KTKA 2WIGA 3BTSA 3IP9A 1YZLA 3OPMA 4G1FA 4NNJA 3RKSA 4DLSA 3LWNA 4HDAA 3FLAA 4HH4A 5CBPA 2G25A 2P4UA 1TTHA 3IIJA 2V9CA 2J48A 3NBKA 3HV0A 1G20B 1E58A 5H3CA 7REQB 2MSKA 1P5ZB 3KU4A 2YWEA 4NFHA 1KHTA 4UVIA 5ESWA 4B3RB 4D74A 1Y4ZA 2CCJA 4PIVA 1DKRA 4Z7NB 2ZRIA 3PJFA 4KG7A 2E0IA 4HFJA 4KVAA 4RTNA 5AW9A 1LPBB 4OAQA 1XXLA 5I9SA 3ORSA 5I3ZA 1XDBA 1DWQA 3WMGA 4CV0A 2P5SA 5I9NA 2W4IA 4G25A 1YUBA 4ZO7A 1ZCBA 1UM9B 2RBGA 4LYFA 5LKAA 3VR6H 2BTEA 3O2JA 2XCSB 2UV8A 4MW1A 2INGX 4U2KA 5DBHX 1ZOSA 1EUYA 1BW9A 1LPMA 4GZ6A 4RVOA 1GEEA 1GAXA 4BGUA 2DFNA 4DMMA 1SELA 1E7MA 3G9ZA 1JAHA 3O1HB 4Z9AA 1NBMA 8AT1A 4RV4A 4FD2A 1NVEA 1J90A 3MC1A 5SYMA 4BBPA 4LHEA 3Q98A 4YT5A 4G5YA 2R47A 2ZIZA 3MFYA 3I6BA 3SD7A 3TIGA 1IVSA 2WV7A 3HCEA 2FR0A 3QELB 3PNLA 3UQYS 3LPDA 3BG5A 4CT4B 1M2KA 1XK6A 1RLMA 1V11A 2OAP1 2ZBPA 3MLBA 4PRZA 2D7DA 5JUWA 3QE4A 1BKDR 1MJNA 2XEXA 1N3YA 3Q7SA 4R68A 5DW3A 4X6LA 5EZ6B 3TAHA 3VNQA 4BB6A 2ZUCA 2HPHA 4ZYYA 5IDVA 5FV4A 3O9ZA 3Q85A 2P9BA 3DXFA 2WA1A 3P9RA 4WXRA 1B7GO 4LZZA 5DZSA 3ITNA 3HP1A 4PG5A 2QL5A 3QOXA 1FTSA 2HGZA 5FIUA 3HUTA 3DYIA 4OL0A 3TOZA 1KRXA 1XXHA 1PWYE 3OQPA 3OURA 4K28A 2ZRPA 3FOBA 5F2OA 5H81A 1GXSA 2QL7A 4TLMB 3MELA 5JAQA 1JIJA 5MFPA 3FUCA 1M2JA 2NZYA 4CCYA 1PVOA 4MRNA 3RC7A 4Y2GA 4XUCA 3N9IA 1E18A 3U4AA 3AR3A 2VQEB 1CZOA 2X23A 4TWJA 4BV3A 4L08A 2GSDA 2DKOA 2CLSA 1OBHA 3AHGA 5CURA 4P22A 2F4VB 4QC2A 4WZAA 3NO4A 2HYDA 1B8PA 1V26A 1GU7A 2OO5A 3LVBA 3KE8A 4XJTA 2VDUE 1Q7RA 1N2SA 3NQ41 3U4GA 5C1PA 3BT7A 2ZTLA 7MDHA 3THWB 3RYCB 2AJBA 2WHYA 2BFAA 4QVGA 2C98A 3ITEA 4LFCB 3OU6A 3ZZNA 4YRAA 1MB2A 3L49A 3EYWA 3PNSA 2Y2UA 3BWVA 2KWIA 1MTOA 4H16A 5ALYA 3RO7A 3BWYA 3USZA 4ARVA 4KR3A 2PD6A 2QYTA 2QUBA 3RYHB 5KHLB 5ALZA 1C2TA 4H1UA 2P0AA 2BFCB 3D7RA 4KIWA 3T3IA 1LUAA 1XCBA 1XJCA 2JAUA 3UV6A 4A16A 4F21A 3UJ7A 4EFLA 3BX1A 1JVBA 1Y3FE 4AJJA 1KKLA 3ZK9A 3H2YA 3A36A 4KLCA 3LDHA 3I9KA 1BYUA 4MVJA 3QBVA 1I7NA 1R66A 1QHYA 2LDBA 1TJPB 3KHUA 3RBVA 1TFUA 4JB0A 1PX2A 2OCLA 1NKSA 1VI6A 5J2TB 4CEHB 2Q3FA 1BG6A 1ZD9A 3FBGA 1UDCA 2BSQA 4LZNA 4TV9B 3TLBA 4L0MA 2X2OA 4RVSA 1LK0A 4CLRB 1R0RE 1CTQA 4TYWA 3ADKA 2O50A 1TJ3A 1W52X 1W8DA 4CM8B 4BMCA 3L7MA 3CVUA 2OLEA 2YIJA 3QX7A 1GNPA 3GLQA 4L0DA 2YS7A 1AA9A 1HG0A 1U3CA 3A1EA 4WTOA 4UASA 4EQ6A 1P7CA 2ZBRA 1OWMA 3N53A 3ZEIA 1RKBA 4JEUA 3AY0A 4ETIA 1T25A 1VFNA 4Y2TA 1I2CA 1NE7A 2PWPA 1ONOA 3Q9SA 4PFKA 3OBBA 1MZPA 3V3KA 1BXRA 2GXQA 3O4FA 4FSHA 5FUMA 3F9CA 3I52A 4Y2JA 5DHPA 4I2VA 2JHFA 2Q45A 1FNDA 4IS3A 3BS4A 4W6QA 4DLNA 3N86A 3WQQA 1WUJS 4N65A 4QLAA 1ADFA 5LA6A 3VZCA 3WNDA 4A6EA 1CRLA 2C8KA 5LKRA 1U81A 4U7FA 2GR9A 5DCYA 2X6RA 3ZU4A 1CNEA 4AJ2A 2QX9A 5BQ3A 3O4JA 4B3CA 4Y6PA 2O8DB 2PRZA 1HSOA 1U1IA 4UUOA 4OAPA 1XNGA 1RZ3A 1S9DA 2VP2A 4Z7QB 4WDRA 3WB9A 2I03A 5DHAA 2CV2A 3JQAD 4CHTA 2HLNA 4QSMA 3F8WA 2W83A 4FX2A 5JATA 3OWXA 1EGMB 2X0JA 1W44A 1XEFA 3F96A 4BPRA 2OPHA 3T5TA 2I66A 4ZWNA 1JPJA 5BUQA 3AG5A 1FNNA 2NQ2C 1I5OA 1Q57A 3PRJA 4IDNA 4KZPA 1V0JA 4OP3A 2QN2A 5DCUA 4M9UA 5DP1A 4PZ0A 3UA3A 4KBGA 5AI5A 4AMUA 4HYQA 1SPBS 3LY8A 3W5BA 2KMLA 2JFVA 3TBFA 1Z06A 2FB9A 2P9QA 1HSZA 2K2WA 2YBDA 4NEQA 1ISPA 4TT3A 5A3JA 3FUUA 1HLPA 2X4GA 3B36A 3G2PA 3GOHA 2JLSA 4JOCA 4QOJA 3T1QA 4HLUC 4F6CA 1E3WA 1FQJA 3PNQA 4WNCA 3ETLA 3KZKA 5CM9C 2QLTA 4DTIA 3NHLA 5JH7F 1NNUA 5AW3A 5D5PA 3CC8A 2AK3A 4HWTA 5K45A 2NZ8A 1Q11A 5CH5A 4X5OA 4MXDA 4E1BA 3ZV3A 2W0SA 3LZDA 4GUDA 3EUWA 1ZX1A 4CDGA 3I5XA 2XCTB 1VJDA 3ND9A 4MVJH 4NDNE 4YK7A 2BYTA 5IJXA 1Y3DE 4HF7A 3FPKA 1T8WA 3EZGA 3MJTA 4M8IA 2IPAB 1KMHB 3ET4A 2Y3IA 2WILA 3FUWA 3LUDA 3AUUA 2QLNA 3D4LA 4CI9A 2D54A 4GE3A 4EJ0A 4KIUA 1H2AS 1J9ZA 1G6HA 3OJWA 1ECPA 1WW3A 1HDYA 2PZAA 2QUKA 3GNLA 5L3ZA 1UODA 1IY9A 5JHHB 4JP5A 3DE5X 1IN1A 2YV4A 1SUWA 1RE0A 3KE9A 2R2AA 4KODA 2H1OA 2ZREA 1JDSA 2UUPA 4RF3A 2GZHA 1N75A 5IJ0B 3COSA 1LW7A 3BEDA 4D98A 3EXHA 4M1OA 4E2FA 2BBOA 4KHPB 2JAHA 4KE9A 4E3WA 2I87A 1YQUA 3WWCA 2H48A 1CY2A 1ESCA 4TTJA 3DPIA 3HRHA 1WP4A 1EK1A 2OWDA 3KUDA 3Q7RA 4CR7A 1G9TA 5IM4F 1E9CA 4UM5A 4A36A 1LV7A 3SR3A 4FPXA 3GC6A 2OZKA 3OX4A 5AW2A 2SHKA 3FYDA 1FSGA 3HSYA 3MRTA 5H3HA 4NLLA 1OGJA 4PLGA 5ADWA 1NG9A 1JQEA 4F97A 2WAAA 3DZDA 5AHOA 2HBYA 5LLSA 1RM0A 2AZDA 1AQNA 4DDHA 1NTOA 3DC7A 4OAOA 5HCUA 3P9CA 3HFSA 3R7FA 4CRWB 3CS3A 4PO8A 5TQ2B 2AOVA 1UBCA 3Q2IA 2JFXA 3D3KA 2ZYWX 5DT2A 5BRJA 4OGKA 1DKUA 3N2ZB 3PFFA 1V9LA 4C6TA 4ML3A 2ETXA 5ICSA 1RBZA 2QTNA 4OATA 3RHSA 1PBTA 4LBZA 3ENNA 5IKOA 2RGBA 3U09A 4NMWA 4UOQA 1Y8AA 2X4DA 3DC2A 4LZJA 4BO9A 2EOAA 2C82A 2AHOA 2AB0A 2PSFA 4INAA 4YUYA 1T9HA 3I8SA 3SNKA 2C2OA 1FSFA 3X1MA 3TBHA 1NW3A 4H6PA 5HM6A 1K2VN 3KJGA 2B69A 2JFPA 4DJ5X 2E4VA 1MJGM 3GGPA 2R5FA 3I9MA 4E0BA 4WI1A 1MAUA 4YMGA 1I2DA 1ESEA 2N1MA 2VS1A 2ZUUA 3Q7IA 4P38A 1U2EA 3AHHA 3QE0A 1K5DA 2GESA 4V0ME 5K8VA 4LHVA 3R9XA 3I9V1 4HLNA 4R2MA 4DV7B 1D0VA 3R3ZA 3RFXA 5K99A 1KL7A 1P77A 3E8SA 3EEBA 4DV1B 3OHSX 1U3DA 1ZVKA 1UKEA 5IAEA 3HVHA 6GPBA 3ZHBA 2K7FA 2JL1A 2VPZA 2WK1A 4I5EA 5JQGB 3F5FA 2OHXA 2ZOSA 5CBKA 4IHAA 5DN6A 2IVZA 5JDIC 1NUHA 4E51A 1K4MA 1I8TA 3WLPA 4C3OB 3EXG2 1BS2A 2XXBA 3D5TA 4X7BA 3WK5A 2GYVA 4F06A 2DLCX 1A8QA 3MSXA 2CCGA 2IYZA 2R79A 1HC7A 5EP2A 5G40A 2I34A 2H2AA 1UP6A 1RJEA 2FKNA 2GERA 3M3DA 3VHXB 2ZIXB 5BSGA 3AM1A 4BNLA 1TGVA 3OFSA 4N9QA 7ADHA 2R8EA 2AQ8A 3QGMA 5BN1A 2AL7A 5ADHA 4N76A 1J7JA 3Q2KA 2WOJA 1SCUA 1J70A 3VGJA 3TX2A 4QU9A 2BKXA 1NX9A 1ZK2A 2V45A 4H7FA 4PRKA 3CSDA 2XZTA 1YZGA 2PM8A 2ZPAA 3PQ6A 4UBJA 2X7JA 1NMXA 3WKAA 2HT1A 3K70B 4EYSA 4EA8A 3F6EX 1DUIA 2R6HA 3WWOA 3EMKA 9ABPA 3NHUA 5AI8A 2IX3A 1MF7A 1M2GA 2XMPA 4D96A 2V6IA 3WL8A 3B1XA 3ER8A 2O07A 3WFIA 3UVEA 3GELA 4U8GA 2W43A 4UQPA 1T8PA 1O87A 4H7PA 1S3GA 3GWZA 2EZUA 1K7FB 3H83A 3QKUA 3CXUA 3KYBA 1TUBA 2XOXA 3LQRA 2ASVA 4ROSA 4F8YA 5FHQA 4JI1B 2Z8ZA 3IUJA 4BLRA 1J25A 3AF0A 1ZIPA 1XTPA 1AMUA 4ZOCA 2CFTA 2X3YA 1NJ8A 4ZXPA 5A03A 1QDLB 3LX6A 3SMVA 2X0KA 3DKVA 1BDBA 1CY7A 4D8TA 4KMRA 2FDCA 1FVHA 2R86A 4URUR 3K2QA 4PN7A 1VYHA 2WPDD 3WLRA 3DDUA 3MERA 3H9CA 1ENYA 4P5DA 4UHDA 3DNFA 1N7HA 1RCUA 1T0UA 3NS7A 1PIWA 2Z9DA 2BHLA 2XITA 2R11A 3R9WA 4EX6A 5EIWA 2O5RA 2IWHA 1YTLA 3OJFA 3EN0A 4MV3A 4CV3A 4URWR 1V8FA 2BJWA 5TE9A 2C04A 1YMQA 2YX1A 1JH9A 5TMBA 1C8BA 4D9EA 2BJHA 4ZVLA 3FRIA 3OCWA 2ZBEA 1RRGA 2XA2A 1P80A 1JHZA 3H42B 3ICCA 2PNJA 1B8UA 4JUAA 5I8PA 3RHFA 1ZVMA 3ZE0B 1KGSA 3NB0A 4O6VA 1TEVA 2OLKA 1OFVA 1SEPA 2HNKA 3GR6A 1YL6A 3PPVA 4TTPA 4DPMA 5KYXB 5B1EA 1TZJA 5D7NA 4HZUB 3HO1A 3E03A 1PF7E 1XEAA 2VT7A 3D4NA 4M1YA 4IX9A 3MWEA 1M9NA 4UJ5A 3ZJYA 4RTPA 3PEWA 3A6FA 5J5CA 3V1YA 3V8QA 2WTAA 3HUEA 2VUSA 3LV8A 2P2DA 4KQ1A 3N5CA 4ZCSA 1S5PA 4TMXA 1A1VA 1LFAA 4KPFC 4DCUA 4FMCF 5JRZA 1DG9A 2C59A 1Z4IA 2HEIA 1YRLA 1RZUA 3R24A 4TS4A 3B3FA 4Y1RA 4AJ9A 4JHLA 1VIYA 4JCCA 3H2HA 1JVSA 1ULHA 2Q1UA 1UC4B 2OECA 1L6RA 4XLLA 5F2EA 3R7AA 3LCVB 2UYGA 1QO0D 1WY7A 4FC6A 4BNVA 4E03A 1M7HA 4HGOA 1NTRA 3OA0A 1RABA 2NVWA 2ODWA 3PGXA 4XM1A 4E13A 3E5HA 6REQA 4I99A 1DBWA 4A0GA 5FWDA 4JP8A 4MW7A 1AV6A 3L6CA 3P0FA 3QVOA 1W73A 5ALOA 3OQBA 1W5BA 2R1VA 3C43A 2B99A 2EC5A 4RK1A 4YJ3B 3ELDA 3PUYA 2GJ9A 3GJ5A 4M98A 1ODTC 2Z04A 5LL6P 1NONA 1WHTB 4H7IA 4IDDA 3V7YA 4XUGB 1BN6A 2WLTA 4PG6A 4P84A 3HNPA 3O8QB 4RIGA 4XTCS 3QOFA 1RKVA 3KYIB 3VTAA 1IIBA 4NK5A 2XGJA 3GHHA 1NR1A 3ZN2A 2OESA 2FMIA 1NJ1A 4YO8A 1PEAA 2AR7A 4LDNA 1WHSA 3BH7A 3EJ6A 5LMCA 1YACA 2PL5A 3OO1A 2R8BA