4TWRA

Structure of udp-glucose 4-epimerase from brucella abortus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
325
structure length
325
Chain Sequence
ANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAVRWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSLLDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVAYGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPDGTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSVPVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords NAD binding site:NAD-dependent epimerase/dehydratase:UDP-glu
publication title Structure of UDP-glucose 4-epimerase from Brucella melitensis
rcsb
source organism Brucella abortus
total genus 112
structure length 325
sequence length 325
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4twrA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4twrA02
3C8MA 5F3RA 1IULA 1JKJA 4L75A 3TDKA 1A4IA 5COAA 3DZJA 4GGOA 4GPD1 3LK7A 5KVVA 1PZHA 3SJ7A 2X9NA 3WIDA 5L4SA 1Y8QB 1OC2A 1Q7BA 4JJFA 4CUJA 2Q2WA 4IDDA 4ZQGA 4M49A 1NM5A 2YHIB 4RJTA 5I9NA 3EVTA 3A14A 1Q0QA 4GL4A 1F06A 1WDMA 4PLZA 3RUFA 2XPCA 2J3KA 3QWIA 3U4CA 5BR7A 4NK5A 2I5PO 4I1IA 3BYZA 5I7VA 2FMUA 3WWZA 4B79A 2G76A 1YDWA 4GSKA 4YDRA 1ZK3A 2C5AA 3E5RA 1GUYA 4J4TA 4BKOA 3KSDO 5JC8A 3DL2A 2WM3A 4J6FA 3BZUA 1R37A 5A5EA 1Q7CA 3GNTA 3DZFA 4CQLB 2Q1UA 4HWKA 4PLVA 2UV8A 3RUEA 3V1YA 5TLSA 4ZRMA 4A03A 1LEHA 1TA4A 4CMAA 3TNLA 3I3OA 1LRJA 3GG2A 3H9JA 4NJMA 2Q45A 5H81A 3WWYA 4D3FA 1XDWA 4KTTE 1E6UA 3QW2A 4CM9D 3HNPA 2I9PA 1X13A 1DFHA 1IZ0A 2VNAA 4U8GA 5ER9A 4MVJH 1O8CA 4WUVA 2AEMA 1Z75A 5JLAA 4NU6A 3G1UA 2FR1A 4CM8A 2J3JA 2JHFA 2J3HA 3LLVA 1R4NA 4GVXA 4QUKA 4E32A 1F12A 2IODA 1K6IA 3MJSA 4E0BA 2X86A 3IC5A 1DFIA 4ID9A 1PU2A 4IDBA 1ONOA 4IS3A 1TEHA 3U5TA 3S2GA 1M76A 1I2ZA 3GVCA 1ENZA 1S7CA 3AY7A 3G79A 3H6KA 3LC7O 1E3SA 4I5EA 5IFLA 2IE0A 4OHUA 3KXDA 2PGLA 1YDEA 4A10A 4CMEC 1J5PA 3T7CA 1XU7A 2ZIZA 3EVNA 1HSZA 1MA0A 2X4GA 4DYDA 3GRPA 1LDGA 4D0RA 4E30A 2VHXA 1HLPA 1XLTA 1C0LA 1DLIA 5JMPA 4O59O 3WDSA 1FJHA 3F4BA 3D7LA 4LW8A 3L4SO 1DIAA 1Z74A 2HKIA 3GAFA 5BQFA 5TT1A 1G6KA 3KO8A 4RO0A 3MCVA 5I8WA 2EP7A 3CH6A 2GZ1A 4ND1A 4YRDA 1EZ4A 1KVQA 2W98A 3VVCA 2XOXA 1LLCA 1SOWA 1NVGA 2OL4A 1EBUA 2WD7B 2BGMA 3EC7A 1AHIA 5JO9A 3RC2A 1MFZA 5FWNA 1XG5A 2FR8A 1SNYA 2CMDA 2C5EA 1QYVA 1U9JA 4OSPA 4DYVA 1JTVA 1N2SA 2DPGA 1VC2A 2PD6A 3R3JA 1RM0A 4OMUA 2D4AA 1HTBA 4KZPA 4YRAA 2HO5A 3NRCA 4TKLA 4E6PA 4E33A 4LMRA 2VYNA 3KUXA 1NQTA 3LDHA 1P33A 4A0SA 1NVMB 1PZFA 2DTDA 2EGHA 3IL2A 1AE1A 1QYDA 1PR3A 1I2BA 1H94A 4BNFA 1E3WB 1ZIDA 3JQ7B 4IXWA 3ZU4A 4ZICA 3OEWA 3GZ4A 4RVSA 3D3WB 3WGOA 1GPJA 4Q3AA 2WYVA 5DP1A 4HXYA 2EHDA 1M75A 3ZWOA 1PL8A 1K3TA 1VL8A 3EGOA 4XKJA 3ZHZA 3EUWA 4YR9A 1PJBA 1T2EA 3PFFA 5TF4A 1NR1A 3VH2A 2NTJA 1B8UA 4W82A 2P2SA 3QA9A 4PLWA 5C37A 4O0LA 1DIBA 1J0XO 3W8DA 2X9GA 4WE3A 4BNMA 4E5KA 4OH1A 3HWRA 3GR6A 4B4UA 1E77A 4WGGA 4CQMA 2JCVA 2D5CA 2AMFA 2GNAA 2VHWA 1H5QA 1HLDA 2O3JA 1U28A 2FSSA 4WCFC 4WPGA 3PK0A 3DAFA 3TZCA 1C0PA 2GO1A 1LQUA 4J9UE 4GQAA 3MJCA 4BO5A 5I7EA 4BO3A 4XRGA 1I10A 4JNKA 3U4IA 1V9LA 1PIWA 1YOVB 3INTA 3DMTC 1LSUA 1O6ZA 4DA9A 1BRMA 1U7HA 2DBVO 5JW6A 3BMNA 4PLFA 5A3JA 2AEFA 3DQPA 4GLOA 4N5MA 3IUSA 3RKUA 3PQFA 1PQPA 3CXRA 5JYDA 5I8ZA 2FSVA 4CMKA 2EJVA 1SB8A 4CMEA 3WYBA 3BAZA 4W4TA 1PQUA 2X6TA 4YQZA 3ROPA 5KJCA 3ZU5A 2CVZA 3E9NA 3QWFA 1LU9A 4BNZA 3HADA 3RBXA 3FCOA 2VYVD 1CIVA 4GI2A 4RV9A 3OQ1A 3GNSA 5IDXA 1ZJYA 4XGKA 3ZU2A 3D4NA 1CJCA 1U5AA 3AY6A 3DZBA 5T64A 4E5MA 1BDMA 2JFFA 4R3WA 2X8LA 3JD4A 2QX7A 1E3EA 1ZSYA 3DEYX 4I5GA 4AJ4A 1Z7EA 4OM8A 4JN6B 4L4XA 5IJZA 1X1TA 3GMDA 3PZRA 1X7DA 5L3ZA 1PGPA 1GZ3A 3P19A 4LVUA 4R5HA 4BNVA 1P74A 1FDSA 4G2NA 4I9NA 1HYEA 1YQXA 1HSOA 2HK9A 2PZKA 4ZRNA 4RORA 4RF3A 3T4EA 3PLNA 3DHEA 1E7SA 4RVGA 2Q1TA 2YQ5A 4NK4A 3WTBA 4DQUA 1T26A 3QJ5A 4HNGA 4ND5A 3K96A 1PJLA 3KYDB 1EFKA 3H2ZA 3GUYA 5CDYA 2QYTA 1UP6A 4W99A 3E18A 4BV8A 4EJMA 2O2SA 3ZV6A 2WWRA 3JQGB 3QWHA 5TJ9A 3LC1O 4CV2A 1XQ1A 1UH5A 3D5TA 4K6FA 1VI2A 3E82A 4CM3A 2NV6A 1C1XB 2YHUA 3UCFA 3VPFA 2WD8A 3G0OA 3GPIA 3H8VA 1PL6A 4H7PA 1E7MA 2CZCA 1BWSA 2JFHA 3CZRA 3OJFA 4MINA 4AJHA 4AJOA 4W7IA 3IIEA 1E7RA 3PYXA 2XF8A 3L9XA 4I8XA 1XYGA 5A06A 2YDYA 3IQDB 2C54A 2YZ7A 2NVUB 1ULUA 4XRRA 4W9NC 3HB4X 3I4CA 1HDZA 3QRWA 3M6IA 4KDFA 1ZSVA 4N5NA 3U4DA 5K6AC 1ZKMA 2BD0A 2PH5A 1TLTA 1ZSNA 3FPLA 3FR7A 4CMCA 4UVEA 1QV6A 3TN7A 1KBZA 1ONPA 4AL4A 1E6EA 3JYQA 3ZHXA 1ULSA 4GLLA 4BNJA 3PYLA 2O7QA 1DC4A 5DOZA 4NPCA 4PLTA 1ML3A 3UVEA 3GUCA 5ADHA 1DB3A 2NVWA 4BGIA 3OQBA 4FJ0A 1ADBA 3Q9NA 4WCFA 1I36A 2QRJA 2EP5A 3FF4A 2I3GA 2Y1FA 5EIOA 4JBHA 1JU9A 3OM9A 4ZHSA 3DMTA 2B5VA 2CY0A 3AFMA 1T25A 4RL6A 3WFIA 1LSJA 1OBFO 1E6WA 4NHEA 1DC6A 4YTEA 1E7WA 4KMSA 5DNAA 4NR0A 2IZ0A 4YRBA 3GLQA 1Q1NA 2RBEA 4CQMD 1CERA 5CPFA 3JQAA 1H6BA 1U7TA 1WNTA 4ZU3A 3FWZA 3VH1A 3WOHA 4DQXA 3DHYA 4DL9A 3ZWYA 2D1YA 1X1EA 1WP4A 1XCBA 4I08A 4HV4A 5EL0A 4U6SA 2HQ1A 6ADHA 4XQGA 5AQ1A 4XYBA 1C0IA 3H9QA 4DPLA 3MJ4A 4PG6A 1KS9A 1PX0A 2X5OA 4EEXA 3CZMA 4FGSA 5CDUA 2GERA 3M2TA 4O5OA 3FBGA 4XYEA 1FDTA 3DTYA 4MVJG 3SC4A 5L7TA 1J4AA 3P7MA 1XHLA 1S6YA 4RZHA 3WGQA 2RCYA 1NASA 4RQUA 2H1SA 3KETA 5H83A 2HMTA 3FNEA 3JQ8A 2WSBA 4CM5A 2E49A 2W2KA 5U9CA 1KVTA 2DUWA 1GR0A 1P77A 3I5MA 2EW2A 1AXEA 4R9RA 3L9WA 1EQ2A 2Y0EA 4NI5A 4ALNA 3W8EA 4DMMA 4QSMA 3BTUA 3DMYA 4XCVA 4XQ9A 2HJSA 1G0OA 1R0LA 1U4SA 1V3VA 3E8XA 3TL2A 4CMIA 2GRAA 1ZNQO 2JD2A 1NPYA 3NKLA 3ABIA 3NT2A 4NG5A 2HMUA 1VE9A 5DF1A 1H2BA 4FS3A 4E21A 1SCUA 4UREA 4EGFA 1B0AA 2VTDA 1OZAA 1ENPA 4XD2A 3RI3A 4NFSA 1NQ5A 3SLGA 1GQQA 4FDAA 2IZ1A 2CUKA 3ROKA 2HRBA 2G17A 4W9NA 4IIUA 2OHXA 3M1AA 3RQSA 2X0IA 1Z73A 5KJEA 4CM4B 2GZ2A 4O1MA 3WQQA 1BDBA 2FN7A 2JHGA 2IDZA 4R01A 5TC4A 1E7YA 4JP2A 3AOEC 4MO2A 1GADO 3E1KA 1MLDA 2EWMA 1LJ8A 3AOGA 3NUGA 4BMSA 5DT9A 2OMEA 3WGYA 1A4UA 3BMCA 4ZQEA 3BXXA 4AJ1A 2OORA 1P0CA 1KETA 2DAPA 7MDHA 1O5IA 4DLBA 1ZEMA 3T7EA 4IZHA 3E9MA 4DIFA 1C1DB 3BTVA 3K30A 2RH4A 1KEVA 3NGLA 3Q11A 3KV3O 2VT2A 1IHXA 1RKXA 5L53A 5ILGA 2IXBA 2R00C 4MP8A 2HK8A 1LRKA 3AUSA 2EKLA 4PLYA 4RF4A 1E0DA 3VH4A 2VRCA 1E1NA 1C3VA 2CD9A 3GVPA 4QEDA 3ZWPA 4DVJA 4TZKA 4YJGB 2JD0A 5I7FA 3HN2A 9LDBA 3A9WA 4PLCA 1T1RA 1ZO8A 3AI1A 4Z0TA 2VHYA 4MVJF 2P5UA 5JAMA 1GAEO 1DOHA 1GDHA 4K6CA 5CEJA 4BQPA 2WDZA 4AG3A 3O8QB 2A9FA 4OKNA 4BVAA 3C1TA 2JL1A 2F1KA 3I9KA 3ZNOA 4ZD6A 1DIGA 1F17A 1X15A 4G81A 4BGVA 2VZ8A 3RFTA 2X23A 1LDBA 4KUHA 4KQWA 1P0FA 2CF5A 1MXHA 4U5QA 3HDYA 4I5DA 2B4RO 2C2YA 3RJ9A 2ZTUA 3JQAB 2LDXA 3GT0A 1LLUA 1YBAA 3JQAD 3W1VA 1B3BA 4FJ1A 1Y9AA 4R69A 1NHGA 4ILKA 1YL7A 2O23A 1W73A 3PIDA 4ALJA 3WGIA 1UJMA 2PR2A 1E3IA 2P5YA 2PWZA 3ENKA 4LCEA 1U5CA 3HDHA 3QY9A 4HFMA 2PZMA 2Q4EA 1GTMA 5ITWA 4U0JA 1O95A 2B4QA 1KEWA 3JQDA 5JY6A 4ALLA 1Z7BA 4R1SA 4P38A 2HRZA 1H9AA 2NQ8A 3AM4A 5HM8A 4YJHA 5G0TA 5KCZA 1VLLA 3HDQA 1NWCA 3UICA 5IZ4A 1NHWA 3KVOA 1JN0A 3CMCO 5TSDA 3K8ZA 2Q1SA 3JQEA 1A9YA 5KNLA 3TZQA 4BNHA 4YPOA 3S55A 2CDCA 4J3FA 5KOIA 2Y1EA 1LDEA 3MJEA 4LGVA 2B37A 3PJGA 1LI4A 4PRKA 5JDCA 4GBJA 1OFGA 2XXJA 3AOEA 1QYXA 1NAIA 4UVIA 3FBTA 1MB4A 2Y1GA 1BTOA 2H5LA 1BW9A 2EG9A 3TSCA 4CM6A 2G82A 4MVJE 2V6MA 4A7PA 1HDCA 1PGJA 4W7HA 4BO7A 4OJNA 2X5JO 3RBZA 1L7EA 3RFXA 2JAPA 4YXFA 1DXYA 3K2BA 1WMBA 3RUHA 4BNIA 4AFNA 1EMDA 3DAPA 1PJQA 1UDCA 4IGEA 1TXGA 2AXQA 2YDXA 2Y1CA 2R00A 3GH3A 5TRTA 3WICA 5THKA 2QW8A 2NU8A 3I52A 1DIRA 3PI7A 4BO9A 1GEEA 3BMCB 1QRRA 3H4VA 4QXMA 3Q9UA 2VZ0A 4XQCA 3V2UA 5BT9A 2BFPA 3AI2A 1SAYA 1I01A 2VT3A 1P1JA 1QG6A 2GN8A 3BHJA 4EDFA 4PN3A 3VVBA 4NBVA 4AJIA 4LISA 1FK8A 4LSMA 4N5LA 2OO5A 1CDOA 2FZWA 3LT1A 5BSGA 1YQDA 3PWSA 4F45A 3ZWMA 4MKRA 4AVYA 4Y6SA 5L7WA 1I3LA 4TRMA 3ETEA 4R68A 3AU9A 3K92A 1F0YA 2NADA 5A3VA 4GKBA 2VRCD 1GPDG 3QVTA 3PHLA 4NJOA 3EDMA 3VDRA 3DBHB 1Y81A 3X2FA 3D1LA 4EUFA 1IY8A 4DBZA 4EITA 1P44A 3V1TC 5GMOA 1GV1A 3KEOA 1CF2O 2D2IA 1E5LA 1Y8RA 5CHEA 3PJDA 1ZEJA 1NP3A 2Z1MA 3H5RA 1ZK0A 1CWUA 3DZGA 4JXKA 4M1QA 4Q3BA 1SZJG 1K6XA 3EHEA 1K6JA 5JSFA 2OGUA 1EUDA 4HFRA 2O50A 2EW8A 2GPTA 5DCYA 2HJRA 2YJZA 1HETA 4OXYA 5G0UA 2OBNA 1YH3A 3S8MA 4P4GA 4JGBA 3MWDB 1U8XX 3JQFC 5AXDA 2QZ9A 3FRJA 2RH8A 1UAGA 5COQA 3WGZA 2DPHA 5BSHA 4BNUA 2JCYA 1PS0A 3H9UA 4E12A 1GUFA 1Y5RA 3IKVA 2V65A 4BMVA 1B8PA 1OI7A 1XSEA 2YFHA 3AUAA 1P1FA 3K5PA 4B3IA 1ZK4A 1OC4A 1W4ZA 4TRNA 1I3NA 5AVOA 2VZ9A 5ENVA 3VDQA 2H6EA 3JQ6A 3KYCB 4LCJA 3OEYA 1H9BA 5BNIA 4YJFB 1EQUA 2EGGA 1JKFA 3JD1A 3U49A 4WLEA 4FC7A 3OP4A 4XR4A 1V6AA 5G4KA 1LLDA 5C3MA 5IAAA 4XB2A 2PK3A 2ZATA 4CR8A 4N54A 3NJ8A 5J23A 2X0RA 2OP1A 2PKQP 3K6JA 1D7OA 4J91A 3H3JA 1EVJA 2I99A 1ID1A 3GZNB 4XZ3A 2FZEA 1DDOA 3MJTA 5CPBA 1HDXA 1PZEA 2CVQA 1I32A 4YAJA 3S1LA 5H82A 4RLSA 4LN1A 4YAGA 5IN4A 5DCUA 4ALKA 1GUZA 3RWBA 3PGXA 3TZKA 4J2HA 3O26A 1MUUA 2ZB3A 5G4LA 1DIHA 3AWDA 1I5RA 3KHUA 1W0CA 1BHSA 4BNLA 3ANLA 3BMOB 1K5HA 4U0KA 3E48A 5G0VA 3UFXA 4QFDA 1IB6A 5T57A 4J0EA 4DWVA 4ZN6A 1NQAO 1HYHA 3ZW9A 3SXPA 1XU9A 3JD0A 4CV3A 3QWBA 4II3A 3WBBA 1FF9A 4DLAA 4DTIA 1ZFNA 1RJWA 3VC7A 4K1LA 2VN8A 4XWYA 2UDPA 4HUJA 3F47A 1BMDA 3HB5X 1PWZA 3KSZO 1P31A 3UAGA 4IIVA 4FFPA 5F1PA 3INGA 5G2OA 2HU2A 4OQYA 7ADHA 5BNTA 2AE2A 4DUPA 5A9TA 4B4OA 5TNXA 1KVSA 1T1SA 1A7AA 5I9MA 3FWNA 1NWHA 3DFZA 4YT2A 4MP6A 3LYLA 4CR6A 5JCJD 4CLOA 5G0WA 3GGOA 1G0NA 2IXAA 3ETGA 2O4UX 4M89A 3QVOA 3GEGA 4Q3DA 3HHPA 2ZJ1A 2I3AA 4F3YA 5F1KA 3JQBC 3KZVA 4R3NA 2SCUA 4XX0A 5FF9A 1LDMA 5THQA 3S2EA 5ER6A 4A27A 4AJ2A 3C85A 3MOIA 1I30A 2UUPA 4BB6A 4S1VA 2WE8A 4JCOA 3VKVA 4IDEA 1EUCA 1B16A 1KY5A 2UYYA 3G3EA 4GSLA 3P5SA 1GYRA 1ADGA 1PQWA 3ICPA 3V8BA 4D0SA 1P1IA 3GFBA 1K89A 4BIIA 1GZ4A 1IE3A 1LTHR 1RWBA 1YONA 2D5AA 4WECA 5L45A 2X9VA 3RUCA 3A4VA 3LU1A 3JYPA 1BVRA 2VWGA 2Y0CA 3W4KA 3IUPA 3OJLA 5DULA 4EUEA 1BGVA 3KOUA 4E3ZA 1F14A 2J5QA 1NFFA 4PVCA 4FFLA 3ULKA 1M6WA 1Q2XA 2DKNA 3H65A 2EV9A 4HFNA 3M2PA 5DN9A 3OJOA 4UAGA 3UOGA 3HFGA 1ISMA 4IINA 3CSDA 1PL7A 5EN4A 2NM0A 4BO1A 2QRLA 2QIOA 3L77A 4I9HA 4R41A 4TSKA 2EXXA 3B1KA 3KRTA 2BFAA 2A4KA 1RM4A 2IRWA 5EQFA 5I9LA 3FN4A 5HA5A 4UVDA 4CLXA 2QQ5A 1DHRA 2ILTA 3CKYA 4BKQA 1GV0A 4OL9A 1LSOA 4CLEA 4RVFA 5F5NA 3WQRA 3GG9A 3ONFA 4L9RA 3ASUA 1YB1A 2Z5LA 4Z9YA 3ZHBA 4EZBA 5IZCC 2BI7A 2ZKLA 4ND2A 3AJRA 3ZWXA 5KJ1A 2JCXA 4J49A 1B7GO 4NJMB 4FOOA 1BSVA 1DO8A 3BHMA 3EW7A 4ZQFA 5BSEA 1SMKA 4UVGA 2FPPA 3ORFA 1G1AA 4Q3CA 3ZHYA 2GD1O 4DRYA 1YGYA 3HG7A 4RF2A 4CM8B 3F6YA 1R4NB 4MVJA 4TRRA 1WZEA 1NFRA 3TRIA 1WMAA 4PZCA 2X22A 3H2SA 4CLDA 4AJPA 5C7OO 3DZKA 3GF4A 4YQYA 2ET6A 2EEZA 4FW8A 4LVCA 2AW5A 2C20A 4MPDA 3DBVO 4KP7A 4XA8A 4Y67A 2Y66A 2VWPA 2VWHA 5IDQA 2HMVA 4M87A 3PQDA 1NXQA 2I6TA 4WKGA 1BXZA 3PLRA 4P4NA 1K2WA 3L4BC 2EKPA 4Q9NA 4YYZA 4HADA 3SX2A 1KVUA 1QLHA 5IF3A 2VOEA 4S3MA 4BS9A 1PS9A 4INAA 1AUPA 4BQRA 3RIHA 4RQTA 4HX5A 2BGLA 4CV1A 4DMLA 2YY7A 2FPGA 3JQBA 3B1FA 2P9CA 4RPJA 4E5YA 2W2LA 1J6UA 5JYEA 3VTZA 3DXFA 1VJTA 4MJLA 5DDIP 3C24A 3ZNNA 3ICCA 2GDZA 4J2OA 4NFYA 4CM7A 4DC0A 1ENOA 4R51A 2FR0A 4XJSA 1UDBA 1HYGA 2ZK7A 3MEQA 3PHHA 3GDOA 4ND3A 1Z82A 3GN2A 1QKIA 1HF3A 1FDUA 2J8ZA 3K73O 3F46A 3V5NA 3NEPX 4FSHA 3ADPA 3Q1LA 3PJFA 2D59A 2VYND 4PCVA 4ZQBA 3V1UA 5L51A 3RASA 3DBRA 1BXGA 2QYSA 4JBGA 4FB5A 4FFNA 1YQGA 3TOXA 2VQ3A 3MTJA 5TJHA 2AE1A 1N9GA 3OQ6A 4TQGA 5CP8A 4OXKA 3DWFA 2AQHA 2C2XA 3R6DA 3CIFA 2I65A 4BNXA 5JDIC 2ZJ0A 3IP3A 2R2GA 4BO6A 1IUKA 1DJQA 2WEKA 3NTQA 5DP2A 1HZZA 1I2CA 3GMSA 3PHIA 4L0QA 5F21A 4I9UA 4QX6A 1U3WA 2DBQA 3GVXA 3I23A 5HS6A 5T67A 3KTDA 3JD2A 3D5QA 1DSSG 3PP8A 3FHLA 1R16A 1L7DA 1GCOA 2VRBA 2XXBA 4P4LA 5IZCA 1O89A 3RBVA 4J7UA 4D3DA 3UKOA 1Z6ZA 3EK2A 1ISHA 3KM0A 2B69A 1ENYA 1DFGA 3TL3A 4CQMB 3CMMA 3JD3A 1NTOA 4BUCA 4ZVVA 3ZGYA 4BB5A 3TFOA 1HWYA 4WOKA 1P9LA 1GYPA 4GX5A 5A5FA 1ZK1A 2Y93A 5B1YA 1RYEA 2YV3A 3C7DB 4OO3A 5L4LA 2NTNA 2X0JA 1DC3A 3VKUA 4PG4A 1QORA 3TFQA 4BKRA 4TMFA 2W90A 3GC6A 4NZ9A 5ENDA 5GZ6A 4A2CA 4XYLA 3BMNB 2WMDA 3EY4A 1DC5A 3NAQA 3E9QA 4Z6KA 1B3RA 3ZN2A 4H3VA 3WXBA 3GHYA 2C0CA 1E92A 3BMQA 3NYWA 2H9IA 3U09A 3RUAA 1R15A 3GOHA 2BLLA 3L4BA 3RC9A 2RHCA 4DC1A 3U3XA 2YW9A 1ADCA 4GWKA 1AHHA 3GAZA 1ZW1A 2BHLA 2DT5A 2HMWA 3F3SA 4GWGA 2YYYA 2P68A 2QHXA 2V6FA 3MJVA 4D43A 2VUTA 4B7UA 1YB5A 3OJ0A 2E37A 3ZV4A 2A94A 2NSDA 3QVXA 4GMFA 4ND4A 2YQ4A 4L8VA 2DFDA 3ZZNA 1W6UA 1H2HA 4WLOA 1JWAB 1T4BA 4IY1A 5B4UA 1LNQA 4JLWA 4UUOA 3OSUA 4YAEA 4WOJA 4XJTA 1AXGA 1ZMTA 1EK6A 2PGDA 4YB8A 2VUUA 2X58A 3NV9A 4J16A 2P91A 1Y7TA 1R6DA 4CLRB 4B8WA 2PY6A 3OIGA 3TOZA 3D4OA 1HXHA 3ZWVA 1V35A 2LDBA 2YFQA 1F8GA 4QQRA 3L6DA 5K6AA 4U6QA 1E3LA 4D42A 1EE9A 1FXSA 1NX6A 3ZWCA 3QV1A 2O4CA 3S2IA 1J49A 3JQCA 3ANMA 3HUDA 2W2LD 5GY7A 3WNQA 1SC6A 3O38A 1NPTO 5JNLA 2P9GA 3DOOA 2C82A 4JIGA 1WVGA 3F5QA 3OICA 1U3UA 3L6EA 2I66A 4EBFA 4IDGA 1LA2A 1WZIA 2W8ZA 1E3JA 4RPLA 5A9SA 4KWHA 5JDIA 3I1JA 1QP8A 2Y99A 3AK4A 1MFPA 1OOEA 2X5KO 3P2YA 4PVDA 1UP7A 3DHNA 3X2EA 4DIOA 5K0ZA 3FPCA 4MIYA 2GGSA 4XGIA 1A5ZA 1SBYA 1H6AA 5IN5A 1ONNA 3L07A 3I83A 4DREA 4URFA 4Q39A 3E5MA 2BI8A 4WNCA 4FFMA 5JC1A 2FPIA 2FWMX 1R4MA 1E1LA 3D64A 3WR5A 3RU7A 3U62A 4M55A 1GQYA 3DBLA 3SEFA 3LSYA 3W4JA 5JE8A 3OMLA 4WCFB 4B7CA 4A5OA 4NU5A 1Q7GA 4M54A 5LCXA 4ZQHA 1DJNA 3VPSA 3ANNA 4IPTA 3WYEA 1KY4A 1M66A 1WPQA 2PNFA 4PG7A 4ROSA 1GCUA 1V8BA 3HE3A 4MIOA 3RSHA 2GR9A 3C7CB 4UEKA 3BA1A 4YVFA 1IZ9A 4IJKA 3COSA 4E5NA 4J4HA 2WYWA 3CPSA 3OH8A 2V7PA 1SO8A 4MOWA 1X14A 2VNSA 4WLUA 2GN6A 2TMGA 5DCWA 4J1TA 3M1LA 3RJ5A 2O2YA 3CEAA 4B3HA 3IKTA 1PJ3A 3N58A 5EERA 2NLOA 1KOLA 1PTJA 2FHSA 5CDGA 5JXWA 1TI7A 8ADHA 3IDSA 3ITDA 3K9QO 3Q2IA 1B26A 4OYRA 1PSDA 5IG2A 4OGWA 2ZYAA 5KVSA 3RD5A 5JCXA 2POQX 1D1SA 1UXGA 2VTEA 1Y8QA 2PKRA 5TT0A 2DVMA 3WLFA 2YHIA 4YAIA 3AM3A 4ITUA 1V3UA 3KSUA 2NU9A 5AXCA 2AQ8A 3DDNA 2O3RA 4EI2A 1JVBA 1NPDA 3DONA 3BHIA 5LC1A 2CF6A 3JQ8B 2OP0A 5ITVA 2W2KB 3N74A 2G5CA 1C14A 1GL3A 3WQSB 2GSDA 3AY3A 1GY8A 4YBZA 1XQ6A 3BIOA 3ZCXA 3ITKA 1WAMA 4JK3A 2GN4A 5FI5A 3B6ZA 4CQLA 5KJFA 1QXSA 1PJTA 4BNGA 4YEDA 4CM1A 4CMBA 3DO5A 2O3TA 4LRSB 2Z1NA 4CMIB 1ZZEA 3HDJA 3LT0A 5T5QA 4CM9A 2O3QA 4Q3EA 4RPKA 4BMNA 4PLGA 2VHZA 3HFSA 4NFHA 3AM5A 4QECA 2NNLD 2ZB7A 3NTOA 2JKVA 4IMRA 4O63O 1Y1PA 1OAAA 1H0KA 2DFVA 1YS4A 3G49A 4CL3A 5AYVA 5K9ZA 1U2DA 3LZ6A 4UUMA 4XB1A 3W4IA 3PQEA 4D44A 2VHVA 3LT2A 4J7CA 1E1MA 1GEGA 4IQ8A 4R4JA 4D7AA 2Q46A 1X0XA 5FFFA 4L4RA 2Q3EA 3LF1A 3ZWWA 1LX6A 1DHTA 4BO8A 2HLPA 4TZTA 4YT4A 8LDHA 3JQ9C 4GX0A 4WNIA 4QT0A 4BO2A 2PFGA 4CPDA 4QO8A 1B2LA 2RAFA 3IJRA 4HY3A 1MGOA 5JS6A 4Y98A 4OIMA 1HEUA 1MC4A 3HJAA 3F9IA 1HDRA 3WBFA 3TQHA 2PV7A 4L76A 5EESA 2C7VA 4MP3A 5KKAA 1QR6A 4FPXA 4WLNA 3ZV3A 3VTFA 4WJZA 4TKMA 5DZSA 4ONEA 3MZ0A 3ZDFA 5CFZA 2C29D 1V3TA 4RPGA 3HQ4O 4XIJA 1HDYA 1T2AA 1CQIA 4BNYA 5CAEA 3ZWAA 4CL8A 4Z3KA 2EERA 3W8FA 1ZUD1 1JAXA 2WD7A 3MWEB 4FCCA 1GZ6A 3RAJA 2DTXA 4IJWA 4D46A 3OHSX 5C7LO 4UVHA 2BF7A 4F6CA 2NUAA 1RYDA 1EUZA 4K28A 4EJ6A 1GQ2A 2OOSA 4CLHA 2GYYA 2NU6A 3E03A 1HT0A 1PGNA 1UZMA 1A7KA 1CRWG 4OQZA 3R0IA 5B37A 3B20A 3I6QA 1EVIA 3OETA 3B1JA 5EMHA 1PGQA 2DBZA 3C1OA 1PJCA 1QYWA 1DRWA 4II2A 4YCAA 5L95A 5F5LA 2HSDA 1ZK2A 4XEHA 1DLJA 5CEFA 1GFSA 1HE4A 1Z45A 1E3WA 2DC1A 1YB4A 1TVEA 3JQ7A 4JP3A 3MTGA 3WSVA 4NNJA 4IMPA 1EFLA 2B35A 2I76A 4J0FA 2X0NA 5HRUA 3D3WA 4XYMA 1R0SA 2E6UX 2GN9A 1YWGO 4WASA 1HDGO 3UCXA 4XQEA 1EDOA 1O9BA 3VZPA 1VKNA 1I3MA 3OBBA 1KEPA 3DC2A 5JMWA 1IPFA 1PGOA 3WG9A 5JBIA 1LUAA 3H3FA 3KB6A 2PLAA 1WXDA 4CODB 3ENNA 2HAEA 4IM7A 4EJ0A 3NDRA 1JWBB 4YJHB 1BXKA 3KEQA 1ZMOA 1A71A 1T2FA 3STHA 5A4DA 5IXYA 4LMPA 1CEQA 4LK3A 4PZEA 3NJ4A 1QLJA 5JO0A 4J4BA 1HRDA 9LDTA 2Y68A 1EVZA 5KWEA 1A27A 2IEDA 3OF2A 4B8ZA 4L4SA 4BGEA 1UUFA 3EZLA 3DZIA 5T6BA 4CR7A 4RPHA 1DEHA 1YOVA 4FOSA 3IMFA 4R54A 4TROA 2Q2QA 1UXHA 2H63A 1VL6A 1ZVMA 4RZIA 1ZH8A 3FI9A 1TT5A 2E48A 4IQGA 4B4VA 4CMHA 1LC0A 3JQ9A 1N5DA 2UVDA 4XYGA 3A1NA 1JLLA 1ZCJA 4GGPA 2QZZA 2GZ3A 3UUWA 3GN1A 4J1NA 1C0KA 4F6LA 5A02A 4WK6A 1N1GA 3ST7A 1BW9B 1N8KA 5TS3A 3FTPA 5U1PA 3AW9A 1MV8A 2VYVA 3LC2O 4FIZA 4KQXA 1QV7A 2ZYDA 4J9VA 3RC1A 3PVZA 1T4DA 1U8FO 3KLPX 4JX8A 3RC7A 1YE3A 2CSUA 3JCZA 4IZIA 3GNQA 2BRUA 3OA0A 4PGFA 5EINA 4CUZA 4XR9A 3UCEA 1LRLA 4CUKA 4D3SA 2B0JA 1HDOA 3F1KA 5KJ6A 4WLFA 3I9NA 1EE2A 4U7WA 2YV2A 1IHYA 3U0BA 4EEZA 5ICSA 5TGDA 1VPDA 3O03A 2DM6A 1XEAA 2OZPA 3PYMA 5ILOA 1RM3A 2WYUA 4O6VA 1DRUA 1NVTA 1TB4A 1YXMA 4PG5A 2CNBA 3C3XA 4FD3A 3IOYA 3KYDA 2GUGA 4CMGA 2G1UA 3TZ6A 3L0DA 1WWKA 2OBYA 4Y6RA 1JA9A 3Q3CA 4GMGA 4FR5A 4YJDA 3T4XA 3JQGA 1P1KA 4DPMA 5A04A 3SC6A 4XGNA 3S2FA 1MX3A 5KVCA 1WDLA 2NVBA 3WGGA 1C1XA 3OIFA 3UHAA 2ZCVA 3FD8A 3QIVA 4WLVA 3TJRA 1RPNA 3NX4A 4HBGA 3JQFA 1VM6A 4RVUA 2QRKA 4IUYA 4NH4A 2OFPA 1DAPA 1QYCA 1Y5MA 3H9EO 3OECA 2FRDA 4PLPA 4ZA2A 4D45A 3GVIA 2NVUA 2XAAA 3P2OA 2AG5A 5L4NA 1KC3A 3GRKA 3ONEA 1NR7A 1Y8RB 2ZB8A 3AI3A 5JFOA 2BFMA 4GKVA 3DB2A 4TWRA 1PWXA 4E2ZA 2BGKA 3AU8A 4WCDA 2ZYGA 3SLKA 1NQOA 4OKIA 1DBVO 2VWQA 1E7QA 3QVWA 1UXKA 3VPHA 2BFOA 4Z9XA 2O7SA 1HZJA 4M86A 4MVJI 1N7GA 3PHGA 3IAHA 5G0SA 4P8RA 5EPOA 3WMXA 1JVSA 1MC5A 3EYWA 3F1LA 2GCGA 3O4RA 1LLQA 2AG8A 2J6IA 1LDNA 4HKTA 3WGTA 3U4HA 3N7UA 5HWSA 1R66A 3RU9A 4P22A 2ZTVA 3R3SA 5TQVA 4B7XA 4E2XA 1JDJA 4RLHA 1LBEA 3FTNA 3D0OA 3I9JA 4MIEA 3WS7A 4IDFA 1IYZA 1ARZA 1I3KA 4PFJA 3H5AA 3RUIA 3U9LA 3VH3A 2F00A 2ZQYA 3CINA 2BKAA 2HCTA 3ASVA 4TVBA 2Q1WA 4NBUA 1XELA 4BL5A 3RROA 1N92A 1VKOA 4FFOA 4C7KA 4D79A 3EAGA 5CG2A 3BTSA 5G4KB 4E5PA 4NQZA 3INRA 4UUPA 2WTBA 4YT5A 1IL0A 3WGHA 4RF5A 3UF0A 3UN1A 3EZYA 4PLHA 3F5SA 5ICMA 5A05A 2BMAA 2FOIA 1ZXBA 5MDHA 1X0VA 2E82A 3GY0A 4IDAA 3DOCA 4UEOA 3SVTA 1TT5B 4BNNA 1AN9A 3GGGA 1D3AA 3H5NA 2J3IA 2V6GA 1U4OA 4OOFA 2NQTA 1YRLA 3AFNA 2B4TO 4FBGA 3RFVA 4Z3DA 3UXYA 5MGBA 5B4TA 3FNHA 3KBOA 4JROA 4KOAA 4W6ZA 4Z9FA 4Q3NA 5U4QA 3ROMA 4IJUA 2Y67A 3A28A 2I67A 2AQKA 4Y8VA 4FN4A 2UAGA 4CV0A 2IZZA 3KYBA 4MKXA 4BHTA 1HE2A 5EQDA 2RHRA 3JYOA 1B14A 1MXFA 2B36A 1NBOA 4BKPA 3TF5A 3GQVA 5B4VA 5T8KC 4C7JA 2P4QA 3DR3A 3JTMA 3NT4A 1SPXA 3NDIA 1FDVA 1XIVA 1KEUA 4RDIA 1I24A 3OJEA 1K0UA 4F46A 1YJ8A 4QFCA 3PJEA 3QLJA 4IJVA 4YACA 1U2GA 2YUTA 1UP4A 4RVHA 4CLOB 3WNVA 4CM4A 2JFGA 3ZW8A 1I33A 2R6JA 1VSUA 1NNUA 4R1UA 2PH3A 4BV9A 3DFUA 4J1SA 2D0IA 1EDZA 2VCYA 1GYQA 4GX2A 2EKQA 4UULA 2HUNA 3LF2A 4PG8A 2A35A 4BO0A 2OXIA 1Q0HA 4Y9DA 3VZQA 2Q50A 3PGJA 4G65A 3KLMX 1A72A 1GD1O 2J5RA 3WB9A 1KIFA 4RDHA 3PWKA 4HP8A 4YT8A 5L9AA 4BNKA 3LQFA 5AXAA 4HFJA 1C1DA 3VAZA 4C4OA 3RCBA 4AJLA 1EBFA 1WDKA 1U3VA 3FNFA 1XKQA 3GFGA 3W6UA 3WLEA 1M67A 1O94A 4GVLA 5JY1A 3ADOA 3K31A 4H15A 3DTTA 1NYTA 4PIVA 3OFSA 2UUOA 2ZCUA 1U3TA 2C07A 4A26A 4YJGA 3UH1A 2EIHA 4KWIA 2NACA 4RVDA 4GH5A 1ISIA 1IPEA 5F1OA 1N1EA 2VOJA 3ZNQA 3PDUA 2GLXA 2IYOA 3O8QA 1T2DA 1T24A 4ESOA 3GEDA 4ALIA 3I6IA 3HSKA 2AA3A 3RKRA 1YVEI 3VZSA 2BH9A 2Q2VA 1F8FA 3RUDA 1T2CA 3EMKA 3WFJA 5LDGA 3C7AA 2P9EA 1UXJA 3VPGA 3AUTA 1P1RA 4EW6A 5JAQA 4IGFA 1KYQA 2C7GA 4J1QA 3QQPA 3D3EA 4LSWA 4R1NA 4UUNA 4IBOA 4BOYA 4R1TA 3GDGA 1LDYA 2HDHA 3O9ZA 1UXIA 4BO4A 4R5MA 4B3JA 2X1HA 5BNFA 4E13A 1UR5A 4NBWA 3GHHA 4MVJD 4EUHA 2AEJA 3GPDG 2PZJA 5T8KA 1IOLA 3GGPA 4LRTB 2OUIA 3DAGA 1VRWA 3PTZA 5B12A 1D8AA 1OMOA 3Q6IA 1YL6A 5L7YA 2X7HA 3VPXA 3JSAA 1EVYA 1QSGA 2ZB4A 3PZBA 3QWAA 2D8AA 1RM5A 5CEEA 4DIBA 3LVFO 1MG5A 2Q49A 4X54A 2ZQZA 4I5FA 4OOEA 2CVOA 5DOVA 2V6BA 1VJ1A 3PIIA 2YV1A 1UAYA 1E1KA 2W4QA 1PS8A 1BG6A 1R12A 4QTZA 2PZLA 3LT4A 4NDNE 1SEPA 4JJIA 2VUSA 1UDAA 3DZHA 4YAKA 3I9MA 5CDSA 4YA6A 2FP4A 3VOSA 2NWQA 4WEOA 4AJKA 2JAHA 3NTRA 1HL3A 4OSOA 3PFWO 4MKZA 1GU7A 2Y0DA 4FFRA 2WJPA 3PEFA 3C1AA 2ZTMA 4L73A 4J7XA 4QO7A 1SEVA 1LC3A 5ES3A 1ISJA 4TRJA 2RIRA 4GAEA 3ZH2A 1M6HA 3IS3A 1N7HA 2IEBA 4A73A 1U1IA 1O0SA 5FEUA 1HE5A 2ZTLA 3R1IA 2DLDA 4K9DA 4CLRA 1YBMA 2NU7A 2B83A 2Y05A 3I9LA 4XDZA 5JDCC 5DBIA 5DBGA 3UGKA 2PD4A 1PJ2A 4KTVE 3JYLA 4CJXA 5C5IA 3I4FA 1E5QA 1ZBQA 1JKIA 4XDYA 5HBRA 2PTGA 4J90A 1MP0A 3DBRB 2O3SA 1BXGB 1CYDA 4E4YA 1P1HA 3PXXA 5TIIA 3SBOA 2NTVA 3E6AA 3QVSA 4D41A 5AOVA 5CG1A 1XGKA 1N9GB 4Z0HO 5KTKA 5GZ3A 1H93A 2DQ4A 4L74A 5A03A 5EJ2A 2PA3A 6LDHA 4JQCA 4NBTA 3CUKA 4K26A 1YO6A 4KUEA 4KDEA 1KC1A 1BVUA 1VJ0A 3WTCA 2TMDA 3ZU3A 3QSGA 4R16A 2B5WA 3PRJA 4J43A 2DUUA 4MVJM 1WLYA 2Y1DA 5GZ1A 4ZJUA 1ISGA 2O48X 3I9OA 4AJNA 1P3DA 4AJEA 2AQIA 4FQ8A 5JAIA 3D4PA 4BGUA 3BTOA 3GDFA 2QG4A 4E2YA 4E2WA 2E4AA 3HN7A 1X7HA 2FY8A 1XA0A 3G17A 3K2EA 3Q0EA 3DBHA 5KKCA 1ZXLA 1B8VA 1I0ZA 1JQBA 1ZJZA 1PJ4A 1VL0A 2HMSA 4GX1A 4DXHA 1KVRA 3JYNA 3L6OO 1SOVA 5C7IO 5A1TA 4JJGA 3CTMA 3FSRA 2O3UA 3MOGA 4JBIA 3GK3A 5JPIA 3F4LA 1LQTA 3ROQA 4MVJP 2AHRA 3PWZA 3OA2A 4XIYA 3ZNPA 3QE3A 1MG0A 1FDWA 3GA0A 2EJWA 3V2HA 1D4FA 3H9GA 3HZZA 1Y6JA 2WE7A 3BMQB 4Y6PA 4PRLA 3ZWNA 3GVHA 4ZGWA 2DU8A 4E31A 4DPKA 4DQVA 4N18A 3NDJA 4DLLA 1DRVA 5JAZA 2CDBA 4FGWA 4IQ0A 1NFQA 4R9SA 4B4WA 1LXCA 4DBVO 3KYCA 2IYPA 4AJJA 2Z95A 4YJFA 3AUUA 1I8TA 1P45A 3V2GA 3ON5A 1PJSA 2Q99A 1XR3A 4WEQA 1KERA 2PKQO 2HK7A 3FR8A 4ALMA 3OIDA 3UW3A 3TZHA 5LDHA 4FC6A 2JD1A 1H6DA 1PEDA 1DPGA 4MDHA 2PGJA 4N7RA 3GZNA 3NT5A 5HTOA 2GF2A 2CDAA 5IDYA 3TPCA 4M8SA 3LLSA 5BSFA 3PDJA 4NBRA 1CQJA 3ONDA 5KVQA 2BELA 4IXTA 5I7SA 3NGXA 3B70A 1XWFA 3Q2KA 3WJ7A 4EYEA 3ZI0A 4KUGA 1YJQA 2GASA 4Z0PA 1UZNA 3H7AA 5A9RA 1JW9B 4DGSA 1PR9A 1ORRA 1Y9EA 2D3TA 1SB9A 1FMCA 1X7GA 3GEMA 3G1TA 1PZGA 3BMOA 4YWJA 5A9SB 1LSSA 3W6ZA 4RCVA 1QMGA 3PHJA 3PPIA 5FI3A 2JJYA 3QP9A 5FYDA 2P4HX 4OAQA 1W8DA 1DAOA 3FNGA 1JAYA 2J5KA 4H16A 1EK5A 3ETDA 4UEJA 3WYCA 5L40A 1HE3A 4BNWA 2DTEA 3TWOA 1D1TA 4OXNA 2CFCA 2Y1OA 1CETA 3CE6A 4FJ2A 3ZV5A 4CMJA 4HNHA 4IDCA 3DOJA 3WJAA 4TVOA 1VSVA 1R4MB 1YBVA 1AGNA 5DBFA 1V0JA 4G5HA 5TX7A 5AXBA 5IXSA 3DBLB 4NIMA 1R0KA 1HKUA 2A92A 5KIAA 1NAHA 3WMWA 3RVDA 2PD3A 3VZRA 5JCJA 2G0TA 5IDWA 1UZLA 1A9ZA 4PZDA 3WX0A 2DBRA 1ADFA 3JV7A 4BNTA 1EEHA 3QHAA 5COBA 1WW8A 1YKFA 4AICA 3WIEA 2EF1A 3ZWBA 3IJPA 4BKUA 1H6CA 3SJUA 2C59A 1L1FA 1M2WA 1Q0LA 1TT7A 5CDTA 2Q4BA 3IP1A 3VHRA 3WSWA 3A06A 4NMHA 4RGBA 5HS4A 1B15A 4IS2A 1YL5A 1ISFA
chains in the Genus database with same CATH superfamily
2MTBA 1VKZA 2O8NA 5IEJA 1UPCA 3MYYA 4RHYA 2UUCB 1U02A 2FUNB 3DD1A 1WTAA 4G5OA 5LN1A 3QTLA 1XRQA 4G1FA 2ZR8A 3RVBA 3DZJA 3PXDA 3HNOA 3OTIA 4GPD1 4Y1RB 4ER7A 3O8RA 3AVTA 4Q16A 4PGAA 3I2FA 5ARBA 3O1LA 4RDXA 1BQEA 3RVMA 1VIYA 2L0XA 3KR2A 1T4CA 2W70A 3UXEA 3HXQA 1OC2A 3EOAI 4R05A 4II7A 4RA9B 4YP5A 3SHWA 4G0PA 4ZQGA 4CUJA 3L8DA 1NM5A 4BLVA 4WVLA 3EVTA 3CJTA 4OHBA 4NEGA 1Q0QA 1V8ZA 1WDMA 1E9FA 2ZS7A 4FZ3A 4P84A 4PLZA 2V0CA 3RUFA 3ZOZA 1EVEA 1JA0A 4ECAA 3QWIA 3BFJA 1SCAA 3RK1A 5CYPA 1NYQA 4FQ7A 5D6OA 2OHFA 2WUGA 1PT5A 1J06A 4FR2A 4RABA 3Q6MA 1TLLA 3CO0S 3WWZA 4M1EA 1NQXA 3CVJA 2OHHA 1JEJA 2G72A 4KC0A 1ZK3A 2C5AA 5IT4A 1UBSB 3NALA 4J4TA 4OHWA 2H7XA 4X8MA 5KTYA 4TKZA 4DJEC 3KSDO 3OZBA 5JC8A 1WP9A 2WM3A 4JEHA 1SOUA 3BZUA 1R37A 2CHUA 4YRQA 2WABA 3DZFA 5KDDA 5KYUB 2Q1UA 3SS7X 2UV8A 3RV3A 2YCBA 4ZRMA 4LYDA 5K3OA 2ZIWB 4CMAA 1OAKA 3TNLA 1LRJA 4PSVA 2R5WA 4JI6B 2Q45A 3BF8A 1SG6A 4P9NA 3N8NA 4HLDA 3ED1A 3JWEA 1YZVA 2J32A 4CM9D 1MB3A 1S01A 3HNPA 4OBXA 4HDAA 3UB4A 4CTMA 2AJCA 2CMKA 3AXTA 3KVVA 4JBNA 3TZLA 4CFZA 1X13A 2VNAA 1OAOC 3WVNA 1N6OA 1WCXA 2VJMA 1U28C 1XD2A 4HWRA 1ZCFA 4L3WA 1RXSA 1S89A 1PLLA 2J5BA 1KSJA 4BLWA 1EAYA 1AMNA 3JWPA 3KUDA 3RGGA 2QMYA 1MJGA 3BB3A 4GOND 1PVVA 5FAKA 4QUKA 2VYCA 3SP1A 1SXJB 2X1MA 5D5PA 4NOKA 4LF8B 2Z4TA 3GFTA 4P7GA 2P7IA 2X86A 2XBMA 4ZTUB 1DFIA 4Q1BA 2BFEA 1T3HA 1MO4A 1ONOA 2Y2UA 2ZVPX 1TEHA 4IS3A 1QP4A 3U5TA 3GVCA 5HIMA 4TLLB 4V24A 1E3SA 3ROEA 2PGLA 4LZAA 2ZWIA 1ZNYA 3KKMA 4PICA 2WYIA 3M5WA 1IBLB 4C88A 4OQNA 4K86A 1W1WA 5LZ5A 1X6VA 4ETMA 5B58T 1XU7A 4E1BA 3R7NA 2HHAA 3EVNA 3MMZA 1WS6A 1G8FA 1UXOA 3VSEA 1MA0A 4MCJA 1MAAA 2X4GA 3L41A 4DYDA 3ZVMA 3ZS8A 3VR6H 4MW9A 4MUKA 4QSHA 3C6MA 3AONB 2VP6A 3QKWA 4PYRA 1BCSB 2CZGA 2H52A 2QN2A 2ZUUA 3F7NA 1BJRE 2YXDA 4TSFA 5ARDA 3NQ41 3S81A 3U4MA 4ZVOA 3WDSA 3KB8A 1HURA 2YICA 1CQIB 3STYA 2Q6LA 1V48A 2ZE5A 5D1HA 3KO8A 5I8WA 3OFVA 2GKGA 1V6SA 3MBIA 5H4GA 3FWPA 1X7XA 1H65A 2GHIA 2OL4A 4JELA 3MCUA 2BGMA 3K9NA 1AHIA 5JO9A 4KQHA 5FWNA 4Q1VA 1JEYA 5C5CA 2C5EA 1QYVA 2MYPA 4OSPA 4OU5A 1G7CA 2NU6B 2DPGA 1N6NA 1GNSA 1JR3A 2YIDA 2C04A 4ZYZA 1W4CA 2V54A 4F86A 3NRCA 2A5JA 3B60A 2V4MA 2CD7A 3DBIA 2ZSUA 3JW8A 4U2DA 4OJMX 1NQTA 1XMXA 1EHIA 2OSBA 2WPDD 1P33A 4A0SA 2EQAA 2QRGA 1U6KA 1Q1EA 4Q7MB 4EPVA 1HG1A 5AKHA 2QX8A 3CRVA 3L8CA 3B78A 1QYDA 2HA3A 3EVZA 4KXFB 4F5DA 4EY6A 1BS2A 2OCDA 5FL7A 2WVHA 1V26A 1ODSA 1TUEA 1NULA 1OWLA 1JQDA 4ZICA 2JFUA 2EIXA 1F2DA 2ZPAA 3OEWA 3D3WB 4K3UA 3N05A 3WK4A 5B7PA 1Y3BE 3TIXB 5DP1A 2EHDA 1JX6A 2FXVA 2H7YA 1BU8A 2XCTB 5JAHA 1K3TA 2JBHA 3QPVA 2WU8A 5F7XA 2C3MA 4EPTA 1PJBA 3K1AB 4CI9A 1XZIA 1NR1A 3O91A 5TF4A 3VH2A 4YCBA 2VNJA 3F5FA 1UMBB 3UAYA 3KWFA 4YDHB 4Y2JA 4R2KA 4GI3A 3WBJA 3U7GA 3GYBA 1APBA 1XPUA 3WKAA 4E5KA 1NLUA 3C39A 1Q1BA 3R24A 4JOSA 1RXVA 4DV7B 4B4UA 4V3CA 2I4NA 5HCNA 4CQMA 2D5CA 5B57C 3BE5A 5B58C 1T3TA 3KEGA 2XMSA 3P9KA 1SHUX 1H5QA 1HLDA 5JADA 2FSSA 4WPGA 4OLFA 3PK0A 1G5RA 4WACA 4C3ZA 3K9CA 4QFMA 2IIVA 4J9UE 3WLQA 4Q1CA 1Z5NA 3HDGA 1AM4D 1OLSB 1DV2A 4BO3A 5HP4A 4DN6A 3U4IA 3BZBA 4NMWA 1RZRD 3INTA 3OEHD 3PNYA 2XJ4A 3AILA 1O6ZA 1RHMA 1TM1E 4DA9A 1BRMA 1N78A 3C1UA 3BMNA 1QHSA 2MINB 2XDQB 1F5SA 1QOPB 4N5MA 3IUSA 3DOFA 3FPJA 3RKUA 3SJCA 3THRA 3PQFA 3ZLTA 2XBUA 3LL7A 4S24A 5LKAA 3BHNA 1PLKA 5EIBC 3AEUA 2EJVA 4J0IA 4DR4B 3HXPA 4QRDA 2HA4A 3T7RA 4TYNA 1Y4SA 4MULA 1MOZA 2DFLA 4QFBA 4W4TA 4RQBA 4YQZA 4H1WA 1IOZA 3ZU5A 5EJIA 5LSAA 1F20A 2AX4A 2M32A 1FTYA 1QS0B 1Y3IA 3A0RB 3HADA 3RBXA 1DTSA 4QDKA 3TR6A 2MJLA 1E2UA 4GI2A 3EPJA 1S3FA 3ZU2A 3RRZA 1KTVA 4JQSA 4YV7A 1QTNA 1Y1SA 4OF4A 4WOPA 2X13A 4EG1A 4D1YA 1VMAA 3KUCA 2E1PA 2GYUA 2F1IA 2V5VA 4JI4B 1ZSYA 3JS5A 5FO1A 3RARA 5CH8A 1WM1A 4I5GA 4AJ4A 1D6NA 1Q11A 1Q21A 3KAJA 4HGQA 1U3FA 4DDUA 2ZUCA 4RD2A 1J0AA 3ZQ6A 1XVLA 1E64A 4YMIA 3GMDA 1R3UA 2IP4A 1PGPA 1U1EA 5L3ZA 4FDLA 4ODIA 5C2JB 1W5AA 1XTZA 1E20A 3JYHA 1P74A 1FDSA 2VRWA 3PD7A 4I9NA 1HYEA 2PZKA 4JKIA 3QLVA 1FE8A 4R1OA 4RF3A 4ZRNA 3OCYA 3ET5A 5JR3A 1HR0B 2G9QA 2W2PA 3FE2A 1XZHA 4KGXA 5FOWA 4HNGA 5AUQA 3CNNA 3TB4A 4ZP1A 1EFKA 3BRWA 3D7SA 5JZ9A 4DQKA 4P80A 5E0OA 3NC4A 4EEKA 4KE6A 1NQVA 3UAWA 5BN3A 1YJXA 3H16A 1WU8A 5IC6A 2VF5X 2QT9A 2WWRA 4KFSA 5TJ9A 1KWKA 6REQB 1GTRA 4AO8A 2IHJA 2NUTB 3L7CA 4QUJA 3V4LA 4K6FA 2E9SA 2A7QA 4OQLA 1RQPA 4CM3A 4OQEA 1QWSA 1FZTA 5DTEA 3OPMA 4G3XA 1H3FA 2YHUA 4GT1A 4NLLA 3G0OA 2VP5A 3OM1A 3Q9LA 3HRIA 5KDLA 1BWSA 3L7JA 3DQQA 2B34A 3Q5DA 3UGQA 1E7RA 2B6NA 4I8XA 3L9XA 5EUQB 1XYGA 1J0EA 1PNOA 3RU3A 1GFIA 1Q1AA 3I76A 4HYTA 4MRNA 3VR5H 2ERCA 2NVUB 1ULUA 3EARA 4G4SP 4HGZA 1Z06A 4W9NC 3J7TA 3K35A 5EIHA 1KAHA 2BD0A 4EYQA 1RJ9A 3FPLA 3VPCA 5JOQA 3ZXXA 5BSTA 1KBZA 3G02A 3OPQA 1IDN1 1FB5A 3T5TA 4ZAFA 4PNPA 1JR6A 2Q5CA 4RMGA 5DTJA 1NDQA 4GLLA 1TZBA 2AXEA 5P21A 1MN6A 3EIOA 3TQCA 1L7RA 2H2FA 3R20A 3EUEA 4WBNB 5A4AA 3RM3A 2XIQA 4WI1A 1TZKA 3GUCA 1SQGA 1UT5A 4D0GA 5LLTA 3E84A 3LP6A 4LJ4A 2V7QA 4KX3A 3OQBA 1G5HA 3JQQA 1NN3A 4WCFA 3GRAA 4KE9A 4HR7A 3ZY4A 4EQ6A 2ZBRA 3QF7A 2NSYA 5FWXA 4BBJA 1LW6E 2I3GA 4XH9B 4EGJA 4MPJA 4FI3F 3RIMA 2XMQA 2YXPX 2F9MA 3OM9A 1V11A 2DEUA 4JV5B 4WXMA 2CY0A 3BFPA 1CR2A 1T25A 2JIOA 2P35A 4JJ4A 4EFNA 3WFIA 2X7JA 1E6WA 3WMRA 1IU9A 1KI1A 4GKKB 3U4AA 4IHJA 3FFXA 2R1TB 5FPSA 1DC6A 1E4VA 2FYTA 4YTEA 5CCXA 1E7WA 1OHHD 1SUBA 1TKAA 5EJ4A 2IZ0A 4YRBA 1XBTA 1WW2A 3EXHA 2QLTA 3TTUA 3VYTB 1FS4A 5CPFA 1WXWA 3Q7IA 1WNTA 1W44A 5DHSA 3EXG2 2KJQA 3NVAA 1G5IA 4ZU3A 3GUHA 5G40A 4YRMA 4FMDF 4MDFA 1ORHA 4S0XA 3ZWYA 1ISRA 1AO3A 1XCBA 4NHOA 1GG2A 3O7MA 1AF7A 4U6SA 4HTFB 3EQ2A 4XQGA 4E70A 1SA0A 4DT1A 2D5IA 3CCFA 5JCPA 4EAQA 2DX7A 3H5VA 2L19A 3KNZA 1TF7A 3FTFA 3KYJB 5D5QA 1KS9A 5DGXA 1PX0A 4XSVA 3ESBA 3M5CA 1I6MA 5B2FA 1ZVJA 4PYKA 2GERA 5T7BA 1Z2PX 1MT3A 4FFWA 2PT7A 4O5OA 4XYEA 3TNJA 3KZNA 1K63A 4LYYA 1J4AA 1EK0A 3DNMA 3P7MA 4MQ6A 1RWKA 2F9LA 3WGQA 4D74A 2H1SA 3FNEA 2A0WA 2JFZA 2JI6A 2WSBA 4CM5A 2E49A 1M1YE 1O96A 2CXQA 4H4EA 1TYDE 2FZ5A 4ND8A 4B35A 2H1VA 2R8BA 4F3NA 3AR2A 1AXEA 3UJCA 1C9EA 3N8HA 4HRAA 4N03A 4H1UA 3CB2A 4F60A 1E6KA 3SHQA 3ANYB 3AHEA 1OB2A 4TS1A 5UKDA 4EDHA 3KZXA 4XCVA 4M9XA 4POAA 2X0EA 3W6NA 3PR2B 4RGVA 5BW5A 2HJSA 1G0OA 1O95C 5DMHA 1F8UA 3P2JA 3E8XA 1TM4E 1JJ7A 3ZUGA 3BDAA 4CMIA 1I4OA 3P9RA 4R8MA 1I4DD 1N5KA 5DBHX 5DRYA 2QAIA 2GRAA 4HEQA 4YPFA 2JD2A 3T06B 5KOJB 2R62A 2WWIA 3ESRA 3M8KA 1T0PA 2N46A 3ND6A 4R7ZA 5TV2A 2XZLA 3DDZX 2P41A 1DG9A 1ZOPA 1QWOA 3K0SA 1EA7A 2BWJA 4EW1A 1H2BA 2WNSA 4FS3A 2QD3A 3D7RA 4E21A 2DQSA 1J8VA 4XD2A 4LY0A 4MMYB 4YMUA 5ICCA 3P71T 4XX1A 3REFA 2K2QB 3FF1A 2LZ0A 2V98A 2HRBA 3B6EA 3K5WA 3PQ2A 3M0EA 4MI3A 4A1FA 4B84A 4E94A 4OK5A 1B23P 4KACA 4BMZA 4GUAA 1Z73A 2CLHB 3N86A 1OWPA 1QOZA 2JA1A 1GLNA 4O4IB 1TFUA 1ZD2P 2IYZA 3SN6A 2JGAA 3TE6A 3U40A 4V1CI 5HRAA 4F12A 2X2FA 4KMOA 1KO7A 3F2VA 3VAAA 3AOEC 4MO2A 4DC9A 1T4GA 1V47A 1GADO 2IUYA 3B52X 3BGDA 3G0CA 1V7PC 3A6DA 1LJ8A 3AOGA 4KFTA 5DXFA 4P5EA 5JI3E 1V4BA 1XJQA 4MPTA 5A7HA 1ZHOA 2F67A 2WUEA 3IMKA 1LBQA 2OMEA 1L2TA 2QWXA 4N5DA 3BMCA 1RXUA 2P9ZA 2OORA 3GRZA 3N0WA 4LOIA 5JBQA 2BJHA 3OIYA 2J9XB 2J0UB 2QOEA 5J59A 3T7EA 2VP3A 2XZOA 2RC5A 3KQPA 4N6OA 5E4JA 4ZT4A 2WVGA 2RIPA 3ZQJA 2BH2A 3VOAA 3FFAA 3Q11A 3KV3O 3WRXA 3QU7A 4LE2A 2CXNA 1AT1A 3T6KA 3AHIA 1M6EX 2BGNA 3PDIA 3Q3GE 5ILGA 2NVOA 5L53A 2JVKA 3UMCA 2IXBA 2R00C 3WA7A 1JE0A 4HQ6A 3AUSA 1OV6A 5CCEA 4PLYA 1EUQA 2NYVA 3R44A 1V1MA 4QEDA 2ZRPA 4LHZA 1L5GB 3JQPA 2JD0A 4A2PA 5AW4A 5IMBA 3A9WA 2Z08A 3WGMA 3IEVA 2IYAA 4FT4A 5AVRA 3QENA 2ZWVA 3BEDA 4MVJF 4RE5A 4R1QA 3C3AA 1X1AA 1GDHA 1DOHA 4K6CA 4OBWA 4R8LA 4JGGA 5SZHB 2EZUA 4BQPA 1NRXA 2VG8A 4LF5B 3GJQA 1U3CA 3IB3A 1A9TA 1J2UA 2PSJA 3G8YA 4PTLA 2JL1A 1C4WA 4NV3A 4LFBB 3KL2A 1YZUA 3I9KA 4JP8A 4IYJA 4OY3A 2QAJA 4ZD6A 1DIGA 1F17A 1X15A 2IY7A 2WFAA 3E70C 2Z9BA 5A71A 2AKEA 1WZ2A 3V42A 3EZFA 2OT3B 5F73A 1BX3A 3WK5A 2B82A 2IY8A 4JVMA 1SCDA 4ENQA 4OSEA 5EIBD 2PKCA 2EOAA 5DFAA 1GNRA 1E2GA 4MAFA 3AZQA 5F9MA 4G0VA 1VLHA 1YKSA 2R66A 3OU2A 1AQNA 4RLFA 5D6NA 3RVRA 4M8KA 5KYTA 2H3EA 4R69A 2B8JA 5KOHB 4ALJA 1XEWX 2YV5A 1U1GA 3ECSA 3KUUA 4DHEA 2GPBA 3H99A 2Q3LA 2AC2A 4LCEA 3HDHA 2PZMA 2Q21A 3O4JA 5FP0A 1EJ0A 5ITWA 4NZMA 1T91A 4ARBA 5ITVA 1H4SA 2FWBA 4EATA 1KEWA 3JQDA 5KYNA 3A2KA 2QZ4A 3BZWA 2WY2D 2E18A 4MWEA 2G6BA 2VPWA 1NT4A 5A4MS 4R1SA 4PPNA 2GZRA 2ZYSA 4JJKA 1L4HA 5KX5B 4TRJA 4D8XA 4ARZB 2OM6A 4WA7A 2UXBB 4R1PA 5G0TA 3CX8A 4C08A 4BY9E 1GUAA 5EMKA 1JDBB 1CS0B 1RZVA 3KVOA 1JN0A 4ARSA 5CFPA 5KHLB 2ZULA 1BGWA 4LCBA 3TZQA 1WLSA 3MRVA 4BNHA 3U56A 3S55A 3EVDA 4ZHQF 1C3JA 2QMEA 1LDEA 2QN7A 3MJEA 4PQFA 1U8ZA 2VUHB 5AI6A 5CIYA 3GUZA 2QUHA 1TAHA 1Y33E 2CW5A 2GJSA 4FHFA 3GB9A 4ZCMA 2MMCA 3TIGA 1DDIA 3DWIA 4MQ5A 4B6RA 1M5TA 5EMMA 1RABA 1YFLA 2O6HA 2ZRJA 5J47A 2HBRA 2J4DA 3F7TA 3HR7A 4FE3A 2JZOA 1X9GA 5CNIA 1NAIA 3NHRA 3V4ZA 4UVIA 4J2TA 2R60A 1BTOA 1RDFA 1R8JA 2EJBA 4N7MA 4RHFA 2DHDA 4B83A 3NXKA 3R5FA 3HWSA 5FWYA 5FTLA 2ILVA 5DSXA 2AN5A 4KAFA 5DXAA 4WKPA 2BCEA 2V6MA 4A7PA 1HDCA 3ITEA 2BMVA 1G5PA 3CH4B 4OJNA 4UHHA 4F5EA 5MFZA 4C1BA 3RBZA 3H6HA 1Z8HA 4UCWA 1ZJ6A 4B9AA 3MGGA 1Z0DA 3V1MA 1QHIA 3K2BA 4P5PA 4JYZA 3K5IA 3EFHA 4B6JA 5D7BA 3T52A 5EJ5A 2OESA 1PJQA 3TW6A 2YDXA 1PYDA 3GH3A 3WICA 1N5JA 2Z57A 3MIIA 4BEWA 2JDID 4MYCA 2R8PA 3PI7A 3JAWA 1DQSA 4JITA 1PEKE 1WUKS 3T5BA 4D02A 4RH0A 3UWSA 4QOGA 4XDHA 4AO6A 2JJ1A 4QXMA 5JRJA 3G5AA 1OH8A 3H87A 4X6YA 1W35A 3V2UA 4UAJA 3OOYA 1CUGA 1T2VA 4RMIA 3JZFA 3L6UA 3IOEA 1I01A 4U7GA 4BLQA 4U02A 3B85A 4F9GA 3VM6A 4XOUA 3ZZMA 3E2MA 2NW6A 2QLNA 3VVBA 1NLYA 1U2QA 3CW9A 3PEWA 3TB6A 1CJBA 1KAQA 1V39A 5ED0A 3FW1A 1CDOA 4QJIA 1II0A 3PWSA 2WV7A 3ZWMA 4IMIB 3G9XA 4BRWA 3AQIA 3C8ZA 3IESA 3A3YA 5EIEA 1MAVA 5ALXA 4X62B 2NADA 1IQPA 4GKBA 2XDYA 5A3VA 4DY4A 1JYSA 2NYUA 3QVTA 4KB5A 1FBNA 4DR5B 1F2UA 2QD5A 3DBHB 5HIJA 3D1LA 4EUFA 3CRQA 3IJEB 4ZT2A 1XJ5A 4V1CB 4S05A 4FZJA 3KEOA 1CF2O 5EE5B 1OZGA 1Y8RA 1AGXA 2YWXA 3D81A 4IHAA 2XHZA 3H5RA 4PEVA 1U0RA 3RTAA 3SEAA 3HJGA 3MMXA 5HCUA 1FTQA 3UT6A 1OIWA 3QKSB 5KNDA 1R0WA 4G84A 3AX6A 4DDKA 1KI3A 4ISCA 4CF4A 2O50A 2EW8A 2YJZA 3FFBA 1HETA 3H2BA 2GPNA 4JGBA 5I48A 2E4XA 2QGNA 3FWHA 3JQFC 2HIAA 1SHKA 2H18A 4HMOA 2RGNC 1RPAA 4B0PA 2RH8A 5CFMA 3EZ9A 1DKPA 3EF1A 3CNEA 2DPHA 1YS7A 4BB9A 2V97A 5IJ0A 4N65A 3BXZA 5HZKA 3TQIA 1PD1A 1A96A 1YZQA 1KNXA 3RS7A 4C5AA 1I4EB 1OI7A 5J1TB 1K7FB 2D0OB 1ZK4A 3KZCA 2WSIA 3TIFA 1I3NA 2QVLA 2NZWA 1G8MA 4DG9A 5IBQA 2SKEA 2ZRDA 2QRHA 1QO0A 3LX8A 3GLGA 5LLSA 5BMVB 2E4YA 4LCJA 5CNJA 4YJFB 1JV2B 1NP7A 2GCOA 4EYGA 4N0DA 3RAEC 2BY4A 4WLEA 3OP4A 2ZTHA 1V6AA 1VGRA 3C3CA 4OP1A 4YX9A 2QRNA 5FX2A 5MF6A 1SD1A 2PK3A 2FE4A 4XB2A 1W52X 1KEKA 5J23A 2XW6A 4RD0A 1H2FA 3JAMA 1I13A 3FB1A 4DV2B 4MIKA 1NONA 2RK4A 3W7VA 3H3JA 1M2OA 3L7KA 1EVJA 1P39A 1BCRA 2I99A 5H8WA 1XD9A 3GZNB 1PR5A 2C1XA 2GTPA 3K72B 1DDOA 1RKQA 4LZWA 1FCJA 3MJTA 4P35A 4EO4A 4FWIB 2LXNA 2CVQA 2O7NA 5BQPA 4YAJA 4OP3A 4QYIB 3S1LA 4I7EA 3F9CA 1QIGA 1PUXA 1N0IA 1HEYA 1GITA 1X19A 2DWOA 2P9FA 3O73A 4LRXA 4UM9D 3B8HA 3ORQA 4DARA 3RWBA 2FN9A 5FV4A 5GVSA 1C29B 3GIWA 3NHPA 4TWBA 4S1PA 5G4LA 3LLCA 5T3UA 4BRZA 3AWDA 1I5RA 2W5UA 2WAOA 2V7VA 1U0FA 2HC9A 1RSZA 1WPRA 1YZFA 2H31A 2P4UA 4QFDA 5EE3A 3WP1B 1IBCA 1R4AA 1X1BA 4WW0A 4J0EA 1NQAO 4MS1B 3ZW9A 4M9ZA 5GJVC 4LYEA 1ADYA 1SVOA 2QUAA 1Z4JA 2HRQA 1OREA 1TCAA 3PIRA 3QWBA 1RBYA 1I7NA 4V03A 4CDRA 2DLCX 3I0NA 4DLAA 4DTIA 1TVMA 1RJWA 1GFZA 1TD1A 2A9OA 3C3KA 3CLRC 1ZESA 3LCJA 3WQHA 4EUNA 3HVRA 4K1LA 1T8RA 2DR3A 3RODA 4M9QA 1L7QA 3BXFA 4XLZA 1A2KC 4AKGA 1QRSA 1X8JA 4JOQA 5BVHB 2VUIB 1PWZA 2HA7A 4I4NA 1P31A 5TARA 1T5LA 5DB4A 2HYIC 3AM1A 1EYZA 2L69A 5AOCA 3LCRA 5KBYA 5G2OA 2HSEA 4KBFA 2HU2A 4PC2A 4RTJA 2RE8A 2GBLC 3TE7A 1ISPA 1Z6YA 1GZ5A 1JPUA 1TZJA 1YNOA 1OXKB 2OV2A 2DSTA 4OQDA 2OAGA 4NYMR 4M7WA 1EP1B 2QZPA 5CBKA 1NIPA 1T1SA 3DGFC 4KQMA 4UC0A 1A7AA 3B7GA 2QB5A 3EF3A 3PQ6A 5I9MA 3Q87B 2FUCA 4YT2A 4MP6A 1QVAA 5JCJD 2IXFA 2W11A 3FUUA 1SWVA 5G0WA 1FNNA 5DYYA 2ZR7A 3ETGA 1KI6B 4M89A 3QVOA 1T1IA 1MNQA 4F3YA 1IDOA 2ONKA 1BKYA 1YGPA 1N2CA 2C92A 2M98A 1JZTA 3JWIA 4XX0A 5FF9A 1LDMA 3PENA 4RJLA 1DQRA 2IHYA 3D54D 1C9JA 1NG1A 4HLQB 3ZBUA 1M8FA 2GK3A 5SZJA 3DDOA 4KQFA 4YJ2F 4K3VA 3PKZA 4GZMA 1IWOA 4MSUA 4O4LF 1S8NA 2EBFX 1I30A 4WNYA 5IJ9B 2YRXA 1GPBA 4ZOAA 5DNCA 4DY6A 1GAWA 4JCOA 2GH1A 4YMHA 4X63A 3KLNA 5HZMA 2JIZA 1JWLA 1UJBA 2PVSA 1AQUA 3B1YA 5LMNB 2QSUA 3RSSA 5IJAA 4B71A 3IV6A 1P1IA 2LGJA 1A5SB 1PHRA 2GTIA 2WTXA 3N75A 4LC9A 5DRTA 2Z2IA 3OAAD 4CWAA 1T4CB 4O5AA 1WCIB 1W5SA 2EFCB 2X9VA 3F6EX 3LU1A 5BQ5A 2PFSA 3JYPA 2WFZA 4GYYA 3UXHA 3NHKA 1BVRA 4FKMA 4QEZA 1S2IA 1YVPA 3OJLA 3KR0A 1ESCA 2EW1A 4OGLA 4ZXFA 1S2MA 4E3ZA 2J5QA 4HAVA 1ZN8A 1H9CA 3DB1A 1BWQA 5DIFA 1JPJA 2VYFA 4CF7A 3H65A 3HJNA 1QBGA 5DN9A 1JIKA 4UAGA 3AB3A 3B5EA 3UOGA 4KN6A 2GDJA 1PL7A 5EN4A 4Y2TA 2HUPA 2NM0A 2Q5IA 2XIJA 2QRLA 4L2IA 4TSKA 5GGXA 5H02A 2Q2NA 3KRTA 2BFAA 2A4KA 2H1IA 2QVBA 3MUNA 4ZU6X 3KXLA 4ZC1A 1JBQA 4GD3Q 3DMRA 1FLNA 2VP2A 4UVDA 1CRPA 1DHRA 2ILTA 3CKYA 4BKQA 3Q15C 3G0BA 4W6QA 2BR3A 2Z2YA 3D4BA 5FUXA 2EFHB 5KS2A 1L4GA 4L9RA 3PEUA 2V1UA 2Z5LA 1JHYA 4B87A 5IZCC 2BI7A 1YJCA 5I4BA 1JIQA 2X14A 3AJRA 2JCXA 1XFAA 3N0XA 4J49A 4BAZA 3R5JA 2GN2A 1CZHA 3AO0B 1IVYA 2J9GA 5BV0A 1UQTA 1DO8A 3EVGA 3MLEA 1H8EA 1ISSA 3ELBA 3EW7A 5AHRA 4Q00A 2FPPA 3FYHA 5ALGA 5BSEA 1MCZA 4RK4A 2VJMB 1XD2B 3FKSA 5HF5A 4ZZ2A 4GI1A 1YGYA 3S7ZA 3HG7A 3NBQA 4RF2A 4DRYA 1HG0A 4MAMA 4AY3A 2P6RA 2CHGA 3TOVA 4C0QC 3CVWA 1NXXA 3D6TB 4TRRA 3G8DA 4DZZA 3H2SA 1Z12A 5EA2A 3BIFA 2GPJA 3EE6A 4JX9A 4JQOA 3HYLA 3BCUA 1HOTA 2BFEB 1KU0A 4JIMA 5FUBA 4DA8A 1F3LA 1H3NA 4FW8A 3A05A 3V7NA 4KP7A 4XA8A 3CKMA 4CKBA 3W79A 3QU2A 5DTRA 5FYQA 2F8SA 4EAAA 2XUQA 5IDQA 2XTMA 1KXZA 3EBPA 1UT6A 2J9FA 3PQDA 4MQ4A 2V0GA 1SC4A 2OCBA 4JWTA 1BXZA 3SM3A 3D1JA 4GW3A 1VHWA 1PT6A 1PLJA 3NHWA 2PIAA 2BFDA 3VGPA 1YR6A 4FQ5A 4Z86A 1AJEA 1CY1A 1KVUA 2QLLA 3QG1A 2HMYB 3ZW7A 4FMDB 2C4HA 4XD7A 4F11A 1TMOA 3BL5A 3FVWA 3GJSA 4JYMA 5AVWA 5HSGA 2VOEA 4OX9B 2UZ1A 1AUPA 1IXSB 1UOPA 4BQRA 1G42A 3Q8XB 2PBRA 4TQAA 3QE9Y 4KYVA 1USVA 2FPGA 2ZVDA 5BXYA 1M74A 2I78A 4MX8A 4RPJA 2ONJA 1JG7A 4LBVA 3L05A 5CX4A 3ZHOA 3A6PC 1CB0A 3LD9A 1KDTA 3COWA 5JYEA 3ANSA 3VTZA 1WSAA 1X8LA 3DXFA 1NI4A 3I2YX 1S1MA 3I73A 5FAXA 3UA3A 3ZTWA 1X7XB 5F5XA 1Q6YA 1MGPA 5DDIP 1EKXA 1TYEB 3C24A 3HV0A 3HR4A 4J2OA 2GXSA 1GZ7A 4NFYA 4DC0A 3K05A 1A7UA 5EXTA 3DXXA 3CG0A 1JEYB 1ODLA 1ENOA 1VTKA 4JVNA 4URUR 3IVGA 3LHKA 5WRFA 1UDBA 1HYGA 1OFUX 2OO7A 2ZK7A 3EVFA 3PHHA 4MGIR 3COPA 3EZNA 1Z82A 1FFGA 4KRXA 4OXQA 4TLAA 1QKIA 3K73O 1F60A 5GM1A 1U81A 1D4AA 1MIHA 3BCSA 1XTRA 3HCWA 2Q5HA 4FUTA 4NCIA 1UC5B 1YQWA 2D59A 2P2DA 4M8NE 2IOYA 4MHOA 4XEUA 3UH0A 4ERXA 3D3KA 521PA 4HEA6 4KO4S 5IP5A 4CTJA 2AXPA 5EZQA 3RASA 3RIYA 2ANCA 4UHCA 3ONVA 4AIIA 2XCRB 4R7GA 3LQ1A 5BWBA 1KSFX 1SD5A 3DCNA 3HJBA 4ID3A 4FBLA 3RS8A 3UTCA 1LQ2A 4UXJA 2VQ3A 1FTGA 1LK0A 5TJHA 5FI0B 4TXHA 3JX9A 3ZJTA 3DWFA 3R6DA 1X2EA 2C2XA 5A3RA 4EPWA 2OGWA 2ZJ0A 5JS7A 3ACDA 1DINA 4EFLA 5FBZA 1VE5A 5KQRA 1BDIA 5EWMB 1Z4KA 1I2CA 1TQ6A 2YXBA 4RSMA 2D2VA 1NC3A 2JPDA 4I9UA 4J8PA 1NOIA 3GVXA 1QG4A 3IA2A 4P0TA 2RC6A 2ZSEA 1SBQA 3JD2A 1W2WB 1R16A 3VNUA 3KR1A 3LCVB 5FORA 1O89A 3RBVA 4J7UA 3CU5A 3CZ4A 4CT5A 1TCBA 1RWVA 1Z6ZA 1Z7GA 3EK2A 3QEKA 4QHSA 4K1XA 3O1IC 4Y0VA 2G08A 4RAQA 4CQMB 4BUCA 4ZVVA 4CEHA 3LCMA 4ZI7A 4DSUA 3ZGYA 1Y7PA 5AUPB 3GT7A 3ZJYA 4IFBA 4FYXA 1YZHA 5A5FA 2Y93A 1ZN9A 5L4LA 3V6LA 4MW1A 3W6OA 4X65B 2WJVA 5FR1A 5EHQA 4AP6A 4P7JA 5LXTF 2JFNA 3AVPA 1L8AA 3VKUA 2RHBA 3HWWA 2OCPA 1M2JA 1SBNE 3B3QA 2W90A 2IV7A 4N8DA 2PIDA 2R8YA 3BMNB 4ENWA 5DWVA 3UJNA 1Z0ZA 4G9EA 1NVEA 2ZI9A 4WK2B 2XTZA 3BWXA 1XQWA 3F71A 4C04A 5EZYA 1XAGA 4JCCA 4J1TC 5FD8A 1JPNA 2C0CA 2AOWA 3AEUB 1E92A 4UXIA 3UB2A 3OTWA 3SK0A 2AOXA 1U7WA 1R15A 2BLLA 1URPA 3L4BA 4KJXA 1BX0A 4Z9AA 3RC9A 1A5TA 1HI9A 2BF4A 2KS6A 3L0IB 2GM9A 4LHWA 3CRNA 3H1BA 1T6YA 2PUFA 4GM4A 4GWKA 1YF3A 2UVPA 5EP1A 1GJRA 4O4HA 2DT5A 3CF4G 1A7JA 2YYYA 2QHXA 1CY6A 2V6FA 5A7FA 2K4MA 3LMKA 5AI4A 4AKTA 4F2GA 1YB5A 3TF5A 1LK7A 1ONBA 3CLRD 2E37A 3QW4B 4OI0A 3KJXA 2A94A 4IUCS 4GMFA 1P73A 4ND4A 3WLAA 2CDNA 4D3SA 2G80A 3K5HA 1KZ9A 2IIQA 3T41A 2ATIA 1W6UA 3M6FA 3PEEA 5KTNA 2D7CA 3X1YA 1ZDMA 3K0HA 3OSUA 5A4IS 4YAEA 5IUJC 4XJTA 5ITZA 4AZWA 5M34A 1ZMTA 1EK6A 4UPVA 2PGDA 4H0CA 2RK6A 4DADA 1QQ7A 5KU1A 3D7NA 1FQWA 2WF6A 3GCZA 4KW7A 2A67A 1R5JA 3T9CA 4G0WA 1QHHA 1XL0A 2OG1A 3QX9A 1WOMA 3D4OA 3PQ7A 3T7TA 1WPGA 1V35A 1QIEA 1T2UA 4ESEA 5MN5A 2O6LA 1FP2A 3QZUA 3GLRA 5AM1A 3H1AA 1X1CA 5BN3B 1EE9A 3UY4A 1NX6A 1QDLB 4YALA 3KZMA 1V4NA 4YDQA 3WGUA 1SH7A 3VR4D 1J49A 1N2EA 1E69A 1ULZA 3HUDA 1J8FA 3JQCA 3P0FA 4FSXA 5GY7A 1SC6A 3FHJA 4E5UA 1EDBA 1Q3HA 4E6EA 1AB6A 2ATCA 1ZMRA 1AKQA 2C82A 1D2NA 2PSSA 4HNAA 2WC1A 5BN1A 1TQ2A 2Q6OA 3OICA 5KCMA 3DO6A 4MUBA 1NZFA 1I1NA 1Z29A 2A5YB 2OXCA 2W8ZA 1JZSA 3MW8A 1TKCA 4FMPA 4JEIA 4MA5A 1ETHA 3W5HA 5CT9A 2C7OA 5JDIA 5BV8A 1CUVA 1XJ0A 3DOIA 2WMOB 4IOJA 3QM1A 5AUOB 2D3WA 1OOEA 3MPUA 4PVDA 1RLJA 3DHNA 4GPZA 4AT1A 4A2QA 4DIOA 1SXJC 4Y2HA 3GLHA 5EWJA 1FIUA 4ZO4A 1ONNA 1JI0A 1RJ9B 3L07A 4EY5A 1O97C 4DREA 2FMTA 4EMSA 4KFUA 1D4OA 1IUOA 2E89A 2BI8A 4WFIA 4WNCA 4Z5XA 2W22A 4LF7B 3U1VA 1HFJA 1Q12A 1XKLA 2XNDD 3PE6A 3FYDA 3DP7A 3TQSA 1W7AA 5EHZA 2FPIA 2FWMX 2A9QA 1R4MA 3KB1A 2FMKA 3OLVA 3RU7A 3M4ZA 2H4FA 1XE3A 3DBLA 4IXNA 1WVMA 3LSYA 3SEFA 5BWOA 2EJTA 5JE8A 3PD0A 3WI7A 1UBFA 3SYKA 4WCFB 1EHYA 1NXTA 4B7CA 4A5OA 1EGHA 1YFJA 1YBHA 3JQRA 1Q7GA 4M54A 2J31A 5FHRA 3KAPA 4E14A 1IPHA 2ZVQX 3RVOA 5FWXB 4IZ6A 1OROA 1QIIA 2AVNA 1A8UA 1E62A 2QI9F 3KSAC 1V11B 1VMDA 1GCUA 3RSHA 1QJCA 4CFSA 2GR9A 2FU5C 3C7CB 1KJ9A 2JFOA 3AF6A 4IJKA 5INTA 3IT2A 3FOWA 4DQDA 3QEBZ 2AFHA 5A6VA 4EB0A 2OM2A 4E5NA 1C7RA 4N8EA 1WG8A 4IHJB 4RLQA 4Z7OB 2V7PA 1JIVA 3N70A 2RI1A 4IIJF 4MOWA 3C4JA 3GV0A 3HZHA 1X14A 4ABYA 4WLUA 4CRWB 2FN8A 1U94A 3LS2A 4ZT3A 4EUSA 4HK4A 3F7OA 3OUZA 1G3UA 3EXHB 1WCV1 4QNNA 4DCSA 1U7XA 4F0JA 2GETA 3IKTA 4QYXA 3M6WA 3GJ4A 1WZNA 1PD0A 3L8MA 2NLOA 3C3EA 1D2RA 3LBIA 3NHZA 4HOYA 3HA3A 1T8YA 2M1ZA 3O92A 4L8YA 4PIMA 2AK2A 5CDGA 4K9OA 1TI7A 1J42A 3W6PA 3Q2IA 2IYQA 1B26A 3NVKI 3EJWA 2NSHA 1UPXA 1DNPA 3CF6R 5KNBD 2ZYAA 1HQCA 1SKUA 1R6XA 2POQX 4UAVA 1Y8QA 1SA0B 4DT1B 5CMLA 5GOZA 4F38A 2YHIA 5GOTA 3GCGA 3WQBA 4KEAA 4DAEA 2C7QA 3PC8C 4UQPA 3WL5A 2EARA 1Z17A 3OTOB 4F3CA 1KO5A 4ZYTA 3HZOA 2IELA 2PX0A 2PO5A 2W37A 4WXHA 3BHIA 4A92A 2ES4A 3RV4A 5ESRA 2OP0A 1IK4A 1O96B 4TLBA 1E6CA 1SUSA 1VBNA 2G5CA 1C14A 2X4IA 3N0RA 4ND8B 4XI9A 4Y9UA 3UJ3X 5CB0A 4X93A 3AY3A 2A1TS 1IZ8A 1QKJA 1SCIA 3B2QA 3BIOA 1R00A 1QIMA 3ZLVA 2NN3C 4P7KA 1C30A 1FC0A 5FBRB 1SG9A 3TXAA 4TKUA 3W2EA 3W2FA 2KI5A 3MTEA 5JNRA 1L4KA 4PPYA 4CQLA 4HGOA 4FE7A 1L1EA 4LDRA 2LCFA 1YIOA 4PR0A 1KQNA 3ZLAA 3A9CA 3DC7A 4K9LA 3I2GA 3BILA 5G1OA 2O3TA 4LRSB 2C98A 5B1DA 4CMIB 1S2GA 1K8XB 2HJ9A 3VSCA 5HOEA 2EX1A 3PU6A 3R09A 5K8IA 3RVJA 1ZG3A 4Z2YA 1ZHFA 4CM9A 2O3QA 4Q3EA 2R6R1 4NE2A 5LZ8A 1Y1QA 1HH4A 3AM5A 5GV7A 3M6XA 1GZSA 5AI8A 3P9QA 4JP5A 3BCHA 1Y1PA 3F8SA 1SKYE 1Y3AA 2DFVA 3MLBA 1JSLA 3G49A 3Q3EA 4CL3A 5K9ZA 4EVQA 2GM4A 4Q34A 3JALB 5LZ4A 4EKDA 1IN7A 4IIDA 5DGHA 2VHVA 4NY1A 2J3LA 1CZUA 1E1MA 3D6NB 4IQ8A 3CNBA 5HE9A 4DDMA 4UQLA 2JHAA 2Q46A 2ENUA 2ZP1A 3AVQA 2AN3A 2HRCA 1JJAA 1WZUA 2H16A 3LF1A 5LOVF 4KIFA 1LX6A 2XQVA 3QXGA 4YT4A 3JQ9C 1YRAA 4GX0A 4L9SA 1OWNA 1Y8AA 1EHCA 1NP6A 2EHJA 3GMIA 3HJUA 4PZ0A 1V1RA 5DTQA 2BZSA 4GXTA 1TCUA 3VR3D