1XAJA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
352
structure length
337
Chain Sequence
b'MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDINVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
total genus 119
structure length 337
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xajA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xajA01
1JPUA 1NVDA 3RF7A 1XAHA 1NVEA 1XALA 5K8CA 3OWOA 1NUAA 1NRXA 1SG6A 1JQ5A 1JQAA 5EKSA 1NVFA 1KQ3A 3UHJA 2BL4A 5FB3A 1TA9A 2BI4A 1XAJA 3OKFA 3QBEA 1XAGA 4RGVA 3CLHA 1NVAA 3BFJA 1VHDA 1UJNA 3OX4A 3CE9A 1VLJA 1XAIA 5HVNA 4MCAA 3ZDRA 4QGSA 2GRUA 4RGQA 1O2DA 5BR4A 1NR5A 1NVBA 3HL0A 3JZDA 1OJ7A 3QBDA 1RRMA 4P53A 3W5SA 3ZOKA 3IV7A 4FR2A 4RFLA 2D2XA 1DQSA
chains in the Genus database with same CATH superfamily
1QHSA 2P9TA 1PT5A 1Z4NA 3DYVA 1R5NA 4NJEA 3ORFA 2YFHA 3C4JA 3DBLA 4FGUA 3M8KA 3TGWA 4DMGA 5I9NA 5IKEA 5L95A 4EHFA 2IIVA 2ZW9A 3IAHA 4BKPA 4MRMA 1NJ6A 1ZIDA 5D3ZA 2FR8C 4GEGA 4TV9B 4D8YA 2CEAA 3ME5A 4LGVA 3E9ZA 3ASZA 4O4JA 4LC1A 1OUMA 2MOKA 5I3ZA 3KTFA 3DAGA 4RK4A 4HMQA 4TSFD 3DAOA 4X8OA 1I51A 3L7AA 3VU9B 3QH4A 3K8OE 5ESXA 5AMXA 2D1YA 3AUUA 1FMTA 2O8CB 1UEXC 1Q1ZA 2J3DA 2QTRA 2OZLB 2P4EA 2X5NA 2ZYTX 4FQ8A 1KH1A 4TXNA 5KAPA 5AVQA 4JWKA 2HZ7A 4M0EA 2EKDA 3SKXA 3N2KB 1GPH1 1ECJA 1XCMA 2YYYA 5CEEA 3FOCA 4IY1A 4XPIA 1KEZA 4KRYA 3TINA 1M54A 2AFIB 4F1JA 1VCIA 4HR7A 3CKYA 2PKQO 4OJYA 1G20B 3WGUA 4RMIA 1PD0A 4IEEA 3FTQA 4HTAA 1AUXA 1VTKA 2O0JA 2QBYA 1CRWG 3RS0A 1UFQA 5KWSA 3OCUA 1EUCB 1QUFA 1RTTA 2WHQA 4W1QA 1MB2A 5AK0A 3TQOA 4UZFA 5IMSA 2XGGA 3KZNA 3U4AA 2I3GA 4P4GA 5FPKA 4QXRA 4JP8A 1KDYA 3T95A 3IVGA 3WRXC 4DPKA 4PC2A 3R0ZA 1LPOA 1M2VA 1Q57A 4OHKA 1WPXA 4UQOA 5HKKD 1GFIA 3U13A 2M98A 3LDGA 4L74A 1EX9A 1F1BA 2AG6A 5D85A 4BQNA 4C7JA 4QG3A 4K2AA 3WE7A 3JQ6A 5TDHA 2Q4BA 3QLEA 4HQLA 5ALSA 1U2DA 4GOND 2PMFA 3CE6A 1OZHA 4PFJA 5JJIA 3ZK7A 5DBIA 3A9VA 2C2YA 2X77A 2Z5FA 1ZIXA 1NIJA 1W76A 4H7EA 3P2IA 3UAVA 2IBTA 3RIYA 4U7GA 4M55A 5DI9A 5GIOE 4O4HA 3LJKA 4OJKA 4OM8A 5L51A 4RULA 3ITNA 3UAOA 3G2PA 1BCSA 5EI5A 3HCPA 5TT1A 3V4OA 1D7OA 5JXGA 4ISCA 3C98A 5IK2D 3MRTA 2GILA 2FEXA 3L0DA 2MSKA 4UUPA 1WXFA 1RZ3A 2P2NA 4DV2B 5LOVB 1DKMA 3GGGA 3KPWA 3NHRA 1FU7A 3WGMA 4UHKA 4J76A 1BD3A 1FFAA 2W4QA 2L17A 3BWMA 1IZ8A 5KBYA 1A5BB 3K20A 4RDXA 3U4QB 4BAZA 2XUQA 1SXJC 2V8BA 3ZLBA 4ZZ0A 3P4YA 1G6KA 5EMHA 4RE5A 3USES 1RLTA 1D2RA 2BMVA 2NSYA 1N7HA 5FIUA 3FFBA 3S70A 1CR1A 1E1DA 1M34B 3IV6A 4UE6A 4I50A 4DYHA 1J0DA 4HKTA 4IOMA 1BG6A 2JAWA 1B15A 1PR2A 3LX5A 5KX5F 2VJAA 5KNCA 4K6MA 4LXGA 3W2EA 1XTTA 3KZMA 2B99A 2J6CA 4QAQA 1AOXA 3Q7SA 3U48A 1T4CA 2YKGA 4ND1A 1A9RA 2FZKA 2YS7A 4H3VA 5F7OA 1DHRA 3FZYA 3WMWA 4EG7A 3LGSA 1G66A 4EELA 4H7HA 2LKDA 3ZOKA 3AHEA 4K87A 2OCPA 3CZPA 3FMOB 2CXTA 3N2GA 4LZOA 4PYQA 3HSYA 2FOIA 2J0UA 4RK0A 4ZANA 4ESHA 5AVVA 2VYFA 3Q2OA 1U2GA 1C3OB 2OQ2A 4UTVA 3JWGA 3RVLA 2ZOSA 4PZYA 4E7OA 2DU8A 5EEHA 1VE3A 2PKYX 1VFPA 4MAAA 3Q0IA 5KHLB 2X6TA 4V02A 4Q1EA 4N39A 5JAHA 4D6XA 3DXFA 1H05A 2ZDHA 4PS0A 2P2LA 3TPZA 5HZGA 5D7BA 2ZWPA 1RIFA 4NKRA 5T67A 1OBFO 2Q0XA 2JA2A 3CA8A 5EERA 3UJHA 3RYCA 1XN1A 2NXNA 5FOVA 3OQOA 2B8JA 1PWXA 4RHUA 3KV3O 4TKUB 2WQZA 2H18A 3JQ7B 1YRQA 3T3HA 4KHPB 2ZJ5A 3GCDA 4GICA 3QFSA 3UJBA 2O07A 4L0QA 4PSAA 3TFWA 4DLXA 4A36A 1WO8A 4RTSA 4KAJA 2C84A 3AIIA 1HE5A 2BJWA 3OCZA 5CXSA 1ISJA 2I6UA 2XXJA 3CEAA 3MOGA 4ACBA 4K9SA 3GLGB 4KAAA 2Q7OE 5F12A 2YRFA 3ZJ4A 4R1OA 2NTYC 2A1UB 2H63A 3MJRA 4WZZA 1BNCA 1M1YA 1OFUX 1T2DA 2XMRA 3VJMA 4UNNA 1YVDA 3UFXB 1C0PA 5JS6A 3QE9Y 3OECA 4LNHA 1FLVA 1XZQA 2EP8A 3LXMA 3OUZA 4YDRA 3VPXA 4NENA 4BB5A 4GQBA 5E4YA 1D2AA 2Q29A 4HI0E 4OYHA 5AM2A 6ABPA 2O3SA 4ANFA 2GA9A 1UWVA 2AXNA 5CVVA 4B5KA 1PIWA 2KB0A 4KLCA 3LT0A 2GEVA 1JJBA 2ZR9A 2HNAA 5KPDA 4WCDA 3RREA 5JU6A 1W19A 2PL3A 3TTVA 1TEHA 3HP4A 3P52A 4EFLA 5CT5A 4BZWA 4FJ2A 2X0FA 4XRGA 1YDEA 4YQEA 3FW1A 1IJBA 721PA 2OXRA 2XB2A 1EVJA 1BH6A 3BL6A 4V0ME 4J0CA 5FO0A 4A5SA 2CXQA 1DGQA 4AJIA 4CEJB 3ROQA 2VJMA 2WJGA 1II8B 3Q72A 3CT6A 4W1PA 5KVAA 4G4SP 2W48A 3I2FA 1KS9A 1DEKA 1NY6A 2P65A 4HEA1 3WLFA 3UYLA 1Y4SA 4D42A 4E1VA 3VR0A 2D8AA 2C57A 1TTPB 2XNHA 2Z1MA 3ROFA 2NUPB 2OGUA 4I66A 3UENA 5LB4A 1ESMA 5KYWA 2X58A 4CEIA 2O8EA 1R6DA 1F9EA 1PS0A 4HXFB 3VDMA 1LZKA 1KJ8A 1EDDA 1BA2A 1CUAA 2QN2A 4HEA6 4I14A 3RU9A 3W5UA 1I6WA 1QG4A 2OBFA 3C3MA 1GO2A 1WP4A 2E1RA 3GB9A 5DTMA 1FP7A 1Z8DA 4NMXB 3NJRA 2XZLA 3DLPX 4X71A 4LJKA 3VR6H 1WSBA 3BSWA 1VL6A 2VH5R 4OB8A 3UH1A 2EBWA 3L49A 4YT4A 3NNNA 1L7QA 3PKIA 3I83A 5EZ5A 2B9VA 1AQUA 3NGXA 5H70A 5TPWB 1E64A 4NE7A 4L5YA 2RCNA 3IKJA 4ECEA 2VPZA 2CD9A 3CYFA 3JVVA 4YPOA 2C5FA 4RPIA 3JQ9A 3NBKA 2AT1A 3MS4A 2QAGB 4XM1A 2XTZA 3G0DA 4RF3A 3T4EA 5IG2A 1Z63A 4B4KA 1PT6A 1UK9A 2CF6A 4PANA 1D6MA 4YRFA 3ZU6A 2NU7B 5HKLA 1TTQB 2A57A 3L8DA 5B55A 3F5MA 5KYUA 1CUEA 2Z2JA 3EDYA 3PTZA 3BHIA 4RU1A 1T6YA 1V43A 1FPQA 1MBZA 3AP2A 3NTVA 3TM5A 1VL0A 2ERXA 3LU1A 5DYIA 4EJ2A 3S1SA 1BHSA 5E6RA 3ZPXA 1LRJA 1M33A 2A5GA 2D62A 2VQ6A 1A2BA 5TV2A 2VLBA 2IYUA 4MHSA 3VX3A 2HRRA 1AU9A 1D4OA 4M4SA 2IIQA 3HCFA 3AY6A 4IQ8A 3N6VA 4WOBA 4A0FA 4KUHA 2PJUA 3TX6A 2ZRDA 1H1TA 3CISA 1KIMA 1ZSVA 4IHJB 3UM9A 4LF7B 2C99A 3M5WA 4L5BA 2DY0A 1I7NA 2YZMA 3OZAA 1EHCA 5A3SA 3BQ9A 1C30A 3B1YA 4GR4A 4Y2QA 4YUVA 4LOHA 2K2QB 1LPBB 2FEOA 4MV1A 5JMTA 3DL7A 3DKVA 2WD9A 1B8PA 3I6YA 4DPLA 1Y3DE 3ITDA 2VUIB 3H3FA 2JGDB 1ZCJA 4PWZA 2WFLA 3RU7A 2HJHA 3TOCA 3O94A 4UAJA 1VDMA 2XRFA 5CCDA 5AI9A 3F96A 4JSTA 4TKMA 4WLEA 3REGA 3SLGA 5AD1A 1E99A 1Z6QA 5GONF 5E0KB 3SBEA 1WLYA 5HE8A 2HXSA 4M37A 1JALA 1DWUA 2CBGA 5E6UB 4BMVA 1EFTA 4PGFA 2J5RA 1YI0A 2E4WA 2BIFA 1ZH8A 3RRJA 4AJOA 4YV2A 5EWJB 1SVUA 1IY1A 1WZNA 2BM9A 3I5UA 2QX6A 3TK1A 3KE9A 5CRIA 4GMGA 2PZ8A 4OHBA 4UBMA 1OYYA 3D54D 2B2XA 4LI3X 1JKJA 3E53A 4KMSA 4RTMA 3TMAA 5ALDA 4EPVA 3O8RA 5HCUA 5ILQA 1E66A 4US0R 4NDZA 1SQ5A 3HN2A 1H3FA 5AKGA 2JVIA 3IL2A 3L92A 2NSLA 5HG0A 5DZSA 1S01A 4YRLA 4LHWA 821PA 2VJLA 4QBHA 4LXIA 3OQMA 4BVGA 4EMTA 1Y6ZA 4CR7A 4YCMA 3T1HB 4R1PA 2Y0CA 4JEUA 2RGUA 3PI7A 4KZKA 4XKJA 3LW7A 2I33A 3AKCA 3RUPA 5AK6A 3AUXA 4DSAA 3I73A 1KBQA 2O9JA 5ALEA 2IDZA 3C3WA 2QR5A 4MB2A 1BO6A 2GXSA 3L18A 1EFPB 5KOJA 1M6HA 4WZ6A 4LBYA 3R41A 1X9HA 1J2UA 1W0JD 2RHRA 2XTAA 3EGXB 3G6KA 5F5LA 3HJUA 3DBOB 1ZDMA 3ZH9B 4JXJA 3CWCA 1QX3A 3WQHA 2JKYA 1XU4A 3ANYB 4FT2A 2POQX 2C92A 4V24A 1IHYA 1TM2A 2GYVA 4Q05A 5ES3A 4KP7A 5FTWA 1BWQA 1CK4A 3LF2A 4BGEA 5TF0A 2CCJA 4RY2A 3LRPA 3AJ9A 2Z6VA 5AJXA 3OCCA 5EIBD 1UMBA 5FUVA 1ODCA 2OFFA 4YRQA 4KXMA 4OGGA 3RVQA 2PD4A 2GZAA 2WJAA 3A4NA 1YQQA 3C3KA 4QWMA 3R2JA 1JDJA 1XCLA 5JDCC 3SF8B 3QMPA 5JDIC 3HPQA 2GD6A 4DR5B 1GG9A 4EJ6A 2O1XA 4ZO7A 3WLQA 1FDRA 2AXEA 2YN4A 4F04A 1U8AA 1UIMA 3QU5A 3RIGA 1KMIY 1A8IA 4DCVA 1BXKA 3QMMA 4TLDA 5B2ZA 3VGPA 2F8SA 1BWSA 3QFTA 4UJ5A 2NM0A 5KEIA 3A4YA 4TZTA 2ZUEA 2VJCA 4MS3B 3QFCA 1PYGA 4EMSA 1A71A 5C81A 2NYVA 2QJRA 3IALA 1ZNQO 2A5DA 2XA9A 3SQLA 5SYAA 3W5VA 3M2PA 4B2IA 4J16A 3OEHD 1O6FA 4D43A 4P6VF 3O7WA 3ZUPA 2VYVA 4DA0A 3FWYA 4ZVLA 1ZA2A 3UHFA 3CNLA 3ASVA 3GRKA 4HH0A 3ACCA 3N1UA 2GEFA 3ANMA 3ABIA 4JJKA 2BI4A 3DA8A 3OY7A 4IAOA 4J2OA 4R1MA 3GHHA 4OFZA 2Q2WA 1P2GA 2LIPA 2F8MA 2XWSA 4CKCA 3AR9A 3ZBQA 1YB2A 2AA3A 3UXEA 4ZQEA 3S1AB 1ICEA 2AHOA 5CJ2A 3AUAA 4TT8A 2WTBA 1EA5A 1ZD5A 1Y6JA 5ER6A 5BN5B 4D4MA 1PUJA 3EFOB 5IJ9A 3KQNA 4UQLA 1V7PC 1DAFA 2JS7A 1ZNWA 5EQFA 5GV7A 3RH0A 3KB1A 3D3JA 4NFLA 2B1QA 4KI0A 5IEBA 1VSVA 2VDMB 4AULA 1GVHA 3V1KA 1Z45A 1XTIA 4TQ9A 4Y1FA 3ZXXA 4F2DA 1EVEA 1Z3CA 2WTMA 2YC2C 3CH5A 2EVWX 3G0CA 2LW7A 1XNHA 4FMPA 4JELA 1E7MA 1ADFA 2C9CA 3KZOA 2BP7A 4Q4AB 4QO8A 4PO9A 2GNPA 1V35A 2HRDA 2B61A 4YXFA 3MMZA 3WLHA 3ZX5A 4QQ8A 3NMUF 3ZDXB 3R74A 2WWXA 2F64A 4MNTA 3I76A 5HZKA 3FPHA 1EE2A 1P0CA 1HDCA 4MICA 3B8EA 1MNQA 4XIFA 5JJ5A 2PUBA 3GRAA 1W88A 2NV0A 4IIBA 1JG1A 4MWBA 1U7OA 3TYXA 2PMBA 2ZIEA 3QNMA 3EOAI 2DECA 2BONA 3ZK8A 1U94A 4G1MB 3TSWA 5YASA 1OWMA 2GERA 2GPYA 1G7RA 1N2CA 4WY8A 1S2MA 4N4AA 1G9SA 5AJWA 3DFUA 1SKMA 1UZUA 3CY6A 4J6EA 4P9NA 1QC5A 1XGKA 2BFAA 2Q62A 1J9ZA 3LDAA 3NT4A 2Q3HA 3A9CA 4HWPA 5CU7A 2JH3A 5DTQA 5SZIA 2ACEA 1LBHA 4LZNA 2BT4A 4FGJA 1EM8A 4JLPA 4YAFA 2W0SA 3Q3HA 2C1EA 2JLQA 3SM9A 2YC4C 3MMSA 3S28A 2ORWA 5LU8A 2QRKA 3V2HA 3MTDA 4DT1B 4AY3A 1KYXA 1RWNA 3MQ4A 2Q2NA 3TD6A 2Q5EA 3MCTA 3E1GA 3PA8A 1ML4A 4AURA 1P2UA 4H6XA 3O74A 2YVKA 5IX8A 1WDMA 3VC3A 1AUPA 5DBOA 1E7QA 5KNCD 1C8KA 3EC1A 3QX9A 4X3CA 2IF2A 1P5RA 2IYQA 5JFGA 1JR3A 1TZMA 1OV4A 1MABB 3KKNA 1QGUA 2VPTA 3H2YA 5EHQA 3WX0A 1V11A 1U5CA 2R1TB 3E9MA 2AV6A 4GL2A 4OIMA 3MWGA 5HP4A 3PUWA 3QPBA 5DBGA 3TZEA 1Q7CA 3EIEA 3R8CA 2X8LA 1ZHFA 1XMQB 3R7LA 1NONA 3ZVRA 1Q20A 4WN9A 4ARZB 1NJ8A 4RVNA 1SUEA 1Z13A 3QOXA 4GGPA 2JLVA 4GSLA 1ZJ5A 3DR3A 1UR5A 4C04A 1CS4C 3SYNA 4COKA 3NC1C 4G5FA 1QV7A 2NLOA 4KOEC 1R4NA 2Q1WA 1I2AA 3ZVLA 1S2OA 2I4LA 4AXBA 3M6IA 1VLLA 1W4RA 3K35A 3LFTA 3LY8A 4KSCA 5REQB 4Q3OA 5JO0A 4ZU3A 2V5AA 4NCJA 5JYCA 3SDBA 2C8VA 1H6CA 1Z39A 2ZJ4A 1V71A 3NASA 2CHVA 2WJHA 2AD1A 1RW4A 1G9TA 1KA9H 2B21A 4OFXA 3AOGA 2G5PA 4MV0A 2Q3JA 3DVLA 5DHSA 1UKEA 5G40A 3IAAA 4Z3OA 1RYYA 2NZVG 1TO6A 3A1FA 4B7AA 4MDHA 4OHYA 4D3XA 1RKBA 3DZDA 2P30A 5HGJA 3ZEAA 1CNFA 2GO7A 3N2EA 5FT9A 4N47A 5FNVB 1VHTA 4DHWA 4JU8A 4LK3A 2O7SA 5H7XA 3OD5A 2WZDA 4IF4A 4XJXA 2PKWA 4DOMA 5C7YA 1UDWA 4E03A 1FTWA 2JFBA 3KKLA 2F3TA 4GR9A 2VCHA 3SC2A 1OWNA 3AFNA 3IPRA 3PT9A 4ZAWA 6YASA 3BD9A 2CZCA 3S2FA 1G7CA 2ANCA 1WXDA 1FEZA 5ESDA 5BOSA 4WDRA 4JB2A 3W8NA 2YMMA 1E2FA 5BSWA 5CB8A 4FGZA 5BYKA 4NZ9A 2YHUA 2OHGA 2NP6A 2X4LA 3ZV5A 2Z5GA 2FK7A 4LS3A 4IFBA 1OY1A 5F4BA 1EXDA 5FA5A 4DF3A 2HA3A 1E6EA 1UXJA 1CNEA 2EKZA 1BE6A 5H3CA 1Q19A 1W4LA 1YNOA 2Z5VA 3CZAA 3LV8A 3REFA 3QSYA 1OGYA 3AK4A 3CF4G 1XROA 1D5WA 2O54A 2BZGA 3EZXA 1ZM9A 4JC0A 1GGHA 4O4HB 3ZZ0A 2PZLA 3V4ZA 4DC9A 2EFYA 4RK6A 4MW2A 4ZMSA 4F8JA 1DUIA 1W4AA 4RLFA 1F8YA 2YY5A 3HM2A 4UCWA 4XFDA 3UB2A 3WMFA 4AS3A 4EG4A 4NMLA 2Y6UA 3EFEA 3O4VA 2M6RA 3HNRA 2O6LA 5LQAA 4PC1A 4NU6A 1VKJA 1G5TA 1XU7A 1YS2X 2SKEA 4I7EA 4JOBA 5FR1A 5B3LA 4GHWA 2OOKA 3F6RA 2WB4A 2VNSA 1A7JA 2PX5A 2KLHA 4FSXA 4UCXA 5CA1F 3JWEA 5DHRA 2ZVPX 2SICE 13PKA 2QJWA 3K5PA 2PNJA 3AZPA 3AM5A 1MB3A 5CTAA 2A2ZA 1E2MA 1G8HA 4F72A 1FQWA 1GUYA 4MA4A 3W5HA 1X39A 4DRZA 4EARA 1SU6A 4B87A 3KFXA 1P74A 1B8NA 1ZJYA 4Q21A 2FJ0A 3VFDA 2ZZNA 2WDPA 4DLVA 3DL0A 1ESDA 1WXWA 3UWPA 1P8JA 1IY2A 4RTRA 3DHNA 1V37A 1E3IA 3TRJA 3AUYA 4RETA 3WBBA 4UOZA 2AUNA 5FWDA 3HU3A 1B23P 5DYNA 4B3JA 3KETA 1W30A 1U3GA 4TLLB 4W8GA 1C9NA 3DZFA 3NETA 4J7UA 1TYDE 4NZPA 5FNZA 4ZEWA 3TKLA 4CT0A 1HY3A 4JL8A 3DMTC 5AIAA 2R85A 3PGJA 4WBNA 4X6LA 1ILWA 1K7XB 2EJVA 4Y2PA 1KTIA 1LSOA 3COZA 1SBQA 1XPUA 3MTEA 5GY7A 5K4HA 5LFAA 4BNNA 2OV3A 1WOYA 3R20A 4HWRA 3F73A 2ZEJA 4L51A 3GFPA 5E2IA 1TE2A 2NX2A 1UPTA 3VXKA 3WGTA 2A9JA 1J8DA 3D6FA 3M3HA 3NDJA 2PJRA 3BPSA 4UTPA 4YLYA 2AH5A 3GQVA 4C9BA 1HFKA 1VZ2A 4JI8B 3NVMB 4IXMA 4IVNA 3LXRA 3B3FA 5E7MA 1DSSG 4Q00A 4EATA 3X2EA 1NW5A 4JT4A 5JCJA 3EXHC 3WYNA 5F3WB 3O73A 3L4JA 1V1RA 3EGVA 2Q5CA 1I3CA 3ZGVA 2PEYA 4QUGA 2OCIA 5JQWA 4QJIA 3RWMB 3TLKA 3WKBA 3H16A 1JV2B 4PYOA 2BC9A 2FPLA 2CL7X 2I1WA 4P7FA 3WP1B 3SIXA 3ANSA 3DDCA 1ZR4A 4U8GA 3I1IA 5JVDB 4L6AA 3EQZA 1XDDA 4FFBB 1ULTA 4O2AB 1ACMA 3PK0A 3C7AA 2B98A 3JD3A 5AUQA 3DVAB 4I55B 4JUIA 4QUBA 3RPEA 4AS1A 1IZ7A 1PTJC 3OZWA 4X8LA 2D1FA 3BIJA 1JDSA 4XYMA 1ZXLA 2DFTA 5DYWA 3HXPA 3CVXA 2JLCA 3E4CA 1JG4A 1WJGA 5KVVA 1KMHA 1YR8A 5FLYA 2ATEA 3FWHA 3FCSB 4HH4A 3GO4A 1FRZA 4RYLA 3IKLA 3E58A 5EJ8A 3OIUA 4LRQA 2EP7A 3GJYA 4MCIA 4ZVPA 1XTUA 5LA6A 2A5FA 4F4CA 3AVXA 1U7XA 2GPWA 4FX5A 4RQBA 3G5TA 3WGHA 1TEXA 4E21A 1W36C 2J6HA 4Z0TA 4Q3CA 3PX3A 4OL9A 4B73A 1NXOA 2YHIA 5BMVB 1KP3A 3IE1A 3ETLA 1FLAA 4HGNA 5KYNA 3HBMA 3JALB 4IIGA 2NXWA 2EHJA 3B38A 2YXBA 1L9XA 3A6HA 2IS1A 1NYRA 4GRAA 2RE8A 1OH5A 4G81A 2IEIA 2J9GA 5FTNA 3ZHYA 3ZU4A 1EB9A 2N75A 4E2YA 2J41A 4DDTA 1N2SA 2A58A 4LVOA 3W6PA 4A2PA 5CDFA 2F3UA 5HCNA 5EJ5A 3EGIA 5C34B 1PX0A 2VDQB 3ETGA 3JASB 3WIUA 1G21A 2IYRA 1U7HA 3GJ5A 2A78A 3BHNA 1DLIA 3M2TA 2G0AA 5BSGA 1YMQA 1JDNA 4IGFA 4XLTA 2VS1A 4I1OA 5JNTA 1MC8A 4FILA 1FFGA 1Z5ZA 3THYA 3WK9A 4B09A 1TTTA 1LK5A 1T2AA 2W6IA 3QVUA 1NVAA 2AZMA 2C88A 2X8JB 3RS8A 2W2KA 4UHCA 2XLCA 3F97A 1DG3A 3STTA 3AL3A 4EHDA 1U7UA 3AHDA 3OA0A 4XWOA 1VBMA 1WMBA 5AJHA 3BE6A 3OC6A 3U26A 3KUDA 3HJTA 3L5OA 3P2EA 5FYQA 5JR3A 2J7PA 2GM5A 4N5IX 3ESZA 1PTKA 5SY4A 5KDOA 1Z0JA 1JHPA 2RHBA 3LZ6A 1ZJWA 4ICIA 2D00A 2W2NA 2ECOA 2R8YA 2RAPA 2ZYHA 1C1XA 3H2KA 3AVOA 2OLKA 3H8SA 4HJRA 4QDZA 5EWMB 1AUOA 1NQTA 4J2HA 1PGNA 4JS0A 3VZQA 1RXSA 4Q9HA 4INJA 1HYGA 1D4AA 2E5WA 3BFVA 3PSHA 4RIGA 4A6EA 1XRPA 1UBNA 1RXEA 1F5SA 2Q0QA 2AUMA 2WOJA 3AF4A 3UV3A 2R8OA 3KQOA 1VRWA 4YJHB 3KHSA 2G0NA 5FI1B 1H6AA 1I2CA 2G6BA 2VYVD 1PK9A 4EY3A 5KVCA 1WHTB 4GPD1 1YZ3A 1W9HA 3TQCA 4RE6A 1R1DA 2NG1A 1JHVA 5HDQA 3ROTA 3U7QA 4E3WA 2JGAA 5DLDA 5A9SB 1VHLA 2AQHA 3FPBA 2ONCA 4IUCS 4ED9A 3H9UA 1TUEA 1LPSA 4QLBA 1CETA 1JUDA 2HLPA 5C4IA 3MTAA 4WGFA 5HS6A 2BYTA 5J1SB 3I4LA 4PHHA 3E9DA 5F5XA 3N0VA 3JATB 3ASUA 2V65A 4OOFA 1K4KA 4C0SA 2C9BA 1CZOA 4PLWA 3N7AA 3M89A 4M7RA 1B76A 1DCMA 2O06A 1MTZA 2PX4A 5AVJA 1LCIA 1B6SA 4IFEA 3DTVA 1K89A 4TRMA 3TSAA 2I29A 5JSZA 1H94A 4UDYX 4MYHA 2GETA 1CQJA 4BLUA 1R6TA 2NVBA 4IMIB 4UZEA 4Y6OA 4XWGA 4WNIA 1GNVA 1MXFA 2V0NA 3LUKA 2TSYB 4LMPA 1PNRA 3BT7A 5FPPA 3OQ1A 4E4TA 2XQGA 1JWLA 1YHNA 5DTIA 4H0CA 4D96A 1W59A 2VT6A 2L69A 1R4MA 1RQ7A 1YCFA 1EUZA 2X0EA 3D0QA 3FDZA 3FMFA 3MYRA 5KTRA 1IUKA 1WZUA 1FS6A 2FPPB 4P4NA 4CIAA 3RIHA 1ZCZA 4FYKA 4AICA 3CLHA 2PGDA 3KZCA 3R5TA 1W5TA 1PQ4A 4OXYA 4BP8A 1IN6A 5IXYA 4RJKA 2REQB 3VYTB 4OHCA 4DBLC 3W2HA 3DLTA 1FMLA 1X7WA 3H2JA 1I7PA 5AW9A 4MUXA 1JG3A 2NV2B 2O0HA 4C0WA 2NU6A 1E89A 1RBQA 1XF9A 2ZBPA 5JH7B 1UCFA 1UM9B 2C3MA 2QRHA 2G5CA 1JFRA 1FVOA 2PBRA 1PO7A 2PFGA 1HYQA 5F1PA 4X64B 3C87A 4IJKA 5EMJA 4YPFA 1QGOA 1TKRA 1P7CA 4DV5B 3WK8A 3N0WA 3M4XA 4FWTA 1UWCA 4FR0A 2R84A 3L8HA 4CMIB 2D1TA 2OP0A 3OMLA 4FU0A 4LQDA 4XUGB 1UC9A 1M10A 1TMYA 1WF6A 2HDHA 3H8WA 4HK4A 2G83A 3AESA 3HMQA 1S8FA 3D7LA 4JGIA 4MP3A 4RPCA 5C8ZA 1UT5A 4DZRA 1WDLA 3IP5A 1P80A 5H4GA 4P8RA 2OMKA 2IYYA 3NB0A 3W6NA 5GTDA 1K86A 2VDLB 4Q1CA 1YU9A 3EVAA 4BNYA 5KQPA 2NZWA 3CU5A 4P81A 2NMVA 4QRHA 1U3CA 3MTGA 1S3IA 3SZLA 3VKWA 3U6BA 2UUAB 1CJTC 1RKXA 1T5IA 1JR3D 3PWTA 4UUOA 3JARB 4X8HA 3UK1A 2Q7XA 3GA7A 3E9CA 4C29A 5EINA 2BFBB 4KWIA 3ZU5A 4TN5A 2FQYA 3TRFA 3CINA 3QPUA 2PIAA 3WB9A 3N07A 4O4LF 2V1UA 5BN4B 5IN5A 3VPSA 1J4AA 3WV5A 8AT1A 4BQSA 3W1VA 1WD7A 2GFQA 5KNDA 1FRFS 1GTMA 1RHJA 3PPIA 2J3JA 4YIKA 5AJUA 3CPJB 2DB3A 1G19A 3PGLA 1L7PA 4CDNA 4GBED 4CCSA 3JYOA 4U9IS 1QUEA 4QODA 3W7VA 5KOHB 4IO1A 1U1DA 4PNHA 3DV2A 3ZWOA 4BMDA 2OHIA 2NIPA 5TJHA 3VYVA 1Y3BE 2GFHA 4L4RA 4CNQA 4PX5A 4TLEA 1I0IA 2GPJA 4RANA 2H1FA 4W6ZA 3SKVA 5K01A 1Y1QA 3R4CA 5DEOA 3PFNA 1FMCA 1SBYA 4N8EA 4Q4LA 4WBNF 2CLEB 2UUBB 1DPGA 4UHFA 2MT9A 3K70C 2A84A 2ZRLA 1MC4A 4UXIA 2QQEA 4PZEA 1JDTA 4CMEC 4WVFA 1JHUA 4HS4A 4EJMA 4E31A 3H5AA 4CQNA 3D8NA 3PP8A 3VO8A 2BLNA 5LD2C 1K5PA 4S1WA 3FVWA 1P2TA 3KKQA 4P4LA 2IXAA 1AZWA 2JBAA 4ZREA 5L3ZA 4D4GA 1G3IA 1H23A 3KEOA 3ZE8A 2Z8ZA 3EODA 3W6ZA 2NYRA 2XCUA 3SPXA 1VKOA 3A14A 4AYTA 3RYFA 3K8YA 2N47A 1NNI1 4LYHA 2WSBA 2ESRA 4RSMA 4D44A 3ISJA 4LRUA 2BHRA 4OJNA 3G2QA 4S3MA 4BFCA 3JQEA 3IPAA 1O94D 4KO2S 3NHLA 3CJQA 2ERCA 3JQAA 4E1BA 2UXCB 3VMFA 4LYJA 2AGVA 1OU4A 4RA6B 4TLAA 5BRJA 3IP8A 3JQGB 1XCPA 3GNLA 1EK2A 3EOBI 4FOLA 3MSCA 4OHUA 1W1WA 3ESBA 3PUIA 4Q1BA 1S2LA 3Q7EA 1QO0A 2RC6A 2G72A 3GCZA 5AM5A 1AHPA 1U8FO 5IBPA 3SBXA 4WAUA 4BQIA 1JXAA 4D26A 5EJEA 2EW8A 1X3LA 2WUFA 2XDQA 1XJ0A 1Y0BA 2WIJA 3A4TA 3C15C 3OIWA 3QVTA 1D2HA 4G0PA 4JQYA 4O3FA 4V3BA 4L75A 2QW1A 4HLDA 4DIDA 3EH1A 5ALGA 3PXBA 1Z4OA 2VTVA 1T8YA 2HNKA 4X61A 4PLZA 3TXYA 2XHEA 5HW0A 3L1IA 3AGQA 1Z6AA 3RBXA 4F5ZA 4KO4S 5KMGB 5CFNA 1TA0A 1RQLA 2I3BA 1NLMA 3A58B 3GNTA 4QECA 3HYCA 4BRWA 2W90A 3JYNA 4BTEA 4D9JA 3WADA 4LG1A 3KKEA 2JIQA 3FBGA 3FJ1A 4MKZA 4P7GA 2A88A 3RV3A 4ZT2A 4UOEA 5CLJA 4BN5A 5JZVA 4HGQA 2RJNA 3CUKA 4FCVA 4WKBA 1KKUA 1LLFA 3ZHCA 2AKEA 1O6CA 3HH8A 2N46A 2GAAA 3K5HA 4TXHA 3GGPA 1K06A 3F46A 5DGHA 1EMDA 4RVDA 3U9TA 1WKBA 3B6EA 4M1ZA 3RC9A 5C3UA 3FM9A 2QD3A 4I81A 4S35A 3GROA 1WB9A 1N8NA 1PAUA 3IIKA 1O77A 2Q6IA 3BWXA 2AFHA 1PLLA 3QVSA 4ZT6A 3CEMA 1VMEA 3RASA 1MXHA 5K03A 1MVOA 3VU9A 4R9VA 1B00A 3IDFA 3OZBA 3INNA 3WLMA 2O8CA 3JRWA 1PQPA 2OZLA 3DAHA 3STYA 3GELA 4CODB 3N2KA 3DD1A 4MPDA 3AEQB 4N76A 1P9LA 1JQKA 3OFNA 3TPFA 4EAQA 1BJRE 3EZYA 1ELOA 3UJPA 5HRAA 4HDRB 4PPNA 3IQHX 2O8NA 4RY8A 5TSDA 2OXTA 1TCUA 3BMCA 3G6WA 5JTTA 5HUHA 4JCOA 1XG5A 3C3XA 1XEWX 3W4JA 3QMWA 4RFSB 1YR1A 2VHXA 4XDZA 1K3FA 1CR2A 4F4HA 1IXRC 1EUCA 3F6CA 4H1UA 1L5MA 2QWXA 2YDXA 2QDKA 4BMPB 4ZOQI 4M98A 3JR7A 4YJ2F 3R8XA 3RJTA 3ESCA 1Q3TA 3T4PA 3UCFA 3MMNA 1QNLA 2M1ZA 1G41A 5CBPB 3NHJA 1K6EA 3O95A 5DIZA 4H0FA 3GRRA 1VG8A 3O84A 4G8BA 3X44A 5K0GA 5DEIA 5JCJD 1R0CA 1WV0A 4EFMA 1ITZA 1DRVA 3DLAA 3Q9SA 2ZE6A 5CP8A 3RVOA 3S55A 1T13A 4FKBA 2P6NA 1NVVQ 4IIJF 5LDGA 3UVEA 4DW8A 1YZQA 4D9HA 1MN6A 1T6BY 1CDZA 3FUTA 4LHSA 5GJCA 1I6MA 1XXHE 2UDPA 4CXMA 1AHHA 1NN1A 2WJ4A 3DLBA 3PGXA 1SUPA 1L8XA 1YQGA 4J75A 3Q1LA 3TKYA 2WMYA 4X95A 4IH1A 4DLRA 2PT6A 1H8HA 2P6PA 5CX1A 5TNXA 4LXXA 5B7QA 4MGEA 2H9YA 4UEQA 3RDPA 2OMEA 3WRXA 2IYXA 4KDRA 1P2VA 1BS2A 5CH5A 2V7PA 3ZCTA 2YV1A 2ON6A 5HK9A 1QXSA 3S2IA 4ZOCA 4PYJA 1SG9A 5CA0B 3MUFA 1NF9A 1VL5A 4OBEA 4YJ3F 1CYEA 3NHFA 4BO6A 3O38A 4IFIA 4URZR 3BJEA 5LZ9A 1PJ2A 5CB4F 2ZSJA 3LVQE 4JJFA 3M4NA 4ZFNA 1RE1A 1A0OA 3QUAA 4CJXA 4PG8A 4BVKA 1M34A 3BXPA 5ITZB 4MQFA 4D4JA 4WESA 1RHUA 3CJTA 3V48A 1MV8A 2V98A 4AWXA 4BV3A 1SQ0A 5CW1A 1X70A 2PV0A 4OL0A 2QTWB 3W6OA 3BMOB 3H1FA 3KXIA 3B1VA 3RV4A 3WYAA 1SBTA 2EKLA 2XVZA 4N8DA 3H05A 4XQGA 5ED0A 3WLTA 2CLMB 4DWJA 3VDQA 1YFZA 3BIFA 3PHHA 5DBHX 1AD2A 3ZIUA 4MQBA 3DNFA 1GA1A 1SXJA 3P1JA 2W2PA 1LS1A 4HX5A 1SELA 1T2CA 3VPFA 4EKIA 1D0VA 3TSCA 1ZXBA 1URPA 1C3OA 4BBPA 2EJUA 2OD9A 2PA3A 2R44A 3H5WA 3O2QB 2FW0A 5I4IA 5KSYA 4Q12A 1G98A 3DMYA 2B6NA 5BV0A 4D8UA 4MSUA 2I91A 5KNLA 1W94A 4PQGA 1DZIA 4DC0A 2FDCA 2RH5A 4ZOEA 4OUKX 2XE6A 2QVLA 1H2BA 4NCIA 4EHBA 4D4LA 2W6ID 4DLZA 2GXUA 1XZFA 3DMHA 4WEQA 4CGYA 1AZSC 4WOPA 4X3OA 2IVZA 3JYPA 3KVVA 4G9BA 4R5MA 2GUWA 2QUHA 4ZWNA 3M1AA 1RPTA 4CT4B 5ADWA 1KQNA 1M9NA 4OMUA 1FS5A 4WUTA 4BWVA 4DY4A 4AZSA 3PR3A 3QWBA 3JQ7A 1FTYA 4JLBA 5EJ7A 4LDNA 2V1XA 2HIMA 4JROA 4DQXA 4EKEA 2K4MA 1Z4QA 2QE7A 1IBSA 3GLRA 3LUHA 2Z9CA 4QDKA 1PSDA 1TUBB 3F3SA 5EWLB 1OX6A 4N7BA 1BRMA 1QYVA 4KR2A 4FI3C 1IM5A 4C7XA 2JFUA 2AZXA 2CLIB 2FX2A 3KJZA 1VSQA 4URUR 3AKEA 3HDTA 4N82A 4P3OA 2WW8A 5IUKC 4GS5A 1UOEA 2ZI6A 4WJZA 4R9UC 1BAPA 1CDDA 3JYHA 5IM4A 1O6BA 4E5DA 1AMNA 1NF3A 4XCQA 3NRBA 3H11B 3G2IA 4IKEA 2IYOA 3DEZA 3LVBA 2G77B 3F0TA 4U02A 1JKFA 4RPKA 1RLJA 3AUSA 5CX4A 2DHQA 4LQCA 3V8EA 2RGXA 1Y80A 1YRAA 4OSOA 4XAQA 2HB6A 2JCYA 3IUBA 3I64A 4BNZA 4HO1X 3OTHA 2IUYA 1KI1A 4C7VA 4QOGA 2X0RA 4PZCA 5EJAA 1M2HA 4ZPXA 3SYRA 1TADA 5I7UA 1E18A 4YUXA 3VTKA 2WKRA 5H5JA 1RMQA 4N0DA 1JB9A 1S89A 2GCIA 3ZHZA 2Q4DA 4MR9B 4J1SA 1G0OA 4Y2YA 3SJUA 5JHGB 1ZM4A 3M82A 2VAXA 1V16A 4HNVA 5EZSA 4BJ6A 1ZEJA 1D9ZA 2MJLA 4YASA 1WSDA 4ZZIA 2BD0A 1OH8A 1GGKA 5JAZA 1D4ZA 3UIEA 2MTBA 4S2EA 4CEJA 4KSYA 3QKWA 1VLHA 1GL9B 1IMOA 2JASA 1C3EA 5LR6A 3HV2A 3TQQA 3GEDA 4L6CA 5TGZA 1Q0PA 4B8WA 2NUPA 3KD3A 1SVNA 1OILA 3OFJA 1W44A 4G4JA 2ECPA 4UM8B 3FKJA 1KVRA 3NH6A 1ORWA 4BDTA 1VI6A 3IEKA 4X60A 1IHXA 4WOKA 1OI2A 2QRQA 2A1TS 1P6QA 5JECA 2JLSA 3L3BA 4PPFA 3P4UA 3WTBA 9GPBA 1Z0KA 3UY4A 1EJ0A 1Q7BA 1Z5GA 1Z28A 3MFYA 4XFKA 5TVGA 2PUCA 5A3VA 3TAHA 1T29A 2G1UA 4HWKA 3EPHA 5MDHA 1XRRA 4HWGA 3TCNA 1PNQA 1JAZA 2UUPA 3UMMA 3IEIA 5CBKA 2WC1A 4JMPA 4Q34A 5A7FA 1JEDA 2WINI 1I1OA 1UIRA 2JCBA 2BEVA 1Z25A 2P78A 5BW5A 1DC7A 3QP9A 3CGGA 3LUAA 4KI7A 2C7OA 1AS0A 2A8YA 3MJSA 2BTQB 4DSOA 4FOPA 1IEVA 2QAGA 2V7EA 4C21A 2FLWA 3DONA 4NCNA 4DCGA 1OBHA 3W7BA 2BZ1A 4DE5A 4ECAA 5IKPA 4F5DA 4D92A 5LQNA 2XQIA 2CKMA 4C5CA 4NEGA 1XNGA 2PD3A 1X87A 3GJSA 4MROA 1J8FA 1CJSA 1TFUA 4MYTA 2YNMC 3NXSA 4HX2A 1A2OA 2Z5LA 4TUYF 3U5ZB 4QUEA 3L0BA 4ILEA 2WLSA 3VR1A 1CRPA 1BHQ1 1FNNA 3A1SA 4YA6A 3RQIA 5KINB 2DUMA 1E1RA 4TV8F 3W5JA 5EZYF 1K6IA 5JLAA 5JXWA 5AI4A 3BDVA 3AM1A 3G0IA 3CEPB 4H27A 1NXVA 3K71B 4D56A 1LPNA 4HFRA 1Z29A 2VSNA 2V5UA 4BU0A 3IHWA 5BP7A 4DV3B 3GNQA 3T3IA 4IHJA 5KNDD 2GGSA 4FWBA 2RI6A 3HL0A 2PD6A 4CMKA 1SKBA 5E7IA 1G5PA 2PRKA 2Y77A 3Q0EA 3HVIA 5CT6A 3CV3A 1ODIA 1UFVA 3OPYB 3CR7A 3NIGB 5LP1A 5IAJA 1NXPA 4OHPA 2I6GA 1MFZA 3I72A 2WJYA 2YIVX 3SE7A 3HSSA 1P5HA 4O1MA 3MG9A 2F67A 2QP3A 3P97A 3RUAA 1RXUA 1GSOA 1UINA 1EJ2A 1OLUA 3C5EA 4FFPA 5EJFA 2ACVA 1JEEA 2C7VA 3A3PA 3GZTB 5BWBA 1MENA 1PJ8A 2GJSA 3ZDCA 1W93A 1H2WA 2BBSA 5K3CA 2R8EA 4TYWA 2WJIA 2ZVJA 1NTRA 2KHZA 5E6UA 4BCCA 1P4GA 1DOHA 2R48A 2VYNA 4JEHA 2GKOA 2NUBA 3CXUA 2RKOA 1Z38A 4C05A 1VQ1A 1ZONA 4UE3S 1BGVA 2EG5A 4EUFA 2ZSEA 2F3PA 3ANLA 2M1XA 3WRYC 4AMVA 5IT5A 4MUKA 3GLFE 4UD6A 1CERA 4B3FX 1QIEA 2GKGA 4P33A 4UNIA 3IMKA 3GLIB 3W2IA 1NZDA 2JEOA 4DCTA 2I6FA 1QIMA 4V2IA 4EPWA 1BCRA 1XN4A 2WM3A 4BN0A 4P22A 5HF8A 3B3JA 1XNJA 2AG5A 3LMKA 2VPPA 4S1TA 4ARSA 4RXMA 4WBSA 5D5PA 2VL7A 3D6JA 1D04A 3NCTA 4Y8VA 5U4XA 2V6MA 1JMYA 4UDOA 2VSYA 3JQAD 2J0VA 3E2MA 4GBMA 2FW6A 4HNRA 4P38A 3OOSA 4TVSA 1FXWA 2ZRKA 3HADA 5DOVA 3RFVA 3TDMA 3AWDA 1JDVA 3DHWC 5FBHA 2Z6QA 3WKAA 3QGMA 3U4DA 1XDZA 4AM8A 1X1AA 4KREA 3HP7A 3KKPA 2JC3A 3EGXA 2W6ZA 4MDYA 4PIMA 2MSDB 4UULA 1YT5A 2PRJA 1U3WA 4E08A 3VV2A 4ZYVA 1Z36A 3BXFA 2FPKA 4MPRA 4R7GA 3T38A 1HYBA 1BD4A 4BZQA 3QU9A 1LDYA 3F3KA 1U0LA 4I8DA 5F52A 3V4PB 1GXSB 4I5GA 4CR8A 3EIUA 4FP9A 3LFHA 5I47A 5CDYA 1Z18A 2HPZA 4PQRA 4NS1A 3PUKA 1ZG3A 4NF2A 1H0KA 3PC8A 4GW3A 2ZTVA 3TBFA 5JNRA 3QELA 2X2PA 4REMA 5KQGA 2OXFA 4DB2A 5FOQA 1KPHA 3QI2A 2AXPA 4XYLA 5LN1A 4V2UA 1X0VA 2IYFA 3EE6A 4CDRA 3CLUD 3S27A 3VSDA 2D7CA 2QP4A 1SAYA 4RABA 4XRRA 2RK6A 5DI3B 4HQOA 4TL9A 4AUMA 1NAHA 2ONJA 4QEDA 2NADA 2XV1A 1TD9A 1LWNA 1R0LA 1UBUS 1WY7A 2VSQA 3NONA 2QQ0A 3TQTA 3E27A 2V4ZA 3OESA 5B53A 2GEKA 2DPLA 3EQ7A 5KJEA 4JENA 1HRKA 2G7ZA 2WVAA 3UOWA 2FMFA 4NHOA 4A4DA 1Y8ZA 5CLIA 4GECA 1NXXA 5TMEA 3ESRA 1MP0A 3PVCA 4P3KA 5BUZA 5JDCA 2P2SA 2QPOA 2Q3DA 4GNRA 4LPSA 1EKXA 2XRYA 3GQBA 3D3WB 4PX2A 4X8MA 3WO1A 4YYEA 1PV4A 4BVJA 1IHPA 2BKLA 1NVXQ 3IDOA 3S2EA 4J6FA 5B6PA 5CNJA 2PVPA 3GRZA 3PQFA 3QTBA 5I45A 1BDBA 1H2EA 2I9KA 1B2LA 1AO0A 2ZAGA 1ZI9A 1VIDA 1NLZA 2HQRA 3I8OA 3S1AA 3MBOA 3TTUA 1VRVA 1SO8A 3EDMA 3GA0A 3F7NA 5BN5A 4TM8A 5LYYA 5CD9A 3OFND 4L95C 5LXTB 4FS3A 4TYYA 4C0BA 2QRUA 2BGWA 2HSWA 1IM8A 3BGOS 1KNQA 4KQEA 1RJ9B 1P29A 3SNKA 4KFUA 3IA2A 2EU8A 4I4TB 1KU6A 4KX3A 5GAJA 3DDOA 4MVJE 3C3AA 2WVJA 3FPKA 3FYSA 3NEYA 1IJFA 1GL7A 1JSRA 2HU8A 1EXVA 3AR2A 3WLKX 1YNSA 2DBVO 4ALLA 1V96A 2ZJ6A 5K6AC 1UFRA 4JI0B 1L4EA 3FOBA 1FP4B 3VU1A 1KDPA 2I2BA 1IXZA 2LKCA 4GP9A 3GYGA 2BKUA 2IP2A 4RHEA 4G07A 2UVDA 4MAMA 1KWGA 1A7UA 2HX1A 4EZEA 2C8KA 4K1XA 3IDZA 4Z6KA 1ZJZA 1FNDA 2PT5A 3OU7A 4I19A 3B53X 1TCCA 4N7RA 4L9SA 3PD0A 3KQKA 4A15A 1TZKA 2QRGA 4EW3A 3OF2A 1U65A 3G2HA 1HE8B 2YHSA 4WADA 3QU2A 5DYGA 3K1AB 4ZQGA 3R8FA 1A9YA 1H8HD 1XEWY 2GAJA 4NDNE 2QYOA 4OXNA 3RUCA 3OTQA 1MQAA 5ALMA 2CMGA 2PUVA 4D9NA 3Q11A 2JH9A 1JHDA 1BTOA 2BOVA 5M5BA 2O1WA 3RM3A 4LJAA 2ZDGA 2WF7A 2G06A 3LC1O 2IDKA 3H1AA 3U17A 1VLZA 1HT2E 3R5SA 3QEMB 4JJZA 5CVCA 1FDSA 2NZJA 3FOEC 1Y4UA 4B35A 1TQ4A 3H2BA 4MQMA 2P3SA 4E5NA 3WJ1A 1X80B 1SOMA 1ZKMA 2ZUUA 4ZAFA 4NU0A 4DNPA 5KJCA 1Z0SA 4IF6A 4HZUB 1MHTA 1D0IA 1E3MA 4BO1A 4K40A 4WWHA 1HZZC 1WMFA 4MP6A 3I01M 4QBTA 3MCWA 5ALKA 5ICMA 1Y7PA 1EH5A 4ZVUA 1MEOA 2R1TA 4JAVC 4AB1A 2AI2A 2OZVA 1K7FB 1IJKA 4BFUA 1RIIA 5BSEA 4K88A 4UUMA 4C01A 1XTBA 2G9ZA 1RTKA 3I4FA 4QLAA 4WZBA 4FYHA 4ZJPA 4ARCA 5DSZA 1FMFA 1C4OA 1DCTA 3Q8LA 3H0CA 4AN4A 4XZ3A 5AJTA 4ARZA 4I3FA 5FUQA 2CLLB 3N2NA 3OSZA 4KZPA 1UPCA 4LY0A 3UATA 1YIAA 2UZIR 2CMKA 3IOYA 5BSRA 3F78A 4Q4JB 3VR6A 2GEDA 1FJGB 3TD9A 1W8DA 1MO3A 1PX2A 1R50A 1U31A 1LK0A 3D7SA 4Z7NB 2RG1A 1NT2A 1SBZA 2PWZA 1E60A 1P4HA 5REQA 4ZI7B 1DIAA 1P75A 2PPVA 3OJXA 5EZ6B 4OB6A 1EUQA 2P2ZA 1H8EA 4KQWA 3KPJA 4ND3A 1XTQA 4YCBA 3CRRA 4LRXA 5ITVA 2JAUA 3OJWA 2JZCA 1ISFA 1R4ZA 1GGVA 1I4DD 2Q1YA 1QYRA 1NW4A 3ES9A 4NE9A 8ADHA 5EP3A 2DFKB 1VE9A 5AVOA 1EVIA 4PCVA 3QXXA 4DKXA 1MAUA 2GA8A 1FU4A 3PPWA 2QE7D 1TA4A 4WSOA 2CT8A 4RVCA 2FPOA 2ZBVA 4TMXA 3U3DA 2KYRA 1PFKA 2MYUA 5T8KC 3QE3A 1IULA 2ZRAA 3BKWA 4WDQA 4G4IA 3OF5A 4IIVA 1UKBA 4DBZA 5KYVA 5I3CA 3HCEA 3KXLA 4J0FA 3J81k 1UL1X 3HU2A 1U9JA 3D0RA 2AN1A 2ZSIA 3K2QA 4N6OA 3RI3A 1AK2A 4M22A 5EA2A 4L07A 4GZMA 5KI6A 2XR1A 3M3PA 2G28A 3GDHA 2RFLA 4GX5A 4EI2A 1ZN9A 1QTRA 2FVYA 3GZNA 4HDMB 3DFMA 2QSUA 1EFHA 2QD4A 5A4KA 1T25A 3DLHA 3HA5A 1UXHA 4K6KA 1JPVA 4XXHA 1CUHA 2C77A 1U0TA 1OLXA 2NU9A 3GP3A 1A2KC 3M1YA 4HFJA 5LP6B 5M7EA 3FB4A 1ZOSA 1RAAA 2R751 4CMGA 3X2FA 1O95C 1VLMA 4EJ0A 5A5FA 3RR2A 1F48A 4IWNA 3M9XA 3DXYA 4YV1A 2NVWA 1JHOA 3CRNA 2F7SA 1ZXXA 4BZXA 5K0NA 3BTVA 1KEWA 2QVCA 2BGTA 5AKKA 2OQVA 1XF1A 4LMRA 1ZSNA 1Y33E 2CCKA 1SPBS 3PHLA 4CCWA 1JAXA 3ZDFA 1P81A 3O2NA 4B3XA 1G9XA 1ODKA 2A92A 1BOOA 2VBCA 2BMFA 4K3VA 4PRLA 1C8LA 3O3MB 3HFJA 1E2IA 1OA0A 4WGGA 3OA2A 3RC3A 1SQGA 5IWCA 3O2JA 1R64A 2XW6A 4PLVA 1BXZA 2ZVQX 1KC3A 2QV7A 5H68A 2IK8A 4MP8A 3EXG1 3GLKA 3R0VA 3RCBA 1PWYE 2C58A 2XY4A 3GFTA 3WGKA 5I7HA 1ISIA 4HT3B 2F1KA 2ZB4A 5IU6A 2OORA 1PE0A 3AKYA 4GM0A 4FDMA 1KH3A 1GQ2A 4XQEA 3ZY3A 4X20A 3A8TA 2DH6A 2P9YA 1H4QA 1IZYA 1EE9A 2R00A 2QPLA 4BEVA 3EFBA 2XTNA 3AY0A 4M46A 3F4LA 3C74A 4MI6A 4OP2A 3TZHA 1ULAA 2DPHA 4I5EA 1V8DA 4E09A 3VKVA 1RBZA 3PCTA 3TGPA 1P61B 3BE4A 4HAIA 3H8VA 3EAFA 3V8QA 3HUUA 1WP9A 1G60A 3WSVA 3ZCVA 2CSXA 2E5FA 4JITA 3KG2A 4PN3A 3FUVA 1D8AA 1ZWLA 2CHGA 2ISQA 1Y6FA 1GM5A 2VRCD 3T7JA 3MMXA 2AF4C 2F62A 2FVXA 4G0NA 5GP1A 2GCOB 2FN3A 2FPGA 3LO8A 2JATA 2BKAA 3M5CA 2PL5A 1U6IA 3PGMA 4FVTA 5GQSA 3ICEA 2HO4A 2HDOA 3K4HA 4QXOA 1R8SA 3WGQA 4N9WA 4UUNA 5A9TA 4MJLA 4W6QA 1S3FA 1JHAA 2J7KA 3GMDA 4WZAA 2GH1A 4JIMA 1KE1A 3WGYA 4ND7A 2X1HA 3MUEA 3CG0A 1T5BA 3Q41A 3PR2B 4NH4A 1LBIA 4PICA 4UU1A 4DQ0A 5HX7A 1S9HA 4QRDA 2FF7A 2PXXA 3A6KA 3L6BA 3ETJA 1P1KA 1Z4IA 2V7XA 3F8WA 4IDNA 2GR9A 1C14A 4Y2XA 4ZO8A 2QN8A 5FR2A 1F4PA 1B8VA 2GEBA 2KE5A 2WJVA 3TRDA 5LMUB 5K05A 1ZH2A 1GPAA 1UZMA 3T6KA 4RO0A 1TPZA 3A2LA 4UBOA 2Q2VA 3VPHA 1ZLYA 3G23A 3T1TA 1NNLA 2CV2A 1THMA 2FQ1A 3IIEA 2XA1A 3T7IA 1E1RD 3LNCA 2J9ZB 4EF4A 3QKRB 2WU8A 4IJMA 2IZ0A 1CUCA 2IZ6A 3FBWA 3SLKA 4D0NA 1XALA 1KF0A 1TK2A 3C6YA 5KWEA 1A04A 2HLHA 3FXAA 1WVGA 1VJCA 4B3BA 3OZVA 1N2ZA 5K99A 4IIUA 1YZHA 1IQUA 2REOA 4KXUA 3BEDA 3MF4A 5A3JA 5LPNA 1VCNA 1X7YB 1ZOPA 1IPFA 4JSRA 1JA1A 1FYFA 3Q3JB 1P0IA 3V34A 4DTIA 5FUMA 4C06A 1UBMS 3USZA 4CLXA 1MRSA 1YONA 4ILKA 4KQ9A 1C2YA 1NSFA 4TKVB 3VU8A 2JKZA 1IVNA 4HRAA 1FP6A 3TNYA 5JVDA 1MH1A 1I80A 1X14A 4FFBA 3RBVA 4JNKA 3I8XA 4O2AA 3GEPA 1S4QA 2FZGA 2IEGA 3AOEC 1NI4A 4I55A 3SFVA 5JW6A 1W85B 2Z2ZA 3LOPA 3MAGA 2PGNA 1B3RA 2BFFA 4U63A 5FADA 2FSHA 4JGBA 5J2TF 2I6SA 4IUBS 2GZ2A 3V6LA 3NHKA 4HTFB 3IX7A 1AG9A 3TWOA 2APJA 4HRYA 5DVZA 3T5GA 1S2IA 1U8XX 2VYND 1M2WA 1BWRA 3FNIA 2VI5A 5BT8A 3PFBA 4RH1A 2G9VA 1OF1A 4EMUA 2OSVA 3QOWA 4C4AA 2GM3A 3RNOA 1PL7A 1C7IA 3GLTA 3FCOA 1PGJA 1VGVA 2HSDA 2PZGA 1FFYA 3LLCA 3EZ6A 1O7JA 3RRNA 1TIPA 3JALA 3WIDA 4ASUA 3BWVA 1PTJA 1T9BA 3PFCA 4JDPA 4H31A 4K8OA 1XRQA 2QRJA 3WLIA 3ZLTA 2OHFA 1Y37A 1YDMA 2FF5A 4JI5B 5KTKA 1CT9A 3SJAA 3OFSA 2B4TO 1OBCA 3BTSA 1A72A 2CNWA 1WUJS 2HDNB 5FKJA 4RJTA 3F5DA 3P9XA 1PV1A 1FFCA 3QZUA 3F49S 1B6GA 4K6GA 1SVWA 4X1OA 3SX4A 3ERCA 1X1SA 4XUDA 4X93A 4ZVQA 2NPOA 1EAYA 1L1FA 3SXPA 2ZXUA 4H6WA 5DGDA 3ZBUA 5AI8A 3SIWA 2PE5A 2CVHA 2PKXA 2LP4Y 2IH4A 4OIFA 3RTAA 3VOBA 2IXBA 1P33A 1EG2A 4CIVA 3NPAA 2X8JA 3AVPA 1RSZA 1N1MA 3AJRA 3PJEA 1V6SA 2H2DA 1M6WA 5DSTA 4D8WA 1VBFA 2G1PA 4Z9FA 4R6WA 2UZ4A 4QU5A 1JJIA 2GAFA 1ZISA 3I58A 3SR4A 3DDHA 2XIQA 4DHEA 5ABPA 3JYQA 1D9XA 2Q46A 2Q6OA 5IAEA 5J47A 3EZFA 3FG9A 3MT8A 1PJ4A 2QMUA 2WNSA 3SC6A 3MT0A 4BUZA 4ALKA 4CM4A 1MPXA 3PPVA 4X63A 2GHRA 3GT0A 4OP3A 4FE7A 3U7FB 2PX8A 2OBNA 2SCUB 3SQOA 3VR2A 3DD5A 3W5CA 2Q4OA 3PHJA 3AB7A 2JGLA 5EWMA 4M1YA 1TC1A 1HYEA 2VK1A 3ZI7A 3WYBA 5KJ1A 3TMYA 2K7FA 1RZRD 1CJUC 1JNYA 1XTJA 1W49A 2DFDA 4L0MA 4CKWA 5HBRA 2XNDA 4GXQA 2H0AA 4YBRA 4WXHA 2W71A 4YJHA 1GZ3A 4Q0MA 2NUTA 1DIHA 1GQQA 2OTCA 3CIFA 1XZNA 4KV9A 1MMFB 2VRNA 3TL6A 4HNTA 2VNAA 1WHTA 2YZGA 4YWHA 2DBYA 1WDKA 1QVRA 2DKOA 2ZRJA 4MWOA 3UC9A 4EYKA 1ZAYA 5T3YA 1AKNA 2UYGA 4XEUA 1PWHA 5A9SA 3RHTA 4B6PA 2DULA 3Q7IA 1RYFA 3CNHA 2EYUA 1NLUA 5TX7A 2PZBA 4AI6A 2FZVA 4OAOA 3EW9A 3AVTA 3C6BA 4IXDA 4B9AA 4FS8A 1Y81A 5JHHB 1DTWB 2ST1A 2VF8A 2XMBA 2VDRB 3FI0A 2B0JA 4LJ7A 4MV4A 3KJEA 2AOUA 3WGJA 5K0EA 4PZZA 1HE2A 4HUJA 2ZPUA 5LUAA 2F43B 4GBJA 4DQUA 3KM0A 1Z4LA 3C39A 2GZMA 3GLHE 3NT2A 1L0BA 2XT9A 4A6PA 4AS2A 3G8AA 3IUJA 2DE0X 5TEWA 1Y4DE 1I1QB 1QFYA 3FNGA 4P5PA 3WWOA 4F4JA 4JQZA 4FPXA 4FYYA 1UT6A 4AJ9A 4Q3BA 1DADA 2NZXA 1FNBA 3MBIA 4KAXA 5FLKA 4HAUA 4Q3EA 4MGHA 4BBAA 2XQKA 3I0ZA 4BWFB 4L7VA 3DMPA 2X4GA 1E9DA 4Z1OA 2P11A 3RUDA 2QYHA 4IOKA 3AFGA 3SAJA 4IP0A 4E94A 1X9IA 4QPNA 4A5OA 5EN4A 1PBNA 1QRDA 3SE0A 3D9QX 1E6WA 4PLCA 1TQ6A 2J6IA 3EPJA 5A7GA 4QL3A 2RI0A 1GCOA 4UATA 3NXKA 4HUQA 2DJIA 3B89A 3DP9A 4BRUA 2GJKA 1ESCA 4LYEA 4B6EA 3NR2A 5E0OA 2L0XA 3AGPA 2M2IA 3GXOA 3K9BA 5FTJA 3OOEA 4FYWA 5JH7A 3IRUA 5LKAA 1NRJB 3QPDA 1UM9A 3DL4A 3UYKA 2QIOA 4EY5A 4EUEA 4GC5A 4WY2A 2RK4A 4Y9SA 3I6BA 1T9HA 4D82A 2AX3A 1RYZA 4OH7A 3SEAA 1D03A 2HEGA 1DE0A 2DFLA 3LCMA 4QXQA 1O1YA 4GD3Q 4BTVA 4CMIA 4WK6A 1TM3E 1CRQA 5CDHA 1B41A 4A10A 4ENSA 3DNPA 1T2FA 5F3DA 1BU5A 2PRIA 1SCJA 1GPLA 5F4ZA 1X3SA 4P53A 5F64A 2I3DA 4X90A 2I8AA 1YB5A 1XIVA 2J3EA 3ENKA 1TX4B 3I6IA 4ENVA 1B2RA 4K81B 1GQRA 3HACA 3NH9A 2EF1A 2QEQA 2ZE5A 4U3JB 5DO9A 3RFTA 3ZV6A 3KHUA 1R0ZA 4JNCA 2VDUE 221PA 4DZTA 2PUHA 4F85A 3JARA 1UMCA 4PSCA 3QUTA 4QOJA 4QVKA 1ZGCA 3ADKA 3FSGA 3L8YA 3MM4A 4RD2A 5P21A 2BFBA 3KXKA 2FOLA 2RARA 2V7GA 2QD1A 2W43A 2XD4A 2QTTA 4JZKA 5FBKA 1Y6GA 2HAEA 3MJHA 4IDCA 4YECA 1I94B 1G7TA 1PZXA 1YJ5A 2FCAA 3WV4A 4R84A 4DMHA 5HDBB 5BN4A 2H4WA 2NT4A 3JWPA 3NBMA 4XCVA 4LW8A 4RDCA 1WAMA 2HWWA 2XVMA 4F21A 1ML3A 4C4TA 3N5KA 5DCYA 2FSUA 4U2BA 3GRCA 1OI7A 1H4VB 3LHKA 3ZCUA 4RF2A 3VR6D 1XZMA 3OO0A 2IYLD 3KZVA 1KI7A 3TTSA 2OAP1 1U81A 2A0KA 3B13B 3ZGYA 1TT5A 4GLFA 3O21A 2G9NA 2X0DA 1D1TA 3N8IA 5D1NA 5B1SA 1H8ED 4B6JA 3GWZA 4HQ6A 2IOQA 2RH9B 2P5TB 2QRNA 3WWZA 4L85A 2BL4A 3RLIA 3RRYA 2Y0EA 4H4CA 1ZD4A 1JYSA 4B17A 1V4NA 4RTNA 3KUKA 3WKCA 2NTVA 2CLFB 1C1DA 3H0EA 5IDQA 1VJDA 1FX0B 3ZWBA 4GPBA 2W7TA 3BM5A 3Q7PA 4FW9A 4MUJA 3VHXB 1KAOA 1JA9A 2YN0A 2BUBA 2I71A 1IATA 3PLNA 3WDMA 4AZVA 4BLWA 4V1CB 1GG5A 1KI6B 2HRCA 1TVMA 2RDMA 2LWIA 1RRGA 3H65A 3QXHA 3AR6A 4IBOA 4OMFG 2DSTA 3O8BA 4RZQA 2YN2A 3VVMA 2V7VA 2AI1A 2BZSA 1EVQA 1VG0B 2E49A 1JEQB 2VXYA 3N8KA 4F6CA 4HYYA 4YMGA 4XGNA 5G1PA 1MX1A 1M2KA 2AN5A 2R4TA 2REXB 4AZ0B 4BRZA 3E8XA 3BULA 3HU1A 1P0FA 1LFDB 4JUAA 5AM0A 3LYLA 5AWFC 2B4YA 4JHLA 1MRNA 5LDHA 3IURA 4JP2A 1FP1D 1ZK4A 2RCYA 4M9RA 4OVKA 3HDQA 2EFDB 3SLRA 3DJYA 3ZN2A 3FNEA 5H9WA 3VYSB 4UUBA 4II7A 2PMWB 2AUTA 5F51A 3T7CA 3HCOA 7ADHA 5JS7A 3A37A 1XTSA 2HUPA 3EQ2A 3PZRA 2E2WA 5JYBA 2C00A 4BVLA 5CH3A 3OT5A 5DGTA 1CJCA 4HCJA 1DP4A 1M2JA 4NBVA 4KTTE 2ATIA 4QBGB 1QR6A 5LQDA 4Q9DA 2QE6A 3NAZA 3BMQB 3ZDEA 1GPKA 3VNQA 4EDHA 3U0BA 5ICGA 1QG2A 3QPAA 4F3KA 4CF6A 2J9YB 3GW8A 2XHZA 3HWX1 3EEBA 4G0WA 2CD7A 1K8QA 1PD1A 3ZJTA 3F8SA 1L4UA 1B7GO 2FMXA 2JH8A 5JAQA 2ZUSA 3VKGA 1TM1E 3O75A 4W9NC 2DHDA 4EG5A 3GPDG 3GRFA 5EMNA 4FKZA 4A26A 1KVSA 2JGMA 5KMGA 2ZS9A 4IYJA 5LLDA 3HO6A 1CVIA 3FTCA 2VWQA 3QE0A 2YYSA 2BVNA 4LVCA 2WQ7A 3PNQA 1GKKA 4G5QA 3PDHA 4M1KA 2V97A 4LQLA 1GUZA 4O4IF 5KYXA 2XGJA 1NA5A 1GTVA 3D0KA 5B64A 4DV7B 4ZGBA 4E6EA 1N2XA 3GJ7A 5CCBA 3HUDA 2QUIA 1V7CA 4F46A 1M7BA 5HM8A 3O92A 2FRDC 2XYPA 4OQDA 3B7GA 3ER6A 2HT1A 1HDIA 1EP2B 2OP1A 2VA9A 5AXDA 3LT1A 1BGXT 1GGNA 4C0KA 4RSGA 4WCFB 2BBWA 2ZR0A 3ZDZB 2QSJA 3CZ4A 1JAHA 3ENVA 4NDAA 1YS6A 2X2FA 3B70A 3DEAA 3EFHA 3NANA 2WYIA 2J3QA 1H2HA 4UHHA 1WMEA 3IILA 2O7VA 4Q5IA 4DJJA 4EBBA 2F00A 1SWWA 5AW7A 2VQFB 3MGBA 2J9XB 4CLRB 4DC1A 3VDRA 4FCWA 3I9JA 2Q5IA 2QA5A 2WILA 1ZCFA 4CG1A 1QGZA 3AEQA 1QG6A 3AW8A 3GBSA 3AUJB 2BFNA 3K2BA 4Z86A 2CLKB 1ZUNA 3BJMA 3NJ4A 3OCWA 4TMTA 1KP9A 4F9FA 1KFKB 2CVZA 2FG6C 4L15A 3IVMA 4M54A 2QUKA 1XD8A 2QW0X 3I9LA 1K7YA 4BFXA 3P8ZA 2ZSFA 1P1IA 2XDAA 2XUDA 4MUMA 4KUGA 1Y1RA 4CUJA 2BGJA 4ZXPA 2O8DA 4PC6A 1NU8A 1O9GA 1YOVB 4D8VA 4QNMA 1DEHA 1GU1A 2ECFA 3FOAA 2HJSA 4DDWA 3UMYA 2JJ2A 1C9EA 4MQLA 1XWWA 5G0TA 5AOBA 2QSYA 3QKUA 3IP6A 1QRRA 2PH7A 1W2GA 1YUNA 4YCJA 1A9SA 5AVKA 1N92A 2ZK7A 2BUCA 5C2JB 4JCCA 1SC9A 3AVQA 3IOBA 4TLCA 4XQ9A 2O8BB 4EENA 4TYNA 1B1AA 3A25A 3GDGA 4G4GA 3BRSA 3IBYA 3DP7A 1FDOA 2R60A 3NKFA 3R76A 1A9PA 1GLNA 3B52X 4JBXA 5BRNA 3V42A 3AVWA 3C8DA 2R6HA 1T8WA 1SXPA 4U7TB 1OV6A 2M6SA 5CXXA 2Y71A 3G82C 4FB4A 1FSPA 1E8DA 4QBIA 4X7MA 4YQZA 2ZYGA 3LUPA 1WTCA 3CZQA 1WUYA 5DU2A 1E4YA 1XZDA 1MQ9A 4PYLA 4KMMA 4Q9LA 4EGFA 3DT9A 3TEJA 1T6NA 4KDEA 1C4WA 1M8KA 3ZBTA 3CVOA 4KLRA 1U0OC 5TMPA 2EDCA 4Q37A 2Y9MB 3FAKA 3KR9A 3R3SA 4YAJA 5ITZA 3KJHA 4RJ2A 1XLVA 2JLRA 3BERA 2WUVA 4BNJA 4L4ZA 1Z4KA 3VR4H 1FP2A 1PV2A 4J8PA 2JANA 4K9NA 1BXRB 3ELDA 4JBLA 1XE3A 5LMZA 3EVGA 4FDVA 1TVKB 2XWJI 1JKMA 1YACA 1AKRA 3L8GA 3X1KA 3DYBA 2HU7A 2A0FA 4CHGA 1BRTA 3UAZA 3U7EB 4ASUD 5IJ0A 4Z4QA 1ONOA 1TGVA 2DQZA 2V4UA 1NF2A 2VRBA 3FGOA 2IPAB 1VOTA 3H4VA 1YC5A 3BB1A 3GGSA 3JQQA 3Q10A 4LDAA 5FA8A 4DNQA 1U2QA 3SEFA 4HVCA 3I9V1 3R7SA 5FPYA 1P73A 2WM2A 3D6UA 4PINA 4B2LA 3NO4A 2CNWD 4GOOD 3GLVA 4PBSA 1AIPA 1MF7A 2G4CA 2VP2A 1RWWA 3PJGA 5ESRA 2QGFA 2XMSA 2XYRA 4JYPA 2WWRA 1NWCA 1AMOA 1QH8A 2A5LA 2MYNA 2QZJA 2RC5A 2VHJA 3C6QA 4Y6GB 5LNK6 5EYPB 2AG1A 1UBTS 2BF4A 4KFTA 1NVVR 4IJWA 4GOJA 2R79A 3SZUA 1T4DA 3P27A 5HUQA 5DTEA 2VC2B 1A5ZA 1N9KA 2I2XB 2MMGA 5FX2A 2RBGA 1ZGBA 3L6UA 1BXGB 4QT0A 2D06A 2IHUA 1QE3A 1UUFA 2VHVA 9ATCA 2BN4A 3A1EA 5GM2A 4G56A 4ZXFA 5L3QB 1CX9B 3OIGA 4LCEA 4E1AA 3T5PA 2C7RA 4R83A 1DWOA 3HCWA 3NFYA 3G85A 3JD0A 3OE4A 2HV8A 3EYAA 3QYFA 4GL4A 4F1KA 2EQBA 3TLAA 1LF5A 3K6KA 4K8RB 3V00A 1UBFA 1ZQ1A 4G3XA 5K8UA 1B26A 5JXHA 1ZN8A 1P0MA 2GSWA 2II6A 2YZKA 3JZAA 3OJOA 2IYNA 3VR2D 4R8SA 1QYIA 3DDUA 2PFKA 3N0TA 4TT3A 3FYUB 1HEIA 1QLJA 2O7NA 4XX0B 3VJKA 2N42A 4P4UA 2ZIXB 3DYIA 2ATVA 2JHGA 3E9QA 4DFDA 2XNDD 2ZU0C 4HEJA 2HA7A 3VR3A 4QNNA 5ISMA 2W6PA 4M0CA 4TROA 4UJ3A 5SZHB 5EPOA 4H16A 4PS1A 4BGIA 4NY1A 4HDNA 4XTRA 3M7IA 1DRJA 5EPEA 5CB6A 3BGVA 3MUNA 2ROQA 4QHYA 5KYYB 4I46A 1NN5A 1S9DA 1XCJA 2WNIA 2IBMA 2NVOA 2C31A 1P3Y1 2PXCA 3P20A 1MJGA 5CPFA 3BA6A 4HNGA 3VNBA 3WMGA 3ZE7A 3S8YA 1YCGA 3M4YA 3OOYA 4QFCA 5BUSA 2R6FA 2VP6A 3PV0A 5EJMA 1H2FA 1T5DX 3NBAA 2EIXA 4A8JC 3WNBA 5A04A 1QP0A 4R1UA 5EIEA 5HNKA 1V8ZA 2PQ6A 4ZYWA 1GSAA 4DJDC 4JA2A 5H3HA 1TRKA 3RFFA 3H42B 1SBNE 3G5UA 1OYOA 4QE3A 4Q9NA 1NW6A 4JFRA 3U9SA 3AEUB 1EU1A 1Z5WA 2YQ5A 4H0NA 4MR9A 1KDOA 1ONSA 2H07A 5IYZF 2DPGA 2N1MA 4DG9A 1PP4A 1AQ6A 4HUTA 4DUZB 2ZAYA 3N28A 3AXTA 1LEHA 4W8OA 1JBKA 1TDJA 2O3QA 3FOWA 4F7WA 1GUFA 2QRLA 4JBNA 4G2NA 1AT1A 3IV7A 3SR0A 1Z6PA 1U7WA 2PY6A 1SA0A 1H9CA 2GF9A 2ZRHA 4KXLA 6ADHA 1T0HB 4I5FA 1A27A 3G8DA 1XZLA 2ZWMA 1ECFA 4FFOA 1I5RA 2AEMA 2LNDA 1P9OA 5DN9A 1QONA 2R7LA 4K7JA 4LRTB 5F73A 3SSOA 4EF5A 3NDPA 2FPMA 5EFOA 5AYVA 5T41A 5IVPA 4QQKA 1EP3B 1IL0A 4D99A 5AQ1A 3RQSA 2QU7A 1HLFA 3KO8A 3I6QA 3ZQUA 1XD2A 1OREA 1CTQA 4RKFA 4TVKA 2WQ6A 3RSFA 3OX2A 1C50A 1COWA 5ALNA 1VE5A 2BGNA 4EGCB 4JLKA 3A9TA 1X7ZB 4NXMB 5JS1A 3DOCA 2EV9A 2WD8A 2QRMA 1H9AA 4CF5A 3KE8A 1YB6A 3Q85A 4NWIA 2XOKA 1US8A 3AONB 1SCUA 4ND8A 4ZDKA 3DBIA 4R16A 2H4JA 3HDGA 2XB9A 3CUUA 3KB2A 4OQEA 3VOTA 3TB6A 5AFSA 1E2GA 2BTQA 3X1ZA 3TECE 1TQ8A 3UAGA 1GL3A 4BMZA 1IDN1 1YHYA 1F9AA 2HT6A 3EDOA 3TNJA 2I55A 1O0BA 2A3NA 2QVZX 1BDIA 1YQXA 3IAS1 2BGKA 1QOZA 4MO2A 1VHDA 1UJNA 3ODPA 3MWFA 1ZH4A 1J7KA 2ODBA 5JZOA 3IAS6 2IY9A 2EGGA 1NULA 1YDFA 4NYJQ 4RYDA 1YI1A 4WLOA 4LOJA 4OHOA 3FSGD 4U7WA 5FV4A 1PFWA 2CVOA 4MCHA 1VKRA 4HNSA 4HMOA 2X86A 3PNOA 4UBLA 5FULA 1IAQA 1SY7A 1ZRMA 4OLBA 1PG2A 1T8UA 3NWPA 3ETCA 3AV0B 2FB9A 3K2IA 3QOYA 1F12A 3AY3A 4YAEA 1RPZA 1Q12A 3IHKA 1FA9A 3ZQKA 2XXAA 1BROA 1GZ7A 1S3GA 2EDAA 5LUBA 3IEUA 4C14A 1Y5MA 2PJZA 3AQIA 3L9XA 1KVQA 3LYHA 2XBUA 3OPYA 2GKSA 4R8KA 2OV6A 2XMZA 1EK5A 2WWWA 4BNFA 1NQOA 1NOJA 2O23A 1RKUA 2DWCA 1RCTE 3KDAA 2ODPA 4IJUA 4B32A 2XUPA 1A1VA 1Z9BA 1RFLA 5LYJA 1K5HA 3DBLB 2D1SA 2J4CA 3EOZA 5CLGA 1DEAA 1M1ZA 2K5UA 4YAIA 2D13A 4S05A 2YXPX 1A9TA 4RMJA 4BLRA 5NLLA 5JASA 1E5XA 3O3NB 4PGMA 1X1BA 3MGKA 4KXQA 3WBKA 2L42A 3VHLB 3E9NA 4DQKA 3KTOA 3ZZTA 3OKCA 2J33A 4L4YA 4UARA 3WGGA 4LJ6A 2BR5A 4C6HA 4JKYA 3T5BA 4AKHA 3DOJA 3V32A 3TRKA 4D25A 2VXCA 1XT6A 2VVTA 2GLTA 1IOVA 3ESYA 3ZIAA 1KHHA 3GLIA 1R2QA 1DELA 2GXQA 1N3IA 1QO9A 4MQ5A 3WGNA 1SHJA 5E9WA 2WTAA 3W05A 4RPLA 2RGNA 4XPIB 1L4MA 2JEZA 3HBLA 1QU2A 5GONB 3E61A 1IBCA 3MCUA 2I3AA 3GC6A 1ZIYA 2FX5A 3GEMA 1JZSA 1T3TA 3TQRA 3E48A 3KBOA 3UBTA 5DCUA 1WMDA 5KS2A 3GI1A 3NAMA 4BGDA 3SEZA 4ZMBA 4WY5A 3H3JA 3RJZA 4CTJA 2NO5A 1EZ4A 1Z8NA 3WRYA 3IVXA 3K4QA 1EVKA 2ETVA 2G17A 3QY9A 4I1UA 4X7PA 4BFLA 3M6AA 2RHJA 4S04A 1AKVA 3DT8A 1F8GA 2SNIE 2ES4A 4JKIA 1DXQA 2MSEB 4DV0B 4WD3A 3DC2A 2YBEA 3K94A 3QEAZ 1RJFA 4H9GA 3NWJA 4XWKA 5JNVA 1J23A 1AQLA 4AKEA 1CP2A 1TUGA 4ERXA 2QN6A 3ZHSA 2W2MA 4F9GA 4XH9B 1GUBA 5A5VA 1GXSA 3V2GA 2G04A 2PTGA 1KC1A 2WYWA 3MJDA 1YU6A 3HCAA 1XDGA 3N7TA 1XZKA 3IR6A 1JSZA 5K0LA 3GFBA 3RRZA 1JR2A 4TMKA 1C81A 3TL2A 1AF4A 2WK1A 1XVLA 2HUNA 2UVPB 1X92A 1DU4A 3C97A 4Q3NA 2W6JD 3N8GA 1T26A 4XLLA 4YMLA 1XAJA 2EIHA 2P35A 3PQ6A 1RWBA 3ZWWA 1SHLA 5DN6D 3SVZA 1EG7A 1GRCA 4IYRA 1DKRA 4FLEA 1Y34E 5KTMA 1O0CA 1E62A 1JF8A 1YCHA 1YJQA 4TMWA 3WLNA 1N2BA 5CHYA 3BXOA 4TPKA 1XHFA 4ZICA 2P0EA 3AEKA 3NGMA 3JWHA 3QUSA 4Q1VA 4WECA 1Z37A 4MUEA 4D80A 4IZHA 2C4VA 2G88A 4WX2B 4YCLA 3USCS 1WBDA 3MWDB 2YMLA 4MW6A 5CLHA 3RSHA 5HQ3B 1J22A 2CZQA 5D3QA 3FA2A 3FPJA 4EZBA 2O0LA 3ENNA 3FUCA 2I1LA 4J43A 4HH1A 5C1DA 4E7PA 1KKLA 1DG1G 1QHYA 5FAXA 1PJZA 1LRKA 5HCIA 2CSUA 2ZVDA 1Y8RB 3B7PA 4OQFA 4LNUA 4S0ZA 1KKMA 1C7FA 2C3UA 2QM3A 2EZ8A 3D8RA 4G65A 4LSWA 3PXXA 3Q3VA 1VHQA 2WJPA 3JAWA 4I4TA 1XX6A 3O1LA 4L02A 2IEZA 3WRVA 4U00A 4A73A 1L1EA 1AE1A 3J7AC 4ZYLA 1E4OA 1N3BA 3P2YA 4DMUB 1MH9A 3ABOB 2H5IA 1JIXA 4TL7A 1Y9AA 3Q88A 5FWNA 2O52A 2GJAA 4IICA 1VMIA 4UBNA 2Z6AA 2FE1A 2HMYB 2JJ2D 2FP4B 2FUEA 2ZJ2A 1V4VA 4JI3B 2VTBB 3RYCB 2UZAA 3BGSA 4Y2GA 1A50B 5BT9A 4QYTA 2FH5B 2WU3A 4MKRA 3RC8A 1NW8A 3P9YA 2X0NA 1JEJA 1HDGO 2OBMA 2FWAA 3CRMA 1PHRA 1E5QA 4FNMA 3VPCA 1E0JA 2VK2A 4CV1A 3CGWA 2VWPA 1SXIA 1K4YA 4BKQA 4TWAA 3TLBA 4P0QB 3QX8A 4QGGA 1TQ2A 3A32A 1VM6A 4A9AA 4LY6A 4FI3F 3K53A 1G38A 5BSHA 5LBTA 3AI2A 1EX6A 5LQCA 1UBRS 3O83A 1M1YB 3OM1A 4V39A 5G0SA 1T8TA 1USGA 2R2GA 4JVLA 2QLMA 3BL8A 1JDBB 3PZBA 5E4TA 3WNQA 1WXHA 4KVFA 4EA6A 4BNHA 3OIYA 4E0BA 1PG0A 1QH1B 4LSZA 1HMPA 4QBFA 5AIBA 3EN0A 3RF6A 1LLUA 3D6HA 3ZQ6A 3QEMA 2RHDA 5IANA 2C07A 1ENYA 3EY9A 2G1JA 3H6HA 4FHZA 4KNWA 4L8GA 1OLSA 2OE2A 2XCQA 4IPTA 5HF6A 3VC1A 4ZDJA 4QYMA 2J30A 3X3HA 1X80A 1YIOA 2ZTMA 5B4VA 5BYAA 4W82A 1LTQA 1UZNA 3ID6C 3OQPA 5JPCA 2QORA 3H2IA 2FG7C 2XOEA 1TFRA 5FHRA 4K46A 2WHEA 5AVRA 2BGUA 1X1DA 5A05A 2NWQA 2IPLA 1IN4A 2B83A 2P67A 3KPYA 3ABZA 4LEIA 4R5HA 2PA0A 2OO5C 1Z8HA 3KSAC 1YFJA 2FMIA 4GKVA 2HWXA 5EP1A 5FYDA 2G08A 1UMDB 1DDIA 2OHHA 1RKQA 4G63A 2ORIA 2EJTA 3D5TA 1Z6XA 1E8NA 3JQDA 3P2MA 1PRYA 5DDIP 5EKXA 4DAEA 5TT0A 5IAOA 2ZIZA 4CEIB 5KYWB 1ZL2A 3EBLA 3G7NA 3GGJA 4ZI7A 1J5EB 2XGSA 1Z2OX 1ZO8A 3CKMA 4D9CA 1EBUA 1JYEA 3TFOA 1WE2A 1YZUA 4D1YA 2JNWA 4EGJA 1DINA 1P7ZA 4ZEOA 1H42A 1KAGA 2MIIA 2P0YA 1BH2A 3HRHA 1PHPA 4X94A 1F4VA 2X9VA 3JZIA 5ALFA 1KAEA 1N2JA 3O4JA 4WFIA 3ZWQA 1X42A 4K9LA 4CL3A 1ACLA 3DZIA 4QPCA 5TPZA 2H06A 3UTDA 2VT3A 1XRJA 1N2CE 3WWCA 3D4IA 3N05A 3FTNA 1QVWA 1AHIA 1L3BA 2WT8A 4KQHA 1PJQA 1V2HE 2GN1A 2J45A 2P6UA 1XTKA 2QRPA 1RAIA 1LQTA 1SUWA 1V5IA 2DQ4A 3L4BC 1KEEA 4TT3D 5JCXA 1C7JA 4BMYA 1M1XB 5GADl 2HF7A 4D41A 4HEHA 3KUUA 3SFZA 1WZCA 2HRBA 1E2UA 1MQSA 3ZTWA 3G2MA 4HS9A 1GILA 4M76B 1BKYA 1OXXK 3VR3D 1ECLA 2VF5X 2C54A 3W2TA 1G8YA 3KB8A 1BS9A 4HDMA 2GBGA 1B0UA 4TRJA 3TQHA 2R96A 2IODA 5EE9A 2I7VA 3IBSA 3TM4A 3ZVKA 3HPRA 4W5OA 2HDWA 3KFLA 1KO1A 1UWLA 2C4KA 1JR3E 4MWEA 3CIOA 3H0KA 1WY5A 4OHRA 2D0IA 4P2GA 4HXYA 2M6LA 2PH3A 1BFUA 4MV6A 5JS2A 4DJTA 4RJIA 3NEPX 3N3AC 1Z2EA 1BFKA 2JK1A 2IEBA 2AN3A 1CUFA 4Q1DA 5AKYA 4TV9F 4AJ2A 2QXUA 1KI8A 1G5HA 2Z2KA 1GN9A 2V6BA 1IG0A 4CIYA 4ZGWA 2G70A 3H9BA 5K3SA 1C30B 3KX2A 5TXGA 4B0PA 2GBIA 2DZDA 3IQWA 2JB9A 4HWSA 1ZJ6A 2CUTA 2QGNA 3OJ0A 5L4LA 4CL0A 1XC7A 1I3NA 1ODLA 2XB8A 5FPQA 1CY2A 2JFOA 4QT4A 2Z6UA 3OKFA 3CPEA 2M6KA 2WFLB 1E9VA