1XAJA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
352
structure length
337
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDINVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 119
structure length 337
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xajA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xajA01
3OKFA 3ZDRA 3BFJA 3ZOKA 3CE9A 3OX4A 1VHDA 2D2XA 1O2DA 1UJNA 1KQ3A 4RFLA 1VLJA 1SG6A 3CLHA 1NVFA 4QGSA 4P53A 3OWOA 1NVDA 3HL0A 1XAIA 3QBDA 4MCAA 1TA9A 1NVEA 1OJ7A 5HVNA 1JQ5A 3IV7A 3JZDA 1JPUA 1JQAA 2BI4A 5EKSA 1NVAA 1DQSA 2BL4A 4FR2A 5FB3A 3W5SA 1XAGA 1XAJA 1XALA 3QBEA 4RGQA 1RRMA 2GRUA 1NVBA 1XAHA 1NRXA 5K8CA 1NUAA 3RF7A 3UHJA 5BR4A 1NR5A 4RGVA
chains in the Genus database with same CATH superfamily
1UJMA 1ULBA 1QFYA 2NGRA 3S2UA 5DCWA 1EFKA 3SG0A 5NULA 5BN1A 1PJZA 4UDNA 1ZNQO 2JCGA 2Q3HA 2VJDA 3OPVA 5ALIA 3R3SA 4HDMA 3OJ0A 3JQ7B 1M1UA 5IEBA 4WK0B 4YVFA 4PN3A 3IEPA 2I9KA 2BKAA 5CX1A 5M2QA 1I0IA 3G9QA 5KSPA 4L0CA 4JOBA 3MAJA 5AKIA 1NVTA 5D3MB 2EQAA 1DI0A 2FWMX 2RGEA 4QHTA 4X6XA 2VF4X 3ICPA 3PGXA 4PCAA 3TX2A 1K8QA 1R0YA 1BE6A 3GZNA 3O82A 2Y1KA 4DR1B 4JLSA 2RHTA 1BA2A 5A4KA 4P33A 4UD2A 1Z6TA 1GTMA 1TYAE 3HBAA 5F7JA 4Z0TA 2V6BA 2R8PA 3SHQA 2W2PA 3A4IA 2VSYA 3E22A 5DYWA 3SOPA 2VHTA 4DANA 1QVWA 3W8DA 3ZW9A 1L4FA 3ZCUA 5TQJA 4DIFA 4UMFA 2C9YA 4MV7A 3RYHB 3NTXA 3P9PA 4BNLA 1Z4LA 1HT2E 4GDMA 3ZDYB 3JQGA 1O97C 1EEHA 5DZSA 4C3OB 3WYGA 1RPAA 4YXWD 4U2CA 4DW8A 1Y1SA 1RM5A 1R0XA 1USUA 3DOEA 4HSGA 4BLTA 1J49A 4JVOA 4DCTA 4B8YA 4MUKA 3E9DA 3UG7A 5B30A 1J1UA 4Y2JA 2WMOB 3B7WA 3LY7A 1NG1A 3GJ4A 5H68A 2W8ZA 1GTL1 1P75A 2FE1A 2BFDB 4PG4A 4BAGA 2JBHA 1U1FA 1WW2A 4H15A 4G9GA 1NRJB 3UJBA 3BX1A 3MMZA 1U9ZA 1QIKA 2JBAB 3HABA 4WGGA 4EFDA 3LC7O 4OP3A 3ZW7A 2I34A 1SA0B 1KEVA 2CCGA 2ONKA 2O1SA 2VQDA 3I09A 3KOUA 3GGJA 5AUNB 1N2GA 2YWCA 5LU8A 3NDBB 1KRXA 1MEJA 1EUZA 3H2ZA 4M55A 1EBBA 5AJVB 1PK8A 3IV7A 2NU9A 5DGXA 3PNSA 4D4JA 1PFQA 1JNXX 3RVNA 3WSVA 2VTVA 1E9SA 3ST7A 4MYUA 4E2WA 4HLNA 1JJ7A 2G4VA 5LLDA 4G0VA 2LIPA 4LOIA 1Z5WA 1PUIA 1ZOLA 1F1BA 1UQRA 3CLUD 4O2AA 2DPYA 5K45A 1QQ6A 3BTUA 1X74A 4U2DA 7ADHA 2I78A 2FMTA 4JJKA 4UMDA 4E70A 2DPXA 3FTDA 2PZGA 3OQHA 3QUSA 3GVHA 1P5RA 5LP6F 4B35A 1OU0A 1IPHA 4GSKA 2XKKA 5FFMA 3R3UA 3U13A 3K3PA 1GUFA 1O94D 4UXHA 4B6PA 4BFVA 3BREA 4OXYA 1W7AA 4OXRA 1SUAA 3WBBA 1REQA 2E85A 4RD6A 3FGNA 3JWPA 3ZU3A 1I2ZA 3O6VA 3GLKA 2P9QA 1WCWA 1KTIA 3I2HA 1GL9B 5IAEA 4Z3DA 1COZA 2F9LA 2Z08A 5AIAA 4IS2A 3ZDZB 3LH5A 2H7CA 4JLDA 1OTHA 2FRXA 2VTEA 3ZIAA 4BGIA 3NUZA 3CLVA 2IEAA 4UUBA 3OF2A 1I36A 4ZYVA 3QEBZ 1NVXQ 2GF0A 4PR3A 3IHTA 1OXSC 4CQNA 2BT4A 1X1CA 2QM7A 3H0KA 4TT3D 2VL7A 4B3HA 2XYRA 3WGVA 1FLDA 1G20A 1E8MA 4PAOA 4WKCA 5AW3A 4NOLA 3DLBA 4NE7A 5FLYA 4HNTA 3OC0A 2FCAA 4XPIB 2IDKA 5AHKA 1DOHA 4KK3A 4UULA 1HQYE 1OLXA 2UYGA 4TN5A 2IVZA 2PT6A 1N2JA 3DEAA 1M1NB 2II6A 4EY5A 4B3TB 1Q3TA 4H16A 3LKVA 4V2UA 4QFCA 3ZE7A 2E37A 2HRRA 1YR6A 2XDWA 4GGOA 1FP6A 4J2TA 1I30A 4ZTUB 5KDOA 4TLEA 4FYPA 4P7FA 2Z98A 1TJ3A 5CRIA 3QBJA 4HL6A 1QYDA 4FCTA 4WOPA 2F1KA 5G41A 5KTTA 4TVSA 4JT2A 2LWIA 3PJFA 2F1OA 4U6SA 2H9YA 2LD4A 5JWHA 1KQ3A 5JY6A 1ZVMA 1H2WA 2HHHB 2R6ZA 5CK5A 1TM5E 2C8JA 2VKQA 2JIDA 1BEEA 2LVBA 1SHTX 2ZRQA 3RGGA 1K3TA 2QU8A 2Q5IA 4YRRA 1B4DA 2OZEA 3DV9A 1VYHA 2YYYA 4QXPA 1RYNA 1NX6A 1VIMA 4K9QA 2JFGA 1PJ3A 3DE7X 4PRKA 2RKOA 2J07A 3BL6A 4FGZA 1MR3F 1F3OA 1MA0A 3ZVNA 4FOTA 4DF3A 3G89A 2HRZA 2FPGA 4WX2B 1DL5A 1YQXA 4MWBA 3P0JA 1V5WA 4XLLA 3V4ZA 1ZXXA 3HKDA 3MS2A 3SS8A 2CDRA 2Z04A 4B44A 4DXHA 2LE0A 3EC1A 3PR2B 1EK0A 2JZCA 4PYOA 1VHDA 1Y4DE 2MINA 4Y9DA 2SECE 4ARIA 4E3WA 3EQ2A 5BUSA 1VDZA 2HJVA 3L6EA 3LWDA 4EI7A 3ETEA 3IHWA 4EAQA 4A0GA 2P9JA 5LQRA 1A8IA 4L4SA 4M60A 4CWAA 3IC5A 2IKQA 3I83A 5JAHA 4M8LA 3U1TA 3PYXA 1UJCA 2XXBA 4DQLA 1FSPA 4KQKA 1A4XA 4MI1A 2XOKA 2VHVA 3DEFA 3IOCA 3JALA 2XGJA 3Q7QA 1QB8A 4MS4A 2Z1DA 1IU9A 2XUHA 4J2OA 1ID1A 1JFLA 4KXLA 5DWVA 4XVCA 5KPDA 4A26A 5C7OO 1CLUA 5I7UA 1KS9A 4AO6A 5BQ5A 4JKYA 5JNSA 1IUKA 1ZH6A 5JO9A 2O8EA 3LFHA 2GF2A 4J4BA 1QF9A 4G3XA 3R6TA 3OE7A 4AQYB 5DEOA 4Q9NA 4LZNA 1Y4ZA 2IIPA 2Z2XA 2BMWA 2VUTA 5AJYA 1A8UA 1E2LA 1OJ7A 1Q0PA 2MTBA 3NOOA 4K8OA 3ZTYA 1QCYA 4P38A 3OJXA 5LDGA 5TXGA 1E2UA 5EOVA 5T67A 1H0KA 2B6NA 2P30A 1T4GA 4YUAA 4DA0A 2AYYA 2WF5A 1MF7A 3BHMA 5FO1A 1B0AA 4NMHA 1AS3A 1VJ1A 4N03A 1S8OA 1CJBA 2UVPA 2ZP1A 2VK1A 2HO4A 2ZRGA 4AICA 1OZHA 3FSGA 2IUSA 3V7NA 5LMZA 5A7HA 3Q10A 5A5EA 3T38A 4QU8A 5AKXA 1GT6A 2ZJOA 2X8AA 3D64A 2V7GA 2QLMA 2VS1A 2X5XA 2UZAA 1Q16A 1T15A 2NU7B 3AP2A 1NDQA 3K5IA 3T52A 2BGRA 1U7DA 2DWOA 3AM5A 3PQFA 1E1LA 4I8IA 1G7RA 1DU4A 3DT9A 1UBNA 2NNLD 3R7WB 2CUNA 3PVSA 2GCNA 3LRXA 3TSWA 1CJVC 1UBGA 3N5CA 3HPQA 3HUDA 3PYLA 3SEZA 4AB1A 2H85A 3HDQA 1GFSA 2FQQA 3ACBA 4I9HA 3QYJA 2YCBA 4JVMA 3QI7A 4WNAB 5GP1A 4A03A 4KQ9A 2C7PA 4BU1A 1IM2A 1Z22A 1JDPA 4CUZA 3WE7A 2JD1A 3RQIA 1PU2A 3B6ZA 1HYQA 1PJSA 3EW7A 4LPKA 4GZ6A 1SD5A 1T91A 5IKEA 3DYIA 1RC8A 2R44A 4K1LA 4C7KA 1GGEA 1O77A 5CLGA 3GGOA 4ZT5A 5JV5A 4ZTZB 4UMVA 1E0AA 2EJWA 3KV3O 3QEMA 3TLGA 3EG9B 3LZDA 3EGEA 1ZU4A 3UMVA 3LDUA 1MOSA 2ZTLA 3CU5A 3DBHB 3HV0A 5IHPA 3J81A 3K70B 1U0BB 3LCUA 2PH3A 5JR3A 1YL5A 3KXKA 5H5JA 2WU0A 2EX4A 4M37A 3HG7A 3VKWA 2WKSA 1PZGA 3QMMA 4FCCA 3FOZA 5CVUA 4F6RA 2IYRA 3AF3A 4WY8A 3ZHSA 3Q0TA 4JBIA 2YNMD 3RUFA 1FSFA 4EGJA 4ZOQI 5FBVB 5LC1A 4LZJA 1MIHA 1KETA 4FYKA 2A1TR 3Q40A 1DBSA 2I7TA 3BFJA 3MRXA 4KW7A 2BFNA 3TIXB 5I9SA 1R6BX 1LDNA 5FV4A 1GKLA 1HNZB 2FZLA 1YJCA 2O59A 5FI3A 3SXUB 2ATXA 5KOJB 4M89A 3DMGA 3CVWA 1P60A 1T5BA 1YRWA 2YOGA 3NGMA 1OZFA 2D7DA 4B3SB 4WOBA 4NP6A 2F7SA 2KMLA 2ADOA 1C81A 4TV9B 5JANA 3ADBA 1LU9A 2RC6A 1CF9A 4RS3A 4RZIA 2PNJA 4A8PA 2OE2A 5TMBA 5FR2A 4BMOB 4D3YA 3NTQA 3L7YA 4J3FA 4RD1A 3TE6A 1KRHA 5KNBA 2VG8A 1WXFA 1Z26A 4RETA 3WBFA 5J3JA 2VOEA 4JT8A 4AZSA 1SKYB 1R0ZA 4LWOA 2P27A 5IKMA 4TS3A 1USVA 1U9CA 5DYYA 4PPFA 3IR5A 2WIAA 3OPYA 4YCJA 5JQGF 1VMAA 3HA5A 3KQSA 4BMPB 1WVIA 2GM9A 1EHYA 1E94E 3TFWA 2ZIVB 1A8SA 4X8HA 4MI6A 1OWPA 1VPEA 3C1OA 4PZ0A 4ZZ1A 2P3OA 1KEUA 1GWNA 4M1WA 1C5KA 1R4NA 5ENVA 1LLUA 3M9XA 1NMQA 2O2CA 4MNTA 3W1VA 3W7BA 1SUEA 2AF3C 2OV4A 3HLYA 4J75A 3ELDA 4M38A 4YASA 1XXLA 1DG3A 3BQNB 3PGKA 4DM3A 4N39A 3WO1A 5B4UA 2E49A 4RTNA 4BPBA 5KWIA 4ZEVA 5AVOA 4DCPA 4OPMA 1O6CA 3JQ7A 3D8NA 2FSPA 2XV1A 4HFRA 5HGJA 3WR5A 5IK2D 3EX7C 3UGTA 2OQVA 1ZM4A 2C5SA 1HSZA 2PD3A 1ODFA 4KSYA 3MW8A 2IYEA 2GEUA 2J3EA 3L77A 4QL3A 3L02A 1ISHA 4ENUA 3G2KA 3FNFA 2ZRFA 1KJZA 3FZYA 3K6RA 4U1RA 4PLZA 4WBNA 1WHSB 4R6XA 3SP1A 3ZGOA 3FR8A 4AI6A 1MZVA 3MUOA 1E4OA 4QUBA 1NX9A 5EE0A 4F85A 2NUAB 2O3TA 1H23A 3L7DA 1JFRA 2WF7A 5TGTA 3TCXB 1V5EA 3W8EA 1YGYA 4BWFB 1W9MA 1BDBA 1EQUA 3DV0B 2V3WA 2YDYA 5K8VA 3DJFA 4DV4B 2O8VA 1EG2A 2AT1A 1R4ZA 5HF9A 2W6CX 3GPLA 2FEXA 1N6PA 2WSYB 3VR5A 3M81A 4Z7QB 5BSHA 3OAAD 4C30A 5SY9A 4J1TC 3KXLA 4ZMSA 2R8RA 3BAZA 4HLQB 4OQFA 4MRAA 3I04M 3KYBA 4PZLA 3VI3B 2Q4EA 4EMSA 5LJIA 3M4JA 3TZKA 4MXDA 4BLQA 3L8YA 2VNHA 3BXPA 4RFLA 4FXOA 3DFFA 2CJFA 2AJCA 4X1IA 3PEYA 4QGSA 3ASZA 3E2MA 1RXUA 3QLJA 4CN9A 4X94A 3IVGA 3I4FA 3OJCA 2GN8A 1BS2A 4J7CA 2P7HA 3AHEA 3K6JA 3ER8A 1IOLA 2HHLA 4DUGA 3O91A 1U5BB 3NBFA 3UVEA 3QUBA 3PQ2A 3QXCA 3SFVA 2R6R1 4FM9A 1Q0RA 1JIKA 1N8NA 4G5XA 4DHWA 3GQBB 1XD2A 3OFNA 4O1MA 3PLAE 5E2AA 5B7GA 2P0YA 2PEZA 4PXYA 3I8OA 1C1HA 3P0FA 1SXJB 2R68A 4RK0A 3ZDEA 5I4CA 3TJMA 1NUSA 3WLOA 4YMSA 1J8VA 1ODSA 2R7LA 4AROA 3QOYA 4JBYA 2ODEA 5DISB 1OKKD 3VR6D 2CNWA 2JAHA 3ET5A 3BEOA 4K2AA 2VNIA 1ODJA 5CP8A 1L7PA 3TQTA 4YRGA 3LF2A 2DERA 5KKNB 2I1QA 1JWAB 1QGYA 4HB3A 4ENVA 1EJBA 3WAGA 4PAGA 3WXMA 1SG0A 5KYKA 4K9MA 2GBCA 1U7OA 4LJ9A 3ESRA 3LO8A 2XCSB 3DL0A 2VNSA 5DIZA 2ZTVA 1JI3A 2JI4A 4FIZA 1KK1A 1NBME 4BX9A 2Z4SA 5K0FA 2ZE5A 2OPHA 4QDXA 1FFSA 3CEHA 1DC4A 1VMEA 4U8HA 1I3CA 4FSDA 2QI9F 4QPNA 2ZJZA 4M8KA 1BX1A 1ENOA 2ZAMA 2JFUA 3PC8C 4JGBA 4DVGA 1L4NA 1OBCA 4EA7A 1LI7A 2ZIXB 3N2GA 1O3YA 1C50A 1HYBA 1YO6A 4O2LA 3EWAA 3RJTA 4HYQA 2CF5A 3I9V6 4DTIA 1LW7A 3T3NA 3VC1A 2CXOA 4BJ3A 1PFWA 3V7FA 2NV2B 6PFKA 3S8YA 3ILXA 4R98A 4K7JA 2YHIA 3WV4A 5D7NA 1IG3A 3DPIA 3V8MA 3IDOA 3VYRB 1M2EA 3ZBTA 3F49S 1SCDA 4F60A 1KKLA 1XZBA 3TRHA 4BFZA 4EKNB 2W2QA 2XYHA 4WZZA 5EJ6A 4J1TA 1K7EB 1SPBS 1I7DA 2XJ4A 4RKWA 3ZWYA 1JEAA 5A3SA 3BF7A 1PR6A 4IWNA 5AH0A 3S1LA 1A1VA 3UXYA 3V2UA 5C37A 1FRVA 1K9VF 3IKVA 1P5FA 3V4VB 1G1MA 2ZW9A 1OPXA 2VA8A 3HY3A 3B5EA 3O3MB 3Q3IA 2R1TB 4HDRB 4KXXA 1UPFA 2I4TA 2O7RA 2ZRIA 1GHTA 3PQEA 2YJ5A 3E9RA 5MDHA 1NVFA 1UT6A 5FBHA 5C46F 1R18A 2ECKA 5HZHA 3EOZA 5DCLA 3RRFA 5FEMA 1Z08A 4EF5A 1EXMA 1JIIA 5JQWA 1JH8A 1GADO 2JCSA 4XCQA 5E1OA 1EVQA 4CIXA 4PYQA 1R16A 3HM9A 4AS3A 5DNCA 4AN1A 5JMOA 2D8AA 3DE6X 4WGFA 3EVNA 4YI5A 3EXEB 5ALOA 1Y1QA 3O2SB 2PJDA 4ZAYA 4KR7A 2EHDA 2PTHA 4IGIA 1IXSB 1R64A 2SKDA 3AEKB 2YIDA 3DBLB 3LLCA 3LM8A 3PTLA 4WFJA 3FOEC 4ONEA 2VJMB 1SU7A 4NK5A 5CCDA 4CTMA 4K9SA 4OUDA 1FFCA 2D2XA 3GOQA 3R4CA 2FTKE 4EYGA 1JBQA 1YTUA 4P4SB 1TAHA 1FX0B 2Y1CA 3AETA 5G1PA 5IKOA 4D97A 3TSZA 3AVWA 2F90A 4A15A 1JSLA 4GPEA 3HGTA 4L4RA 4FGSA 2AJDA 3BE8A 4LQCA 4MP8A 3VDQA 5T8KC 1WQ4A 2EIXA 1V43A 3ZVMA 3D8HA 3BGSA 4PYNA 2GA8A 2DM6A 5HMMA 3PC8A 3SIRA 2F67A 3MRSA 3ZNNA 5IM5A 5DGCA 2WG0A 5BQFA 3K92A 3OD5A 5AOBA 2M6RA 3K05A 2VF5X 3BA6A 1AQYA 1WDKA 2PXAA 3F7MA 3QVTA 5FRDA 1TADA 3OO1A 2B9EA 2WUDA 3QTTA 4LHWA 2R6FA 3PICA 2VH5R 1YB4A 3EF1A 3FYDA 2IRWA 3T06B 4U7TB 4U7DA 4YDQA 1ZXBA 1BQEA 1HT1E 2GPBA 1MXFA 4FGJA 3W2GA 3PHBE 2A5LA 4WNYA 4PCUA 4IHJA 1D3AA 1N5IA 4Q18A 1Z38A 3K9FC 1X7WB 2BBWA 2WMYA 4M22A 5IU6A 3HKCB 3MELA 4L7VA 1YBFA 1Y3BE 5AP9A 2GZDA 3L1HA 4R01A 4DB4A 1GGHA 1GLNA 3L0OA 1NMEA 4Q3DA 1XVAA 4C0QC 5HTOA 1DXOA 4PCVA 4H1VA 5FOTA 3A58B 1OROA 1RMTA 2ZB2A 4YR9A 4ASUD 3K9QO 1B6TA 2VAWA 4NEGA 4D9GA 3FH0A 3EQ9A 3HWRA 3ENNA 5ICEA 2QD3A 4ZA2A 1NQ5A 4K9NA 4MVJP 3GD7A 1R0LA 4OMCA 2J85A 4FHCA 5KWVA 4PBRA 2C4MA 4C7BA 4N5DA 2G1KA 4HJXA 1CHDA 5LCXA 4YCBA 4X54A 5HDBB 2DBQA 5TF0A 1HDRA 2VUSA 3IQHX 2B7CA 3FCSB 4X63A 1OB2A 1FFBA 1PE0A 3SM3A 5HK8A 2WFLA 2V4ZA 4QYIA 2IV3A 1GPLA 1RYBA 1S9HA 3GK3A 1J2TA 4DGQA 2PX0A 4KU4A 2CJWB 2V7XA 3DF7A 3H2HA 1LPSA 1M6VA 4BVLA 3LRTA 4ZXPA 2PQ6A 1P2VA 3BWVA 4HRAA 1HOTA 2WU1A 2WAYA 5CLLA 1J0AA 1LSJA 3STTA 4IIXA 3KALA 3O4IA 1TL7C 2A92A 2R7KA 3KJXA 3LWNA 4QSMA 3L8MA 3L9XA 2C5GA 5CA1A 5H81A 1T5LA 3CB2A 3JU3A 4CM8B 2Q27A 3MRTA 4K3VA 4MW2A 1N2OA 3H9CA 4NE9A 1EX1A 1YI0A 4QGAA 2IOFK 3M34A 3R8XA 3E48A 2JBWA 3OU7A 4WNAA 2XVYA 4DA6A 5KREA 1OXMA 2JKZA 3T3DA 1JAIA 3DEZA 1WAMA 1XEFA 4C7XA 2E5WA 4UBOA 2O5VA 3OEYA 2SNIE 3HACA 3LT5A 3AFOA 4PBSA 5FBRB 4YP5A 2V03A 1QE5A 2WV7A 3F78A 1IUPA 5LQNA 4QODA 3PXUA 4GOKA 1V71A 3CSUA 3VX4A 4CMEC 4BAUA 3PI7A 4NHOA 1A4RA 4XWAA 4GKJB 3CX4A 2ANCA 3MBIA 3Q7IA 4MICA 5DM1A 4EUSA 1GZ3A 3G2MA 1ZM3A 1A3CA 2OCGA 3LX4A 5KEIA 4MDHA 3OF5A 3HFRA 3UK6A 3E9YA 4ENPA 3ZY2A 5ITVA 5LMCA 3G0OA 3IMGA 1TMOA 1YRAA 1VSQA 4LXYA 3AWIA 2RHMA 3KB8A 1GILA 2ZE6A 1V4VA 5EXXA 5I4IA 1V6AA 3L4EA 5HUJA 1CY8A 3AESB 4RSMA 1SVKA 3KQLA 1UMDA 1ZZGA 4YAOA 4W6ZA 3QX7A 4EPYA 3DV2A 4F4JA 1I0LA 2WQ6A 2ZRAA 3SXUA 1AXEA 3RREA 2A4MA 1NP6A 1SJ9A 3V8RA 1LRJA 2W5UA 2D1YA 4I3FA 5M5BA 2Y68A 3U1BA 4MVWA 3X1YA 2FDCA 1EUDB 1ORDA 1OWMA 2OGSA 4I19A 2P0EA 2OG2A 1A9TA 2X1HA 4ZZ3A 1F6WA 4U2BA 1JHVA 2QXTA 3TJRA 3OA2A 4ID9A 3GLFA 2UVQA 1FA9A 4E2XA 4JC0A 2GO7A 4D9JA 4C08A 1DIAA 4MUAA 4PONA 4C2AA 3RSSA 3E53A 5ALGA 4OHYA 1RM0A 1VBKA 3PQ5A 2QRNA 4WZ6A 4FEEA 3IP8A 3EA4A 4WLOA 3S3TA 3FHOA 3OZRA 4EG1A 1DDGA 5CDYA 2A7QA 4I46A 4ZEXA 3N39C 1Y7TA 3WKAA 1XHEA 1ISJA 3FZNA 1FFEA 1IFXA 3GEMA 4AJ4A 4E5VA 4QJBA 4Z49A 5AW8A 1KYIA 2RIPA 4N65A 3ZV4A 1FJHA 2NVOA 1IQPA 1KR5A 2ZUEA 1RM3A 1DMSA 1K2WA 1SAYA 1Z39A 3DHWC 4TKMA 1N2CB 5AW0A 3QY9A 2VLIA 2HLPA 2CXPA 1OFUA 1PQ4A 5EJ2A 1QTRA 4P54A 4RFSA 3I04A 5EA2A 3SJAA 1U8FO 5DNVA 2C4UA 2HZ7A 3TNLA 3UJ6A 1PRYA 1GNTA 2FR8C 5EN4A 3ZZUA 3M2PA 2IDMA 3AY7A 3PQ8A 3IBYA 3OHPA 4P4UA 3QVOA 3P8ZA 4CW7A 3JYQA 2DJ5A 4X92A 2Q21A 4B3BA 2HIMA 4Z4FA 3TTWA 3VTFA 1GRQA 2H4WA 3W04A 1BC5A 2IOYA 1EXVA 1TYEB 4ALLA 4N76A 3LUCA 2E1RA 2AMVA 2MSCB 5G3YA 2HRQA 3N2IA 1MB4A 2YWJA 5H0IA 1BO6A 2X86A 4JDPA 4CMEA 5DO9A 4MKRA 5I9NA 3A9TA 3U9LA 5KVAA 3JVDA 4JEHA 1Y98A 3LPLA 5FPKA 3MCVA 5IVHA 4UM9D 4DDUA 5FLXA 3Q9SA 3R77A 3FMOB 4GMGA 3Q8KA 2XF2A 2VP9A 4E33A 1SBTA 1ZH4A 2H5EA 3G8DA 2XMQA 4AJNA 4I55F 3NI2A 2JNWA 5LD2C 1OTYA 1L5OA 2UAGA 2PS9A 5EPEA 5JVDB 1JGTA 2VC2B 4NPAA 3NAGA 1K75A 5KNDD 4Y6OA 2JKYA 4L73A 3PRYA 4AIIA 2ZZNA 2BFWA 2BIFA 4JYCA 4L4ZA 2OFPA 5KTOA 1AKWA 3FDXA 3U4QA 1GR0A 3RSHA 3AKZA 2JLXA 3X1DA 2VDWB 2GAOA 3I9OA 3DNPA 4IHQA 4URWR 4C06A 2O8CA 2FW7A 2VXCA 3DUFB 4AJIA 2UZ1B 4RANA 3L1IA 1XKLA 2N0SA 2WJVA 3MMXA 1EK6A 2MIIA 4OQDA 1W88A 5DMHA 3RF7A 3A1VA 3EHEA 1XZMA 5AK0A 1J7KA 1V16B 5GV7A 4JJIA 2F8TA 4LGYA 2FSHA 2Q4OA 3HRKA 2PBZA 1O6ZA 1YZ3A 2X1MA 3V46A 3V55A 4WZBE 1AG9A 3WG9A 2VA9A 3ZE9A 5A4JA 2XRYA 3B89A 3AEXA 3F3SA 4M9CA 4PFQA 4YI3A 4ZALA 2G1AA 1M2NA 5C5EA 3DB2A 3IHLA 3ILYA 3GGPA 4OJMX 4L85A 2IS2A 4PLPA 1OVMA 4ABYA 1ISMA 2W70A 5CDSA 3JPYA 1THTA 2UXBB 1GQQA 2JB9A 2XZPA 2PPLA 5AKLA 3ZZ0A 4EJ6A 2IPOA 1KYTA 1PF7E 2QPOA 4PHFA 1W46A 3HCRA 2LCFA 3JVIA 2FR8A 4TXMA 1YI1A 1VE3A 2B82A 2YS6A 4YAJA 5AFSA 4QELA 2X2OA 4MQBA 3O0DA 3IFSA 1A97A 1N5RA 3OLXA 3RRZA 1JR6A 2IOFA 4LBYA 4BL5A 3Q3VA 4CG0A 5IZCC 1QGAA 3UHPA 3VAZA 2O2EA 5AO9A 2EYUA 3IMEA 3VPAA 1YJBA 3AKYA 1GTSA 5T4HA 5TSDA 4O5AA 5JAQA 2E6UX 4C0AC 1JSZA 5B1SA 2Z3WA 3B9QA 1WPXA 5F3RA 2CE7A 4UEKA 3M7IA 4RQAA 3OBBA 2C7VA 1E2KA 4FFSA 4MLPA 1Q1NA 5CHYA 3KSRA 3FLMA 2HMTA 1RWKA 1U8AA 4IGKA 2XVMA 4D56A 1ODKA 2CMKA 2DULA 2VJLA 2VPPA 5ALLA 4MR8A 2EL7A 1VHJA 4N3NA 4JFAA 1KQPA 3X1WA 1TKCA 3O4RA 1XZ8A 3UJAA 2GKGA 3C3DA 4LJ7A 3ODGA 2O6HA 1WPRA 4B6QA 2X40A 2D8MA 5HBRA 4R84A 1QFZA 2FWPA 4FZ3A 1TTTA 1I51A 3ZZNA 1NFFA 1OMOA 2OXEA 3LGAA 4ETIA 2PQMA 4R71A 1T9HA 3GUUA 4Z1MA 3O1JC 5JZVA 2C7OA 3UJNA 3I92A 2BMAA 3CS3A 2O0JA 1P2GA 3D31A 3U4MA 2NYAA 2NUPA 4TTRA 1LCIA 4WESB 3ZY6A 2QB5A 4IVPA 2C2WA 2J7KA 1RPZA 2D1TA 2FWBA 6AT1A 5A4FS 2RJ3A 5KX5A 2J67A 1AUOA 4UE3S 1CDEA 2DH6A 2X77A 2CNKA 3Q98A 1XEWY 1RJDA 2PZLA 4UCFA 5B1DA 3S27A 2JS7A 1W4LA 4ECAA 1GTRA 4ZKEA 2QZJA 3V34A 3X2FA 1FZTA 4MUMA 1JKMA 1UKCA 2AMLA 3S0JA 4IMPA 3FPLA 3WQQA 5AHWA 4EX7A 5GMOA 1SK9A 1X8KA 3DWEX 3EC2A 4FZVA 5FI0B 3WGQA 5AJWA 2V0GA 4Z4IA 2XWBF 2G3YA 2TMKA 1UOPA 2WU3A 4PC7A 4O4LA 4FU0A 2D0OB 2OC4A 4RLQA 4B4OA 4MA4A 5ECGC 4NOMA 3NNDA 4WY5A 2GUWA 3AR9A 4JT9A 4KGVA 4F9GA 1NSFA 1RAAA 3LQ1A 1QH0A 3JQAB 3OF3A 2QL6A 4HPXB 5CFRA 5IZCA 2RGCA 4MGEA 4RV5A 4IDEA 1DGQA 4HUJA 2D2VA 3DLIA 4HVTA 1FX0A 5FJJA 2H1LA 3UUEA 1IE3A 1NAHA 1TYCA 5EWJB 4OMDA 5A4MS 2FW1A 4LVOA 4O2BA 4A9AA 1BA3A 2ZYIA 1M7BA 2YX1A 4B2PA 4RVOA 1KGSA 3G5AA 3UW1A 1O4WA 4RTMA 1HT3A 2ZROA 4I4CA 3TLMA 1NF9A 1YKGA 2I2FA 3VDMA 2DKNA 1JLMA 3ZQJA 3ZHTA 1GKKA 2OCXA 4MAAA 3DNMA 3HKBB 4MVJM 3NBYC 5CEEA 5KHOC 4PZYA 5CT8A 5LBIA 1NVVR 1TEZA 2ZT6A 4PZEA 4P31A 5JLAA 1TD1A 3GFRA 1L7QA 1J22A 4G41A 3UV7A 4LX8A 3UV3A 3N28A 1EUCA 3P9IA 3LX6A 4S24A 3UH1A 1YFJA 3O3CA 1Z56C 3IKLA 5DGTA 4EVRA 2AQKA 2VZ9A 2DUUA 3AEQA 1C3XA 3I12A 2DPMA 3KHUA 3LUBA 4MZDA 5EEHA 3UB3A 4HGQA 2GJKA 4M0KA 3RTGA 3HKCA 1UAYA 4GG1A 4QYWA 4EKYA 1INLA 1G16A 2I2DA 3A05A 1W4ZA 1UPXA 1RHKA 4BLSA 4LFAB 4X3PA 5DSTA 2H2HA 2O6LA 1WZCA 3CH7A 2WJWA 3G6KA 1BQ3A 5SYNA 1KJWA 4M1OA 4BX2A 2YZGA 2ZYHA 3AERA 1NJ6A 2PUWA 2VHJA 1QAOA 1ZM2A 4Y18A 1P1IA 4X20A 8ATCA 1RS0A 1U0RA 3HO1A 7ABPA 3OQ6A 3KEGA 4AUKA 4KQ1A 3RUPA 3SYKA 4B83A 1D0VA 5C8XA 1ZLYA 3MJSA 3FUTA 5BSEA 2CXUA 3MGGA 1Y3DE 2GJ8A 1V48A 1LSSA 1QV6A 1V1RB 2XB9A 3ETJA 3Q5EA 1WS6A 4FT2A 1B2RA 4KFRA 3ZDXB 2XADA 1VSVA 4WN9B 2VHWA 3SVLA 1WZNA 3NHKA 1YV9A 2FUCA 1PT6A 3SC6A 3NYRA 3ZNQA 1G66A 1RI2A 1EFAA 2AKEA 3SYMA 5CVEA 3UAYA 4EZEA 3QE4A 2F59A 4PYRA 1R88A 1H2YA 4BRUA 1VJ5A 5AW7A 2GCIA 3NEPX 3HKEB 5DI3A 3X43A 1ZAKA 2JFYA 6Q21A 2D5LA 1KXZA 2HQBA 1JPJA 3ITKA 2PS0A 4CMIB 1P5JA 2OQ2A 2WNHA 4XQ9A 5I9TA 1UPTA 2E82A 1K6EA 4DIEA 3MB8A 1XNGA 4CT5A 5IT5A 2W43A 1KI7A 4IO1A 1M66A 4NJEB 3BWYA 3IKTA 1OAAA 1PR0A 3C98A 4P22A 1H4QA 2Y4OA 3CPSA 1C9NA 1WCXA 2EXXA 3I6BA 4TV8A 1P61B 4HGRA 4BYMA 3EBOA 1V7ZA 2IPXA 2NPIA 1UJNA 2JG3A 1PKXA 1U3FA 3GA7A 2J5XA 3U80A 1F9AA 2BBSA 2R86A 3KWJA 3ER9A 1ARZA 1K89A 3TNYA 3JZFA 3VYVA 3LPNA 2UUBB 1JG2A 5ALQA 4FMCB 2PKQO 2CLOB 2RHBA 3OWHA 5IJZA 1DQSA 1BD4A 3GEIA 2FR1A 2QMYA 4GXQA 4HDCA 3UAWA 2QX9A 2I4NA 1QHGA 3AVOA 4J1QA 3CF4G 4QYMA 3BBPA 1RR6A 2RGUA 4EWLA 1DIRA 2OO7A 1RXIA 1C1YA 2HK7A 3TZEA 3ZWDA 5IPFA 2JGEA 1MDBA 2I1WA 3AESA 5D1NA 4C7MA 4CLXA 1E3SA 1H05A 3MLBA 5LYJA 3TD6A 4O59O 3TTXA 5LB2A 1Z4PX 1NY6A 2OMEA 4MVCA 4D8TA 3O8BA 4XJXA 1ZUNA 1L5WA 1YR8A 2QUIA 3GCGA 1BXKA 1B15A 5EMLA 2ESRA 4TL7A 3TSAA 3GVXA 3SZUA 5K0GA 4B73A 1PTKA 2X5NA 3JASA 4YUWA 2B1QA 4RGBA 1AY0A 3ESAA 3IT1A 1ATZA 1DLIA 4N5NA 2LP4Y 4UAUA 4EBBA 1G38A 3DKPA 4MYSA 2R7AA 4YAGA 3LE8A 1T2AA 1UOEA 4FINA 4P5DA 5EHGA 2FZ4A 4RTJA 5KNBH 2AFRA 4BDSA 1GQ2A 4FKMA 1H0RA 1N78A 3L82B 1DZ3A 1V1MB 4ZO7A 1DTWA 3WL3A 1UIRA 2XMZA 1XV5A 4QUKA 5DNAA 5IVIA 4B3XA 3E5RA 1PZMA 2VT2A 3NHAA 1VLJA 1FDOA 1JAYA 1DUVG 2JW5A 2JAOA 4RHCA 4QQNA 2H17A 2ZWVA 5CM9C 3X3HA 4AUMA 4F5YA 1APBA 5CFQA 1YDHA 1DAFA 4LE2A 5E8RA 1E7SA 4FC7A 1ZD1A 3BQ9A 4RK4A 2ZWAA 3T1HB 2DFPA 3KQUA 3ZBPA 1H22A 5IX8A 1QAMA 1SB8A 3OLZA 2R6CA 1YQUA 2PH1A 1B0UA 1EJ0A 1NVBA 3WVNA 1HM5A 3AFNA 3RHTA 1XQWA 2A30A 2IPLA 3D1LA 1ZA1A 2QD4A 3K9LA 1LD3A 2EKDA 2PLWA 2QTMA 2X42A 3GJ6A 1JL3A 3I4CA 5AKEA 1EFUA 4PNHA 5A0TA 3O03A 3HSSA 2REQA 4MEBA 4PHHA 4D3XA 3A4LA 3QE9Y 4X24A 2XAUA 2ORYA 1XTRA 2R47A 2OHFA 1QHSA 3BILA 2PNFA 3KZXA 4IFBA 4WN3A 4JJGA 5DE3A 3NHMA 3HCAA 3VKUA 3AR8A 4D46A 3PHCA 4KEAA 5CDHA 3GMDA 3VJKA 2QLTA 2FEPA 3K0FA 2P5YA 1IY8A 2O2YA 5JVDA 4YYEA 4IKPA 1DKLA 1F0KA 1HLGA 2GPSA 3LQKA 5I51A 2Q2NA 2I5PO 4PYKA 3ZLJA 4EI8A 2UUOA 3M89A 4RZXA 1IJEA 1HE1C 4S2EA 3FHTA 3H75A 1GU7A 2C1ZA 4OXIA 3UNXA 4XFKA 5AHRA 3ANSA 4A1FA 1GPBA 1Z0DA 1U2EA 2GARA 2G83A 3NBUA 4TLMB 4N5HX 5L3RA 2AVDA 3V2IA 3WSTA 2VDWA 4EBFA 2E4XA 2LKDA 1DIBA 2DMRA 2W2OA 2XZOA 4YQEA 2G80A 4WL0A 4DSUA 1AOXA 3GJ3A 5B58T 3RTAA 4AZ0A 4KBYA 5D00A 3TTTA 4MYDA 1VMIA 2W00A 4EELA 3EPLA 1SG9A 1KU6A 1EHCA 2X9VA 4LHZA 1UBMS 4ARZA 1C4KA 4HT3B 4X7RA 4OXXA 4QRIA 1U4OA 1Y8CA 1EFPB 5LJLA 4OFZA 1DP4A 4WOKA 1E62A 4EUEA 1LWNA 1EDOA 1BXGB 1ZD3A 3GLIB 3DULA 1ZZEA 2HU2A 2OHXA 2JLAA 1QFJA 2QNRA 4RDCA 4AULA 3TPFA 4DHEA 3ELWA 2Z58A 1HFWA 2CFRA 5FULA 1RKBA 1C9YA 4C6RA 5E2IA 4HNUA 2QE7D 2WU4A 4YB8A 5L8VA 4HLCA 1TLLA 4WFKA 1NZFA 3KJGA 1UQUA 2NAFA 2VXOA 4BLVA 3R0JA 1BS1A 5D85A 5FYQA 5DV9A 3OKCA 3FOCA 4KBFA 1C7ZA 4DSNA 3N87A 3SC2A 3WK8A 1GG5A 4KRGA 1V3QE 1DUSA 4CI9A 1E99A 4FDVA 3ZTWA 1F0PA 1AGXA 1G291 4NENA 5I8PA 2BGNA 4I4TA 4CUKA 1ZRHA 1M34B 2HL6A 1FNCA 1W1WA 4QJ4A 4L5JA 3TIVA 3TUIC 3ZCQA 1X77A 2P3QA 4EVSA 2FQYA 1HTWA 3HZRA 2QMEA 3C74A 5JS2A 3VR4A 2FFBA 5KDDA 2X8WA 2NPFA 3U9TA 3SJ7A 3H2BA 2V6GA 5FTWA 2JHPA 3QV1A 4CLRA 4Y6GB 1VG8A 4C21A 4A8JB 2VDPB 3IPLA 4FHZA 4OJTA 2W83A 5I7AA 1CUUA 4CF5A 3FCUB 1JQDA 1R0KA 5HFJA 1D2MA 4ETMA 2AI2A 1YAJA 4ZYZA 5J4HA 2CL6X 3VYTB 1QH8A 5E0OA 1OHHD 1KPHA 5L3QA 4QTTB 4O4HF 3AJRA 2PEYA 3HDGA 2RCNA 3BPSA 4QJIA 3SX4A 5KMGA 2BSXA 3OURA 7MHTA 5DM70 1QVVA 4EPVA 1SK8A 4II3A 3UC9A 1NE7A 4GMFA 3G5LA 4C4PA 4P7KA 5BNZA 1EP2B 1R74A 4JIMA 3TMAA 1VE6A 3IIEA 2Z3VA 2ZLBA 5J9FA 1L3BA 4FFBB 4MVJA 1E5VA 2Z2IA 1QH1B 3EGWA 5DXAA 3N8GA 3B1WA 3OOYA 5C8YB 3IIJA 5BMVA 2XEDA 5DLYA 2BFCA 2QUAA 1QKJA 1CWUA 2Z1MA 1ULAA 1OBOA 1IUNA 3DMRA 3IDFA 3JQCA 3N0VA 2NADA 5EJ5A 1U2PA 5TB5A 3LCJA 1IQRA 1DBIA 3FOBA 3HJCA 3M1IA 1ETHA 1PQUA 3RU9A 4LK3A 3OTWA 1TCCA 1UK9A 4O3MA 4IJVA 1N6LA 1YAHA 4LSZA 2GX6A 4IUBS 4UKDA 1BTOA 3T95A 1HDZA 5J2TB 1RLTA 3KEQA 1STOA 1QLJA 1E77A 1AB6A 3ESQA 4S1NA 1AHNA 2QPLA 4FFNA 1R9NA 1Z0JA 5AOCA 4B6SA 1T6XA 3DL4A 4G9EA 4YJHA 5T6MA 4EF6A 1XO1A 4MGKR 2DPGA 2VUUA 3LVBA 3GXOA 3GL9A 5DXFA 3IBGA 5EL0A 3WMFA 4EFLA 4I4IA 3N8HA 2OB2A 4KXNA 5COQA 1SUDA 3RS4A 3RKSA 3VUFA 1L5MA 1E2DA 3A1EA 4C3ZA 1DMRA 1I2AA 2VHXA 3AEUA 4FGUA 1I4EB 2XYGA 4GPIB 2V65A 3PNQA 4RQBA 5JCPA 1G55A 3U56A 5EZYB 1FEZA 3QUTA 5IW8A 2ZVQX 2FYTA 4BFSA 1FYEA 1QG6A 4I50B 3HC7A 1KAMA 1P3DA 4Y8VA 1QRTA 3HKBA 5T4FA 3ROMA 3DLTA 2X4LA 3DZCA 2GZ3A 2XW6A 3OTQA 4LVNA 4HAOA 3MJHA 3AH8A 1Y6QA 3QLEA 3V1TC 1M6WA 5BPFA 3JQ9C 4RO0A 5CBPB 2IYAA 4LI3X 1ORIA 5K3DA 3P19A 1KPGA 1XMVA 5BW8A 1D4AA 3IT3A 2YUTA 3A70A 4F5WA 1IATA 1TU0A 3BL8A 1VKZA 3E23A 5FHRA 2VQ6A 4XWOA 4UW9A 1X70A 1CUIA 2AR0A 3QHQA 3RUHA 5HJ2A 4DEXA 5BOSB 2Z5VA 2ZJ4A 2HXSA 4JMLA 1V41E 4UDOA 3PVZA 5AK6A 2A1UB 3TZ6A 1WTCA 1CETA 1XCPA 2HSWA 2GM5A 1M2KA 3K0KA 4OAPA 3UJ9A 2BI7A 2W6JA 4QU0A 3BTOA 1NUAA 5CTJA 5L3VA 2H4XA 1IJFA 1F4LA 1GRVA 5BWOA 1NOKA 4DUYB 3EBPA 1LDBA 3PXGA 4IV0A 3CE9A 1JH9A 3N76A 1LDGA 3LZ6A 3V8BA 3QKUA 2MWMA 1ZWKA 2G9NA 2N3ZA 1Q7EA 2GDJA 4K1XA 1B8OA 5BOVA 3QFRA 2G88A 4IQ0A 3BA1A 5DTJA 5KSZA 5AXAA 1G5QA 2P40A 2XT0A 4TL6A 1QU3A 3B1YA 1PVDA 1WWKA 4ND8B 4WN9A 1OY1A 2BDUA 2YWXA 1SFRA 2QYSA 2ZANA 4RDHA 1RTTA 2CVOA 3L7CA 1S96A 5E38A 2EZ8A 3KP1A 2IC5A 5I9LA 2QT0A 4GMKA 4H17A 4LYFA 4PW0A 1EFRA 3RU3A 3NNNA 5F1YA 2C4HA 3GF4A 1JR4A 3E7FA 3I05A 3OMLA 4HLDA 1SIUA 3IE1A 3KC2A 3JQEA 3PNMA 1MOZA 5KQMA 1WZ2A 3BMQA 2JH8A 2X19A 5JAZA 3HH8A 1H3EA 2FP4A 3KKLA 1W94A 2Z2ZA 4FFVA 1LEHA 4MR9B 1D2RA 1U5AA 1MVNA 1NV9A 2KSQA 2DFLA 1TVKB 4NJEA 2I8LA 1A5ZA 2OB1A 4U2KA 3RUAA 3RSCA 3PIRA 2HNKA 1J5PA 1KI9A 2HA2A 1W85B 9LDBA 3KR9A 2YKGA 1LS1A 1EFVA 2P9BA 2VTKA 4KMOA 2ID9A 4HI0E 3UOGA 1B93A 2GILA 5C7YA 2CXNA 4ZOAA 5DVZA 3JQ9A 1R50A 3PJEA 5ECDA 1P0PA 3H2JA 2CXQA 2NYVA 2P79A 4CMBA 1OU4A 3V4RA 3L0PA 3HUFA 4O0LA 4NBLA 3OZIA 3QSGA 3P2JA 3UHOA 4C1NA 2WJHA 3PGA1 3WGZA 4DG5A 3DKKA 4DJAA 821PA 2AW5A 5FJIA 5WRFA 5AXCA 4D6XA 3O1IC 2JGLA 4LXUA 3BK1A 2W2NA 4PSAA 4CLEA 4UTXA 4JVNA 4JQCA 5F98A 4INPA 3TVTA 1QH9A 3B7PA 2HWKA 5CD9A 1JIQA 1I13A 2FWRA 4QULA 3QPCA 3DOHA 3EEOA 4N18A 2AGVA 1ITZA 3WRXC 3WRVA 3LTNC 4HYYA 4CV2A 1I0ZA 4OHBA 3LYHA 3NKVA 4YYZA 1B7GO 2PGNA 1H6AA 2W2TA 3JARA 4G1EB 1VLMA 4XGIA 3UK1A 1Z13A 3OECA 1T9ZA 4HXFB 2I80A 1TZMA 1YL6A 1SQ0A 3G1TA 4PF1A 4AO8A 1YQQA 4DWVA 3CYFA 4ND7A 2E4VA 2J3MA 2WJIA 3GLQA 2OCKA 2WUVA 4P93A 4F2GA 4G65A 3VO1A 1L4MA 2I1LA 1JALA 1WDMA 2P90A 3A28A 4UATA 4G4IA 4C4TA 4QC2A 2B6HA 1PIWA 1KE2A 4Z2AA 3UN1A 5KYTA 2I4RA 2P9TA 1VPTA 2B2NA 2HU5A 3INGA 1YZNA 1Z4KA 1LI5A 3M3HA 3DEKA 1E6EA 1VHTA 1DXHA 1CYDA 3I2IA 4TWZA 4AURA 2L69A 5LLSA 2ZIFA 4TV9F 3E0QA 3F3KA 3GLGA 2QS9A 4DQDA 4XIYA 2BUCA 3C5CA 1NXQA 3KFVA 2YRFA 4H60A 2Y71A 4M21A 4B6JA 6CHYA 2BEVB 3D02A 3P4YA 2JLQA 3V4PB 1XZGA 3D7LA 2ID7A 2O7NA 4M99A 1YB7A 1FFXB 1BGWA 1EK2A 1JLHA 3OZDA 2MR5A 4HLUC 4OI4A 5ALEA 4NBKA 1VI2A 4D4IA 1KZ1A 3JAKB 3MGBA 4JFRA 4BB0A 4KQJA 2WM3A 3G9TA 1A9RA 2P5TB 2Q8PA 5AM4A 5AVKA 3ZHYA 4Q34A 4DILA 3L79A 2Q8NA 3H1TA 1UPCA 1QDLB 2IZ0A 2IBSA 4Z5XA 2A86A 1BDJA 3G0GA 5K0LA 3BGVA 4WSOA 1FSZA 1QK3A 1OH7A 4I5DA 4Q3BA 3EHDA 3PEVA 1NDUA 4H3VA 5EKUA 1MJ5A 2CMGA 3P32A 4AJJA 4MMXB 5K4HA 1S1MA 1Z4OA 4POAA 4XIIA 5ALRA 1KSGA 3SJUA 1HY3A 1OA1A 1T5IA 2ZUBA 3FYCA 1HL3A 1OIVA 4CL3A 2RAVA 1JZQA 1VOTA 2FK8A 3D8TA 4G0XA 2PPVA 2WYWA 1OBVA 3P94A 3M6UA 2HSEA 2ZIZA 1P9RA 2HA6A 4HGOA 3D2CA 1QR2A 2L18A 5IAOA 3LP6A 1HKHA 4H7HA 1WF6A 2J48A 3AU9A 1HH4A 3RRJA 4LGVA 1V7QA 2E89A 3AG5A 2XTMA 4RH3A 4ZRDA 3WLTA 3ZNPA 3WRXA 2HZBA 5CVTA 1YWGO 4ZVKA 3VH2A 4QNNA 5TPWB 1AUPA 1ANKA 4W7HA 1DAHA 1V5IA 1XK7A 4HX9A 3WMXA 1DDOA 1KZGB 5DN6A 5FA8A 3R7DA 1TYBE 2Y2VA 1UAGA 1UEJA 1YHZA 1K5HA 1EWVA 1X7XB 3A26A 5IAKA 3UXEA 4ZHQB 2Z9DA 1T8PA 2YRWA 2AIRA 3OIVA 5JSFA 2ZIEA 2AEEA 4LJAA 3TM5A 4DDWA 1DFHA 2ABWA 1G8PA 1UH5A 3TECE 3H87A 1MTOA 5HKLA 3RC7A 4A6EA 1N7GA 3DDOA 1T3GA 2J5QA 4OGLA 1ZCBA 2BN4A 1RDFA 1T8SA 3OZVA 5E4TA 4LSGA 4B9AA 4E03A 4P3YA 3FWZA 4YRIA 3KQOA 5G0UA 4CTKA 2QE6A 1KY2A 3A1CA 2EDAA 1ZIOA 5KS2A 3THXB 4OQNA 1M2GA 3AONB 3BIWA 4NH4A 2Q3CA 4YCDA 3T0IA 2YYZA 2ZITA 5ULLA 1BXGA 3X2SA 1U3TA 1XELA 5E6RA 3B2EA 1TK2A 1XF9A 2DCUA 2WYIA 4HLUA 5DEIA 4G0QA 5I6DA 1X1BA 2FU5C 4U7FA 1SBYA 4PWZA 4DQUA 4WXMA 2E9SA 3PPYA 2PFGA 3G2OA 4D8WA 4ZV9A 3DVLA 1A2BA 4H4DA 2JCVA 2KBEA 4BQPA 1PT5A 1QANA 1BFDA 3N9IA 1NI5A 3GEGA 1J6UA 3KKKA 5F9FA 3QY0A 2H8KA 3G0CA 3IVXA 3IOEA 4G23A 3VVLA 3CISA 2RB5A 2FMUA 3DLHA 1SUPA 5JHHB 1IC6A 1NONA 4ILKA 4R8KA 2QG6A 2NZJA 3H4IA 4UD6A 1UJ5A 2GVDC 2ODNA 3AF4A 5HM8A 4UMEA 5DHQA 1WP9A 3G2PA 3KZMA 4PFJA 3WNQA 1O95C 5K8UA 4O4JF 4TTIA 2XNDD 1A76A 3E61A 4UQLA 4RHFA 4IGEA 3ZWOA 1OYYA 2HCRA 2LTAA 2IHVA 4BEVA 2DBVO 3IP3A 2JD0A 2JFOA 1NUQA 2PZ8A 1QYVA 4HAYA 1YFZA 4EJSC 1IXZA 1OE0A 2ZR8A 3IODA 1E5TA 3FPCA 4KLAA 4KMMA 4PFKA 3EZFA 4DAOA 4LXXA 5KOHB 3MQ4A 2FLVA 3MJEA 1JILA 3I72A 4V0LA 5E2BA 2YL2A 3EUAA 3PNPA 5G0WA 2B37A 3KYCB 4IDCA 2D00A 4IH1A 5I7VA 3AT1A 3RROA 3QYPA 3RVRA 2W2VA 4J91A 5TPZA 2IU3A 3IV9A 2H4ZA 1ECBA 5EIOA 3NVMB 3RVMA 1YS1X 1NKVA 5IWCA 1J0BA 1WM1A 4Y6PA 4QWWA 1S8AA 1ONBA 2WDZA 2C1EA 4A16A 2R6AA 1HFEL 4YP1A 2I7VA 3QKSA 3I9FA 5A6SB 3VZBA 2POCA 3JS5A 2YVUA 1XN1A 4Y6QA 4LV5B 1EM6A 1ZLXA 4IYJA 1T4MA 4ME6A 1XCOA 1Y9ZA 5FXMA 4ZZ0A 1CD5A 2AX4A 1THMA 3K96A 4TMZA 1BYUA 1GUZA 1Z7GA 5B3AA 4E4RA 5JH7A 2PBLA 5H7XA 4UFOA 3H86A 2Y0DA 1G21B 3H18A 3CW9A 2OQRA 3BIFA 4K6OA 1BKSB 5LXTA 3EPPA 1U2TA 3LXXA 3I61A 4CUJA 2XVXA 4D02A 2FRVA 3TB4A 2VO1A 1GARA 1LSOA 4GH5A 2V4MA 4ZJPA 1CFJA 2YN2A 4BN4A 4C22A 4NRDA 2AUNA 4JA2A 1VBMA 2GUGA 1H8HD 3D7SA 2VDRB 1GQYA 3VO8A 3VI4B 3PRHA 3RUDA 4DRYA 3U3JA 3HE3A 3B6MA 2XX3A 3WGHA 5KYXB 3TB6A 4WERA 3G2LA 4BO7A 3KKPA 4CDRA 1PD0A 1ZOOA 3AY3A 1T4DA 2UZ0A 4PZUA 4D4MA 3OLCX 4QEKA 2V97A 1QHEA 3G5MA 1BVUA 3U7EB 1VI5A 1X39A 4EUFA 4JP8A 4YRPA 1T1JA 1V0JA 2V5VA 1F48A 3FBTA 4EIWA 5JOQA 3D4OA 1ODTC 3C14C 1F1JA 3JQPA 1C8KA 3MJFA 3PL5A 4Q1DA 1O95A 3EJWA 3PDWA 4TYPA 4QPJC 1EFDN 3BWDD 3ZQ6A 2JGIA 2G0NA 1GA6A 4L22A 5CDFE 2XMBA 1JJBA 4YJ2F 1C4WA 1FS5A 4WOJA 2PX3A 1OVGA 1JU9A 4EJSA 3QLVC 3NYWA 1E3JA 4Z54A 1E92A 1ECPA 3IP6A 4HOYA 3ROEA 3TOCA 4MW9A 3WLEA 3UAGA 1Y6FA 2GB4A 3GJTA 1YNSA 3IH5A 3NXKA 5KQPA 4D4LA 1NVAA 2YMPA 4NPCA 2XY4A 4QYTA 1SXIA 3QE0A 5FYDA 3D2LA 1KDPA 1YZTA 1J07A 2DG2A 1F9EA 1GSHA 2KQUA 3PWKA 4UARA 3REOA 3SPXA 3U17A 2GOYA 2HHCA 3F8TA 1AK1A 1R15A 2H7XA 2MSKA 1IK6A 1YA6A 5FTLA 3N1UA 5K05A 3GJ0A 3IBTA 3R6GA 1BKDR 3GNLA 5GINE 3RS9A 5A4AA 1IMJA 2JAPA 3FZGA 1N0HA 5BOSA 1MB0A 2ZREA 3KPJA 2AJTA 3KJIA 1U7XA 2QSUA 3D81A 3PE6A 4UJ3A 5DBFA 1UBTS 1N8KA 3NBZC 4XDYA 3WKDA 3TGPA 5HVNA 4GXRA 3W6PA 4CF6A 2Q5LA 4M0DA 1KR2A 4KXQA 2CK3D 1ZINA 1M54A 4OSEA 4HWSA 3DDNA 4CLOB 4C7JA 4P34A 4TQ9A 1CEXA 2YWRA 3PQ6A 5AI4A 1MVLA 3QHAA 2HMAA 4BTEA 4LQDA 5A5GA 1KQOA 3RBXA 1X9GA 5HKKA 1A9XA 2B4KA 2CW5A 2GFHA 4JX9A 5GJBA 2EIHA 3FOWA 3PPXA 1Z0SA 1RQNA 4HKTA 3TR6A 5HXAA 2BKLA 1RIIA 1LPOA 1CS0A 2AFHE 2F00A 2J6CA 4IZOA 1M1YE 1XQ6A 4JEUA 4RA6A 4V03A 3MFYA 4CM6A 1Q17A 3UWOA 1FNSA 3D5QA 2AEMA 1NFQA 3KD3A 4M1SA 1TLTA 4DREA 1I1NA 1X6VA 3AXTA 1N9ZA 1ES9A 3ZWWA 4JGGA 1N5LA 3JQDA 3ECCA 3A3YA 1JLSA 3KUDA 3HV2A 3LWBA 3PEFA 4WWHA 2IUUA 5K3EA 4CEIB 2POQX 1BW9A 3NT5A 2FZGA 3D7RA 2ZAIA 4IV5A 5CK4A 4TN1A 2C84A 4OIFA 3PQ3A 3N7AA 2O48X 3CH4B 3KT3A 2DWQA 5I4KA 1UQTA 4UUPA 4D98A 2RH5A 2BKUA 1QLHA 3N53A 1NT2A 2KYRA 3GIDA 3K2IA 2XCIA 5ENDA 1E1QD 2HXYA 4DA8A 3U5ZB 3QLVA 1PO7A 1NF2A 2A0FA 2G40A 5LMNB 4ZQCB 2EQ5A 3C39A 4CEHB 3NO4A 4EY3A 1KE1A 1XXHA 3F47A 4KQGA 5LDHA 4ARSA 1HE8B 3R9XA 2Q0SA 1XLVA 4PC3A 4BFUA 1NNUA 1NVUQ 2E21A 1TA9A 5KNLA 2CVPA 3NM4A 2PRYA 4HWRA 4KRFA 4BFCA 3OQMA 1GU0A 2QRHA 3Q4GA 4WCVA 1RWWA 2H1SA 2X9NA 3IO5A 3NATA 3R6LA 5A05A 2PX8A 3T8YA 3RVOA 1Q44A 1PT7A 2FVXA 3JYNA 3M1YA 3NPMA 3P4XA 5LQUA 2NV6A 3I0NA 4HC4A 4IOKA 4D0SA 1TCVA 1TE2A 3JX9A 4DZRA 1TNDA 3H9JA 4MW4A 4DCCA 3GFGA 3WWDA 2VCEA 4D5GA 1B23P 4MQEB 1ZHFA 4LKOA 4K03A 3H5IA 1SB9A 3EWIA 2XMDA 4JLJA 3MERA 2BD0A 1T2FA 5K8TA 2GT1A 1XYVA 5EMHA 3D6NB 4MJXA 2P41A 5K5EA 1U02A 3CKKA 2YXLA 3W9UA 1XP5A 1L5HA 4ARAA 4W1PA 5BT9A 1QO0A 2AOUA 4W8GA 4ANFA 4R0NA 1J0EA 4RL4A 3U62A 2GI4A 3DEHA 3E3LA 3I5AA 2CVFA 4YR7A 1KSFX 4JUDX 4HRYA 1XDUA 3K1AA 4I5FA 2WNSA 3NUGA 4LX0A 2FH5B 3LUAA 2R7NA 2VF7A 4P58A 3PCXA 4WK6A 3T7SA 4DTCA 3X44A 1IL0A 1TEVA 4IZIA 1MX3A 4PINA 4R0VA 1YFKA 2Q49A 2V1XA 1Y1KE 4RPIA 4KDRA 1Y8QA 2B8WA 2PTGA 1M3SA 2OT3B 4BNTA 4KYUA 2NZVG 4BQEA 5ICMA 1CTQA 2QTVA 4OA8A 4ZT7A 4ZAFA 2YWFA 4JOSA 1T0PA 1KU0A 1ORRA 4CEJA 4JYAB 3B8EA 3V97A 5LIRA 4RIHA 2EG5A 3UAVA 2RGGA 4HZIA 1QBGA 3CA8A 5CNKA 1QPZA 1W48A 4DCGA 3OM8A 3U7IA 1SHUX 2H1FA 3LXRA 3TM4A 4I1IA 3W0LB 3BZBA 1ZM7A 3MXOA 1L7XA 3MD0A 4DSZA 4GBGA 1JQKA 2ZYVX 2WYVA 3EGDA 4HNGA 4FOSA 4PSCA 2YOFA 1ONNA 4Q4DA 4R1LA 4RPKA 1VLLA 2FXIA 2XOEA 5K0CA 1A5AB 3FSRA 3H3JA 4LY6A 3IUQA 4N82A 3EDCA 5IJ0B 3NW9A 3PF8A 4QUDA 4WT7A 2BC9A 3HTXA 4FGWA 5JE8A 4C0LA 3E84A 4U5QA 3HNPA 4TLCA 5HCUA 2IV2X 4AJPA 3TKYA 4BX8A 3G8BA 3KQHA 3HL4A 1MBZA 2GBGA 2P1RA 1M2WA 1SC6A 2CLLB 2FUG6 3DEJA 4UQPA 4K3UA 1U1IA 4ZPXA 4MO9A 3USES 4C03A 2QIPA 3ZJ5A 4F0JA 1U1DA 3WA7A 2QDXA 4TMKA 1G6KA 1NAIA 3FDJA 4N12A 5ALUA 3F2VA 5EPOA 4ALKA 3PX7A 2HF8A 2ZGVA 3N6RA 4EO4A 2V7QA 2LDXA 1E3EA 5C32A 1DB3A 1YQTA 4DNFA 3QVVA 1FUUA 1SU4A 3MWGA 4MLCA 1RNLA 3MTGA 2IY9A 3VYWA 3UMRA 4M7WA 2EV9A 2JAXA 1XPJA 3EARA 2P65A 4X7BA 4MQLA 4E32A 1IHPA 5EP3A 1H6CA 4D99A 3WLQA 5BN5A 1OW3B 3CR7A 2AOTA 3KQTA 1YVUA 2FPPA 3AXSA 3PD0A 3PFBA 2VH1A 3QLUC 4C89A 3TQCA 5HJ5A 4XE5A 1H1LA 4HDAA 1TKRA 4WZAB 1SXQA 2BZGA 2AZ4A 4OATA 5ENZA 4Q6WA 4CG3A 1JJAA 2W2LA 1FK8A 3ETCA 2ZAYA 1L1QA 3R7SA 1NBEA 1OWLA 2X0KA 2E3JA 4QDKA 1P8AA 4LVCA 2R8OA 3TNFA 3IDSA 3ZHQA 3PVCA 5AI9A 1L4BA 2RK3A 3FX2A 3AUJB 4BBJA 4QVIA 2PUCA 2IY8A 4FBMA 1FLVA 4BP8A 4DSOA 4OGWA 3R5KA 2RIRA 3ASYA 4P92A 4XD2A 3QLTA 3BVPA 1XQ1A 5IAGA 4FNAA 2QYOA 3WZ2A 1GTG1 2IWHA 4E6PA 4X85A 1Y7PA 3R6DA 3E1GA 2DLNA 4M8SA 2BMJA 1X2EA 4F5EA 4IP0A 4RKQA 5H80A 2CBZA 1VZ2A 4Q4CA 5TQ0B 4QT4A 3GAMA 4KHZA 4ZYTA 4RHXA 4WXPA 1NNLA 5ES3A 3UJDA 2IHUA 1YCHA 2FA9A 1P2BA 1V45E 1UWVA 1HG1A 2OD2A 3M4XA 2M1XA 3M9LA 3ND8A 3ORYA 4ZDKA 3EGOA 3Q8WA 1PJQA 1XOIA 3K9HA 4DBLE 3GBVA 5EJ8A 1JA0A 4H9GA 4B40A 3RDPA 2R2GA 2C3UA 3NIGB 1QS0A 4EKGA 2EJCA 5A4DA 3DVAB 1OXUA 2QLJA 3A36A 5CEJA 3AR2A 2CB9A 1EU1A 5TX7A 4OQXA 4DMGA 1ESZA 3T4PA 3ZS9A 2B36A 4BMCA 1EDEA 1W1UA 2WK1A 3GJZA 3F90A 3I9NA 3LUGA 3VR4H 4MDFA 3M1LA 4K0KB 1PJBA 1OX5A 1PX0A 3OEEA 3PHLA 3V7YA 2ILVA 3EGVA 3ON5A 4JAVC 3IE0A 2IHYA 2F3SA 3Q7PA 4LYAA 2IS1A 1YS9A 4NCIA 2ZIWB 4WMLA 1SQ6A 4JIGA 5DGIA 4BN5A 3KPVA 1RXVA 1LX6A 2AEFA 2BAGA 4K6FA 2C94A 5D8DA 1M6NA 5BRAA 2BTEA 1A04A 3EOAI 2JIZD 5HQ3B 1BCRB 1NXSA 2HA3A 2VPTA 3PGLA 4P86A 4A2WA 3M5DA 4OMUA 5LQCA 1DIHA 3QLUA 1DC5A 2HRCA 1B8VA 1Z6GA 4DKXA 1BXRB 3GCXA 4RAOA 3ZGNA 4DA7A 4E12A 1CRQA 1PJAA 3HDJA 1IZ7A 1IY2A 4J0CA 3VQTA 2R3SA 3GWZA 2X5JO 1A82A 1C80A 2OQIA 4DDTA 4MI3A 1P4JA 3H97A 1JHZA 4H31A 1VPDA 2ZRLA 4G26A 1OYWA 1JFTA 4ZDWA 4TOIA 4MVJH 2GD6A 4Q01A 2V74B 1ZN8A 4IIFA 5DTQA 3TZCA 1X14A 4K9KA 5K7SA 4GAEA 5K0ZA 1SEPA 4RENA 4YFVA 1ABBA 2Y99A 1IOVA 1TUGA 5K0TA 5INTA 3EVFA 3VPXA 1C7IA 3GLRA 2O0KA 1BEZA 4M76B 4LI0A 3TBFA 1NUUA 3S2ZA 1Z7YA 3WQBA 4EZIA 1KEEB 4RGVA 2P9YA 2PDAA 3RYFB 4NV3A 3T4XA 2J0EA 5F51A 3TL3A 1TEHA 1V2GA 2VNJA 2Q3EA 2OO3A 3VTZA 3DPUA 4H0NA 3ER6A 1IHDA 1V11A 4Q4AA 5ITSA 1H3FA 1T9BA 3KX2A 2IZOA 3C6KA 4G37A 2WZQA 4DV6B 2DY1A 3GEHA 2IQ5A 2JIRA 2HEIA 2J6IA 1FYFA 2ZBUA 1JMVA 1Q6YA 4YACA 4TMFA 3O74A 1GG9A 4TVBA 1O87A 4QG3A 2FI1A 3Q6IA 4RLHA 1DRWA 2CN1A 2I99A 3VZRA 2IY7A 1TJPB 1BYIA 2CEKA 2J9FB 3D6TB 3FCCA 1AKUA 1YBHA 3O2JA 4GDFA 4NZYA 4X9XA 1PWEA 1ZP6A 2C9OA 4DJTA 4EW1A 4YRAA 1YBVA 4PLWA 3NH9A 3R3WA 4J49A 3OFSA 2HF9A 1G18A 4NBNA 5F2EA 3S8EA 3B82A 2DT5A 1QYWA 2VJOA 3GEEA 3ZHZA 3DLAA 1D2HA 1IZZA 2FUG1 2JFPA 3KDPA 4FLFA 4E2ZA 4XLTA 1CQPA 1A9YA 1D7AA 3HB5X 5ALJA 2NT3A 3X1MA 3N2KB 3RFVA 4RKFA 3ZLTA 3CLTD 2M32A 2NSJA 1RE0A 1GNSA 3HCOA 4WD3A 3U26A 3X1XA 3IPRA 1PL7A 3PEUA 2E4ZA 1PR5A 5EXTA 2ZJ8A 5TEVA 1GQOA 1FNBA 1JIUA 4L8LA 4W8OA 2EX1A 2LCQA 3PR1A 5B55A 2IKSA 3JZIA 4DIOA 2FUEA 1EUQA 4GI3A 2EFGA 4X1YA 4F9EA 4YV1A 5BWLA 3RYIB 1MZPA 1MA3A 3OKPA 1DPGA 4XPZA 3QELA 2IXDA 1HORA 1U2GC 3R75A 3FF4A 4CKBB 2CC2A 4NCKA 3NX4A 4Y2RA 1T1EA 3OHSX 3A6LA 4XVHA 1DAMA 1G3MA 4ZO8A 3AILA 2A5FA 4NNPA 3RS5A 5BUCA 1THGA 1TAQA 1WSAA 2HKIA 4NCHA 4LFBB 1PYOA 1RJFA 3OE1A 4TYNA 1ENZA 4E14A 1DNPA 2GK4A 1U3CA 3WKBA 1DAEA 4CIWA 3KJFA 2WE7A 3NBQA 3TFOA 4ZQFA 2JIMA 3CLRC 3IQEA 3X1JA 5GOTA 4KIGA 4TTPA 5BN4B 3T9EA 3W3AH 4QE3A 4C2BA 3ZWAA 1HLPA 2PK3A 3KU1A 3TPZA 3DTVA 3TAXA 1C1XB 4YLYA 3RV4A 4QQ8A 3ZUPA 3V8VA 3EDQA 5K03A 3L8DA 4ZQEA 5GPBA 4B9EA 3NIDB 2YVAA 2GO1A 3JQ8B 3UATA 2B1RA 3BXZA 3FMPB 1K66A 3IAS1 1HF3A 3BTSA 4HB2A 2WTEA 4LBZA 5LKAA 4E07A 1RKVA 4KOEC 2C7GA 3QX3A 1MC8A 4CVNA 3GU3A 4CM4B 3CC8A 3PTAA 3PFCA 1C9MA 1MJGA 4RIGA 2IW3A 3OLWA 1X92A 1AQJA 2VQEB 1XDSA 2EJUA 5LA6B 3RASA 3VPSA 1QWSA 3I6MA 2GZRA 2OVBA 4JBGA 4LWZA 5BWMA 2QY9A 1XJWA 1L5VA 4CQLA 2WF8A 1EPUA 1XROA 2Z3ZA 3GBPA 1W36D 1QCZA 5FBWB 1E3DA 4DCMA 1NPTO 3ONWA 3IUYA 3W9SA 4K86A 3H11A 4RSRA 4W7IA 4L0DA 1YUBA 1Y3IA 2FPXA 3AOEC 4JLPA 2W48A 4WJKB 1E9CA 4A6XA 1EXDA 1M2JA 3JAWB 2HJHA 1H5UA 1UL1X 4YUVA 4QVKA 1CQZA 1MP0A 1CZLA 1D5WA 2R751 2C03A 4Q16A 1S2IA 4YJFB 4D57A 1B1CA 3PXEA 3IA2A 1N6OA 4HDSB 5E8JA 1MT0A 4M0FA 4A5SA 2WUFA 4WXHA 3GB9A 4CR7A 4K0RA 1A2KC 3DLCA 4ZYYA 3WLKX 4UCWA 2FPMA 2AXEA 1VIDA 4Z1OA 5CIYA 3FNHA 3KWLA 1ZJYA 1U2GA 2QRVB 3DXFA 4GLFA 3R0IA 3IOMA 4HDKA 2Q3BA 1LVUA 2WP0A 1I7QB 2FVYA 5KOYA 1YIDA 4KACA 1MRNA 3BGIA 1XZHA 3OQIB 2XIQA 5KJEA 5EJ7A 4ER3A 1HUQA 4LWQA 5EJGA 2GZMA 1E3MA 1FF9A 2LZ0A 3T4EA 4UOEA 3R3JA 1H94A 1HYHA 2GD1O 3ZK8A 3CZRA 5E7MA 2F3QA 4F06A 1GZSA 4O2AF 1SXPA 3E9MA 4URUR 1E9FA 1XFDA 2KB0A 3P9QA 1HFJA 4ZPJA 2SKEA 4MMYB 1WB5A 5EERA 2GSWA 4DB2A 3C1UA 5JSHA 2YJ6A 3BJIC 3GGDA 4P81A 2DYKA 4LRXA 4AECA 4BP9A 1MUUA 4NY1A 1WB9A 3B85A 2PSEA 3EVZA 4I1SA 1I5EA 2ZRKA 4OH7A 2OYRA 1IVSA 2CV0A 1QC5B 4WZBB 4ZRMA 3TAHA 4MQ5A 3WGGA 2FSFA 5HKOA 2R8ZA 4CE6A 4LDNA 4LJRA 3OMWA 4EQ6A 4FX2A 1WCV1 2RBEA 1Y6RA 1H8HA 3H9BA 3OZAA 1FYDA 3PWTA 2OG1A 2ZIGA 2I22A 1AX9A 4AG6A 1BMTA 4J0GA 2IHJA 4MHSA 1KO1A 4KPUA 3WJAA 4EHJA 1RAHA 4JD5A 4F8JA 4K9DA 4WLVA 1H66A 1ZW1A 2F9MA 2Q2QA 3AF0A 3EXG1 3QE3A 1LFDB 5IJ9A 1NMYA 3V1NA 4BV3A 2B83A 2H0RA 4RTOA 3EIXA 3GPBA 3ZC3A 2D5BA 5A03A 3KTFA 4ZARA 4HADA 2WTBA 2XCUA 1CUGA 1SVNA 4ZCLA 3WL5A 1MTZA 3WYAA 5JZBA 3N2EA 2B8TA 3A3PA 1EIWA 5AJUA 2I2XB 5DCYA 3VJLA 3A2MA 3DWFA 2O0HA 2ZB4A 4RM2A 1SCJA 1NBMA 2GZ2A 2R6JA 3L0CA 4XKJA 1H4TA 3B7GA 3OZUA 4FS8A 1XPUA 3QG1A 5FNVB 3EQ6A 2B5OA 1EFCA 1MAHA 1XVUA 4IWXA 4NFYA 3UPTA 3L41A 4HB0A 1Z3IX 3UQZA 4XYMA 2HYDA 3KB1A 4IBOA 1DWPA 3U2QA 3UO8B 3TINA 5JWRA 3FFBA 3ABZA 1AKNA 3LUHA 3ZBUA 5JNTA 4NXMB 1T8YA 1VFPA 3GDFA 1RAIA 2BKXA 3B9RA 4CYMA 5AD1A 2Y0CA 3MWYW 2ZRBA 1G6OA 1JF8A 5HWSA 3P9KA 1MAUA 2IU6A 2SKCA 1JW9B 5UKDA 1RZRD 4JJEA 4MGHA 1V9LA 4QBHA 1IXRC 3SU8A 1GGVA 1OWNA 2HF7A 1COWD 3S2YA 2PSFA 1NBOA 4MRNA 1WQ1R 1ACLA 3FVRA 5CH5A 3UOWA 1GXSB 2Z8ZA 1YS2X 2JGFA 2V54A 1SKMA 1DCKA 1X7YB 1N6IA 1TTQB 3GLUA 4GFDA 5FOXA 4KFCA 2IYPA 2GN9A 3UTDA 5I3ZA 4XD7A 3L0SA 3V2GA 1WBDA 5TF4A 2XF8A 4TTAA 3OT4A 1Z45A 1U81A 4RKRA 4Y2HA 5DK4A 1AH2A 2XNCA 3KYDA 3M49A 3VZCA 1YCFA 4KI7A 5BWCA 1NJGA 3ZX5A 4X1KB 1KVTA 1RU3A 1RC0A 2I87A 3PT9A 3PUXA 2VVTA 4HPJB 4PG8A 5HF8A 4OSOA 1XDZA 4UPVA 1WA5A 5SV2A 2BFEA 4A36A 4PLTA 1MX1A 3QVSA 5DT2A 1C7RA 1CZKA 1NN1A 2QENA 1RYFA 4Q82A 2GK7A 4UM9B 1M8JA 2JGDA 4ZVTA 1GPMA 5DGDA 1BJRE 4GM4A 3SMQA 5A04A 3WIEA 2YJGA 4JJ4A 1ZVVA 1R7RA 4UBIA 4GM1A 1TI7A 1E96A 3WX0A 4NQZA 4X8LA 2I29A 2ZQZA 4BVAA 1M2OA 4M1QA 1ZDMA 1Q1ZA 3WK9A 4D92A 3THYA 4NZOA 2B99A 1T0IA 4B87A 3LQQA 3SOZA 3CTPA 3G59A 1QP7A 5JY1A 1Z4QA 5FBZA 3BH7A 4ZOLA 4JR2A 4RSGA 2C0PA 1V6SA 3OZBA 2GHIA 2R6DA 4XUEA 3RF6A 3RWOA 5GVRA 4F91B 4LJYA 4OQEA 4NX2A 4Y0AA 4YDRA 4Z2YA 2XDQA 5JC8A 3W5DA 1TF7A 3A6ZA 1XA4A 4RHTA 1RADA 3HYTA 3S81A 2V0NA 3EK2A 2AOWA 2ZQYA 1Z2CA 3ZWBA 2J41A 3EZXA 2B78A 3IL2A 3FPKA 2ZSBA 4BQNA 4BQFA 5BSVA 2GCOB 1GUAA 1JG1A 2A7XA 4RXUA 2QTNA 2JARA 2IX9A 3K9NA 5EP1A 1GNQA 1Q0UA 3BIXA 2CHGA 2LDBA 5HW0A 3ISVA 4IQ4A 4A91A 3VOSA 1U7ZA 5IM4F 2CBXA 2W98A 4YJGA 1I1QB 5SYAA 4H1UA 1KHTA 1E66A 2BEWB 3NHYA 5F64A 4EKIA 3WMRA 3R9WA 3P5BA 3ZLVA 3LW8A 1W0CA 1Z5PA 1KMQA 3W5JA 2WJJA 3GNTA 4IOLA 1CX9B 5B2ZA 2BH9A 3NQ41 1EXNA 3KUKA 4GKVA 5FP0A 1XZFA 2OXTA 5FWXB 1I7SB 1GGMA 1XPOA 3EEYA 4LJ4A 3BWBA 1OLSA 1TT5B 4HDOB 4JA0A 2XCLA 3R5TA 1P31A 2WAAA 1HEIA 1OPRA 4R1NA 5ELXA 1W8DA 1MQ9A 2NU6A 3B38A 1KZ6A 4TRMA 4MWZA 1PI3A 3V6MA 3FIJA 5TVKA 4JSRA 3SI7A 1XA0A 3LVFO 3W2IA 4BE9A 4BWYA 1A7UA 2W37A 1WXXA 1DDIA 5IXSA 2JI6A 2WIKA 3U7GA 3VGJA 1GPJA 1LBQA 2Q0XA 2O8FA 1FLAA 2XDYA 2OUIA 4GXNA 4DC1A 3A27A 3QPAA 4JWTA 1V47A 3UJ3X 1GDDA 1XK6A 5LP6B 4W5RA 4HH4A 1RWXA 3JR7A 3IVRA 5B7QA 3L05A 2ONYA 3L4KA 4N5IX 2CZQA 1A7JA 2PQ0A 2XVAA 2RMKA 2UUPA 3A6KA 3Q0EA 1O57A 4MIKA 3GBSA 2IIVA 3HCCA 2AH5A 2BLNA 3M0EA 4L3VA 1LTHR 2I6GA 4TL8A 5EKXA 4OYYA 4OHWA 4BFWA 3FKQA 4GMDA 3PB3A 4PRLA 1QLWA 2I9PA 2WABA 4I9NA 3IAXA 4X84A 3R7AA 2HK6A 3WB2A 5DM60 2DP4E 3EQ7A 5DHUA 3SR4A 1VHQA 3N8KA 3UXHA 2ZULA 2O20A 4YV7A 2V7EA 1DQPA 1I3LA 2VDUE 3HBMA 1KQGA 1MFPA 3ES9A 3O4FA 3TW8A 5JJ5A 3OCUA 1VLHA 3TL6A 2H4HA 2V9CA 5KC9A 1WXHA 4G2NA 3WLJA 2XZLA 1LBSA 2GAIA 3SHVA 1R6UA 2NIPA 3DAGA 4AN4A 1QOPB 1GUBA 3MAGA 1EINA 1JDSA 1UC9A 1V7CA 1SCUA 2VDQB 2WHQA 3KPUA 5CFLA 3ENZA 1Z73A 2FPRA 3KTOA 3L5OA 4EHBA 2VAMA 4C4SA 2XHEA 3AJEA 3T9CA 3RS0A 1H2XA 2ZRDA 3UMMA 4L08A 1DCTA 1OLUB 3V4OA 5KCZA 2VAVA 4GLOA 5D1HA 1L8LA 3WIDA 1E89A 1YT5A 1DC8A 1N5JA 1TU4A 2EG9A 1OOEA 2FG7C 2J3HA 2ZRNA 3DWGA 1IULA 3G3EA 1LSUA 1XJCA 1XRQA 1P45A 3G8AA 3RYIA 4MUNA 3CF0A 4U6QA 5HS4A 2HC9A 4OTZA 3EPJA 3SQXA 4JUBA 4EHFA 1PJCA 2RH4A 4Q0MA 1EFTA 3VPFA 4KCGA 3WGJA 4NV1A 4F4UA 3T0FA 4QEDA 5DBEX 4EKEA 5KWJA 4A0FA 2GPWA 4CFYA 3AR7A 1ZSNA 4FOPA 2C2GA 1G2IA 4G1VA 3MLEA 4RK6A 1P80A 2PAAA 1K8YB 2HLDD 1V6CA 1KO8A 3AYXB 1SXJE 3Q87B 5BVGA 1NNEA 2PAFA 4CKWB 2F43B 5JAUA 1QOZA 3C3XA 3NAQA 4MCAA 4RORA 3JQFC 1K4MA 2FN7A 2SCUB 1KDRA 3KKZA 2JKVA 1BSVA 4L28A 4AWXA 4BB6A 2H06A 2QAJA 4RKYA 1NXVA 4L15A 3K5HA 5HK9A 2P4SA 3UCXA 3ZHCA 2J32A 1PG2A 2V9ZA 3Q88A 1VKJA 1O5IA 3NETA 2DC1A 3M3PA 4IIYA 5IBQA 1P6UA 2Y92A 2JLWA 2DUNA 2ZSDA 3ANTA 5C2JB 2F3UA 4ITVA 1H5NA 3U37A 1NYRA 4F9TA 5I45A 1B2LA 3K0SA 3R3HA 3S4YA 1YVEI 3CCBA 3T3EA 2B34A 4ALJA 4HEJA 2QW8A 1TU3A 1ATIA 1F8FA 1RPTA 1RW4A 1A88A 2CXHA 4Z8XA 2JIPA 3DR5A 3FTNA 4GT1A 5J58A 1GIAA 1KK3A 1MABA 2HM7A 3A2KA 4PS0A 2PMDA 3AVXA 1ZO8A 4UM8B 1XLWA 2WHRA 5BQPA 5KWEA 3AHDA 5FWYB 1XR3A 1WUTA 4OOEA 4O63O 4CKEB 1S6YA 1QZUA 1B3BA 1RP7A 1UM8A 3E3OA 1W59A 1N6RA 1CB7A 3IA7A 4G86A 2RKBA 4JLVA 3PD1A 4Y98A 3SM9A 1GTVA 4YRNA 1KC3A 4TVOA 3RLIA 5IYZB 1L3CA 1RWVA 1WD5A 3CKLA 1IUOA 3MJ4A 4Q9JA 4LMPA 3DPSA 3MJDA 1ZJ6A 2CFOA 2QZSA 2ZI9A 1KJJA 4Q1VA 3DDWA 3W4JA 2FWJA 1S8FA 5JI2E 1MLDA 1DO0A 5HZGA 4MW7A 1VXRA 5IXJA 1ENYA 2O19A 4V1CI 1W29A 1OFGA 2NUBA 2QRVA 3HP1A 1ECCA 4NC9A 5ALZA 1RSZA 1O5OA 3ISJA 3QM1A 4BO4A 3GZJA 2IH4A 1X9IA 4PNEA 2VOJA 4LV8B 5FB3A 3IURA 3LT0A 2W2XA 4C5BA 2I2CA 4L8VA 4Z51A 5C80A 1AF7A 1RCFA 3TQIA 2VTDA 3PV0A 4DIBA 7REQA 4W9MC 3K71B 3A6JA 4S3MA 2FFRA 4NBRA 3UGKA 4RTQA 5L7YA 3G8YA 5JECA 3FPEA 5IS2A 2DLDA 5CVJA 1FBTA 3FGPA 4CLDA 2UUAB 5I4BA 1RZ3A 4Q9DA 4GWGA 5A4IS 4X6YA 4PPYA 3JQFA 2WSLA 4KO3S 2H5JA 2H0AA 4L51A 4BAZA 2BMEA 3BK2A 5HHTA 4DWJA 1J20A 4YCCA 1KP3A 3LOUA 4Q21A 3AMVA 4XFJA 5K99A 4MR7B 4WZBA 1NBIA 3A1UA 3QVMA 5LP1A 1E2MA 4UUOA 3TOZA 2C9ZA 4LOAA 3HEBA 2OFFA 3USCS 2XD4A 4WQMA 4RY0A 4E11A 1EVYA 2V6MA 3B3GA 3TRJA 2FCRA 1SY7A 2ERYA 2DFNA 5MF6A 5IAJA 1N4DA 1XTZA 3N2ZB 1TMKA 1E2PA 2PMFA 2X58A 3H1BA 5K8CA 2YYAA 5TQ2B 3P2IA 4RPLA 1JFVA 4G36A 1SC4A 1TVCA 3F3YA 1J8MF 1FFGA 2BKVA 1GTJ1 1CVRA 2TMDA 3QU2A 4G81A 4WEQA 1GPH1 1AVTA 1B1AA 1JQBA 1KI6A 3DDSA 3G0DA 1ISGA 3A4VA 3NP7A 4J07A 3SLRA 5CBKA 5EIXA 2AUMA 1IQ0A 4GYKA 2COUA 3TOXA 3BSYA 3BDVA 4ETNA 2ZYGA 4PGMA 3C8DA 4C4OA 5EG5A 1PR1A 2EFHB 3OPXA 1F2VA 3KV1A 1DKUA 4UXJA 1G98A 4KQFA 4GPTA 1G3RA 5EWMA 4QAQA 5GY7A 4BO5A 3UHFA 4GR9A 5HZKA 2H9IA 3NEJA 2JJMA 4D9HA 4IDPA 1BE8A 1PNQA 1FB5A 1UPUA 1Z7WA 2YV3A 1OV6A 1QMGA 2FLKA 2QRLA 4RH0A 3ZY4A 4EMTA 3JAMA 3WNZA 5JZ9A 4TS9A 4IG4A 5B6PA 2IDZA 1MC4A 1CW2B 2JCBA 4ACBA 3DP7A 1US8B 1QJCA 5K0BA 5C0OE 3EDMA 2QVGA 3UT6A 4DE5A 3DGFC 5E1BA 1MIOB 3QKRB 1QO7A 2JLVA 3QENA 4REQA 4I5IA 4ZU1X 1MAAA 4OH1A 4NZ9A 2EWVA 1FBNA 3PTZA 4L5CA 2B3DA 1QTIA 4HPWA 4C4XA 5ITZB 1WMSA 2ZJ1A 3CRVA 1M75A 4NCNA 3L0YA 1DFIA 4NVRA 3A6PC 4JP5A 2XMPA 4TMVA 2NTJA 4BRZA 5C1BA 3S44A 3VJMA 2F1IA 3H2IA 4M1KA 1ISFA 3RLFA 2QQ0A 3LJKA 4LJ8A 3PA8A 1ADBA 1Z0IA 1Z4MA 3JCZA 5H3CA 4ZI5A 2YMLA 1DQYA 2NAPA 4UBJA 4GRDA 1KMHA 3M83A 1JG4A 3NRBA 1L5GB 4O8ZA 3SDSA 1U7UA 4QDZA 2IYUA 5CB4A 5AVYA 2ZB7A 1F14A 1W4CA 4UUNA 5FHQA 4HQKA 4H77A 4NFLA 4J0JA 3FPAA 1XFAA 4DM7A 3ZE1B 2QGNA 5JFGA 1U7TA 4D6YA 4ISCA 1UUFA 1P7CA 5HEKA 4V02A