The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
119
|
sequence length |
352
|
structure length |
337
|
Chain Sequence |
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDINVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb |
molecule tags |
Lyase
|
source organism |
Staphylococcus aureus
|
molecule keywords |
3-dehydroquinate synthase
|
total genus |
119
|
structure length |
337
|
sequence length |
352
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.2.3.4: 3-dehydroquinate synthase. |
pdb deposition date | 2004-08-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01761 | DHQ_synthase | 3-dehydroquinate synthase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Dehydroquinate synthase-like, alpha domain | Dehydroquinate synthase-like - alpha domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |