1XAJA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
352
structure length
337
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDINVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
total genus 119
structure length 337
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xajA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xajA01
1KQ3A 1O2DA 1SG6A 1OJ7A 3OKFA 3OWOA 4RGVA 3UHJA 3OX4A 1XALA 2GRUA 3CE9A 3IV7A 1XAGA 2BI4A 1NVBA 1XAHA 1DQSA 2BL4A 2D2XA 5BR4A 5EKSA 3HL0A 1JQ5A 3RF7A 1UJNA 4FR2A 4P53A 5FB3A 3W5SA 1VHDA 5HVNA 5K8CA 1NUAA 1JQAA 3QBEA 1TA9A 1RRMA 3BFJA 1VLJA 3ZDRA 4MCAA 1NVDA 3CLHA 3ZOKA 1NVFA 1XAJA 1XAIA 4QGSA 1NVAA 3QBDA 4RGQA 3JZDA 1NRXA 1NVEA 1NR5A 1JPUA 4RFLA
chains in the Genus database with same CATH superfamily
3W06A 1BE6A 4LXQA 2X3UA 4OFZA 4WD3A 4I08A 4ZAXA 4Q6WA 3ZU6A 2GXAA 2QYSA 1JP7A 5D84A 5IH3A 4XJTA 4X3OA 5KTRA 1CEEA 5C80A 1QS0A 4UFNA 5ITZB 1UJNA 1A9YA 2LD4A 2HLDD 4JJ7A 4LV8B 3WWZA 5KNDH 4WXRA 2I4NA 2Q99A 1JMVA 3IUMA 1TCAA 1VHWA 3I2KA 1I4DD 3ILHA 4PHHA 4X9XA 4HJRA 4ZAGA 3VH1A 4DQUA 3FHTA 4W9NC 4JGBA 3QQPA 4BP1A 1GKLA 3ZYZA 4LSWA 3KWFA 1N33B 4QBHA 2OYRA 3H17A 2FE4A 4CQLA 2ATVA 2F1JA 3IEUA 1N9GA 1HZJA 4ND8B 4A1OA 4C0JA 3MVEA 1QFYA 4IP0A 2QYOA 4RIFA 3P26A 2ZRKA 4F4FA 3SCZA 4XARA 1SC4A 4TYNA 3VZSA 1UWVA 1R4MB 1TU0A 4HB2A 3PUVA 2DM6A 2WWVD 3GZNA 1WVIA 1WCYA 2GD0A 3GO4A 1J8YF 3DAYA 2GF2A 4WA8A 4BWVA 3SIRA 1L5HA 4ZIRB 5JSQA 3NHKA 2FEOA 5TE9A 5K3FB 4NIMA 2B4TO 2CLDX 3A3NA 3GJXC 1GUDA 3CPHA 3FDJA 621PA 3PJGA 2VI5A 4GNRA 2A2ZA 3BYZA 5LLSA 3VNQA 3HV0A 1ISSA 1MAAA 2SHKA 4YAIA 3LTEA 1VE1A 2MOKA 2XQIA 3AC0A 2I6XA 1GPYA 3QVJA 4KXMA 1GGVA 3R9KA 4REMA 1D0VA 4CUKA 2AOXA 4ZT2A 1JEYA 2JVJA 2GYWA 2NTEA 1HE1C 1UKEA 1E4VA 4HLQB 3U62A 4CM4B 4TS4A 4A0GA 4RK4A 3ZY6A 6AT1A 3RODA 3BH7A 4ABYA 3CURA 4DLYA 1I3NA 3EW9A 1JIIA 4KYUA 5ICEA 1E20A 4G97A 2GD6A 4RZQA 4OAQA 4HRAA 4M0LA 5MHTA 4O1IA 5DCLA 3H8JA 1KY2A 2MYTA 1JHQA 5HKAA 1YUMA 4NAHA 4NR0A 4DKJA 1TKAA 4PZ0A 1FMTA 1E4YA 2C3YA 2QKYA 2Z9CA 2HDNB 3Q5GA 2GZMA 4MUEA 4QYWA 1QE3A 2APJA 3Q7QA 3QE9Y 2J0UA 3I5MA 1GGMA 5FLKA 1E5VA 3Q5EA 5CFQA 2WKPA 2YWGA 4FKBA 4LWQA 5ARDA 5HDQA 4FDUA 1JQAA 2CK3D 1SKAA 2P5TB 2WJIA 3GLRA 4PAQA 4QVIA 3GAAA 1P4HA 1YOVA 1E7RA 2BHTA 2YFYA 5KX5F 4XPIA 1NMYA 1MNQA 4KTTE 2AKEA 4NYIR 5JD4A 2FFAA 1Z07A 2YWEA 3KV3O 1UBEA 5T57A 3W6OA 1XT6A 3DM5A 3ETJA 1N3YA 4LPKA 2ZAOA 5IM4F 2GEBA 3SEQA 4QU5A 3GFVA 1QG2A 1RYNA 2QG4A 5HP4A 3C4VA 2ZZMA 1WY7A 5JJIA 5FL7A 1SBQA 3SBDA 2XUHA 4CTJA 2OBXA 3SZUA 3JPWA 1P2VA 3FCUB 4YAKA 5TC4A 4YMUA 1Z0ZA 3JVUA 2ZB7A 2QQEA 1D7AA 3LUPA 3WG9A 2VT2A 5ECWA 3PGJA 3T7DA 2WU4A 4YUZA 4BBPA 4DBLC 1YKGA 1S89A 1QF7A 1ZL2A 2ZTLA 3C43A 4E3ZA 3T7CA 3U3JA 4IJ5A 5MDHA 4YHHB 3PXGA 1EWRA 3TB6A 4K88A 2X8AA 2IJGX 4F9FA 1II8A 1H9BA 2OECA 1DI0A 5BWOA 2SBTA 4GMKA 1E9EA 1Z2OX 2IS2A 4BN0A 2EFCB 2CE2X 1EIWA 2CVPA 1XPRA 1RHJA 1T2VA 4KXNA 1PBTA 4CYMA 4J0DA 4OAPA 3QJGA 4JUFA 3IAUA 3OPYI 4H9GA 4Y9DA 1RYYA 2AG6A 1AS3A 1L4HA 2D7JA 3NONA 2JFHA 4IICA 4FOTA 5HIJA 1HDRA 5CEJA 4UTRA 5CMLA 3C6ZA 1C1HA 2BFAA 2C8JA 3C24A 1W44A 4F5EA 3FG9A 1NI5A 4C20A 4PICA 1ADBA 2PYDA 3E8XA 3FBWA 4UUMA 4ENWA 1NDUA 1Y5LA 121PA 1S3SA 1BEEA 1U8UA 1MRZA 2ZIFA 3NHPA 1OTXA 1ZZGA 1FS4A 3F5MA 3UWSA 4BFLA 3REGA 3QLUA 4IGEA 4DQ0A 4NV3A 3TDKA 1SAYA 4ZD6A 1II9A 1HOTA 4P0TA 1ZUWA 2WR8A 4C4ZA 1P0FA 3MWDA 1PNRA 4RPLA 1JG1A 4UAGA 4PLYA 1ZRHA 3A3KA 3PXUA 3GEPA 1BROA 5B3AA 5BVHA 4UUOA 4JL8A 2FJUA 3UAXA 4K6FA 3JRNA 2JEOA 5HR5A 1C7EA 5DCYA 5T4HA 2WTBA 1GYRA 3FBTA 1MMFB 1QYCA 2VHVA 4OSOA 3U0BA 1B8OA 4MQEA 3KJQA 5C7IO 3RTEA 3PNMA 5DTJA 4A15A 1RJDA 2ZSIA 4EQ6A 3EQ7A 1Z2NX 2GR9A 2O06A 4C4OA 5EZSA 3ZHCA 3CRMA 2IYFA 3QW2A 2BGJA 2QTHA 3NB0A 1OWMA 1INLA 2FJ0A 3TOSA 3WMRA 5JNVA 4F2GA 2GVDC 1SCAA 1E9FA 4XLZA 3HO6A 2ZZKA 3I2IA 4C76A 4DRXA 3PU6A 1LNQA 3RC9A 5LQAA 4OHBA 2H48A 2CBGA 4E5UA 2M32A 4RMJA 3RB8A 1ZD9A 3TLJA 1Y9AA 1O54A 1EVIA 2EW1A 1CCWA 2Y8EA 2M6KA 4BNYA 3JY6A 4DV1B 1W0KD 1YQGA 2QE6A 1QLJA 5DBEX 1U90A 1HQCA 1KP3A 4J9UE 4HEJA 4BVKA 1AY0A 2C88A 1SIUA 3SLKA 1JDVA 2EP7A 4E51A 3O4RA 4TXNA 2GHTA 3NVMB 4JEMA 4KBGA 2ZUVA 1PTJA 3DFMA 1ZCJA 2BW0A 2GOYA 4JDPA 4C21A 1J0EA 1OREA 1WZNA 3N28A 4IGFA 3H7IA 4Y1GA 3N7TA 3V8NA 2P68A 4YJ3F 5AQ1A 3ESCA 3WJ7A 1B15A 3U3MA 1Y3AA 2XNDD 2R96A 3K7EA 2C7RA 1M2FA 1U1IA 4E70A 4I9GA 5HZMA 2F2TA 5AXCA 4BEWA 3AJ8A 3KE8A 5GONA 1FQOA 4YRBA 3LCRA 3H19A 4GKJB 1R27A 2IPNA 1G21E 1G41A 4NG5A 5AT1A 3MELA 4L2IA 4XGIA 2VP5A 4EGFA 1E2KA 5K03A 1EEXB 1U7HA 3ZCPA 4ZYUA 5CCDA 4ZI3A 5EMLA 3TM4A 3ORSA 3QY9A 3GPBA 2JD1A 1SWWA 2UUAB 4ZVQA 4GR9A 3AVVA 3PQ8A 4G5YA 3LHSA 1R64A 3P2IA 2AK2A 3ID6C 4WZAA 2VF5X 5E6SA 4CXMA 5IH7A 1NV8A 3B5IA 3WLMA 3S29A 1J5EB 4FGSA 4XYMA 1WHTB 1ACJA 4HVAA 5AH0A 5IM5A 3SYRA 3WQHA 5K8IA 3ODPA 2J46A 4AL4A 1RT9A 1STOA 3T4PA 4DV2B 3SBEA 1YVDA 2IPXA 1K6IA 3PR2B 4HDQB 1JR2A 3QV2A 4UHHA 4IEIA 2FUG6 4LAFA 3JQ7B 1TZ2A 2W9XA 3TO5A 2Z4RA 4JLVA 2O5CA 3LP8A 2AOUB 2IYPA 3HB5X 3MPOA 1OY1A 2EARA 2IHJA 2OCPA 3V8EA 1VRWA 5BRJA 4DEVA 4BKUA 5KIAA 3P9KA 3ZCQA 1IN5A 2P35A 1P1BA 3ZGLA 1UOPA 1XZQA 4M38A 2ASEA 2GN8A 3A70A 3KEMA 4RNDB 4XFDA 1H05A 4KFCA 2DWQA 4OHKA 5E38A 4EKDA 4MPRA 1B00A 5H80A 4FNAA 5K6RA 3EIXA 3GEGA 1DPFA 2JH9A 2DFTA 3D2BA 3PLRA 3VFDA 5A6SA 1LPSA 5C1BA 1O08A 5FR2A 1YR1A 4LHVA 1KMIY 1M8FA 2P78A 1PLJA 5DIFA 5HG0A 1AM4D 3WC4A 5TPZA 4WBNF 1W9HA 4F7WA 3EVNA 1F6BA 1SHKA 5CFLA 2DECA 3VISA 1TW2A 2X1VA 4NZNA 3T5TA 1J8QA 3A6ZA 3URMA 4ZU6X 2PQ2A 4ZHSA 4E2XA 4BWFB 1CLEA 5EI5A 1RKVA 2OBMA 4CUZA 1P2SA 5HJEA 1EE9A 3DE6X 5KI6A 4LJKA 2Z57A 2NO6A 5DYTA 5HTOA 3WKAA 1UXKA 1RWWA 1Y1KE 2C3UA 2O7QA 3M4XA 4MR8A 1LGYA 5KSYA 5AK5A 3EZ7A 3ZQ4A 1P45A 3W5DA 4HLNA 1T8YA 4QGAA 4IS2A 4BMYA 1NRWA 1OBOA 2VPQA 1VPTA 3DZBA 4L50A 4P33A 1M74A 4G0OA 3EVAA 5FI3A 4Y1RB 3WRWA 1BZYA 3FGNA 5B3JA 4BKRA 2VQSA 1TECE 2Q9UA 3LL4A 1ZCAA 4XB2A 4DMRA 3K70B 4Z7NB 1Y5MA 2XHEA 1SCNE 2V96A 1FSSA 2XNKA 1DV1A 3LRTA 1QIFA 2BBSA 2G8NA 4L9AA 4MB2A 4M9ZA 3U37A 2JS7A 1ZIXA 1P3DA 2G1UA 3ICOA 1TEXA 4HQLA 4QQRA 5FDFA 5FWYA 1C4KA 2R84A 4PAGA 2C9YA 4W7IA 2GJKA 2WD8A 4X6YA 3SHOA 3UO8B 1XXHA 4JLSA 1Q74A 3F4BA 1K7XB 3PC3A 3LCCA 5K6AC 2W42A 3CF4A 1CS0A 1KFBB 1PJTA 3M3HA 4DA7A 4B3SB 4AFNA 1G16A 2NZ2A 2RHGB 4I50A 2K7FA 4CKWB 3OHSX 3H9GA 1T6NA 4CCAA 3KT8A 4RBNA 5H9VA 1M5RA 2ZYGA 3RROA 4IDAA 1TZBA 5HF5A 4NYMR 5GWXA 3ZCRA 2EJBA 4P92A 4NJEA 4RF2A 1ID8A 1FEZA 3STVA 2REXB 4KRFA 3JQDA 1KVTA 3N2GB 2NZVG 3ZV4A 4P9NA 2W43A 3TCXB 1JIQA 1VB3A 3W5UA 2GPWA 3H5NA 3JQRA 5DCUA 5K2OA 3H16A 1VA5A 4AZVA 4B3XA 4EG1A 3NHBA 1EINA 4N8SA 4KRXA 3H8WA 3E9CA 2IP1A 4LQCA 1C29B 1AS0A 2ET6A 2HREA 3FDIA 3P32A 4WZBB 1HKHA 5F1PA 1NBMD 1Z5VA 3BIFA 2V0GA 4MVJD 1I3LA 5HDBB 3MWLA 4FXOA 4RY9A 4WGGA 3RT1A 2VDJA 1P0MA 1ICIA 2XZTA 2R7KA 5FFNA 5AXDA 4G37A 1JTVA 3M6XA 1FUUA 3HRKA 2YMMA 1EFUA 1Z6YA 2ZULA 2GRUA 1T5SA 3B20A 5TQJA 1Q22A 1JJ7A 4HTFB 2WRZA 3KXKA 4KVAA 1U7TA 2KX7A 1RC8A 3RKUA 2X8JB 3ZHVA 4YWJA 1C2TA 4E03A 4U9HS 5ECYA 3SGLA 2B4QA 4B3HA 3DLPX 1T3ZA 2BCGY 2QN7A 1RIFA 1BOOA 1YAJA 5IXJA 1AC5A 2K6GA 1N5LA 3QY0A 3HGTA 1ZJWA 3KLOA 5HKKA 2DJ5A 1AN9A 1KMHB 1S2NA 2PUVA 2Z58A 3BORA 3C7KA 3EUWA 2QTVA 3OHPA 4U3JA 5CXXA 1SOVA 2ZU0C 3VQTA 2F1KA 1E94E 3HPQA 2JIZA 4N03A 4EB0A 4GXRA 3TEJA 2BV3A 1WCIB 3A9RA 5CD1A 1UDWA 4UTVA 1J00A 3E1GA 4OEHA 2BH2A 2B7BA 4I1SA 5AM1A 5HM6A 5CD9A 2DBRA 5GADl 4D8WA 2MSWA 2VAPA 2B98A 2C9OA 3IESA 4YT5A 3I4CA 1NXQA 1E1RD 2I1WA 3HR4A 4CLOA 1YV9A 2QT1A 3ZHTA 4TSKA 3F7NA 1R4AA 1TFUA 4LDRA 5DGDA 4AX4A 3KPUA 1Y3FE 4QECA 3T7TA 2J7PD 2YWBA 1AMOA 1RJGA 3G2JA 3NR2A 4GOND 3TKYA 3COJA 1VLJA 3NYIA 3RWOA 2QLBA 4V2IA 4RJKA 4IDEA 5JAIA 2QTLA 3MLAA 3NHJA 2EZ4A 5JBIA 2BEJA 5A0VA 4IHJA 4JDUA 4K8RB 1U1CA 3GQBB 4X8HA 3MBIA 2WVHA 3V7WA 4BV2A 2VP6A 2WFAA 1R6BX 4GP6A 3T4XA 1WEHA 1IAVA 5CM2Z 1U9JA 3A9VA 3BMOB 2DU8A 2G09A 2C92A 1CX9B 3CUKA 3ZDDA 5B57C 4UTZA 1J9ZA 5JC1A 1HY3A 2XIJA 2C8VA 1EXMA 1BHSA 1IHDA 2GK3A 1RVV1 2CUZA 2NUPB 2VJMA 5IN4A 2P0EA 2G1PA 5FQOA 4CODB 4JQOA 5L6MB 3NDRA 1ZVVA 1QIEA 2IYQA 3OQMA 4AYWA 2O3JA 4IZIA 4YREA 3IP1A 4JMPA 4Z3DA 1N7GA 4COOA 2VPIA 4Z9AA 5IMBA 1QHFA 1X9IA 4Q21A 4RE5A 4GEGA 2CMDA 4IIGA 4U2EA 3V3TA 4EJFA 1RRGA 2DTXA 4CTMA 3BK2A 3ANLA 1ID1A 2PBZA 1WNTA 3BDAA 4DLUA 3L0PA 4TUYF 1IBKB 1N2JA 2B1IA 2V4ZA 3FFTA 2E49A 4B17A 5EJ6A 3B7GA 2W2OA 1N2EA 4GW3A 4LGCA 1L4LA 4HAWA 5G1PA 2BISA 1AKNA 4WLUA 3EYAA 3I01A 5DLDA 2EYQA 1LK7A 2CSUA 4MA5A 2XE7A 2YCLA 3B2EA 3I9LA 3L8YA 5KVQA 5F2NA 4FE7A 4J3JA 2GD2A 3FM9A 1IHYA 1IY2A 1B4DA 2EG9A 2RJ3A 3DTVB 3ESRA 3I2JA 3JQ9A 5TF4A 2JK0A 3HEBA 5HIIA 2VQ3A 1M10A 1YONA 2CNKA 2HQRA 2Z2KA 4B9AA 3QU4A 2JGRA 4GRDA 3QPUA 3ZH9B 3NRCA 3HDGA 4P3XA 3W90A 3C1AA 2VAVA 5IJ0B 1WL8A 3LBAA 3TQFA 4UTNA 2NZ8A 4KN8A 2FOIA 3EVZA 4NG4A 1SMKA 1GXSB 2DPXA 3DJFA 3LQ2A 1YZLA 4FE4A 4H4CA 3TVYA 1IVYA 4E12A 1JLKA 2BGIA 2N3ZA 2Q8PA 3C8HA 1TO1E 2P9BA 3HY4A 3QPAA 5F78A 1M2NA 2G4LA 3L7MA 5DGHA 3UV3A 4ETMA 4IMIB 4HV4A 1EM6A 2WNHA 4GC9A 1SK9A 2BMJA 4JC5A 4L6IA 2ADMA 3L43A 2HD4A 4R2LA 5JO9A 3TFOA 3X44A 2VTBA 1X70A 4RGBA 1P80A 2AG0A 3VR6A 1BO6A 4J0GA 2H1OA 5HJ2A 2WLTA 2C5BA 3QU2A 4N4AA 1PR0A 1YGPA 1CRQA 1ISPA 2FVYA 1UJBA 3O31A 2AC7A 3SSOA 4EFKA 3EDRA 4F4IA 4GRIA 5FUXA 4D4LA 4LDNA 1KZ9A 2HEIA 2GO7A 4KWTA 3CE6A 2C2HA 4RV9A 4W8HA 4WKCA 1JJVA 3O1JC 2XA9A 4JX9A 2CNNA 2V6GA 1XZNA 2DBYA 1Z0AA 1YZUA 2H1VA 4H7KA 5LA6A 1ZVQA 4IXMA 4ALNA 2QTNA 2Q5OA 5CK5A 1Y48E 1OAOC 4IRXA 1PGPA 2JAPA 3K8QA 4IF4A 4NLLA 5FPHA 2WBLC 2DQ4A 1YC5A 4Y1FA 1JJAA 2C9BA 2FQWA 4ZVMA 3ZV3A 5MGBA 4GOXA 5ESDA 5HFAA 1EHYA 3R3JA 3Q9SA 3WL3A 1WMFA 3R5HA 4XCVA 4EWLA 2HSZA 2PS9A 1U0BB 1Z7BA 1XDGA 3MHTA 4OPMA 2IS4A 4EO7A 1JECA 1GFWA 3K9FC 3EWAA 5FOSA 3RVSA 3VKFA 1T0PA 5IAOA 5L45A 4Q9AA 1UODA 5BN4A 2PKRA 1Q0PA 2O1WA 5DTMA 4Y2VA 4DCJA 1GR0A 2CXRA 3WYCA 2XJ4A 4KWIA 4YJDA 3NHMA 4HZUB 3UAYA 5CCEA 3WLAA 5CB8A 1PT6A 2CLHB 2R60A 4BC0A 1IDN1 4GHWA 4U00A 2OO5A 1VCMA 4JBXA 4YJKA 5FIUA 5A3RA 1SD1A 4FR0A 1KYWA 1NMZA 4GL4A 1HLGA 4XYEA 5CYGA 1F60A 5EOVA 1GNLA 1BWPA 4EB3A 5C51B 2QE7D 2OFWA 2BEUB 3N2EA 5DTQA 2A7QA 1KP9A 5I8PA 3NRJA 1CF9A 4WINA 3HBLA 1Q2XA 2IHNA 1CUGA 1K88A 4GNKA 4CIYA 4D9BA 4D9EA 4NPAA 3AJ9A 1O57A 3RADC 4Z9BA 2JI6A 2PGIA 1LDGA 1QUFA 3TN7A 1DU4A 3EH1A 1EE2A 1KPGA 2CVOA 2ZTHA 1CUZA 2Q3DA 3F5DA 5ERYA 5KWIA 5U9CA 4KPYA 2GZAA 1HYEA 1E6KA 1IONA 2A3RA 2KMLA 4YRRA 1IY8A 4CRWB 5IKMA 4DV4B 2VHWA 2PH1A 4PYRA 4L6CA 5LBUA 4D8TA 4F3CA 2PRZA 1H4SA 4ES6A 4GRAA 3WKDA 1OR8A 4H1HA 4WY2A 2PLNA 3KOXA 3AR5A 2ZJ6A 1ZRMA 2WJAA 1NFFA 5EWLB 4QG7A 3ENKA 3IP8A 1BQ4A 2H4JA 3O2QB 3QENA 1QK4A 3V2UA 3NAQA 2JFYA 1G8PA 5TX7A 2JGDA 3N8DA 4MIOA 2DRIA 1Q5PA 1SZDA 2XBMA 4DZZA 3IXLA 3FPAA 1QH9A 2PCLA 4JOBA 4UVIA 2CJXA 3TAHA 4HLUC 4BTLA 5IK2A 1JZTA 2QZSA 4LCJA 3DAHA 1YS7A 5BSFA 3AP3A 5A4JA 1DZ3A 4P7BA 3WWOA 4A0FA 2C3MA 3UN1A 2XUIA 2CVZA 2QUHA 2B5VA 3UIEA 1NI4A 1B6SA 5BY2A 1WZIA 4NCJA 3BSFA 4WOPA 1C9MA 3QYAA 4YMLA 3ET5A 4I6GA 4ETWA 2P7HA 1UKCA 3WTCA 3JS5A 2X22A 1XLTA 3G0IA 4UOZA 1TTHA 5LOVA 3PWKA 5ALUA 2WU8A 2WUGA 4JJEA 1JR3D 4HN9A 3AINA 3O8LA 1QU3A 1GP2A 2FSVA 3WR5A 1LFAA 1QVRA 2EKZA 2W71A 2E82A 4P93A 1PEYA 4PPQA 5C1IA 1JLLB 2D59A 5JASA 5KSOA 3ZD7A 1RCUA 1UBHS 3MMNA 2P9HA 3FRIA 2VHZA 4RD4A 4UULA 4KFRA 1V5GA 5CFZA 1XVLA 3LPMA 3QPBA 4Y2TA 1EDOA 4WLFA 3UEOA 2A5DA 1WXXA 1W75A 2WJZB 2CZQA 1L7DA 3PFIA 3DUWA 2H1CA 3AF3A 1KI9A 2QQ5A 3KXLA 2CSXA 1IY1A 1W4AA 2ZJ7A 2ZBPA 1GGEA 1E1KA 4D6XA 4F5ZA 3I0NA 3T1VA 4BNTA 4IDNA 4LTDA 5B3KA 4R1TA 1K5GA 3KCNA 5LBTA 4X61A 3SEAA 1WPRA 1VHLA 4A73A 5I9IA 1N7JA 4ZOBA 5B3LA 1MVOA 1PD1A 3EGVA 5DNWA 5JQWA 3DO5A 3AXTA 4YMVA 1MJNA 1O97D 3AB7A 3RRJA 5DLEA 2XIQA 4CQMA 2DFVA 2OHVA 3D1VA 4LBZA 1VMDA 2Z04A 1G60A 4Q4HA 2FUG1 1ESDA 1JAHA 2NXJA 4LC1A 3OKFA 1XMSA 3HVUA 1Z08A 1EQ2A 1T9GS 1ZS9A 1MT3A 3IQDB 1IXZA 2VXBA 1CS4C 1K75A 1HETA 2EQBA 3F6CA 4A0RA 4BNMA 4DDTA 2QNIA 2J67A 3U09A 1R0ZA 5EZ6B 4ZU1X 2CLSA 1BSVA 1YI8A 2VNAA 3NCHA 4N0QA 3SSAA 5ED0A 2A88A 2NV6A 3L8ZA 6REQB 5JPCA 5IDXA 5E3JA 2V4MA 3T95A 1NJ2A 2W6CX 1N2HA 3TD9A 2W6JD 4D3XA 2I7VA 4RYLA 4PC2A 5KJEA 1XV5A 4BZPA 3KUCA 3OQBA 3LSYA 3QIVA 1KVSA 4F4CA 4BVFA 4AJ1A 3HM9A 3ITDA 5BWNA 1H5UA 1S8FA 1WBJB 1K4YA 4JMLA 4D0NA 2CFCA 4XEUA 2QMQA 1C1YA 2PXCA 4BNFA 2GH1A 4TVOA 4C2AA 4FVTA 2X86A 5CFMA 3F4KA 4G26A 4G8CA 1HXHA 1MJFA 1YASA 1ILEA 1DQRA 2EJUA 1L4YA 2HF9A 3S70A 3WLTA 8AT1A 4F8JA 1BDIA 1LBQA 4ZVLA 2ODBA 2FMXA 4MPTA 2PS1A 3WGQA 5H70A 3QVSA 3HTXA 4ARSA 2B30A 3AWIA 1U3WA 2XXAA 4ZZ0A 3IP5A 5HKOA 4CLEA 3A9TA 1XQYA 2Z5GA 4LN1A 4PC7A 3VTKA 1E4OA 2IDZA 3M4NA 4GGPA 4TS9A 3RYFA 3NORA 1J09A 3NBQA 4HGPA 4N3AA 5DSTA 5BWBA 1YRLA 2BI8A 3W6PA 4OUKX 5GIOE 5D7NA 2MR6A 2VZLA 3KQWA 3Q3CA 1BS9A 3UJ9A 4W63A 1ZK4A 4B34A 3RIMA 1X87A 5B36A 5KX5B 3L6CA 3QPDA 4TWJA 2UUPA 5C31A 3OFNA 1IEWA 3I30X 4YR9A 3LY8A 4HDKB 1G3RA 4IQ4A 3CFYA 3SQNA 4D92A 1UPXA 1Z12A 1GNSA 1H93A 1I6WA 2DE0X 2N75A 3DBHB 3FXAA 3L8FA 4O4JA 4UM7A 5CVJA 4QJ3A 1MIOA 1MR3F 4WZAE 4G0WA 4I3GA 1A8SA 4MW7A 4Q34A 2OXTA 2FLWA 1RLUA 3G3EA 4A0QA 4EB8A 5T8KA 3PGMA 2QVXX 4GWGA 1WZ2A 5KJCA 2FR1A 1JEEA 4CU2A 4H0NA 2BZSA 1JJBA 3MQ2A 3OI7A 4E11A 2H7CA 2JGIA 1NW4A 3DOJA 2HA4A 3EXHB 4JD5A 4ZO6A 3SI7A 1JA0A 1NNSA 2JAUA 4M21A 4V24A 1NBOA 4W5NA 4OQFA 2H18A 1ZM4A 2FN8A 3ILXA 4ILKA 3EFHA 4BS9A 4EITA 5GVSA 2VT3A 1XRJA 3RVRA 1E1QD 2P2SA 2V7GA 4C87A 4CMIB 2NMVA 1B0PA 1P4JA 2F43A 4WZ6A 3FLBA 3QBEA 2PSEA 4X1IB 2EKDA 3OFJA 2YZMA 4O0MA 1JHAA 1WD5A 1LQUA 1DQNA 2A30A 1OZAA 2XXJA 3IEKA 3QZUA 3TGPA 1FQKA 5LXTA 1TQDA 4K9QA 3I61A 3FI0A 4J1TA 5ALKA 1SR8A 1U63A 2IEAA 3PHIA 3NP9A 3KD2A 4FDVA 5JAMA 1DEAA 2OG1A 3KJZA 4DAOA 1CD5A 4X45A 2ZIEA 4MO9A 4KQFA 2I7XA 4F92B 1GHTA 3TUZC 4P86A 2JCSA 4GXTA 1KY3A 3H5IA 3RC8A 1AQIA 3KPWA 3TLEA 5KQRA 4OHWA 4RA6B 4WBXC 3VKHA 3TG2A 2QW8A 1KAEA 3DKPA 1JG3A 4EI7A 3AIMA 4EARA 5NLLA 3KYJB 4FZJA 1UDXA 3TSCA 2VSOA 1T0IA 2C61A 2ZRQA 2NW6A 5M5BA 2YJ5A 4UHKA 3NTLA 1GUAA 3CLTC 1XAIA 1G2QA 4C9BA 3ZHRA 4IM7A 1CJMA 3SDZA 4N40A 1I7SB 2UU9B 1TA0A 4LZOA 3RH0A 3WRXA 3ICVA 3MBKA 3E05A 4FC6A 1N7HA 4HGNA 4K9OA 3T3MB 4JI0B 4PZLA 1W36B 2J6IA 2VPTA 4BXOB 1JI0A 1U0NA 4OJTA 3WP0A 1I7QB 2ZSKA 1XP5A 1MEEA 1XXHE 1I80A 1XVVA 4PNPA 1HFKA 1QM5A 2HHLA 1VSTA 2E1RA 1W34A 1LQ2A 2B3DA 4X90A 3D7MA 2AZ4A 3NAZA 1WO8A 1DO0A 4KQ6A 2KS6A 4ML3A 5EJAA 1L0BA 3U7JA 3ZW8A 4IOJA 4IIJA 3EVTA 4ITRC 4MS1B 2OILA 3LQYA 3NIFB 4QZVA 5EIAA 3MIZA 4NAVA 2D7DA 2FWBA 4GMDA 4UDNA 1HZZC 2QRNA 4PLPA 2XB8A 5B4TA 3F7TA 3KB8A 3P0EA 5BT9A 5EMJA 4YDHB 5KVSA 1XMPA 2D62A 2VF8A 4UHFA 1WB4A 4QGSA 3OQ1A 4AJ4A 4Y6PA 1XD2A 1E66A 1FRZA 2C77A 4M9SA 4XWAA 1JSCA 1SVMA 1DKMA 3L1IA 4J1SA 3EVGA 5TS3A 3ZD9A 4CM1A 5BOSA 1CQZA 1C4WA 1HWYA 1DOHA 1JA9A 3DL4A 1DAHA 1WDWB 3ESYA 3KVOA 3IB3A 2Z3VA 3DFKA 2I34A 3A31A 4OHMA 5H68A 1CWUA 1EVLA 4YJ3B 4C7VA 4DJEC 2FEWB 2QUIA 5JCOC 2Y1LA 3QI2A 1WD7A 4O2AA 4LJSA 4PC1A 4ENVA 5KYWA 4RESA 2UZ4A 2Q3MA 3VU3A 5L6LB 2GXQA 4GLBA 4O4IA 3FSGA 5JXJA 2O2EA 1E6MA 1L7PA 1ZD4A 2RHJA 4B2PA 1G4AE 4J0CA 4MUYA 3DEZA 2Q4RA 4ZARA 3D4OA 1I7DA 1FSPA 5BYBA 3DVAB 4EI2A 3H13A 5C5CA 1VG9B 3L7YA 3LIPA 2Z5LA 4BIIA 3LC2O 3CNHA 3LDAA 2Q62A 1N5MA 4QQ8A 3DEAA 1ZKMA 1XA4A 2QD3A 3HU2A 3KR2A 3VR5A 4CI0B 2GASA 1Z4KA 3MYRA 5FNZA 3UK2A 2H1IA 1C9DB 3EAGA 3GPDG 2RGAA 3WYFA 4DA0A 5ENDA 2ZPTX 4GS5A 3WGKA 2W93A 3A6GA 3BN3A 2JBHA 3TSAA 1JHZA 5BRNA 1U11A 4TTPA 5GMOA 2QN1A 4JODA 3KPVA 1U3TA 1EFVA 1OLSB 3R6GA 5BPHA 1R3UA 3H1FA 2VZ9A 3W9SA 3E9NA 3SE7A 4FOOA 5KYTA 3CVXA 2F8TA 1FU4A 3IC5A 4HDNB 4HB0A 3UGKA 1RBZA 1COWA 4IWXA 5TPWB 5TMBA 5KNBD 3BD6A 2FLKA 1CUUA 1C3EA 3OTHA 3F9IA 1PUJA 4CKEA 4J8PA 3IAFA 1RXVA 5K3BA 2X19A 5C8YB 2BBOA 1UBSB 1MOSA 2I2DA 1E69A 1H3EA 1H4TA 1N75A 1NQUA 1E3WB 3EVFA 3N05A 3U9SA 5JFGA 5JDIC 4PV7A 4OB7A 1LSSA 3ITNA 1QGUA 4EW2A 3HYSA 4R3UC 2PKXA 3SHTA 1IM5A 2O8DB 1CRPA 4BY9E 3AIIA 4Q1VA 4RHXA 4Z7OB 4Y9TA 1JFRA 2FMHA 2KBEA 1NNI1 1L3IA 3QU7A 1T1IA 1PEAA 2AYXA 3BREA 3BG5A 3AGPA 3R3ZA 1UBFA 4IDQA 3ROGA 2PTGA 4LY9A 2C7QA 4BV8A 3NW9A 3HL4A 4H1TA 1DKNA 1X7XB 2IYXA 3OLZA 5EE1A 3GEMA 1LLCA 4KPGA 1VKOA 3SYMA 1U8TA 4MIKA 1IB6A 3K2BA 2G5PA 1ND6A 3H05A 4LYJA 1RYZA 2ERCA 1IC6A 3KSMA 3W8FA 1AQYA 3ZQKA 1D6SA 4JJAA 1NQAO 4ETIA 5KNBH 4M36A 1G8YA 2AXQA 2QUKA 3NG1A 4ROTA 4A91A 1YAHA 3IALA 3MINB 4IUBS 3O4FA 4C2BA 1SXJA 4C3VA 1ZHHA 4EUKA 1EJ2A 3ZDBA 4TWAA 2QX8A 1CUFA 1D2EA 3RKSA 5CNJA 2VATA 3ZE7A 3BFPA 4ZVNA 3KPYA 3MWEB 4TTSA 1SCKA 1TM5E 2A86A 1LPMA 1DFHA 3A7EA 1A2KC 3KVRA 5DNUA 2CMFA 1EZ1A 3FCCA 5KHOC 5LSAA 2AJCA 1RZVA 5H0IA 4B44A 3ASVA 1KF0A 3DR3A 2R5NA 3I76A 3K6SB 1NQVA 1DT5A 3A3PA 3I6IA 4YONB 5I9MA 3WL6A 4WEQA 4TXJA 2Z83A 5IPFA 3HVJA 2OCYC 4IJKA 2PRJA 4EY5A 1QRUA 2R6FA 2WNSA 4C2TA 3R3YA 4B3GA 4Q3KA 3QE4A 1NKSA 3DLCA 1VG1A 3RTAA 4AKHA 1CQJA 1MA0A 4OQNA 4H77A 5EERA 2YV4A 5LYJB 4MRRA 3CVYA 1UXGA 2Y6VA 4ZDWA 4V0SA 1ONPA 3U4QB 5F7JA 1YVPA 2W2QA 3EN0A 2AN3A 3OBBA 3MT7A 4BRSA 3KYCB 2JA2A 4NS4A 4EHLA 3HCAA 5C32A 1DAEA 3TE7A 3LH5A 5JAUA 3OCZA 5JRZA 5KOJB 1ADCA 3CLKA 2AFRA 5DNAA 4FB5A 2PZGA 4DW8A 4IDPA 1RVDA 2J6CA 3PGXA 4EKGA 4LRUA 5HGXA 3FCSB 2HQ1A 3FPSA 1GL6A 3C6QA 8ADHA 2G80A 2Q2NA 3IKJA 1TADA 3GMDA 4V2UA 2V54A 3U2QA 2PUWA 3KSAC 1VZ2A 3A58B 4HKTA 3LPLA 2WWFA 1YRWA 3FHOA 4NKRA 2CEKA 1NVDA 1SUPA 1BE8A 3EXEA 4Q7MB 3WLQA 2VXOA 2BMFA 1BXKA 4B6EA 1ENYA 1A7AA 4UZSA 4CDRA 1OLOA 3OCVA 4BO4A 2I03A 2YZNA 3EY4A 3LVRE 4IIXA 4AU1A 4YUAA 1UBLS 1ISRA 2JFVA 2B4KA 1NVUQ 2BFNA 5G4LA 3W2FA 3I64A 4BGEA 1QP7A 1P9NA 4IXTA 2GHQA 4FN5A 4PG8A 2Y77A 1FYVA 1QSGA 1BWRA 2PGJA 2UXDB 4BRWA 2QR3A 3E3LA 1R0KA 4UVEA 4ESVA 1U0TA 2Z4SA 1YJCA 3MWYW 1E60A 1N1DA 3FHCB 4YN3A 1JWLA 1JBQA 1JMKC 2C2YA 2QTTA 3WKCA 1J9EA 3HUUA 2QTWB 4OK5A 4AJ9A 4AZ3B 4LF8B 4OY3A 4YWHA 1AKEA 1Z6PA 2CLOB 3IVGA 4Z2AA 4RTJA 2QU7A 3NM5A 4KO1S 1RHKA 3IPAA 4IVRA 2R00A 3EGXB 4AICA 4FEYA 1QZUA 5J2UA 2AJTA 4R51A 4EQZA 2J9FB 1U81A 3PSAA 1XTZA 2Q5HA 3P9QA 3PLAE 3DE7X 1E1LA 4KQXA 4G1EB 1AKVA 1HKUA 2A84A 2VOEA 3NGLA 1W94A 3CPJB 3MSCA 4I2NA 5CH5A 1OYVA 3O8OA 3TLAA 4CKCA 3O03A 1JT9A 2WQZA 1VRVA 1II0A 1CUCA 2R8XA 3L9XA 3PUKA 1X2EA 3K15A 3PXXA 5GGYA 1R9NA 3ZV7A 3TDMA 5LD2C 4B35A 2LXNA 2IYTA 2I62A 4EOGA 3SIWA 3GLIA 3CN7A 3FLEA 3RVOA 4XW2A 2Y4NA 4IILA 3NGXA 2I1LA 2DQSA 1WMSA 1MJGM 2AI1A 2BDUA 2GEUA 4HXFB 4WX2B 1LBSA 4KH0A 3GIWA 4NNOA 1SUAA 2VDUE 3EC2A 4I5EA 1XD9A 4G1BA 1I9CA 4F72A 1TJYA 3GPCA 3K4PA 1KY5A 2R86A 3IOCA 2ODNA 1TW3A 5ALYA 3QRWA 3AK4A 3UAWA 2WUEA 3FPHA 3M9WA 4AX8A 3QPWA 4HRXA 1YJQA 4MS4B 1IMOA 4XEHA 5EVJA 4M54A 3VI4B 3SVZA 3AVOA 2RHHA 2TS1A 3EEIA 1E3JA 3W8NA 4F4HA 3GLKA 4RF4A 4PAWA 3TL2A 2LW7A 1YB4A 2ZS8A 3ZY4A 1ZGGA 4U7PB 4GICA 3OO1A 4FWIB 1JE1A 4LJ7A 2I6QA 1QFJA 1JDZA 1I2DA 3CZCA 1GA6A 4IG4A 3K31A 5AW5A 4EYQA 4EG3A 4TX1A 2COEA 4G85A 4MRMA 5L3SA 3MJCA 4KKVA 4FDLA 1QUEA 5KTOA 1W5FA 3RS8A 4TUYB 3UM9A 2G28A 1H5QA 4A8HA 1HI9A 1WPXA 3ELWA 1U2QA 2OCGA 3N2KB 4HB3A 3THWB 2G70A 1BGXT 1RXYA 5JE8A 4FFLA 4E08A 2BLNA 2ZSEA 1CY4A 3OIUA 3FUVA 1YL5A 2XRMA 2MDTA 4OI0A 1FXUA 4DNXA 3RU2A 2ILVA 1UBGA 4C06A 2VYND 5ESXA 2O48X 4R01A 1TEZA 4LMAA 1BKYA 4KAFA 3W3AD 1EP3B 1NQXA 4KN5A 1TTPB 2CHUA 2J9GA 2RK3A 1Q7EA 3HP1A 4ZRNA 2EVWX 2WWYA 2GEJA 1D09A 1MABB 3URKA 3WDMA 1C3OB 1GFZA 3KNZA 5KINB 3HL0A 2B8NA 3EGOA 1OI7A 2JRCA 2QAGB 2PT9A 2XNJA 1AHPA 3DUFA 5ALQA 2FZVA 1EMDA 3ASYA 4G84A 4IDOA 1QFSA 2ZJ8A 2EX1A 5U4QA 4WCVA 3ZDYB 5IW8A 3VO1A 2HCFA 2WSYB 2Z1MA 1C8LA 1CUYA 3LA6A 1SEVA 4HNVA 3WQQA 5TF0A 4IKPA 3T3GA 1Z28A 3TW8A 3QKRA 3UJ7A 4ALIA 1LZKA 3MMZA 1YDHA 5AVWA 3QLUC 2HCTA 4IF6A 4J7AA 5CM9C 4EJSC 3E27A 3T9AA 4A16A 3LO5A 3HDTA 4PSKA 5LZ4A 4F21A 1Y3DE 2ZSJA 4WASA 2HX1A 4L57A 4QPPA 1HG0A 4QDUA 1DOAA 3PDJA 3I0ZA 1QLWA 4LWOA 5E0KB 3T06B 4HXEB 3RF7A 1LLQA 4TV9F 2PXAA 1Z0KA 3VSDA 1GZDA 1EFKA 1GQ2A 2G82A 4ENTA 4N7MA 1WB9A 2HIAA 2OQVA 5A9RA 3MAAC 3TLCA 2WHEA 4QPCA 1A5BB 4IXDA 2R97A 3RS5A 5DHRA 5EP1A 2OXRA 4KQIA 3PDUA 4UE6A 3SKYA 1C8VB 1P73A 3HWRA 5BN1A 2BVNA 1KMMA 2XDQA 4HATA 4V38A 3T9EA 4U39A 2ZI3A 4RGQA 4R54A 2M9MA 5IRCD 1Q6ZA 3CSSA 1A9PA 3JQEA 3MN1A 4UU7A 2OXFA 3CG4A 1CUJA 3VSEA 3LGXA 4QD3A 3G7NA 4FU0A 3AFIA 2QW1A 2B8EA 3MIIA 1EWTA 2OCAA 3IAS6 2JLXA 2V98A 3V6LA 3MCTA 1HTWA 4YRSA 1ZAYA 4LYHA 4Y30A 2C04A 4KL8S 2JI4A 3K5WA 4NJOA 5A9SA 4F71A 1UBOS 4B3IA 1SVSA 5BSGA 4ESEA 2VBCA 3GCWA 4AS1A 5DHAA 4DXDA 4U7FA 1I33A 5JMPA 5LJIA 1Z0DA 2WT4A 2O8EB 3IE0A 2Y66A 5EP3A 5FPPA 4ENSA 3VKUA 4FYWA 5J5VA 2NU9B 4UHBA 1SXGA 4XTCS 1XNHA 3EAFA 3ZWMA 1PTJC 5K3AA 5AD1A 1U8XX 1JIUA 2ZUCA 3E3NA 2HDHA 1GZHB 1V16A 2IF2A 1LPPA 2QM7A 3GT3A 4OQMA 5JSHA 2C98A 2OXEA 4N3BA 5AI8A 4PCVA 4AF7A 1ZOIA 2Q07A 3NATA 4WCDA 3FWHA 3FETA 5BNZA 5IJ9A 5C7OO 5JLJA 3SC4A 1E9CA 4E32A 1KWKA 1OFTA 3ULKA 2AMVA 5ITVA 3HJFA 3DDSA 1E2MA 2FDCA 4RAQA 3QJ5A 4FC7A 1QB8A 2FOXA 1P5RA 3DMDA 3EA4A 1XTIA 2Z8XA 3HKEA 1D1SA 3SD7A 4EY8A 2IBSA 4LC9A 4EI8A 1TPZA 4F6RB 3ABZA 3UV6A 3DLTA 1KI2A 4IZHA 1OE0A 3OCUA 1BTOA 4CCSA 4P38A 3HK2A 5I4IA 2YXDA 1M9NA 1JDTA 1THTA 3DAOA 4TM7A 5BNFA 5FTNA 5L95A 3RYCA 3U7FB 4QBGB 4OOEA 2B83A 2IYEA 2Q6TA 1NW7A 3HJCA 3O93A 1TDJA 1PT9A 4UTXA 2JJQA 1XG5A 3IBTA 3T61A 3E9MA 3DEYX 5EEHA 1HNXB 1XCGB 5G0VA 3WGZA 5BR7A 1EKXA 3GG2A 3KS9A 2FWPA 4DBZA 3MUFA 1P2DA 1RC0A 3IFSA 3LYLA 2H7XA 1H8HA 2J87A 1KJNA 2WKRA 3H2IA 3HFSA 3O75A 2OKCA 4FCWA 1M8KA 4Q82A 4I36A 4Q4JB 5EIXA 5FOTA 2OESA 3TI7A 1ECJA 1WNFA 3VTAA 2HU5A 4O4LF 5ITWA 4QGFA 4DBVO 4KR6A 4V0ME 3D3EA 4MR9A 1F20A 2C07A 2PNJA 1K3FA 4HFJA 3GOQA 2WEKA 4CEJB 1BJTA 2WQ6A 5DI9A 3BRQA 3X0DA 5IC5A 2GN1A 2G7ZA 4Q00A 1SVWA 3QNWA 5TS2A 2VP9A 3DV2A 5KQGA 5A7GA 4EG7A 1CJSA 4PBSA 3FF4A 4Y2XA 2H5LA 3FBGA 1EFPB 2RMKA 1LUAA 1RBMA 2J85A 3OSZA 4JENA 4M1TA 4TM8A 1ZICA 1S5PA 3KZXA 1YQWA 4AJKA 3QW4B 4R3NA 5ICMA 3BQ9A 4UBKA 3PUYA 1JX6A 4QDXA 4QXMA 3PQ6A 4A8TA 4KFTA 3NXKA 4XUDA 4YCBA 4DWOA 5D3ZA 3VAZA 1V1MA 1M73E 2CVHA 1PNVA 2WKWA 2G63A 2V9PA 3C48A 1DBQA 3LC7O 2IZ1A 3D4PA 1QYIA 2V6JA 2IYAA 2GJ4A 4NZ9A 1IU9A 4GGOA 3SR0A 3EHDA 4F45A 3RC3A 4EL0A 1VCIA 3KFXA 1V2GA 3A37A 3ED1A 5B3JC 4N9QA 3B78A 3LCJA 5ALOA 3N8HA 1ZXLA 2AXEA 4P3NA 2WTNA 2YASA 3CSUA 2H59A 4XVCA 1TU4A 2W6IA 1UZLA 4A6XA 4UBMA 3D8RA 3LY7A 2HDOA 3PDHA 3WMWA 5EHZA 3B9RA 1E5QA 2KBFA 1FX0A 1JNYA 1FDTA 4F5DA 5CLQA 3V55A 2EATA 1GGFA 5EKDA 2NU7A 2JHAA 3CNOA 4NEQA 1E0SA 1F0PA 2R4UA 2J0SA 3HKCB 4KQEA 5H16A 3UATA 3P2EA 1PV4A 5HUHA 1R37A 1V45E 1TUBB 5FEMA 3WBJA 4AS2A 3IEVA 2VL7A 3B1FA 3TUJC 3N76A 3PK0A 4NYJQ 5TVGA 4F3RA 5JALA 3H11A 1FSFA 3E61A 4I4TA 2KYRA 2DWCA 2QAJA 3BFXA 2NWQA 3LVQE 4IPTA 1LJ8A 1UT6A 2W2PA 2HAEA 3H3XA 5LDGA 4DWWA 1Z5UA 3AI3A 1JDBC 2PH7A 3BA1A 5A2QA 2CXNA 3GFOA 1JB1A 4LE1A 2G77B 1G3UA 2GA9A 1RCFA 3I2HA 5DCWA 1ECBA 1BXZA 1L5LA 4NBTA 2V7TA 1NHGA 3PTZA 2IX9A 2IFTA 1ZK2A 4FFBA 3WLJA 4S0XA 1I2ZA 1VL8A 3OICA 3GJZA 1A5AB 1ZJ5A 3H99A 4ZVRA 2QD5A 1W7AA 5DWVA 2CNWD 2XUJA 3K1AA 2C7GA 5DLQC 2J07A 4YUXA 5JNSA 2OPHA 4KZPA 3FTCA 3QXCA 3EUAA 3U16A 3L4SO 3LLMA 4O5AA 3GT4A 1QAOA 2AQ8A 3OZCA 2EBUA 3UQYS 1EI9A 4AUKA 1K8XB 1XWFA 3E5HA 2QN2A 1M6VA 1E9SA 1GN9A 1W96A 2GAIA 3GA7A 3INTA 3OMXA 4FEAA 2PV0A 4P53A 1KS9A 5EN4A 4E1AA 3OE5A 1H6BA 4HNRA 1E6WA 3G8YA 4NFLA 4TKZA 3VMFA 4A2QA 4F9TA 2M6LA 3UENA 5SZHB 2VUSA 3HGMA 4OLHA 3H3FA 5EWMA 4CQJA 3G8BA 3JWJA 2TECE 1RPZA 1XEWX 3ZE9A 3LX6A 4DABA 4OX9B 3AI2A 1IG3A 4Y2PA 4GE0A 1R4NB 3TS1A 2B2XA 4LGYA 2RC5A 5JI3E 2YC2C 4DA4A 2HC9A 1XA3A 1NT2A 2H2IA 1FP4A 2QMOA 1QQTA 3UAZA 4EI9A 4EW6A 2ID9A 4TT8A 1CT9A 5B4VA 4A4DA 3LDFA 1ZBDA 3B8HA 3QVLA 3WBFA 4R6WA 2EJWA 5BW8A 5CIYA 4OI2A 2HA5A 5A5FA 3PXAA 4OMFG 3TSYA 4DDHA 3MWJA 4JXZA 5EJMA 3U6BA 4OUDB 3N3BC 4MW4A 2GFQA 2V7XA 2A1IA 1RJ9B 3J7TA 3QNMA 3KAQA 2Z6AA 2Z3ZA 4LOKA 1KDYA 4X97A 4M0MA 5REQA 4Y7CA 1JFFB 1ESCA 1JJFA 2B4AA 1B6GA 1L7NA 3F6BX 1JEQA 1J42A 2CJPA 4DSOA 3THYA 2V7QD 3H84A 4X8LA 1JQ5A 1C14A 2ID7A 3KKLA 4D1YA 2NPOA 5C9ZA 3E9QA 3NWBA 3LBYA 1DG9A 2H29A 4TXLA 4WAUA 4X7PA 4EAAA 5DNYB 1NF8A 1YTLA 1NSFA 2BFDB 2JF0A 2KJQA 3EDMA 4KR0A 4RFSA 4V39A 4Y2UA 3VR1A 4ERNA 2NSJA 3KBBA 3F67A 5TT1A 2EHDA 4BYMA 2BFCA 2W8BA 3LHDA 2P9ZA 4CG1A 4BV9A 3IP6A 1G6HA 2C99A 3IUYA 4Q0MA 3HADA 3M3PA 2KE5A 4B87A 4DREA 1NN0A 1UKAA 2OBYA 5EHIA 1N4DA 4WKNA 1G42A 2DQKA 3VVLA 3A1DA 1WUHS 1VGVA 1EK0A 1EESA 4EY6A 1M6HA 4I1IA 2R44A 2VNHA 3DOCA 3EQ2A 2AXNA 4GI3A 4IV8A 1FFHA 1Z5WA 1T36B 3ORFA 2Z1NA 3ERCA 3QF4A 4RGVA 2XTJA 4WACA 3LPDA 3CRRA 3WAJA 4GO1A 4C7OB 1JFVA 1WEKA 2BTOA 2JDIA 2VPWA 3CZ9A 3ORYA 1AF7A 2A8YA 2BI4A 1QZ3A 3E9RA 4U7TB 4PO3X 3SFTA 1JDSA 3B3AA 3FR7A 3ZKAA 1CG6A 1UP7A 4JSRA 3UFXB 1RQGA 4PYNA 3RCBA 5ERGB 2IS1A 1TGVA 1IHUA 1SXJE 2I2FA 1J23A 3KSRA 3LG2A 3Q3VA 4LS3A 4RH3A 4UASA 2HXSA 2SKDA 3C15C 3K9WA 2NV0A 4DMKA 1FLNA 3JQ9C 1OGJA 1XKTA 2C5HA 1ZESA 3G49A 2AZXA 2V4UA 5JADA 1PL7A 2X9LA 1BHJA 3O9VA 2BM1A 1YU9A 4K9KA 4KLCA 5ALMA 1PS9A 3VYSB 4N9WA 5A04A 4DV0B 3U1VA 1T9ZA 2X7HA 3L1UA 1N4AA 4L8GA 2QRLA 3CJQA 1DIBA 1TZCA 2X2OA 3DZFA 3PC8A 4DJTA 2BGKA 2XUGA 2ZI7A 4GI1A 4P54A 3DBRB 4DMLA 1K1EA 1LVUA 2H85A 2O3RA 4MYUA 3GJQA 5BORA 1QXSA 2HFJA 1Y7PA 4PQYA 4GWLA 3M5PA 3WB2A 2X4GA 3L93A 1GDHA 3HB7A 3VHQA 3ZI4A 2BDEA 1IRIA 1AQNA 4KOAA 1ZSNA 1X1BA 3M1YA 2H57A 1ZJYA 2XH8A 1S6YA 2OLKA 1IULA 1F3LA 4KXYA 3H83A 4WESA 1H6DA 3OU6A 3P2YA 1CF2O 1V7PC 1WQ1R 3OPYB 1FYFA 4YRFA 4RD0A 4I9FA 1MOQA 1IRXA 1M1NB 5SZIA 4ILEA 4BBJA 4DRYA 2I8AA 2R6R1 3KR1A 3QVMA 3IV6A 1WSAA 4HGYA 3IVRA 4X64B 3ZGVA 4B73A 3RTDA 3JWEA 4KXXA 2PLAA 3LF1A 2FK7A 5F1OA 2ZPAA 1UADA 1U8EA 1VIAA 2I4TA 3HI4A 1CUDA 2D0IA 1WG8A 3D0KA 3Q8XB 5F1KA 2E6UX 4JIGA 2PZAA 1KETA 3L4KA 2CKDA 2K87A 2XMSA 4KJZA 1KO8A 2BCJQ 2O9JA 1AKYA 1M6EX 2XW6A 3DEKA 4HEQA 2GAJA 4PRKA 4YRDA 3NT5A 4J0IA 4EATA 4YRGA 4J3NA 1G18A 2X23A 3O83A 4TQUS 5KTKA 3CNQS 1P2FA 3LSTA 1FDSA 3CWCA 3IDFA 2WZQA 3B85A 4CKBB 2JGFA 5HX7A 2AC4A 1YL6A 2EDAA 4F2DA 3Q4GA 2WTUA 3DP7A 1K7FB 2XQKA 2IYWA 3DJYA 5BNWA 3OZSA 1KQOA 4YRTA 4EG6A 2PZMA 5FAKA 2OHHA 1UEXC 2RB4A 2XUQA 1R88A 3M6FA 3M5DA 4X54A 3U81A 3ZLJA 2BFWA 5IBQA 4LYEA 1IH8A 4A2WA 5E2AA 3EPLA 1L3CA 4HH1A 3HO1A 4XPZA 5JCZA 1PTKA 2OO5C 4XX1A 2ZIXA 1KAHA 3A27A 4OP2A 5B1HA 1WXWA 3HSYA 2FUNB 3GEEA 4I81A 1N1MA 4LBWA 1OVMA 2OO3A 3P9RA 3KKZA 3SKVA 1OIWA 1NFRA 4WVLA 4D9CA 4ZTZB 1W85B 3HGQA 3Q87B 5T3UA 3A0UA 1YZGA 4EFNA 3INNA 3SQOA 3HMKA 1FFAA 2LCQA 2MSDB 1FUKA 1KO5A 5CT4A 2YVLA 3DDCA 1U8CB 5CHYA 2B5OA 4ZANA 5KS2A 1EP2B 1FP2A 2IK8A 2Q9BA 1PNTA 2EU8A 1C7JA 1U9ZA 2GK7A 2VHYA 3I72A 3IT3A 4KFSA 4LI0A 4WFIA 5D5HA 1SUSA 3EIOA 4IFEA 1PV1A 1KRWA 2KSQA 1T5IA 1LPAB 3MXOA 3LAWA 4QM6A 1VFNA 4JFRA 1I10A 1YC2A 2QGFA 4LQDA 2VH2A 2FPMA 4EMUA 4IIUA 3GLIE 1CE8B 1WZUA 1TF7A 1XB2A 1JUDA 3G5MA 1BA2A 4NC9A 3T1YB 5IU6A 5KTNA 1DDGA 2YKGA 5DW0A 721PA 3GFFA 4Z4HA 5AVYA 5CITA 3R0IA 5IEJA 1E5XA 3GRUA 5EE5B 5F2KA 4IMJB 5LMCA 1RABA 1GPBA 3USES 4H7EA 3NAGA 4HADA 2QIPA 5BQXA 5JBQA 4UW9A 1QVWA 4OL9A 3L0DA 3AL2A 1XVTA 4ETNA 3GN2A 1L6RA 1E6CA 4OO3A 3WFJA 2CCJA 1W1WA 3IAS1 3WI7A 4JQYA 1HT1E 5IFKA 3DMYA 1YQUA 2C5EA 2PPLA 3CO0S 3KQUA 1AKWA 4N5IX 3EXIA 4DV6B 1V5WA 4J29A 4UDYX 1NP6A 1V37A 4ZO9A 2DT8A 2P1ZA 1QDLB 4J0KA 1PVVA 2CL5A 1GN8A 3JALB 4B2YA 1T4CB 4CE6A 4BLTA 1QF6A 2WB4A 4ZOLF 1K2VN 1MU0A 4UEOA 4EGAA 5A03A 4LGVA 1UMDB 1KOLA 4IIDA 5J4YA 2A5FA 2VK4A 2XCUA 3TMKA 3WYAA 4F8YA 1EVYA 3AF1A 1E9VA 1WA5A 3L0BA 3NLLA 3PDCA 4JK3A 1GRNA 2QLNA 4JH0A 3SHVA 3WMFA 2NZYA 3KJGA 4EYKA 5C1OA 3K8YA 4XLLA 2FSVC 4G86A 3DO8A 3V97A 2AX3A 5JARA 2BGWA 1TEVA 3WWCA 4IXNA 3CM0A 3K4QA 1YR6A 4IJUA 4DUZB 1EM8A 3MAJA 4INZA 1JJIA 1BMDA 3UOGA 3GARA 5LQUA 3I34X 3ONDA 3UYKA 2ORIA 2GZ3A 2H52A 2IQ5A 2Y3IA 5FOQA 4YQFA 2Y0PA 4M1MA 3S2EA 3C45A 2ALJA 2FTKE 4KVZA 5LNK6 3FFXA 1EGHA 4IX1A 1UWCA 4TWZA 5JYCA 1VECA 3VNUA 1YZ3A 3ZWXA 1AZSC 2EQ5A 1P7ZA 2E5LB 5JYBA 4KXUA 4OREX 4ZEXA 4DGSA 1QRAA 5IAGA 3N8KA 1FNCA 4V0RA 4K03A 1T4GA 1FOEB 4A3SA 4R5MA 4QO7A 2XCIA 3U7RA 5EHXA 1Y9ZA 5F21A 5G2OA 4FDTA 5JS8A 1Q77A 1UC9A 2WYOA 4MIEA 3PXEA 1UEIA 3WNQA 2WAAA 2W2TA 1N77A 1G2IA 1D0IA 3BGOS 3R40A 1EVZA 3KLPX 4YROA 4CTKA 3WGMA 3SF8B 4QYTA 4OLFA 4RD1A 1OWPA 2BM9A 4Z99A 3ZDRA 2Q3CA 1GNTA 2IL1A 4JKYA 5JZOA 4CMEA 4KQ1A 4DV7B 2OLEA 4G5XA 4I4CA 3ANTA 3EW7A 1QC5B 3AF5A 1VYTA 5BV0A 3HVIA 3PA8A 4J6FA 3GG9A 1C7IA 4R2MA 1CY2A 4NMHA 1DRJA 2XE4A 3JZFA 4S1TA 4R8SA 4AJOA 3F2VA 4MARA 2X4IA 2H4WA 1O5OA 1QO0A 1DKQA 2O7SA 4LOIA 3S5JA 3ZI7A 3Q85A 1FTGA 3T5CA 1N8KA 2VF2A 3HKBA 5KYKA 4G1FA 3E22B 2A9QA 4LSZA 1XNRB 1NAIA 3EOBI 5G0SA 3R7WA 4DDMA 2BJVA 4H7HA 3PEFA 1J33A 2QJRA 1XEAA 3OQHA 4MS3B 1U6KA 2CDAA 1JSXA 2BM0A 4YRQA 2K2WA 1SKBA 3AV0B 2HA0A 1DIAA 1D8AA 1RYBA 2PV7A 3BICA 2X14A 5CDFA 1ULBA 1NJSA 3DV0B 2I2WA 1FFBA 1JQKA 3K2QA 2DERA 1A4XA 2HL6A 4OHCA 3JVEA 1AK2A 1WCV1 4GT1A 4E7OA 5ITSA 2EGGA 3D5EA 1Y8CA 1DSSG 2J9YB 3T7SA 1D2RA 1E3LA 3TAUA 1SCUA 2AD1A 4HEA6 4ONEA 1KMQA 2PFGA 4INOA 4A92A 2QP3A 3I6QA 2HBYA 3BXZA 3FPCA 3IH5A 3IE2A 4C89A 1MW8X 1X19A 4FYMA 2J9ZB 4LWPA 2D2FA 4DNQA 2BONA 2QENA 2Z3WA 3HJBA 4YP7A 1NFQA 4HAVA 4HGOA 5CAEB 5AM5A 2LCFA 3OWXA 3WO0A 1I4LD 2QZPA 1QE0A 1Q1NA 5A5EA 2D1TA 5JROA 3WGVA 3IQZA 4D41A 3FI9A 3QM1A 2ZYIA 3SR3A 3NJ8A 1WCWA 1FYXA 3BGDA 4WPGA 2OK7A 3P20A 4IZ6A 5T8KC 1SHJA 1VOTA 4YUVA 4BKQA 4BNKA 3RAEC 2FMFA 3I2GA 3OKAA 4DCUA 1CR6A 1DINA 3E7WA 3PVSA 2V6IA 3NUZA 3LWBA 5ALEA 4BNLA 4L9WA 4R2JA 3BGSA 2DX7A 3FZQA 1ZK0A 1JI3A 5DYIA 1JMYA 1LRJA 5FTJA 3CLSC 3QX9A 4K28A 1T8PA 3IVXA 3MD0A 4CM5A 2X58A 3OZGA 3Q9LA 4TROA 2WMYA 4ER7A 1RHQA 3AKDA 3KR0A 4YTEA 5M29A 3O21A 3RYTC 4MMXB 1QFZA 1GD1O 5EZYF 4QQNA 3NHZA 3MOGA 5C5EA 1KK3A 2ZJYA 3D7SA 5TEVA 1QMPA 1BFDA 1ZGCA 2WHPA 2WSSA 1Z5NA 3PFWO 4J1TC 1EP1B 2ISCA 4ATNA 4Z3OA 1ZY2A 3CU5A 2RGNA 3FNHA 2ZETA 3PL5A 4M9QA 3DDZX 3DZIA 3SZGA 5G1OA 3SE0A 4AN0A 5A3QA 5E7IA 3PR1A 3PUWA 3ZIUA 2B4RO 3GX1A 2FZEA 3FSEA 5HBRA 4EL5A 3BE4A 1Q0HA 5EJEA 4RY2A 3SHWA 2J45A 2IEZA 2O3SA 1FQJA 3ML1A 3P8ZA 4YRKA 5HW0A 2OLJA 4B83A 5BMOA 5JBNA 2XDAA 1QH1B 3T94A 1T10A 3HFRA 3UPUA 3GPLA 1XMXA 4LFCB 2GBPA 4JQCA 4L8VA 4RIHA 3LLVA 5GAJA 3W9YA 4OQQA 2HB6A 3OQNA 3PD0A 5C81A 2WC1A 1E79D 3L1JA 3JZDA 1O58A 3PD7A 4BFVA 2DJIA 1CJUC 4TV9B 2VUIB 4UTOA 3VZCA 4BPBA 4V0NA 5B6PA 2GM4A 3QXXA 2JHGA 3WRXC 2FPGB 1DBRA 2H31A 3FKJA 2ZYHA 3G8AA 4Y0VA 4AS3A 2WUDA 4TZ6A 5AXBA 3SJAA 4BYGA 1YI1A 3PC4A 4I1YA 1XZBA 2GN0A 4KQGA 5ALXA 2O5EA 1H2HA 2WE8A 1RXEA 3L0YA 2FRDA 1XUOA 3LUBA 3NIBA 4H4DA 3NTUA 4K9MA 4MA4A 4AULA 1PS8A 4MZXA 4NMLA 4YYEA 1RLJA 3LUGA 4KW7A 4MW0A 1XRQA 3LXXA 4N5HX 4TKMA 3IULA 2NVUB 3HLTA 4NCIA 4YECA 3KZKA 2DUJA 2OV4A 1Z62A 4DL9A 2OGUA 3CIFA 4HVTA 3ZDCA 1QRTA 1U3VA 3HCNA 3VPSA 3DXYA 4H6WA 4PHCA 3UCFA 3ITEA 4D4HA 3AYXB 1FPQA 1XZJA 4UCWA 2YIDA 3D81A 4P4TA 5LMZA 4GKBA 4IQGA 1XEFA 2FSFA 1PK9A 3GDOA 4JJFA 3AESB 1E3TA 4EDFA 5AJXA 3OLQA 5DW3A 3RHFA 3AVTA 1DG1G 1Y1LA 3CLTD 3UT6A 1KZ1A 3Q7TA 4H35A 4R9UC 1KQFA 2OQRA 1Y6QA 5EPOA 5HK9A 2WFLB 1TIPA 2C94A 5D1NA 1ZMTA 3I8OA 3G2QA 2X0NA 1IUNA 2O05A 3TQCA 1E5TA 3UJDA 3NHUA 3HN7A 1RKQA 3NANA 1C4OA 4WN9A 4RFVA 1V9SA 3AR4A 1U0EA 2R6DA 1GPJA 1Z7YA 1KJQA 2NIPA 1O95A 4OKIA 2Y68A 2VBIA 2F59A 2ZATA 4AROA 2HLNA 2JLAA 1FXWA 3C3WA 5F2OA 2YXLA 3V1KA 2NTNA 4D96A 1BX0A 3A9UA 3OESA 3O8NA 1T6XA 1EB8A 2SNIE 4OXRA 4ZEVA 4GOOD 3TZLA 2ENWA 5BSVA 2RGDA 3CZMA 1LTKA 2P9TA 2YJ3A 3GN1A 3BB3A 2JFWA 3E4CA 4MHSA 1Y5IA 2J5RA 4CF3A 1L4BA 2CGEA 2XA2A 3AOGA 1NIPA 5FBHA 4MDEA 1FCJA 3OKPA 1W29A 2QPAA 1KPIA 4LJAA 3C6MA 1RZUA 4BLPA 2YCBA 2I7DA 4ASUD 3LECA 1YBFA 1DEKA 1NUPA 3ET4A 4H7IA 4BLOA 3OJWA 2FEKA 3D31A 5D01A 4BJ6A 3O1LA 3F1KA 2AJLI 3G2PA 3RQIA 1BVRA 1TYEB 2VRCD 3GAFA 4TT3A 5DP1A 4DCPA 2A92A 4Y2YA 3DMRA 1W25A 5BSMA 1EUYA 3IMCA 1VJ0A 3OM8A 3F3KA 1H69A 1OXBB 2FW8A 3NOQA 5EMKA 3RSOA 1N6RA 2XMDA 2UV8A 1U8FO 3JAMA 3EWSA 4PPFA 3CKLA 3KK0A 3M6WA 3PIIA 4O4LB 2PU5A 5ED4A 4D82A 1H6CA 2FPPB 4RK0A 1SUEA 4AF6A 2NU6B 3F46A 3LQRA 3A1TA 1UIMA 2P40A 3DE5X 4ZT7A 3B60A 4RTMA 1UK6A 3HQ4O 1UBJS 2PUHA 4LGMA 1Z68A 1Y4ZA 3JZIA 3VBCA 3HE3A 4GP9A 3L1KA 1B42A 3PB3A 4X1OA 4BGUA 1R12A 1GPDG 1F9AA 1ZOSA 1OW3B 4GH5A 3IUPA 3O84A 1AKRA 1M2OA 3L46A 1X77A 4KPUB 5EEGA 4B4WA 5EJ4A 1WOMA 1QJCA 2HV8A 1JFLA 3DT6A 3IRVA 5J5CA 3T7EA 3JSAA 4C0XA 4KUEA 3VKVA 1NQTA 5A3SA 4RC9A 3O2SB 4N54A 2GLXA 1N0VC 1TIKA 1OH5A 1J4AA 4TKVA 3BHMA 3MILA 4DSNA 3GEIA 4D9KA 5HOQA 3OECA 1AK1A 4R7GA 2VDLB 3BMQB 4C4RA 4A7PA 1J25A 2C5AA 2L82A 1AJEA 2VSXA 1SCDA 4U7DA 1PEKE 2XADA 3IJEB 3G9QA 2W58A 5F5NA 1S2LA 4EA9A 3OF2A 1HQDA 1XTBA 1HE8B 1P3JA 2QMHA 2WTAA 4DV5B 3GFGA 5EC8A 2A57A 1RYEA 3P4XA 3AR3A 3H2KA 3HB0A 3JYQA 1I1QB 1E4EA 1NATA 1XCMA 1SXJC 1Z4IA 2C7BA 3AF4A 4KDEA 4AW9A 4C4YA 3GLFA 3NPMA 3R5JA 3RC7A 3DDOA 4Q9DA 1O89A 2RHOA 1O87A 2R1TA 3DE4X 3H4IA 4NK4A 3SZMA 3UV7A 4B6JA 1I8TA 2DF8A 5AVKA 2YYSA 3AETB 2AMFA 4KSBA 2O2DA 1MC4A 2C8KA 1NVXQ 1W5BA 2O0LA 3D6UA 3LT0A 1SC6A 2RGWA 3CMMA 3OE1A 2IV2X 4WUTA 4ALJA 5HNKA 2J0VA 1P1JA 3AUFA 4NDAA 3GL9A 1HGXA 4WNYA 3HEAA 4G81A 2C7OA 1L4EA 4QX6A 1KAMA 2AA3A 2WAMA 2HF2A 5EJ7A 1BFUA 4EB6A 3DAPA 4E6PA 4DG8A 3K0FA 5I01A 2DR2A 2QVCA 5BW5A 1KFJB 4RVOA 4Q4CA 4GLLA 521PA 2O23A 1Q6YA 2P4HX 3L4JA 1PG2A 2QN6A 2YOHA 4EFDA 1N32B 1C9EA 1RAEA 3DMHA 5B7GA 2A6PA 1ESMA 8MHTA 3V9AA 3NKFA 1DCKA 4NE7A 4ZHQF 5DBIA 1OB2A 4XD7A 4QASA 1RMQA 3CKMA 2GRAA 2ZWMA 1TMKA 4UC0A 2I91A 4WHMA 5CLHA 3GXBA 3GGOA 1ISHA 3TXYA 3HBAA 4GKAA 4EABA 2B36A 1E89A 3BDIA 3U40A 2OGZA 4D8UA 2Y93A 5HMLA 1DBIA 3A6FA 3QG5A 3TXAA 4B4OA 3P1JA 4CMGA 4CEIB 5FI5A 3U3DA 2WM9B 4NMWA 3L1VA 2WYWA 4GZ5A 2ZBQA 4U8GA 3T38A 3JVVA 4Q3NA 2NO7A 2YNMA 1W4LA 3ER8A 3UFBA 2AK3A 1U65A 3OZAA 1V3UA 1EH5A 1XJWA 3X1XA 5EJFA 2C3OA 4I4IA 3ZXUB 3UUEA 3DAFA 4NXMB 1F17A 3GY0A 1QRRA 1VE5A 1H2AS 2FMUA 4QIHA 1HYQA 3CKKA 3ZK9A 4B6PA 1MN6A 4AWXA 1ZRNA 1ZU5A 2VHQA 3DMGA 4LYFA 3OX1A 1CZNA 3VJKA 1Q0ZA 2PJRA 1TB4A 2YRWA 1Q2UA 2ZI4A 4IG9A 1P2UA 5G0TA 2VP0A 3V9PA 3MRTA 5F3DA 2AE2A 1RI2A 2IYLD 2HO5A 3H5TA 4YPOA 3G7SA 5HM8A 2SKEA 5DZSA 5JH7F 1BIFA 2HQBA 4HQOA 4NULA 3R8CA 4HWTA 4LNUB 3IDZA 4CIWA 3BE6A 4XZ3A 2WMDA 4BE4A 4ZCLA 7YASA 1OA1A 4YUYA 3ZGNA 2HJVA 5KTTA 3CONA 1GNPA 2R00C 2WHQA 4IMPA 3RRYA 1PJQA 1JH8A 3W5IA 1Q20A 5LP6A 2O8FA 4OHVA 1ULSA 4HG2A 4D79A 4ZXPA 1AVTA 5D6OA 3PE4A 1L5KA 4RQBA 4NH4A 2M98A 2QK4A 3FVRA 4A8PA 4U7GA 3AR8A 3TOXA 3BF8A 5IC4A 1SBYA 1JXMA 4RLQA 4WUVA 2JFOA 3KHUA 1ZIPA 4IKOA 4QRIA 3FOZA 4NAUA 1RU3A 4JJZA 3DYIA 4DR2B 5EXEA 2RFLA 3GUHA 1EHCA 4NOLA 1ZK3A 1Y37A 3D2LA 3P5SA 4MRAA 3KWLA 5C0OE 2NU8A 3SJ7A 4Y6SA 1E2LA 1OA0A 4C22A 4YV1A 4Z2YA 1DP4A 1UOEA 3GD7A 2GSWA 2ETVA 2H4ZA 1I3OA 3LT2A 3QVKA 4MUKA 4Q9NA 4WMLA 5CVDA 5A7FA 4O2RA 3E23A 4D8YA 3NEJA 5JRDS 4JQZA 4X7MA 4K2HA 2BCEA 4JLBA 3VZDA 3QFTA 3P0RA 1OX6A 3IP3A 3TD6A 1US8A 1NR5A 1FNNA 2Q3HA 1CV2A 3U4CA 2AQKA 4W8OA 1G8HA 4DUPA 4C88A 2Y0CA 5CFRA 2ROQA 2G04A 5AQEA 5EKUA 5K0LA 2ZR0A 5H1YA 1R6UA 2NUAB 5IT0A 3O26A 1C30A 5K0CA 4MRSA 2PWZA 3DMNA 3T8YA 3TCNA 2I9KA 3JATB 1GFIA 2X7JA 2JLSA 1U0SY 2P11A 2HSWA 4NBSA 4KE8A 4UREA 4PG6A 2ZYUX 3U0VA 1FSGA 3QUBA 1B74A 1B8PA 1F8YA 2ZJ2A 1CB0A 1HE2A 1KIFA 1UAYA 2I8LA 4AN1A 4PYMA 3EB9A 2G9ZA 4GI5A 5L4SA 1J0BA 4PS1A 4OFBA 1I4EB 5KMGA 2C95A 5FV4A 1FBNA 1YA4A 3V34A 2J3MA 3NXSA 4QYMA 1ORDA 5FHQA 3WZ2A 1HR0B 3AUSA 3HA2A 4LOAA 4LV6A 1XTVA 3WLNA 3CEJA 1LV7A 3KKOA 4QU8A 3WLHA 5EJIA 3ZDQA 1Q7BA 4BFTA 4PGMA 2AUMA 3ECSA 1P1KA 3A3YA 4FKZA 4Q9JA 5H02A 3PRJA 4MEAA 4P4UA 4YP1A 3Q2IA 1PJ4A 3U17A 4EVRA 3GHHA 1I0IA 1VKNA 2A59A 3OCXA 2PKEA 4G3XA 2VWGA 3KQQA 1Q7RA 5A4AA 4LY0A 1FDWA 1V4VA 2ZRCA 1HFWA 1UDBA 2GHRA 5ENVA 1ECPA 3INRA 3A26A 4MW1A 1JLHA 3N07A 2EZ8A 3J81A 2WJPA 2XNSA 1E96A 1MF7A 1ZM9A 4DMCA 4F2PA 2FX5A 2FRXA 3KYDA 5AIAA 4CFSA 1P6XA 1CFJA 3OLYA 1XN4A 4ZMRA 3F73A 1XWWA 2D1RA 3CEPB 1H2ZA 3HU1A 5IUNC 2IW3A 2RBKA 1XZAA 3HDYA 2GCPA 2FWRA 2GLTA 4PPYA 3L7NA 3RG8A 3U19A 5JYEA 3E81A 4Y2GA 1PJSA 5F3RA 2R0QC 1DO8A 2GN2A 1E2JA 5JVDF 3ZLBA 1T29A 2AF3C 4H16A 3G9ZA 2RJNA 3S1AA 5EY5B 3P5BA 3SJBA 3DR5A 4V3CA 1WVGA 4ZVPA 3P2MA 3ZE1B 1K7SN 3AEQB 4NPCA 5FXMA 2Q7OE 1QGZA 3MQFA 5E95A 3KTFA 1XCPA 1QDEA 4I55F 2Q4TA 1CDOA 2MTBA 1BWSA 2RD2A 4N5MA 3MF4A 1CC1S 2ZE6A 2PPVA 2HMVA 1RBYA 4S12A 2UZ0A 3GJ8A 1N2CA 4YCLA 1BMQA 2BEKA 2RDMA 3ELUA 2PZ8A 4BB9A 4BVHA 3AKYA 4OB6A 4ZMBA 3WJ1A 3KKEA 3SZ3A 4DR3B 3IV7A 3BA6A 1W76A 2OYSA 2JIMA 3FSRA 3RRFA 2G1JA 5BSRA 2QZJA 2OVBA 3JQ8A 1RFLA 1X15A 2P67A 1OQAA 3H2YA 2LR0A 3KUXA 4NATA 5T6MA 5KTYA 2OHIA 2X5NA 3NV9A 2YIMA 4XR9A 1DFGA 3GJ7A 1TOAA 3LA8A 4J7CA 1FDVA 1WPGA 4M1OA 1Y6ZA 5FFMA 4JNKA 3S5UA 1O03A 2BSXA 3HP7A 5IABA 4LF6B 1QK3A 2I2XB 3HKDA 4KGVA 4Q1DA 3UW3A 5BRAA 2PO7A 2C2WA 2PX5A 3D4NA 3CB2A 2PZLA 2IZ5A 3C16C 1RMYA 3INYA 3DE2X 3PQEA 4QYIA 1QG0A 2XGJA 4ZEWA 3CPEA 5EJ2A 1K0UA 4QLAA 2KI5A 5CYPA 3DXFA 4HGQA 1F7VA 4WNCA 1SC3A 4YRLA 4ZOCA 1ZGHA 1HDOA 2EX0A 4HLDA 4MW2A 3JX9A 1GCUA 4N65A 3TVDA 1BMFA 4QQKA 4X5OA 1O9GA 5E4YA 2ONYA 4W82A 4R0MA 2JNWA 3QYJA 1SOAA 1X80A 3CNNA 4PG7A 4W5WA 3H9JA 5CDFE 5BT8A 4DCTA 3E7PA 4BLVA 1I30A 1XXLA 1ZIDA 2NO9A 1NYLA 3ENVA 3PPXA 1X8XA 3S1LA 4C7KA 3PUHA 3GEHA 1WKVA 3U7GA 2ZK7A 3OP1A 3I58A 4NQZA 1Y3IA 4F4UA 4IDCA 1IIBA 4M8IA 2XA1A 1KR5A 2Z30A 4G07A 1OWOA 3ZIAA 3W5BA 4D25A 4H1WA 4IHKA 2IYVA 1WW2A 3PRHA 1I7LA 1CKEA 1CQPA 1PZGA 2FVXA 2WD7B 4C0KA 3CTPA 1SQGA 1I5RA 4IUYA 4I99A 4XRRA 5H81A 3M4YA 4I4NA 2WIBA 4RF5A 1IUOA 3TNLA 1CUIA 1YTUA 2X9GA 1SXIA 2GPBA 2X2EA 2QOEA 1CR0A 4MYHA 3QYPA 4J0EA 3S4YA 1WU7A 4JL6A 5FA8A 5HRUA 2C5LA 2OR3A 4MLDA 4M87A 4FGWA 1IAQA 4OD0A 2IIQA 4UVHA 3TLZA 3UWDA 4AMBA 1SNYA 2YWCA 3H9BA 2JI9A 5G0UA 2PZKA 2XVYA 3E6AA 4N01A 1YDEA 3QQ5A 4MQ5A 1ZCZA 4HQFA 3IQWA 5HOEA 2WAYA 3LGSA 3MT8A 2F3PA 1YBMA 3DFIA 2R8RA 1TYDE 1D8TA 5BXQC 5DH9A 5JY6A 4PX3A 1VJTA 1QB7A 1W73A 1I4TD 4NU0A 3F7OA 3AUXA 4X20B 5J1TB 1V95A 5AOAA 1ZVKA 1AUOA 3KOYA 2MSEB 3PNOA 3IJPA 3PNPA 4NL4H 5B5SA 2DSNA 4A8JB 1JHPA 4QOHA 3N6VA 4US0R 3RGWS 1TD9A 1X0VA 2X5XA 5HA5A 3Q8MA 3VV2A 5A02A 3QELA 4E2YA 3CF2A 4FMPA 4B4DA 2W48A 3CUYA 1R66A 4KQJA 3ZOKA 3I09A 1ZQ9A 4JLAA 4BKPA 1EDBA 3KYIB 2PS0A 4Q02A 4BJ3A 3N0VA 4TL8A 1M2EA 1Z5ZA 2AW5A 4LQLA 5EXTA 2MSKA 5B1YA 1ZU4A 4FLEA 3QKWA 2WB2A 2DFKB 3LMKA 2D4AA 4DLTA 4HMQA 3AU9A 5HE8A 1A2QA 1PR9A 1ZG3A 3GJTA 4RDIA 5AVOA 4WKGA 3RO7A 2FP4A 3N86A 2XTZA 1CQIA 3ICEA 1JQBA 4HT3B 5FOWA 3EPPA 4Z9XA 4KIUA 3RAGA 5KNCH 3C2QA 1T5TA 1P60A 3F96A 2NPFA 1XMQB 4JU8A 2ONKA 1WP9A 3B52X 2OAP1 2QBYB 1M7HA 1MJHA 1AZWA 2F17A 4HSEA 1R5BA 4RD2A 4NE9A 4EMSA 1WRBA 1DXYA 1IBRA 4UM9D 1P2TA 1BXRB 4GSKA 3X2EA 3RYHB 5K2MA 2HRDA 3GXOA 5HKLA 2JFFA 1FNSA 1TEHA 4R5HA 3GRAA 1AQ6A 4UUNA 1Z15A 3M1LA 3CH6A 5EL0A 4XIFA 2AMJA 2AG8A 2I71A 3FTFA 2L2QA 3IT0A 1ZISA 5ICGA 2EYUA 3WKEA 3AVQA 3Q9NA 2GTHA 1SN7A 1FX1A 2ZBGA 4AAYA 1BMTA 3LXRA 3ZZNA 4GAEA 2AYZA 5D6NA 5FTWA 3N0TA 3ACCA 3NM4A 3OZBA 5TY0A 1LC0A 4G5SA 1TCBA 5K9ZA 2NSLA 1QHSA 1QGDA 3K4HA 4R2HA 4AZSA 4DT1A 1JXOA 5C4IA 3LKBA 4PYIA 5FJJA 3BJMA 1EAYA 3C3EA 3OPVA 5CU7A 5IUKC 4PCAA 4DLAA 1A98A 1OYOA 1XKLA 3HR8A 5DN6D 3MZ0A 1LV8A 2BF4A 2AG1A 3D5TA 3FDZA 4O8ZA 1B8UA 2F1OA 4P4SA 5TQ2A 2I8CA 1IJKA 3GLTA 3F3YA 3RUIA 4MAAA 2PMFA 4Y9RA 5U4XA 3F6SA 2HMWA 4Z7QB 4AJJA 2PX4A 5U1PA 3PUZA 3BZBA 1XNGA 2WWGA 1YSCA 1TMOA 1Y1SA 2QPTA 2CF5A 3B89A 1JHYA 3I01M 4LVCA 3TLBA 5JECA 2HWYA 1D04A 3TECE 1PR4A 4KLRA 2R47A 2P4EA 2X42A 2I2AA 4AY3A 4KYTA 1GIAA 1Z39A 4Z0HO 5FV7A 4MWOA 4FX5A 1D6JA 2BKXA 4IRMA 1YU6A 1NZDA 4ER6A 3KAPA 1AQLA 2CFRA 4KGZA 4DNPA 1TPYA 4IDBA 4DA6A 1F4LA 2XYHA 4EO4A 2P90A 3HRHA 4Q9HA 2V7VA 3P9PA 3BRSA 1AHNA 5E6UA 1PJZA 5C5DA 4F6LA 1Z47A 1NC3A 3DPIA 4LE2A 3AH8A 3REFA 1OTHA 4MPPA 1QTNA 2Z98A 2VYVA 3PG5A 3ACDA 4BNXA 2Z08A 1BKSB 2Q9CA 2B1RA 1FB5A 5DSZA 3A05A 5EVCA 3MGCA 3RARA 4NCHA 1CLUA 2XGMA 4DXAA 1ODJA 3PENA 3IO3A 4PX2A 3S3TA 3V1UA 3RJ5A 3PXBA 1YR3A 2NQ8A 5AFSA 1G5IA 1VE9A 2JKVA 3SQLA 2O8BA 3EJWA 4BU1A 2ZP1A 2HMYB 3OETA 4AD8A 1GCAA 2ATEA 3JVDA 1YQQA 4RKEA 4DM4A 3H8SA 2F1IA 1CYDA 1L7AA 2CJWA 2Z1DA 3QUCA 2QB5A 3NETA 3EC7A 4HI0E 3CVVA 1QIJA 1B76A 2AOTB 3R76A 3AERA 4IVPA 1FFYA 5EZYB 5HKKD 3AHDA 1CR2A 1L7QA 2YMLA 5C3MA 3G82C 1ZD8A 1T1EA 1KJWA 1WXIA 1RADA 1T1JA 1G1MA 2AQHA 3G0OA 3UICA 5DJ5A 4HNAA 1T2AA 3VU1A 4E2WA 4XRGA 1YHYA 5BSWA 5IXYA 4ID3A 5CLLA 3C3DA 2PLFA 2D6FA 3CPSA 2HLDA 3EMKA 2J5XA 4CGZA 2PZJA 2FKNA 3ZCSA 1XJCA 2HCBA 1P5FA 1KMNA 2D1FA 2EKLA 4M49A 4YAFA 4CETA 1HH4A 5E6RB 4L4XA 3P9SA 5ALZA 4BOYA 4JWTA 4UOQA 4WBNA 2DB3A 3BL8A 4MQBA 4CV0A 3D4IA 3UKDA 1WULS 4D45A 3AEUB 4DADA 1IPHA 2WVGA 3VU9A 4EUHA 1QQ7A 2D74A 3STWA 3TGLA 4ZK2A 3FAKA 1I2AA 3H75A 5E7QA 1SC9A 2ZS7A 1RZ3A 3FLAA 5JSZB 5IHPA 3TTWA 2LWIA 5KB3A 1YA8A 3OY2A 5I9TA 2GA8A 4EBBA 4RTOA 3JQGB 2IY9A 2QL7A 5E3HA 5JXGA 1RWOA 1HFJA 4J75A 3GLFE 1AGXA 1TYZA 3B1JA 1DAIA 2GUWA 4BP8A 5A6VA 3OQIB 1P61B 3WYBA 2ZYWX 3IUSA 3R5KA 3WSVA 1WUJS 2EBFX 1G9TA 1LI5A 3E7XA 3LT4A 3ZNQA 2WTMA 2H06A 3T3DA 1CIJA 5KVCA 4PGAA 2P62A 1KH2A 3QOXA 4WJLA 3AVPA 3ZVKA 2QRJA 3FTEA 5DYNA 4CDGA 1KMCA 3K72B 4G36A 4IDDA 1Q7TA 2BZ0A 2ASVA 4UQLA 5CBPB 3QOFA 3PC8C 3TKLA 1G6KA 1P7YA 5LN1A 3G0BA 1KO7A 2UZ3A 2XWBF 1L5FA 3M1AA 3OTIA 4L75A 2Q1WA 3ED5A 3IBGA 4IYJA 4U6NA 3RQSA 4ZDIA 2FWNA 1EK6A 4RZXA 1R9GA 1P9LA 3AG6A 1GTMA