1XAJA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
352
structure length
337
Chain Sequence
b'MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDDINVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDMYMLSDKKNDKQGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
molecule tags Lyase
source organism Staphylococcus aureus
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
total genus 119
structure length 337
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xajA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xajA01
5EKSA 2GRUA 1NRXA 1XAIA 1JQ5A 1O2DA 1VHDA 1XAJA 3JZDA 3OKFA 3OX4A 4RFLA 1JPUA 3HL0A 3CE9A 3BFJA 1VLJA 3ZOKA 4MCAA 3ZDRA 3QBDA 1NVBA 1OJ7A 1RRMA 1SG6A 4RGVA 3RF7A 2BL4A 5BR4A 4RGQA 5HVNA 1JQAA 1XALA 1NUAA 3W5SA 1NVDA 1XAHA 3QBEA 5FB3A 1NR5A 3UHJA 3OWOA 1UJNA 1NVEA 3CLHA 1KQ3A 1NVAA 4P53A 1DQSA 4QGSA 2BI4A 2D2XA 3IV7A 1XAGA 1NVFA 5K8CA 1TA9A 4FR2A
chains in the Genus database with same CATH superfamily
3UG6A 4N0MA 5FWXA 1KKUA 4KKXB 5KDDA 4Y2GA 5H9VA 1M0TA 5JC1A 4BLWA 4QDZA 3NH9A 3S44A 5DNWA 3KKZA 1B6RA 4BFSA 3OTGA 1WPQA 5J2UF 1GGJA 3IUJA 5EWLA 5M3BA 2QPLA 5TXGA 1F06A 1E64A 5JO0A 1QZUA 4ZYWA 4JBXA 3CEMA 2YMMA 4DJJA 5HWSA 2BP7A 5C7OO 2F43A 4QU9A 5EG5A 2Q50A 3G89A 1PT7A 3KYCA 3STYA 1MAHA 1KDZA 2N47A 3CLHA 4LW8A 5DHTA 2ADFA 3AL3A 4OHZA 3TQQA 4D9IA 5CA0A 5TLSA 4HCJA 4GKAA 3G8YA 2DQZA 2WJGA 2DBQA 3DT6A 3R24A 2V0NA 4F1WA 1IY0A 1DIOB 1WB4A 3KCQA 4JWKA 4LY9A 4EDFA 3G0BA 1KK3A 4DV2B 5KNCA 4NK4A 5J2TA 3H9CA 1CP3A 2AG1A 2NSJA 2UZ3A 3TDKA 1RPNA 4AY3A 3FRJA 3FWPA 4QIHA 3Q8LA 2MJLA 3ZJ4A 4BB6A 1WL8A 2MOKA 1IUOA 2PBFA 1GD1O 3BDVA 3C4JA 5CNKA 2XTNA 3LT4A 4GSKA 5GWXA 1ORWA 1P8AA 2A7QA 1EFPA 1G2QA 2J1LA 1N6KA 4TWIA 2OZLB 1XCLA 3JQGB 3TD6A 3LX4A 4WK4B 4R84A 5K05A 5A0VA 1Y7LA 4JVNA 3E5RA 1Q1BA 3OMWA 4IBOA 4LYDA 4ZRDA 4KYIB 4LS3A 1QE0A 3WMFA 1PAUA 1TCUA 4ZWNA 3WNQA 2ODBA 2PL1A 1T2EA 4O59O 2E4WA 4BNGA 3QYPA 1GG2A 3WYCA 4B81A 3D3NA 3FOEC 2JGMA 2Y3IA 2I1VB 4LZLA 2B2XA 1W48A 3TL6A 2Q0HA 2BGKA 3LWNA 4IHAA 4V38A 1JDBB 3NUZA 4M9XA 1R37A 4JFRA 4KSBA 4LECA 2XWBF 3LO8A 4N7JA 1IHYA 3WE7A 4LJRA 1K4YA 3IDZA 1LDEA 2FZ5A 5H59A 5L3SA 1YFLA 2PUFA 1L7DA 4JQOA 3EDQA 1CUGA 2R87A 4PBSA 1PF7E 2XB8A 3WL4A 3ZKWB 2CNDA 2ACVA 4MVJH 3Q9UA 1HDYA 4BNDB 1NOJA 4R2IA 1JHMA 1NUSA 3IODA 3EE6A 4HDOB 2GT1A 1TYCA 1YVRA 2BKLA 2JIDA 2RGEA 5JCJA 1MD9A 4XDHA 3D6UA 4ILKA 4R1NA 5GP1A 3BFJA 2FGKA 3OURA 5JDIC 3GLTA 4MQ6A 4Y2VA 2GEJA 5HR5A 1JPJA 3FHJA 2DFDA 3HWX1 4MTCA 3NJ8A 3BL6A 3EQ8A 2QP4A 3O31A 4MZXA 3VPFA 1RBMA 3C8ZA 2FWRA 3EG9A 2IDKA 1Y4AE 4FFDA 1IJFA 3ZGNA 1Y5MA 5I3CA 3K0SA 3S27A 4JLKA 3CURA 4CETA 3JZFA 4RPLA 2QRVA 2FPIA 3QITA 3VVCA 1JFFB 4QPCA 3OU6A 5FBRB 1PYDA 1CS0B 1Z68A 3O2QB 4R8RA 1IQ0A 2IV2X 1F1JA 1R9GA 2JIZD 2D0OB 3IVCA 4N82A 3R76A 3T7SA 1N5OX 5CFMA 3QGMA 4K7JA 3AHEA 5TS3A 2C2YA 5KQLA 4W1RA 3T7CA 4EB0A 1BWPA 2X8AA 3RNLA 4UTPA 4QGGA 3A7DA 3FLMA 3L1IA 2YWHA 3CEAA 4KSYA 5HM6A 2G08A 4NL4H 3VNSA 3U5ZB 3A27A 1U11A 4Q6WA 1HEIA 3DZFA 4ER6A 1ZCAA 2QUIA 2FG6C 1CQWA 3B2NA 3C3YA 1A4UA 1DTWB 2W6PA 2AJCA 2X6TA 5JCOA 3LBIA 3V6MA 1PT5A 1EVIA 1H93A 1LQUA 1T5HX 1FQJA 1YHZA 3GAZA 1Z4LA 2C3PA 3SJUA 3S28A 4DLUA 1YDWA 5LQJA 4I50B 4J3FA 5G1OA 2IZ7A 1EKXA 3KTAA 3QX3A 1K92A 4P84A 5DGXA 2Y1KA 1P31A 3ND8A 5F2OA 2GN8A 4DDKA 1NBIA 1T1JA 1TW2A 2WDPA 4PR0A 1CJMA 2CZQA 5HILA 4GRIA 3PPWA 1J39A 2QD2A 2BFCB 2ISSD 5FI3A 1E98A 1XTKA 2PCLA 3L04A 3ULKA 4AFNA 2EKBA 3BWEA 4D26A 1AUPA 3TPCA 3DAOA 4OL9A 1RCFA 4JYBA 2B94A 4WZBA 2GPTA 4OI1A 2Z43A 3N2EA 3N28A 2H2HA 4O0MA 4LFCB 2FN8A 4UMEA 3K3PA 1YMQA 3UKJA 5BSVA 4TXNA 3VO1A 3K6KA 121PA 1MJHA 4PFKA 5SZIA 1E92A 2F43B 1P2DA 1FUUA 1Y1TA 3WTBA 2NW6A 4AMUA 4MJLA 5ALHA 3M5CA 2BDTA 3CX8A 4QSMA 1OWLA 4QXRA 2GZSA 4RQBA 1MF7A 2P78A 4MULA 4DCNA 5K4AA 3PNVA 9LDTA 5IVIA 2LVBA 1MO6A 2ZI7A 1U7PA 2IIVA 2VNIA 2WWWA 2ZRAA 1JW9B 3FSGA 4PO9A 3I2FA 4C0HA 3ZV4A 2QN7A 4FSXA 2HA6A 3A3NA 2JEOA 4MS1A 3AUFA 3NI2A 4KPUA 1F9AA 1UPCA 4B85A 1T5OA 1S0UA 3W8EA 2PUEA 1EA7A 2WSSA 1Z0FA 2FMHA 4W8GA 1RD4A 4C05A 2R48A 3GELA 3IPLA 5CM9C 3S1AB 3I5YA 5HP4A 5JLJA 2QK4A 2JKVA 3EDRA 3EGXB 4PHCA 4ZVPA 5EIXA 5BRNA 4MQ4A 4MVJP 1KE1A 3M82A 4GL4A 4PIPA 3LQ4A 2NPOA 4BJ3A 2JARA 3FUWA 1XPUA 2GUWA 4FE4A 1YR7A 3BMOA 3BG5A 4IIBA 3VU0A 2D5CA 1E2GA 2Z95A 3I9V1 1Z9BA 1A5AB 2EX1A 3VV3A 4HNRA 5CH3A 4OIFA 1A9RA 3ZOZA 2N46A 1RC1A 4ER0A 1NJ1A 3IV9A 3QVVA 4LMPA 3ROGA 3NT2A 3DLIA 2PIDA 2Z83A 4NOJA 1XN4A 3H1EA 2XDQA 1NE2A 4OQ4A 1QOZA 3FLEA 3G2JA 4ZO9A 3IVXA 2QTTA 4HSGA 4ATNA 2WA1A 4JT8A 1LA2A 4L0DA 4I9GA 4IH1A 1X92A 3DYBA 5ALNA 4K6KA 3EFBA 1WO8A 3TB6A 4MKRA 3S2SA 4C3UA 3LLCA 5IABA 3LCUA 3F1LA 4XD2A 3R6DA 2X3FA 3RJ5A 4GR4A 3L9XA 3W1VA 2EW2A 5EXPA 3U7HB 2ZXFA 2HXGA 1V39A 4XLZA 1BVRA 2VKTA 4G9BA 3SPXA 3FCCA 3QELB 4BFYA 1M6HA 3NTOA 4H60A 4BB9A 3V97A 1GTRA 2QRUA 1FDTA 4J0IA 4BB5A 5L7TA 4NKRA 5FUQA 3MEQA 4IJQA 4P0QB 1EJ0A 2ATIA 1Z8DA 3NT5A 2YVQA 4D9MA 2VSXA 3VOTA 2QG6A 1E8MA 5DX0A 2E5FA 1ISRA 1DARA 4RVHA 1L4LA 4L7QA 1B43A 4TVOA 3FYCA 2B1IA 1UPUA 3SN6A 2P11A 1AUVA 2LKDA 4JU9A 4RNDB 3UOAB 4CG2A 3EPKA 1C9YA 2FSPA 3PX3A 1YJ8A 4I3FA 5EZYF 3DQQA 3KETA 3UKDA 4FR2A 1ECCA 3VZRA 5F5NA 4HV4A 1FVXA 4M0PA 3ZXSA 1QFMA 3JXEA 1N1MA 3SIXA 1XZJA 1SRRA 2GBIA 3DEYX 1HA3A 1RXIA 4CQMA 2GASA 4IXNA 3FPBA 4YAOA 3QA3E 4XFJA 5H02A 2C9MA 1LJLA 3NCHA 5DMXA 4B33A 1KAQA 4DWWA 3B70A 3RF7A 4KXNA 4S1OA 1RFGE 5EP4A 1Z0JA 1LDYA 3DOCA 3U4CA 2IXEA 5HF9A 4DY4A 3MCWA 1RRKA 4M89A 2CDRA 1COWD 1I7DA 2JIZA 2CVZA 1C7JA 1OH8A 1TB4A 4O4IB 3KQNA 5ITZA 2BDEA 4PO3X 1GPAA 2G0AA 1X77A 4YP6A 4WY5A 3FTPA 1J7JA 4OGWA 4I46A 5SY6A 3QVGA 4OHFA 3IR6A 4GM0A 3ZIAD 4P83A 3F8TA 4CM4B 1GTSA 2RBEA 2AB0A 3RI3A 2ZRLA 4DNQA 3DULA 4PXYA 5AJHA 5LJIA 2EWWA 3K0FA 3QPBA 3UJHA 3MQFA 1JJIA 2HK7A 1QIDA 5IAGA 4XARA 1Z0IA 2QTGA 4UNSA 4B40A 2PRIA 3LUBA 4YK7A 3IXMA 3TSAA 4N5LA 3RM3A 3DDUA 4HGZA 2JDIA 3IJRA 3LOQA 4DBVO 4KXVA 1B8OA 3E3MA 3ID6C 4Y67A 4F2HA 4UU8A 3G85A 2Q5EA 3CKYA 5DXAA 5KTYA 2GD6A 1A2QA 1ZN8A 4RF3A 2VDMB 2JVIA 2HPZA 3DH0A 3QG5A 2C0QA 3T35A 4NBLA 5HIAA 3NB0A 2HA3A 4GDMA 2HSGA 2IPMA 5LUBA 3D3EA 4IDEA 2Y27A 3CZ9A 1OWMA 4HNQA 3QEOA 2D74A 5D6NA 2C1EA 1IXZA 2I80A 3E8XA 1ETHA 3EQ7A 3GQBB 1JPUA 4ZVSA 4UATA 5A4FS 1SKUA 2P1DA 1EJ6A 2NU9B 3ENKA 4G1UC 3MUNA 2VYVA 3S2GA 6NULA 2EATA 1N34B 3GROA 3RTBA 2VT3A 2FGJA 2TMGA 1BKDR 2VZLA 3DC2A 4HTAA 1YUNA 1ZD9A 3U2QA 3RIEA 4YYZA 1B6TA 2FW9A 1JB9A 2F1HA 3FWYA 4CT4B 4MB0A 1L7OA 3PFHA 3X1MA 5CA0F 5SYAA 1T8PA 4Y2RA 1G2IA 1FVFA 1U31A 4XWGA 1EWYA 4JDUA 1X8LA 5HCNA 5DNYB 2X4GA 3TNFA 4RUKA 2EARA 4IL5A 1JAYA 1Z5UA 4FGKA 2FRDA 4IH9A 4JC5A 4X84A 3VSCA 3VMFA 2ZCJA 1GDHA 2XZDA 3SZGA 2RGXA 4ZDWA 5DRTA 3WG9A 3MJEA 1P0IA 1N0UA 5F5XA 3U4HA 1X0VA 3GN2A 2QMHA 3KVYA 2HEGA 2JGNA 2FHPA 2V5VA 4GECA 1U3UA 2D8MA 4JMLA 3JSXA 2H16A 4PLPA 4D97A 1M2EA 4D9HA 4ZI7F 4PC1A 5H0IA 3IIMA 1UAYA 1TQ2A 3FFWA 3RBZA 4OP2A 2C8LA 3S8MA 3L5OA 1I2AA 3L82B 1CIVA 5JPCA 1UUFA 3B1JA 1EFDN 4ZAZA 5GZ1A 4GQBA 5TVGA 1TD1A 1W0KD 1G4AE 3WMEA 4EITA 5M04A 4KNYA 1BS9A 2GBGA 4G1VA 1KZ4A 2J0EA 1QHHB 2R96A 1XRPA 1AC5A 3M4ZA 4OXNA 5IK2A 4EKNB 3BEOA 4F4UA 3GT3A 4YCBA 2WHXA 1I4EB 2C99A 3C3DA 3IMFA 5TNXA 3BA1A 2QROA 1FBTA 1KVSA 1X19A 3C43A 3SDZA 3PYMA 1GPYA 1F5NA 5DBIA 4UPDA 2P0EA 2IS1A 4CG3A 4XEUA 1YKFA 3JU3A 1GOTA 1OAAA 3D1VA 1OV4A 3QPDA 4G8BA 3O90A 4QU0A 2CDNA 1EX7A 3I4CA 2YHAA 1TLTA 4NXNB 3KTDA 1Y3DE 1B0UA 3F46A 4PLHA 4DLKA 5BW8A 4QELA 3UF0A 1AM4D 4J9UE 3WJ7A 2OCBA 1UFRA 1TYEB 2Y2VA 2UUAB 1NLMA 4HO1X 5D5HA 4Z8YA 2QZSA 3W5DA 1MH9A 3E84A 2H1CA 3WGNA 4RTJA 3B20A 5B4TA 2Z6AA 4RJJA 1L5LA 3GW8A 4KREA 4U6NA 2G17A 2JFPA 1I3CA 2H2WA 3AU9A 3GN1A 1SD5A 4LSWA 1S4QA 3WRYA 1WTAA 1SBCA 2P6OA 2PA3A 2QQFA 2BE7A 2GNOA 3DBLA 3DXZA 1U8AA 3N8HA 3QBVA 4QBHA 4QEKA 3W5VA 5A9SA 3B9PA 1XQYA 2YZ7A 2ZUBA 3K1TA 1J5PA 1L4NA 4Y9SA 4UU7A 2GK6A 4TS9A 1XK7A 3EVEA 3UAZA 4UTNA 2YJ6A 2JF0A 4C6RA 3LPLA 4IKPA 4K03A 3ZTWA 4ND5A 2JK1A 4YRJA 3PQ8A 3A6JA 1UJ5A 4PG4A 3WWEA 4E07A 4URVR 2Q5LA 1VI6A 2FFJA 3JWIA 2JIRA 1AKTA 2OZEA 1OHHD 3AIOA 3KZOA 1XWWA 2Y0EA 1NJ2A 3KDPA 4IIJB 4PG8A 4NPAA 4M60A 2G1KA 1YZGA 1SVUA 1DQPA 3ND9A 1YRWA 2OBBA 4IVRA 4RW0A 4RV4A 4UHFA 2WABA 2GN2A 4R2WA 3SIPA 3ESDA 2EWMA 4Q5IA 2OO5A 4PYMA 1U0NA 3OE7D 4OPMA 2AR7A 5J59A 1B8PA 4OQFA 4DMLA 1T6XA 3ZH2A 2YWRA 2QN1A 4C4OA 3DONA 4AD8A 2UDPA 4B3JA 2AS0A 3HU5A 4WCFC 1POWA 5IC6A 2VHXA 4DVJA 1P44A 3VPHA 1VL5A 1VLZA 1P33A 1IM8A 1JZTA 2O5VA 4ZYVA 1H23A 2IF0A 2WZDA 1RWKA 2Z08A 4WAUA 3ZDCA 2VH1A 3K8QA 2GFHA 4OK5A 2JHCA 1H2BA 1NQTA 2W5UA 4S2UA 3VPAA 2O5CA 4EG0A 4ZREA 4ITUA 3DFZA 2Q1SA 2ZIVB 2QN9A 2IHTA 3BTSA 4IWYA 5HUJA 3H2BA 3OCUA 4YO7A 1H9AA 4EF6A 4CR6A 3H6HA 3NDRA 2H54A 5FUBA 4TLMB 4YPFA 1YHNA 1T6ZA 1ZH0A 5B2ZA 1JHAA 1LY1A 2BFDB 4BU1A 2X40A 5DYGA 3TE7A 4FYIA 4TLCA 4OUDA 4B9AA 4DZTA 4CIVA 2VUUA 3SJZA 4BKRA 5TQ0B 2FFRA 3U44A 1IN5A 1SC3A 3LQQA 1CQXA 5AKKA 1WMAA 4G1MB 1SVOA 3VA7A 5I7SA 4IYRA 1E6KA 1HMYA 2HOQA 3DPIA 3HKDB 3OT5A 2C2KA 3QKSA 4HQRA 2ZITA 4BP1A 1AGPA 5H16A 5HZHA 1SG0A 4O2AA 4LV8B 3LOPA 2CMDA 1PHPA 4HVAA 5DTQA 2BGWA 2ZRBA 4RYDA 4M8SA 1T2CA 3QEMB 2X2PA 3DZJA 4OB8A 2V6FA 3N75A 2OBXA 5PGMA 3VOBA 2JGIA 1IN8A 1W59A 2ZSJA 1R6DA 2GJ8A 3FTNA 4INPA 1T4CB 4JEMA 3AHFA 3SK0A 1T3GA 3SS7X 4XD7A 3FOBA 3UQZA 1TMGE 5HBGA 1GQOA 3HSSA 2OAEA 2DPYA 2QLMA 4P4LA 5BW6B 2ZS7A 3P9IA 3B5IA 3LXXA 4IRXA 1ZBQA 4LKRA 1XHLA 4IILA 1XO1A 2ORIA 3IEPA 5LVAA 2ZU6A 4F38A 3EH1A 5IEJA 2O2HA 5KEIA 2YMQA 4I55A 3E1GA 5ETJA 2I9PA 3WGOA 1V25A 4MGEA 1J8MF 1I30A 2QDKA 4DA9A 1NBME 2PKEA 2ZG6A 4ZT2A 3MAGA 5BSUA 4BYMA 1C5KA 5BWNA 2HADA 3OWXA 3C3MA 3R40A 2ZJ3A 1PSDA 3PCTA 1GSAA 2MDTA 4PAQA 3M83A 3SR4A 2X0DA 4AG3A 5DEOA 3QVWA 4KR3A 4UM9B 1SOMA 3FF1A 1V8BA 4G3XA 1C7EA 3C3EA 4B6RA 1E6UA 3L4BC 4RTMA 4R81A 4EPTA 2B9VA 2SKEA 2WUGA 1XNJA 2WWIA 1QHIA 1HKHA 3F73A 1R8YA 1I10A 4A6EA 2QTAA 3W7AA 3VDRA 3WYEA 1BHJA 4MUMA 4WOPA 4A6PA 1JBKA 3HO6A 3IJ5A 4OU5A 4CEJA 4YJ3B 2HWUA 2V7WA 4MRPA 1CF9A 3AFNA 3EGVA 4HQNA 3GP8A 4B3MB 3EASA 2JLAA 4HXYA 3LY5A 2JGKA 3KJGA 5H68A 4PRZA 2PUHA 3N05A 3GB9A 5CH5A 1H2FA 4ZP1A 5KTKA 4LF8B 2JCGA 5AW1A 3GLGB 1ZI6A 2BHLA 3BC1A 1Y6FA 1KERA 4BLRA 1CW2B 1WCIB 2ECFA 3GLFA 3AESB 3BHJA 5EMHA 4ZGBA 3WWCA 4DUZB 3H8VA 1DS6A 3FCAA 4CEIA 4UAGA 4UQPA 4K9OA 1Y98A 2XEDA 1TOAA 5F12A 4CN9A 4ENWA 1U02A 1BO6A 3RUPA 2AEEA 4PGGA 2DUWA 1N9GB 2HYIC 1DUVG 1RXYA 3KQWA 2POCA 3CWQA 3KFLA 2D62A 2HLNA 4GSLA 4QUJA 4LFBB 3AR6A 3JALA 5L3RA 5C8YF 5ESRA 2VTVA 1OUMA 4U8HA 4Y0AA 4C7MA 1EESA 5KWSA 1HE8B 3F3KA 2ZTLA 3BKWA 3CPJB 3D6JA 2OAGA 1YC5A 1JLSA 2FPPB 2R25B 1HEYA 2BM8A 2R5NA 4H6XA 4Y7DA 1R4NB 3NBFA 5IDYA 4BO4A 4JBIA 5MFZA 4CLOB 2GOYA 2ADMA 2XMDA 3O95A 3TRIA 2QJOA 4HPXB 1QUFA 2DECA 1NW8A 4PM4A 5BY2A 1QGUB 2CT8A 2MYPA 4KAXA 5HQJA 3UN1A 3KZVA 2L18A 3A05A 3LIIA 4I50F 1DVRA 4MVJM 2IPAB 2WBLC 2YXNA 4HBZA 3FTFA 1VPWA 3ZV7A 4EYKA 1BXRA 4JI3B 1CVIA 1N3YA 2FZ4A 3DZKA 5I9LA 1S3SA 1OX5A 4RKFA 3A1WA 4W9NA 4BO5A 1HTWA 3TUJC 2WNHA 3CSUA 2X2FA 4QOGA 1UXGA 3AF3A 1G5QA 1GFWA 3IUQA 4F5DA 1R6VA 3SEAA 5L40A 1EHIA 4X1IB 3K6JA 4I9HA 3WJ1A 5IKPA 4AKHA 4FKMA 3KT3A 3EIUA 2Z5FA 1RXVA 1BMTA 1I7QB 4RVFA 2QXUA 3NGLA 4ITVA 1GUYA 3UW1A 3UAVA 3WWZA 4C0AC 2EWVA 3RG8A 4TV8A 4EG8A 3ZOKA 1OB2A 2HA0A 1YS2X 3WDKA 1BGVA 1Y89A 1I3NA 3BZBA 4ESOA 1WW2A 4CL3A 1QNFA 1Z82A 1XYGA 1GCOA 4JKIA 5EQTA 1DAPA 2FYTA 3LCCA 3E9CA 4NEHB 1CLEA 1SNYA 3GFVA 1BCSA 1YONA 1LTKA 4I1IA 1SXHA 1RPJA 2D1TA 3M6FA 3RT1A 1Q0ZA 1IHOA 4OBXA 4QQ8A 3VBEA 3WB1A 1O0SA 4AO7A 1QQ6A 1KI3A 2GJ9A 4C2BA 3O0DA 3WQSB 4MUEA 4YS6A 3DCNA 3TINA 1B14A 1YR1A 3PC8A 5KYGA 2BJVA 2BEKA 4K0RA 3BBPA 2FSVA 4OX9Y 3JYPA 3L3BA 2OHIA 3UJCA 4YGYA 4R1TA 4DL9A 4F6RB 4Q9IA 2QXTA 1YVDA 3EIFA 5J2TF 2JFGA 5DOZA 2WYWA 4UD2A 5IBRA 4GH5A 1C1HA 3BIJA 4MVYA 1ZRMA 3ZG6A 3UGQA 3E23A 1WEHA 4L85A 5JDCC 4F9TA 4LAFA 4YAFA 5C37A 2ZK7A 1TM7E 1Z39A 4X24A 1MB3A 4DYHA 2NNWB 5JYBA 2IUSA 4WK0B 2VXBA 3HVUA 2EHJA 4YJ3F 3BWBA 5CDUA 2K4MA 4Y8VA 5DASA 2WVHA 3VDNB 4OHWA 1F2UA 1JEEA 3LL4A 3W7BA 2RK4A 3QVUA 3T1VA 3L7IA 4EFMA 1XF9A 1C3XA 4Z6KA 4FR0A 2HMYB 2O6LA 4DR5B 4ZI7A 4IMJB 1T15A 1RLUA 3D2LA 3MUEA 3M1IA 4WY2A 4JQSA 2XCUA 4F06A 5HKKA 3S70A 3J80A 3THXB 4DV6B 2JATA 2XD4A 1OH5A 1Q7BA 3K0KA 3Q98A 3R6LA 4BS9A 3SVTA 2EDCA 4E0BA 3S8YA 3TL2A 2V9PA 4IIYA 5CYPA 1JTEA 1U9IC 4GVPA 2EFDB 4GT1A 1RMQA 2E21A 4H9GA 3SVLA 3PUKA 3E81A 2ZYDA 3M2PA 1DEOA 5DLEA 5EXDA 4W5NA 2FDXA 4MQFA 2X4IA 2CFIA 3EFOA 1NE7A 1NXVA 1PFQA 4PYQA 5A04A 1KDVA 2XA9A 1MXFA 4NMLA 2AV6A 3WGTA 5B6IA 3WNCA 4MP3A 1EZ4A 4N6GA 4RFVA 3QFHA 2R6JA 3VR3A 5KKCA 1Z4NA 3L49A 1PVDA 4GRDA 3A26A 3D7RA 3PIIA 2PS1A 2Q7DA 2O0HA 3ZWYA 4CMGA 3I1FA 4MKHA 2NZ8A 1F6WA 5AQ1A 2ZJ7A 2Q1WA 1CUSA 4QGFA 1QG6A 2C58A 5ALWA 4AF7A 3BM5A 2PSFA 4RC9A 4BRWA 3DPSA 3Q12A 4NPCA 2I6SA 1CRWG 4F85A 5C7YA 1QTQA 4EFNA 5A7HA 1E2IA 4KQKA 4LCEA 3UXHA 1RM3A 3BHNA 2PLWA 4DABA 2X5KO 3A8TA 2CY0A 4WINA 1LDBA 2VDUE 4QNMA 2YOFA 2Z2JA 3H05A 3D4NA 5C5EA 5AK4A 2IW1A 4D80A 2UXBB 4DIDA 4AJJA 3DEJA 5EWJA 1YQUA 1SQFA 3LW7A 3ETGA 3ML1A 4LRWA 5BO5A 3L01A 2QX4A 3VU3A 1BIFA 3B1KA 1VSUA 4EUEA 2QQEA 1N7GA 1ULTA 3IULA 5AH0A 4DMFA 5AVVA 5IH7A 4X8LA 4C6TB 4X3CA 1JVBA 1Z0ZA 2O2JA 3AIIA 4IGFA 4N76A 2QM7A 3O9MA 1V8DA 4QLOA 4Z0PA 4I6GA 5EVJA 3VR6A 1MC1A 2PVPA 2XVMA 4FMDF 3NWEA 5CVVA 1ULBA 1VA5A 3AO0B 3W3ZB 3HFGA 3GBVA 5I9NA 1DRKA 2CVHA 1C1DB 4B09A 1JMVA 1TJPB 3LDHA 3D81A 3ELDA 1X7HA 5LQMA 4NWIA 3WL6A 7REQB 5K6AC 2CB9A 1FFBA 1K8YB 2Q5QA 3EVTA 3EPHA 1E0AA 4Y9TA 1P5RA 3KTAB 3DW1X 13PKA 4BBJA 2B0CA 2WIJA 4CL0A 1A8IA 1BJTA 4DXAA 4ZYZA 4Y18A 5BW5A 3B13B 5FKJA 1MZVA 5FBWB 4GP7A 1G5FA 3UOGA 4DREA 4TV8B 1DKQA 2NP6A 2QD5A 4GI2A 3RAJA 1QRUA 4LDRA 1HGXA 2FNAA 3DLTA 3QX9A 1BQ4A 1L4KA 3KWLA 1X39A 3QF4B 2PU7A 3NYQA 4ZMSA 1W88A 1Y82A 4M1EA 4CMEA 5JTTA 3T9EA 1IN1A 1W52X 4BZQA 5A5FA 3KKPA 2I03A 2WT8A 1KK0A 3AUKA 2E49A 1CSEE 4HJRA 2C31A 5JW6A 4KDFA 3D0OA 1OYVA 1CS0A 1LSSA 1WV0A 2XB9A 4KXXA 4BKOA 5HEKA 3DFFA 4LPKA 4FWIB 1DG1G 2ZBRA 4QUHA 4UHKA 4U9IS 4RJKA 2P27A 3JWHA 4QDXA 3IP9A 4BMVA 3OC0A 4URZR 5A6SB 1JIJA 1Z6AA 1AKVA 2Z2ZA 3E18A 3ZIUA 3JATB 4ZV4A 3DHWC 3HKEB 2PLFA 5B36A 1EX1A 4GM4A 1WQ1R 3DLBA 4MPDA 2BAGA 1EFVA 4Q18A 5LDDC 2WTEA 2WWRA 2Z8XA 5AKJA 3V9AA 4B3CA 5HQTA 5ALOA 3G82C 1I4DD 3OT1B 4FINA 1VIAA 4PO1A 4XA8A 4LRTB 1NUUA 1D6MA 1EUCA 1JXMA 1YHYA 2DCMA 3BMQB 3HRHA 3Q7TA 3WLRA 3ZW8A 3MJHA 5CM8B 2JA1A 4BKPA 5TEWA 2YR0A 1PVOA 3HPRA 1G291 2Z04A 3JAKA 4M87A 3TLMA 2FX3A 2H1LA 2EKQA 2MSNA 4E33A 1Q91A 4CL8A 3OTWA 5E0OA 1SCJA 3A4NA 3EMBA 1PNQA 2FPSA 1SEVA 2GEDA 3SHFA 4CI9A 3HVRA 2C4TA 2E6UX 4N3BA 4PFSA 2FOIA 4FM9A 1ZUHA 4FE3A 4Y6GB 3WX0A 4H17A 1GILA 1WQ4A 1WULS 3TM4A 2OBFA 5FLEX 3ZNNA 2DBRA 1SC9A 1Y4UA 5FA6A 5IP5A 4PPFA 3E9QA 1I4LD 2G25A 4B35A 1NVEA 3OT4A 3CG0A 4OHYA 2XBMA 2Q5HA 1VHWA 1FE8A 3JPYA 2CXXA 4MYTA 4HT3B 1U5AA 2A5JA 2CC2A 3AONB 1N1DA 2EDAA 4GUDA 1T43A 5F76A 1ZCFA 3WKEA 3ENZA 1E1NA 5H80A 3M5WA 4BO7A 4E1BA 2RCNA 1DC6A 1QH0A 2H5LA 3A6EA 1OR8A 1SCQA 2O8CA 5BSHA 5F21A 2VXYA 2X5OA 1YQQA 1B6SA 1DAKA 2Q6VA 2XV1A 1TI7A 3NHUA 1YS1X 3GARA 3VRHA 4BLOA 1FMFA 2DGDA 3V8PA 5FF9A 4Y6RA 4DFDA 1PP4A 1DZIA 2VDWA 3Q1LA 5TQ2B 2WM8A 2JRCA 4M0CA 4UULA 1P4HA 4EX6A 4CWAA 3S2YA 5KYKA 1MTZA 3IQEA 2PQ6A 3LYAA 4LQ4A 4B73A 1IB6A 3I01A 5KOHA 3DAYA 4JUCA 4KO1S 3REQB 5AK6A 1PJTA 1ZH2A 2BF7A 5KBYA 3OQJA 2REBA 5EMJA 3NHJA 3KQLA 3RREA 3BFKA 4C08A 3B1XA 1BE8A 2H4HA 1R1DA 3HJTA 4CM8B 1DC8A 1JLRA 1T0BA 2EP8A 3BJMA 3QIVA 3I6MA 3PCXA 4FBMA 4QD3A 5DT2A 4I4TA 3IFSA 1JHRA 1NMQA 1NVGA 3KLMX 2BVNA 3MD9A 4NS4A 3HRIA 1ZBDA 4UD6A 3UUEA 1UPAA 3KUUA 3PX7A 3HLKA 2GWRA 4BCDA 3VV2A 1GCAA 2W48A 3A1EA 3ZWBA 1H4SA 5FBVB 221PA 5HGJA 3VR1A 3PGVA 5JAIA 2DLCX 3F9IA 4M9UA 5IC4A 5ALSA 2DX7A 4FHZA 1V7CA 5LP6A 1KFJB 3DDHA 4BGDA 2GFIA 5B64A 2QW8A 2IDZA 4TS4A 3V34A 4CLDA 4EHIA 2QTVB 1HC7A 4O4LA 2BCJQ 4HVCA 1GZVA 5HG0A 1XMJA 4IIEA 1NNSA 3T4PA 5MDHA 2OCAA 1JIXA 2ZBPA 3LY8A 3PQ7A 1AA6A 2WFMA 1ZD5A 2B4YA 2Y0CA 5BMVA 2B5OA 4U6QA 1D6JA 1UWKA 3TZHA 3V7FA 1MB0A 2EQAA 1UJ4A 2YN0A 1AUOA 3KJFA 4X6XA 4ZOBA 2PMWB 2WIAA 3KPJA 3N07A 3NEJA 3TVTA 4AY6A 4WECA 2ZWMA 2Y76A 3BJEA 3SZUA 4H1VA 2I54A 4GR9A 1JR6A 3G2NA 1II8A 2JEYA 4LJYA 3HYRA 2H7XA 2YDYA 3QVSA 3FKSA 1V1RA 3G5TA 5ENDA 5KNDD 2ZKLA 5F51A 5F7XA 3PC8C 4CV1A 4XB1A 1WR8A 2OHXA 3I9LA 3QPWA 3LXMA 4CCYB 4XCVA 4KMSA 4K6GA 2HBZA 4P1ZA 1G8SA 2HC9A 4DMGA 1CZRA 2CJWB 1LU9A 1BGWA 2JI8A 3MUFA 4FFWA 4D4LA 4MKGA 3ICVA 1UQUA 5AMXA 2R11A 1QYWA 3P1JA 2EXXA 5LNK6 3BZUA 621PA 4TMKA 1E2QA 3GRZA 3MF4A 3PD7A 4PZ0A 1X1QA 2PLNA 1E4YA 4U9UA 5EPEA 3KXKA 3N8DA 4BFCA 4QL3A 2J6BA 1NKVA 1WOYA 3TGWA 1EBFA 2O23A 1K7XB 3U37A 3DE3X 3D6NB 1MLDA 2Z9BA 3ELUA 3ZK9A 4G5RA 1ZK2A 5FNVF 3ND5A 2RIRA 3G7SA 3W2HA 1TYBE 5AI5A 3MERA 2NP7A 1KSGA 2D5AA 3G9QA 3NRBA 1K9VF 3WXMA 4H16A 2OLEA 3HV0A 1UKCA 3OJCA 4WMLA 1H22A 4QDTA 3RUEA 4O4IA 2HJVA 4E5SA 3HE3A 5FWNA 3LKVA 4XR9A 1DTEA 2Q28A 3TG2A 5LXTB 1LQ2A 2ZWAA 1WXGA 2D5BA 3TUIC 1N5MA 5T64A 3MWDA 5CA1F 4ZKEA 1P6XA 4PWYA 4HVLA 4ZV7A 4IDGA 4CFZA 1TEVA 4Z3OA 1BA2A 1W47A 1WY7A 3JQ8A 1SKQA 1SXJA 4RH0A 5DISB 1F0PA 2FUG1 1OYYA 2GHQA 1KC1A 5EHGA 3EUFA 2O8FB 1PGQA 3LZ6A 2EW1A 1ZMXA 2XNJA 3HYLA 2VHWA 4UBNA 4PLGA 4B7UA 3UH1A 5KU1A 3WKCA 3HM2A 2XMCA 1H5QA 3EY4A 1G21B 1FEZA 2I3ZA 1Z2CA 1VB3A 3EOAI 3GT4A 5BMVF 2IXGA 1HK7A 2ZJ1A 3AY6A 3U49A 5LXTA 5B58T 1UZAA 1M6YA 4BDSA 3T95A 2BMVA 3RARA 1V1MB 5JYDA 1WHSA 2XZTA 1UWVA 2ZS8A 2Q2OA 4JB2A 1P4RA 5BSWA 1NY6A 5CFOA 3WRYC 2YOHA 2O2CA 2P90A 1QO9A 4NBSA 5JNVA 1V11B 3TSWA 5EYPA 1ITZA 2H59A 3PEUA 4EPYA 3I6ZA 1EDBA 1L8QA 3VNBA 1HM5A 1EBBA 1RQLA 3JQ9C 2EZ8A 4QPJC 3Q7EA 1P0MA 1XZHA 2OO5C 3MRVA 3TJMA 3TTTA 2C5BA 1IONA 2V4MA 4NMXB 1BDMA 3LC2O 4TWZA 2ZU0C 2UZIR 5DFAA 4AYWA 1T8TA 3OJOA 2XYGA 3QKWA 5CPBA 1XNGA 2VWQA 3LP6A 3V2HA 4B4UA 1SUDA 4YUZA 4DOMA 4JJZA 3UJNA 4B7AA 1K97A 2NO0A 2P79A 4HDSB 3R6WA 3UV6A 3PITA 4EENA 2DBYA 3RVLA 3GAAA 4Y2XA 3IILA 2VYQA 3O91A 5JSUA 5KREA 4MR8A 3PNSA 3EXIB 4JX8A 5HMLA 1V4NA 2COKA 3RABA 2VHVA 4BPRA 2PG3A 1P77A 4FTWA 4CMKA 3ACCA 1W8DA 2R8EA 3QMMA 1L5KA 1XCBA 1Z7YA 2YWDA 5HRCA 3BWYA 4NCBA 1MA0A 5BPHA 5HTOA 3DBRA 2L42A 5KTPA 3GJSA 3OZTA 4AICA 5AUOB 4E15A 3DUFA 4PQRA 3ET4A 1HYQA 4JEHA 2R1VA 2OSBA 4KLNA 4AZVA 1V35A 3C74A 3Q5GA 4U7PB 5D1HA 1QKJA 1ND5A 3BA6A 1DIRA 5D5QA 1QANA 3ZX5A 4BCCA 1WUKS 2OYCA 1H3NA 1P39A 2JIMA 1F8GA 5IMBA 4D82A 4DYVA 2QIPA 3OF2A 1QUEA 4JLDA 1IJBA 1ATZA 3QU4A 2DLDA 4JP8A 2PD4A 4EG4A 1ZU5A 2CVQA 4MS4A 4ROSA 2ACKA 3H86A 1ZRNA 4D8YA 2QTVA 4QGHA 4JI8B 3FB4A 1K7CA 1TPZA 4DQDA 3WQHA 1H3EA 3G5UA 2GAAA 4RZSA 2ID7A 4NCXA 1JQKA 3LA6A 5BP7A 1RFLA 1NP3A 2GKSA 2AC4A 4NEQA 1X7YB 2P8JA 1EB9A 2C83A 1X8KA 5EHNA 4O4HF 1KI8A 2G9RA 3ANNA 5FOXA 5AM4A 1CR1A 2YZ2A 1P3Y1 4XQ9A 2HT6A 4H31A 1F51E 1PZEA 1P2BA 2DPXA 3WYNA 1Z6TA 3BXHA 3O6VA 4UBKA 1BD4A 4PNEA 1M2VB 2KI5A 1T0UA 1UWLA 1WKCA 2ZOSA 1P5HA 4JLVA 2P3SA 4D3ZA 4LHSA 4MK4A 2TMDA 4B4OA 2Q4DA 3IPYA 3F6PA 5ABPA 1I01A 1VJ5A 1XL0A 3EGOA 1RP1A 3KEGA 1MDBA 2P4QA 3AR9A 5JWHA 5LLSA 5KMGB 3P2EA 4IDOA 3E58A 5JVDB 3JAWB 2BE9A 3GRKA 4IRMA 1H2YA 2BMAA 2C2BA 3OOJA 3QELA 4KWIA 4PZZA 4R3WA 4YP1A 4OI0A 4KIGA 4P22A 3I2YX 4X3OA 2J6IA 1ZC3A 2B2CA 2I8AA 3IPCA 3MCVA 5E9JA 3C6BA 5LDGA 3COPA 4OJQA 1JIUA 1M66A 3AF0A 1JG3A 2FDCA 3ACDA 3O3OB 2BCGY 1NWCA 1WB5A 2JCBA 3IP5A 5J63A 2HDHA 3N7TA 4R3NA 4G9GA 4XUGB 3RFCA 4PLYA 3DTVD 1U3CA 2Q3MA 3NEAA 4O8ZA 4N03A 4QLBA 2REXB 2I8LA 3CG4A 4XIFA 5FTKA 5KYWA 1M0EA 3E8SA 1ESZA 3CZMA 3GFTA 4KBFA 4XB6B 5BN4B 1UKYA 3VO8A 1M8KA 3ZTTA 3ZLTA 1P9OA 3U7GA 1N0HA 2ONYA 3F97A 1LK7A 4RZIA 3WGJA 3Q85A 1B1CA 1E18A 4TKVA 1JR3E 3V7YA 1DQNA 4A8JB 2YL2A 2AVNA 1R50A 1CT9A 2TYSB 2Y9PB 4RMHA 2C4NA 1QF9A 4K8RB 2O48X 4JYZA 5H9WA 2GN1A 1NF9A 5HFAA 2W83A 2IEDA 3EOBI 3PHHA 4L8FA 3VDXA 4DPMA 1CZLA 5DP1A 3PNBA 3WFJA 3VNRA 3R20A 1CY6A 3HJGA 4Q3DA 2DFNA 4BY9E 3IXLA 2W2XA 3UT0A 5LMNB 2FFHA 3AOEC 2X86A 4A0RA 2XUAA 3HEAA 4P3NA 4HPWA 4W5WA 4I1UA 1MC5A 1DXOA 3I2HA 5EKDA 3U1TA 5JQGA 2C9BA 5C5IA 4G5QA 4KI0A 4PEVA 3MGGA 3T5TA 4P34A 3TD9A 4G09A 3WL3A 4U4AA 2NSHA 1J21A 2Q1TA 3RG2A 4J3JA 4AIRA 4ISBA 1TYDE 1M5UA 1DTWA 2PV0A 4Y2TA 3EJ6A 1RHUA 3FNHA 4G07A 4P54A 2FFBA 3N2IA 3X1JA 3MBOA 1QYCA 3NHMA 2AMFA 1W94A 4M49A 2HHCA 2CUNA 2CXTA 3WQQA 4YP0A 4OQYA 4TYYA 4LSGA 1UBJS 1VCMA 2PVSA 5CT8A 3SOZA 3SSMA 4L22A 1J2JA 1I13A 2YXEA 4CV2A 2FMXA 5I9IA 3L6UA 4OBBA 3OIVA 1PLKA 1GZ7A 1MFPA 1YDMA 1A69A 3EVZA 2QAJA 3IUSA 2N75A 3MRXA 4LI0A 4TT8A 3UT6A 4K81B 3TS1A 1IDN1 2OVFA 4WY8A 3H0EA 1S96A 4FFLA 3BE8A 3ROQA 1Z6QA 3DDNA 3FZEA 5EWJB 5CFLA 2RH4A 2GSWA 1IY1A 3OZVA 4R1MA 4FOOA 4N39A 1QIKA 5DKFA 1G1MA 3ICQB 1DBSA 4RH1A 3D6MA 5HF6A 2WG2A 2QUBA 1IOZA 2WSLA 2J0UA 4W1PA 5K0JA 5K7SA 3U4DA 5ADUS 4X1YB 2R8YA 4UQLA 1XZBA 4K9RA 1HG0A 1Q5PA 1TXGA 2ZUUA 4UNRA 3ES9A 1HKUA 1NBMD 4FYKA 5HUQA 4DIUA 3RK0A 2NTYC 4NIMA 2BEJA 3TL3A 5EN4A 3VR4D 3L2OB 5DW3A 1PG2A 1RI4A 1D5WA 3OLYA 2FDRA 4ND4A 1S8NA 3AL2A 4X9XA 2PH7A 3IJPA 3SSOA 1XTIA 4MAMA 5ENZA 2V7PA 3FJOA 1R6UA 2AI3A 3BL8A 4YYEA 5AW9A 1OH6A 2JW5A 2JD0A 1ISJA 1ZUNA 1FDUA 1MABB 2ISCA 3IB6A 3IMCA 2BH9A 4K28A 4ZC1A 3PFCA 4DG9A 1KOJA 4D0GA 1QPZA 1WXDA 2OY0A 1VHTA 4A0HA 3DKIA 4YAKA 5EZSA 2YIVX 4KQHA 3C3BA 3PTZA 3N2GB 2QR5A 4M0MA 3ITDA 4ZA2A 5ULLA 2W2KB 1A71A 2HJRA 3T94A 3TTYA 3B3FA 3BXPA 4L07A 2HV8A 3HJHA 5K0GA 1HH4A 1B8VA 4LQCA 1CHNA 4MV7A 4U5XA 3P2OA 3TDNA 3UM9A 3NDIA 3C6YA 1U63A 4MW1A 3A9CA 4U1RA 4A91A 4B45A 2WIBA 4ZANA 2ZCUA 3HCAA 1PJ3A 1LPSA 5BYBA 3MWEB 4MUXA 3L7MA 5AJVB 3RHSA 5FJJA 4HUTA 6CHYA 4PONA 5IYZB 4GKBA 3VHLB 3PQ6A 1U2PA 1EVKA 2X8LA 5IAOA 1I32A 2C9OA 3N0RA 2VLBA 4MVJG 2OZLA 3GLSA 3T38A 3T34A 4CCAA 4JNCA 4XWOA 2HW8A 4OHVA 4J1QA 3AR7A 1NUTA 1CZHA 1HQCA 3NAMA 2UU9B 3HKEA 3H9QA 3PZRA 5IG2A 1HEUA 4DR7B 4ZOQI 3KXLA 1ORIA 1YB7A 4CF6A 5D84A 3L4KA 3P2JA 4R8MA 3H4IA 5AW2A 1EEHA 2FPPA 3F6CA 2PHZA 4FN4A 3BE4A 2VJQA 1RRGA 3A2KA 3PFWO 4UOEA 4YRIA 4K6CA 2W37A 2QRPA 1F38A 1HDIA 3ON5A 1FVHA 4A4DA 4GG1A 2VTDA 1XZ8A 2ZFUA 1WXFA 3PL1A 3FAZA 4GNKA 5AM0A 5E6SA 4F21A 4ZCMA 3I6IA 1U4SA 2OO7A 1S8OA 1FTNA 1NZDA 1ECBA 3VR6H 4R6WA 5C4MA 1DKUA 3CLTD 3W2EA 1RP7A 3DBVO 1CZNA 1SUIA 5LZ5A 2F59A 3HBLA 3Q40A 4BQEA 3WI7A 2XUHA 4F8YA 4ZTZB 1ARZA 4NH0A 4B7CA 4QEZA 1D2CA 4D1YA 4A8PA 1N75A 4G5SA 4MQMA 2YHBA 3A3YA 5AVZA 5IDWA 4ER7A 2VJMA 5BT8A 4KPYA 3CRMA 3TQHA 2YJ5A 1ISSA 5FPYA 3R44A 4S1PA 4GD3Q 3YASA 3I2JA 4UOZA 1K8XB 1KZ1A 1OIWA 5IANA 1UXJA 3EQ2A 2C7GA 3Q41A 3V7WA 4CKZA 2B1QA 4XE5A 1FLDA 3O8OA 4LXYA 3EGCA 5TARA 1SUCA 2Q6LA 1TJNA 3NGMA 1C0IA 3QJ5A 4MVJE 4P81A 3HMKA 2VTEA 5GJCA 5CBPB 1NRIA 2BFFA 4AT1A 3UY4A 4PRYA 5G41A 3JQGA 4TV9B 2G04A 2HBYA 2XJ9A 4KWCA 4UCFA 2I4OA 4KX5A 1IK4A 4RFSA 3HKCB 4UMVA 1JHOA 1QZZA 2QP3A 2P65A 4PAOA 1KAHA 3IBFA 1JAHA 1VYHA 4URHA 4YCSA 1Z56C 4AN4A 2QVGA 2A4MA 2ACWA 1W36B 1J1ZA 2KM1A 3WGVA 4K46A 1ST2A 3Q8KA 4O0LA 1T2UA 1YTUA 4K9LA 2J5RA 2WFLA 4JLJA 4WCFB 1PJLA 3FYTA 3A9WA 1ZGGA 2XDAA 2Q3CA 1T0HB 2ZRMA 4L75A 2JCYA 4B4KA 3QPCA 3IHLA 1YU9A 1V9SA 2HNKA 3NVMB 4CCSA 5CB4F 1DMSA 1U65A 2Y1CA 3FGOA 4KYUA 1J5XA 1TUEA 1ZJZA 3OZEA 3JAMA 1EFLA 2DSTA 2L19A 3UMRA 1HT2E 1P74A 2P9FA 1YZHA 3KD3A 5ISMA 5C5DA 1DPFA 4WLUA 2VQEB 2PBZA 2WMOB 5IM4F 7GPBA 2CZGA 2M1ZA 4EF5A 3C7KA 3AKDA 3OX3A 3K70B 3RU2A 1Z15A 1GRCA 5C7LO 2R6CA 4Z4HA 1CY0A 3CO5A 3VQTA 2HIMA 1KY5A 2WYIA 1YJBA 1DWUA 2DFKB 2I34A 3MNFA 4PQGA 4CHGA 1YI8A 4CF4A 4QM7A 1CU1A 1FFYA 2IH2A 1XDZA 2VPTA 3S2EA 2AH5A 1CUWA 2BTEA 4DWOA 5ALPA 4CT5A 2Z98A 3GWGA 2V65A 1IIBA 4NI5A 3A3PA 3EGIA 1OROA 4OJTA 2FPIB 5JEEA 4FHCA 2CHUA 1ATIA 1S2OA 5HYVA 1Q1QA 1QHXA 3PXEA 5FADA 2JIQA 2VYND 2YJ4A 5F35A 1KQ3A 1LSOA 1UK7A 5CTAA 2Q3HA 2PKQP 1GZ3A 4H4CA 2QRMA 3ROZA 4XWAA 4P8RA 4EP1A 3UUWA 3THYA 2ZT8A 2Q6KA 4EVSA 1FP2A 2GD2A 3DYVA 3A3KA 3ED1A 5JPDA 1V2GA 1BS1A 1XMSA 4KQ2A 4EZEA 2GN0A 3NHRA 2D2FA 4M0DA 5A4DA 1E0SA 1N6OA 3CCCA 3MCZA 3PXXA 3I92A 3RFXA 4F3YA 5C35A 5KNCH 5TMPA 3T5AA 5KSPA 3LCMA 1PI3A 3N5KA 4JJ4A 1G8MA 4U7GA 1BMDA 3B3JA 1KMHB 4B80A 4R1UA 3GFGA 3WHLA 2L69A 3U3ZA 2I62A 1VHLA 4N3NA 4EG1A 3KR2A 3P9CA 1J2YA 4L50A 1W49A 1RRFA 3ZZNA 5M7EA 3THWB 4EYQA 3MS7A 4XQGA 3QLJA 1I5RA 1RXUA 2YBDA 4AUNA 3TLKA 4XWWA 4Q3OA 3OQNA 1JSXA 1ZNQO 2QV7A 5BXQC 1WCV1 4FW9A 4RGBA 1V8FA 5A4JA 7AT1A 3BULA 1CEQA 3QVOA 4Q9JA 3PLAE 2GN4A 3ZDEA 1KC3A 1BA3A 1LK0A 4GGOA 4RESA 3VH3A 1KTVA 1EVYA 2EW8A 4AZ3A 2KHZA 4BVFA 3S68A 4V1CB 3M9XA 2OTCA 5FNVB 2AFIB 4NFLA 3ZDFA 4LHEA 1O6CA 4KE7A 2XKAA 4IXWA 1BKYA 3ZXXA 2I7DA 3IX7A 5GPBA 2XWQA 1V8PA 5JYEA 1WZNA 4GX1A 1ZRSA 3DKVA 5IS2A 3NC4A 3IE0A 1Y6ZA 4DSZA 2V96A 4IMIB 1THGA 2ECKA 4RIIA 4ED9A 4J0GA 5MN4A 4RTOA 1B6GA 2YWJA 2J8ZA 1XD8A 1T5BA 2O57A 1XKTA 1I9CA 1N33B 4QYSA 5JAUA 3G8DA 3PEFA 3SP1A 4LC1A 1BZYA 1TADA 2PX6A 3H9JA 2EF1A 3W8NA 1TRHA 4C4YA 3IAM1 1D03A 1YAHA 3RRBA 1JXQA 2JRLA 2PWPA 3RBVA 5EESA 4I5DA 2VG8A 4JZKA 2MMGA 3EZGA 1PD0A 1ZQ9A 1KSHA 3INNA 2G1AA 4JXKA 1XU7A 4KBYA 1DWPA 5ICSA 5LNK1 5HKOA 1Y1LA 2UYGA 5IWCA 2Z30A 1ZLXA 4F96A 2DERA 3U61B 4WNYA 2JFVA 3TR5A 2XE6A 4HRXA 2X1LA 4PZEA 1NJSA 4RD6A 4BVLA 4HXGA 3LPMA 3FD8A 3I83A 3SR3A 4BJHB 2XVXA 4C3OB 1I2ZA 1C0KA 1UMCB 3AERB 3PRJA 5KTSA 4MPTA 1EE1A 4AUMA 3SFVA 2WAOA 1URPA 3H3JA 4DHEA 4CR8A 4HEJA 3FNQA 4KR6A 2X6RA 1PN3A 1Z4OA 1X1BA 2Q7XA 4KDCA 5BSGA 1QAOA 1JV2B 4KMMA 1W1IA 1IZZA 1MQSA 4W9RA 4WQMA 2DBZA 5DNEA 1VFPA 2I2BA 2PVCA 4TMTA 3SYKA 3BJRA 4YV1A 1A98A 2DKOA 2UVPA 3G0HA 4RV5A 3TSCA 5KU7A 1J1UA 3QVJA 3LTNC 2Q5JA 4E03A 2HDNB 4OSOA 4UW9A 2FQWA 2A9KA 1KQNA 1XT6A 3NHSA 4WFKA 1C3JA 1GA1A 3W5SA 1X9IA 1YJXA 2O0KA 2Q2NA 1BE6A 3GMDA 3LWBA 4MVWA 4Y7CA 4BNLA 1SUEA 4U7FA 5EGNA 1CNFA 3A10A 1IMJA 4RANA 3WV4A 4CCYA 1NYQA 1WCXA 1NUPA 3ABQB 4H2DA 1A4IA 5LKAA 5JO9A 2VPQA 3OMXA 4BRZA 5CLGA 5LL6P 1VECA 2QTNA 2ZSEA 2AF4C 3WC4A 3HB5X 4DHWA 3EXHB 3O03A 2HIGA 3L0SA 1XPOA 4OIMA 1L7BA 1RJFA 3DBIA 1EVZA 2EIXA 3GFOA 3ZK8A 1W34A 4CZ2A 5K2OA 2ZAMA 4BX8A 1ODKA 2C4VA 3JASB 4TWRA 4YAEA 4NMMA 4J2TA 4PGFA 2YCBA 3ADBA 3LX6A 1C9DB 2PUJA 1PR2A 3ANYB 2I6GA 2SBTA 1SVWA 2QJFA 4GMFA 1KO8A 4TQAA 1PHRA 3L84A 5HKLA 2A1IA 3QVTA 5E7MA 1H94A 1Y48E 2FRDC 2WOJA 1YR6A 2GPJA 3KLNA 3MB5A 4MJXA 4WDRA 5JXHA 2J9XB 3JYLA 1N8NA 2REQB 3D59A 3PPXA 2D2XA 2IZ6A 1W0JA 1X3SA 2AFRA 5JYCA 3E7FA 4LRSB 2Y1GA 2G9UA 1DWOA 1U2QA 3GUHA 4HPJB 3HWSA 5EXSA 4KX3A 2CN1A 5DHPA 4S0ZA 3TLBA 3X2FA 1YA6A 1U1FA 3JQ8B 1NLZA 4PTLA 1YRAA 4ADSG 2Z1DA 3KLPX 1KPHA 2BIFA 2WRZA 3M70A 1IWOA 1V47A 3MQ4A 2HBQA 1CDEA 1RM5A 4AI6A 2PZMA 3MJ4A 2GEKA 3NIDB 5DT9A 2FMUA 3TMAA 2CWDA 2A58A 2WYVA 1MAAA 3E7DA 3FPSA 2BHNA 1F8XA 3B8EA 2VZ8A 4KUGA 1XZQA 1YOVA 3TZEA 4NZPA 1ODFA 1OXUA 3FNFA 2P5TB 1EX6A 1VHQA 3PD0A 3T9DA 4XSVA 3SQDA 3WS7A 3GRUA 4MAAA 2HCRA 4HLUC 1Q11A 3WL5A 2XPCA 3ZBQA 4DCSA 4DMUB 4F7DA 1XEAA 2VJYA 4CEHA 3OQVA 3FDFA 1XMXA 1JDBC 3W5UA 3H83A 5AJXA 3DAPA 4I2VA 3MJVA 2O2SA 2ZSDA 1E59A 3VR4H 3WYDA 5KO2A 3H75A 3OSZA 3GFFA 1YSCA 4ZOEA 3CLRC 1DKMA 2W7TA 1RNLA 4BUZA 1KEEB 2WA2A 5CCBA 3FG9A 4R4JA 3ZCPA 1JTVA 1OFHA 1RXWA 2Q1XA 1K66A 1M0WA 4E14A 2RHWA 5CNMA 4Q93A 1Q7TA 4X6YA 4QEDA 1M2NA 4FGZA 2C98A 3GOHA 3K0CC 4I66A 3TD2A 1JR4A 1CRZA 2QX9A 2GD1O 4PW0A 2FWIA 3SR0A 1RQXA 3ZHOA 4CF5A 4B3HA 2E5WA 3NKVA 3I45A 3IUBA 4KTVE 4RVSA 3CVJA 4HNVA 3EC7A 3I6BA 3IV7A 1GCUA 1Z0KA 1Q3HA 4X3PA 1E9SA 3ZYZA 1CF4A 3TUZC 4IZIA 4NJOA 4L9WA 4Y2YA 4F60A 4WBNF 2QI9F 4RIGA 4I5EA 2UUCB 4AY2A 4M8KA 4ARZB 5ICCA 1GYPA 1LVUA 4C14A 4C7XA 4LJSA 5CR9A 1JILA 3EY9A 1VGVA 1VRVA 2HSEA 2QE7D 2QLJA 4N6OA 3RJTA 4F7WA 3N3AC 4CDNA 2AXQA 3B6KA 4G0YA 3UMCA 4W5OA 2IS2A 4Z4GA 2QPOA 4PWZA 4ZVMA 1C8VB 2DVMA 1EJBA 1LSUA 3KNZA 3OKCA 4JR0A 2D54A 4L08A 1AVTA 3Q9NA 4BFXA 4TRNA 4AAYA 3ZUGA 2HRZA 2R7MA 3HG7A 2C2WA 1NAHA 2OM6A 4QUGA 4ZOLA 4EI9A 3NONA 3AOGA 4B4WA 1JLLB 3DGEC 3LP8A 3K53A 2IHYA 3COVA 4KQ9A 1GRNA 1JXOA 5EEGA 2FN4A 1T1SA 2X3YA 1L4BA 3THSA 4EX7A 5ADWA 4C5CA 2XNCA 4UZEA 3U7QA 3H7IA 3HHEA 3RYCB 4PG6A 2UYQA 2R4UA 4G2NA 1A7JA 3DE5X 3KEFA 3LT1A 3FHOA 4TKMA 2D5LA 1ZHFA 3H7AA 1GGHA 3NVDA 3SE7A 3R3UA 4LOJA 5KTRA 2PZ8A 5CVJA 2ZVPX 1EEXB 1PJBA 3CX6A 5DYTA 1ZOIA 3L7LA 4PX5A 3EZYA 1OC4A 3LRXA 4YMWA 1J24A 3G2HA 5JWOA 4L4ZA 2YVKA 2WJ4A 3ITKA 1BEZA 3FUUA 3JYHA 3PS9A 3VISA 5CDYA 4X66B 1QHSA 1Q77A 4X54A 1RC8A 5BWOA 4X65B 2WTXA 3CH6A 16PKA 1YRYE 4A82A 1O8CA 1UZLA 5ILGA 1KMCA 4RH3A 5BSMA 5BVGA 2AOUB 2ZB3A 3VZDA 1WPRA 1OMOA 1RWNA 3KOUA 4KVZA 5TGTA 3SX0A 4YRKA 1UBEA 2FSHA 5AQEA 4YCLA 1TGVA 4UXIA 3CEJA 1KJZA 1Z8HA 1L5ZA 1KBZA 4LDQA 5ICFA 3GP5A 2NTJA 1E7MA 3N74A 3BD9A 4BMOB 3QXCA 4BNTA 3DPUA 1SAYA 1DQZA 2IYSA 4EI2A 3PTLA 2WLSA 4FZVA 2BFAA 2K7FA 3IUEA 2Z6UA 1TU3A 4JD5A 3CR3C 4YB8A 3H19A 3OZXA 4JQYA 4OH1A 1BJRE 4C21A 3O1HB 4KXFB 2G82A 4WBXC 3MPUA 2X23A 3G68A 1LI5A 3ANTA 4RL4A 2H29A 3IOMA 4ARIA 4HLCA 2IYLD 4JJ7A 1Z6PA 5E3JA 1PWZA 1Y7TA 2B20A 3LDFA 3RIMA 1Y6QA 2QTMA 2PAAA 4NVRA 4ALLA 1VG9B 4Q6BA 4DDTA 4WVLA 3IKJA 1IULA 1T1GA 4H35A 1G4HA 2ZSUA 1L6RA 1PEAA 1SHLA 5J4KA 2XKJE 1PTJC 3BMCA 1N77A 3TOZA 2WFZA 2XEXA 3CH7A 3MTDA 3UMSA 2KWIA 4XQCA 4Q0MA 2BTOA 2CEAA 1W6UA 1TO1E 2KLBA 2MSCB 2YV2A 4UASA 3H5RA 4LBYA 3S2UA 3WLNA 5A7FA 5C31A 5HJ7A 2IE0A 2JBAB 5FFNA 3ZEAA 1Z33A 3X2SA 1HT3A 2DR3A 2OGSA 2WJ3A 4US2R 4TRJA 1NVVR 4P3PA 1UBUS 2DY1A 2IOHA 3Q72A 4ALJA 3LK7A 2YTZA 4DE5A 3K0HA 4KFTA 3UWPA 2BGGA 3WRXC 4TM7A 1IVNA 1HYEA 2JL1A 2ZRNA 3AOEA 3LWDA 3ST7A 2BC9A 4P7FA 5DULA 2JZNA 1IY2A 4TSFA 2ZVJA 3BUSA 3CB4A 3F7TA 1N6HA 3MINB 4R8SA 2O8FA 1E5DA 3QV2A 1UBFA 5AWFC 3S2FA 1LLCA 2DAPA 5D85A 2VRWA 3IQXA 3CUTA 5AM2A 4RTLA 2CLSA 4LY3A 4G0UA 1PKXA 2CBGA 5FWDA 5JNRA 4GUAA 3QENA 2IU4A 4IWXA 2IYRA 4HEHA 4J0JA 3TN7A 1C7ZA 2A5YB 4UM7A 4EZIA 5KSZA 1VPVA 1J49A 2R1UA 2YMLA 3FY4A 2P4EA 3U3DA 4BP3A 1MUUA 1Y1RA 3WIVA 3NJ4A 3GUVA 4DLAA 4Q34A 1GRVA 4JR1A 4DM3A 4IQ0A 2ZI4A 4CLHA 5KWIA 1CDDA 1OI4A 2G07A 1WU8A 1GEEA 3MB8A 4L6AA 4E11A 2H1SA 1A4RA 2X9QA 1DCTA 4ND8A 3MELA 3TXXA 5IX8A 4PNHA 5JR3A 4WL0A 2PR2A 2JGFA 4BMSA 5IBCA 4U6SA 1C8KA 4X1KA 2Z9CA 5EIFA 1RWBA 4IOJA 5KPDA 1M6WA 1C4XA 2OORC 2O0MA 2Y1DA 3CUWA 4R51A 3G2QA 5E8JA 1BHSA 1UXHA 4HAOA 1E4VA 1ZZGA 3ETCA 3FYUB 3K0AA 3OESA 3UJ9A 4HH0A 2IVZA 3VKWA 3ZZ0A 1XXHA 4D98A 2HQBA 4DN6A 1T4BA 2DMRA 2Q3EA 2WD8A 1Z4QA 2R00A 3B48A 3FDZB 4LOHA 2EP7A 4TUYA 2EVWX 1FW8A 3A1DA 1K6IA 3GZ4A 2XCIA 3AHGA 2HU7A 3LFHA 4J16C 2V1UA 1V6CA 1QG4A 4YONB 2Y92A 3B12A 1A9XB 2FPRA 3BK2A 3I42A 2O3SA 3B9RA 2A57A 3J7AC 4U2GA 4JH0A 4UUOA 3EHDA 3DMFA 4OK6A 1BVHA 1AZLA 1R5BA 3AP3A 1XRLA 1DIAA 3R2JA 3GPBA 3KQPA 3M1YA 4E3ZA 2B1GA 3AIMA 3ZDXB 2IPXA 4WZBE 4OLAA 1JQBA 2C5HA 2P62A 1SHTX 1TAQA 1QRAA 2AG8A 4REQB 3OU7A 1QYIA 4RZQA 5E38A 1TCBA 2GR9A 2V54A 4NJMA 4QGAA 1NONA 4YMIA 2O6HA 1G59A 2V5AA 4TTVA 5TR9A 1XXLA 1C41A 2OHOA 4OQEA 4XLTA 2SCUA 3GT7A 4CN8A 1VPTA 4F4CA 4C3ZA 3U09A 2QT9A 4S1VA 3MGKA 1UOEA 1ZVKA 3L8FA 1KHHA 4WZ6A 1H0KA 3LDGA 3FAKA 4LNHA 3GEMA 1PL6A 2PGIA 5JHGB 2WJVA 4M9SA 3ZLUA 2DXIA 3U3JA 1LGYA 3QPUA 2VBCA 4ECEA 4YJHA 1FXWF 1P29A 3HDQA 4FK8A 3S6JA 1D0SA 4ID9A 1PR3A 2WZQA 1SIBE 3CNOA 4C4SA 4REQA 4ZZ3A 2ZULA 3IIEA 1X7ZB 3NW9A 2FWAA 3V1TC 2DCUA 3O2SB 1ADFA 1PX0A 3E9MA 1PR9A 4Q00A 2GAFA 3RWMB 9GPBA 1NVDA 2YHIB 1F9EA 3D0KA 4FU0A 4PZ9A 4RD4A 1UAAA 2HQ1A 3FVWA 3OZBA 2WU0A 3TOXA 3UXMA 2O8EA 3BGIA 1P3DA 3KB2A 3PDIB 3CO0S 2A5LA 4JUFA 1YRQA 4KGZA 5BQFA 4R8VA 4RY0A 2CNKA 1Z29A 5KUTA 1H4VB 2K7ZA 3H5OA 3Q3CA 1A0OA 4ZXFA 3SSNA 5FNZA 4YCNA 3UFXA 3MT9A 2G9ZA 3MPOA 4DIFA 4HMOA 3CISA 2H5IA 4F3RA 3HL4A 1C7FA 2J46A 4PNPA 3CY6A 1I1QB 2FEMA 1ZINA 2XOEA 2B3TA 3AUYA 4L9SA 3P9ZA 1XI2A 3AY3A 1LPNA 5K0LA 1NQVA 4TLAA 1JU3A 1XYVA 4YUWA 2B69A 1UMBA 3CKMA 1UBOS 2FZKA 3AMVA 3MGCA 2UYHA 1XN1A 1Z73A 1U2EA 3JQFA 2OB2A 1A7KA 3NWPA 3HSYA 5JFTA 3AJEA 4F93B 4AK9A 4KLCA 1LD3A 1IXRC 1ACLA 1U1CA 2WF6A 3IYLW 4TN5A 3TIGA 3ZV3A 1TTQB 3GG2A 3CZQA 3V7UA 1C4KA 3N6XA 4L8WB 2XLBA 3RSOA 2M6KA 3TZCA 4GKKB 2VRNA 5IMSA 1GCIA 2BEVA 2AX4A 1KH3A 1M8FA 3H1GA 3N2GA 2ODTX 2NO1A 4MQFB 5FTNA 4BNFA 2GN6A 3U19A 4GYKA 4NG5A 1W4ZA 2QD3A 4ZOAA 2C57A 5KYVA 5DYIA 3OOHA 2JB9A 2EV9A 4TOIA 1GA6A 2P2GA 1FFDA 2XUZA 3EF1A 2AD1A 3MSXA 2R5FA 1AIPA 1D8TA 5BNIA 4P4UA 2R8RA 1ZJ6A 4LDAA 4URYR 2ETXA 3RYHB 5LWQA 2XCTB 4ZJUA 4UTOA 2XKKA 3HNPA 4I50A 1TA0A 4IX1A 4OP3A 4PSKA 5EJ8A 3ASUA 3HR8A 4L7VA 3IKVA 3HI6A 4CF7A 2IPNA 1H8HA 3IAUA 1HF3A 2HI0A 3N58A 4TLLB 4EK9A 2P35A 1SOAA 2V7BA 2ZSAA 3A4MA 5A7GA 4WKCA 5JY6A 3AUSA 4EO4A 5EHQA 2NT4A 2H7VA 5JCZA 3DZBA 3JVIA 5J58A 2BGMA 1C9KA 1IEVA 1K06A 1MJGA 5DK6A 3COZA 3I61A 1WCIA 3GLFB 3M7IA 3WGIA 1W36C 3B6EA 5I8ZA 3F1KA 1RI2A 2PZJA 3R3JA 2F3QA 2ZJFA 2BMFA 1JHUA 4Z3DA 3HO1A 3HA7A 1U2TA 1VLVA 2O1EA 1NQUA 1VSQA 5GAJA 2IWHA 3ZI7A 1IL0A 2V6JA 5DTMA 4E2YA 3H87A 4Q7JB 1KVUA 3MYYA 1E3DA 1BWQA 1DC4A 1KIAA 4J2HA 4B84A 3NHLA 4XJSA 1W4RA 1SUSA 2ZYHA 2WU8A 4X1KB 1XNRB 3T3OA 1ZONA 3GV0A 4I1VA 1FDWA 4DM4A 2ZBVA 3DTTA 4MKXA 1XIVA 2QGZA 4NDAA 1Z5GA 1KI1A 2QGNA 2XMSA 1S1CA 2VL7A 4P93A 1XXHB 3AKCA 2IHUA 3VYRB 1GZUA 4XJXA 1APBA 5JAZA 1KTIA 5K0ZA 1C3VA 4NBRA 1WZUA 3VFDA 1AF7A 1AO3A 3JYNA 4HP8A 1NJFA 4F4HA 5JI3E 2YW9A 4R68A 1JN0A 4LC0A 4MUKA 3DMPA 4EKIA 4RULA 1NVBA 1E5QA 4NOLA 3UOWA 1TZMA 4PGHA 3TX6A 3I53A 2IV3A 3KLOA 1GU1A 4R7ZA 2OEPA 5LN1A 5ED0A 2Q1UA 2J85A 3DF7A 2CL0X 4J0FA 4MQBA 4NF2A 4DA6A 3GPDG 4KITB 4YRRA 5IDQA 5KS2A 2O8DA 1I24A 1MC4A 4I4CA 2XVYA 5AVJA 2G8LA 4EJ2A 2PL3A 5C2JB 4D3FA 3MWFA 4XGQA 4G6ZA 3WSWA 2AGVA 3OD1A 1R6TA 4GC9A 1Z47A 3UGKA 1N0WA 2EEZA 1TK9A 3A9UA 1KAGA 1KMNA 2I55A 2Q4BA 1ZXBA 1CETA 3U7IA 1ZD3A 1MENA 5FBHA 4E2WA 2XXAB 4IIHA 1B2RA 4F2WA 1QYRA 4Q1AA 4FPXA 1IM5A 1ZMOA 1JE1A 4M37A 2QEQA 3C4VA 4XZ3A 4IY1A 2W6ID 3AEYA 1FTWA 3ED5A 5H1YA 5GZ6A 3X3HA 1WEKA 2P4UA 4BE9A 1IUKA 5EXTA 2X22A 5KAPA 3SZOA 3AR5A 3GNTA 5CURA 1N2CA 4C7OA 3HZRA 2B37A 4UEJA 3L0IB 2I6QA 3N2ZB 5AVSA 1PZNA 5HFNA 4X45A 5JD3A 1DRJA 3E22B 1AK9A 1DRWA 1CY8A 1XWFA 3NV7A 4RJIA 2XNHA 3Q0IA 1W29A 5GONB 1CEEA 1GWNA 3A06A 4K2AA 1I7SB 1GR0A 1LH0A 1QCYA 2DKFA 2YY6A 3O84A 2AG0A 3BMNA 4UCQA 4EW3A 3BICA 2L17A 1U9YA 2ZAIA 3QU2A 4FC6A 3K30A 3GUCA 3GH3A 1P4GA 3CH5A 2DH5A 2DSNA 2YQ4A 4LGYA 3SD7A 1ZYUA 5KQRA 3VUFA 1FUYB 4LYGA 1G8JA 1P9RA 2QSZA 1MFZA 3JWEA 4R2JA 3F4LA 3HY3A 3MOGA 1KARA 5EE5B 4C4TA 2PT7A 1HORA 5LP6F 3CW8X 5EKUA 3E8MA 1ILEA 1Z63A 1ULUA 4CMAA 2GN9A 4D3SA 5JANA 1SRQA 5L3QB 1SHJA 1E7QA 3WRXA 1CR4A 2EZTA 1DXYA 2RIPA 3SXUB 3SQLA 3WGKA 3GIDA 1P7VA 3EWAA 4DSUA 3D2BA 3IKMB 2QN2A 3LFUA 1LBIA 2PU5A 2BUBA 2QUKA 1WAMA 3ONDA 1L1FA 1G8PA 1EWTA 1BN7A 3AJ9A 4C0BA 1XTJA 2ZI5A 1DAIA 2P2DA 4J9VA 4P33A 3NRJA 3P9PA 4RGVA 1YL7A 2F62A 2NPIA 4R7TA 1D9ZA 1NF3A 5F33A 5CIYA 4YPVA 1ZGHA 1U0SY 5DI9A 3V55A 2IH4A 3L6OO 2QE6A 4KOAA 1R6BX 3TM5A 1KU6A 4XVQA 2V7QD 3DS8A 3JYQA 1PQPA 3E2MA 1HDZA 3SDBA 2J31A 2N42A 2Z5GA 3NJRA 1GFZA 4IIFA 2G8NA 1FBNA 3M49A 4EUKA 2OYSA 2X8WA 1HE2A 4BVAA 1QZXA 3OX4A 1XRMA 2PGJA 2WT4A 3FFTA 1XKLA 2XY4A 2R7LA 5HCIA 5U9CA 3TAUA 4QTXA 1Z74A 3ZD9A 5DYNA 3TGPA 2PMFA 1Q0RA 3IPXA 1E3WB 2A35A 4X61A 3G9UA 4WH0A 1DO8A 1P18A 1JAZA 2H4JA 2A7XA 4L0QA 2YDXA 1THZA 2D13A 1KAMA 1PUIA 2QYSA 4LHVA 1MO3A 4MEAA 4QJIA 5K8JB 5JHHB 1C0LA 2OBNA 3MT0A 1NVAA 4ZI5A 2J0UB 1K08A 3F49S 1KDRA 4P4SA 1D2GA 2A4KA 1ZK3A 3BQ9A 3L9WA 4O4JB 5COBA 1P75A 2I29A 5REQB 1Q7EA 2FWNA 3CKLA 4DXDA 2QVZX 4DB4A 1A76A 1RYNA 3N2YA 4H7EA 1DHRA 5JY1A 3G6KA 1ECPA 2OD9A 3UYLA 4DV5B 1DINA 3UTDA 1XWIA 3INTA 5CAEA 3PKIA 5C7IO 2HMVA 1N1GA 4QHSA 1FYXA 1U2DC 1K5GA 4NESA 2K6GA 3OHSX 5D3KA 1XD2B 2N1BA 2VP6A 3PC4A 4XJTA 4BBPA 5F2EA 4C4ZA 5DNUA 1FSGA 4KNVA 2C5FA 2DU8A 3UJDA 2F55A 1RPAA 1EHYA 5JNTA 3PC6A 5BWLA 4HR7A 5LMUB 4C4AA 1THMA 4D8TA 2ZB2A 1C3LA 5JXWA 1OGYA 4I4TB 2CSXA 3SKVA 1JI3A 3FBTA 1VCIA 2PUCA 4MWCA 1UT8A 3WK7A 1WTCA 4B7XA 4XVRA 4LK3A 1GGNA 3G0CA 5K3SA 4ZYYA 1HOTA 4HQKA 5H5JA 3EXG1 3ZU2A 2OPBA 2EZUA 2OB1A 821PA 2HCTA 1XP8A 1GA4A 5BQ3A 1XD2A 2WSIA 5THXA 3FF4A 4BMPB 1I1HA 4I3HA 1NQOA 2XF8A 3HO8A 4Q48A 3AM1A 1E4EB 2RGWA 4NAUA 3MTJA 3EDCA 3N3BC 4TMFA 1GQFA 1VIDA 1XRSB 1PS0A 1G9TA 2UVPB 2ZJAA 1J2EA 3FWKA 3TQFA 2GM3A 4QOSA 4D4KA 1RWWA 1C7QA 3W3AD 1WIWA 5CK5A 1GYRA 4BAZA 2HSWA 4HN2A 3ILHA 1I2CA 1JHDA 3MJTA 1NV9A 4LC9A 1QHHA 3I5AA 4HATA 4PSAA 5CYFA 4ZT4A 3QP9A 4HB4A 4LGVA 3KOXA 3NP9A 5JH7B 5JNWA 1FZTA 3DL7A 2DUUA 4IQGA 4B87A 1XLUA 1UC8A 2EU8A 3LQYA 3ZHSA 4FYJA 2O19A 3ILSA 3EBOA 2QNIA 3GRYA 3QI7A 3ICWA 3QVMA 3RS3A 1Y9ZA 3TW8B 4ND6A 3GBSA 2J3IA 4KIWA 1NAIA 1SHKA 2KPOA 3AETA 4QYMA 3STHA 3OPYB 3AR4A 4PAMA 1EP3B 1NXQA 3C5CA 5HZKA 5B2FA 5IN5A 1FJXA 3BMCB 3FBWA 3R3SA 7ADHA 3T5BA 4UVIA 1N7IA 3KM0A 1P91A 1SQ5A 2CCJA 2W0SA 4FFMA 2GXSA 1BDIA 4OCZA 2G5CA 1PJ8A 1KY4A 1X7XA 3OPQA 4JL8A 1TJ3A 1NHWA 2K2QB 5CT5A 3P52A 3T99A 4MEBA 4RK1A 1DIBA 4HZUA 1OFUA 1OF1A 3QVGB 4F56A 2WP0A 1WZEA 4MQUA 1GKIA 3I8SA 5BRAA 3H9EO 3PZBA 5KZMB 1W93A 4Q4JA 1LB1B 4CKCB 4MROA 1VKNA 5T3YA 4F8JA 3TI7A 1V11A 2YICA 4LJAA 2GGSA 4XDZA 1MB4A 1MJ5A 1KEWA 3Q87B 3UMBA 1V45E 4LMBA 1GADO 2B9EA 3CWZA 3QMWA 4KN6A 2FAXA 2ETVA 2NO9A 1E60A 1B16A 3JD0A 1K98A 3KUXA 4CGYA 1LVHA 1GXSB 1QB8A 3LHDA 4HVTA 3G2IA 2HNAA 3AV0B 1PUXA 5HBRA 2IBSA 2ZB7A 2K2WA 3NRCA 4IDPA 4NV1A 2PT9A 5CDGA 1NJ8A 4L28A 1X70A 3MAJA 4M4SA 1QE3A 4F71A 4GR5A 1CULC 3U7QB 2JGEA 4FVTA 4B7ZA 4CEHB 2WD7B 3M6WA 4OKNA 3B78A 1T34A 3KEMA 1R0WA 2RI0A 3M34A 1RBYA 2XRZA 2YUTA 3U80A 4MICA 3N1UA 3GQBA 3O2NA 2H3HA 4UFNA 2HLHA 1V6AA 1L2TA 2EP5A 2WKRA 1O94A 3WSTA 5B1EA 3I9MA 3K70D 2JLWA 2DHEA 1V1RB 2HRRA 3FMIA 1X7WA 5DHFA 1RACA 2IZ5A 1M2KA 3GMIA 3T0FA 1MC8A 3GLRA 2XMGA 2ZWIA 2FW8A 1C7RA 5AESA 5FEUA 3LQKA 4OMUA 4EHNA 3FUXA 5AW6A 1YFKA 3L5KA 4AJLA 4DA8A 5T4BA 3K1JA 2FEWB 3AM3A 1FUEA 1TZJA 2YZKA 3IDOA 1JPVA 2H2IA 3NUQA 3BB3A 2M32A 3CIOA 3HVJA 1OLUB 2YXDA 4FS8A 3RC9A 4YHHB 1UKZA 1A8UA 4N3AA 4GYWA 4D45A 4KAFA 1JIIA 2YN2A 4AJOA 1Z4KA 2FR0A 4DJEC 2IIQA 1PQUA 3MRSA 4MI9A 1EVEA 2X1VA 4FZ5A 5TQVA 3UK7A 5DZSA 3IQZA 5LB2A 3COSA 3CPSA 5F9HA 1CUJA 1U28A 2IDJA 3TQIA 2NU8B 1GJRA 4KRXA 2WJWA 2BWJA 1W4BA 4O5OA 4ZCRA 2Y4OA 4X91A 4JCOA 3A28A 2F1OA 5BUSA 2I87A 4FP9A 5F7ZA 4L4XA 3ZW9A 5IN4A 1SVKA 8OHMA 2CXRA 2HIAA 1FFXA 5JQGF 2COEA 2O14A 3FBGA 3VNQA 1NM5C 4N5IX 4RMJA 4Z8XA 2HWYA 3PUHA 2W2OA 1ESEA 1KK2A 4NDZA 1P1CA 3NZEA 4BKQA 4YV0A 1NG9A 1QO7A 3MHPA 3WLIA 2QTCA 2ZBFA 1A72A 4BVHA 4ENTA 4YQEA 2WG0A 4ACAA 1C14A 1VG0B 3M1LA 1ENOA 2G7ZA 2NGRA 4BOYA 1U9ZA 2NUBA 3KJQA 5DGIA 1GGVA 2F4NA 2HUPA 5AOBA 4YCCA 2B92A 3N7UA 2REQA 3OWOA 1L7XA 1XQ1A 4KKVA 3V8RA 4HDMB 1G16A 1T9KA 5JZSA 2WTAA 3ZQUA 1VG1A 1DX6A 5C81A 2D1QA 3LD9A 4J49A 3RRNA 2OV1A 2TS1A 4JENA 2MINB 4B6PA 4DLBA 3L77A 3V9PA 3ZBUA 3E5MA 1G6KA 1BCRA 1ZL0A 2A92A 3K8OE 4NYIR 3DTNA 1X2BA 5KKAA 1P62B 2OYRA 5IJ0A 1USWA 3VNUA 1ELOA 4MRAA 3Q10A 1XEWX 1VHJA 2H07A 2NVUA 3RJZA 2CZCA 5KC8A 4C5BA 4J1SA 3SYLA 2AOXA 5C8XA 3W6UA 3DBLB 4N0PA 1PYOA 3SQOA 4EGFA 4EQ6A 1F2VA 5JMOA 1VYVA 3BGVA 2OECA 4BN4A 4DTCA 2AI1A 1AQ6A 4HDSA 1UAGA 4WK6A 2C2OA 2NAPA 3RVNA 3VKVA 5IHXA 1O58A 2QHXA 1BXGB 3TNDA 4CFYA 2QZ4A 3EGDA 3IAEA 4HUJA 3HJUA 3TVDA 1JT9A 3MJDA 1SH7A 3NH6A 2PD3A 3GFRA 3S81A 1ZNYA 2ST1A 3QTLA 4Y9DA 1L4EA 1BAPA 4GPD1 1XDGA 1CUCA 1G41A 3K5IA 3LGAA 3GEBA 4HDCA 3EEIA 4AP5A 3O8RA 4QLAA 3RCBA 4X6LA 3K9GA 1RPTA 1YDFA 1JLLA 3BRSA 3FUCA 4M8NE 3SYRA 3FJ1A 1Y6RA 4WUTA 2Z3WA 4IMPA 1UDAA 1RI5A 1T3SA 1CK4A 1KL7A 1RQ7A 4NOMA 1GGEA 4OGKA 4RF2A 2HF9A 2PV7A 2YFKA 3D4LA 4KLAA 5JSKA 2E5LB 2C3YA 5AP9A 1R15A 4AM8A 3PUZA 2IZOA 4COKA 1IPFA 2EYUA 4CM8A 1P72A 1ZNWA 4R2MA 1V4BA 5KOYA 4KVAA 4GICA 1PBTA 3KLBA 3SC6A 4HTFB 2I6XA 3IUPA 2CE7A 1EWRA 3DLPX 4N6NA 1ZQ1A 1RAFA 5TPZA 1FFSA 1EE2A 2A33A 1U6IA 4PZPA 5H3HA 1PLLA 4DIBA 3K9WA 4Q9KA 1R0XA 3K09A 1WMSA 3R77A 4G26A 1G6HA 1GUBA 3GEGA 4EW6A 8ABPA 5B3AA 4U7WA 5EERA 4G8JA 2GO1A 1H6BA 4CM4A 4YV2A 4MCAA 2IEGA 2NZUG 1EB8A 2OSVA 1FVOA 4IMRA 4RKYA 1EXMA 2JFQA 5EE9A 4LF6B 2APJA 4DJ5X 2CDAA 4CM9D 4ZVRA 5J47A 2XIJA 1JS1X 5EQJB 1FLNA 3HKCA 1PL0A 1ID8A 2XUGA 2IUEA 4JX9A 2QRNA 3LE8A 3CLKA 2GPAA 2LP4Y 4YMVA 4C3VA 5DM4A 3JZAA 2G4LA 3C1OA 3X43A 1A95A 1VJGA 4JYPA 4IG4A 3HUDA 5KX5F 2ZUCA 3GI1A 1ZWKA 2E18A 3IDFA 3BGSA 3B8HA 3D0RA 3RSSA 3WWOA 3BSSA 2JGJA 3LUGA 3MJFA 1ACJA 1LWOA 1SM4A 1QKIA 2PNFA 2ECPA 2RGNA 4MPPA 5FPHA 1HR0B 4H7JA 4LRYA 4RIFA 3RK1A 3NHZA 4IICA 3ICEA 2VJOA 1KEUA 1TZBA 1NNUA 1M1NB 2QN6A 3IHWA 2XUOA 1X9GA 4XTCS 2GJSA 3W7VA 1HRKA 1L4UA 2FKAA 2O4UX 3CLSC 2XGJA 4AECA 1E1CB 1QGAA 1U7OA 1I6LA 1SHUX 1YOBA 1Z75A 2B7BA 2FPWA 2JJ1A 2Q3LA 2Q9UA 2Z3VA 2NYUA 2C00A 2M9MA 3QX7A 3VAZA 2I7TA 4A1FA 3CT6A 4WN9A 1C3OA 2BW0A 4QWMA 3AT1A 4KUEA 3QJGA 2AXEA 4QVGA 3ZVLA 2WKSA 3TMYA 1ZSYA 5I4KA 2GRAA 1NUHA 4MX8A 2IJGX 2VH2A 3SZRA 2AE1A 1GTMA 1UDBA 1CUHA 2B82A 2J6CA 1V5IA 1YCDA 2BGIA 2VBIA 2WM9B 4ZT7A 5C1IA 4ZJPA 2CV0A 2H85A 3ZV6A 4HNTA 1M75A 3V80A 3ZGVA 3GJ4A 5IKXA 1E7WA 4J6FA 1Q21A 2P1ZA 4ZT5A 1PZMA 1XVTA 1ZM2A 4LOIA 1R16A 1VGQA 2HRQA 4U2EA 5IJZA 3LUCA 5G1PA 1EUDB 1FFCA 3HA2A 1XYYA 4UZSA 1EFUA 1JI0A 2W71A 5FPTA 1SELA 4A16A 1Z37A 3WKBA 4QFDA 2Y0PA 3SSAA 3DL0A 4NHEA 2P3LA 1TNDA 1ZW1A 2LDBA 3V1YA 3ZVRA 3HKBA 4E3WA 3BHIA 2ZBEA 4HDMA 3I0ZA 4F3NA 1M1YA 3USZA 2WJZB 1R3UA 4KGVA 3ILXA 4I6JA 1UKEA 2QYHA 4NR0A 3T5DA 3BXXA 3HWWA 3MW8A 4KH0A 3U4AA 3MYRA 3PWZA 2CFSA 4Z9FA 2F64A 3DCYA 1W0KA 3QYJA 4KVFA 3VOSA 5LQAA 2V6IA 3N7AA 2C97A 2XSZA 3GJYA 4P7KA 1P3JA 2R7AA 4IIDA 2O7NA