4N7JA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
268
structure length
256
Chain Sequence
FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 256
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n7jA00
4DCOA 3R6GA 3SIPA 4QUGA 4AWAA 3D6HA 4PS1A 1ICEA 5IBCA 2QLJA 4N7JA 3R7SA 4AWBA 3D6MA 4HQ0A 1RHQA 2XYPA 1RWPA 3NR2A 2HBQA 3V4OA 4JR1A 1F1JA 1RWKA 1QTNA 4QU5A 5LUBA 3EDQA 2H5IA 4QUIA 4IYRA 1QDUA 2XYHA 1SC4A 5IAKA 2Y0BA 1RHKA 2H48A 3DEJA 2Y1LA 4JB8A 4QULA 3SIRA 1I3OA 4N5DA 3PD1A 2J30A 1RHMA 4ZVSA 3NS7A 5IARA 3PCXA 3E4CA 2H4WA 2C2KA 4NOMA 4QU8A 3EDRA 3GJRA 2CNKA 4QUAA 1SC3A 3DEIA 3K7EA 4IEFB 5H0IA 1M72A 5K20A 2CNLA 4ZVUA 2QLFA 3R5KA 3V6MA 4ZVTA 4QU9A 2H4YA 1RWVA 2C1EA 3GJTA 2K7ZA 1CP3A 2XZTA 3BIJA 3NKFA 3V3KA 1NMEA 4N6OA 5LU8A 4QTXA 4ZVRA 2XYGA 3H11A 4LSZA 2C2MA 1BMQA 2XZDA 4AW9A 5IBPA 4EHDA 2FQQA 1K86A 3H11B 2FP3A 1I4OA 4JJEA 4N7MA 3ITNA 3H13A 1SHJA 4NBLA 1RWMA 3P45A 4JQZA 4FXOA 4NOJA 2CDRA 3D6FA 3R5JA 1RHRA 3H1PA 4HVAA 1CVRA 2CNOA 2FUNB 1PAUA 2H65A 1RWWA 3IBFA 4I1RA 4QU0A 4NBNA 1QX3A 3R6LA 1SHLA 4FGUA 5IAJA 4EHHA 4DCPA 4NOLA 3DEKA 4PS0A 5IANA 5IASA 3KJNA 5I9BA 3P4UA 3KJQA 3V4LA 1K88A 3V6LA 2NN3C 1RHUA 1SC1A 3S70A 1RHJA 5IABA 4QUHA 4ZVOA 1KMCA 2QL7A 2HBZA 2WDPA 2HBYA 4M9RA 4PRYA 1NW9B 1RWNA 1RWXA 2C2OA 4D3XA 3H0EA 4QUBA 2J33A 2P2CA 5I9TA 2J32A 4EHFA 4EJFA 1NMSA 2QL5A 4JJ7A 5IC6A 4NBKA 2H5JA 5LU9A 5JFTA 2C2ZA 4N6GA 4I1PA 2J31A 3GJQA 4QUDA 2CJYA 1GQFA 3R7BA 3IBCA 2H51A 3KJFA 5IAGA 3V55A 4FDLA 5IAEA 4D3YA 2QL9A 1RWOA 2AR9A 4DCJA 4JR2A 3S8EA 2CNNA 4QUEA 4JJ8A 1RE1A 4HQRA 4ZVQA 3RJMA 4EHLA 5LUAA 4FEAA 1JXQA 3GJSA 4EHAA 3OD5A 5IBRA 4QUJA 3DEHA 4JR0A 4N6NA 4NOKA 3UO8B 1PYOA 3QNWA 1IBCA 2QLBA 4QTYA 4EHNA 4PRZA 2CJXA 5IC4A 2DKOA 1I4EB 4D3ZA 1GFWA 2HBRA 3R7NA 1NMQA 2H54A 4JQYA 4ZVPA 3PD0A 1I51A 4EHKA 3UOAB 1F9EA
chains in the Genus database with same CATH superfamily
3TN7A 4QBFA 2GPBA 2A59A 4LJ4A 3OIFA 4DSTA 1KEUA 2CB9A 1O9HA 2XUDA 4TT8A 4UREA 1T4GA 1XCBA 3I28A 2WQ6A 5BSRA 1TW3A 1P2GA 2HK9A 3OEHA 4TZ6A 1I6WA 1ZK3A 4O8CA 1HLDA 4FYVA 3QEAZ 5CVEA 2P3LA 2GO7A 2UUOA 3E7XA 3DE4X 3DLHA 3OP1A 4HDOB 1FFSA 4EW1A 1TADA 2PKCA 2VT7A 2V98A 4ZQFA 2GO1A 3RHTA 3QVXA 3W1WA 4FOTA 3WNBA 1CJCA 4LGCA 4RNDB 2Q3MA 1K0UA 2NU8A 3DM5A 3BDVA 1XAGA 2XRYA 3F3MA 1XZMA 5K5EA 1C3OB 3WR5A 3H42B 1MRNA 1NE2A 1IH8A 4FJ1A 4FYXA 2J3JA 1CK4A 2FE1A 5BYAA 4RTRA 3ZHZA 3S1AA 1AGPA 1EB9A 2PJZA 1F4LA 3LCVB 4L1KA 1I1OA 1P2FA 1BE8A 2R6HA 3WK8A 1DCMA 1NTOA 3CRZA 3G6KA 4CBVA 1L5KA 2F4VB 1Z4QA 4QTXA 4ZYUA 3WKCA 1GQQA 1ADBA 4BGVA 4AX4A 1H5NA 1YK1A 5AHWA 5EMJA 3K16A 2WFLB 5IBPA 4Y18A 4RTSA 4L27A 1KMNA 1SBZA 2F1RA 3EF1A 4G6ZA 3X44A 5JAMA 4ZRMA 1RJ9B 2QUIA 3H1EA 4DA6A 1U3CA 4NOJA 3CRVA 2YH2A 4GGOA 4FYIA 2HMSA 2VRBA 3GA7A 3V8EA 1YASA 1TZKA 2B0JA 3U60B 4DYVA 3QJ5A 4LZJA 4WFIA 3G2OA 1GZVA 5CH5A 3IUJA 4PZCA 3ENKA 1G64A 1YONA 4JQCA 2IU0A 2LWIA 3LDHA 5I7OA 1RZUA 1UAYA 1IWPB 3ABQB 3KYDB 5DTMA 1NIPA 3HA2A 4MULA 3U09A 3G8AA 4ZT3A 5J4VA 1BDIA 4XIIA 3EZFA 3B1VA 3HQ4O 4CT5A 1JR4A 4HUTA 1W47A 2HC9A 3GLFA 4Q3EA 3HJFA 4DSNA 1MGPA 4QPCA 3ZWCA 3HKCB 4V3BA 1NSTA 1ECFA 1IN6A 3C7TA 4QARA 1U8YA 3DL0A 1XDDA 2D1RA 2R65A 2GDJA 2A57A 3KYCA 5JPCA 4NYIR 1KDTA 2BHRA 3DE0X 4IILA 4KN6A 4X8HA 2WJ4A 3VHLB 1U7UA 3TAUA 1FIUA 1QRTA 1ECBA 3L8FA 1KDRA 2CJPA 2G6TA 4HWGA 4WI1A 1JHDA 3EXG1 3OPYA 4R8LA 4XVHA 4D3DA 4MW0A 4JB2A 4CIBA 4OU5A 5CXXA 2W11A 3HXMA 1J0AA 2XKAA 1ZGHA 2X0DA 3H6HA 5LWHA 1G8JA 2AMFA 3RSGA 4GPEA 4DEVA 3VMMA 1JN0A 3DBHB 4K9KA 3TOCA 1CRZA 2CLDX 1FS6A 4PG4A 2FPLA 3BFXA 3ZD8A 4B79A 4DMFA 4IDNA 1UEXC 4F12A 1QYVA 1Y9ZA 2X0JA 3STYA 2JHCA 2XCTB 2ORED 2GLUA 3WLHA 4B09A 3TTVA 4PHHA 1YVDA 3OT1B 2JGIA 1VM6A 1T8YA 2TMDA 3F7TA 4FE7A 4K26A 2ZI9A 3K4QA 2HOQA 1WDKA 5LP6C 5A4DA 1OBHA 3AEUB 4KR3A 4M54A 3ACCA 1UF9A 1GCIA 4X3CA 2AQIA 3TL2A 3ZGLA 1JNYA 4L9WA 4XAQA 3C8MA 2FA9A 3ET5A 1D2CA 2ZIWB 2WZCA 2Z3WA 3NP9A 4ES6A 1L7PA 1Z0UA 4HVLA 2CMDA 3IQEA 1HGXA 2XUFA 1JEAA 5FKJA 2ZE7A 4KMRA 1PBTA 5EMKA 5HKKD 2FDCA 2X8WA 1DSSG 4IJKA 2XXAB 3FUXA 3W0LB 2P4HX 1YHNA 1RHQA 3H8VA 4Z5XA 2HU8A 3E6AA 1X7GA 3H84A 3CE6A 1IBKB 3C0KA 1Z6TA 4DA8A 2Q4RA 3NTXA 1IU9A 1PO7A 4P93A 3TB4A 5CJ2A 1H2RS 3IQDB 2ABWA 4U2BA 2QTZA 4ATNA 4E5SA 3WSTA 5HM8A 3PKIA 2KSQA 1Z2PX 4OHBA 4OJNA 1HDYA 1L4HA 1R5BA 2JZCA 2RJNA 4PYQA 5CD1A 1YR2A 1JFRA 2D62A 3A9SA 4IM7A 4EX7A 3ED5A 4Z2AA 1M1ZA 4OXKA 2POQX 5KSWB 1Z5PA 1Y4SA 4AG3A 1S8FA 3MQ4A 3QUAA 1T8SA 3A6EA 1E7SA 4U2EA 5L3QB 4JXZA 4ZVUA 1UMKA 3N3AC 4ER3A 2BVNA 4YMVA 1ZR2A 2B8WA 4B8WA 3PVSA 4IJMA 2EKDA 1K92A 4AP5A 4HWPA 1D8AA 3EJ6A 2V6GA 4OI1A 3VX4A 5I9IA 1C4KA 4DV2B 3ECCA 2NGRA 2Q6TA 1Q95A 1DIGA 1ZONA 4ND4A 4O4HF 4IXNA 4C4YA 2B2CA 4EKGA 3O4FA 4YT4A 4BVHA 2RIPA 3HN7A 4EHDA 1TA9A 4CKEB 4EYKA 1CVLA 4BPRA 1I6MA 2C77A 3NFRA 3WQSB 4YUXA 1E9FA 3HDYA 3D59A 4YIHA 1C3XA 5JZBA 1W44A 1B74A 4IZ6A 3ZLJA 1Z0DA 1II8B 2B5OA 3FHLA 1VCIA 2X3UA 4OQNA 4KDRA 4OGGA 4Q4AA 3CJRA 1QBKC 3MLEA 1XDBA 3N2KA 4OJKA 5FLYA 3LT4A 3MMNA 1MX1A 3R3SA 5FIUA 1QG6A 1GA6A 3P9XA 5JSHA 5ALFA 3PVZA 4RVCA 4R0NA 2WTNA 5DEIA 2RJ3A 4URUR 4DZZA 1HEUA 4GXTA 2QZSA 1T34A 2Q2NA 1QMPA 4NH0A 1Y3BE 2WZQA 4KVZA 1AQYA 1JWBB 3FPHA 3MXTA 1XTJA 2HWXA 3AR9A 2VQ3A 3EXEA 4LJAA 3IPCA 1QPBA 4V0LA 2Y92A 2BHTA 2XD9A 4M22A 5C4GB 3TNDA 2IY7A 1A2KC 2XITA 5K9ZA 2H2IA 3L5OA 3GRZA 3GI1A 4KUEA 2PIDA 1KPGA 4DLLA 2L82A 4RKWA 5LYJB 2ZYDA 3ZD6A 1HFJA 4PQFA 1ETUA 4MB0A 2NX2A 3N28A 1RYFA 1TQ6A 1WHSB 1NXWA 2V7UA 1KJIA 4LNHA 4PX3A 4BMXA 3PXUA 4OOEA 5JPDA 1E62A 3ZE0B 2OB1A 4HN4B 5AW2A 3HCPA 3M4JA 3TDMA 4KO3S 3REGA 1F2UB 2H0QA 3OCYA 3QWAA 4MARA 3CRQA 1G8GA 4D97A 1FYEA 3GQBB 2AYYA 4D4HA 4GOLD 4AX8A 1DTWB 5BW6B 2FHPA 5J2TA 2AN4A 2V8OA 1SCUB 5A71A 3AZPA 1LFAA 3KPYA 5IW8A 4C0XA 3D5EA 1U81A 2ZG6A 1F48A 3MS4A 2Q5CA 3AIOA 2WWGA 4C7MA 3I1FA 3V7NA 3NONA 5AVOA 4BECA 2AA3A 5EXEA 1MF7A 4E13A 4CV0A 1B15A 3C3WA 4GL4A 3E2PA 2ZS8A 2I4MA 1HYGA 5D1HA 3FLBA 2AXEA 4QVKA 4L50A 1IWBB 1MFZA 3DC7A 3ICWA 3ZN2A 5LP6A 1ZUNA 1XZQA 2QAGB 2GZHA 2LDBA 3JTEA 4KGDA 2VTEA 5CH8A 5JJ5A 2WUEA 3R3UA 4CGYA 3IVAA 1E2UA 3NR2A 4DM7A 2Z8YA 3V4OA 1W29A 3GLFE 4ZZ3A 4BLRA 2QUKA 1V71A 3D6JA 1QDUA 1G63A 1GT91 1M2NA 3K53A 4EUSA 1PS9A 2VNJA 1U8FO 1AF7A 3MYRA 4Z0TA 2HNBA 5HQJA 3S28A 3GN1A 1UP6A 3NBFA 1XQXA 3NOQA 5FXMA 1P4AA 4X54A 2XUQA 3FW1A 3K96A 2XJ4A 3CR7A 4ITUA 4O02B 3T12A 5IUJC 4JROA 2NU8B 1P80A 2JI9A 2WJ3A 4DG5A 3O5AA 3Q41A 4NE7A 2CNKA 3HMQA 2PLFA 4WINA 1Z4MA 1P72A 2DLNA 4CUZA 2MSEB 1T5TA 4A5OA 4P3YA 4W5WA 3KDSE 5E9AA 1K27A 4C08A 4P83A 4DQDA 2BMJA 4F7WA 3U4DA 5DB4A 4QU9A 2CFCA 3DV9A 4OAPA 4EHIA 5JE8A 2ERXA 3QVVA 3CGWA 2LUOA 3NATA 2ZRAA 3P20A 4WKCA 3RU7A 1CD5A 1IWOA 2H7CA 3EF0A 4RA6B 4D8UA 5HXAA 4CIYA 5CG1A 4G0MA 3R9KA 2HGZA 4F4JA 2ZXEA 2QWXA 2XCLA 2C57A 4L5CA 3ME5A 4FFBB 4KMOA 1XZLA 1C9DB 2CKMA 2HJ9A 4I50F 1KSHA 4J2HA 1T8TA 4GVPA 2A84A 4PCVA 3V46A 1DOHA 3VDMA 5C51B 5K8CA 4KBYA 5A9SB 3PJEA 3UC9A 1WXIA 4EG1A 2W6MA 3R76A 3WRWA 1NJFA 3PNKA 4QFBA 5THXA 3WRVA 1YAJA 4E33A 5COBA 4C05A 1OWNA 2DPMA 2FFAA 4RVDA 2FEAA 5AM0A 2V9ZA 4LGMA 2QZ4A 1E2BA 1M5RA 4Y2SA 2E7ZA 4BQEA 2I1WA 1S89A 5I9BA 5GINE 1A9QA 1C1DB 1WZIA 1G3RA 1R8YA 2XB4A 4Q48A 1T4CB 2IIQA 3AR4A 3GNLA 3SKXA 3GLFB 5IVPA 5DULA 3MOIA 1A4IA 4MHOA 3NHFA 3Q10A 1QG4A 2Z56A 4A10A 1SIWA 3ASYA 2IVZA 3KYCB 1E3QA 1XSEA 2GERA 1DOZA 4JA2A 4AJPA 1ABFA 1OLSB 3CNNA 3NDIA 4ZC8A 1TIKA 1JT9A 1GFZA 2IYWA 1OCEA 5BWBA 3CZAA 3N2IA 2HDHA 3U0VA 3PDHA 1JYEA 3FDFA 5BSVA 2GK6A 5GVSA 3LQRA 2EFYA 3KHKA 4G5RA 4NG5A 2CNNA 5DZSA 3DNFA 3S99A 4U63A 5B4VA 1FMCA 4EJMA 4XWOA 1PV4A 3ZWXA 2HL6A 4IGIA 4QEDA 2YOGA 3EGXA 4F9FA 1TPZA 2JGDB 2PV7A 4MGHA 2A9QA 2E4VA 4UTPA 1RKXA 3RAFC 4XDZA 1TQ8A 5FPTA 4L4SA 2Q1YA 1RXVA 1Z0JA 4L08A 2ATVA 3UJNA 3CF0A 1C4XA 3IC5A 4Z9YA 1E5VA 2J4DA 2B6HA 2WE8A 4K7JA 3GQVA 5EZ5A 3ZQ4A 5TVKA 4XLTA 1AX9A 1RRVA 3TNFA 1BKSB 3I12A 1YHZA 5E3IA 3OZ7A 1QMGA 1ZCAA 5EVJA 1BU8A 3MBKA 2QMEA 1JV2B 4RBNA 2ON6A 4IJWA 2BBSA 3AXTA 5E6UB 1ICEA 4L0MA 4YYZA 1P5ZB 2OGTA 1RKBA 3EAFA 2FG7C 3G2MA 3KD3A 2RARA 3OFKA 3KQLA 2APJA 3KXDA 1W19A 1W73A 4OGKA 3KLOA 4XVQA 1KS2A 4QXPA 1JDNA 5CNJA 4WFKA 2FMTA 3VV2A 1ST3A 4EZBA 3C5WP 1C1XA 2GJ8A 3AB3A 1YRLA 1V3VA 3G0DA 3E5NA 1ESCA 2E4UA 4J6FA 5CVCA 2NUPA 1BKDR 1B42A 1OUMA 1P62B 2EKPA 4PG6A 3W7VA 3QUBA 4CMIB 3O21A 1QH8A 1A9YA 2GD0A 5EJ5A 3I92A 4IIUA 3JATB 3OHSX 1AKEA 3OBBA 4DR3B 2O8VA 2HR1A 2YHBA 1ZJ6A 1HDOA 2FTKE 2OYCA 5C80A 3RNLA 3PPVA 1GV1A 1MV8A 2BEKA 4QWMA 1UANA 4M88A 1E98A 2Y99A 1CUUA 4NONA 1IG3A 1YB2A 1BFUA 3E9DA 1R3UA 2VRWA 3FA2A 1JSLA 1GTL1 2CJWA 3BIFA 3EJWA 2HJGA 5B1YA 4KDCA 1A82A 5J2UF 1G7CA 3VR3A 2QUZA 2PZBA 4MRSA 3GRVA 5TQ0A 2YZ7A 1NOKA 3SR0A 4FINA 4EA6A 1RRFA 3R9XA 1LCIA 1TMGE 2P77A 4E2ZA 2LGJA 1CG6A 8ABPA 2PX6A 4BZWA 3MEQA 4RKEA 3Q9LA 5COQA 1GGKA 3OPXA 1GU7A 4H1TA 3ONVA 4DCPA 1TZCA 2ZWAA 3OUZA 2QP4A 3VGPA 3EFHA 1R66A 2QZPA 3FDJA 3EPHA 3TBKA 3VOTA 1QIKA 3LT0A 4Q1EA 1SELA 1L5QA 1RI4A 2DLDA 4JLSA 1GGNA 2IVFA 2HBZA 3PP8A 4V1CI 1GAWA 3B1FA 2DF8A 3DP7A 3VSBA 4KLZA 3EXEB 2YYZA 4V02A 4XGNA 5EERA 1R8QA 4QOFA 4OHPA 4J16C 2VT6A 3L7BA 5ALHA 4BNWA 3LC2O 1QRDA 1W0KA 4D9FA 3PPWA 4D6YA 1R2QA 1KO8A 3PFNA 2IZ5A 4B3GA 3IDFA 2V7PA 2Z98A 3LZ6A 5FAXA 5K0EA 2QBYB 1YR9A 1JR6A 5C37A 4XR4A 1KYVA 4G84A 1YB4A 2Q6OA 1WSAA 3F2IA 2CV1A 3PICA 3KE9A 4MI1A 4Q03A 2UZ3A 2G76A 4W7IA 1OSNA 4EABA 3IHLA 1A96A 3P9ZA 3K9BA 2N42A 3VYSB 5CW1A 2UYCA 3ADKA 1NOIA 3KZNA 4LF9B 3QUQA 2BEWB 3F6RA 4UEJA 5J2TB 3ZK8A 1PYOA 4OD0A 1EWVA 1IYZA 3V2UA 3L18A 4AJEA 3LUFA 4ER7A 3PQEA 3L4SO 4FDUA 4RTKA 5C3MA 2R5FA 1HE3A 2Q7XA 1K2WA 3CLRC 1P4SA 4ZCLA 3EF3A 2PLRA 3EY9A 1ZXXA 2VHTA 3NHMA 1OXMA 1G2IA 3W6UA 3A70A 2YCLA 1QZXA 3U37A 4TXNA 2G71A 4MVYA 3INNA 3KBOA 1YDFA 1L9XA 4B8ZA 5F7OA 1DDOA 3ND5A 1R16A 3LT1A 4PYNA 3R8FA 1H1LA 1ZN8A 4XCXA 1N77A 5LP6B 1ZUNB 5FBKA 1M2GA 3NOXA 5LYYA 4B3MB 1UJCA 3IT2A 2Y05A 3L4EA 4O0MA 4U2CA 4BTEA 3BJRA 3AJEA 4ZDKA 3L7DA 3BGVA 5EWLB 2GKGA 2VH5R 2WHPB 3UJHA 3IT3A 1QHYA 3UEOA 1ADFA 3FNRA 4B85A 2DFDA 2XOEA 4X6UA 3IURA 1FFXB 2OG2A 4BU1A 2XB6A 2GHTA 4L8FA 3T1VA 1M0WA 2NO7A 4KV9A 2WF5A 3G5UA 2YV1A 2HY7A 3LFHA 4PY2A 1R6DA 3IL2A 5F3WB 3AF3A 1OTXA 3QY0A 1W4BA 2NU9A 221PA 2G7MC 3AP2A 2QJWA 3GJRA 3UM9A 3G2JA 2WABA 4FB4A 3HWX1 4AS2A 3FFWA 1KQGA 3VDQA 1GPLA 1WMAA 2R1VA 3KR2A 4ZQGA 4UTRA 5ALRA 5FA5A 4K5QA 4OCZA 4GICA 2R60A 5LU8A 4XE5A 1NMEA 4OKSA 1BRMA 2ZJ1A 1DPFA 3M89A 5FT9A 2XYGA 3TECE 3AESA 4PFJA 1JW9B 2WOOA 3DZJA 4AJ2A 4Q9KA 4G0VA 1G0NA 1EZZA 2OBFA 3IQFA 3OCVA 3OLZA 2ZJAA 5HKKA 3DBOB 4AICA 1SUBA 5AVXA 1EP9A 4NXMB 1UT6A 4GIBA 1NFRA 4RADA 3ADBA 1PL8A 1EG7A 1U7DA 1ZOPA 2IW3A 3O26A 4MR9A 5LNK1 1ZJWA 3ANYB 1DEHA 3CN9A 4MV1A 1Z6XA 4NZYA 4F7DA 1IPHA 2XE7A 2E1PA 1R9JA 5LZ7A 5JRJA 2R68A 3OX3A 4P34A 5B3KA 5ADHA 4KH1A 4NAUA 1ZGBA 1FRFS 1T1RA 5L6MB 4MRPA 2Q5QA 3TYXA 1S4MA 5CA1F 1ZNZA 1E9VA 3C3EA 4B43A 1KK3A 3WYFA 2C54A 3OQHA 5DP1A 4RVOA 1EUQA 4UMDA 2JLZA 1FUUA 3AL3A 3GDWA 3OOSA 3CIFA 1H42A 1LK5A 4K05A 2B1GA 4A0QA 2XCIA 3CLVA 3TNJA 4S1VA 5EY5B 2UYGA 3L01A 4K28A 4URHA 4KN8A 5AD1A 3CWQA 1U04A 1VRWA 3K32A 3I4CA 3OURA 3QXXA 3ZHTA 4D44A 4BCDA 1CR1A 3G79A 5JV5A 4FZ5A 3W5BA 1AO0A 3V55A 5EWJA 4EFMA 1OX6A 3WJAA 2DQ4A 2LKDA 3AWIA 3CX8A 1OPRA 1Y8RA 4LCEA 4Y2PA 4MUBA 3ZXXA 2OCBA 5KHLB 1PL0A 3HKEA 2ZT6A 1WB4A 3GLGA 1W87A 1Z13A 3HZZA 1Y6QA 5B2EA 5ECWA 1XELA 2BT4A 2HIHA 3RJMA 3STXA 3U3DA 4GC9A 4HZIA 5H3LA 1ICIA 2YWHA 1AK2A 1J0CA 4GPAA 1L6IA 4ZIRB 3PGA1 3CZPA 3ER6A 1J8FA 4JD5A 5IXYA 3GZ4A 2AX3A 2IHJA 1JI3A 1AUPA 2XZPA 4HF7A 1Z7EA 3FHJA 3K1TA 4E88A 5B2FA 1R9NA 3RKRA 1JR2A 1VLLA 2D7CA 1YKFA 3JD3A 4XVUA 4XLLA 2WF9A 2H00A 3CVXA 2H11A 1XPUA 1E0JA 1MMFB 1P0CA 1TB4A 3RH0A 2F3RA 8ADHA 1CEQA 2X6QA 3GJYA 5FV4A 2ZM6B 1KMMA 2H2HA 5EKXA 2AUNA 4JBXA 3DO6A 4XGIA 1NM5A 3UTCA 1L8QA 5KJCA 1D1SA 1W9HA 5J4KA 3F6EX 2GN1A 3B38A 3AF4A 4A2QA 1C1XB 4BMCA 3DLIA 3VZDA 4ZT2A 1XQ1A 3UXHA 4Z0NA 2CC2A 2ZIVB 4UTZA 2RKOA 5D5HA 1PHPA 2QN9A 2ROQA 3D3JA 5C35A 4KU4A 4NK5A 2J5QA 4F5WA 4MVXA 5TB5A 3DMGA 4EKYA 1U8UA 1YE3A 2AG5A 2OUKA 1WTAA 2HQRA 3GAZA 2Q6KA 4MA5A 2L42A 3DDZX 1HT2E 3G5TA 1WW3A 1EI9A 3B2NA 1XZDA 3FWPA 3OIGA 3STTA 4M1QA 2P4QA 3ANSA 5I8WA 3EZXA 2WHXA 4C78A 2FQYA 1UKEA 4OQXA 3G89A 1JEEA 1P7VA 1MC4A 4I4TA 2BUCA 2V54A 3J7AC 4J4HA 3KJZA 2B98A 4XZ3A 3I3OA 4OHFA 5IXSA 5HBGA 3MWDA 2R66A 3ELUA 3GAMA 4DUZB 2YVQA 1EFVA 3D6FA 4L8YA 5ALTA 4HVAA 5DSTA 1CVRA 4D43A 1YOBA 1EA7A 2PPVA 3ENZA 4G37A 4HDNB 4HS9A 4XQCA 4C88A 3VMFA 4QHYA 3SZ3A 4B6RA 3DKKA 4FIZA 1YZFA 5FBHA 1B73A 1OOEA 2QX9A 3VFDA 1KIMA 1FTYA 1Z6PA 4IQFA 4OHUA 4WXRA 3LNTA 4Y2JA 2G06A 4ZPJA 4ZQCB 1FFEA 1F9AA 5BUSA 3KZ1E 1XXHA 2YHAA 2WQ7A 3DE2X 1Q44A 1ZOLA 5EZSA 4ZI3A 1AQIA 4OGLA 1IJFA 3BXHA 3GP3A 6REQA 3B89A 1WM1A 1YQDA 2KI5A 2PAAA 2W7TA 2HX1A 1N5MA 1PSZA 5T8KA 2FN8A 4MO9A 3OIVA 5JNRA 2YL2A 4NBWA 5ILGA 1O54A 3AERA 2QN7A 4KV7A 5FJIA 2CL6X 5IT4A 5A02A 3WQBA 2IV2X 1BOOA 3IJ5A 5CXSA 4PLHA 5HZMA 4US0R 3UXMA 1E6WA 2CLOB 2HSJA 1V37A 1C7QA 1EFTA 4I4CA 4KO1S 3MMPA 4QPJC 2JCXA 2PWPA 3QW2A 1V8FA 3ZE6A 5FOVA 4IXTA 1G55A 3VPSA 1ISIA 1L4EA 2B92A 3LDGA 3L02A 4RVHA 4XUGB 3T0FA 5GY7A 3RWBA 7AT1A 5DASA 4A0FA 2IU3A 1KNQA 5BR1A 1ZIPA 3AYZB 1PR2A 2ZSAA 3EZ9A 3SS8A 1FB5A 4Z9FA 3CW2A 3NTQA 3R7WA 1UOQA 4URYR 5F1OA 1QH1A 2ESRA 3R6DA 3IQGX 5AHRA 1FSSA 3NALA 4P5DA 4WA7A 3USES 1DQYA 3AF5A 1DTEA 1XRJA 1RAGA 4MRAA 3EXIB 2NO5A 3TTUA 4EPWA 1OPXA 5JEEA 5GZ3A 2H92A 1PTJA 2OYSA 3HSKA 3HY3A 3T54A 5IBCA 1B4DA 1HPLA 1BVHA 3WDSA 3NT4A 5KOHB 2UUAB 3HUFA 1JNXX 4I2NA 1G8FA 3OO1A 1MQSA 4XGQA 4G23A 4W9NC 1HRDA 2IE0A 4RH0A 2CUKA 4RLHA 4TQ9A 1KYIA 3ZHRA 1NVDA 3F1KA 3OM8A 2PWBA 1D4AA 1P3JA 1G5TA 3GOHA 3LPMA 3PTZA 4MGEA 2ZUTA 3F78A 2CMHA 2JFZA 2HSZA 6YASA 3ICEA 4FC7A 3T1TA 2PMBA 1QOZA 4OK6A 4C0BA 5KQLA 3UOWA 3LD9A 3QGMA 5DYWA 3UKDA 1WG8A 2IZZA 4F97A 1WJGA 2C0CA 2JIPA 4DLNA 2ZJYA 4J43A 1MB0A 1T10A 3PDIB 2NU9B 3OLVA 3LUBA 3O8QA 5THKA 3IVRA 4WJZA 1ZVVA 2A9VA 1WRBA 5G0TA 3GJTA 5HKOA 1OWOA 3KSAC 2R1VB 3K6RA 3N0RA 1FQOA 2G8NA 3H16A 4N47A 10MHA 1KJNA 3SIWA 2VF7A 3CVJA 1YK0A 2R8EA 2WLTA 3AESB 2XPCA 3FKJA 1Z12A 4BMSA 1CEYA 1FU7A 5JBQA 3FXAA 3LRTA 1T3HA 4O2BF 3ADOA 3IMEA 2PQ0A 4WASA 1CQPA 4XFDA 1H3NA 1YRQA 5KOIA 4BP3A 1BCSA 4KPEC 1HDGO 2AFIE 1P3DA 4O3FA 1U7ZA 2OCDA 2PSHA 3B9BA 3I2KA 4D9CA 1MIHA 2NQ8A 5E4FA 3G5AA 3O93A 4MR9B 1FDOA 2ODAA 5E38A 3R20A 4B7UA 1RJFA 5I7FA 3PWZA 4KBFA 1JS1X 2Y4OA 4UM8B 2HW8A 2PVSA 1JG1A 4FGUA 1VYTA 1MIOA 3PZRA 3KDAA 5D00A 3WA6A 2ZRNA 1BXKA 4H4CA 1IQUA 3DCIA 3O7MA 3P0JA 4PF1A 4FOOA 3U49A 4DB2A 4HDRA 5D86A 2NSYA 3FTDA 2PA3A 1M6EX 3H17A 2OY0A 2GEFA 2PO5A 3GPLA 1WV0A 1RXEA 2Z5FA 3ORHA 1NW9B 1DCFA 1Z6GA 3H0EA 1D9XA 3LUGA 3GK3A 4XX1A 2QU7A 1W46A 4ISBA 2B4KA 5EKUA 3ZXIA 4RULA 1XYYA 3P5BA 1YKSA 3LQQA 3H3XA 1JEOA 4KEAA 4NU0A 2R8ZA 3VNUA 3KEFA 1GQYA 1KPHA 1MX5A 5EWJB 4CL2A 5HUHA 1HZZC 1Y8RB 5FYDA 4OK3A 1E2FA 1X13A 3ZGYA 4W7SA 3LOQA 4MW1A 3DCNA 3EMVA 5EIWA 2C00A 2VDOB 3KKQA 1AS2A 3UO8B 1CRLA 2GN6A 2FRDA 1WNTA 1IBCA 4MRMA 1XQYA 4E1AA 4CKCB 4I55F 1SWVA 1HEYA 1FUIA 2HF8A 1FSPA 1MT0A 1QVAA 2OHOA 2AFIB 3VC1A 3GFPA 3RIYA 4CPDA 1T0BA 4M53A 1LD3A 1F8GA 4F9EA 1OWPA 3BHJA 5DM1A 4GBMA 4R9NA 5JAQA 4YRFA 4YJ2A 3CONA 3P5SA 4QBGB 1L4GA 2QLJA 4X7PA 1RIFA 1LDNA 2UUPA 2WYVA 3B8EA 2HSGA 2Y27A 1UK9A 1NPYA 4K9QA 1YUNA 2D5LA 1X1AA 3F90A 1UC5B 1WDLA 1GPYA 1V1JA 3QFFA 1OGJA 1PV2A 2RJOA 2V3VA 4XUCA 5AKKA 3CVUA 1PG0A 3CHYA 3C7CB 5C1IA 1C0LA 1WZNA 2HNAA 3VAZA 1LWOA 3L8YA 1X9GA 5ALGA 2EFGA 2OXEA 4IF6A 5AJYA 2BEUB 1P2BA 4CFZA 4BV9A 4E6EA 4RGVA 2Z30A 1MJNA 4TV8F 4JLDA 4TLMB 3D8BA 1ZJ5A 3INGA 1PBNA 4YWHA 5C0OE 5T67A 5E9JA 2AV6A 2ONZA 3AILA 4W9NA 3EZYA 1L5SA 4DA7A 3RC2A 1Q3TA 3AM1A 1JDVA 2ZAGA 3VR0A 4C7OB 3LUDA 3M6UA 4B4VA 4NY1A 4G0WA 2YFHA 1Q15A 2C2GA 3B1XA 3CUTA 4TSRA 1AGYA 2NW6A 2PHZA 5ED4A 4I1IA 3FKSD 1UDBA 1VQ1A 4URWR 2F8SA 3ABOB 5HK8A 5KZMB 5IDWA 1M2HA 3BFVA 3QUTA 3HBAA 4KYTA 1YXMA 2FQQA 2XF2A 1RRPA 3TO5A 2YNMA 3OHPA 4MVJI 3NBZC 4IUDS 4U2GA 3SJ7A 1W4CA 3P9PA 4KFUA 1YZNA 1DU4A 3PNSA 3NDPA 3OLWA 3VOAA 1Z75A 4OXRA 4KUGA 4EX6A 2TSYB 3OQBA 4ZU6X 3LECA 1G8AA 3MWDB 5AFSA 3HL0A 4MGZR 4O8ZA 4BQOA 2O6HA 5LQMA 5TMPA 4MV3A 2JDID 5JVDA 1EFVB 3CVVA 2O06A 1L5YA 1XQ6A 4RLSA 4YRMA 2VG8A 1TFUA 3TIVA 2ZDGA 1RJWA 5DW0A 4I4LA 2PU7A 3TQSA 1CLEA 4R1TA 3SGLA 3UPDA 1EE2A 1CY7A 3LYAA 3ZWVA 5K0SA 2R1TB 4Q4DA 3QVOA 4JSYA 5T4HA 3LXUX 4DYHA 2GZSA 1UK8A 3PBKA 3PQ6A 3GJ0A 3FUUA 1KZ1A 2GA9A 5E1BA 3QKWA 4HLDA 4DA4A 1XDSA 2NP6A 3P1JA 4F71A 4C76A 5KCMA 4B4OA 2IYVA 2ZK7A 2G3YA 2HHCA 3TS1A 4LCJA 1XZIA 5HILA 5FBVB 4DAOA 2EJVA 5AESA 2PNFA 1V9LA 2X4DA 3CLHA 3PS9A 1ZBQA 2NO9A 3KUCA 4FNGA 5HZHA 4UFPA 3JSAA 2YWFA 1DJMA 3CG0A 1T9GS 5CR9A 2PMEA 2SHKA 4FYMA 3RHSA 4DLBA 4QUEA 3S8EA 1O8BA 2AHOA 4HL6A 1KSJA 1U7HA 3EXHC 3KTFA 1OFTA 2GPYA 4BZQA 3T7EA 1QGAA 4TXHA 4JHXA 3R3YA 2AI3A 1MAWA 4FILA 1N34B 2WHEA 3OIDA 3QVGA 1L5LA 2QLTA 1IY8A 4B6FA 4EUNA 2DLCX 1AT1A 2EG9A 1ONPA 2ZP1A 4EZIA 3VKGA 3AKYA 1W2HA 2V7VA 2OHVA 2W83A 3HI6A 5ALDA 1P17A 1T4BA 3DO8A 1PWEA 4BFWA 3I0ZA 2PU5A 1VSUA 2UYYA 4MYRA 3WGTA 4B6OA 3HSYA 3R7WB 4E14A 4NV3A 4K2HA 4FYHA 2OO7A 3GLIE 4JI7B 5FWNA 3KZVA 3K8ZA 2P0YA 5IF3A 1JE0A 5FTWA 1K9VF 3PGMA 4IIBA 5K6AA 3ZX4A 2H63A 1I2AA 3F5SA 1HLGA 5HP4A 2IYFA 4UAVA 3EGWA 5ITZA 3O91A 3K4HA 2HLDA 2JFHA 4UQPA 4CLOA 1ZUHA 3RT1A 1UMBA 1BW9B 2D1SA 1WKBA 1QZUA 5CLQA 1J7JA 3K0CC 1H3FA 3NI2A 3WK9A 1NU6A 2QMHA 2AMYA 3TLJA 3R9XB 1QKIA 3K0KA 5IAAA 1WTCA 1J39A 1NU8A 5L8VA 1DINA 3V4FA 4LWZA 3TL6A 1I7DA 3UMFA 5DNYB 1NVTA 1NUHA 1QRUA 2Q41A 3W3ZB 4F91B 5JRZA 4Z7JA 5JY6A 3ZGVA 2HJVA 1IMOA 4L6IA 4PLYA 4LXHA 5HFAA 3K0HA 1O0SA 4HVCA 3KNZA 1GKIA 4WK0B 3O8QB 4MUFA 3LP8A 3KB8A 3FMPB 1JECA 4HOYA 1W581 1KIFA 2WAAA 3AKZA 3F3SA 1UODA 5JZSA 2FUG6 1SHUX 2WP0A 4FPXA 3WJ2A 3T7JA 2RB5A 3MUOA 5EWMB 4RMHA 1EFPB 1GITA 2EAUA 4XRGA 1QO0D 1RIIA 2BM8A 5C18A 1V35A 3FUWA 2LDXA 3ZIUA 1HETA 3OVMA 3WJ1A 4CMHA 2FZVA 5A4MS 4WZBE 5JD5A 3BE5A 3JYNA 1KI6A 1UL1X 3IGFA 3GLIB 1DS6A 3IHWA 2JHGA 5F5XA 4PYKA 2A0XA 4Q16A 1GUDA 2OBBA 4ZV9A 2HD4A 4ZALA 4L16A 4EYEA 1X87A 2JJ8A 2XRMA 2IP2A 3R3XA 1MIOB 2I54A 4UHEA 3SF8B 4B45A 4BVLA 2C5LA 2GSWA 2YQ4A 3BJMA 4DPKA 1FTNA 1YMQA 1KPIA 2O4UX 4YT2A 3CPHA 1EIZA 3LUHA 4RSRA 4HRXA 4IOMA 2JGKA 3EOAI 3PQ3A 4Z0HO 3T4UA 3ZUGA 2QL7A 3B7WA 1RABA 1UXGA 1WXEA 2PGAA 2YX1A 1TVCA 1H05A 1M2FA 1SCQA 4NECA 1MVLA 4B87A 2DR2A 2R6ZA 4R9UC 3MJSA 3FCSB 1T3TA 3N2GA 2W93A 1I80A 4YRBA 1B8UA 3QBJA 2OLKA 5D7BA 3RU3A 1H9AA 5E4JA 5CBPB 3S2UA 5LC1A 4LF5B 2C2YA 2OP0A 3D1JA 2XX3A 4IG9A 1RLMA 3NDJA 4FDTA 3TPFA 1DC5A 1TEHA 2R3SA 4HCJA 3ROEA 1CUVA 4RD6A 2XMCA 4F8YA 4E12A 4NU8X 3AVWA 2OWEA 4F4CA 1M7HA 4OA8A 4OXQA 1JJAA 2G5TA 2JD2A 3IPRA 2Z04A 4CEIA 4D7AA 2VJLA 1SULA 3CT4A 3DE7X 3PWKA 4LBYA 3N75A 1N3LA 4YUVA 1ZM9A 4YWJA 2CE7A 3U56A 1V8ZA 2O5EA 1J21A 1R8XA 4H7EA 5EIEA 4MRMB 3GDFA 4CMEA 3RPEA 4CM5A 3WX0A 1T5BA 1VIYA 1AH2A 1SPXA 2OEPA 3HRKA 1TYAE 2IQIA 1JQKA 3WDMA 3NHPA 4FYJA 4WZBB 3JRNA 3ZWDA 5LYJF 4IDAA 4LOJA 4ZEWA 4AZ0A 3GUZA 1OXBB 1NATA 1YS7A 1XO1A 2A1TR 2VL7A 3DFMA 4KG7A 3TVTA 4JVMA 4F56A 2Q3FA 1RNLA 1FNMA 2Q4TA 4KAJA 1NVVQ 2C20A 1GRRA 1H0RA 4LJ8A 3FIJA 4PNEA 3NBYC 1RWPA 1VRCA 2Z9BA 1USUA 4O4LB 5FOUA 4J3JA 1T2EA 2FWPA 2O3QA 3JAKB 4Q7LA 1UPAA 1HWYA 2RCNA 3C6MA 4KE7A 2DHQA 4A2WA 1CJBA 5AVRA 4M86A 3FYSA 1I1QB 3ZYZA 1GAJA 2BH9A 3HEMA 4Q19A 3ZXUB 2CSXA 2C4NA 4R2WA 3I6BA 4YTEA 2PRYA 2ACVA 1F3OA 2BHNA 3INYA 1KJYA 4HWTA 3A3OA 2ZLBA 4FMDB 1MAVA 3L0CA 2WTEA 3CX6A 3CW8X 3K0CA 1HMPA 4J8PA 4OFZA 1ZD3A 1X1RA 4QEZA 4OMDA 4OXYA 3RS4A 3WLSA 5EFZA 5IF9A 5K20A 3MAAC 4YP5A 3BHMA 4ZZ2A 2X5OA 1G9SA 4R2JA 3U3RA 2K7ZA 1CQJB 1QV7A 3LW7A 5AVKA 4BC0A 4TYNA 5BSUA 3LBAA 5DM60 2Z2ZA 2JJ1A 3OG9A 3UMCA 1VSBA 3WADA 4ZJPA 3GRRA 4QLOA 4YV1A 4AP6A 4UTXA 3LFUA 2QN2A 5EUQB 5FNZA 2WMYA 4E32A 2ID4A 1DFIA 3NJRA 4NDAA 4MO2A 4UJ5A 3UJPA 4RPKA 1U98A 1PW7A 3PHCA 2JFXA 5ERXA 1QJCA 5MGNA 1NW3A 1SPBS 1VHTA 3C6BA 3GJ8A 5GQSA 1GWNA 3WYBA 1WP4A 2FP4B 4IS3A 4B76A 3F7OA 1B8OA 4Q9NA 3IUPA 1U94A 2ANBA 1DG3A 1TZ2A 1UJ6A 2XIJA 4OU4A 3S2EA 1IL0A 1O9BA 4MIEA 5JVDB 3PQCA 4UOEA 1NF2A 2FJPA 2BZ0A 4FOSA 4ZCPA 3NEJA 4DARA 2XCQA 2DBQA 3K6JA 3HGQA 3JR7A 5HPYB 2F55A 2P5SA 4YT8A 1UPCA 1PJZA 2QP9X 5LB2A 4YK7A 3IP8A 2P5YA 1NQXA 4CIVA 4TUYA 1WV1A 3L7CA 1NYLA 5EJGA 3ZLVA 4ARSA 3RK0A 3EC2A 4OHWA 3RO7A 1Z6AA 4KR2A 1UZNA 3WL6A 3RGWS 4CMJA 5KBYA 4BO6A 2K6GA 3I52A 5HTKA 1R5NA 1W4LA 1YRHA 1N3IA 4DS3A 2K87A 2UVQA 1TAUA 2CVOA 4Z7QB 2CXXA 2NADA 1Y5IA 5K0NA 3K9FC 2AOWA 1QHFA 2H1LA 4WJKB 2CXHA 4MVWA 4JT2A 3ML1A 2IEGA 1V43A 4MEJA 2VYVD 1LBQA 2Y1XA 2J5KA 1RBQA 4R3WA 3IAFA 5CCDA 1YRWA 2FPPA 3V7YA 2GZ2A 2AR9A 1MC1A 3G1WA 4IO0A 4Q9AA 3I4LA 4RE5A 3FJOA 4GC5A 4E0BA 2AMJA 1A7KA 1JXQA 2AOVA 1P39A 2PQ6A 5HE8A 4V0KA 5A2QA 4OHYA 5HG0A 3E2MA 4RYLA 2ZYGA 3I8SA 2GN0A 3NPAA 2GLXA 4HEHA 3KSUA 3OTQA 3QVGB 5KSPA 3Q8MA 1N1EA 2KLHA 4KI0A 3QELA 4BV8A 2ZATA 3I2YX 1BH2A 2HQBA 3QX8A 2A78A 2IP4A 1FS4A 1ENZA 1FDUA 1N6NA 4PZUA 3AZQA 4F5DA 3BAFA 4G1MB 3J81A 3RJ5A 1FFHA 1IQPA 3MT8A 5HKLA 3REQA 3UAGA 1CCWA 1QPZA 2B3TA 4HGOA 3JVDA 4HDAA 3X1KA 3ZDDA 2CMFA 3NORA 3M7IA 4KXVA 1BJKA 2BGWA 1GGEA 4NAVA 4V3CA 2BR5A 4OG2A 3JQBC 4EDFA 4RESA 1LA2A 2C9CA 1YZTA 1G4AE 1QQ7A 2P2NA 3C39A 3LPDA 2FN9A 3PFBA 4A27A 3D7SA 3SBEA 2IHTA 2P67A 5KWIA 9LDBA 2C7PA 3BG5A 4BPBA 3X1XA 4WXPA 4RDXA 5KTTA 2IYUA 2GOYA 1BDBA 3A4NA 1LFDB 5DW3A 4JFRA 4NV1A 3ABZA 4H17A 1URPA 3HCNA 4HAXA 1IULA 5EQFA 3VVMA 1GZ5A 1NRWA 521PA 4DXHA 1Z36A 5LCXA 3G9ZA 2BMFA 3EG5A 5CFLA 1U4NA 1DMRA 2P9GA 1Q3HA 4NE9A 4N0EA 3W5SA 1LZLA 1XA0A 3PC6A 1DWPA 2NO6A 4F4FA 5FUMA 1ZR4A 1E6LA 1W8DA 2PGLA 2J3MA 3CQ9A 4OKIA 3I9KA 4UBNA 1NHWA 1Q0ZA 1MABB 5ALEA 3ZE9A 3EISA 3QIVA 3BB3A 3WV5A 1V39A 2O8CA 2GYUA 2P6NA 4YRJA 3TSWA 3CZQA 1BHQ1 1EVIA 1YA8A 1K5HA 3DE1X 5G02A 2DCUA 3FG9A 4Z1MD 2XEDA 5K2OA 5KYXA 1WLYA 1IC6A 1EA5A 4MQ4A 1QB7A 1QIIA 2CE2X 3PC2A 5FUXA 1Y9EA 1UKBA 2I1LA 5ICGA 2IEDA 5KU7A 3BE6A 5BQFA 3TE7A 2PLAA 2OCPA 2ADFA 1HH4A 2PX5A 1N2IA 1RYBA 3E9NA 4ZGGA 3FCAA 2NAPA 3IIMA 1KI6B 2AZ4A 3KL4A 3THWA 4TYYA 1IN7A 3WGZA 2R6DA 3CNEA 2QX8A 4QT0A 5SY6A 2IY9A 3K0BA 1VG1A 4YAFA 1YZKA 4FNMA 4DUPA 2F9MA 4XVCA 4D3FA 3WNQA 2P9QA 4YCNA 4EVIA 5KYTA 2FLVA 1N5RA 3T15A 4J2OA 1U8AA 4JI2B 2HB6A 3C70A 1CS0B 4FC6A 2DWOA 2FB9A 3SYKA 3SXUA 4D3XA 4TWRA 4MW6A 3THYA 2CLCX 3ANNA 3ELDA 3PXCX 4X1IA 3WSWA 1QR2A 3QTLA 5HCUA 4GKJB 4EMSA 3LKDA 1YS9A 4KQEA 4GF5A 3NGXA 2YFYA 3SLKA 2I4IA 5AXDA 4QO8A 1VL2A 1C9EA 3PU6A 4ME6A 1NXPA 1V47A 3S8YA 3O1HB 5EIFA 4UEWA 3FPCA 3PRHA 1JLLA 5FLEX 2ENUA 4GGMX 4CM1A 4O5OA 3D2CA 1WABA 2H07A 4YMTA 1X2EA 4KQ6A 2YS7A 4H15A 5EZ6B 3KQPA 2XT0A 5JS1A 2OORA 3QWIA 3WZ2A 2NUAA 1E9AA 3NTVA 2J5XA 3B3QA 4PN7A 4JX8A 5BVHA 1VE1A 3TQQA 2A5YB 4KFCA 2P68A 1DBPA 2Q2WA 1QP4A 3K35A 2EZ9A 3ITEA 1T6NA 3L6EA 3X2FA 3IP6A 3VHXA 1L4KA 4UUQA 3EXHB 4KGVA 1NVWQ 2K2QB 2JLAA 4ONEA 3QTTA 4P36A 3R8CA 3W2HA 1X94A 1NI5A 2D13A 5FOSA 2GBCA 4U4AA 4I81A 1I7SB 3MCUA 1O94D 1DVRA 1Y8QA 3OLXA 5HCIA 1KK1A 3VKUA 1U2PA 1OC4A 4PFKA 1J2EA 2Z1NA 4YMIA 1XVTA 1I5OA 4GMKA 3TIXB 4JR1A 3QE0A 5I4KA 5EE5B 1H2EA 2Y0DA 2VPTA 5EN4A 3KR0A 1PUIA 3I1JA 3PWTA 1ODCA 1FXWA 1G5PA 5KDDA 1MEOA 8GPBA 1QUFA 2FY8A 1KFCB 4QOIA 4QPPA 5DHQA 4V2IA 1HG1A 5J2TF 4F96A 4BVKA 1ZIDA 4LXTA 4F85A 3JQBA 4RWEA 3MWFA 4B0PA 4Y8VA 4YRAA 3HP4A 2COKA 2DQYA 2J6BA 4N12A 2NV6A 3GRCA 1LSUA 2O05A 3K2EA 3K20A 2FSSA 3NV7A 4HH1A 2WM3A 3SQNA 1EVKA 1ZISA 2FSVC 1K7SN 5FPKA 1S2DA 1WU8A 2ALJA 4NI5A 1D0IA 2GFQA 3R5SA 2WFAA 4RK4A 2IIVA 4XCQA 1CF2O 1Q83A 1JEQA 1IZ9A 4BV3A 1U9IC 3UK7A 5H9WA 3U4GA 5LP6F 2O20A 3HU3A 1RFGE 3AFNA 3O1JC 1A8UA 5EXTA 4MZDA 5E3HA 1TCAA 1TCCA 3CX3A 2O7NA 4JVNA 5DGHA 2DUNA 3TLMA 2Z6QA 2IF0A 1GG8A 1XZEA 3IE0A 3ND8A 1BEUB 4HQ6A 3LI2A 1GILA 1OASA 2GJ4A 5EJ4A 4LF6B 1YVUA 1QHSA 2QY6A 5D8DA 4C3UA 2OFOA 1L7DA 5TPZA 4BLQA 5TLSA 5J3JA 4J75A 2P2GA 3FZEA 4IV0A 3T5BA 4AUNA 4LDJA 1H9BA 3KZXA 1O6FA 2FX2A 1P1FA 2M6SA 3GDHA 1LDGA 3MT9A 2QD3A 3ZW7A 2ZBVA 3HN2A 2YJZA 4Y9SA 3FCOA 2R25B 4A4DA 1E0AA 1ZC4A 4NDZA 1OC2A 1Z33A 1YB6A 4V24A 3G0BA 1B8NA 1BD3A 1JQEA 2C4MA 4O08A 3B6ZA 1TUIA 2H29A 5CNMA 2GQ0A 1L4YA 2GYWA 4K6FA 3WK4A 5EPUA 3H5TA 3HJCA 5B6JA 1K3FA 4AJJA 3L1VA 3BMQB 1CR2A 4DZRA 1U1IA 1LPNA 3GB9A 2D59A 4ZICA 2RGDA 1PHRA 1JFVA 4NCXA 1Z4LA 5FPSA 1PX2A 5IBQA 2WSYB 5K2MA 5IT9A 1T3SA 4EA8A 2IP1A 3AUAA 3EY4A 3VU8A 4CG0A 2ZRHA 1S2IA 5JW6A 3UKJA 4ABTA 1K5DA 5SY4A 1SXIA 2YV4A 3DDHA 5FI5A 1G7RA 1PN3A 1NF9A 2B1RA 3DVSX 5DM2A 5A03A 2O54A 2FPPB 2HREA 1NXXA 4M83A 1GG5A 2RKWA 4D8YA 5AM2A 1G8MA 2NUBA 4MR8A 2C7GA 4ZJUA 2EZUA 3BK2A 1SIUA 2G4CA 1WCXA 2JARA 3TQCA 4IGKA 1X74A 1XTBA 2BI7A 2CLIB 1V96A 2P91A 2VAMA 3HZRA 3OQMA 1ZHOA 1EWQA 5B3LA 4JI5B 4KIJA 2WUWE 1UEIA 2I67A 3FOAA 3R5XA 4J0GA 4MA4A 3LU1A 4MOWA 4BVFA 3GIDA 4QJ3A 3S5JA 1SQSA 3QELB 4D4GA 1FRNA 5GJVC 1TKRA 3T5CA 3WI7A 5D3QA 1HQDA 2WVHA 3JZFA 2WD9A 2JFPA 4C6SA 1DC4A 4HV4A 5CVUA 2XLBA 1JVBA 3UB3A 5CK5A 3OZBA 1T8RA 1CT9A 4O2RA 3UZUA 5GADl 4B3RB 5DCLA 3KLPX 4LDQA 3REQB 3I09A 4DV6B 1I33A 1UFKA 4ETNA 3MERA 4UBJA 4DMUB 5JXGA 2QDKA 2HMVA 4NZMA 2YN0A 4P7BA 4RK6A 5TEWA 4OGFA 2YIJA 3SQLA 4RD0A 3EDQA 5G4KB 1SQ5A 3QXHA 3OESA 2FZEA 3QF7A 2NTJA 1XTQA 1ZITA 3CF6R 3RASA 4P7FA 1G1AA 1YRAA 2EBWA 1R4AA 1UM9A 1N75A 2CF6A 4GEKA 4II3A 1ESDA 3V32A 5AVVA 2J30A 5TJHA 2ILVA 3MWJA 3Q9UA 4LFCB 3PCXA 3K8QA 1LWNA 1BN6A 3IAM1 2FFHA 1J09A 3Q3VA 3DVQX 1E1RA 3JZIA 3VVLA 3ZU4A 3C3JA 2YY6A 4LWOA 4E22A 5CFNA 1EYZA 2WJWA 1E69A 2JH8A 1N8NA 1QF7A 1L5FA 3Q2IA 3SX4A 2HXYA 3VI4B 2E21A 1HF3A 2J9GA 2O7RA 1KZ6A 1P2TA 1Q5PA 4TLLB 3TG8A 3SJCA 3DL7A 2VRCA 3M3DA 3KT8A 3VNBA 4H1HA 1CQIB 5TGZA 2P7HA 2JA2A 4PYJA 4JELA 4W5OA 2P9CA 2M6KA 2O8CB 2EU8A 4IVPA 1T1IA 4G8CA 2GWHA 3FVQA 3PEWA 4IMJB 2FSVA 3DTVD 1U0RA 3R44A 2PLNA 4GYJA 2J0QA 3D8NA 1A8QA 3D31A 3JQ7B 3G8DA 1HC7A 1QTIA 1O7JA 2YMPA 4LGYA 4IWXA 5L3RA 4P33A 1U9IA 4OHOA 4CLEA 1QZZA 3PGJA 4M0PA 1PZHA 1XQWA 2A9FA 3TGWA 1OA0A 2FR8C 2C4WA 2PYDA 3THWB 2P6PA 4R5HA 3JAWA 2Z6VA 3T6KA 1MOQA 1WW2A 3QENA 1NQTA 3H5IA 4U6NA 4PX2A 3HCEA 5T64A 4YRRA 1TL7C 2E0IA 2H18A 4IUCS 2OG1A 5BQPA 5BYBA 4OHVA 3L04A 4P5EA 3L1KA 1J23A 3L40A 1S7CA 2UZ1A 3C3PA 1ZD9A 3A11A 3CH7A 2FW0A 4YDHB 5L45A 4HNHA 3AU9A 1DBQA 4FHCA 1XQ9A 1XCGB 2Q4EA 5IP5A 1OBFO 4DCMA 3EX7C 2ZBPA 3DFZA 5HF5A 4Z4CA 4X1IB 1T3GA 3OHMA 4D42A 5K0GA 2FF7A 2RHCA 4JOSA 3LRPA 2ENWA 3VH4A 2Q7OE 3T1HB 1X7XA 4EBBA 4AXBA 3NWBA 3E7PA 4MP6A 4B3BA 5IK2D 3AZOA 2ZQYA 3KFXA 4QDKA 4EY3A 1JR3A 2E48A 1K7EB 3QVWA 4LGVA 2E4XA 2I03A 3CO5A 3R41A 4J9VA 2PKXA 2PZFA 5EP3A 1H2XA 2G9RA 1VPVA 3DPIA 1O95C 4F9GA 4QGAA 1EQ2A 2PUTA 3MZ0A 3S55A 3S27A 5KI6A 1UBRS 3JYQA 4UBLA 4J3FA 3U7QA 3KWLA 3UY4A 3P9SA 5C7IO 1L8XA 4Q02A 4B2LA 1RAFA 2AOUB 3D1VA 1RM4A 4EFDA 2EJBA 4FUQA 3DAYA 2NUAB 3TCXB 1E5TA 3TF5A 1DMSA 2HZ7A 2CGEA 1OHHD 3K9NA 4HYEA 3UUWA 4DDVA 1CF4A 2JVJA 3L06A 3RTGA 1DAEA 3MIIA 1FRQA 2H2AA 3MWGA 4JU9A 3SIPA 1E64A 3VHXB 1Z56C 1P75A 4N0DA 1Z0SA 3DBRA 4NKRA 2X7XA 3PITA 4DSAA 1Y6ZA 5BT9A 3V1KA 3OEEA 3ZIAA 1U8ZA 3SVLA 1MORA 2O5VA 3EG9A 4NV0A 4R7TA 5ECDA 4BUZA 4GOJA 3CPSA 4MPTA 1JHUA 1XD2A 2VYVA 3HG7A 3OWOA 4LJ5A 4AULA 2CLHB 5FEMA 4NNPA 3FPAA 3UAVA 2UUBB 3R1IA 1OAAA 3P0FA 3C5VA 1RAAA 3KPUA 3WP1B 2JASA 2O8BB 1T2NA 3HNOA 4N7BA 1YO6A 4JC4A 4BRZA 1R9GA 1E2JA 3D6UA 3UXYA 1QFXA 3AI1A 5AHXA 5LIPA 1M73E 2EWMA 4HBZA 2OPHA 4TPKA 1VBNA 3AX6A 3K7EA 2PS0A 3BB1A 1FUYB 1O94C 1Z4PX 4HMPA 5FL3A 1QDEA 4W9MC 4C2UA 1XZKA 4COOA 4X6LA 3RUAA 2OCKA 1VYUA 1X9IA 3TZLA 1CP3A 3LX4A 4V0MA 4HEA1 1YBFA 1WKVA 2A9KA 1YL7A 2AIRA 2B5WA 2XV1A 5HE9A 3UK2A 1KEZA 3W8FA 4CL8A 3TR6A 2A2ZA 5JXIA 2XNHA 3NHLA 1DE0A 2RHLA 4F11A 1WMSA 1TM5E 1I24A 2FR1A 2WU8A 4D45A 1J9EA 4RHEA 1JHYA 4OYHA 4OAQA 3OECA 4MKZA 3SI7A 4F1WA 5TS3A 2L18A 3HCFA 5JMWA 1IIBA 1VE9A 3BXPA 3ZHUA 5HHTA 1LRJA 1N5LA 3MPOA 4IO1A 4UKDA 1GZDA 4A92A 1WEHA 2H65A 1TK2A 3GVXA 2R2GA 3I0NA 2HFJA 4LZWA 4MW9A 4QVGA 2YICA 2W00A 4XEHA 2CZGA 2G9NA 3PB3A 3QY9A 3ZV5A 3EFEA 4Y6QA 5KYGA 4HQKA 1KDZA 1ISRA 3A28A 4CKZA 3KVYA 2EX1A 1H2ZA 2D3TA 2ATIA 1TUEA 1WDMA 2NVOA 4Q66C 3RRYA 5CHEA 3ZNPA 3ZR4B 1AA6A 3PLAE 1HYEA 3T1QA 3T8YA 4EI9A 4C4XA 4OM7A 4YAIA 4Y0VA 3BCRA 5AW1A 4GVLA 3AI2A 2JVKA 1J70A 2NZ2A 3FSGD 4Y9DA 3S1LA 3ZQKA 2YASA 1OXSC 3ZBQA 3LLUA 4DC0A 1LX7A 1MQ9A 4MLZA 3JQGA 3O9ZA 5JAHA 3G3EA 3C5EA 3WLAA 3SFZA 2RHGB 3PF9A 4LRTB 1ZO8A 2XB9A 4DQUA 2A92A 3QVMA 3IBCA 4Z1MA 1MB3A 1EK6A 4PBTA 5TMBA 2VXYA 2DTEA 3PGLA 5HJEA 1JIKA 3VR2D 5EGNA 4QICA 2L69A 5A3SA 3CRNA 3A6DA 4XIGS 3E9MA 1JSZA 5JD3A 1TQHA 3VO2A 1NVUQ 4G25A 4R2XA 4M87A 2Q1SA 2Y1GA 5CYFA 5JH7A 3S8MA 3IXLA 5GVRA 5I3CA 1OZGA 2Q1WA 4JI4B 1L4UA 1KF0A 3DMFA 3QFHA 4C4PA 4TMVA 4PZ9A 4KQFA 4ROTA 1IN8A 4ZCIA 3I04M 1Q7EA 4N03A 1KQOA 1A9TA 1GGJA 3SMQA 3Q2OA 4OLFA 3C8ZA 1LBIA 1ZY2A 2GBGA 4PR3A 3P2IA 1Q19A 4CF4A 2OMEA 1NMZA 3WAKA 1O95A 1VSVA 2R5NA 5CVTA 5K8JB 2QR2A 1SUIA 1YTLA 3O4JA 5JHGB 5A5FA 2G7ZA 1U9YA 3C6QA 3A31A 2OSVA 3A4LA 2AE2A 1JPUA 4R1OA 1J42A 4E5NA 4XJSA 3P2EA 5G40A 2JFQA 2PH1A 4N7RA 4EO4A 3ILVA 4J1TC 4UVIA 1T3ZA 4IDPA 2NNLD 7YASA 3I34X 5B37A 1ZWLA 1WSWA 5EC8A 2C4UA 2VAWA 2CL5A 2HDOA 1SMKA 3UHOA 5FTKA 3SZGA 1GGHA 2VHZA 2Y93A 1PG2A 3L6OO 4B46A 4JJKA 3BRCA 2CXRA 4BIMA 1GLNA 2D5IA 3NS7A 1BYIA 1LZKA 1UM9B 4P53A 2VEDA 5FUQA 4B71A 4QJ5A 1ZESA 5LLSA 5AW6A 3BICA 4KTVE 4XUEA 5H4GA 2DSTA 3K4PA 4M46A 4KTTE 6LDHA 1I2MA 2LNDA 1V8PA 3G2HA 1ZAYA 1M8GA 2J41A 4RJ2A 1H2BA 5BN4A 1ZD4A 3AIKA 3UT6A 2GEBA 1U2GC 4J94A 1XRSB 4MR7A 1JAZA 2PSSA 4JQSA 4L75A 4OKNA 5TR9A 5CPFA 3CXRA 5E1OA 4EMBA 1ODSA 1FC0A 1U1EA 3UKOA 1M9NA 7ADHA 1EBBA 3F2VA 2H3EA 1S8AA 3OO0A 3K15A 4LOKA 1VOTA 2I7DA 1ZVKA 4KXLA 4Z7OB 3UH0A 1VPWA 1RPAA 1AF4A 3ITKA 3PJGA 4WXHA 2BFFB 2QW0X 1J0EA 3EYAA 3K94A 5DE3A 5DLQC 2A1UA 1RW4A 2VH2A 1EBFA 2XJ9A 2Z2KA 4MMXB 1MLDA 1LPPA 2B8EA 4G1FA 1N3YA 1EFRA 1ILEA 3OQ1A 4TXLA 1Q7CA 4FR5A 3WP0A 5C5CA 3NANA 4QOGA 3RYIA 4Q21A 3KOOA 3AHJA 3GRYA 1P9NA 2W2QA 4YMGA 2RHWA 5KINB 3QMPA 4KX5A 3CINA 1GIAA 3KEQA 5K3SA 3RSHA 5IM4A 2LRHA 1JFLA 1Z47A 3ST7A 2UZ1B 5CX1A 1VE6A 5KYUB 2BHSA 2DCMA 3JTMA 3WGVA 1A50B 1E32A 1OY1A 2ZTMA 1ZC3A 4DLUA 2WWVD 1SRRA 1ZZEA 1A7UA 4JJGA 4EELA 1Y7IA 2J9FB 4FDLA 1VLMA 4FD2A 1GGMA 2DM6A 4HDSA 1B7GO 4X7BA 2IWRA 2EJTA 3GVCA 1X7XB 3GFBA 3EVCA 3QYFA 5TQVA 1NJGA 2HA4A 2O19A 4GWKA 5IULC 4RF2A 1XU9A 4RCVA 2RHHA 1L3BA 2CFTA 4ZDJA 4ZYTA 2QVGA 2VEOA 2Y0PA 4LY9A 2BELA 1S1MA 4NULA 1KO4A 2G82A 4LFAB 1GJRA 3U7QB 4PRZA 1TJ5A 3JQAD 3F7NA 4MWOA 1I4EB 2CFSA 1QF9A 2DHDA 2V7WA 5EI5A 1WLSA 2AWNA 2HU5A 2FXVA 4I8DA 2DWCA 4R71A 2AYXA 2DKNA 3PR2B 5JCJD 3OPVA 4PX9A 1GPWB 3VPHA 4DIBA 4NLLA 1AZSC 1M2VB 5I5GA 2AS0A 2VDNB 4JT4A 2GZAA 1WP9A 1HE8B 1KXZA 1O6GA 1SM4A 2EKBA 3MPUA 3WIBA 3MGGA 2OGWA 2G07A 4K9DA 3DBRB 4WT7A 4YI5A 4QYTA 3CZ5A 2AN9A 4CMAA 5CLJA 3DDNA 3V4VB 3WOHA 1K8YB 1NBMD 3BPSA 4QL3A 4BP9A 1WCIA 1K5GA 3OZWA 1GNTA 3RANA 1CX9B 1NJ8A 2HHLA 3EG9B 4C43A 2JG3A 2GN2A 2QTAA 1G41A 2X23A 2L2QA 2AEEA 3SIRA 2BGKA 4GR5A 4L76A 1F06A 2OLJA 4Y6SA 5AR1A 3TBHA 4CQLA 1T0JB 1K97A 3BWEA 5ALPA 8ATCA 5J23A 5J5AA 2QTGA 2G1KA 2PYZA 4AMYA 1PW5A 3LY7A 4ZZIA 5F77A 3I5XA 4J1TA 4WBNB 2CXTA 4IEFB 3ZYCA 2CNLA 3EGEA 2BEVA 2OM2A 4BFXA 1U8TA 1Z7YA 4I3HA 3DTNA 1FDSA 3PX3A 2ONJA 3CX7A 3NKFA 5AM3A 4M8LA 3DDCA 3OIYA 4DN6A 3ILYA 3VPAA 5AK6A 2C2MA 1BMQA 3QUCA 5KNDA 5BYJA 2P11A 3I83A 1X70A 4F3YA 1WB5A 2HF9A 4J0CA 1Q3KA 1SVUA 4MXDA 1HL7A 3D3QA 1RLJA 1YNSA 2G1UA 4Q7KA 2FPWA 4MCJA 4JEUA 5JG7A 4RJIA 3TZQA 4DLKA 1Z2EA 4EECA 1U2GA 2IXEA 2JCBA 3ZTTA 1BE0A 1GLVA 1RWWA 3EGVA 5D3KA 4ABYA 1IUOA 1OFIA 2ZYVX 3EZ7A 3X1WA 3LVQE 2DECA 2QNRA 2DEUA 1RE0A 1JL3A 3IDSA 4FT4A 1U7TA 3A1WA 4RHXA 4FFPA 4GZMA 4F21A 4MVJD 2Z9CA 1TYCA 3IJPA 3NWJA 2Z5VA 4LWQA 2HQ1A 1BMDA 1RBYA 4AY5A 1LW6E 4OH1A 4R8KA 1Q1EA 1KWKA 2WDPA 3DMPA 3HB0A 4S1WA 3BT7A 4FT2A 1DX6A 3GT0A 2D2IA 4AF6A 3IKJA 1JEDA 1MZVA 1B43A 1H2WA 2P2LA 4MKHA 4EJFA 6ADHA 4GOND 1YQ9A 2PWYA 2ZANA 3DB1A 3ZZNA 4DWOA 1Z5VA 3HXTA 3PC8C 2IKSA 1SKMA 3RQIA 1RMQA 2EBFX 5E8RA 5SZHB 1M6VA 3B9RA 4GECA 3C16C 4KQIA 3V9AA 4NJMA 3GHHA 2XOXA 3FHCB 4Y0AA 2O8DB 3NH9A 2BN4A 1KOJA 1QE0A 2D54A 1FPMA 1T24A 3BH0A 4EMUA 2YDXA 2PT9A 4NE2A 3VKWA 5M7EA 1B0PA 1RI5A 3W77A 1NVGA 3L49A 1KI7A 3VA7A 3TUJC 5JH7B 1FFBA 2WMOB 1JLMA 4M21A 5E6RA 3ZZUA 2DJIA 5WRFA 1MOZA 3WFIA 3LCMA 4OHRA 2ST1A 3NIGB 3D4LA 1F5NA 1P7CA 3CEAA 3KKPA 4PO1A 3WKBA 4MMYB 1D1PA 2BHLA 2ZYWX 4K6CA 4HNAB 2BFCA 2ZJBA 3P97A 1T6BY 2X8AA 4XLZA 5H81A 3TI7A 2V5UA 2OAGA 3GJXC 2GA8A 3GCXA 5J5VA 3RUDA 1C7JA 3C1AA 4YRQA 4RTLA 2DKFA 3UJ9A 3ODPA 2OBXA 4RDHA 3JVIA 2IQ5A 1S3SA 2YDYA 3N6XA 3HEAA 4FGLA 2ANCA 4JL8A 4CM9A 1NX9A 1GL7A 3FGPA 3F74A 3KTDA 2GNPA 4YS6A 3RODA 3WS7A 4BGIA 1SCAA 1XCLA 2FKNA 1B6SA 1DBWA 3OTWA 4HRVA 3WQQA 3WGMA 3BMCA 2V4MA 2MSNA 3RNOA 4IXDA 3QFRA 3M3HA 2FEOA 3OJEA 4HDMA 4AECA 2A1IA 3RFTA 1P61B 4AYXA 5JLAA 4ZVSA 1RZRA 2QTLA 1FZQA 2VK8A 5I5EA 5TNXA 2O07A 3GUVA 1RPJA 1REQB 1FP1D 1QK3A 3LAWA 3RS2A 2IYEA 3BF8A 1PJQA 2XA1A 1ZW6A 5ECGC 1N57A 3L05A 2ZWOA 4ZAVA 3SHOA 1F0KA 3K0FB 3ZU2A 4UHJA 2WUDA 1MPTA 5CCEA 1A8PA 1DARA 4S0ZA 5FCDA 3Q12A 1NJ5A 4FFMA 2E6UX 5H59A 3AW8A 1GNLA 4MUJA 5SYNA 5BN4B 5IUKC 2QTNA 2ZU0C 1JG6A 1ISFA 2ZWVA 4MTLA 4R1SA 4EGFA 3TR0A 3UJCA 3EPJA 4Q1CA 2GJ9A 3ACBA 2Z57A 3M5CA 4YJHA 1OYWA 2F3SA 4O4LF 4IICA 2QAJA 3WA7A 1UC4B 3NIFB 4NCAA 3VDNB 4CEHA 1IEQA 1ARZA 1XKTA 2YZKA 4Q1AA 1H8ED 3HUUA 1Z3IX 3I3SR 3L6DA 4LZPA 1T36B 5C31A 2KM1A 5IKOA 4EQ6A 4Z3OA 1PAUA 1JAIA 1PFVA 3KG2A 1L4BA 2H7YA 3EVBA 4FMDF 4INOA 5AJHA 5EEGA 2W43A 1P19A 4HBGA 2H2GA 4H77A 3TVDA 2VJPA 1S3IA 4TMYA 3H86A 4TV9A 5IC5A 5T57A 5I45A 3TPCA 1COWA 5I4CA 3LPNA 1ULZA 1M0EA 2POCA 1QS0B 1BGVA 4MS1B 5FWDA 1T91A 1RXCA 1TZBA 4AJ4A 4RTQA 4B75A 2ACWA 2YQ5A 4G26A 3RBVA 3TUZC 3BWMA 3HA7A 1ZNYA 2A0UA 1JQBA 3K1AB 2Q1TA 3MT0A 2VPPA 3K8OE 3DV0A 2F00A 2F1KA 3FPFA 4G9GA 5H4HA 3BRSA 5EHQA 1DEKA 1J97A 3PPXA 2AI2A 1FNBA 4Q5IA 4WN3A 5ICCA 2GETA 1M1NA 4YV2A 1X1DA 2XA9A 4X85A 2PM8A 4BFVA 4EI8A 3AJAA 2FMHA 3IERA 4BC1A 2PL1A 3LYHA 5JVDF 5KYWA 2JFYA 5HFJA 1W34A 2O0JA 4DIUA 1YI1A 1NUSA 4TZKA 2OV4A 3TQTA 2AW3A 2O50A 3IEKA 2RI0A 3PEFA 1B8PA 1CZLA 3PC8A 4NOKA 4KREA 2AHRA 2IT1A 2CF5A 3GHYA 1KE2A 2XUZA 3MJHA 1KZYC 5IC4A 4U6SA 3GL9A 1Z9BA 3V48A 5LMNB 1P33A 1WQ4A 1VZ2A 3Q72A 3IOCA 2GBLA 2VUHB 3KZMA 5B4TA 3JQCA 1R0YA 1ZWKA 3FTQA 1YIOA 2C29D 2NV0A 2ZR0A 1AK1A 3N2EA 4PPFA 2CLLB 1ODLA 2P5TB 2ZRBA 3WHLA 3O8NA 2XUKA 4O1HA 4V0SA 1HK7A 4WBXC 4YREA 2VP5A 3OKFA 5TVGA 3T3DA 3RLIA 1P5RA 1N4AA 2RG7A 3FF4A 3M9LA 2R8RA 4RC9A 5ALIA 4I5IA 3OT4A 1CR4A 1OLXA 3O1LA 4CG1A 3UA3A 4FONA 4HKTA 1WCIB 2ZPUA 1H93A 4DJDC 1N78A 3VR2A 1NC3A 3DEJA 2W6JD 4FDMA 3T06B 3USZA 2OM6A 3FZQA 1WXGA 5H9VA 3ZWWA 4X6XA 1QU2A 4V1CB 3BD9A 3RHFA 3FF1A 3K92A 3ET4A 2NZVG 3SHWA 4CQLB 5CMLA 1JKMA 5JDIA 3WSVA 3IEMA 4XIJA 1G8PA 3HXLA 5L7YA 3T5DA 3HBNA 2DH5A 3OLCX 4KWEA 3V8RA 3SQDA 4D92A 1OI7A 1DIHA 1KBOA 3GZNB 3X2SA 3ZPXA 3KTAA 3KQKA 1RC1A 1NDUA 2BEVB 2B1JA 2V3WA 2EYUA 1ISGA 2W90A 4WIAA 5DJ5A 5KTMA 1QGUB 4C21A 4WESB 2P4EA 4RABA 2YUIA 1H4QA 3EZNA 3ZJVA 1ADJA 1Z82A 2OCGA 1N6KA 2OLEA 4RM2A 2WD7B 4XJTA 3VU9A 1KY4A 2PX0A 1YZHA 2RH5A 3I2HA 1ZNWA 4YRKA 3F7MA 3UMRA 4E51A 4CXMA 3DBLA 2AOTA 3ZHVA 1X14A 5GPBA 3UUGA 2OSBA 5JO9A 4YR7A 5BQXA 1JDJA 3BWXA 1Y1PA 1SB9A 1DUSA 3ZVKA 1RHRA 3BGWA 1UZMA 3ZZ0A 4YP0A 5BWCA 3HXQA 1Q0TA 4X65B 2OO5C 5JS6A 3BWDD 3TSAA 1GYRA 1NQUA 1W4ZA 1DAIA 1YDWA 4OM8A 3UMYA 2XWSA 1GZ4A 1A69A 1ZOOA 3I8OA 4JLVA 3WOVA 1XA4A 4ECEA 1WQ1R 3DTTA 4EY7A 1Q1ZA 2V0NA 1YFLA 1E77A 4KQCA 5I7SA 1UMDA 1WCYA 3ZHQA 3EVZA 1KTVA 1ODFA 4NS1A 1H5QA 3D3KA 4U7TB 2QR3A 2VPIA 1QAOA 1IOVA 2REXB 3UTDA 3ZVLA 3BWYA 4ARBA 3ZK7A 2HBYA 4D4KA 4GLJA 1F4VA 1UCFA 1G2QA 1V7QA 2HPHA 2RI6A 3E0QA 3LQ4A 4P7JA 1MFPA 3SJBA 2ZBFA 4YB8A 3A6KA 1VRVA 4G0NA 1QGOA 1OJLA 1YD7A 2OT3B 3KT6A 5F4ZA 4U2FA 2JK1A 3RYFA 3H2IA 3IAS6 3WZLA 5H8WA 2PGDA 3F46A 2X42A 3C6XA 3VPBA 4D0LB 2LE0A 5DTJA 3D3NA 2I22A 1RI1A 1M6VB 4IDHA 4OO3A 1UEJA 3F6BX 1J6UA 1CDOA 3TMKA 4NJMB 4JB3A 4MYHA 1Y0BA 1L0BA 1K8RA 4F86A 2ES4A 2JIMA 4FFNA 5IKEA 2VP0A 4HLUA 4X6YA 2GPSA 3PEEA 4R9VA 3CEMA 5IJAA 3TQRA 4EA9A 3KQWA 1QBGA 2R4QA 5I48A 2JGMA 4HXEB 2ZB3A 5LA6A 4A16A 4WH0A 3NASA 1EFCA 2ZTVA 2QYTA 4I3GA 4C2TA 1SCNE 4EHKA 2BFCB 2DFPA 4KE6A 3R6GA 3ROMA 4B84A 2HV8A 3F98A 1ULTA 1A9XB 1W85A 3N70A 4FCVA 2ZU6A 4W5JA 1HXHA 3FSJX 2BJVA 1KSFX 1FRVA 3VJRA 1Y7HA 3CUEF 2FYTA 3DG9A 4RZXA 1XZPA 4D6XA 4WMLA 5HK9A 2OV3A 3MHPA 4DR6B 3RGGA 2NPOA 2ZT7A 5LUBA 4M7RA 1KO5A 3O47A 2VDVE 1L7VC 2H1RA 4OBEA 1JMVA 3QVSA 3PEYA 3MRVA 4AJ1A 1ZX1A 4ENQA 4PSUA 1XNJA 5EKDA 1JHRA 4ITVA 4EVRA 4FBLA 4N5DA 1QANA 1DQZA 4HDMB 2PCJA 4D4JA 2GESA 5ALYA 4TKZA 1KVRA 4J1QA 3JCZA 1UJ2A 3TEJA 3SE0A 2IOHA 1QF6A 2ZI5A 4M60A 1XRPA 5H3HA 1T9GR 3D5TA 1N2EA 2WSBA 2PNJA 2WHRA 4G67A 3JQAA 3A2LA 1HDXA 2GEDA 3F9IA 1LC0A 2VCHA 4YAWA 3LC1O 2PMWB 3OICA 3KQMA 4P4LA 3D3WB 5LM3A 1RRCA 2NZJA 4QYIA 2FPRA 4L8LA 2FP3A 5BR7A 1SUSA 2X4IA 3DV2A 4FS8A 3V8VA 4G5OA 3FB4A 1S3FA 2D74A 4MVJG 3ZDZB 2AN5A 4JEMA 1P29A 4F2PA 1GPBA 3ZE8A 3QZUA 3VPDA 5FV7A 1NBMA 3LX5A 4AZTA 5JCZA 4CEHB 3C98A 3WB0A 2ZGVA 2JI6A 3ZKAA 3JWIA 4M8NE 1YS1X 3A3NA 1VYVA 1F0NA 1TM2A 1VZ3A 3FVWA 2RHRA 1DIAA 4JUCA 4MNTA 5SY9A 1RYYA 4KJZA 3W6ZA 4EQ6B 2YZGA 3IR6A 3D2BA 2AJLI 4MUKA 2BJWA 4ZAWA 3I6YA 4PYMA 1I1NA 3F3KA 5KYVA 3GAAA 5LZ4A 4JKYA 2WIAA 1Y4AE 1RXYA 4AK9A 1HNZB 4MLCA 4OL0A 4TV9B 4J0EA 3QK7A 1R64A 4PC3A 3V1YA 2IC5A 2OO5A 4K9SA 1G6KA 4TM7A 5A3VA 2IGBA 2R6FA 1NHGA 4IBOA 2XECA 4UAGA 5TMEA 2CNWD 1ENPA 2O7SA 3FAZA 5DI3A 4QUBA 1T4MA 4F1JA 4INPA 4G5XA 3UV3A 1DDIA 1UBGA 3K9GA 3DE5X 4LZLA 2B4YA 3TW4A 5DNVA 3K73O 1PGOA 2CHEA 2PR7A 3BFPA 5EL0A 2C5BA 4RACA 4DJAA 4O4HA 5EJFA 2QQFA 4LXGA 5SYAA 1XLWA 3FVRA 3V33A 4L28A 4RV5A 3RF7A 1OFUX 2IFTA 3HUDA 2WKWA 2XSZA 4KJXA 1NI3A 1FXUA 4B82A 1M1NB 2VBGA 5ILQA 1OT3A 1PFWA 2DPXA 3QF4A 4E2YA 3NEAA 3I72A 1F4PA 1XZGA 1Q11A 3H8JA 3AVUA 1XPJA 1EUZA 5GIOE 2CHUA 1ZINA 3LP5A 4X71A 1KOGA 4U39A 5BRAA 2K5UA 5K7SA 3QWBA 2W2PA 3ZD7A 4NJEA 1I2DA 3O75A 1PI3A 3VR5D 4B3SB 3NM5A 4KQ9A 5DNEA 1U9JA 2OZPA 3IKMB 1J2YA 2VHXA 2OA0A 1XQVA 2HPAA 1X7HA 4N9WA 2GPNA 1XMJA 3O31A 1T43A 4NCIA 3ZJ4A 1TI7A 1USWA 3N2ZB 2CXQA 4PS1A 5BN5A 4Q3LA 4IHKA 5CYGA 1WB9A 5GMOA 5LQCA 1BE6A 4Q4JB 1XWIA 4PTZA 4L5AA 3OCCA 4YMSA 4N54A 4ARZB 1GUZA 3MG9A 1ZMTA 1G6HA 2H7XA 2I66A 2WKQA 1DBVO 3OCUA 2JJ2A 2OV1A 1L7OA 4R81A 4EYSA 2FCAA 3E9RA 3I9LA 2BFEA 3II6X 1JDPA 2SKEA 4QD3A 2W2NA 1DBIA 4QULA 4ZP1A 3RIMA 4DILA 1DLJA 3HJTA 3T9AA 5ESWA 6GPBA 3M3PA 5KNBA 1RHMA 1R6TA 4MPDA 3TKYA 2XQGA 3UW1A 3ZWKA 4NCKA 3W2EA 2Z2YA 3BS4A 4OOFA 1K6JA 2AT1A 5IN5A 4X9XA 4DDWA 4M0DA 4F92B 2BZ1A 3S1SA 1IHXA 4N3AA 5KYWB 1SC6A 1ZM2A 3OFSA 4BRUA 4DMKA 3FOCA 3BREA 4Q01A 1QQ5A 1GZUA 3IQWA 1T9AA 3KJXA 4WOKA 3K09C 5JMTA 1RBMA 3BEOA 4XUDA 1T2AA 2R00C 4YRTA 3WGNA 1QYCA 2OKGA 2QJFA 1PJ3A 3RUIA 1OKKA 2P9ZA 3B6JA 4AIIA 121PA 5CD9A 5DX8A 3DBLB 1ST2A 4EG7A 3TUIC 3FOWA 3W5CA 2XUHA 3L7NA 3AUSA 4UUNA 4PEVA 3RVOA 1SU6A 4TMXA 3D7RA 4IFBA 3B6EA 3LA8A 3NJ8A 5C7YA 5MN5A 4RIFA 4P92A 2PRJA 4MEAA 4XKJA 3WL8A 5C1OA 4NMLA 2BGUA 3ZDQA 2R7NA 4NEHB 4MS3A 1TF7A 1LBSA 1FLDA 4IH1A 1VSTA 2XMSA 3NW9A 1L7MA 1KO7A 3VTZA 3UOGA 5BNZA 3GGOA 1P0MA 4EG0A 3TLYA 1N32B 3LRXA 2J9XB 4LXYA 5K45A 1Q7GA 2ACKA 1QHEA 4JJAA 2UV8A 1UMDB 5JISA 3FMVA 3MILA 1ORRA 1WU7A 1XEWX 1XG5A 3BYZA 3DZGA 3FKQA 1AHHA 1UINA 3ZV4A 5KMGA 1T0PA 2R6CA 3LT5A 3CLSD 3U16A 5CT8A 2ZUSA 1X9HA 2Z8YM 1HO3A 4MQFA 3V97A 3OJLA 4FGSA 1MXHA 2FCRA 1T5DX 4RKFA 2WT4A 3DL4A 2GTPA 3WYDA 1OV4A 1U3UA 2X8JA 1HDIA 2PUHA 1GFSA 2QMZA 3RYFB 3BK1A 1AUXA 1IZ8A 3I6QA 1Y3AA 1RWOA 4HX9A 3GEIA 4LW8A 3OQPA 1XTSA 1H8EA 3AUUA 4YP9A 3VJLA 4ZV4A 1JB9A 2GD2A 4FE4A 1RE1A 4FMBB 3X1ZA 1KY2A 3NNDA 2C0QA 2HADA 4JLUA 1EFHA 3TNYA 4BB9A 2Q4OA 5BSEA 5DI9A 1FE8A 5ALQA 4WEOA 5AK5A 2YRFA 3FZYA 5H3CA 1ESEA 4N9QA 4MIOA 1LB1B 4K40A 1B2LA 1L4NA 4C4ZA 4JT8A 1NMYA 3KSRA 3Q3EA 5KNDH 1ML4A 4RFLA 3N59A 5BOSA 1UKAA 1UDAA 1NBME 3G0HA 4JBWA 3WLPA 4ZOEA 2W8BA 4WOPA 5LA6B 2FZCA 4JI0B 2A0KA 3Q3CA 3W5IA 3JVEA 1VL6A 2H57A 4D74A 1WXHA 3GCDA 5LZ8A 3U7RA 1U63A 4QQNA 3EC1A 4MYSA 3RUFA 7ABPA 5JBNA 2FMKA 1C8LA 4TRMA 4YGYA 5AOCA 3Q98A 4GNRA 2G0TA 3GELA 1SBTA 1ZIOA 3IT0A 5B55A 5HKBA 4Y6GB 3DW3X 2GLTA 2I55A 4IR7A 5H7XA 3ULKA 1OXUA 3BD6A 1GP2A 1VJRA 1WA5A 1KMQA 3CURA 2G83A 1Z8HA 1FFYA 1TQ2A 1XVLA 4JB8A 5A6SA 2HT6A 2ZBQA 3MMZA 2WY2D 4BFSA 1CB7A 1R0LA 4H6XA 3OTGA 4BMYA 2EHDA 4ZEVA 1H6BA 2JD1A 2IPNA 3FLMA 1AHNA 2DBYA 4FEEA 3UJAA 4R0MA 3HNRA 3LUAA 2NU7A 2AC4A 4ZEXA 1OBVA 5EZQA 3GPCA 4KR0A 3BQ9A 5FORA 4FYKA 1Z5ZA 1SBYA 3IX7A 5E6SB 3U1BA 1CNFA 3KHSA 1E2PA 4MDHA 1FUKA 1EDBA 1LSSA 1SKAA 3O2SB 5JU6A 3CKMA 3JQAB 2OZLA 1LTHR 3FTCA 1IB6A 4XCVA 5HGJA 3O4RA 3VNAA 1BRTA 1XTTA 1MKYA 1IHYA 1RMYA 1QIHA 4UUOA 5KQRA 5LN1A 4PQEA 4X60A 1Z0IA 3SQMA 2Z3VA 3K5IA 1H1TA 2ZYIA 1TT5B 3PGVA 1OH6A 2I87A 3V34A 4QYIB 1RWMA 1FX1A 3DKPA 4KX3A 4Q18A 5T3YA