2HBRA

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACAGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hbrA00
4QU0A 4HQRA 3V3KA 1NMSA 1SHLA 3NR2A 4N6NA 3DEJA 2XYPA 2C2ZA 4FXOA 1K88A 1PAUA 3H0EA 4AWBA 1CP3A 1SC1A 3R5JA 2AR9A 5IBRA 4JR0A 5IC6A 3R7NA 5LU8A 4FGUA 2C2MA 4JR1A 4AW9A 4IEFB 5IBCA 3GJTA 4N7MA 4QUJA 4QUIA 5JFTA 2WDPA 1RWKA 2NN3C 4N6OA 2XYGA 3H11A 2H54A 2C2KA 2FP3A 3H1PA 4QUHA 4EHLA 2XZDA 1M72A 1I4EB 3UOAB 2CNKA 1RHQA 2H65A 5LUAA 5I9TA 4PRZA 1RE1A 4QUAA 3H11B 4QU8A 4NOJA 5IAGA 3UO8B 1PYOA 5IAKA 1QDUA 2H5IA 4QU9A 2H5JA 1RWXA 2QLBA 1GQFA 4QUDA 2CJXA 4EHDA 2CNLA 3GJQA 5IAEA 3SIRA 3P4UA 2CJYA 3EDRA 3ITNA 4EHHA 4M9RA 3D6FA 4I1PA 4ZVRA 4JJEA 4HQ0A 1SHJA 5I9BA 5K20A 4ZVPA 5IARA 4QUGA 3IBCA 4ZVOA 3V4OA 1K86A 3E4CA 5IANA 5IC4A 1BMQA 1I4OA 2H4WA 4JJ7A 1RHUA 2QL7A 5H0IA 3DEIA 3H13A 2CDRA 3SIPA 4QU5A 4QUBA 2K7ZA 4FDLA 1RWNA 1NW9B 2QL9A 3D6HA 3OD5A 2HBQA 4I1RA 4ZVUA 5IAJA 1ICEA 3K7EA 5LU9A 1GFWA 4JB8A 5IBPA 1RWMA 4NOKA 3V6LA 1RHMA 2HBRA 3EDQA 4DCOA 2H4YA 3KJNA 5IABA 1SC4A 4N5DA 1IBCA 2QL5A 2J33A 3KJQA 1I51A 3NS7A 4NOMA 1RHRA 3V55A 3P45A 2C1EA 4LSZA 4PRYA 1QX3A 3BIJA 5LUBA 2FQQA 4EHNA 3DEKA 4FEAA 3V4LA 2H48A 3IBFA 2H51A 2J30A 3R7SA 4JQZA 4DCPA 2P2CA 2DKOA 2HBYA 4HVAA 4D3ZA 4QTYA 1QTNA 4EHAA 4QUEA 2QLFA 3R7BA 4NOLA 3R5KA 4EHFA 1NMQA 2CNNA 1SC3A 3QNWA 4PS0A 4JJ8A 1RWPA 1F1JA 4NBKA 3DEHA 3PD1A 4QULA 4N6GA 3KJFA 4AWAA 2QLJA 3GJSA 2CNOA 1RWVA 2HBZA 4EHKA 1CVRA 3RJMA 3S8EA 3PCXA 3S70A 2J32A 2XYHA 4PS1A 1JXQA 1RWOA 2Y1LA 4N7JA 3R6LA 4D3YA 3V6MA 4QTXA 4DCJA 3D6MA 3NKFA 4JQYA 4NBLA 4ZVTA 1F9EA 4IYRA 2Y0BA 4D3XA 4NBNA 1I3OA 3R6GA 4JR2A 3GJRA 5IASA 2FUNB 2XZTA 2C2OA 1RHJA 1NMEA 1RHKA 1RWWA 4EJFA 2J31A 1KMCA 4ZVSA 3PD0A 4ZVQA
chains in the Genus database with same CATH superfamily
4HAOA 3GB9A 1T4GA 3QUSA 1KI8A 1TKAA 3HKDB 3PXDA 3Q0TA 3UG7A 3UIEA 4K7JA 4L5BA 1JKJA 1Y7IA 4EJ2A 5D3MA 1I0ZA 1V1MA 2HU7A 3AUYA 3K9CA 1BSVA 3JD0A 4DQUA 4PGFA 2VAMA 2VHQA 4B2YA 3R3YA 3K9FC 1DC7A 5KC9A 1OFVA 2P2DA 1Q3KA 3OQJA 1QHGA 1GAXA 2IHYA 4JP8A 2FEWB 1LW6E 5D7BA 5E7QA 5TE9A 3VPCA 4B31A 4Q6WA 4AX4A 2PA3A 2I4TA 3QLTA 4FBGA 5BMVF 2KI5A 3JQGB 4NPHA 3AHIA 3DVAA 1T6ZA 3CRQA 3JWGA 1AZTA 4ZT5A 13PKA 1D2AA 2VF4X 1DL5A 1U8FO 4PVDA 4IDOA 4QUAA 3STWA 1P44A 4JKIA 4EKNB 2IV2X 5FULA 3NALA 1OY1A 1XJWA 3O4GA 3DCJA 4G37A 5TMEA 4C7BA 3MG9A 4AROA 4QGGA 5JYBA 1QBGA 1ZNZA 2A0XA 1U8UA 3OA0A 2LWIA 3ETGA 5AK3A 1QIMA 2H63A 4MKFA 3LLMA 1NBWB 1VBFA 4C04A 3IB6A 1ADYA 1R0LA 2YFHA 2Z30A 3OCXA 2W2VA 2AYXA 4ECEA 1JKJB 5B30A 4LF5B 1OFUA 5D3MB 2EKQA 2B4RO 2G0AA 4WEQA 1BHSA 1VYTA 4EAQA 2QMUA 1RLMA 621PA 4EGQA 3ADDA 1QAQA 3IR5A 3SIPA 3S68A 3V2IA 1MQAA 3ETDA 2VP4A 4BQPA 1ORVA 4DVJA 4XR4A 4BU0A 2I2FA 3JXEA 5GZ1A 2F62A 3QFFA 4XR9A 4Z2AA 1W0KD 5J4LA 4LDAA 2GASA 2NTEA 3A58B 2MYPA 3DVAB 1PKXA 4Q1AA 2YYZA 2WFZA 1ZMBA 4DMGA 3L0SA 3HU1A 1IY2A 2NYUA 2WJZB 4MYHA 3WLTA 1JBKA 2JAOA 2J0SA 1W93A 1X3LA 4Q24A 3UPTA 3NHYA 1I5RA 2DHEA 5HQJA 5K0EA 4DA6A 4ARIA 1E2QA 3KV3O 1M1UA 1XRMA 5KVAA 2FPIA 2QYTA 4LBWA 3M6WA 2HM7A 4LJLA 2IS6A 2AFVA 3VU9B 5ICSA 1AKVA 1XB2A 4MWGA 1A72A 2C5SA 4UNPA 1QFMA 1PUJA 1O9BA 3A1DA 2HDHA 1FUKA 1RJ9A 4GYKA 4MLCA 4NP6A 4E3WA 5BY2A 1UP7A 5LQRA 1MTOA 3FTNA 1S8OA 4JOSA 1WABA 4WEOA 4NK5A 1TK3A 4IKPA 2ZUUA 3NVMB 5AM5A 3T5TA 4GMXA 4D6PA 1D03A 3GFPA 5CA0F 5L7WA 4ND8B 1I6KA 1Z6AA 3IEPA 4P8RA 3MUOA 1NRIA 1UH5A 1HDIA 3AI3A 4JYZA 2J5QA 4MCAA 3ZS8A 1I7DA 3E9CA 3EOAI 4KRYA 4QYSA 1IB6A 3VZBA 1TM1E 1MLDA 1UINA 3DB1A 2X5XA 2L19A 1Q95A 3G85A 3PRHA 2E0IA 2YFYA 4LNUA 4Q3KA 4QU0A 5C37A 1ACMA 1B76A 1H0SA 3ILSA 4TXHA 1NY5A 4XX0A 4CI0B 4IVQA 1LVUA 3RFTA 5CIYA 5H7XA 2ZBDA 1QHHA 5DU2A 4M8SA 2G76A 3LKDA 1G5QA 2DLDA 2FPIB 3B6IA 3DQZA 4EVSA 3FPKA 3IT0A 3QLVA 3VNQA 3BM5A 4N7RA 5KTTA 2H52A 2QD3A 4B3GA 4HNQA 5E2IA 3IUJA 1L5ZA 4PSUA 2CXOA 2WHYA 4DSUA 4BFZA 3OJWA 2IV7A 2WSSD 5B6PA 1FQOA 2CGEA 4JYCA 4XSGA 4MCJA 2YIVX 3OOSA 2I99A 1Z8FA 4ID3A 3OX3A 3UXMA 4F4HA 4MQUA 4YB8A 3JWHA 5AW0A 3PNMA 4AZWA 4EFMA 5BQ3A 2VTDA 1CW2B 4W7IA 2A92A 1ZRMA 1P91A 1W0JD 3HUEA 2Q4EA 1NL3A 1M2GA 5J4VA 3V1LA 2HEGA 4C0HA 2RGNA 4E13A 5KTOA 3U4MA 3EXG1 1NW5A 2OFPA 4DJFC 4ZAGA 2XMDA 2BJWA 3NYRA 4TTPA 3E1GA 3AH8A 5BN3A 1E2NA 1K27A 1IPHA 3D02A 3L7JA 1WV1A 2Y6VA 4MS1B 4LNUB 4OFZA 1T29A 3PPYA 4EHHA 1D6MA 1ZRHA 2A9RA 4BFCA 3H1FA 2VA9A 3G68A 5TSDA 5F2NA 1SHJA 3TL6A 1E2BA 3NDPA 2CDAA 4JYMA 4XX0B 2BY4A 4XYLA 3F49S 1GV0A 1QHHB 3GNTA 1K86A 5IANA 1EBBA 2FWAA 2IK8A 3PICA 2WA1A 2QW1A 1YZQA 2BFFA 2YMLA 3KOZA 4PCUA 2IS4A 1W73A 3AONB 2O7QA 3TCXB 4MQ5A 1HY3A 2K87A 3BSYA 2D2FA 1NPYA 1JXMA 2OOSA 3KXLA 4MWTA 1G19A 1HTBA 2O1XA 3AIIA 1MN6A 1FUYB 2HUNA 4H17A 4XOUA 3LT2A 5BSFA 3DAPA 2VKTA 2HQBA 4CJXA 1COWD 1CUXA 2CZCA 2CXUA 1NBME 3FETA 3G2QA 5HCIA 1W76A 2QNRA 2YR0A 4DV2B 3GCZA 2W93A 3X1WA 1ZG3A 3UAXA 4P31A 1IE3A 3JVEA 3ZCQA 4E4RA 1TADA 1UFVA 4LFBB 4TTSA 1NFFA 2V65A 5D01A 1NJGA 1PX2A 1M3SA 2X13A 5JD5A 4YNBA 2Q1UA 3WNBA 3BL6A 1B3RA 4E6PA 1IATA 2PWPA 2X4GA 1PT7A 1RW4A 4MWSA 2G3YA 1NQ5A 2WMNB 2SECE 4LHEA 1BWPA 2ZJ8A 2A86A 2DH6A 5HF5A 4BJ6A 2ZROA 1KHTA 1S3FA 4EPWA 5GV8A 4DWOA 3HLYA 5HXAA 2CD9A 3L6UA 4D3ZA 1M0TA 2Y3IA 4IGIA 5AJUA 1Y3FE 5C4GB 1Q0PA 4ZO8A 1EUQA 3H75A 4FT2A 2BFFB 5FWDA 5H83A 1QU3A 1YVRA 1U1EA 1UADA 4KAAA 5DCUA 5JXIA 3LT4A 5FBZA 3T61A 4XUCA 1RKQA 2H3EA 4CR6A 1N9ZA 1R6BX 1XZQA 2JFHA 2VEOA 1J0BA 4MQFA 1E3TA 1UBFA 4RS3A 2C4MA 2OL4A 4N0PA 3EY4A 4Z6KA 3PUWA 2XVMA 4Q66C 4ZC8A 2PJUA 3GXBA 1RXUA 1Z2NX 5E3JA 4XTCS 2OM6A 4L74A 4X92A 4LXIA 2B82A 1DKMA 2VSFA 4MW6A 3CZCA 5FFNA 1WOMA 2JI7A 3JU3A 1NJSA 3IQXA 1DMRA 1N2CE 2QTNA 3D4LA 3P1JA 2IP4A 3V46A 1VFPA 1ESDA 2ODQA 2PX0A 4M54A 4K2AA 4TWJA 2R84A 1G8FA 3ZE6A 5F2EA 4TZ6A 3PHGA 5FR1A 3ADCA 3IP1A 4A0FA 2VUUA 1RVV1 7AT1A 4OM8A 3D6VA 3HYRA 3Q87B 5G1OA 3OQNA 2ADMA 2UKDA 2F3UA 3N8KA 3ZY5A 2I1VB 4KMSA 1ZM7A 2JZNA 4KN9S 4R8SA 2C54A 3F97A 4Q9HA 5ELMA 5IVPA 2ZR8A 1KZ1A 3QU4A 4OQPA 3AIKA 2NSDA 4Q7LA 2P78A 2FUG1 1C3JA 3KBBA 3U3RA 2H2FA 1L5RA 3SX4A 2Q6IA 3NUQA 2W6ID 3CX4A 1R6XA 2Z98A 3HMKA 4MQFB 3O1HB 3KAQA 1E5VA 3HWX1 2Q5HA 5G02A 5J43A 2R85A 3FHCB 3B7GA 4NFHA 1VIDA 1WU8A 1P33A 5DMHA 1AV6A 3DE3X 2RAFA 4KFSA 3VAYA 4JDPA 3PC3A 2KLHA 4Q4HA 4XDYA 3W2IA 4PHHA 3JPYA 1QK5A 2CD7A 3ANYB 2PT6A 3BEOA 4IOMA 4MA0A 5ALUA 3IL2A 1ORRA 1UANA 2FI1A 1NW4A 1QV9A 2AFHE 2QV7A 3E5RA 3OJXA 4LSWA 4MGEA 4TKMA 4YC7A 3UOWA 1HYGA 3W3AD 4R0NA 4BLTA 3IODA 3ELBA 1IAVA 1TMOA 2HZ7A 1O03A 1TO6A 4KQCA 2ZRBA 1GGJA 2B8JA 3GT7A 4DGSA 4L15A 3A2KA 4ILEA 3FZEA 1N8TA 1NYTA 3Q15C 3T4EA 3JRNA 3F5DA 2NSJA 1SKAA 1NAIA 1YZGA 4I5FA 4WGGA 4BNDA 5C9ZA 5IHXA 3QA3E 1MAVA 3COJA 3DBRA 1NURA 4LYJA 5DX1A 2J3HA 2GN4A 1NQTA 3QEOA 5KTPA 4X66B 1FY2A 4NS4A 1SOMA 1CS4C 1U2GA 2B8WA 2OFOA 4F8YA 5AVQA 1USIA 4MVYA 4CIVA 1CLUA 3WOHA 2GD0A 4WK2B 2WYVA 4JN6B 1K92A 3Q40A 1ENYA 5AK0A 1T5LA 1P19A 2IYWA 1QX3A 3IAM6 1OX4A 2AWNA 2GZHA 4Q4HB 2PL1A 4QICA 1CIJA 2OO5A 1OILA 1XBTA 4MTCA 3IBFA 3WYBA 4JUAA 3CFYA 2OY0A 1YJCA 3IYLW 4I4TF 4GT1A 3WV4A 4KRXA 5LD2C 2ST1A 4IFBA 4MRPA 4B9EA 5F2KA 1Q12A 4M1YA 3STTA 5C5EA 3WBKA 4C0LA 3IT1A 3A2NA 1T5TA 2QG6A 5HFAA 1ZGZA 3WSTA 4IMPA 1P7WA 1JWAB 5D87A 5BV2P 4GMGA 4RZ2A 3X2EA 1A8QA 1D1QA 2XMGA 2XMRA 5ALKA 3OOEA 1IMOA 2G82A 5KJ1A 4V02A 1JPVA 4QNNA 2QD5A 3P52A 2WZCA 3DBRB 1KMIY 1XCJA 2G6TA 1C9NA 4OXRA 1B8UA 2B1QA 1WLYA 4TRRA 4PXYA 3KVNA 3TMYA 1K6MA 1QQ5A 1UXHA 2C3MA 2ZRMA 1ZD4A 4C3ZA 2QQ0A 3SHVA 2G07A 2WKRA 1KMCA 4FBMA 4A6PA 1IONA 4G5FA 2NTYC 5LWHA 2LZ0A 2DQ4A 1OX4B 2AI1A 3DL4A 4KO8A 3OKFA 1O97C 3L05A 4P58A 1PBTA 3PEEA 4WCDA 3KVOA 4UUNA 4GMHA 4EG5A 2DB3A 4EBBA 1DKOA 3FBWA 1V5FA 3MCUA 5LU8A 3KQTA 1YZUA 1G8SA 5CEFA 5IJAA 3DA8A 4DARA 1XLWA 4Z4IA 3H1GA 3I39X 1S8FA 2C0QA 4G23A 1K8RA 2VHEA 1H0RA 1VJTA 5A9TA 4FGWA 4PG7A 3GQBB 1ZGGA 2PUCA 1JP7A 1GKYA 1JDBC 3UJPA 3KOXA 5BN5A 4UHKA 1RT9A 3VDMA 3M2PA 5CYGA 3H4IA 1SBIA 3JATA 4Q4AA 4W82A 5JR3A 3IJEB 2H9AA 3RI3A 1F12A 3A1UA 4NYIQ 2B7CA 2J3KA 3OZIA 3IA2A 1NN1A 4WDQA 5EAIA 4L22A 5TR9A 1ZCAA 4ZYYA 4DR3B 1ONBA 2C83A 1J0AA 1T2NA 2WUDA 2OE2A 4J1QA 1BMDA 2HK7A 3PT5A 5KDDA 5BRAA 1A8PA 2CV1A 3K6RA 1XO1A 4OYLA 4O2BF 4QRDA 4US0R 2WIDA 5E4FA 1QQAA 1GVNB 4JIGA 3NBQA 1BE1A 4RYDA 1LWNA 5CHEA 3M2TA 2QAIA 2L42A 3H13A 2R62A 3BK2A 3R0ZA 2IKSA 2P2NA 4GC9A 2Y1KA 3SDSA 1BE8A 2BTOA 2OLKA 3ZWPA 1P0FA 3NATA 4TX1A 2FEXA 2H5EA 2UZ0A 1TX4B 2VS1A 2Z8YA 3PLRA 3OIYA 4MR7A 2VCHA 4NL4H 4UDNA 3R5SA 4D92A 5M34A 3DQQA 1SKYB 2FZ4A 4TS1A 3O8NA 1PNTA 3PKZA 3FZGA 5A0VA 1KK1A 4LC0A 5BN5B 4JHLA 3RGGA 3FRJA 4UW9A 1T5HX 1DFGA 3JATB 5SZIA 3RIYA 4NG5A 4XA8A 2Z0MA 2RH8A 1T5DX 2IHZA 4G67A 4X3PA 2XUDA 3TDMA 3WAKA 3X44A 4IQGA 4NMLA 4CTMA 4WOKA 4CLDA 1TAQA 4V0KA 4BZZA 1G8MA 1O89A 4IDQA 3GDFA 2HWUA 1II0A 3C97A 4ZGGA 1Q1EA 2WJHA 5IYZB 4XGIA 1KYQA 1DEOA 2JFPA 5FV7A 3FHLA 3O21A 1E5TA 1T9CA 4LFCB 3DWEX 4B3RB 2BEVA 2EJWA 4HWTA 4GI1A 2H57A 1I3MA 3TZEA 1FSGA 4GQAA 5DLDA 2A0UA 3PI6A 2Q5JA 5L3SA 2W83A 1Q0UA 1OH5A 2R8YA 1RJFA 2AZ4A 1IH8A 3L43A 5DULA 4RTQA 4CM8A 2YVQA 4Q1EA 4M0CA 1NUUA 4U4AA 3KR9A 4MR7B 3A25A 3MWGA 2CF5A 5CDFE 4J7AA 4I55F 5K8UA 1BS2A 3JQBC 1G6KA 4H60A 4L9SA 2ZUWA 1U1IA 4TWZA 5AP9A 5A2GA 1ZL0A 1ZK0A 3L6DA 1WDWB 5L53A 16PKA 1JU3A 4ND3A 3C1AA 5GOTA 1JHOA 4A3SA 5IFKA 3P2MA 4M87A 1FLVA 4TQAA 1Y5IA 1C7QA 3F4BA 4JFAA 5LQAA 4N6NA 3C24A 3RFCA 2QRKA 2JLWA 2HSZA 1YKFA 4RPGA 2FPPA 4P4LA 1XLTC 1MIHA 3O74A 5K6TA 3B9BA 1FJXA 4PV7A 3SYTA 3I9KA 2IQIA 2BEVB 2W6ZA 1KJQA 4GI2A 3I72A 2B4YA 4RM2A 1GUYA 1EAMA 1YGPA 2AK2A 1MO6A 2P1DA 3HO1A 4HNAA 4XJVA 2WFAA 5L3SB 2C7PA 4GG1A 3EMVA 3TPCA 4YRGA 1JLLB 2I2XB 1WULS 3UMVA 4CM8B 3RJ9A 3GJ4A 3NEPX 3VO9A 3BZWA 3ELDA 1U2EA 3DPIA 1EDZA 1Q14A 1SB9A 3QOFA 4HQLA 5AI5A 4D9JA 1L5LA 4D4GA 2G28A 1BE6A 2D62A 2MMCA 4RH0A 5CW1A 5KU1A 1MD9A 2C8LA 3AVOA 3LI2A 5IAKA 5I7WA 2CW5A 4P7JA 4EMUA 2P5UA 4D0SA 1K7EB 1G8GA 3AM1A 1RI4A 2YYSA 3EBLA 4UBNA 1JVSA 1NQUA 1PGPA 4YQYA 2WJGA 1PEAA 4M9RA 5A71A 4GXQA 4P4SA 2PGXA 1QRAA 4MHOA 3RS0A 4B7ZA 2CJFA 5E3IA 1EXDA 1HDEA 2UZ1A 2FW8A 2FWNA 4LE0A 4AO7A 1CBUA 3O8CA 2DFDA 1W47A 2Q3BA 4YAEA 3W9YA 1JL3A 4C08A 1P2UA 5ADWA 4BO5A 1YWGO 1UZMA 1FFHA 3D8TA 4O8ZA 4FD2A 2XA1A 4YCNA 2XOXA 3GJ0A 3QNMA 1NQWA 1FMLA 2EAUA 2PYDA 1EFRA 1PFVA 2ERYA 2XGOA 4CN9A 2OXRA 2GN9A 2A14A 4HNAB 3SPXA 1HDZA 1KSJA 4NDAA 4O25A 4BU1A 2KMLA 1RQ2A 4X8OA 4DS3A 3OPVA 5F51A 1ISSA 4PBRA 2HBRA 4JBWA 4M98A 4B40A 3NTOA 3AZQA 1ZCFA 2HPVA 5TXGA 3ZU4A 5JJ5A 3ZWMA 1EGMB 1VJDA 5HIMA 3MHTA 1CQIB 2V74B 4AN0A 1ORDA 3A3PA 3STXA 3WMWA 4M1SA 1XMOB 1JB9A 1YQTA 2PWYA 1UDWA 1M8PA 4KQWA 4YMTA 4C2TA 1XMQB 1OPXA 3GEDA 4MMYB 5B7PA 3LY7A 3TMKA 4C1NA 3TSCA 5KYWA 1SXIA 4S24A 5DTMA 4ATNA 1MC5A 1H0KA 1XQ1A 4ZVNA 4EF4A 1SK9A 3QMPA 1QQ6A 2BFMA 3PNYA 4P4SB 3HDJA 4EGSA 4RTJA 3UT5A 5AVWA 1NPDA 1I94B 2UZ1B 1EKXA 2HTEA 3L7MA 4MGYR 3FUVA 5KNCH 2B2XA 4HLUA 3QFTA 3HRKA 4XYGA 4G4SP 3PFBA 4AWAA 2QUJA 1N2JA 1XMVA 4RMJA 1P7PA 5K4HA 2VAXA 4ZI3A 1JFSA 4P83A 2IY8A 3CF0A 4XWAA 3EIWA 1WPXA 2IYOA 3Q7IA 1XDWA 1XYGA 2JBWA 3HWRA 3X1KA 5ALVA 1PUXA 1W5AA 4JZYA 1P8JA 1OA0A 1GUDA 3O03A 2O2YA 2ONCA 2PMWB 2PSEA 4MP8A 5EN4A 5LC1A 4MS1A 2HLHA 3TTXA 2W0MA 3IDFA 2C4KA 4KKVA 4TQ9A 1POXA 1C1DA 1P29A 1RWWA 1UBTS 2MSCB 3QUTA 1WOYA 2N42A 3QV2A 5ES3A 4GQIA 3K2IA 4LY0A 1IY0A 2QF7A 3IQHX 5KWJA 5A4AA 3IAS1 5HF9A 5KYWB 2QAGC 1F60A 3GD7A 3BUSA 2QTVB 1ISGA 1K88A 2IEAA 3EQZA 1ZN2A 3LBNA 1MFZA 3E9YA 3NYQA 3GBVA 1TZCA 4MYSA 3F6PA 2JGNA 4GO1A 1SOAA 2DWCA 3UT5B 3ZNNA 3K0KA 1C0PA 1V5IA 2QY6A 3OEEA 4QUJA 4RYLA 4WUTA 4DCMA 2AC4A 1R2QA 3MBOA 1W8IA 2AQKA 2AZMA 1L7XA 3LLVA 3T7IA 1Q1QA 2GZDA 3ASYA 1BXGA 4UNQA 5JLAA 4UVIA 1BKYA 4D8XA 2DRIA 4BB5A 4S1VA 3DUWA 2GFQA 1BCRA 1RYHA 2D59A 3E22A 4IJMA 4PZ9A 3FWNA 1WVGA 3EWNA 2IF2A 1HOXA 2E1PA 3HXMA 1K9SA 1UDCA 4KCGA 4MGKR 3TRIA 3CN7A 5T6MA 5REQA 3WL8A 1RYZA 1L4YA 2GD2A 3ODGA 3UF0A 3L6BA 4RF4A 3SC4A 4FJ2A 1BVHA 2QRVB 1LDEA 1QH0A 2X4DA 3VNBA 1KMHA 4A0QA 4C1BA 2EKLA 4UOEA 3RFUA 1K5PA 3B3JA 1C1DB 1C8VB 3TB4A 2GRUA 3L46A 2ZTHA 4X7RA 2ORVA 5K8IA 4NBSA 3URKA 1RZRA 4RY8A 2O8NA 1UDAA 2PX2A 1L4FA 4LV5B 5KYUB 2QENA 2JGRA 2CCJA 4G5YA 4H4EA 3AY6A 3QQPA 4KBYA 2R60A 2JHGA 3W5JA 3CEAA 3DVQX 1RVDA 1WMSA 4GBGA 4DG8A 3RW9A 3Q41A 3QVKA 4BNXA 3NB0A 1E66A 4MW7A 4FB4A 1L5YA 1A77A 1G9SA 3WL5A 1ZDMA 1TCBA 3N2LA 1BCRB 7MDHA 2IP1A 3IERA 1VLHA 3I34X 4DXDA 4DR6B 3AUAA 1P3DA 4BFTA 2QTZA 2GD1O 3PSHA 5REQB 1XPUA 1JHYA 4PPQA 3EFOB 1PQWA 4OUDA 3CZ4A 4GICA 2YZMA 2BJHA 5E95A 4YAKA 1X80A 3RIGA 2PX8A 3HCNA 4A1OA 1KMHB 2AZXA 1JEOA 4GOMD 3SG0A 3R3SA 1MP0A 3O38A 3PNBA 3KKEA 2BEJA 4TTTS 4ENUA 1SNYA 2V58A 1X6VA 1P5HA 3E35A 5FEMA 3UBMA 4OXKA 4JAVC 3N8IA 4B43A 2ZB3A 5HJ2A 4YRAA 2HO4A 3CB2A 1W9HA 2NVBA 2XUOA 1AT1A 2Z83A 3K53A 3LHFA 2YJZA 4HGZA 4KGDA 4L28A 3DO5A 1BMFD 5IMBA 4BQNA 5AUPB 2WIKA 4J6EA 2RGDA 4PLZA 2BFDA 4RMGA 4GQBA 1PJQA 1YQ9A 4BP8A 1ZXLA 2WHPA 2KBEA 2PXAA 1C8LA 1DIGA 4XWGA 1JMKC 1ZVMA 1E9EA 2OXEA 2CBXA 1OPRA 4I36A 2RSLA 3KSRA 2FZWA 2H11A 5EOVA 4UUAA 3JAMA 1WUTA 2AG8A 4KNYA 5HPYB 2OCIA 1LQ2A 3L49A 4QEKA 3D0RA 4EJ6A 2O9JA 4ZDJA 4B0PA 3K71B 3GWZA 4BKQA 2O0MA 3AHGA 4RZUA 3W1VA 4BQEA 1XX6A 4N0DA 3W7VA 2WC1A 2WYOA 3LCJA 4NYMQ 4OUDB 2WSIA 3QP9A 4PQFA 5CYPA 1GG9A 1X80B 1FSZA 4X6LA 3TI7A 1PGQA 1UJBA 4GI3A 3ZTTA 2Q2OA 2XYPA 4MYTA 2QLTA 4XFDA 3LWNA 1PT9A 2D1FA 3H0EA 1SIUA 4OHXA 3KQKA 4FZJA 4KVFA 2WMDA 4XLLA 3U7GA 4XI9A 4YRTA 4DV7B 1ZLXA 4IV8A 4DWJA 3IDSA 3IUEA 2BGRA 3TE7A 1GZHB 2ZE7A 4LI3X 1ND6A 2H1SA 1AKMA 5D3QA 1EHCA 4MKGA 5AR1A 5IN5A 3WO1A 3WQSB 4UNNA 4RL4A 2ZI6A 1Z68A 4DSAA 2BFDB 3U81A 1I1NA 2BMDA 4N8SA 4RDCA 1ZW1A 2WHPB 1VC2A 2EJBA 3H5AA 1MMFB 3O0DA 5D84A 3C3DA 2POQX 4QHTA 1X74A 2I8LA 2Q4TA 5GVRA 4IGAA 3S7ZA 3K5WA 4DAEA 4D3DA 1N8NA 3V4FA 5AW7A 5ALTA 1F6BA 3T9FA 3NBKA 4OQNA 1W48A 2PUTA 2VJOA 4UMVA 4EZBA 2CJXA 2E48A 3LKVA 4ZJPA 4CKZA 3IVXA 1Y6RA 5JALA 2OUIA 1QH8A 4K9PA 4YLYA 3DV0A 4QDXA 1CCWA 4PZCA 3MEQA 3JASA 4KXYA 5K20A 2RD2A 1CUUA 2QZZA 4KAJA 4URZR 1CJSA 1NKVA 3RRFA 2APJA 3AB8A 5AKLA 4TVSA 2O2IA 4IICA 1T2AA 1YOVA 1OASA 1BXZA 1XROA 2XCIA 3ESBA 4J0KA 4GP9A 3UEOA 1Q0HA 2DUMA 5C7OO 5H70A 4M8KA 5EJMA 4KBFA 5BSVA 1FNBA 2QAGA 3GDGA 4H3VA 2UV8A 3I4FA 4F11A 3QZUA 4P7FA 5YASA 1THTA 2QUKA 2FEKA 4CETA 1SMKA 2PJDA 3PWSA 3RRJA 4TSKA 1XP5A 4BOYA 1AUPA 5C3MA 1EE2A 2PRKA 2QR5A 1ZI9A 2UVQA 5K8VA 4X45A 1MBZA 3ASVA 3SFVA 2DPXA 3OWOA 4IDBA 2PMCA 5E7IA 1GGMA 2J3JA 4MYUA 3TZ6A 1XD2A 3MWEA 1N2IA 3AFGA 3LE8A 3OHSX 2ISQA 1JMVA 4PXAA 4PY2A 1PGOA 2CDNA 2VAVA 3NHSA 3PHHA 4N03A 3MJRA 1CUYA 4QXPA 3WYAA 4BQRA 4DC1A 2OP1A 2CMGA 4M1KA 3V8VA 1MW8X 3U19A 5MFPA 4XDZA 4BAUA 1GPDG 3K70B 4CQNA 5J4KA 4GZ3A 3Q2IA 4B4VA 1VJCA 2YIJA 2UDPA 3F8WA 3WHKA 3L5KA 3WAJA 2CXQA 4XX1A 1LTQA 1YOVB 3PD1A 3IPYA 2G4CA 4OQMA 1U7HA 1QOPB 3A6GA 4G5QA 1KAEA 4NEHB 5GJVC 1NDHA 2XTNA 5DNAA 5KNDA 1ID8A 1O9HA 2QAGB 2OSVA 2PQ2A 1HT0A 4IFIA 3PTAA 3LDGA 2WYHA 1NTRA 3SOPA 4DXAA 4C76A 1XVIA 1ZEJA 1LK7A 3D31A 2FR8C 5K2MA 1SVOA 2V4MA 3SYMA 4B74A 4JUBA 1UJ5A 2RBGA 3V7WA 4FR0A 1LS1A 4D3XA 4ZN6A 4DUYB 3IMEA 3M70A 3A4MA 4BTEA 1N2CA 2JFVA 3ET5A 4JC4A 4M1EA 3TTUA 1XD2B 4TLBA 3OZBA 1GNVA 5BW6B 4JBGA 1B6SA 1FMCA 3HN6A 2O06A 1OKKA 2C5AA 4CLXA 5EJ8A 2CFOA 1BKDR 4OAQA 3OHPA 4NHOA 3TR0A 3IAEA 3LUPA 4BWVA 4WOPA 1EG7A 2PMEA 3BD6A 2ZWPA 4AS3A 4DMFA 2AW3A 4AP6A 3A31A 4JNCA 1N77A 1CZLA 3TR5A 4IRXA 4B3HA 1XAGA 5FADA 2AEEA 1RRFA 3UJAA 3U48A 4NJMA 1CRPA 1GD1O 1CNMA 3A4IA 1CC1S 5TX7A 3D43A 4J4TA 4GL2A 1XAHA 1Z06A 2NU7A 2NX2A 3AI2A 4F3KA 1GUBA 3VZPA 3OQPA 3FNQA 4IHJA 4RDHA 4DBLC 3X3HA 1QOQB 1W44A 3GLTA 3P2YA 3SF8A 2ZTLA 3FVVA 3ZUPA 1X7YA 2JPDA 4MGZR 3Q4GA 5EZQA 1XTTA 1I2CA 4UUOA 3A37A 5B3LA 3AVVA 3W2HA 3TKYA 3HBNA 4EFDA 1PV2A 3EEQA 1N2CB 5HR5A 4I4LA 4M2LA 2JAXA 4ASUA 4UEJA 2Q3FA 4R05A 2C20A 3E58A 3PGLA 2QJFA 2OK8A 3PDUA 1JHVA 5I9BA 3IRUA 4C29A 4E03A 4PHTA 4J0DA 1PGJA 1QBKC 4CKCA 3SLGA 1Z25A 1O94A 3V1UA 5GVSA 2D5BA 2GEFA 1UMKA 4OGLA 2JI6A 4YO8A 3ASZA 3UMYA 3H9JA 1BW9A 1CJMA 2FSVA 3FOBA 3G59A 3K73O 1USUA 1JKMA 4EHJA 2GZMA 3N2GA 3CZ9A 4OXXA 4S1NA 5LZ8A 1SUCA 4G0OA 4EQZA 1NR5A 4MAFA 1Y3BE 4M46A 3PFKA 2P8JA 4JLJA 4NJMB 3KJEA 1CUIA 1YSCA 3P5SA 1NUQA 1AU9A 4AG5A 1V5WA 2AYYA 2O8EA 3GYBA 1IY8A 1VE9A 2YFKA 3PV0A 4IHJB 5EMLA 1P72A 2CLIB 1Z2AA 2PJRA 3SF8B 4XM0A 2HQSA 1T3LA 2QUHA 3B6JA 4XH9B 5IUKC 5CT6A 3QU2A 5LXTF 2PQ0A 4O1IA 2G5CA 3SWWA 5AVOA 4QPJC 5KAPA 1UMBB 1QIJA 2IZZA 3ZC3A 4F9FA 4PYJA 3DWGA 1K3TA 1O5TA 4EMTA 3UFXA 3HJTA 2RHWA 2PUWA 4KK4A 3SKVA 4HR7A 2MOKA 1W35A 1WMDA 3C70A 4P32A 3VA7A 5CB6A 3DE1X 1ADJA 4PSKA 1CQXA 3CUYA 3I12A 2ZTUA 4GYYA 3DCYA 3NM4A 5IKEA 3SVLA 5HRUA 2QTFA 4V38A 3PL5A 2MYTA 2TMYA 2CEAA 3IDOA 3H9GA 4AURA 4DLLA 1NATA 4UATA 2QU7A 1BW9B 1A4RA 2ZBGA 3G0BA 1NW3A 3WLRA 2H2AA 1Q7CA 3WGUA 4IOLA 3N2GB 3JZFA 3R3VA 4K9RA 4EW1A 1YR3A 1JG4A 3GLHA 2RHGB 3EZFA 2BYTA 1P7YA 3BB1A 1J2EA 2CUZA 4AXBA 1A95A 3WLOA 2IDKA 5AJHA 1SD1A 3EPLA 2O8EB 3HV2A 2MSDB 1B3BA 3DOEA 1IHDA 1S8NA 1RQNA 2FX2A 4OMFG 2E37A 3JS5A 2M9MA 4I7EA 3HR8A 3UWOA 1QDEA 1QP0A 2E4YA 2ONZA 4UPVA 3PUIA 3W4KA 4Z4CA 1Z08A 2KX7A 4MVJG 5IVIA 1GZUA 2AJDA 5AJWA 3FHJA 3UFXB 1DADA 3AV3A 1OLXA 4BRSA 3K0SA 4TMFA 1YIOA 3MERA 4R7GA 1AXEA 3ETHA 4F72A 1ST2A 2BUAA 2M6KA 4QBTA 4D9EA 4NAUA 3E61A 1W85A 1CY6A 4DDVA 4URVR 4DV3B 1EK1A 2BIFA 2IC5A 3I9MA 4YYZA 1YV9A 4CXMA 1GQ2A 1IHXA 1HSOA 4BCBA 3H11A 3LPNA 3K0BA 3WIOA 1XIVA 4JLNA 4NMHA 3AETA 3MRVA 4RMNA 5EFZA 5BRNA 1KZHA 5IXJA 5JI2E 1GUAA 1BJTA 1OC4A 4LMAA 4UDYX 4XD7D 4M22A 3BTSA 3G1TA 2PZFA 3GLHB 3RBZA 1QAOA 1UT8A 2Y0PA 1U90A 4L76A 1T1EA 4OUKX 4QOEA 5DIFA 1GCIA 2GESA 3AIMA 4DMRA 1WKVA 2GVZC 2PA0A 3G6KA 1QNFA 2WJWA 3D2LA 4XSVA 1OV6A 2P5TB 1GZ4A 3GU3A 1I3KA 3KPUA 5KYGA 3FPHA 3NAGA 5K5EA 2RAVA 1T2EA 3K1TA 1XZMA 4RY9A 1AHHA 3ZV4A 1T91A 5G1PA 1OLXB 2QMYA 2WWTA 4QPPA 4ZQCB 4HFJA 1DQNA 4RAQA 1Z5NA 5THQA 3U7QB 4AAYA 5KCZA 1WBDA 1Q0LA 2WIBA 2HUPA 2JVKA 1W85B 3ZEIA 2X0KA 5JVDF 2EF1A 4YBZA 4ALIA 5DN6D 5ECGC 3OF5A 6NULA 2YHSA 2HBQA 3OEYA 5A5VA 2BKEA 1IOZA 1Z13A 3AETB 3RREA 5K99A 5JBQA 1J2TA 2Y68A 4NOKA 4NTZA 5EIBC 3PNQA 1ZMTA 1Q1GA 1K8XB 2G7ZA 1EU1A 2JD0A 5FD8A 3WE7A 5KJ6A 1EESA 4L3WA 2A1IA 4MQ4A 2A3NA 5I7AA 4QNRA 4RTRA 1DQPA 3P96A 4CUJA 1EZ1A 3IOCA 5JHHB 1GNQA 1U31A 1G8HA 2ATCA 4OI1A 3T4XA 2HU2A 4C20A 5JJKA 3GHYA 1YL7A 1A27A 1XZFA 5JD4A 6ABPA 4LCBA 2DETA 1E0JA 1I2ZA 5G41A 1Z22A 3AERA 1N0HA 2H6EA 3KTFA 4TV8A 5FWAA 3UQZA 3RTBA 4S0ZA 1GY8A 2JZCA 4CCWA 2HMWA 2CDBA 4B2LA 4E2FA 5A3SA 2IOFK 3IV9A 2ZM6B 3ZTYA 1S4MA 5CYOA 2BR3A 1OWNA 3PRJA 1YJ8A 2E82A 3IQWA 3P71T 2G5PA 2A5DA 2JW5A 2J7PD 2ZI3A 2WA2A 2P2GA 1XWFA 2Z2ZA 3OU2A 3VM6A 4I8IA 4HH4A 3D6TB 3E18A 3SDZA 3IQZA 4J2OA 1VRCA 2NXEA 2YYYA 1EGQA 2WEKA 3LHKA 5CDFA 4F60A 5KTYA 5BNZA 2P2ZA 3D4NA 5HMMA 3WGJA 3GMSA 1CYDA 1RXWA 5AI4A 4AD8A 1ZI6A 3H83A 1AK1A 1R5NA 4ZICA 4CNQA 4KPEC 5LIPA 1U3GA 4X20A 3O4RA 1PRYA 1PZMA 1SC9A 2ONKA 4PTLA 2D1SA 2N1MA 3ZNOA 1ZCZA 1SJ9A 4LYFA 2JJYA 2NPOA 4X8HA 4LF8B 1CFZA 3QXSA 4PSVA 3SK0A 4DNQA 4MR8A 4MHTA 3KTOA 3C7DB 3E7WA 3N86A 3VR6A 3AERB 2HV8A 1J97A 1U0EA 3HJRA 3QGMA 4ZJYA 4IVPA 5DLYA 1P2BA 3P9SA 4F2GA 3U40A 1XLUA 2NN3C 2BE9A 3ECAA 3DO8A 3FMGA 3KYBA 3KSAC 1AB5A 2VH5R 4GD3Q 1P4SA 1Z5WA 2VJCA 2PS1A 2QNBA 2VQ3A 4PC1A 4DLKA 5DHUA 1M7GA 3BHJA 3JVIA 5DE3A 4IPTA 3TLEA 3SC6A 3W0LB 5CLIA 4E1BA 4GPD1 1U63A 1AGRA 1Q50A 5I9TA 4YRSA 2GPTA 4Q0MA 3PUHA 3A6KA 1UP4A 4I5GA 3THXB 2JLCA 5C7YA 4FYMA 4MYRA 5EHNA 4I6EA 4BE9A 3SVTA 3ESXA 1E96A 4X20B 2PUDA 5CVUA 2JG3A 2PL5A 2ZVPX 3K2EA 1Z3CA 4N18A 4UBIA 4V24A 1PVOA 2HJGA 5K3DA 3RAPR 5C35A 2FLKA 8OHMA 2O20A 1VBNA 2VWPA 1ZSYA 4R71A 2IODA 3UZUA 3RUCA 1RYFA 2RJNA 2XUZA 2PGOA 2ZSIA 4TUYA 4BV3A 4MR8B 3G2HA 4RY2A 3TQIA 3HVUA 4W8OA 2V54A 1K8ZB 3AJRA 1OREA 2F1RA 1S7CA 2B25A 2FLVA 3FDIA 3HRIA 3BMOA 4J0GA 4JJ7A 4NBWA 1SUSA 4KAXA 3UYKA 5BWCA 2O8BB 6CHYA 4AULA 5HK9A 4CPDA 3HP7A 2JJ1A 1EE1A 4PTYA 4G63A 5FUYA 5KDOA 5AHWA 1WU7A 3LT5A 2FZKA 1CY8A 3O1JC 5CNMA 4AMYA 5JSHA 2WD8A 3BFXA 1VSUA 1U6KA 1G21A 1ZYUA 2GQ0A 5D5QA 4O8CA 1E8DA 2DPMA 2DXIA 2BHSA 3ZW9A 3H5IA 1T36A 2QL5A 2JA1A 3VR2A 3WHPA 2CBZA 1XZNA 1SZJG 4RPCA 1SD2A 2AMLA 1LJUA 4TXJA 3VKVA 5CLGA 3ORQA 3JZDA 4MVWA 5IYZF 4Z4EA 5CT5A 1FRVA 5G1NA 5AKYA 1E6EA 1QTNA 4RSGA 1DRJA 1CF2O 3GGSA 4TUYB 4WXRA 2C4HA 3BC1A 3BXHA 4ROSA 1L7MA 4QAQA 2EZ8A 2WVHA 3K5PA 4FE4A 2JLZA 5KB3A 4XASA 2EBWA 3BMOB 1OI3A 1FTSA 2XT6A 4UU1A 3V4ZA 3KQVA 5JCZA 2YUTA 4IZOA 1FNMA 3OIFA 2J9FA 3EAQA 4LSGA 4JI6B 3BWMA 3OM9A 3K8YA 5JSUA 2BKXA 2G17A 4Y2JA 3SQMA 1ZSNA 1G55A 2IYEA 1RYBA 2A9QA 1X9IA 3OP4A 3MFYA 4Z5XA 4AECA 1Z56C 3HVIA 1KZ6A 2GAJA 3C3KA 3Q8XB 1DC5A 1EX6A 1T36B 1T9BA 4IFEA 3ZCUA 2PH3A 5IK2A 2Z6UA 3BA1A 1NUTA 4WFQA 1SEPA 4LCEA 1E98A 3CT6A 4HQRA 4OFBA 4E4TA 3ADBA 5CHYA 1G6Q1 5FQNA 1X1RA 1T4DA 1XL1A 1C7JA 2M6RA 3GLSA 3L8ZA 5DSZA 4TTJA 2AWOA 2NZVG 4AWBA 4BLPA 3PQ7A 3PLAE 3JWJA 1KI3A 3HY6A 1PJSA 3S1LA 3FYTA 3BQMB 2P8SA 2BZGA 4ZO7A 2UZ3A 1IM5A 4MCHA 3W2TA 4ZGBA 5TRTA 1BROA 3RQSA 1EUCA 3SHTA 3B38A 4AG3A 3A1CA 2IYLD 4KFRA 2RGYA 1JEYA 4L07A 4I9FA 4C0XA 7MHTA 4OP2A 5CDGA 2CVFA 5DI9A 1R8SA 2FWJA 4GMFA 5AMXA 4GKVA 5DBEX 3RJTA 4DA4A 1PS9A 4MP6A 3HPRA 4S0XA 5FTNA 1HI9A 1LBQA 2J9FB 3AKEA 4A0RA 4R8MA 3LRTA 3E9NA 4KNVA 1E0DA 4HUJA 5KIAA 4ZOQI 1RE1A 1CUCA 1GPKA 2YN4A 3OX4A 4GPZA 3HR7A 2Y67A 4EA9A 2VYCA 2ZB2A 4PHGA 3U3XA 1DPFA 4QXAA 1J7JA 1XPOA 4GMKA 4AJ4A 1EIWA 3BZUA 5EIXA 5BUCA 3BE6A 1BG6A 4JP5A 2HRRA 3H04A 3A3KA 1I5EA 2GO1A 3M81A 2XB4A 2GWHA 4WNYA 1CZKA 3EISA 4BAZA 3EJWA 4XZ3A 1EX1A 3CF4G 3DMTA 3JVUA 2OBYA 3D8UA 1M34E 2ECOA 1XKXA 3PQ5A 5I51A 4MVJM 1YHZA 2GPWA 2O4UX 4LDNA 3E82A 2XIJA 3GT4A 2RGRA 4ZI7F 1G9TA 1EUCB 1P7ZA 1M2EA 3AR5A 1YGYA 2AYZA 4B6QA 1NX6A 1SOWA 5KWSA 1T2CA 2GJSA 1JEQB 4HAVA 2YDYA 1U3UA 1LBTA 3L7YA 1J0XO 2XDWA 3TRKA 4BKUA 1A82A 5KCMA 3RUPA 4BP3A 4EUKA 3OTOB 1YZ3A 3IMGA 3ZX4A 1H0HA 3NHJA 3KJQA 1D0IA 5FLEX 1CVIA 1EHIA 3OE1A 3OESA 1JQBA 3HSSA 3T9BA 3I5YA 2ZWOA 3N3AC 3GA5A 3P2IA 4WVFA 3TIXB 2Z1DA 3ZDFA 5LPNA 2FQQA 5BSKA 1AZSC 2GKOA 3V1TC 2AN9A 3ZBTA 3MWKA 4YMVA 5CP8A 4UCXA 4L6IA 1Y33E 3KOUA 1F14A 1DO8A 2PWZA 3A4NA 1E3DA 3LC0A 4GOLD 1X8XA 4UTVA 3GLFA 3Q3VA 2REBA 4U6QA 4BNFA 1Y1SA 2JGLA 2PY6A 5BR4A 3FPEA 3NT5A 4GUAA 5H3LA 2JF0A 5HZHA 4QXQA 1H6CA 1XZKA 2LIPA 4V0ME 3SXJA 4B2PA 3I28A 1PSWA 5JOQA 1RAIA 4F6RA 4X84A 3LIPA 3UY4A 1O97D 5KTSA 4G86A 2W2MA 3QU5A 1X1EA 3GR6A 1V47A 4WY2A 1HE2A 4KPFC 4HAUA 1QPZA 1U2DA 2IEZA 1T9GS 3LTEA 4D4KA 1ACLA 1D9ZA 1AKRA 1KVRA 2VF5X 2YWJA 3E1KA 1TFUA 2W8ZA 3KXPA 4NZMA 3HFGA 2Y93A 2QSYA 3EOBI 3SHQA 3U3JA 5IASA 1AQUA 3U7RA 7ABPA 4IYRA 5JNVA 2DPGA 1AHPA 3S2FA 4LBVA 4UASA 3RYHA 3L4SO 1CRQA 3NH9A 1JDPA 1TYDE 2BFBA 3S8MA 1G6HA 4M0PA 3DNFA 4MB2A 4CT4B 1URPA 2O2SA 5AHXA 4B87A 3P9ZA 4BUZA 2IS1A 4B33A 2DR3A 1LH0A 2NXJA 3VNAA 1Y9ZA 2QP9X 3LSYA 1NP7A 2KBFA 2A0YA 1QKKA 1VSQA 1Z5ZA 2B8EA 2QB5A 3DUFA 3GC6A 3KSUA 4I5EA 5CX4A 2WD9A 1MJGM 3FGZA 3T3PB 1BE0A 1O96A 3THRA 1E9AA 2BELA 2OPBA 5FKJA 3PQFA 1NDQA 3U9TA 3LVQE 3AB7A 5JJIA 3P2KA 1BN6A 3FAZA 1B14A 1MXFA 3RYCA 2B5VA 3NRCA 2IY7A 3PHBE 3W5VA 4F6RB 2MSNA 1X3SA 3Q10A 5ELXA 1AOXA 4W9MC 4KQ9A 1KDTA 4Q7KA 3W8EA 3PUKA 2HD4A 5LUAA 1RWBA 1OJ7A 1OHHD 2B4QA 3QUQA 4YAIA 5HGXA 4KX3A 3EIUA 4MWBA 4KLNA 2VIIA 2IE0A 3KPJA 4ZKDA 3QRWA 1NR1A 3L8GA 2DWUA 3HNRA 3KZMA 2JFZA 4TYPA 3KQSA 2I34A 4FQ8A 3KYCA 4L08A 2BFBB 1JDJA 2O5RA 1OWMA 2ZE5A 4YASA 3HCRA 1X39A 2BDTA 2NSLA 2X8WA 1BOFA 1WKBA 4RGVA 5LOVF 3QJ5A 4CMGA 1SU6A 3CZAA 1EBUA 3DTYA 3GJ6A 2HY7A 1I33A 5ES4B 3U31A 4UMFA 3DUFB 1BMTA 2PKQO 3NAMA 1W6RA 3C6ZA 3LIIA 3U4IA 1SIWA 1O96B 2ETVA 4MJXA 4XLTA 1ORWA 4IIEA 3O2NA 3ZHZA 3VJRA 5JPIA 3THWA 5JLJA 1M73E 2J87A 2HYDA 4EG6A 1ACJA 3I58A 1DFHA 4UHFA 1I1HA 4F3CA 3RYCB 1UXJA 1W29A 5KZMB 1Z5OA 3QFRA 3BCUA 1Q19A 2H1CA 3KFXA 4ADSG 4DREA 4NE2A 2DFLA 3KJNA 4RJKA 3ZQ4A 3FJYA 3T7AA 3I8SA 3KSBC 1MX5A 1Y5LA 5GGYA 3UV6A 5CBPA 2OBXA 4CIYA 2NTVA 1MO5A 2Z9BA 1A7UA 3V7UA 1ICIA 5JWHA 1POWA 3RSGA 1E0AA 1KXZA 3KKOA 3SJ7A 1I4TD 3FKQA 3ZXIA 1NI4A 1OZ0A 2EP5A 2LGJA 2FTKE 2WMYA 3B7WA 3KYCB 3DE5X 5DOZA 4E7PA 1FTQA 3UPUA 2XMQA 1QIEA 3MMSA 1WS6A 2D54A 3GLFB 1EVJA 1ZA1A 5TIIA 4Z4HA 2HHCA 1Y3IA 3KJZA 4K6CA 1HLFA 5AM4A 1SVNA 2QUBA 3W34A 4DJ5X 3E84A 3NHFA 2JGMA 2P9FA 4D44A 4EG4A 1S2MA 5HF8A 5I9NA 1KPIA 1ZO8A 2HO5A 5TF4A 4U7TB 3WP1B 3TCKA 3THWB 3RARA 2AQHA 4BKOA 3A7EA 4TTIA 3DT9A 3MMXA 5GJWC 4B83A 2F59A 4HJXA 4YJ3A 4Z9YA 1ONSA 1SPBS 2Z3ZA 2I7VA 3S70A 2OLJA 3BPSA 4K88A 4H1TA 4IHAA 3I0ZA 3GAFA 2W22A 3PYMA 4XIGS 3ROGA 4UHBA 5CFPA 3GRCA 1EJBA 3LZ6A 4Q4DA 3I30X 3EG9A 1IB0A 2VNAA 3L0ZA 3CW2A 4R9RA 4FE3A 3HI6A 4IW3B 3ZOKA 3ENWA 4RTLA 3VU8A 1TK2A 1MDBA 1ZK2A 1YKSA 4A1FA 2B6NA 2V8BA 1HTWA 1NI4B 2ZRFA 2I03A 3HYSA 3PA6A 3PHIA 1IJBA 4PQEA 5AHKA 4IIBA 1Q16A 2AFIE 4LXXA 4YMGA 3KZCA 1F4PA 4QT4A 2GCNA 3CVVA 3EJ6A 3CF2A 4CL0A 5EQDA 3MRSA 4RFVA 4FLMA 3D3EA 4DA8A 1C4KA 2GRJA 3QH4A 3WV5A 1SBCA 3FKSD 1VGVA 5AOVA 5A1TA 3RS8A 1NV9A 5J2UF 2F8LA 1E6CA 2G0TA 3DDZX 1KDYA 3NTLA 5AW3A 3O4HA 3AJEA 2P6PA 1FFAA 3LV8A 4EI8A 3BTUA 1Z5UA 3GG2A 2Z5LA 1L8OA 4YJ3B 1XDGA 2Z43A 1YB5A 1ECJA 5HQTA 4WZ6A 3IHWA 5KDLA 3DDCA 4UVGA 1SM4A 5JS6A 1OBCA 1QF9A 2YWEA 2C0PA 4M37A 2EYQA 1QIKA 3GT0A 3LPCA 2HWWA 1ZICA 3BJZA 3O8RA 2C7GA 3PEUA 4AMVA 4OKSA 4RCYA 2ZAOA 5A0TA 1SOVA 4FFRA 4WDRA 3RU3A 3J81k 3A4TA 4RKYA 3AO0B 1Q1ZA 4D8UA 3FTCA 2XUPA 3L7CA 4GVXA 1NBOA 2YXPX 3T5BA 2ZYGA 1N2HA 1RAHA 2NVOA 3FLBA 1EDDA 3GDWA 1I3CA 4HK4A 1OLUA 4WD3A 2VRNA 3Q6NA 2QORA 2BZ0A 3W2GA 2IUFA 3COVA 4RQBA 1IOVA 4V1CA 1LPOA 3G02A 5DCYA 4D4JA 1M2WA 1YQDA 4DCOA 2JAPA 1YS2X 1YVEI 1K4MA 1QVRA 4PHCA 1JS1X 1OZGA 3ZHQA 1JHRA 1VL0A 2R1ZA 3FKJA 3H7IA 1RKBA 3QLJA 2R96A 4MUMA 3BFPA 3UA4A 4UFPA 1MOZA 5JNTA 3EXEA 4PRLA 3V1YA 3FN4A 1RXEA 3JYNA 4G89A 5FLYA 1RJEA 4W5JA 1HUQA 3ZVKA 2A88A 1ST3A 1LQUA 1YA6A 1OIWA 5CLHA 4G07A 3L06A 3G2PA 2HIGA 1UT5A 4YP9A 1F8UA 2GXAA 3LQ2A 1OLOA 2D7DA 2HLDA 1HC7A 3IKVA 2R66A 2WUWE 1GNRA 3NVKI 1IIRA 3N2EA 4GPBA 2HA4A 3QLUC 1JUDA 1KY2A 2WQZA 3AR2A 3DDWA 4HWSA 2QYSA 3NFRA 1FXSA 1KBQA 3RH0A 3U7FB 1SKBA 2CNOA 4XJXA 3WXMA 1KC3A 1OLUB 4M76B 4ZIRB 1DX4A 1RPTA 2B4TO 2C9ZA 2YV2A 3LVBA 4V1CB 4U6SA 1Y6ZA 2LTAA 2CXNA 1N3YA 4IZHA 3VTKA 2C5EA 3GQVA 2DUNA 5K3EA 1WDMA 2G9UA 5DM0A 4XWWA 3KQLA 1OFIA 4YXWD 3M7IA 3SZ3A 3QXJA 4UM5A 2CKDA 3OJLA 2IHKA 2QLMA 4I50F 3BRWD 3QX8A 4DE5A 4JODA 3VRHA 1DB3A 1JJFA 2PWBA 1J2UA 2XLBA 1UXOA 4KIGA 3EXEB 2JEOA 1FP7A 3BMCA 4E94A 3ZDCA 1ESMA 2W6JA 2WPDA 2H7VA 4Y98A 5FAXA 1SC1A 3SKYA 4E5YA 2IBSA 1BH6A 4HATA 2O0HA 4EX6A 3NVAA 3ICOA 3NC4A 4M9SA 4HNTA 4G4IA 1WPRA 3IO5A 3EULA 5D6OA 4JLSA 3R74A 4YT2A 3VZDA 2E9SA 5DLPA 1VDZA 2RHJA 2VK8A 2FEOA 3JQCA 4I66A 2HNBA 5A6SA 3A1FA 1QUFA 1A0OA 1IRIA 2E87A 4G9GA 5F2OA 2GK6A 1HNNA 4KG7A 4QWWA 1XVUA 5GONA 4CF6A 2GSWA 3KB8A 4P0PB 5HRCA 2BSQA 2ZRPA 1AQYA 2BVNA 4MHSA 1Z35A 5EJ7A 2C57A 1UFQA 2RK6A 2I7XA 4CG1A 1SQSA 4Y2PA 1D2GA 1SG6A 2WY2D 3P9KA 4CG0A 5LBIA 4O5OA 3URMA 1TM3E 4NSNA 4YT5A 5BUZA 3V7YA 4ACBA 1AA6A 4OB8A 2V7TA 1JFVA 3N0RA 2IHBA 4ZV9A 4LV8B 1J5XA 2O23A 2NPFA 1UBMS 4MWCA 3I2HA 2XOKD 5C0OE 3RKRA 2MSKA 1DBIA 1JIXA 1EAYA 3F5QA 4CDRA 3G2JA 4H6XA 5KYTA 1PJZA 1QAMA 2SICE 2WV9A 4KC0A 5C8ZA 1N9KA 1Q1BA 3HK2A 4IRMA 1VJ5A 2D74A 3HEBA 1YRAA 4J94A 3L7OA 3AEUA 2HKIA 1V41E 1L5KA 2KPOA 4B17A 5JNUA 4I2VA 3CM0A 1RQRA 5A6SB 2WF9A 4IHJF 4JS0A 4NH4A 3INRA 4OBEA 5GONB 1J1IA 4RM3A 4KLRA 1XZEA 1EA7A 3NHPA 5TT1A 1VE1A 2IX9A 4TMZA 1CRWG 1SY7A 2X5NA 3OZWA 3AM4A 4LKOA 3I8OA 5ERXA 2Z8ZA 2C94A 4RETA 4GI5A 1UF9A 3CO5A 3ME5A 3T5MA 1WF3A 4EOGA 3OY2A 4M6WA 1I2MA 3LWZA 2D1QA 3LCMA 4RKEA 4ASUD 1D6JA 4DLVA 3OEWA 3D8RA 1N7HA 1U2SA 1MC1A 2HCJB 3LCUA 1RKUA 1WNTA 3MAAC 3KT0A 2MR5A 4PIMA 4ZTBA 2O2XA 2R8BA 5G4LA 1J25A 4ZC1A 4L8FA 1C4XA 2B99A 2IITA 4A92A 1C4OA 4TMKA 3KPWA 3LU1A 5HUHA 1ZHOA 1J5PA 1R0YA 2JLXA 5TJHA 2BBTA 5TS3A 2X0NA 3IULA 4FPXA 4EO9A 2OORC 2PX3A 3VR3D 4L4ZA 4A91A 3SM3A 1UEJA 1M75A 1T9AA 2QRGA 4EL0A 2R8OA 4OHCA 4Z0NA 3AEUB 2J59A 3DL2A 4Z9AA 1AGYA 2G06A 3G9QA 3LECA 3PCXA 1B7GO 1G18A 3B5EA 4L0QA 2XCLA 2BMVA 4B73A 1R37A 4D3YA 1W36C 3C1TA 3R1IA 1ESCA 1O58A 3FCAA 5KJFA 3D6MA 4BN0A 3PC2A 5B3KA 1WLSA 3D0QA 4FNMA 5E0KB 4LWPA 3LD9A 2F90A 2IUTA 4HFMA 3HGMA 4H1HA 3HUUA 3ORFA 4WZAA 3WLQA 4M6WB 4RE6A 3RIMA 4QOSA 3O9MA 4TKUA 1N1GA 4RMHA 1K6JA 1PAUA 1ZMXA 2VHYA 3D81A 4HGQA 4CMIA 1UDRA 1RI2A 1VLVA 1WO8A 1R3DA 2F1OA 3NDIA 4LRWA 2OHXA 4RL6A 2QMEA 1PR6A 1RS0A 3AHCA 2IYTA 3MGGA 5CM2Z 3SU8A 4FD3A 1Z0IA 9ATCA 3EQ7A 4K5QA 4RO0A 4H7FA 4PTZA 1F06A 5H80A 3MMPA 3GPDG 4LOAA 4MH0R 3ZG6A 2Z6VA 1HDOA 4E12A 2BDUA 3GRKA 3G0OA 3K6SA 4EZEA 3H9BA 3DW1X 3OZSA 2VYNA 3F1LA 4P3PA 2R6AA 1Z16A 1IUKA 3QLUA 3P9YA 3NXSA 2Q3MA 4HXGA 4I5DA 4MOWA 1YUMA 3PXEA 2NUPA 1XRRA 2XMSA 2NO6A 2VZ8A 1Y1RA 2A7XA 2C03A 2C3PA 3PXBA 3U1VA 4O02B 2CB0A 4GM0A 2BFPA 3TUIC 3NDJA 4HH1A 3AF0A 1K6XA 4HAYA 4ZD6A 1ZUIA 4LYGA 2IE8A 1NKTA 5ECDA 3A1WA 3RSCA 3SBEA 1G0OA 3FVQA 4CMIB 3U56A 4NV1A 1T5OA 4RHEA 2VDUE 2Q99A 4FFLA 4L9AA 5EI5A 2ZRCA 4B4OA 1AUXA 5LP6F 4DFDA 1FPQA 1TD9A 3VXKA 1NU8A 2GEVA 4K81B 4OLJA 4PLGA 1XNJA 3V1MA 1TI7A 1YBMA 4O2AA 3LX6A 1CJUC 3PQCA 4NU6A 4CQJA 2B4KA 1ZM3A 5AFSA 5CDUA 4KE8A 2AUMA 3K6SB 4ID9A 3ETEA 3AXTA 3GUCA 1BRTA 4GLJA 4B2IA 4CT5A 2HMUA 2P3QA 2PLFA 4MV3A 1A4XA 1YRLA 5C52B 2WTAA 1BU5A 1YA8A 2PLNA 4L5AA 3KE9A 5EKSA 3WYEA 1I5OA 2H1WA 4Y1GA 1J8YF 4G9BA 1MIOA 1PR9A 2OAGA 4MICA 2NUPB 4AYXA 1EB9A 1JWBB 4II7A 4ZODA 3P45A 2WAYA 4MI1A 4J43A 3DMRA 3DTVA 4PYQA 2DTXA 2OV4A 4J7UA 5IAOA 5HKOA 5AK6A 2DYKA 2GT1A 1GFZA 3DZJA 2V7QD 5DGXA 1ZD9A 1KJJA 5J9FA 3IQFA 1Z63A 3CJRA 1CD5A 1R0ZA 1KH1A 1YDWA 2PEZA 1IQUA 1T1SA 3FUWA 4WJKB 5KNBA 1FQJA 1Z6ZA 4OATA 3AC0A 4BGEA 1DTSA 4GZLA 2R68A 1FL9A 1Y3DE 4BECA 2XT0A 5D00A 4MWDA 2YRFA 4I9NA 5JQWA 5BNFA 4O2AB 3R7DA 4FJ1A 2JANA 3KKZA 3CKKA 2HRZA 3QI7A 4CR8A 1EQAA 2H31A 5TDHA 1L2TA 1C3OA 2ZVDA 1OUMA 3E2IA 4O4JA 5HIIA 3ROMA 1NRJB 5HJ5A 1ZH8A 4WLVA 4PSCA 5K3BA 5LZ5A 2IV3A 3QVXA 1T5IA 1MVOA 3NHRA 3O75A 1JJVA 1FP1D 4M49A 1MB2A 3RUIA 2VPTA 3NTUA 4PBSA 2YASA 3DAYA 3DTVB 3CE6A 1KARA 4QG3A 4TKLA 1AGPA 1MGOA 3H97A 5M5BA 5TQ0B 5B1SA 3WK9A 5CXXA 5H82A 4I08A 3T6KA 1M1YA 1JT2A 3FZNA 4K6OA 1G38A 1DAGA 4CG3A 4YAUA 1EDOA 1IPFA 2AXNA 2YN0A 3P9CA 4RNDB 1L5NA 5HW0A 4C3UA 5KYYB 4S04A 4QOJA 1NUSA 1QCZA 3WO0A 3TZLA 9MHTA 1E69A 1Z18A 3EIQA 3GGDA 3AYXB 4TS3A 2ZS9A 3TNFA 3UMJA 3QVOA 5B58C 1KY4A 1PJ2A 2GR9A 4E11A 2V5UA 4PO1A 4EKYA 3QF7A 2EZ9A 3GJ8A 4L8GA 3RSSA 2WAXA 1WY7A 4D57A 2BP7A 2FJPA 4C4RA 5FTKA 2BMAA 2XXBA 1CR2A 2CEKA 2V03A 5KUTA 3QPDA 3TQQA 3LQ1A 1QIDA 3ZHSA 2EQAA 3N3BC 3I2YX 1C3OB 2Q4OA 1VPVA 4O4JB 1C5KA 1I3LA 3LYHA 4WY5A 4DSZA 1GTG1 1UDBA 2QJWA 3DMFA 4KIFA 5LP1A 4Q3CA 3FZYA 2PVCA 4G25A 4MK4A 1PZXA 2DUUA 3AVPA 3IVAA 4MIYA 3M6AA 3MWFA 5JEEA 1UOOA 2QRUA 3WWYA 1UC8A 3DG9A 4JNKA 2XITA 3ZGZA 4MUHA 4CMEC 3HDHA 3MCZA 1S02A 1M6WA 3KD2A 3I52A 3I6ZA 1GITA 3V4OA 1RE0A 4DYDA 5CFMA 4HL6A 3COWA 1WQ1R 1M1YB 1M34A 4ZRMA 2CB9A 3TDNA 1K7XB 5H0IA 2Q46A 3B6EA 3UJDA 4DCUA 4C0AC 4NFSA 3UWSA 1TZ2A 3SEQA 5ALHA 1YKGA 1MEOA 4FDLA 5BQPA 2Q7DA 5AVSA 1YTUA 1Y9DA 3D4OA 5KOYA 4UU0A 4H18A 4QJBA 3VR6H 4H7JA 2XNDA 1HFKA 3HCFA 4CKYA 2HCFA 4G1VA 1TAHA 2X9VA 3VI3B 3C3XA 1E1KA 4JEMA 1Q15A 4V39A 2A7QA 3WNQA 1CIPA 3COYA 2BP7B 1EFLA 1T13A 3PHJA 4MUJA 4K26A 4O3FA 3PFFA 1ETHA 2X86A 1O77A 2FVYA 2PLAA 5E2AA 2ID4A 3MK31 4DB2A 1N5OX 5FDFA 5KHLB 1TNDA 1KRHA 1EFVA 3DMNA 5FLKA 5C46F 1FZTA 5FBWB 1TQ4A 1WSAA 1WSBA 1XDBA 3DXXA 1RACA 3CKYA 1H2XA 4Q15A 5DNWA 4DC9A 1LUAA 2FSSA 2J07A 2J6HA 3DDNA 3Q1LA 1SUIA 1XVLA 2DKOA 3I9V6 1BD4A 4G85A 5BUSA 3DZKA 5D5PA 1CXZA 3EGXA 2BCEA 1BA2A 1KI9A 1M34B 3B7PA 1JI0A 2X5OA 3IJ5A 3FVTA 4V0MA 3BJMA 2G1AA 2DH5A 4IQ8A 3R09A 3T8YA 3MXOA 3ND5A 2KQUA 4BVAA 3H9UA 1IXKA 5M2QA 4YY3B 3PWKA 4IKEA 4NG4A 2X8AA 4DJTA 3KELA 3RYIA 4YHHB 1KEWA 4WLUA 2EBFX 4KXFB 5M29A 2AQ8A 2A5JA 3WGLA 1EB8A 1L7BA 3L82B 3UHFA 4C4OA 1DE0A 3CSSA 3ORSA 4R4JA 2YWRA 3VR2D 1ITZA 4I14A 1F2TA 4DLNA 4BV8A 4HB2A 3LQKA 4B47A 3NBYC 2A9VA 5KREA 5H1YA 3B3GA 2LNDA 1S2IA 1YFKA 3VZSA 4C4AA 4EF5A 4PIVA 3IKTA 3S2SA 2IW3A 2REOA 2YQ4A 3B6MA 2AVDA 2RG7A 3A3NA 2Q6KA 4IXMA 4BL5A 2Z1MA 5JC1A 2AC2A 2AJCA 2GNPA 3B6KA 3EGXB 3HB4X 3C85A 4GU5A 4QATA 1II8A 4R1MA 4UEWA 3TF5A 2O6LA 3BMQA 1FVFA 3KEOA 2HWKA 3WIVA 1GT91 3WLEA 1TA0A 3WI7A 3DKVA 4Q6BA 5JH7A 5JZVA 1JH9A 1TF2A 1NSYA 4EEZA 1J8QA 4GX0A 5IHPA 5MHTA 3REGA 3RYIB 4EGFA 5LQUA 1UK7A 3R7LA 2CUNA 2PKYX 5E6UA 5AESA 2ZT5A 4DEVA 3KWFA 1JHQA 4UDOA 4G0VA 4R5HA 3BRCA 4C14A 3C45A 2AS0A 3C39A 1UKBA 3GZNB 1SXHA 4C21A 1F38A 2CLSA 4Z0PA 1F2TB 2ON6A 5IK2D 5EIBD 2QM7A 3GIWA 1QE5A 3OE4A 1Y6JA 1FTNA 1R16A 3DFFA 1VCHA 3WLIA 2EJUA 4ZV7A 4HV4A 5MF6A 1H9BA 2CL0X 3ZQUA 3ZHTA 1UQUA 3NAZA 3V7FA 3WOVA 4DWVA 3O93A 3ACBA 1AF7A 1IUNA 1IHUA 4JJIA 3VOTA 3MCTA 4W8GA 4F3YA 1LWOA 2JC3A 1JR3A 3UHAA 5DASA 3SVZA 1N4AA 3DJYA 1CDOA 1JSLA 2WTEA 1II8B 1QJ4A 1WW2A 3ND6A 3BMQB 5LNK6 2YWFA 5JANA 3BZBA 4DV6B 3KT3A 1E1DA 2WAMA 3AJ9A 3FD8A 3GRFA 2FJUA 3VTZA 1QCDA 2LCQA 2ABWA 4CIDA 3Q5DA 2HDWA 1G17A 2ASEA 2C78A 4Z9FA 2Z6QA 2W2XA 2OZLA 3G17A 5E6UB 1DO2A 2CVOA 1ZAYA 5BURA 1GYPA 1ZJYA 1VG1A 2NNWB 1JIJA 1R7RA 1MG5A 3VH4A 1ZOLA 1ZIPA 4GGOA 4YDRA 1AY0A 2P11A 3D59A 5DXJA 5CUQA 4F1KA 4QDZA 2RGXA 4N5NA 3WNDA 2OGWA 2WU4A 3W3ZB 3UUFA 1YBHA 1V5GA 5BXQC 3AHJA 2R4UA 2WTXA 1QZTA 4FFOA 1B1AA 1P2TA 2IXBA 5JZMA 1GFIA 3JALA 3UTCA 1XZGA 2HMSA 4AL4A 1GGFA 1YZNA 2F00A 1K0UA 4P3NA 3VPBA 1ZUNA 3KP1A 3ZV6A 4BO7A 1DJNA 5IKXA 3V2UA 1T6YA 4OI4A 1QHFA 4LHWA 4ZDWA 5L4NA 1ZXBA 2Y2UA 3JAWA 2ZAIA 3G2IA 1SU7A 4INAA 4PZYA 5FTMA 3TJMA 4CMEA 3OZXA 5DTIA 1KR5A 4FHEA 3DHVA 4TYYA 1ULUA 3T7KA 3LMKA 4NJOA 4TXNA 4PQYA 3G7UA 4XUDA 1LBSA 3A9SA 4R84A 4DY4A 2H1RA 2I4OA 3NBMA 3S44A 4KIWA 3M1LA 1TTPB 2ZR9A 3A9VA 3VSBA 5ALDA 5TNXA 3KWLA 2HU5A 3C6BA 3CMCO 3LWBA 2HHJA 3MSCA 4ZCQA 1GTSA 4JJFA 2Y0BA 3HCBA 3HBAA 3H8SA 3NANA 2EW1A 5THKA 4DCCA 2PH1A 2XZTA 2C2OA 2JH8A 1FX0A 5EUQB 3SJUA 4NFLA 1RKXA 4WOJA 1NLZA 5ICFA 3TNDA 4J0HA 4DIBA 4PRKA 4RH3A 1PR2A 1NG9A 1CIVA 3NHWA 3L93A 4Z8XA 4BGDA 2IDMA 2HF7A 2OKGA 3AR4A 2AFIA 2XBUA 3B3AA 2CHGA 3FOWA 3ZW7A 1DOZA 2PUJA 3NXKA 1YFZA 3A1EA 3JALB 5ARDA 1D8TA 3ZQ6A 5M04A 4U7PB 1GPAA 3W8NA 4FMCF 1ZUNB 5I7EA 2OAP1 2R6DA 4JL8A 4O4HA 4QPZA 3LTNC 4QBGB 3K0AA 1CPYA 1JQDA 1NJ2A 1SCUA 3CBQA 3PGJA 3QKUA 5D86A 2DFTA 3JAWB 4G9EA 5CVDA 1RQXA 4GRDA 5T8KC 4C5BA 1GZVA 2AZTA 3RT1A 4NMMA 2FP3A 3LNCA 5LP6C 1DAFA 1HL3A 2H2GA 4BJ5A 5JYEA 1CETA 3H8JA 3N2ZB 5A9RA 4FGLA 4L73A 2YV4A 1JEEA 3LP6A 1B43A 4U5XA 3V8BA 1XU7A 1Y6QA 1XRPA 2C58A 1D2MA 2XE7A 2DWPA 2YWBA 2ZT7A 3NC1C 4OAOA 4U7HA 1TC1A 3K2QA 3RT9A 1XKQA 3C8MA 2DPYA 2E4XA 2ESRA 3AG6A 1OOEA 4HFRA 4Q47A 5M3BA 1D07A 2I33A 2W4MA 1FX0B 5B57C 3GXOA 2QN1A 1T2UA 2CFIA 2JH9A 5EKXA 2N46A 3AHFA 1JLRA 2RE8A 3V9PA 2ZBFA 3MTAA 5F1PA 3DP9A 1CZOA 2FRVA 1GKLA 2BZ1A 1X87A 4GWGA 5DRYA 2AFIB 1AUVA 2BFEA 2I1QA 3V3TA 4B4KA 2QBYA 3IMKA 4CODB 1M83A 1TGVA 1Z8NA 2A9JA 1A9OA 1GPWB 1YR2A 2CFCA 2QTCA 1M74A 3NNSA 4K9NA 4A6DA 1R4ZA 4BNLA 2GBGA 2JBAB 2QD2A 4O4HB 3K0AB 5IAJA 4R8KA 3CKLA 5EA2A 1SCUB 1X13A 3W9UA 1RC8A 4XVRA 1NTOA 4Y2UA 6LDHA 3LDHA 4K3UA 1S9HA 3PFHA 2J85A 3CNEA 4DUZB 1O6FA 1ATIA 1FVHA 3BE5A 4ND7A 3RG2A 2QR3A 4ZU6X 3AKDA 5TQJA 1R0KA 1OX6A 5E8JA 3VC2A 4RSRA 1FDWA 3O4VA 3PFCA 5F1KA 2XUGA 1H9AA 1C4WA 1H3FA 1VIAA 3TTTA 2GERA 4BIIA 3LXUX 4DRZA 4YJ2F 2Z5FA 4QO7A 3ASUA 1JECA 5GOZA 4AJKA 3VOSA 1LK5A 1VYVA 1J07A 3H87A 3OF3A 4KVZA 4CM4A 5C8YF 5I9IA 3DXFA 4R40A 4CF5A 2VT6A 3MLEA 1WJGA 5JARA 4MUIA 4HGYA 1TK9A 1WQ3A 2XRMA 2VUIB 2RKBA 3AF5A 3GCGA 4WLEA 2QBYB 3WLAA 2GHQA 4K9KA 1A9RA 4UCQA 1XXHE 1L7AA 5JO0A 4EDFA 3CIOA 3OCCA 1JEJA 2DLNA 4YRBA 3KQWA 2WAOA 1B1CA 1U9IC 5DRTA 2DJ5A 1QO0A 1P77A 3LBFA 3DHNA 1H8HD 4DLTA 3IUQA 5EPEA 5CFZA 4KFCA 2IPNA 2F43A 5I7UA 1NBEA 3CZRA 5AM1A 4EG3A 3ZHYA 5ADUS 4Q3NA 2O5CA 3GPLA 2VJDA 3Q7PA 4QTXA 3OTQA 1WDLA 3K4HA 3G2LA 5LYJA 2EU8A 3E5MA 2Y9PB 2JGKA 2NT4A 3K09C 3U3DA 3FUUA 2JS7A 4GC5A 4AMUA 5C7LO 1SHZA 2GBLC 3L40A 3AR7A 3S6JA 4RVCA 1X1CA 1YC5A 1WRBA 1J39A 3BK1A 4LHYA 4WADA 1V2HE 4S2UA 3HV0A 3QWHA 3Q8WA 1NUPA 2AG1A 3LAWA 1UMCB 2C7VA 1JHXA 3GI1A 3I2KA 4FXOA 4CM4B 1PU2A 2YJ3A 5KOHA 1AMOA 5IX8A 1L5VA 5DVZA 1U0HC 1VCMA 4JFRA 5A4JA 4P5PA 3EGWA 5AI6A 4G84A 1JFFA 3ECSA 3FCEA 1G7CA 1DQZA 4FM9A 1MA3A 1OAOC 3WWCA 5I5EA 1YRBA 3VPGA 3KZ1E 3LF1A 4OA8A 4DXHA 2K7FA 3AU9A 4GSLA 1YE5A 3CZ5A 2C2HA 4DIMA 2QRZA 4QUHA 4U63A 1IY9A 1WXIA 2F43B 2YZ2A 5IJ0A 3B20A 1XCMA 3ER6A 4CKBA 2WUEA 1JTFA 1ZR4A 4CV0A 2CMHA 3QBJA 1B6GA 5BMOA 3QYPA 4YFYA 1TUBA 5LYJB 5B64A 1T8TA 2UZAA 4AUNA 3T9CA 4BMPB 4E5SA 2MWMA 5DHSA 2PUFA 1TYBE 3P4UA 2H8GA 3G0GA 1FDUA 5BSWA 4KFUA 3IALA 3G0HA 1PUIA 3EIFA 4PGGA 2PRSA 2BE7A 2VJQA 2PTHA 3B13B 3RVDA 5LKRA 3MWDB 2VT2A 5DM1A 5LBTA 1E9VA 4TLDA 3RBAA 2C3UA 2A0WA 3IHKA 3ROXA 5KOHB 4QPDA 5F9FA 3UHPA 4JI3B 1NC1A 1TCUA 3BFKA 7REQA 3OTHA 5KSYA 3OX2A 3AEYA 3O2JA 3GBPA 4NYJR 1M0SA 1B4DA 2BFAA 3LL7A 1JFFB 3X1YA 2QVGA 4N5LA 5GP1A 2OHGA 5AHRA 2GRAA 2P9QA 2I55A 1OTYA 2QZ9A 4IWYA 3VVLA 1RBZA 1I32A 3A0RB 3PDIA 1FSPA 5C1OA 1T8RA 2HJHA 5IJ0B 2IRWA 1X0XA 2MINA 3KPYA 2A9OA 5AKZA 4CKBB 4F2WA 5T8KA 5IN4A 1KR2A 3D3WA 3OUUA 4TVOA 1G9XA 4Y6OA 2I3ZA 4UE6A 5AYVA 1TUBB 4ED9A 1EQ2A 4MV1A 4E51A 1E0KA 3PTLA 2X4LA 3BJEA 1DWUA 1XZDA 3BOSA 2VK1A 3DMGA 1F1BA 3OJEA 3K0FA 3H3XA 3U9LA 3T94A 1OYWA 2ODWA 2J6IA 4J2TA 2W37A 3PIRA 4L0MA 5EJ9A 4D8VA 1I7NA 4M36A 4YACA 1WDTA 1U7UA 4WCFA 3T9AA 4CZ2A 2WM3A 4TSFD 4IGEA 4YUZA 1PE0A 4H6PA 3KB1A 1M2VB 4IVNA 4ND6A 1E0SA 2A8YA 1T9DA 3IUBA 4I6JA 2G1JA 7REQB 2Q0SA 2B0CA 2JCSA 1YJXA 1Y98A 3GFVA 2DTDA 3LPMA 2EZUA 3OLWA 3OAAA 4OHMA 1JG7A 3RSLA 3ESQA 5ARBA 3DBIA 3RJ5A 5A3QA 4B76A 3GNLA 1VPLA 1S1CA 3GLIE 4C4ZA 3AR9A 1FYFA 2PZEA 3KLMX 4EECA 1DTEA 5J5VA 2YVUA 1TT5B 3F6YA 4PS1A 3QW2A 4TL8A 2ODBA 3PDIB 4UQLA 3GGOA 1M5RA 3EGOA 4Q39A 4KWTA 4R9NA 2VYQA 2YV1A 1F9EA 3RC9A 3TW4A 4EB6A 5DHTA 4OGFA 2JD2A 5DNDA 1PGNA 5JADA 1QHEA 1UBNA 3K6KA 1DRWA 3D3WB 3L8HA 5JQGF 2QTWB 3N28A 4NYIR 1CNEA 3MGCA 4A4DA 3HCAA 4WX2B 3DKKA 4OO3A 3ZH9B 1Z6XA 4G0MA 3GL9A 4PX9A 3V3KA 1BJKA 2R6HA 2JKZA 3BSWA 1RAAA 5CDHA 1ZM2A 2XQFA 5JMWA 1VLLA 2EXXA 1EVZA 1ZLYA 1OWLA 2CHVA 3L0DA 1QVZA 1QCYA 2FG7C 2GEBA 2OCBA 3OTIA 3Q88A 4WCFB 5F9MA 4DN6A 3R6TA 1OBOA 4ZVVA 1PJRA 2YW9A 3RABA 1JLMA 1RBQA 3UMRA 3WL7A 1WW3A 4N0QA 1P5ZB 1U2QA 4YCJA 4CM7A 1ODJA 2BLNA 3V8MA 2XGSA 4NKRA 1E7WA 3CTPA 2WJIA 2V1UA 2C3YA 3B12A 3G5MA 1I14A 2OBLA 3U1TA 4LZWA 2H1IA 1AK9A 3BEDA 2HRCA 1AKQA 1GG5A 1ZL2A 3FDJA 3JQAD 4UHJA 3DC7A 4YK7A 3FTFA 1LTHR 4QM6A 2WYIA 4Q03A 5E4YA 3RC8A 3FLEA 5IAAA 1JXAA 1WMBA 4EB6B 3G23A 3MT8A 4NEQA 1Q3HA 3LF2A 5TY0A 2FG5A 2YW2A 5BSEA 4YCSA 1MORA 2DAPA 3R23A 3X2FA 3Q0IA 1N5JA 1NVEA 1EFTA 1PJ4A 2Y77A 1L4GA 3ZCSA 4UJ5A 1A50B 2CNWA 3DDOA 4U2BA 4RENA 2C84A 2W6JD 1XCOA 2EW2A 4P33A 1YE8A 5FWYA 2NQTA 1JSXA 4RFLA 1RM0A 5EQJB 4U2CA 3MT9A 4IILA 4XD7A 2GBLA 4LWOA 1DEXA 1EXWA 3PZRA 1EQUA 2O1SA 5TMBA 3HKBA 3OG9A 1JT9A 2GH1A 3F9IA 4KQFA 4EI2A 3OQOA 1J22A 4GWLA 2HLNA 4A2CA 4L1KA 4KNWA 2HOQA 2QDKA 1A5AB 4G26A 1ISPA 4F6CA 5K0GA 1SVKA 1WBBA 1FNDA 3HFRA 5A0FA 2AB0A 1G2QA 2A58A 2QQ5A 2YINC 3WBJA 4K40A 4EY8A 1ABEA 2P27A 2VL7A 1XRJA 1OAOA 4ZI5A 5DGTA 4MO9A 2Y71A 4F2DA 2WD7A 1L3CA 1R1DA 2E4UA 3GRZA 1H5UA 5SZHB 3ECCA 2GUGA 1VBMA 2ZIXA 2YJ6A 2IEYA 3NIFB 3ZOZA 4Q16A 3JD2A 3M4JA 1OMOA 1UPXA 2H48A 4IEIA 4YWHA 5DM70 1EMDA 5IDVA 3WGKA 4K3VA 1S3GA 1QP7A 4NDNE 3QITA 3RUHA 3FHOA 4BKMA 2TSYB 5HBRA 3HZHA 2X6QA 4DR4B 1RKVA 2FUKA 4HDCA 1CE8A 4G0ZA 4ICIA 2P62A 4CE6A 3PEFA 2ZBRA 3EUEA 3CG0A 4AJNA 1KA9H 1E4EA 3HKBB 3TQFA 2HN9A 4P34A 3TZQA 3HM2A 5G53C 3I0MA 7YASA 1NMZA 1C80A 1EP9A 2PM8A 3HU3A 3IDAA 4LZZA 4MCIA 4XYBA 4ZOEA 4XQCA 3FBTA 4TL6A 4QO8A 2I7DA 3CT4A 4CIXA 1NQVA 1AS3A 2OT3B 3D6UA 2HR1A 1JSCA 3VSDA 5IH3A 4JQYA 3FSRA 821PA 4CN8A 1WD5A 3ZIAD 2I87A 4UUBA 4AMZA 4DLRA 4RIHA 2WD7B 1KE2A 1WXWA 4JI8B 2PZLA 4P7KA 1C30A 2PEYA 4BYGA 2ZIXB 4Z99A 1SCQA 5FOSA 2BFNA 3L1IA 3OD1A 4QUKA 3EDYA 1YH3A 1V1JA 4O4LA 4I3HA 3BX1A 4BX3A 4TPKA 1VLMA 1A9ZA 4MI3A 4JC8A 2H4XA 4OOEA 1TPZA 3JR7A 2I7TA 2C2MA 2VHTA 1CY4A 3AFHA 1SBTA 3FNIA 1PG0A 3L02A 5EYPA 3GLVA 1J49A 3ST7A 2ZSKA 3TQCA 2ZDQA 4BC0A 5IT0A 1CE8B 1PJLA 1UOEA 4M9UA 4MQBA 3IBSA 5FQOA 1O87A 1XAIA 5EJ2A 4C03A 1KGSA 2FZEA 4XIIA 3KT6A 4J4HA 2I5PO 5TC4A 3INYA 3FVWA 4A0HA 1E4EB 3L7IA 1YRWA 1TRKA 2ILVA 2Q9CA 2UUPA 2Z5VA 3P9QA 1VP9A 3ZE9A 5I7OA 3LKBA 4RHXA 1ADBA 4TXMA 1W1IA 1ZSVA 4Y1RA 3RVJA 5J2TA 3G8BA 1KKUA 4R69A 1HF3A 1LKZA 2OXFA 3ZWVA 1FBNA 1QMPA 3MMZA 1RM5A 2X2FA 2X4IA 1KKMA 2CHFA 2I6SA 3Q5GA 2JNWA 2XWBF 4TL7A 2HSJA 4C43A 1R74A 1REQB 1ADCA 1UZNA 3EDCA 1HL7A 1Z37A 1XEFA 2XRFA 1YCGA 4D41A 1DUSA 5HS4A 3GDHA 4IIGA 1EEHA 4IHKA 3FCXA 4Q4JA 4R9VA 2I4LA 3FF1A 3WLPA 4NCAA 1C30B 3A3OA 3HKEA 5C3UA 2V7WA 3U3ZA 4F12A 2RCNA 1BNCA 2GWRA 1U0OC 4WKPA 4MIKA 1LX7A 1S8AA 3KDAA 4GPIB 4IX9A 4O4LB 4X24A 3UT6A 3TB6A