2HBRA

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACAGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 47
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hbrA00
4NBNA 2Y1LA 3KJQA 2WDPA 1RHJA 3V3KA 2QLFA 3NS7A 1K88A 3DEKA 4PS0A 3V4OA 3H11A 2XYPA 5IASA 5IARA 5H0IA 4JJ7A 3D6FA 3K7EA 4NOMA 4QTXA 2J31A 4N7JA 1ICEA 1RHRA 1SC1A 4FGUA 4QU5A 4PRZA 4QUGA 3BIJA 4ZVPA 3SIRA 4D3XA 2XYHA 2DKOA 2Y0BA 2HBYA 3P45A 4EHNA 4QUAA 2QLBA 4AWBA 1RHKA 1IBCA 5I9BA 2QL7A 4QU0A 4JR1A 5LUAA 4JJEA 3GJTA 3IBCA 2H4WA 1I4OA 3IBFA 4JR2A 4D3YA 4EHLA 4EHDA 5LU9A 4JQZA 3D6HA 1SHLA 2CNOA 4N7MA 4QUIA 2QL5A 4JQYA 3E4CA 3P4UA 4PS1A 1RHQA 2NN3C 3H11B 1RWVA 1RWMA 1KMCA 2XYGA 4JB8A 5IBCA 5IAGA 2AR9A 4JR0A 3QNWA 4FDLA 2C1EA 4QUBA 1RWNA 4ZVRA 4EHAA 2CNLA 1NMSA 2P2CA 5IAEA 1BMQA 1CP3A 1RE1A 3NKFA 4ZVSA 4LSZA 4JJ8A 2H5IA 4N6OA 4I1RA 2H51A 2HBQA 4EHKA 3NR2A 3GJQA 3EDQA 3PD1A 2C2OA 4N5DA 4AWAA 4QUEA 4DCJA 2XZDA 2HBRA 1I51A 1CVRA 4NBKA 2J30A 4ZVOA 5K20A 4QU9A 4NOJA 3PCXA 4NOLA 4QU8A 5I9TA 2CNNA 4EHFA 4IYRA 4QULA 3V6LA 1RWPA 4EHHA 3V6MA 2H5JA 3KJNA 3DEJA 4DCPA 5IC4A 4IEFB 1I3OA 3D6MA 5IABA 3OD5A 5LU8A 1RHMA 3R7BA 4DCOA 3R5KA 1M72A 3DEHA 1GFWA 1QTNA 1SC3A 4N6GA 4FEAA 2FUNB 4EJFA 2H4YA 1SHJA 3GJRA 3V4LA 3R7NA 2CJYA 4FXOA 4N6NA 3ITNA 1K86A 2XZTA 3DEIA 1RWKA 4PRYA 4QTYA 3S70A 5LUBA 2QLJA 1F1JA 2K7ZA 2H65A 2H54A 2C2KA 1RHUA 1PAUA 3H13A 1F9EA 1QX3A 4D3ZA 2CJXA 5IBPA 4M9RA 4NBLA 1GQFA 5JFTA 4AW9A 5IAJA 2CDRA 4ZVTA 4HQRA 3R6GA 5IAKA 2J32A 3SIPA 4QUHA 3GJSA 2J33A 4NOKA 4QUJA 2FQQA 3EDRA 1NW9B 1I4EB 4ZVQA 5IC6A 1QDUA 1NMEA 2H48A 1NMQA 1RWWA 3KJFA 2CNKA 3UO8B 1SC4A 1RWXA 2C2MA 2HBZA 3R7SA 3R5JA 3H1PA 5IBRA 1JXQA 1RWOA 1PYOA 2FP3A 3UOAB 3R6LA 4ZVUA 3RJMA 4HQ0A 4QUDA 3V55A 3PD0A 5IANA 3S8EA 4HVAA 2C2ZA 4I1PA 3H0EA 2QL9A
chains in the Genus database with same CATH superfamily
5KOYA 2DC1A 2NVBA 1FYFA 1C2YA 2VP3A 2W9XA 4QELA 3VFDA 1R18A 1Q12A 3B1ZA 4HZGA 3ZI4A 2I6QA 4OK5A 5E3IA 3OU6A 2ZUEA 2E6UX 3ZV7A 1F8YA 5BRJA 3QU4A 1JIIA 2V5AA 5T3UA 3P2YA 1KOGA 2EEZA 1WDWB 1XVAA 1M1XB 1G0NA 4TVOA 5AXCA 1O58A 2JFBA 2XEDA 3G02A 3LIIA 2HRBA 2XT6A 3Q6IA 3WRYC 1AKEA 2OAGA 4OP1A 2ZE7A 4MV3A 1ZGCA 1EGMB 1UFOA 2UXDB 2HR1A 4OLHA 4DGQA 4MLPA 5FYDA 3N05A 1PZFA 1HLFA 3IQZA 4HUTA 2OY0A 4M8IA 2XF8A 4R9SA 4EF4A 4QBGB 1P19A 1JBQA 2P5YA 1NHGA 2JGKA 2XTMA 3G0CA 3SX0A 4CV2A 1W8IA 4NE2A 2GEVA 1J24A 4UUPA 2ZJ8A 3A9WA 3ORSA 3PKJA 1OFIA 4HHEA 1J0AA 1R3UA 2DSTA 1RM5A 1RADA 1GV1A 5KI6A 1BVYF 1FEZA 4H2DA 5I47A 3TJZA 1M2FA 3W05A 3K8OE 4LYDA 3I5XA 4TSKA 2V0CA 5ICCA 1EK2A 1WHSB 4PCVA 4BEJA 4QQNA 2XRMA 4OMDA 1B0PA 3NTQA 2FNAA 1XZGA 1NBEA 4V0KA 5CEEA 1Z83A 5E4TA 4DR2B 4PFJA 2B6HA 2IWHA 3N0WA 4NCHA 1LQTA 3LCRA 4ROSA 1P77A 2JI6A 2Z56A 3AI7A 3IOEA 4IYRA 5U9CA 3EPJA 4ALIA 4AY6A 1AG9A 4TV8F 3VHXA 1I2ZA 2XWQA 3S5UA 4YJHA 2F1RA 3CZ4A 3D8RA 4I9HA 1E2JA 2VYVD 3CSDA 2A94A 4XXHA 4OGLA 3O7WA 3A2MA 2DWOA 4ALMA 3J7TA 3NWBA 2FPGB 4X1KA 5JRZA 5F7ZA 2Z8YM 4PAOA 1E1YA 3FTQA 4J7XA 3DDCA 1L5MA 2YFYA 1KS9A 4KREA 1PJSA 1G21B 2ID9A 2YN2A 3HXPA 1W5FA 2MHCA 4QQFA 1R8JA 3WGVA 4DSUA 1NIPA 1PUXA 3HEAA 3PRKE 3UTDA 4YCMA 3AO0B 4TUYF 4DLKA 2N42A 3IIMA 3KQTA 4ARZB 2PS3A 3PWZA 5J2TB 1QH0A 4EY7A 2HA7A 2PBZA 2Q3MA 3GBVA 5IBPA 1Q2UA 4G0MA 4X65B 4C7OA 3HUFA 3ZIAD 2ACEA 2IYLD 2IBMA 3L0OA 3T3DA 5JSQA 1CNFA 2OLKA 5HRUA 2V7XA 2CXSA 4M76B 5DTMA 1J33A 3VOBA 1X80A 2JS7A 5LLTA 2ZI9A 1MX9A 4NOKA 5GP1A 5IKOA 4R0MA 1VXOA 3UW3A 2ZJ5A 2OBNA 4FK8A 5FBZA 4KXFB 1BDMA 1KSGA 1VKHA 3HA2A 3F8SA 3QKIA 3R5JA 1HYBA 2IOHA 3I64A 4X62B 4I7EA 3B1WA 3LL7A 2FP3A 3ZK9A 2WKPA 4EVRA 2AFIB 3K9BA 4AL4A 1E69A 5I7VA 1Y7TA 3NAMA 4JHXA 3HB4X 2PRYA 2RG1A 2QY6A 3A3OA 4OBWA 2FMFA 2FQ1A 2XB6A 2I33A 2BFNA 3QZUA 4KH1A 4L74A 1BMDA 4OF4A 1EM8A 3LCMA 2NVUA 2WJWA 2H4HA 1ZRHA 3BUSA 4LVNA 5F3DA 3ZIDA 4F8EA 3AR9A 3O0TA 3P27A 5LQCA 3CMCO 3FMPB 4DLWA 1VPTA 1OFVA 2NQ2C 1RQRA 2BFCA 4BJ6A 4DSZA 3NNNA 1S8NA 4JEUA 4KZPA 3SJBA 4FDAA 2A92A 2WPDD 4QYWA 5HF9A 5TF0A 5IFKA 4OBXA 5B12A 3NX4A 4B3SB 5CW1A 3LC7O 3RVOA 1MO4A 1L4KA 5CXQA 1N5JA 1LWOA 4I4IA 4U00A 4Q7QA 4NYJQ 5JAPA 3HR7A 4EJ0A 1L4BA 4LYJA 4WXHA 3EGOA 4K9PA 3KOZA 3Q3CA 2G5TA 4PPNA 4D9BA 2FX5A 1P0QA 5CH8A 3DV0B 5DV9A 5FL7A 1Z4LA 4II3A 3RRNA 3SK0A 3RVJA 4GOMD 3ZXSA 3NWPA 4DIKA 2EJCA 3RV3A 4YP6A 3RTGA 5EUBA 4DC9A 4ZZ1A 3A28A 1TQ8A 1AJEA 4FKBA 4BRSA 2HPVA 2YWGA 1ZINA 5TQVA 2OXTA 1KARA 2HJWA 2PSJA 1K98A 4JWKA 3TRHA 2VYNA 3QV2A 3OPXA 2ABWA 4DCCA 1ZQ1A 3D8HA 3EWIA 2F43B 2K4MA 1T91A 1TMYA 5FB3A 4D9NA 3GLFE 1IBLB 3HO1A 1HLPA 2OCBA 4CTKA 3NU1A 4Z4CA 3DG9A 3FSEA 2PKEA 3DVSX 3KT0A 3QKSB 1UDAA 5JCJA 3TAUA 1MX1A 4EZEA 3OPMA 4E03A 1VRCA 3D4BA 2QRNA 5K4AA 3LVQE 4QOJA 2JJQA 2G8LA 5TY0A 3TG8A 3E9NA 3K6RA 5F2OA 3T52A 2IZ5A 3ZLVA 4FB4A 2H1LA 4FYXA 3RC2A 1VI6A 5TQ2B 1I1OA 2EQAA 3D6MA 4B82A 5HRAA 4OAOA 2V3CC 4KPUB 5B36A 4B43A 1EJ6A 4TM7A 3SSMA 4XYMA 2BHTA 4GZ5A 3WL6A 3FOAA 1U3DA 4INJA 1IG0A 1CF2O 3SXJA 5FWNA 2BYTA 3Q7PA 4BZWA 1DFHA 4Q48A 2C4MA 2ID4A 2P1RA 4DWOA 2XRZA 4NCJA 5TF4A 3E22B 3OZCA 4WN9B 3I9V1 4PAWA 3D1JA 2EC5A 2ZPTX 3OECA 4BKPA 2VUSA 3BWYA 3K9WA 1QQ5A 4R4JA 5TVGA 4FWTA 2AYYA 4Y1RB 3ZQKA 4MRMA 3FHOA 2AZXA 1EB9A 5CJ2A 3FVVA 4FYPA 1N2ZA 2OCDA 3OFKA 5HZGA 1Y6ZA 2C2XA 4A8TA 3A2LA 4JDUA 4JLSA 3L7AA 3B20A 5SYNA 2O1WA 7MHTA 5T67A 1XTKA 3ANTA 3AY6A 2Q5QA 4Q19A 1NXTA 1GNVA 5FTKA 1U3CA 2BE7A 4YDSA 2GN4A 4YMLA 2JIOA 2Q2QA 1IIBA 1CDEA 4GAEA 4UTVA 1D6SA 4OYRA 1WXWA 2AIRA 1XJQA 2VHUA 2XUZA 1ENZA 1T1GA 4HEHA 5AHKA 3WWZA 1NC3A 3RV4A 1GPAA 3QY0A 4RH3A 2C00A 5AJYA 1MB3A 1IM5A 1T25A 2Y8EA 4ESVA 1XPUA 3BZUA 1M1YB 1ZVJA 3R5TA 2DERA 3GVXA 2Q3FA 4DY6A 5IDQA 2EZ9A 5AVZA 5DX1A 1DBWA 3JAWA 3D6UA 1WV0A 4JS0A 2DBRA 2O7SA 4COKA 3JQGB 1TQ4A 2FG7C 4UNQA 3VR6H 4XWOA 3H65A 1SUPA 1UKYA 2XH8A 5EMMA 5FPPA 1PTJA 3IVCA 3KU1A 1JKIA 1E3JA 5JQGF 4Y8VA 1QRTA 5CT9A 1G6Q1 3FPCA 5EHXA 2H92A 4FGZA 5K8CA 1ZAKA 4LSGA 4QE3A 4FI3F 4RSHA 3UXHA 2P4HX 3ORRA 3WRXA 4GGPA 5D8DA 5JIBA 1GRQA 4NONA 4TRRA 3EZNA 1E4EB 4GKJB 3U7JA 2D0OB 1B7GO 3JVIA 3K9HA 2X13A 4QARA 4UTXA 3VSBA 4EMSA 1QCYA 4ER5A 1F60A 1RWBA 2E48A 3QKWA 4IIFA 1YB1A 4OTZA 5C1PA 1JN0A 5GIOE 3RRXA 4H6WA 3OZGA 4JX8A 4P8RA 1CQJA 2O2JA 3KJEA 2AOUB 2ZVDA 4YFYA 4CL8A 1EB8A 3FFTA 5AI8A 5EKTA 2VXOA 3CUWA 1NDHA 3ASZA 2JF0A 4P1ZA 1BX1A 4RVHA 3K70B 2CUKA 5DF1A 5TMPA 4CU5A 5I7EA 2J3EA 4KGXA 1TT7A 4OA8A 9LDBA 4U7HA 3Q8MA 1SHUX 1U1DA 2HT6A 5BQPA 5CG1A 3FPJA 2XRYA 2EDCA 5ESXA 1DUSA 4QQKA 4EF5A 2D4HA 4V2IA 3TQQA 5FHQA 4RD0A 2IV7A 4LZZA 3QEOA 4YO7A 3AUAA 4HX2A 1M2VA 1ISRA 1C80A 2VOEA 3ZDZB 3C3DA 1FP4A 2GEJA 3T5CA 4A6DA 3PC8C 4TTSA 3UF0A 4TT3A 5HXAA 5L53A 1B6GA 2PUBA 4LBWA 2JHFA 1LPBB 2AR0A 4IW3B 3GU3A 2VRNA 5EPUA 5FDFA 4E32A 2Z4TA 1N5DA 2XMDA 3DUFB 4IDAA 4BVGA 2CLIB 2GK6A 3CNLA 2POCA 1QQAA 3N8NA 3QLVC 4YRDA 3DP7A 5I6DA 2NXWA 1H2XA 4CKBB 2O6LA 3B12A 1E9EA 2BR3A 1OV6A 3KZMA 1T6XA 1J2RA 2GYWA 3O83A 4JA2A 2X8LA 3C74A 4ZI3A 4FXOA 1G59A 1K3TA 2F6RA 3AQIA 3AR4A 4LHYA 4TWBA 2UZ1A 5CUQA 4R2WA 4W9RA 3VI4B 4F4CA 1L3CA 4YMUA 1GDTA 2ISQA 5ILGA 5BN1A 3B1VA 1KAEA 3MTGA 1R64A 2IX9A 3DEYX 1BHQ1 2F3PA 3AHDA 3U4QA 2PGXA 3JARB 3OA2A 2X0FA 4JU8A 3LGSA 3NIGB 5HM8A 4B83A 1YFLA 2O8BA 1LKZA 5SZIA 1EKXA 4MPPA 2IHKA 3N53A 2NUTB 1SHTX 5EMNA 4EB0A 2XMBA 3UMVA 1R4AA 1VKOA 2HRRA 5EIEA 4XEUA 5BWCA 3BULA 3JVUA 4QDTA 1UKAA 4PC3A 3R7SA 2GHQA 1EK6A 2AKYA 2NU9B 3DW1X 1TU0A 4G67A 1H22A 3IO3A 4AU1A 3H3JA 3SEZA 4DT1A 1ID8A 4WDQA 1U8YA 2GTIA 1GDDA 1IEWA 3DH0A 5L7WA 1PHRA 1USKA 3BZWA 5AJZA 2WDPA 4ZQBA 3E6AA 2ENUA 1LEHA 1M1YA 1KWKA 4FOPA 2ZWPA 3UWOA 3BFPA 3KALA 3BCUA 3AKDA 3OEYA 3CC8A 3GFBA 3BD7A 5JDIA 4EJ2A 3FUTA 4B3FX 2RH8A 5F5XA 3EQ2A 4S3MA 1U7XA 3P8ZA 5A7GA 2BKVA 4M87A 4NZYA 3ZWPA 4EUNA 1BSVA 3AEUB 4RPHA 5J1TB 4GXNA 3LQYA 4MX8A 5HVNA 5AHWA 1A9YA 1R4NB 2LUOA 1ODJA 1DRKA 1SOVA 3MJVA 4RK1A 1VYVA 4Q9DA 3O21A 1RYFA 5JH7B 4DLUA 3FNHA 1RLJA 1NMXA 3EDOA 2CV2A 1M8FA 4RZHA 1PK7A 1QOZA 3ZI0A 2PEYA 1QVAA 2HDWA 4IQGA 1CNMA 4M88A 3HI6A 3I4CA 4M1SA 4YALA 3IQDB 7REQB 1EFRD 1GG5A 2C83A 4R3WA 3LM8A 3FDFA 3TCNA 2JASA 3L0BA 2AI1A 2Q07A 1V9LA 5DSXA 5FH9A 3PWSA 3V8NA 1NQUA 1U90A 3G8CA 3AETA 3GQVA 4WFKA 3RS8A 4CTNA 2O8DB 1MIOA 2NZXA 3M6LA 1X0VA 2QY9A 5BVHB 5JYEA 4J75A 1C7QA 1KR2A 3ONVA 1F8FA 3ZHOA 4MNTA 3NPMA 4FD3A 2IZ1A 4JOQA 4ARBA 5AIBA 1O8CA 1J39A 4ZZIA 4Q4DA 1QH9A 1BX3A 1XRPA 2J0VA 3TMKA 1KYWA 3GRYA 1FJHA 3PPYA 1TPYA 3H5OA 5CDSA 4BWGA 1WCXA 4KSCA 2IEGA 4UULA 1Q1BA 2MTBA 2Q8QA 3JQBC 4LOKA 3A2KA 3KLBA 1YH3A 2FEXA 2N1BA 5SY6A 1V1MB 1LBTA 3SGLA 2RONA 7REQA 3UT5B 1AQJA 1R0CA 3HKEB 3FUUA 4DLVA 2PUDA 2P6PA 3S2YA 1SXJA 4B48A 3COJA 1F2DA 4RK4A 1EESA 3ZXUB 4EJFA 4MEBA 1JZQA 1N9GA 4AXBA 4IQ0A 2GXSA 3TLEA 4HWPA 1HKHA 2NTNA 3P9YA 2QTZA 5E9QA 1ZYUA 1E18A 1VYTA 3N3BC 1T8RA 3A1TA 3PGMA 1EXNA 5A3RA 5IT5A 1VGQA 4UTPA 5EN4A 1AQUA 4BQIA 3ZI7A 2IPXA 5CDFE 5JCPA 2ZYWX 3A25A 4GQIA 3CVJA 1AN0A 2L19A 3FOWA 5AJTA 3MA0A 1N33B 4HX5A 3LI2A 4K88A 5HIIA 4RF4A 2YQ5A 2H29A 4MARA 2NTYC 4PPFA 2P4UA 3AMVA 1N0HA 3BFKA 1IL0A 1Y80A 2C8JA 1KBZA 3GGDA 4DRXA 4YJFB 3EARA 3JPWA 2QJOA 2WHXA 4N5LA 1AURA 4P92A 4QPPA 1I2AA 2PFKA 1KZ9A 1G9SA 2P2ZA 3L1JA 3AVVA 2NTJA 3NP9A 3Q5DA 3VSCA 1DWOA 4K6GA 3WKEA 1Y33E 2W2OA 3OU7A 4JC0A 5HCIA 4ML3A 3I92A 5DE3A 5C51B 3A1NA 2FPPA 2QD5A 3WLKX 1V16A 3LL4A 1Y3IA 3AHGA 4WBNF 5LLSA 2VPTA 4ZIRB 3ZTYA 4KQFA 1NW6A 2Y1WA 3FB1A 3HBMA 3PZBA 2G5CA 1GUBA 5JEDA 1C4OA 4KJZA 2LDXA 2B2NA 4J76A 1FMFA 3WYDA 2VUTA 3JYPA 4RK6A 4XX1A 2QW1A 3UH0A 3W0LB 3LHDA 3BQNB 4QBTA 4WVFA 1CVIA 4YROA 3ZWVA 3SMVA 1N6OA 4CL3A 3A14A 3EUWA 3F1KA 4E07A 1V8PA 4PE5B 1QR2A 1QIKA 4DPKA 2Q0SA 2FZLA 2R6GA 5A62A 1GNSA 1X1SA 2GK7A 3I2GA 3W5IA 3Q3EA 3HL0A 1JEDA 4KR2A 1NVBA 3IUQA 5GJCA 5D7BA 4WDRA 3ETJA 1QO0A 3NRJA 4RHFA 4CUKA 2WWYA 4IWYA 1ZN7A 2HQRA 3KELA 4H7IA 4MI6A 1PWEA 4B3IA 4ENSA 3WC4A 2ZRKA 1NVEA 3BA6A 2M6SA 2QAIA 3BBPA 3EDYA 1XA4A 2V4UA 3GZNA 3LXRA 4QTZA 4EQ6B 1XRLA 4DVJA 4DR3B 5AW4A 1BYUA 2O2HA 4JBLA 3REQB 5AYVA 1F48A 1AXEA 1JG3A 4RVCA 5REQB 1UFQA 2XSZA 5EVJA 1SXIA 4A73A 4YR9A 5FKJA 4C3VA 1CJTC 3MPOA 3LE8A 3DFIA 2C7GA 4CFYA 1YRHA 4ARSA 4CI0B 2X6QA 3AINA 1ZOLA 3IP6A 1QLHA 1OI7A 1O6GA 3EMBA 2ZTVA 4GF5A 4G0NA 1IOZA 1DO0A 1TF7A 2RGDA 3NALA 4NEQA 4CM9D 1IZ9A 3M7IA 3WK5A 2C8KA 2GD0A 1VP9A 2AQKA 3EXHC 4KN8A 3ADKA 4NARA 5CX4A 4BC1A 3A26A 3GGJA 4MGHA 5AI6A 3RC3A 4HNUA 4ESEA 4KK3A 1ZR2A 2C2YA 2KS6A 3R24A 2AFHB 2SKDA 5FA8A 1BGWA 3EWSA 4KPGA 4KXLA 4EA7A 3HVRA 3SAJA 3DBRA 2E89A 2FYTA 5JMWA 3E05A 2J5KA 4E5KA 2G4CA 4R9UC 4CMCA 2NIPA 1MVNA 4OL0A 2LIPA 2PBLA 3SG0A 5J2UA 1QDLB 5JTTA 3UMGA 4WXMA 3U49A 2CMGA 4RWZA 4E12A 2I66A 1JAYA 1G7TA 3IEPA 3KYJB 4PY2A 4BV2A 4DE5A 1OKKD 4W9NA 3WLTA 2G63A 4YLGA 4NQZA 1N5MA 2DPXA 5LIPA 1T5DX 3M1LA 3UBMA 2QVCA 4YV7A 1BGVA 2ZIWB 4LJ7A 4J2HA 4PN3A 2AFRA 4TWRA 3DO6A 1Z0KA 3L8DA 4ZANA 3V8VA 3GPCA 1GSOA 1O0BA 2QTWB 3F7NA 4U7GA 5JZ9A 1Q1NA 3TQSA 2IH5A 3GLQA 1EFUA 1E9VA 1JJFA 4EQZA 1F3OA 1PI3A 3EIHA 3WG9A 3ZDCA 1DT3A 3PFWO 3MTJA 3I6BA 4RHCA 1BC5A 3W7BA 4QNRA 1YDFA 4DUGD 3TLGB 3AM1A 1EUDB 4FZ3A 3I04A 5CDGA 2GJ8A 2HWXA 2W8ZA 5LVAA 3R20A 2OBLA 4EO9A 4JH0A 1VPWA 1MAAA 2R96A 2IP1A 2GESA 2O0KA 1II8B 3K72B 2BGTA 1LTQA 1N0IA 2Y1XA 2R62A 3IELA 3DE3X 1NF9A 3TQRA 2BGWA 1XQ6A 2P9HA 3VM6A 4EQ6A 4HB2A 4XJXA 2AXEA 3W2HA 3L93A 3SS9X 3DE6X 3G2IA 4UHEA 2JI4A 3SJAA 5A6VA 1GNPA 3ZY4A 1CDOA 4ZVLA 3TDKA 1I36A 1M6EX 3CLSD 3PFKA 1JIVA 3LUBA 4FE4A 4UNRA 5BQ3A 3ZLUA 3ZCRA 2WUVA 2ZJAA 3C6ZA 4GECA 1DJLA 1RDFA 1BHJA 3ABOB 3ECSA 3IALA 4LQCA 5DBHX 1E79D 9LDTA 3O26A 1BRTA 1TM1E 2A9VA 2TRSB 3KC2A 5HA5A 1K1EA 1JH8A 1YVPA 4PZEA 5C2JB 3TLYA 4B7ZA 2ZWAA 2JGLA 1A27A 1YRQA 4M7WA 4AZ3B 4AROA 5F23A 1IN1A 1M2KA 3L8GA 2HU2A 1UJ2A 4NICA 4ERNA 5BOSA 1DV1A 2P79A 5MF6A 3CLHA 1KU0A 5G1NA 2ZRJA 3KQYA 1QO9A 1YR6A 2G83A 2ASVA 1L5OA 1Q0TA 3Q7SA 2EBFX 3QX7A 3QY9A 2RC5A 4F1JA 1ZW1A 3W5AA 2ZFUA 1Z0DA 1GKIA 1IQ0A 3G0DA 2ROQA 2YYZA 5CBKA 3H2SA 3R3UA 1IOVA 2VZ8A 4IDFA 5IS2A 5BNTA 5TC4A 2P75A 3AHJA 3M0EA 3WKBA 4QYSA 1P4HA 1A2QA 1NNUA 4J0EA 5TPWA 4CM4A 4QHSA 4YPVA 2AQIA 4ZZ2A 3TVTA 2PRZA 3DWIA 3UMSA 3IOCA 4HAUA 4UMVA 3V5NA 2LBPA 4YACA 2FW9A 3PWTA 4GPZA 4DLPA 1D4FA 1XEXA 3VU8A 5TRTA 4MO2A 2IIQA 3SCZA 1UBEA 5FWDA 3DMYA 1EUCB 1DL5A 1KEWA 1ZDMA 1CY1A 2DE0X 1N9KA 4I4LA 5H68A 2A5YB 2WD7A 3LDUA 3LSYA 1YRWA 1OT3A 2WTAA 2FF5A 2HF9A 4RF2A 1DIAA 1E7SA 3BHJA 2NZJA 2XA1A 3DZCA 5KTNA 2HSWA 4ARUA 3JAKB 4M1TA 4KPFC 3GMSA 4ZDKA 4JHLA 5ENVA 2IUSA 3H4TA 1DHRA 4GX5A 1E62A 1KORA 3DC7A 3VR6D 1RE0A 2CHUA 2P6UA 1IFXA 2ZQ5A 4BNFA 3OP1A 1FRFS 4XLTA 3WLAA 4F3TA 4Y1RA 4GEKA 3A36A 5K3BA 4DC0A 4WEOA 5EJ6A 4D26A 3UA3A 4ZI7B 4K3VA 5FOUA 1FTQA 3AVWA 5I45A 3CZ5A 4DMGA 2UVDA 3M6WA 1ZOPA 2HEIA 1YUNA 1T9BA 3A9CA 4GI3A 4MW4A 5H3LA 3OKCA 3OZ7A 5HR5A 3HL4A 4ZOLB 5AKJA 5IAKA 4AO7A 3MT7A 1PUIA 2C58A 1PS0A 3C7CB 2EU8A 4HB0A 2B25A 1KO5A 2RGNC 3DTNA 4BMPB 3JQFA 1ISSA 2WJZB 3DLTA 3I32A 4JC5A 4E1AA 2OBMA 4G56A 1KDPA 1U0HC 3C7AA 4MH0R 4OIFA 5EHIA 2JKYA 2VTVA 3DHNA 2FK8A 3WJ2A 3FOFC 4PAMA 1A8SA 1I3LA 3GLVA 4QUDA 3NJ8A 1OCEA 1RACA 3COSA 1XRSB 3HE3A 2TSYB 4HN2A 2OTCA 4JKYA 4ZAGA 3VTZA 4DLXA 5BSKA 2B3DA 5JATA 1RKVA 4BZZA 1Y1LA 4KP7A 5B57C 5ALKA 1T5SA 5JNSA 4UU1A 4NP6A 3JQFC 4JQCA 1O94A 1XQ1A 1JLRA 3AQ4A 2WIFA 1NJ8A 1L5RA 1F9AA 1RQXA 3A2NA 3E03A 3BOSA 2BMWA 3I6MA 5TPWB 3D3KA 1ZISA 3AI1A 3PC6A 4IIXA 4KX3A 4PPQA 3ZWYA 1VZ3A 1RJGA 1GGNA 5T57A 5DMXA 4I4CA 4E2ZA 5KNBA 2I7CA 4H9GA 3RUHA 4Z4GA 3QXXA 2R2AA 3HYRA 2BMVA 4H17A 4U7FA 3HC7A 4ANFA 4RELA 4M7PA 2ZIZA 1CNEA 5T64A 1YNSA 3K71B 4GMDA 3LOQA 3A6GA 3WGLA 3WTCA 4W5OA 1SC6A 1UKCA 1GGMA 4EHIA 3FJOA 2YBEA 2AWOA 3QELA 4FNOA 4LJ9A 4AKEA 5IJZA 5GJVC 5JECA 1FUYB 1OLUB 2XOXA 1JWAB 3N74A 3VOTA 2AE2A 3SICE 1CXZA 1TYDE 3EDCA 1PQYA 3KQMA 2V55B 3C6MA 3JW8A 3PR2B 5KPJA 4KOAA 3LLSA 2BDTA 4CT4B 1FLAA 3RJZA 1Z28A 2NXJA 4WI1A 4BV3A 4QA9A 4IX1A 1UJBA 3GB9A 4EY3A 1M1NB 1PHPA 2GAIA 4LRSB 1N1GA 3E8MA 4X93A 1D1TA 2XNDA 4FCCA 5EE3A 2PUFA 2PZLA 1LFAA 1IJEA 4CWAA 4OUDB 2IEAA 1ZEJA 4M0DA 4F21A 5IKXA 1NUAA 1JMYA 1ZGZA 2HNBA 4A36A 1DMSA 1EVKA 5ALQA 4TRMA 3CNBA 3AOEC 3JZMA 1MAUA 1ZIXA 2FPKA 3LJKA 1YZKA 4NOLA 4XLZA 4KYIB 4IOMA 3TX6A 1NMZA 2BKLA 2N47A 1CTQA 3D1VA 3HZHA 3R75A 3DAGA 4R51A 4NH0A 3WJ1A 1EUCA 4UM5A 3RG2A 5LMCA 2PMWB 2EKPA 2YVLA 3TXAA 3V4RA 2AF4C 1ILEA 3E9ZA 4GU5A 1JAZA 2BOVA 4MQFA 4WACA 4KR7A 1LQUA 4OVKA 1J8DA 2YC2C 4G07A 4NMHA 5K0EA 2OV1A 1IMJA 2CE7A 5B6IA 3HVUA 3TTTA 4EO4A 5DTJA 3W1WA 1EBUA 5K7SA 3ADCA 2GNPA 5KYUA 1AE1A 3TIIA 3IUNA 4NE7A 4ALKA 4DMRA 3OZUA 2WF5A 4JP8A 3P71T 3KJGA 4LBVA 1BD3A 1PL7A 5ELXA 5DTIA 4YP0A 4DR6B 4KUHA 2AE1A 2Z9DA 4F9EA 3KEGA 1QYVA 2ATEA 4WADA 4R8VA 3M5PA 1KIFA 1KYZA 2EERA 5THKA 2AJCA 3O4RA 1HWYA 1D1SA 4C0XA 3D0RA 4Q9LA 1PFYA 3GJ3A 2O8BB 2ZYUX 1TVKB 2G7MC 3GEIA 1PG0A 4NECA 2OORA 1Y6GA 1Z5WA 3F6CA 3NG1A 2I7TA 2REQB 2QMUA 3I1IA 1OHHA 4LNAA 1FDTA 1K5GA 3HA7A 3IOBA 3GCXA 3NETA 4DXAA 3SZMA 3Q8KA 1DKRA 3P19A 1GNQA 2AVNA 4HXYA 1DT5A 2C9YA 2PX3A 4NF2A 2D5BA 4RL6A 5IXJA 1XJCA 3B6EA 4UM7A 3ELYA 5IJ0A 3U40A 2X2EA 3L0YA 1F2TA 2P9QA 1CJBA 1B6TA 1D2AA 2VC2B 3K35A 3QU9A 4MR7B 4UTOA 5CD1A 2HJVA 5A3JA 4GMFA 2JFHA 3HRHA 5B1EA 5B7PA 3HABA 2PDAA 3RHFA 4MRRA 5AQ1A 3W5JA 1QNFA 2P3OA 1QYDA 3BHIA 1W6UA 2IHVA 4LNHA 4O33A 4BV8A 2H08A 2A9FA 1G66A 3KIPA 3U3KA 1U94A 1SCJA 3ND6A 5KQSA 4US2R 1TEHA 1PR0A 3O38A 4O59O 4TXNA 4C4SA 1IM2A 2QEQA 2QK4A 3PFNA 1U8ZA 1YV9A 1FUIA 2V9PA 2ZAOA 4GWLA 3FMOB 1CD5A 1YDWA 2B2XA 1XP5A 2GM3A 2V7EA 4S1TA 5LMNB 1BS9A 1RBZA 1RFGE 1YCDA 3A3PA 1JLKA 3PQEA 4MEAA 3GOHA 4X1IA 5P21A 3UAGA 3ZU6A 1XRNA 2IKSA 1QO7A 3ANLA 3GEMA 2I65A 1CIVA 4CMEC 1DCFA 1P74A 1GQSA 5IK2A 5C3MA 1VBNA 2PUEA 1SN7A 3KEFA 4UDXX 5GJWC 1M6YA 1UZUA 1KHHA 4JB2A 4MR7A 4EG6A 4DMCA 2OLJA 4X64B 1CDDA 1KEPA 1ZWKA 3OE7D 3ZQ6A 4IXWA 1HA3A 1RQPA 4W4TA 3W9SA 4RIFA 4KSBA 3RADC 1S2DA 1XT6A 4WUTA 5LR6A 4JL5A 4PYJA 2J85A 3IOMA 5ANRB 4CM1A 2OKCA 5JNVA 5EXXA 1TKCA 1FMJA 4G1EB 1GZUA 4OIMA 1FXWF 3ZWWA 2IXEA 2YNMA 5HJ5A 3HCAA 3DF9A 3HFSA 4U6NA 5JO0A 1SWWA 4ZGGA 5BP7A 2OFOA 4MAFA 4JZYA 2GMWA 1CEXA 5ARDA 4ACBA 2BFEA 2PNJA 1U2QA 1XROA 3PEEA 4NJOA 3H84A 2FSVA 4HRYA 4TL9A 5E7MA 2YV4A 2HK7A 1UQTA 2CMDA 1G20A 3IUBA 4RS4A 5EWMA 4BO7A 4HVLA 5JH7F 3AHFA 1N3BA 1KIMA 1EFCA 5FFFA 3TBFA 3WZLA 4B8YA 2UYCA 1L7AA 4JVLA 5EP3A 3C3AA 3BCRA 3KAJA 1QOPB 5TLSA 1TM5E 2R7AA 1T35A 2XNDD 2Z30A 1UIMA 3EWAA 3HV2A 4RC9A 4XOIA 5J4YA 1XN4A 2I0FA 1TEVA 1ZUWA 3FPEA 4UVHA 5IVPA 1FNMA 2QPOA 1TFRA 1DOZA 5CBPA 4PGAA 3BXEA 4UMEA 4URUR 1QWSA 3N1UA 2QN8A 3MEQA 4UCQA 3ZWMA 4UU8A 2PWZA 3IE2A 3N9IA 5FO0A 4Z3DA 2JFGA 2ZI5A 4IEIA 1UBJS 3NM5A 1ARZA 1US8A 2AMLA 4UZSA 2AF3C 3FRHA 1E0KA 3H9CA 2J59A 3KR2A 3F46A 2O1XA 1NBOA 1ZUNA 2YW2A 1YFKA 3N8HA 4BNUA 1ZIDA 2UU9B 3SR4A 3LBNA 1XKXA 4H7JA 3BMNB 2J6BA 4DMHA 3D8NA 3COVA 1G20B 4LX0A 2I3GA 3LX8A 3SLRA 1K63A 1Z6ZA 3HKBA 2NVWA 4BB5A 3PEWA 3O2JA 2BEJA 3N7TA 3AVTA 4BGUA 4PPYA 1MRNA 2HM7A 2VTDA 3AF2A 4XQ9A 4OB6A 2ZRIA 1TLFA 4Q47A 3RVQA 3CZQA 1RMYA 2OD7A 2QB5A 1S2GA 2GKSA 1QYCA 2XMSA 3GROA 4K9SA 1TJ3A 2WTXA 5KAPA 3LY9A 1D1PA 2WNIA 1QFZA 1N6PA 3CRVA 3D5TA 3JATA 4GGOA 3AM5A 4L28A 4NV0A 4G0PA 5CR9A 3DDZX 3W8FA 5K45A 1SURA 4TYQA 3WRXC 2ZSDA 1YBMA 4MUXA 4TL6A 3TNJA 1E4YA 4D6YA 2IXTA 1MPXA 4GYWA 1ZLXA 4ZDJA 3BKWA 3F98A 5EWJA 3F7OA 2DCMA 3PVZA 1N2IA 1EX1A 4DLNA 1II0A 3ST7A 4BO9A 2BP7B 1EU1A 1VQ1A 2EDAA 3EH1A 4FQ7A 3UV6A 5EHZA 2NO7A 1YS7A 1URPA 3OH8A 1G4HA 1I3CA 1RSZA 5EIBD 1M6HA 1DCTA 2Q9UA 1RAEA 3F6EX 3W2EA 1L1FA 4JUBA 4F1WA 3A4TA 2D1QA 2DKOA 3AR8A 3L6EA 1E2QA 3LPCA 3OPNA 4FHFA 2BHNA 4WJZA 1MW9X 1L8AA 2ID7A 4EHNA 2B99A 3M4YA 2A59A 2YXBA 3A27A 4EJSA 1GAJA 5J4VA 1H8ED 3ROPA 1DB3A 5F52A 3RUEA 1SA0B 1YOVB 2C4WA 1IBRA 3C5HA 3CT4A 3FBWA 4IH4A 3DMHA 5CVVA 1DWUA 1VE7A 5JHHB 4HGPA 2HXSA 1CUFA 4OQQA 3EC1A 2V7VA 4WKPA 5HKKA 5IDYA 1J2YA 5KYNA 2QNBA 4DBZA 2NUBA 2OAEA 4B6JA 5EWJB 3I62A 4AJNA 4ARIA 2E1PA 4JR0A 3R0XA 4IRXA 3LGXA 1GNRA 2PWBA 2OFFA 5DGDA 3B13B 5KMGB 1JPVA 3PUYA 3HKDB 4LDAA 4CCYA 2VPQA 4QJ5A 5B4UA 3M3PA 3THOA 4M1EA 1L3BA 5LWQA 1Y81A 4TV9A 1B8PA 3C1TA 3HXOA 1M2WA 1AQ6A 1QM5A 3HFRA 1KL7A 3GDWA 1V45E 3OKPA 4ZVVA 4Y2QA 4TTQA 2F2TA 5K0SA 1JYSA 4FP9A 1UXIA 4IGEA 1U65A 1MAVA 1OC2A 1W59A 1RYMA 3F6YA 3N76A 4AJJA 1QMGA 5D84A 4E14A 3RYFA 2VHYA 5BORA 4WLEA 2ZT7A 1XF1A 4LYYA 4BLUA 1UJCA 3II6X 4LF5B 4TLLB 4H3HB 2RBEA 4D4LA 3R5KA 3RFUA 3MWEA 3D8BA 7MDHA 5J47A 3GDGA 2DTDA 5I7RA 5LZ2A 3H2ZA 2RHWA 2AHOA 4P0QB 1J7KA 2HK9A 4QM7A 4WV3A 1JMKC 2ONYA 2IOYA 1XNGA 4F3RA 5IH7A 1E7QA 1A7UA 1F0YA 1TM4E 3L84A 2NO5A 2QLJA 3PEVA 4QXAA 5FUMA 2DFLA 3U19A 5GONF 4YRPA 4D8TA 5LM3A 1L5HA 2WG1A 3KWFA 5ALHA 2ZOSA 3ZD6A 2I55A 4JLNA 2Q3LA 4XWKA 1A2BA 2CW5A 3DYVA 4FW8A 4EK9A 2Y3IA 3T0FA 2ZYIA 2HA3A 2YY6A 4FHDA 4DQUA 4ZMRA 5JC1A 4LV5B 2ZZMA 4QJ4A 4CMKA 3CF0A 4IINA 3RSZA 4OI4A 2RFLA 2ZTSA 5IC6A 1DDGA 4XDZA 4HNVA 4DG9A 3F97A 4BMVA 3NRBA 4CMJA 3OI7A 4Q24A 2CL5A 2YYAA 3ESQA 3IA2A 1M6VB 3KJFA 1Y5IA 1YFZA 2E0IA 3C3CA 3OAAA 3T3EA 4PZ9A 1ZEMA 3E9YA 3PGKA 1FRQA 3CLKA 3DAFA 4KWTA 4Q9NA 2GN6A 4F85A 2I80A 3QSGA 3KD3A 3EPHA 3KL2A 3L5OA 4QNMA 3UG6A 1DFGA 2XUKA 4N40A 1DBSA 5ITZB 1CHNA 3L6OO 2QLFA 3WL3A 1PX0A 5CT5A 5LYJA 3G85A 4KQEA 2J9FB 2FVYA 2ARKA 2X0JA 3KQSA 5EGNA 3KKNA 2IS4A 1QIIA 1UPCA 4MAAA 3BE8A 4UAVA 1ZK0A 2B8JA 2FFJA 3CISA 3MGGA 4PNPA 1L7RA 4HZIA 3WV5A 4DQ0A 1UT5A 3HKDA 4RF5A 4CCYB 3OM8A 2PD4A 4A0GA 1MB9A 4GI2A 1QGDA 4P84A 4JY7A 2I71A 3Q3GE 1NVUQ 5I3CA 3DT8A 1W48A 2ZJ0A 3K0KA 1EXWA 2H1VA 4J0IA 4BBPA 4CEHB 1SB8A 1LXCA 2R6ZA 3H2HA 4WKOA 4A8JA 1LD3A 1QHFA 3L6UA 2FZWA 3E23A 5AI5A 1Q0RA 2EW2A 3AHIA 4GMHA 3CNEA 5KQPA 2FEPA 3EEIA 4GKAA 3SC3A 3IQXA 4AQDA 4D8XA 1WOMA 3WK4A 4RJIA 2FEWB 4TYMA 3U56A 4LC1A 1QK3A 2XWSA 3G2LA 2F4VB 3THSA 1P7VA 3GG2A 3NBMA 4DG8A 3A6LA 4WZ6A 3C14C 4IAOA 3M4NA 4QGAA 3PRYA 2WMOB 4PGMA 2Z5LA 2HHJA 2VK4A 3JQ8A 4BLPA 5K0LA 3BIFA 3CNQS 1MHTA 5DSTA 1XKQA 2FSIA 3KXPA 2RGRA 2HD4A 1IY1A 1E7MA 1VSTA 3Q98A 1U8EA 2YXNA 1E9RA 1Y9AA 5DI3A 1E4VA 5B37A 3DBLB 2APJA 2RHTA 2J30A 1RAIA 1T9HA 4OM8A 4JL8A 4O0MA 1DAIA 5E7JA 4CM9A 1BKSB 1B4DA 4N0MA 5DXFA 2YN4A 2F1JA 1K68A 4ZOLF 2YZGA 4G0XA 2AYZA 4HFRA 1SUEA 2RGEA 5KOJB 4EB3A 2TECE 3I6YA 2W6QA 4BMSA 4P7FA 1Z4PX 1M7GA 4HRAA 3TMYA 1T6YA 3THXB 2ZRMA 3WL4A 3TE7A 1QHNA 2R6CA 4JLJA 3IVAA 2H4YA 2O4UX 3MCTA 3GUUA 3B6KA 1Q1EA 1SIBE 2HK8A 2JCSA 3L7IA 3VR3D 4B84A 1UBSB 5LQDA 1PJZA 1S8OA 1XMPA 1M75A 3L40A 3PUIA 4K5QA 4R8SA 4AS3A 1ONOA 2JI8A 2XOEA 2GR9A 3N7AA 1GJRA 3D8TA 4ZAZA 5FWYB 1KFJB 2HSGA 1IONA 3SYNA 2GVNA 2G9UA 3KKPA 4TMFA 2JCBA 4C0LA 5FXMA 1F9EA 2CJFA 2R97A 2VJPA 3L4BA 1F5NA 4IHJB 4LJRA 3B6IA 2R4QA 2Q3BA 2DPMA 1I2BA 3DJYA 2PKXA 3CX3A 3MD0A 3ACDA 4EARA 4B3DA 2PCLA 2QTTA 3GNLA 1Z0FA 4YIHA 3O4VA 2F8SA 1ZCAA 3PLRA 4PCAA 2W2PA 1O0CA 3U3MA 1E1CA 3NCTA 4R84A 5TNXA 4EA9A 2WJIA 5DCWA 1M8JA 1LBSA 1VP3A 2JZCA 4A1FA 2WHYA 2N75A 2D1RA 4Z9AA 3SC6A 3R3WA 1B16A 3DL0A 4DTCA 2O07A 3VSDA 4GIBA 5BY2A 1NAIA 2SCUA 3DL4A 3MMSA 1MO2A 4MYRA 4HYEA 1VPEA 2DFKB 4U3JB 5LLDA 2B3TA 2W6ZA 1W96A 1Q3TA 3LY5A 5DO9A 2FEAA 3RT1A 2XITA 3OZSA 1EDOA 3X1XA 3W3ZB 1NFRA 4M1WA 1TUBB 5BRAA 1ZJWA 1PR6A 1AZLA 2XRFA 1L1EA 3RYFB 2ZWMA 2YWCA 2LKCA 2ZXEA 3PX3A 4TKUA 5DLQC 2F55A 1Z6GA 1M73E 3DEKA 2GF2A 3L8FA 4GX0A 1JAIA 3WGUA 3VHXB 1RFLA 1UMKA 5JS8A 1VE9A 2QBYB 4LHXA 3M5DA 2HZBA 1B00A 3IKVA 4G37A 1D6JA 4Q7LA 1P0IA 1IVYA 3HVKA 3R3ZA 4Q9JA 3G6KA 2CDBA 1N0WA 2A35A 1HFKA 2W6JA 4GX2A 3AFNA 2RGGA 3WLJA 2RJNA 1JFFB 3UNXA 3RF6A 1MVOA 4CGZA 3IBCA 2I4NA 2QUAA 2WAAA 1AK2A 1W34A 3U1TA 1M0TA 4PO9A 4RQTA 4R54A 1NJGA 3FTDA 2L17A 3IE0A 1H8HD 2G8NA 3G5TA 5C18A 1U2SA 2ZS8A 4PRKA 4CN8A 1E0AA 3NOXA 3G2NA 5KJCA 1JJVA 3CRRA 3DZHA 3TZLA 4HYYA 3ZLBA 4B3JA 4DA8A 2EIXA 4W5QA 1OAOA 2GASA 2P6NA 3B53X 2IPMA 4XJTA 3THYA 4XIFA 4CM7A 3G6WA 1AKTA 3A9VA 3B1YA 3OCYA 3FOBA 2G07A 2WYVA 1ZBQA 5KSOA 4MMZB 4MGKR 3OSZA 4EVSA 1EQAA 3K0CC 1W5EA 1SBZA 2CFOA 2PR7A 5EYPB 1VE3A 3DOCA 1NP3A 3QVKA 2J0UB 2E55A 5A9RA 2YWHA 4RWEA 4N8SA 4GLBA 4B6SA 1H3EA 2H4ZA 2AN1A 4EMBA 1W9HA 4IHJA 4B31A 1GYPA 2A4MA 3B2QA 3SQNA 2Y66A 2ODWA 3KKOA 5KHLB 1XLTC 5DK6A 2ID8A 2PN1A 4H31A 2FMTA 3KWLA 4CBVA 2BUCA 4B3BA 1Z38A 1GGFA 1Q0UA 1U0LA 2IV3A 3MT9A 3MRXA 4K81B 4XDYA 2ZLBA 2FWIA 4BDSA 5ED4A 2W43A 1THMA 1SRQA 5E95A 3OFJA 1GPWB 1ULZA 2QRZA 3LO5A 4NS4A 1X1TA 2X4GA 2C3YA 4YQEA 3ZE6A 4JI4B 1L5VA 2JAXA 4XUCA 3RVBA 3WLRA 3GD5A 2G1UA 3DKIA 4H6PA 4JYBA 2Q28A 2QNIA 4M0KA 5KYWA 3CCFA 5FOQA 4TN1A 1V4BA 1FXUA 3KSZO 3WRWA 1XLTA 1E4OA 4B35A 3VMFA 3OFSA 1TUBA 4UBIA 4UUOA 3W5DA 1MU0A 2K6GA 2H17A 4KPYA 3KRTA 4TLEA 1X7HA 3HXKA 2BIFA 2QP3A 4HDQB 4NBLA 4HN4B 3SJUA 1GQQA 2IY9A 1H69A 1UBGA 1YJBA 3ZXIA 4PVCA 2X77A 5IXSA 4PLVA 2J32A 3PGA1 1AS3A 1ZP6A 1ZCZA 3ZOKA 3FOZA 5G4LA 1NR5A 3G13A 5EJIA 3OQIB 4C7KA 4E3ZA 3RIHA 3IP7A 5LIRA 4ZCTA 1UFVA 2VKTA 1JQLB 4I4NA 4P7GA 3F3YA 4CHTA 1UXHA 5CM2Z 3O8RA 1Q1QA 3BJMA 4YRTA 1G3MA 3IAS1 5EHNA 3JWHA 4NEHB 2XYGA 3I9LA 1DI0A 3QYPA 4GE0A 2QD3A 3MHTA 2O5RA 4WLFA 4OI0A 1E3EA 4Y2XA 1ZXLA 3NC0C 4Q16A 1UPTA 2MSKA 1XEWY 1B74A 1QUEA 3EAQA 1C3EA 1U7UA 2A0YA 2QTCA 2VK1A 4FNGA 3H0KA 4IJQA 1CDZA 2SBTA 2A9RA 4AZSA 1QZ3A 1RXIA 2ECKA 2UZ4A 2J1LA 3AVYA 4Q3NA 5EEHA 3N2KA 1AM4D 4L1KA 721PA 1KYQA 1VCOA 1ISHA 2F9MA 2GFHA 4C5BA 2IYOA 2XKJE 4REMA 4WECA 2JIZA 3TRDA 4LGCA 4NENB 1JQKA 3ETCA 2D8MA 2B4KA 3GELA 4M9ZA 4YWJA 4W1QA 3RSHA 3AFHA 1RTKA 1DXHA 4RAOA 1A8UA 2YZ7A 3CF4A 3RYTC 4AMBA 4EGAA 3O4HA 5F98A 3TVDA 5FBHA 4O2RA 4E5YA 2ZRHA 4Z9XA 4D82A 3N3AC 5CGZA 2QUZA 5L3VA 4JI7B 3ON5A 2YW9A 4WBXC 4RMJA 4Z3KA 5B7QA 4H59A 2FEKA 3CB2A 1JR6A 1EGVB 1YS9A 3RS0A 3ZVMA 1POXA 1JQ3A 4GBJA 2QPTA 4NFSA 2V7TA 4ZT7A 2B92A 1NSYA 4IWXA 3U2QA 3WVNA 4DQVA 2DRIA 3PA8A 1G7SA 4PZDA 4MDYA 4H4EA 2W8BA 4R69A 3KB2A 2GEFA 3GARA 4FONA 3EXG1 3SM3A 1L5KA 1JAHA 2LZ0A 4YRFA 4HNTA 4G25A 3VYVA 3T35A 4CQMD 5K05A 1YK1A 1H66A 3R7FA 1CY4A 3GFVA 2VRBA 2H11A 4X85A 3WAGA 4RFVA 5G3ZA 3VOSA 5K9ZA 1BWQA 3S29A 4PNEA 1IQUA 3GR6A 1JHDA 2CJPA 1TKBA 4HVTA 4WPGA 4BU1A 3U4AA 1G5FA 1AGYA 1VA5A 2IYUA 3DC2A 3GDHA 2HYDA 2IXAA 4CIVA 4YUWA 2F1IA 1PUJA 1VSUA 4KFRA 5CRIA 2V03A 2CBGA 4F2GA 4WUVA 1LV7A 3W6OA 3ZE1B 1DOAA 1I2CA 6LDHA 5DKFA 1DU4A 1PR1A 2Q5HA 3HZOA 2F1KA 5IP5A 4FNMA 3VXKA 3ZBUA 2ZYSA 3QU2A 3EBPA 4C4RA 2NT3A 4U5QA 2PUJA 3EEOA 1U9CA 3Q8XB 1WMAA 3NTRA 4HLQB 5CK5A 3STVA 3NIBA 1P4AA 1P18A 3EULA 4BE9A 2VPWA 1CFZA 5T41A 1GQFA 1Q77A 3MJSA 5EMKA 5F7OA 3C3EA 4J94A 3WSVA 4NBUA 1P6UA 1B2LA 4DSTA 3W90A 2BKAA 3FGPA 1LC3A 2ZJBA 5C7YA 3Q4GA 4ZALA 1XAGA 1T2FA 3KJHA 3GFGA 2EBWA 3BSYA 1N8KA 1D4ZA 4U6SA 4C6RA 1N8TA 4L0MA 5I4CA 2C0PA 1XTSA 2ET6A 1EYZA 4FBMA 2I03A 3CIFA 5IBRA 3VR5D 1HL3A 1KGSA 1XKLA 2UVPA 3QFHA 5H16A 3OFND 2Z04A 3ZJUA 2XCOA 1UJMA 3R6TA 1HOTA 1Q95A 4B79A 3UAZA 3IAHA 4B6FA 1D8AA 4MUIA 5B1SA 1C0IA 1H3FA 2XDWA 1W85B 4KVGA 4R9NA 2BKEA 3GXBA 5EOVA 2QZSA 2VL7A 5K2MA 3ZIAA 1AX9A 5CJJA 1GTL1 4GZMA 1HDYA 3WB9A 3WQRA 3KUDA 3ZGLA 3IR6A 1U0TA 1DIOB 1CQZA 1FY2A 4GH5A 4HGYA 1AT1A 3S68A 2REXB 4XFDA 3DB1A 5EFOA 3O3MB 4QPNA 4YAGA 2BR4A 3Q3JB 4FVTA 1XDGA 3D7NA 4BBZA 2HTEA 4I99A 5C5CA 3ZX4A 2VLIA 1A4XA 1D5WA 4JJEA 4FXPA 2HWKA 1E2LA 4KYUA 2Y1OA 3BJZA 2YWFA 2NYVA 4PVDA 1IUOA 4WX2B 1B8NA 2VYVA 3WDMA 1E2PA 2FSGA 2CXOA 4QOIA 3U60B 1ZGHA 1UXKA 5AW1A 4UPEA 4YLYA 3EZLA 1FVXA 4G0UA 2V5UA 1H94A 2OHGA 2AC4A 1AO0A 1WTCA 3QUAA 1P75A 5EUQB 3B38A 4BHTA 5E9AA 1NXQA 2WIDA 4JCOA 3W79A 4L2IB 4QX6A 2AVDA 5M29A 4S12A 1G8KA 1MFZA 2P2CA 3D0KA 4A3SA 1EHYA 1N7IA 3PFBA 1EWRA 1K4YA 1JU4A 1L5YA 1ODSA 2ZRGA 1XNJA 3DCYA 2J7PD 1Y5NA 4MS4B 5AM5A 3UB3A 1I1HA 1NR7A 2R5NA 2WIKA 2XUAA 1WDKA 3R3SA 4EHKA 4NX2A 1SUCA 5ALOA 1WB6A 4OQPA 1H3NA 3AZOA 3K30A 3L8ZA 2PCJA 5ALXA 2IH4A 1MNQA 2OB1A 2WAXA 2C4TA 3R9XB 2W83A 4K46A 4QOHA 2HGSA 2I54A 2QE7A 2X9NA 3F9RA 3Q7QA 4OLFA 3TZCA 3RAFC 3JQPA 1HK7A 2JIBA 1B0UA 4QULA 5KB3A 5FBWB 2PIDA 4DCVA 1RYYA 3UCFA 2V6IA 1OIVA 2XUDA 1AUPA 1WD7A 1A9PA 2NT4A 2ZRCA 1NQVA 4QHYA 2EIHA 1Z34A 2NZYA 3PNBA 4FBLA 4DDHA 2ZJOA 2Q2WA 2VYND 1DPFA 4C0WA 4OAPA 1M72A 1XP8A 2NAFA 2R6AA 3EPRA 3JWIA 3IP1A 1JU3A 3KLOA 4L16A 1ENPA 3OJ0A 4G01B 2G77B 4MUBA 3KR0A 4CZ2A 3D3WB 1HPLA 1PV4A 2PMCA 3LRXA 3CCCA 3B8EA 4K87A 2CN1A 4P2GA 2C0CA 1IXZA 4L3OA 2M1ZA 2QRUA 1WB5A 2W6ID 5FL7D 2G9NA 4DM4A 5B3JA 4F2WA 1RC8A 1RPZA 4XWTA 1QRSA 1C81A 1PD1A 4LJKA 4LYEA 3RR2A 1UBLS 4FR5A 4N0DA 3UENA 4CLEA 5D5QA 5EJFA 3WIUA 4BXOB 2C29D 3DDOA 1YQ9A 1RLMA 3LK7A 4BQFA 3V46A 1R37A 2QJFA 4LHSA 4FOLA 1T2CA 5D6OA 2IDKA 2WC1A 1O96B 2BD0A 3R9WA 4X0EA 3REFA 1XXHE 2FX3A 4INPA 1ADBA 2DXIA 3R0JA 2X86A 4M0MA 1O5OA 1GNTA 2NUPA 2ZI7A 5FULA 4EMTA 1U3VA 3FUWA 2YASA 3USES 1P0CA 2FV8A 5CX1A 3VGPA 3GHHA 1XB2A 2VAWA 4O2BA 3AVXA 3LKDA 1UZNA 3R6LA 3L4EA 3A1WA 2IOFA 3TXYA 3QE4A 3RI3A 2N1MA 2YUIA 3UUGA 1MTOA 1PV1A 3DPSA 3LPMA 2V8BA 2FFHA 3EH2A 4C2AA 1E60A 1BDJA 1VOTA 3HJBA 2ZRFA 3K53A 4EUKA 1GPH1 2GBGA 1HT2E 5FLEX 3QXSA 1E9BA 4J9UE 3O84A 5C1BA 5FRDA 1SCQA 1FQWA 1TECE 1Z5OA 3RRFA 5KNCA 2GPAA 3BM5A 4QAQA 1XCMA 3IO5A 1T0IA 2O5VA 3FX2A 1RIFA 3GRUA 3T3IA 3BMOA 3REQA 1QG6A 1W9MA 3C8UA 1Z0AA 1OXKB 3GIWA 3ABIA 4LC9A 1KU6A 2JAPA 4H18A 2X3FA 3IOYA 4W5HA 4G09A 3KTFA 5JWOA 3G8DA 3Q5GA 3VJMA 4K9QA 1QGYA 3QJ5A 3B3AA 2BAGA 3P9KA 1QHHB 3MJHA 1GCUA 1EHCA 1F2VA 1KMNA 2UZAA 1ZCBA 2ZR0A 3B5IA 4QYIA 4R9RA 3VUEA 4DZTA 3R8XA 2CNOA 1S89A 2JCVA 1Y6RA 1Z35A 4RD3A 2XVYA 4P3NA 2X7HA 4ZXPA 1H9CA 1PD0A 3GUCA 2Y0EA 3C5WP 5CVDA 2PG3A 3TAXA 2YYSA 1ZFNA 3JWEA 1OFGA 2X2FA 1IHOA 3E8SA 3N2EA 3WRYA 3E9EA 1OI3A 1P29A 3KPWA 1SUDA 3OIYA 4WLNA 3T7JA 1SIWA 2IY8A 5CW2A 3ZH2A 1QAOA 5FADA 1B6SA 4YN3A 2XXAB 4CTMA 3L1KA 4XH9B 5J2UB 4LTDA 4P34A 2XJ9A 5IAOA 1R4ZA 3PDUA 1KI9A 1V6SA 1Y89A 1OYVA 3QITA 1S2IA 1NV8A 1V16B 3X43A 5DTEA 4LJ8A 4CMIB 4XVUA 4FM9A 1MO5A 2N46A 2YHIB 4BXOA 5E6RA 1C50A 5PNTA 3R7AA 2XQVA 4LOAA 4MJLA 5FBRB 4LAFA 2Y71A 3CTMA 3W8EA 2P9TA 3LHKA 4RMHA 4BJHB 2C8LA 4H16A 2VBCA 4V0ME 2IOFK 2ZGVA 3GEGA 4MR8B 4AP9A 3DHWC 4B09A 3KXIA 3RIYA 2BISA 4UNIA 1P7WA 3UG7A 4ZYVA 3T3GA 3DVQX 2QIOA 4K9LA 2C84A 4V0LA 5A02A 2YIDA 2NYUA 3UGJA 1K86A 3PSAA 4Q1FA 3O47A 1M8GA 4QSHA 2JVKA 3UAXA 4CKWA 1K66A 3E5RA 4F4UA 3FWZA 1UOQA 4RK7A 1HYEA 2TYSB 2XYRA 3ONNA 3SZUA 2MYTA 3VO1A 3PB3A 4K2HA 2FVXA 1BVRA 2A3RA 1SQGA 4FB5A 1P73A 2FMKA 2ZK7A 5LDHA 3W78A 4ND3A 5I9IA 2KMLA 5ERXA 5JFTA 1KY5A 2PJZA 5AJUA 1MNAA 1OLSB 4JC8A 4YMVA 4KWHA 3V9AA 1JA9A 4RZ3A 1VKJA 3A7DA 2SECE 4MJ7A 1T5OA 2AOXA 3GBSA 1DG3A 4HNSA 4B4WA 3LUCA 1C2TA 4M60A 4XUDA 4B4KA 3HDJA 1W19A 2ZJYA 3AUFA 5KVVA 1DG1G 5B3KA 1SXJE 1SXQA 2PD3A 5BSVA 1NVVQ 5KSYA 1SOUA 4G1MB 1JXQA 4GLOA 4MPRA 2AG6A 3WTBA 3AI2A 4MUYA 4LZAA 1ODTC 3SDSA 4YAUA 4J0KA 1IJBA 3X1WA 1Z0UA 5HF8A 5JASA 2GA8A 1F8GA 1XZBA 2VG8A 3NCHA 3BA1A 4DF3A 2A2ZA 4NG5A 4QGHA 3LQ2A 4ZWNA 4ZEMA 4FSDA 3AP2A 4I50A 3EQ7A 5BYJA 4PS0A 3WI7A 1XPOA 1COZA 4Y6LA 3PWKA 5I9MA 1NR1A 3O9VA 2HC9A 4G81A 4XYGA 5FHRA 2Q4DA 3TFQA 1MKYA 4M1YA 1XL0A 3PE6A 3F3MA 1QVWA 3OQPA 5JNRA 2CMKA 3H5IA 2Z08A 1RI3A 3GD7A 2BELA 4U2GA 1ZH4A 4ALNA 3C0KA 1VJRA 3P45A 4IQ8A 4P4TA 3O95A 2ZAMA 4N3GA 3ZWQA 1BYIA 3R8CA 1FS6A 1EWVA 3IEVA 3W9UA 2YFHA 4IS3A 2R8XA 4ARZA 5J2TA 4PSAA 4BRZA 4OOEA 5K03A 5TJHA 2ZE6A 2P9EA 2PHZA 1QGAA 3O4GA 3MUEA 4IZ6A 1Z8HA 2I9PA 1Y8QA 2QJRA 2VSFA 4QYIB 4GKBA 1OI4A 4IUDS 5JSKA 3WIEA 1XEWX 1GG8A 2OT3B 3M1AA 4B76A 2Q9CA 5ALFA 2GK3A 1E64A 4ZJUA 9MHTA 3KZKA 3QVTA 4U39A 2HDOA 2R8ZA 3T0IA 1SCUA 2Z95A 4FN4A 4KWCA 4X6XA 5GM2A 2GCIA 2GCOA 4DCSA 1K7EB 1SBIA 5CNMA 3RS3A 2O8DA 2EJBA 3MMZA 3SDZA 1Y1RA 2O8FA 3UA4A 1H6BA 5DP2A 5FORA 2EGUA 4K9KA 3THWA 1KYTA 1HDXA 1DEAA 1N34B 1OWOA 2BM9A 4D8YA 1Y7IA 1XAJA 4ENPA 6YASA 4HPWA 3L06A 3EVCA 4O4HA 2P69A 2X4LA 5HNKA 5GTDA 1P6XA 2H52A 3IDOA 1RAAA 4C4AA 2QQ5A 1TVEA 1XQXA 2J6HA 2NX2A 4TKMA 4TWJA 1DJPA 4OHRA 1NRWA 2NZVG 3U4CA 2JJ1A 4JI5B 2RAVA 4ZCMA 1ZNZA 2QRPA 4BUZA 5FUQA 4I2NA 4LI0A 1K7CA 1JUDA 1QPBA 1S01A 1UBFA 1DQPA 1RZUA 3CPSA 4L15A 5EZSA 5IC4A 2BWJA 4C7XA 3DDWA 2UUPA 4L8GA 1AMNA 4H7EA 1E5QA 2WAMA 4IDGA 2OECA 4JNKA 3EVZA 4KQ1A 3RODA 4JOCA 4NMWA 5K4HA 1P72A 3M6XA 2XIQA 5A4IS 4LISA 1GCOA 1IEVA 2JIMA 3CM0A 1P2FA 3AERB 2W6JD 3O91A 4JUFA 2XHEA 4N9WA 1U28C 1W94A 4KQHA 1IUPA 3TM4A 2H7XA 1Z25A 4O2AF 3OFVA 5COBA 3ER9A 3WNQA 2VAXA 4MW0A 3BPSA 5E3HA 3NHFA 4BMYA 1JF8A 1Q21A 2HN9A 3FWHA 2ZYTX 3PS9A 4I50B 4LWPA 5A6SA 2FG5A 4KW7A 3I73A 3AESA 2P1DA 1NUPA 2IVFA 2H3EA 3NEPX 5GVRA 3O0DA 4G4SO 3I04M 1BXRA 2H16A 2GPSA 3JRWA 4TV8A 2QE7D 7YASA 1U7WA 2QTVA 1ETHA 3R6GA 4NFHA 4QDUA 1OILA 4LYFA 4MIEA 1KSJA 2DT5A 4B4VA 5INTA 4YV1A 2YV3A 1WDMA 5REQA 5JTUA 1JHMA 2P65A 4MS1A 4AS2A 5HG0A 4RABA 3OEHA 5EXPA 1Y48E 2J07A 2OCIA 1TZMA 1RQ7A 4J0QA 1RP1A 2AUTA 3FAKA 4LZWA 1T8PA 3S2IA 2WILA 3WGYA 1GD1O 2EV9A 3N75A 2CLDX 3IJRA 3KV3O 3I0ZA 3GNSA 3ND7A 1K4MA 5TXGA 1ENYA 4P31A 2B8EA 5ARCA 2D6FA 4MSUA 2QZ4A 1UK7A 1Y3AA 2D0DA 2YFQA 1WSDA 4L4SA 3T6KA 4BO3A 2AOWA 2ZUSA 2P9JA 3JAWB 4OU5A 4QDXA 4QPCA 1JLHA 5H0IA 3W6PA 4ALJA 3MJFA 2PSFA 4DA7A 3MWDB 5FX2A 1U4NA 3VBEA 5A3QA 3KB6A 4KXXA 1KNXA 3EG9A 3GA7A 2VDLB 4MQUA 3FI9A 4NK4A 3RVLA 1OAOC 3GG9A 3OZXA 2VT3A 3CH5A 3TBHA 3ZDRA 5CFMA 1M5RA 5ES3A 4WZAA 4I1IA 4JXKA 4JSYA 2TMKA 4MI3A 5E7QA 1M6NA 5HJEA 3D9QX 5EJ2A 1LPNA 3KUUA 1YZLA 3RIGA 3AF3A 4BNMA 4IUBS 4WZBB 4G9EA 2PVSA 5AW6A 1KOLA 1SXPA 1K6IA 3KKEA 2IS1A 1JTVA 5FUBA 3I01A 2X8WA 3K2IA 4IFEA 2BKUA 3KS9A 1MF7A 3NWEA 4OQ4A 5EJAA 4UVEA 5YASA 2BGLA 4EM6A 5A06A 2EYQA 3ANSA 3PDJA 2C5EA 1WF3A 1EEXB 1MJGA 2J5BA 1U8UA 2IS6A 1KETA 3ZHTA 3OPYB 3ILSA 1BMQA 1CP3A 1SVMA 3OFNA 3BRQA 2DHRA 1Z4MA 3OCXA 4MB6A 3OWOA 1F4LA 3IERA 1YGPA 3GFOA 5D5PA 4AUNA 1ETUA 2BCEA 1CX9B 1A1VA 1EE1A 4NI5A 1Z5VA 3A1EA 1YASA 2BFMA 2Q4BA 4AO8A 3FTPA 4YVFA 3THWB 1R6BX 4GOND 3QUCA 4LV6A 3PUJA 1CG6A 5DLYA 4KJXA 4UTNA 3KQPA 4DV7B 2GZDA 3H75A 4TXJA 5I9TA 5GOZA 5AESA 3VISA 3ZJYA 4BEVA 2Q21A 3KQHA 3K6SA 1EVLA 2F3RA 1LLFA 1P2SA 3HNRA 1XJ0A 2VH5R 3NBXX 4LWZA 1DEOA 4MIKA 2K2WA 3AKEA 5AO9A 5TS2A 4AI6A 1ADYA 1UP7A 2XBUA 3A3NA 4RIIA 2HREA 3ET4A 2JJ2A 3DFKA 4ONEA 1U2EA 4IJWA 2DEUA 3KOXA 1YHYA 4BRWA 4I6EA 3BWBA 2R4TA 3NV7A 3GL9A 1JHUA 3IQHX 5E3JA 4EECA 2BHLA 3PHHA 4EYQA 3EG5A 2GCPA 3OHMA 1HDZA 4TN5A 2X14A 3F67A 2WZBA 4Q66C 3R7LA 4R5HA 2OHVA 3ZV3A 1PE0A 4N82A 3BRSA 1E79A 3C3YA 4FE3A 3RS4A 3HCNA 1OR8A 4RYDA 3CRMA 2WJVA 2J3IA 1T13A 2DOKA 2ZSKA 3JTMA 5KYVA 3SI7A 4GO1A 2DPHA 4QTTB 1O5IA 5AVOA 1WSAA 5FIUA 5BSUA 1LPPA 4R81A 4B40A 1NASA 1HH4A 3I4LA 4JKOA 1S96A 1UMDA 3RVKA 3SEFA 1AV6A 3SYLA 3M4JA 3KDAA 4KXYA 1GZSA 5JSZB 1JKXA 1QC5A 2GNAA 2WNSA 4AZTA 5EQDA 2FN8A 3RFCA 1PFGA 5DBFA 1F20A 3DD1A 2H2WA 5ALNA 1V7PC 4M0EA 3LP6A 4H08A 1HNZB 2QMEA 4FJ2A 4OG2A 3L8HA 2OQVA 3VV2A 2VQEB 1QP8A 1TCBA 5D5HA 1QHGA 1YQEA 3BE4A 4UHHA 3CEJA 1YI1A 5LBTA 5K3EA 3WLIA 1HTBA 2FN4A 3TSZA 4D9CA 1B2RA 4CL2A 5LCXA 1RXSA 1IWOA 3FZEA 4Y2HA 4DPMA 2QW8A 4KE7A 1S4QA 3ZS9A 3GLFA 4FCTA 2P5UA 4HY3A 4BMNA 3LCCA 4W82A 1GQ2A 1U0RA 2A84A 4QU5A 4TXHA 3G9UA 1NXPA 1NUHA 1TRHA 3C5VA 5C31A 2HU7A 1HMPA 2QLBA 3HN2A 4NNOA 4WKCA 3SFTA 1EIWA 3MSXA 2VQFB 2BGJA 5GJBA 2GHRA 3RJ9A 1R0XA 4KRYA 3Q9LA 2I2XB 2XVXA 1C7RA 1RWQA 1X1RA 3DDHA 4WOPA 5JDCC 5JWRA 5I8ZA 4X61A 4F2HA 1OXTA 3NVMB 5KVAA 4L73A 5FTLA 3DBRB 1T3ZA 5EJGA 5TGZA 1WJGA 3AG6A 1ID1A 2A0XA 1NA5A 3WGOA 4WJKB 3S44A 2M2IA 5AW9A 3DGEC 4OFBA 4JB0A 1T4DA 5AVXA 2GTPA 1U2ZA 5DW0A 2G0NA 4INOA 4PFQA 4RA9A 3U4GA 2BZGA 3VHRA 2IH2A 1Q6ZA 1XC7A 1KVSA 4IIEA 2NO9A 2FPIB 3Q2OA 3QF7A 3NIDB 2GUWA 4N49A 3EXG2 3FWYA 2A7QA 3V2IA 5CDYA 3MJTA 1YS4A 5EJ5A 1CU1A 1QIDA 4BFVA 3RUIA 2QG4A 1ZUHA 4NJMB 4YJ2B 2VJAA 5F2EA 5A0FA 3BMQA 1GXSA 2MYPA 2CYBA 2ZRDA 1PR5A 4M6WB 4JBYA 4A8PA 3G0BA 1ZNWA 4C2TA 2EQBA 3K6SB 4CEJA 3M5WA 5DCYA 2XZLA 3I1YA 3Q7IA 1FIUA 1OPRA 1CUWA 1L5WA 2GX6A 4K86A 4J7CA 5FF9A 3V48A 2JA1A 4XD2A 1T0BA 4OQEA 3GGSA 1W5BA 3OZIA 4LJ5A 4KLNA 4JLMA 3NAQA 4O2AB 4IEEA 4MYUA 3GEDA 1A98A 1XZEA 2J5XA 3ETEA 4IIJF 2DAPA 3AOGA 4RA9B 5G0SA 2JFYA 1E8NA 2X5NA 3ZIUA 3O92A 3HJNA 3MTQA 5ICFA 3STTA 3IT3A 2WFZA 3KZVA 4TKVB 1KI3A 3LGAA 2O3QA 1WR8A 3PQDA 4RPLA 3VPBA 5IFLA 3HACA 1BH6A 5DT9A 1HSZA 3GYBA 2FW7A 4N0QA 3OPQA 4PM4A 2B37A 4EVIA 3DVLA 4YDHB 5H8WA 2C5AA 4FJ1A 1T2EA 4NXNB 3ZPXA 3OJXA 2JJ2D 1U2PA 3BWMA 1NMEA 2POQX 2XNSA 2ZVPX 3RVPA 2IHNA 3VPHA 2PH7A 3SNHA 4G4IA 1VI5A 1BFDA 1PLJA 4MP3A 2WWVD 1DAFA 1SUAA 2OV6A 2Y99A 3BMXA 4R1OA 2UZ0A 4QZVA 3PR3A 5BT8A 2IPLA 1PNOA 4Z51A 2GXUA 2X6TA 2EATA 3IUPA 4O4JB 4AO6A 3KQLA 3ZDXB 3H99A 1DC8A 4ZCSA 4OOFA 5TE9A 4PHHA 1DQSA 5GY7A 4MV9A 1PJRA 2HA2A 4BQSA 8ATCA 2H9IA 1GYQA 5EKXA 1RHJA 2I6UA 5EP1A 2P4EA 3HUEA 1TYEB 3O73A 3PEUA 4WY8A 1D6NA 1H23A 1VJGA 1MOQA 1UZAA 3KX2A 4KBFA 3ZVRA 5IUKC 3ROKA 3P9PA 1VJ5A 2DFPA 1E6UA 3NEJA 4MAMA 2YJ4A 4QBKA 3BMOB 3VKWA 4L8YA 2OZKA 2NPFA 4TM8A 1Z0SA 2D5IA 5HE9A 2KQUA 1XKTA 5AR1A 3C97A 1CRLA 5HRCA 3WYCA 2QVGA 4PYIA 3Q7RA 4NAVA 2RGUA 3HCWA 5TSDA 1NATA 5BV8A 5F5NA 3FHTA 3RBAA 1G5TA 4MYSA 3L0PA 3DTVB 1FFGA 2AA3A 2C8VA 2G71A 2ZULA 1NXWA 4K26A 2BF7A 4N39A 5CNIA 1PJ8A 1GUFA 2GPWA 3U1VA 1V7CA 4CMAA 1YULA 1BEUB 2EWVA 1O94C 1W47A 3R7DA 3SZLA 1LBIA 2M6RA 3HHEA 5B53A 4B3RB 1A4RA 1BE1A 2NGRA 5CA1B 4IDCA 2QN6A 2YQZA 5LN1A 3GO4A 5LMUB 3JXEA 3ZNNA 5JJLA 2Y2UA 2VNIA 4X60A 4MHOA 3SLKA 2VJYA 2ZROA 2WJPA 3VJKA 5DOVA 3CLRD 3LX6A 1BOFA 1JI0A 2OWDA 5JS6A 4C7JA 1TLTA 1JHVA 3S2EA 4QEKA 1K3FA 1OGIA 2JFPA 1VHLA 3Q7EA 3SS7X 3WLFA 1OFUA 5EMHA 1O1YA 1TCCA 4YRCA 1LB1B 1PS9A 2COUA 1BU5A 1BA2A 2C97A 2J3MA 2XXJA 2W2TA 3ITKA 4RS3A 4EENA 2DHCA 1KY2A 4HS4A 4LTNA 3RVSA 3H2IA 4DR5B 1I10A 4KIJA 2I3ZA 2VRWA 1LI4A 4QSMA 3VVMA 5K20A 2BJVA 3KQWA 5ESDA 4MMYB 1E0JA 4LUCA 4MHSA 3Q3IA 3DKRA 4NWIA 4Q4HB 3ZCXA 3KJNA 2XGOA 5AM3A 2IU6A 4MQFB 4M1MA 3FZNA 1W76A 1U6KA 3TJRA 1C8LA 4RX1A 5K0TA 1S9DA 3UHFA 1OLXA 3MRTA 3H2KA 3GJYA 4XQCA 4FEAA 3EGVA 4IG9A 5DT2A 1JX6A 1WXDA 4QOFA 2XWJI 5AH0A 5ISMA 2QN9A 4Y2GA 4AMUA 4F4FA 3BH7A 2VK2A 2P3SA 3CX8A 4AXXA 4C04A 3CE6A 4OQFA 4PYMA 5CCEA 3EF1A 2FGKA 2HYIC 1MFPA 5DPMA 4M0LA 5E0KB 1PVOA 1P2GA 1BWSA 1Z3IX 1I14A 1WCIB 3GUYA 1G38A 2BGKA 4GOOD 1V8OA 1ZA2A 3CX7A 3HFGA 1Z06A 1Y9DA 3G5AA 4FKMA 1M9NA 4KMMA 3G5LA 4ZHSA 4QEZA 4IOLA 4ZPJA 1S1MA 4YREA 4HTFB 1Q0LA 2AG1A 3CVUA 2C1ZA 3BAZA 1C4XA 4PHFA 2F00A 1KMIY 1ZICA 3H17A 3FPHA 5K6RA 2HWUA 4R2JA 1WS6A 1G9XA 2RHBA 3O3NB 4ROTA 2Z6VA 4HXFB 4KKVA 3GRPA 1K4KA 3BMQB 4PQEA 5IAAA 3ILHA 5E1MA 4BPBA 4DMFA 8AT1A 1JDJA 4TTAA 4FHGA 4DBLC 1MJNA 2KLBA 1XDZA 1ORHA 3L6DA 4IH9A 3W4JA 2CL6X 3PVSA 5IYZF 2QP9X 3BXOA 1G60A 1HM5A 3JQAB 2F67A 2WWTA 3KU4A 1VYHA 4HWTA 5IARA 3OOSA 3K0AB 2PGJA 1BS2A 3HWWA 3OZAA 4NOMA 3MG9A 4WERA 1E5TA 3GZNB 2QSZA 4PQFA 3SNKA 1TQDA 3I58A 3FTCA 5C4IA 5JZBA 2ACVA 1ECPA 1ZD3A 2X0KA 3F71A 1VL5A 4JB3A 3DHVA 4X1IB 1NPYA 4DCGA 1FC0A 5JCOA 4F91B 4KITB 1QMPA 3M3HA 2QGZA 1I4OA 4G5GA 3IIJA 3VKHA 1KI1A 3K09A 4MLCA 3WP0A 3MBKA 4WESA 3ZDFA 1Q3KA 4L4YA 5H4GA 3VPXA 13PKA 3RU2A 4NXMB 1TF5A 2DCUA 5CTJA 3N87A 4FFWA 1OXMA 1FDUA 4ZOCA 1RAFA 2XD9A 3WLLA 2JBHA 2Y77A 1DELA 2EBHX 4YV2A 1MB4A 3EOAI 1OLXB 2BTOA 3MCWA 4OV6B 4XIJA 4EITA 3UGQA 3KTAA 1P2BA 4IYJA 4OJQA 1GN8A 2O52A 2WHPB 2Z8ZA 1B1CA 2OXCA 3OP4A 4GOLD 4Z3OA 2V7GA 4E2YA 2Q50A 2P11A 1UKVY 3UJ9A 2VHCA 2ZYRA 4QXQA 2OV8A 5J4KA 4TL7A 4XJSA 3TSWA 3WK9A 2JEYA 1OBHA 4ZO6A 4Y3UA 3VQTA 4MQEB 1W0KD 4W8GA 3SXPA 4Z6KA 2GZMA 2QA5A 3AEQB 3BQMB 4LE2A 1UJ4A 3PCXA 1SM4A 2QTMA 3PHBE 4UUQA 4DAOA 3D8UA 4B44A 1Q74A 3BYZA 1KZ1A 2A4KA 3U80A 3EQZA 4Q00A 5WRFA 4QECA 2ATVA 2IU4A 1YZNA 2O2EA 3GJ7A 3DEAA 2YZMA 4P81A 4DM3A 3GT7A 4X7BA 1YZHA 2FR0A 5AVSA 2VN8A 3PJGA 4WK6A 4POAA 4GOXA 3CH6A 4OGGA 2WD7B 2IY7A 3T34A 2QI9F 3UJ3X 3JD2A 3AETB 4PIVA 3CKMA 3NGMA 3P26A 3QPAA 4I9UA 1ZGBA 3CN9A 4TKZA 1XZKA 2YX1A 5KKCA 1SHJA 5HBGA 2I2BA 3THRA 1KDOA 4QOGA 3OBBA 3MOIA 3TIFA 4GYYA 4DARA 4M7OA 1NV9A 2XUGA 5CH3A 4AURA 2YZKA 1MCZA 1SJ9A 2V6GA 3BB1A 4H1UA 2ZRQA 3SR0A 3IDAA 2XMZA 3PL1A 4W7IA 3V00A 4MQEA 1Q1AA 2CJXA 1IDN1 2GEBA 1WKBA 2B83A 2G3YA 5F51A 4B7XA 2YKGA 1FFAA 1T5LA 4X24A 2MDTA 3HKBB 4JGGA 5HX7A 1EEHA 1J8QA 1N3YA 2OCLA 1XTIA 4HNQA 5ENZA 2V3VA 3UJPA 3RJ5A 2ORWA 3VJRA 1UK9A 3PQ4A 4QG3A 4WXPA 1DQZA 3FCAA 2FSSA 5AOVA 2HV9A 2ZSBA 1WXFA 1JS1X 2X0NA 3MGKA 1V5IA 4L5IA 4M86A 3F47A 1AGXA 4MQMA 4UE2A 4EX6A 4RD4A 1U04A 1J49A 4B2PA 2C7QA 4ZC1A 4YRSA 5BW6B 2AKAB 2C82A 1RWOA 1YQUA 3COYA 3GZJA 4N8DA 4MW6A 5DI9A 3V8BA 5ELMA 2K2QB 5JS1A 3UCXA 4ND8A 1A7AA 4FFBA 3FKQA 3J7AC 4DJAA 4JP5A 2OP1A 1J8YF 1AKYA 3WZ2A 1XN1A 2IZZA 4RV4A 1ZK3A 2J0SA 3RAPR 3WGKA 3RRZA 1N57A 1FYWA 3EGIA 3IB3A 4EBFA 3ONEA 4WCFC 1ULSA 2H1WA 5CAEA 5FOTA 1Z36A 3P5BA 1NLZA 2BH9A 4ZQIA 3S5JA 2IXDA 1I9CA 4PRLA 1LH0A 4OHPA 1XALA 2HCJB 2I8AA 4XX0A 3V4PB 4PONA 2ZSJA 2PZKA 1O4WA 3F5DA 1CP2A 1WW3A 1Z73A 5JE8A 3VR6A 4R1MA 2PSEA 3C48A 4NIMA 1GFZA 1H2WA 3T15A 4FLEA 4FS8A 1T0UA 1PJTA 3I6IA 4MVYA 4UQOA 2BN4A 1PJ4A 2PGIA 3FYDA 1ZWLA 3HB7A 1JFRA 5GPBA 4BMOB 3NOOA 3EMVA 4PGFA 5ERYA 3QEBZ 4OD0A 1PL0A 3UJ7A 3GLIA 3ZJTA 1ADFA 1FUEA 4Z0NA 2WVJA 3QPBA 4KO4S 4D79A 2DWQA 2Z2IA 3ZG6A 3L4SO 4ZAWA 3ZYZA 4LGMA 4NYMR 1MXHA 2L2QA 5L4NA 5CAEB 3IDQA 4MA4A 5A2QA 5J3JA 3CLTC 4JYZA 1H2AS 3AFIA 1GFIA 5KNCD 1I30A 2NACA 1W1UA 2CXXA 2AD5A 3KUKA 3QOFA 4BNWA 1N7JA 1WXQA 4JJ8A 5UKDA 4CI9A 5JCJD 5JAIA 5LA6A 1T1IA 4YFVA 5EIBC 1KAMA 2L82A 1JXAA 3AZPA 3BORA 2HLPA 4E6EA 1YL6A 4KDFA 4Z1OA 2QD2A 4UAGA 3KQNA 3W8DA 4O6VA 4RPGA 4LJAA 4WOJA 2I4LA 2JEZA 3LWBA 1JA1A 1T5IA 1U28A 2DM6A 2HU8A 4OJYA 1L8XA 3RCBA 2X8JA 3UXMA 4AN1A 1VMEA 2XEXA 4EOGA 3H9EO 2CD9A 2WD8A 1HE3A 5HFNA 3F4LA 3AILA 3I34X 3EEQA 5HDBB 1E3LA 3V6LA 3SZRA 2ZREA 1DSSG 1BTOA 2HCBA 4HMQA 4TQAA 4G26A 3IV7A 4OXYA 3V8MA 5M7EA 5KC8A 2WYOA 3L1HA 5LQUA 3HMKA 1CULC 2BFCB 5FI1B 2EL7A 2NMVA 3GI1A 3CPEA 3A8TA 4N9QA 4OKIA 4V02A 1GCAA 4R41A 3R76A 1RCFA 4DB4A 2O0JA 1U3GA 4E5DA 1TD1A 5C46F 5J4LA 2PFSA 4JIMA 1DINA 4S1OA 1AH2A 4KGDA 3CF4G 2CJYA 2CDAA 1EA5A 2IRWA 4RKRA 1XZQA 3ZZTA 3CSUA 2AL7A 1U8XX 4GG1A 2Y9PB 1HURA 2WYUA 1L5HB 4OGWA 2K7ZA 3KP1A 3PNSA 4R7GA 5KOIA 2P9BA 1LLQA 4PG8A 1LNQA 2FLKA 1E77A 2HUNA 3UMJA 4BLWA 3VDQA 5CCDA 4ZZ0A 3ND8A 1Q1ZA 3T5MA 3NATA 2O2SA 2QQFA 2QLNA 3PCRB 3FPGA 5KWSA 5ED0A 1A2KC 2OXIA 3QEKA 1WHTB 1M6VA 4KFSA 4RD6A 3THYB 3KHUA 3OPYI 5AKLA 4UTZA 1G6OA 1QZXA 4CV3A 4YT8A 5JROA 4LZLA 3BWVA 3LA8A 5FI3A 2MSEB 3B52X 1YJ5A 4G23A 2J5QA 1YMUA 3OLXA 4IWNA 2QT9A 5AK3A 4RZIA 2VDMB 3GC6A 1PU2A 2C7VA 3LT5A 5CXUA 1RBMA 2TMYA 3H7IA 1Y6QA 5BN3B 4BFXA 3H19A 1KTIA 1X7GA 1Z2DA 1TZKA 1DKOA 4B2YA 5C8DA 1DRJA 1YGYA 2B1IA 3EC7A 3PUHA 4D3FA 5K3FB 1JDSA 1GCGA 2QENA 5C5EA 3B6MA 3R40A 5KWJA 1KY4A 1VLZA 5B4VA 1N7GA 2BR5A 3QELB 4LS3A 5JYBA 3ZWXA 2QGFA 1NM5C 1RM3A 4RENA 2Q5LA 4YTEA 2WU0A 4MINA 5ALJA 5F73A 5H7XA 3L4KA 5DMHA 2WD9A 4YONB 3EA5A 1RHRA 2AXNA 2CF5A 5AOAA 1G6KA 1OZAA 1K08A 1UIRA 5D2CA 2NQ8A 5GV7A 2VDPB 4CLRA 4UQLA 1LPOA 2R8PA 2ZSUA 3FRIA 3RNLA 4JYAB 1G2OA 4BB0A 5ENDA 2GJAA 3EVGA 2AMFA 5I9BA 5HF5A 3LMKA 5F4ZA 4JR1A 2CJWA 3JRXA 3RFTA 4EFMA 2P4QA 1T2VA 1R4MB 3QTLA 3IAAA 4OB7A 4CN9A 1MJFA 3WIBA