2HBRA

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACAGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hbrA00
4DCPA 1M72A 1GFWA 1PYOA 1K88A 2QLBA 2XZDA 3NS7A 4AWAA 5IC4A 2P2CA 2H4YA 5IBRA 1GQFA 2C1EA 4ZVSA 4QUIA 2FUNB 3DEJA 3V3KA 2FQQA 1ICEA 5JFTA 2XYGA 2QLFA 1RWNA 3GJSA 3UOAB 4EHNA 4QUAA 1I4EB 1BMQA 3R6GA 5IASA 1NMEA 3NR2A 2CJYA 2NN3C 4QUBA 3SIPA 3DEHA 4D3YA 4EJFA 3R5KA 3KJFA 1F9EA 3E4CA 4JQYA 1RWOA 4EHFA 2H4WA 4NOLA 3V4OA 5I9TA 4PRZA 3KJNA 5H0IA 4HQ0A 4EHDA 4DCJA 4JB8A 3D6HA 1RHJA 4N5DA 2XZTA 5I9BA 4EHLA 5LU9A 2AR9A 1IBCA 4NOMA 4AW9A 2QLJA 3PD0A 4ZVOA 2H5IA 3R5JA 3K7EA 4IYRA 4FEAA 5IBPA 1KMCA 2H5JA 5LUBA 2J30A 1RHUA 4QU5A 2C2KA 4QU0A 4QUJA 1SC1A 3GJRA 3R7BA 5IAGA 3V6LA 2CNOA 4ZVTA 3V55A 1RHRA 2C2ZA 3S70A 4EHAA 1CP3A 3UO8B 2H65A 5IAEA 5IAJA 2QL5A 3IBCA 4I1RA 1F1JA 4PS0A 3KJQA 4HQRA 2J32A 2H51A 3ITNA 4AWBA 4D3ZA 1NMQA 2J31A 4ZVQA 3R7NA 2Y1LA 4QUGA 3GJTA 3P45A 4I1PA 1RHMA 4JR1A 1QX3A 2J33A 3V6MA 3H11B 4N6NA 2QL9A 2Y0BA 5LUAA 4N6OA 1RWPA 4LSZA 4JJ7A 4FGUA 4M9RA 3SIRA 3D6FA 1QDUA 4NBKA 4ZVUA 4QU8A 1SHJA 4ZVRA 4NBNA 4N7JA 2H54A 3H0EA 2HBQA 3EDRA 4JR0A 5IAKA 4JQZA 5IABA 4QULA 4QUHA 4DCOA 4ZVPA 4NBLA 4PRYA 5K20A 1RWVA 3DEIA 4D3XA 4JJEA 4JJ8A 2CNLA 2HBZA 1RWKA 1K86A 1CVRA 1QTNA 1JXQA 3IBFA 3GJQA 4EHKA 2FP3A 3H11A 1RWWA 4FDLA 1PAUA 1RHKA 3H13A 3PD1A 2XYPA 1RHQA 2XYHA 1I4OA 5IBCA 4FXOA 2HBRA 3H1PA 3R6LA 4NOKA 1I3OA 3P4UA 2C2OA 4QTXA 3BIJA 2CNNA 1RE1A 3NKFA 4EHHA 1NMSA 1SC3A 2C2MA 2CDRA 3RJMA 3EDQA 1I51A 3PCXA 1SHLA 2CNKA 4PS1A 4QUEA 5IARA 1NW9B 4QU9A 2HBYA 1SC4A 2K7ZA 3OD5A 4JR2A 5IANA 2QL7A 4QTYA 4HVAA 2CJXA 3S8EA 1RWXA 2DKOA 4NOJA 2H48A 4QUDA 2WDPA 1RWMA 4N6GA 3V4LA 3D6MA 5IC6A 3QNWA 4IEFB 3DEKA 5LU8A 4N7MA 3R7SA
chains in the Genus database with same CATH superfamily
4R1QA 4BXOB 3L7IA 4XRRA 1BMFD 5F3DA 5I9NA 2XZLA 2XD9A 3PR1A 2IOFK 3VX4A 2B98A 5CNJA 2A9KA 4ETNA 1T5IA 3JQGB 4KSCA 2H00A 3MMSA 1NBEA 3OPMA 1OYOA 3TR5A 1BX1A 3WMEA 1HDXA 1Q14A 3FBWA 1JBQA 2CKMA 3O8QB 3H97A 3S1SA 3HB9A 2CJYA 1U8CB 2RD2A 4FGLA 3RKRA 1RRGA 1C0EA 3KKEA 3O1IC 4GP6A 2VNJA 2IXAA 5FPKA 2C94A 1S8OA 3R7FA 3WLJA 3KYIB 3OPYA 3L4JA 1YGYA 3TLKA 3L4KA 2BSXA 5K3FB 2AOTB 2Q62A 3IQXA 3M9XA 4EHLA 4NDNE 5HVNA 1W35A 3C97A 3KXLA 4K1LA 3RU3A 5HQ3B 1UBMS 1AO0A 3PD0A 4ZVOA 4QJ3A 3R5JA 4HAYA 4UXJA 4B4VA 5AVJA 1Y48E 1AK2A 3WRWA 4MV9A 1HETA 3O8CA 1P4SA 4D4IA 3DV0A 2VS1A 4ZAYA 2VJMB 3AKDA 4LXTA 2IYFA 3X1XA 1TF5A 5K4HA 2QUKA 3BQNB 3ED1A 4UEOA 2UXCB 3HP7A 2YFHA 1JDPA 3R7WA 1AK1A 2IZ6A 4LQCA 1U5CA 2W2LD 3C48A 3C7DB 4G1UC 1X80B 1L4BA 3EIUA 1MW8X 2XMZA 1E1CA 1VI2A 1TQ6A 4IWXA 2QRHA 1VSUA 1Q5PA 2FP4B 1TA0A 1ZOIA 4OXRA 3SSMA 1G8YA 1YQDA 1FP7A 1Z2AA 2F3SA 2O06A 2YVLA 2FCAA 3LUFA 4IVNA 4PLWA 5BUQA 3IT1A 1Z6XA 3BGSA 4C7KA 2MSLA 3PBKA 2Y0BA 2NVWA 3QU5A 4FOSA 1XZJA 2HT6A 3WLSA 3SIRA 1P5ZB 1W44A 1PGNA 2UYHA 1KY3A 4PHTA 4PPFA 3Q7TA 5EE1A 1GSHA 2H4JA 2GYUA 4HUQA 3B3FA 1RAGA 2X2FA 1A1VA 2XR1A 1NUQA 2BZGA 4JFRA 1T9BA 3OLVA 2E37A 3CM0A 1USIA 4E11A 4PNHA 5LQJA 3HJNA 2YV2A 3FCYA 5TVKA 4JNKA 4MR8B 4AS1A 2GM5A 2EIXA 3VZDA 3Q40A 3NTUA 4PSUA 3IQFA 5KHOC 3KYCB 3KOWA 1ICIA 3GEMA 2J45A 2QD4A 4PNEA 2PVSA 1HDZA 2H2HA 2HRCA 3ACBA 3PD7A 2WHEA 2QRQA 3AX6A 3N76A 3IBYA 5FNVA 4AF7A 5JAZA 4YAWA 5KNBA 1BKYA 1W9MA 4HPJB 1XXHA 1D2HA 1VZ2A 2WIKA 2NYUA 3M6LA 5A1TA 5CDFE 5JH7F 3PCXA 1ADJA 4EG1A 1G16A 3UG6A 4XFJA 2NPIA 3C1UA 1T4BA 1B16A 2AFHB 3DEFA 4XARA 1UUFA 4Y2UA 3ZWXA 2UXDB 3ZCPA 3A04A 4WKPA 2QNIA 1G8SA 1GZDA 2OBNA 1R3DA 4MMZB 1WXHA 2H2WA 3GN2A 3AGQA 3Q9LA 4UTPA 1YC2A 2BKXA 3TQOA 1RQGA 1VLQA 3G2MA 3AJDA 3QKRB 1N5IA 1HSOA 4KBYA 2XXAA 4QZVA 1D2EA 2CVPA 5CW2A 2PJUA 1E94E 5J1TB 2C2XA 1RAIA 1KBZA 4MV3A 5CG1A 3AIOA 1E92A 2BC9A 2H0QA 2BFFA 2YASA 2ZS7A 3GLHE 3IO3A 4X45A 3S2SA 3WI7A 2A9RA 3T4PA 1MB0A 1YZTA 1L6RA 3P8ZA 1Z16A 1V1JA 5CB4A 4TT8A 4P3YA 1R37A 1Q50A 1XEXA 3LQ4A 1ST3A 2OQIA 4DB2A 4BRSA 1EE9A 1KXJA 1JR3A 4W8HA 2JVJA 4Y2GA 1M2FA 3DTVA 4Q9IA 2I1LA 2ZTUA 4RHTA 7MDHA 3L8EA 1WS6A 2F67A 3X1WA 1IZ9A 1XE3A 3PC2A 2FY8A 4GMKA 1ECJA 4PX3A 4DLXA 2RHOA 3F5DA 4RM2A 1ML4A 4XUDA 1JKFA 3G13A 2Q4BA 1W2GA 3ZHZA 1UJBA 2CBGA 2FETA 1J1UA 4O5AA 2IWHA 1B0PA 1QQ5A 1YFKA 4BVJA 4KGXA 5BV7A 1RD4A 3KDPA 2O4UX 2P2DA 1FPQA 1VFNA 4I55F 3U3JA 2UYYA 3PF8A 1TB4A 4L4UA 2EQBA 1CLEA 3JR7A 1V41E 1GXSB 1ZMRA 2PBZA 5CLJA 1R6XA 5I3CA 3N70A 3MCTA 5A1JA 1L4FA 1FP4A 4GVLA 2QRNA 2EJCA 2QN7A 2HA7A 3QBDA 4EUSA 4DDKA 3ZGNA 5F7OA 1P80A 3GNLA 3TF5A 2OV4A 4MRMB 3Q5DA 4Q7MB 4Y6QA 8GPBA 1XO1A 2ZRMA 1WXIA 1FBTA 3ZR4B 2NUPA 5ITZA 5J2TA 3H2ZA 1L4YA 1QJCA 2Z2XA 4F9FA 4W8OA 4RK7A 3OI7A 4DW8A 2XNHA 5IMSA 4LHVA 2MT9A 2OCBA 4WOKA 3WNBA 4ONEA 2PGNA 1BE8A 2O3JA 1J2RA 3L6CA 1FYXA 3ZVRA 2ZWIA 4XM2A 4QDKA 4BTEA 1NN5A 2QRPA 4FZRA 2BFDA 4HAWA 1TU0A 2JIRA 1OV4A 2PQ2A 3SWWA 2GXUA 4MIOA 4WZAE 2BY4A 4PZYA 3JXEA 4QRHA 2R2AA 1M7HA 2W6CX 3JQAA 3K16A 4KE9A 4XX0A 3ZDEA 4E88A 3HYSA 3ZEAA 1PAUA 2GD0A 2PSDA 5AKJA 2BP7B 4KDEA 4B3MB 4AMBA 2O05A 3AHJA 4NRDA 2JGMA 4PZCA 2HY7A 3QKWA 4PC6A 3CPEA 3VZRA 5CA0F 1VMIA 3CEPB 2QN3A 1XI2A 5HQJA 4B87A 3TIGA 1JSXA 2PUDA 1KOFA 1DLJA 1X7YA 2ZUBA 3H1EA 3VPDA 1GG9A 4C3UA 3ZD7A 1P2BA 3H87A 1NRWA 3JVVA 3JD0A 3WAGA 2PUVA 3AESB 1K68A 1KC3A 2I4LA 3BHNA 5SY9A 4D96A 1J2JA 3HR8A 4HLUC 4NIMA 5TQJA 2F2TA 1RQ2A 5CFZA 4MV8A 1JFTA 4KBFA 1FEZA 1KTVA 4N3GA 4NBVA 2D0DA 2GARA 4C5CA 5C80A 3ZU3A 4KXYA 4EKNB 3BFKA 3PC7A 1JIIA 1XZEA 1XFDA 2RAUA 5LU8A 2P2ZA 5B1EA 2WVAA 3PFFA 1QXSA 4OG2A 3W3AD 1YULA 3ZU5A 3U4DA 4CV1A 2YC4C 2CNWA 2IFTA 1GPYA 4F8JA 2QROA 4OKIA 4PCUA 4LGYA 4UJ3A 5C7IO 1UBTS 4AX8A 1DRKA 1Q1ZA 2EW1A 3DVLA 3RAEC 5EJEA 1X1RA 1MC5A 3GBPA 2XOKA 1NKTA 5THXA 4PC2A 5CP8A 5TJ9A 5CCEA 1C4OA 5C8YF 1FLVA 2XADA 2EFCB 5EP2A 2NZYA 2E89A 3I9FA 5KCMA 1KOJA 3AI1A 1HYGA 2EFHB 3KJHA 4A36A 2WMYA 2CXPA 3C3CA 3PPWA 4GMHA 2HWYA 2VSQA 4UUAA 5FA6A 5IW8A 1N3YA 2DUJA 1JUDA 3FVVA 1Y1KE 3NM4A 1VHDA 4WZAB 3JATA 5ECYA 5E95A 1YBVA 1F0KA 2MINA 3LLUA 1TEZA 1XVUA 1YZNA 1NV8A 2IUEA 3KU4A 4BFZA 1C41A 1P0FA 3QUBA 2O2JA 2OXEA 3JQ9A 1U0RA 4M37A 5J5CA 4DHEA 1I1QB 2EZUA 1PWXA 3SEQA 1XFAA 2EG9A 1SM4A 1X70A 1LX6A 1GUZA 2PMDA 3MJDA 3OEWA 3LPLA 1E2NA 2VJOA 3FHTA 1VG9B 1LPNA 3D1JA 4IFBA 4YV0A 4KE6A 4PWYA 2BRUC 4WZ6A 3GEGA 2GZHA 3MC1A 1I36A 4GZLA 4FYVA 5HFAA 1EUYA 1P18A 4A2QA 5BSEA 2W2TA 5SZIA 2IUSA 4B5KA 2GCPA 3P2JA 5DK4A 3BTSA 2RGEA 4JP5A 4ZT7A 3WRYC 3UEOA 1NMYA 2ZITA 4KFSA 3VJKA 5KTMA 1B0AA 4JI4B 4F4FA 2J33A 1GT91 4IVQA 3ERCA 2XWQA 1K7YA 2OCXA 4X00A 5BSFA 4BV2A 2ADOA 3FVTA 1US8B 1G2QA 2ZVDA 1CY8A 4MUEA 2UVPB 2R87A 2BDEA 1CRLA 3K9CA 3IAHA 4TV9A 1RYZA 1RLJA 1WBDA 1GZ4A 1NWCA 2ZPTX 4JQZA 4WNCA 5ENZA 1O8CA 2VTEA 2ZWPA 4JEUA 3ZX5A 3GLIB 4RQTA 1GDDA 4MSUA 3P94A 3DT6A 3C8UA 4MPJA 2KW5A 2ONCA 3A1SA 2O2GA 3KT3A 3H3XA 4J0FA 4E0BA 4L0CA 2R4QA 1PVOA 1U0FA 2CD9A 2XE4A 3B3AA 521PA 4GX2A 5SV2A 3DCNA 2FLWA 4G0MA 4UHJA 3PPXA 5AHRA 1E5LA 4OB6A 5IM4A 1UOQA 3U7IA 3LCRA 5DKFA 4PC7A 3ZJYA 2FEWB 4XWKA 3O83A 4UMDA 5CRIA 2ID7A 1D7OA 2AZXA 1DUSA 4C7JA 4RFSA 2EVWX 4LJRA 1BXRA 3BTOA 3D3WB 3AXSA 3GCXA 5EE3A 5C4GB 4PM4A 4A92A 2IYRA 4EUEA 2WYHA 4ZD6A 4PC3A 5KYYB 3RQSA 3QVGA 5FWNA 1U8TA 4NXNB 5A6SA 4BIMA 2PUFA 3WJ1A 4D9MA 3KPVA 4R8KA 4Y2YA 2PGDA 4E5DA 3MQFA 3SHQA 2YWRA 3K0CA 5AVVA 3HGQA 1IIBA 3ORHA 1IUKA 3TZQA 3ZV5A 3VH2A 3WBKA 2AV6A 4XQ9A 5BSRA 3EZ7A 3NBYC 3NEPX 4CKCB 1G55A 3UNXA 4J94A 2BCGY 2ST1A 2HU2A 2PYZA 4UHHA 1BCRB 4XUGB 1Y63A 4DL9A 1LDMA 1ZBDA 4X24A 3RFTA 2DM6A 1H94A 3LUPA 3TOVA 4NJEB 3SX4A 4KKXB 1C7ZA 2G4CA 4BGUA 1QLWA 4ER5A 3HCAA 4D0SA 1XJ5A 2VT6A 1EK0A 3FPAA 3JQCA 4ER3A 5LQAA 5A7HA 1Z7EA 1W34A 1Z36A 4GL4A 2YQ5A 1WZ2A 1H2BA 1DAMA 4LXYA 4TKMA 4II3A 3W0LB 2ODEA 2PO5A 4X91A 1WD7A 4GWKA 4TWJA 1AKYA 4PRZA 4ENVA 2R96A 3FNIA 4JB8A 4OQZA 5GV7A 4EQ6A 3JU3A 5C1DA 5JTUA 1JQ5A 2HSWA 3DMTC 4ECAA 2YN4A 3DE0X 2R7LA 2ZYSA 4JB3A 2CBZA 3RNOA 1OIXA 1NWHA 4U2CA 2XPCA 1PTKA 4Z4HA 1Z2EA 2FPXA 3AM5A 2NM0A 3I0MA 3NHWA 1BXZA 3CJRA 2AA3A 4HEA1 1WZUA 4TMZA 1JWAB 1QCCA 1A9XB 4JI3B 1IB0A 1QE5A 2Z6UA 1XIVA 2PFKA 2R1VA 5FL7A 4QAJA 1NFRA 2V7UA 2ZBFA 3KETA 4BFVA 1Z7BA 3Q4GA 2QRUA 2D0IA 5DCWA 1SCNE 2W6PA 3S70A 4X1IA 4JMLA 2IS6A 1Q7EA 1DRJA 1UC8A 1AU9A 1CUUA 2DWQA 2PGJA 4ECEA 2RK6A 4YX9A 2QI9C 4U7PB 1OBCA 1MAHA 2ZJ1A 2P67A 4LK2A 3BK2A 3ZU4A 4C78A 3E35A 1N92A 4E22A 3OX3A 4GYKA 3H11B 2JKYA 3OA0A 3OIGA 4MP3A 3RCBA 1FF9A 4HNVA 4CTOA 3HFGA 3EUWA 3NTQA 5EIFA 4O3MA 2TMKA 3PGVA 4UU8A 1WCIA 1ZH8A 3B13B 1N1EA 1T9HA 3ZQKA 2AYXA 3N2GA 3I9KA 2ZJ0A 1ZA2A 1PBTA 1MLDA 3AETA 2P40A 2OORC 4GC5A 3WL8A 4PLPA 1O95A 2IODA 3AYZB 3OKPA 3UPDA 2FGJA 3IERA 3R7AA 1SZPA 3HXTA 1O94D 3GJQA 5K8LA 1MQAA 3RJTA 1HFKA 2P75A 4AJIA 3OFJA 1BHO1 3A1DA 2Y4NA 4BNUA 3ENNA 2GWRA 2RI1A 1XEWX 3QWBA 4EIWA 2WJYA 2GZ3A 2OCPA 3RHTA 3O4FA 2QP4A 2I4MA 4I1YA 3VR5D 4INZA 1E9BA 1PWHA 4Q7EA 2ZK7A 3M33A 1NFQA 2V6FA 3BPSA 3K15A 4RD2A 5D00A 3PUIA 2JLBA 4LF8B 3RREA 1AO3A 3W5UA 2QLLA 3SLGA 1KYVA 1N36B 4OBBA 3CUVA 4HS9A 2EJTA 4K0KB 3N2LA 5KPJA 4J1NA 1W1UA 2XHZA 4FDMA 5EZYA 5K2OA 1FQJA 3KTAA 5TX7A 3SS9X 4EP1A 1GLVA 2XF2A 3SC2B 3FHLA 2C8KA 1NQOA 3FPCA 4U7GA 2W0SA 4BV8A 2ZZNA 2HQRA 2IVZA 2CLFB 4AB1A 1G21E 4L07A 1R4AA 2WILA 1RP7A 1H8HD 3T35A 4WVFA 4GOMD 4QA9A 1UQRA 4DCPA 2QLTA 4LV8B 4M7OA 4WESB 4ID9A 4ENSA 5IC4A 3LWNA 4DMKA 1LLDA 5M04A 2CHFA 1SGWA 2AMVA 4ZEMA 3WLTA 2HPVA 4CLRA 1COWA 4F6RA 1MFZA 3T52A 2PVPA 3M6FA 3MSXA 4YRIA 2I8CA 5JXHA 3C1OA 1LC0A 2Q8PA 5L51A 3U4HA 1DG9A 3GWGA 2PANA 4MJLA 2IU6A 3UV3A 5A9SB 3ML1A 3Q2IA 1V4VA 1A3CA 1PJAA 3QBTA 4JJ6A 3E81A 1RRPA 2QVYX 3KYBA 4Q3BA 5BN3A 3CUUA 4MVWA 2QD1A 3HCCA 4KLCA 4OQPA 1F0NA 4HX5A 3G23A 4OK6A 2NLOA 4YFVA 5J2UB 3ZGZA 3ADDA 2R6GA 5GADl 1LPPA 3FXAA 1FYDA 3KU1A 1I3LA 1OJLA 4BQFA 1L1QA 1Q57A 1IBCA 1S4QA 2Z1MA 1D09A 2YHUA 3IT2A 4NOMA 1JXAA 3DMHA 3SP1A 5JZVA 4MCIA 3B3GA 3I2HA 3HP1A 4AG3A 4IO0A 1PFKA 7ABPA 1OBHA 1B4DA 1TZBA 1PR4A 2HDNB 2Y9PB 3BF8A 4HFNA 5D5QA 5DNVA 2RGWA 3GRYA 4D6XA 2TMGA 4KQHA 4MYRA 1EJBA 4WBSA 1NC3A 2X4LA 3IJ5A 3LPCA 5F3RA 1DAKA 3P97A 1ADFA 1X8JA 5AVSA 4REMA 1T8WA 1I2MA 1SAYA 2ZCUA 1RIFA 3ND5A 2BHLA 3E2MA 4A2PA 2QD3A 3DXXA 4KODA 4UBJA 3E15A 5A5DA 4HNRA 1JIVA 1K5HA 5DF1A 2J32A 2JLXA 2R65A 2J31A 2ZYUX 2OA0A 2Y1LA 2FPIB 2RHHA 4NECA 3GJTA 4ZGGA 4FB5A 3ZY5A 4BQIA 3AQ4A 3OHSX 1CYDA 3DG9A 4L5YA 3R8XA 1GSAA 3VGJA 1SXIA 4JJ7A 1J1IA 3ELUA 1PR0A 2A35A 3GQBA 2JGLA 3HHPA 3M1LA 4RD6A 4C76A 2FUG1 4D9GA 1WDTA 4RDXA 8LDHA 1CQPA 4FWIB 3U1BA 3MJRA 3QPUA 4R9UC 2E5LB 1AM4D 4MJ3A 2JH9A 4Q01A 3U31A 4TMKA 3K1AB 4LMPA 3WBFA 5AQ1A 3K2BA 5KKCA 3EGIA 1JEJA 2K2QB 4A6EA 1PZXA 1TYBE 1F17A 1N2CA 2WKWA 4IUBS 3UW3A 4O4JA 3VKUA 3KVVA 1HKHA 4WW0A 5LFAA 1BWRA 5BQOA 3JALB 4YPOA 3DZFA 1XRJA 2NVBA 5T5QA 4DNPA 3ZKWB 3A28A 3LV8A 1I33A 5EP1A 1F9AA 3LQFA 4O1MA 1KSJA 4P4NA 3NBAA 4C30A 3GGOA 1DGQA 1E4VA 1ZD3A 1OH5A 4JLKA 2NU6A 2DUNA 4XJXA 4D99A 4ZQIA 2NUAA 1CNFA 2VZEA 3GZ4A 3ZZ0A 1KVTA 1CDDA 3G9QA 3ZHVA 1DBVO 4WCFA 1NQUA 2OCLA 2WAAA 3PFNA 4HMPA 4L9SA 4F3KA 4KK4A 1ZRHA 1ZLYA 2JLCA 5CHEA 5C4IA 2XQKA 2OLEA 2ZP1A 2WU3A 3NALA 2OESA 2B37A 2RKBA 2QJRA 5AW2A 5BWLA 4QYIA 2BTEA 4QXMA 4FMDB 5D2CA 1MZPA 3AY6A 3I23A 1CZOA 1F48A 4Q05A 5F2OA 1MABA 2R86A 3R77A 3LPNA 4TTRA 4NF2A 1U31A 1FNDA 5IK2A 3KS9A 2R11A 3IP8A 3ZE6A 4NCBA 3OQIA 2QZ4A 1N2GA 2C7OA 3W5CA 1YB4A 4NE7A 4UOEA 5TT1A 3QTLA 1KZ1A 2X8LA 1IVYA 3O82A 4S1PA 1M8PA 3HA7A 3D8SA 1FW6A 1J8YF 1U3DA 1B8VA 3W1VA 1FYEA 3T6KA 3VDXA 1A8SA 2ZXFA 1SKYB 3X43A 2IQ5A 3SC6A 3KCQA 1D1SA 4G9BA 4D0LB 3Q3JB 4R1PA 4Y6OA 3SIXA 2YY5A 1IFXA 1QLHA 3BMOA 4UPVA 3E4CA 4N40A 1EM8B 2QP3A 2AWNA 1XCBA 1J20A 1XZQA 1RZRA 2P0EA 3GC6A 4CDNA 3IPRA 3F8WA 4RGQA 4YK7A 1T1IA 3AL3A 3Q8KA 3V7UA 3O94A 1G2OA 4TMFA 3HP4A 4GWGA 2XKBA 3ZE7A 2YJNA 2IDZA 4Q9KA 3HZHA 4DMGA 3MCAA 5BSTA 1OUMA 3AY3A 1WUHS 5AOBA 4TKVA 2GTIA 3K71B 1QP7A 4OU4A 4R2HA 1AX9A 4DXHA 3OT4A 4Q1EA 7ADHA 2O8EA 3HACA 1EFPB 4JT4A 2AR0A 4FT4A 2G40A 3KQHA 2PZKA 5E7JA 2IYOA 3O38A 5BSGA 4PO8A 3MB5A 4WN9A 2XZOA 4ESVA 1QPGA 3CBGA 4MVJI 2ZCJA 4Q4AA 2REQB 2E4XA 1UIRA 3L5KA 3TFOA 2GPAA 2P1RA 3DUFA 4A0GA 5CLFA 1RLUA 1HM5A 2PSEA 4UAUA 3RLFA 4UULA 3MRXA 3P2EA 3FTEA 2YOFA 1TMGE 3I1IA 3PX3A 4AURA 1BO6A 3D6FA 1A2BA 4I8IA 5BSVA 4ZVUA 3IUQA 4ZVRA 1G3UA 3K0BA 1WSWA 3A9SA 4WN3A 1V5WA 4KDCA 3AINA 721PA 4BFLA 5EE5B 4QM7A 4E5PA 3NBMA 1WSDA 1FTGA 2XUOA 3I62A 2OY0A 4IIYA 5E8JA 2HDWA 121PA 1EUDB 2OO5C 4P4GA 1YR6A 4MWGA 1DDOA 4Q1BA 4XXHA 3WLHA 3JZMA 5C3MA 3EEFA 1BW9B 4L57A 4RPLA 5KX5A 3UMSA 1TKRA 2FPWA 1TJ5A 2JAWA 2OSBA 2WZDA 3N86A 4OPMA 4ZVKA 2FFHA 5BNIA 4OHWA 1U2RA 1RCFA 1U80A 4E5KA 2IPLA 1BHJA 2IU3A 4QL3A 3SM9A 3RRFA 2AUNA 1RC8A 4G4IA 3CQ9A 3VQTA 2R6ZA 4X60A 3SN6A 3GEBA 2YZKA 4XR4A 1EG2A 4S1WA 5TMDA 1PV2A 1RXSA 3MG9A 1X94A 2HYIC 2ZIEA 4NAHA 5AXCA 3NHKA 4PYOA 2FSVA 5E9JA 4ZKEA 1QRSA 2GN8A 5KTRA 4NARA 3LC2O 2X76A 1AUVA 4P4LA 4EMSA 5IANA 1ISSA 1Z0FA 1PT9A 1TZCA 2EKDA 2YWJA 4YALA 1PLKA 4CU2A 1TM7E 2EG5A 5DTQA 2P5SA 1HE4A 4KKVA 1P6QA 2Y1OA 2SNIE 1PKEA 2YJTD 3ER6A 4KIFA 3GFOA 2G28A 5T8KC 1LNSA 2P9ZA 5KMGB 3WADA 3ZVLA 1LPBB 1F8YA 4IKPA 2HDHA 4JOCA 2BL4A 3L7KA 2R6DA 1JTFA 4LZNA 2QTVA 3TGLA 1E3WA 2I29A 2PK3A 1LZLA 2ZSEA 1A9SA 2SCUB 1QVZA 3E18A 1FDWA 4JL5A 2VP9A 2RBKA 2JI8A 1S2GA 3L1HA 1GPUA 4GYYA 1F06A 1W2WB 1YHNA 3UWSA 4ARVA 4JI2B 1GTJ1 2XE8A 3AR2A 3V1MA 1QSGA 4F46A 2FSHA 1ORDA 4YDQA 3IDFA 1DBRA 2IEGA 2R7KA 4ZHQF 2A3NA 4PYNA 5AW6A 1TJNA 1GO2A 3EK2A 5JQWA 5KTYA 1ZU4A 3K09C 4PHGA 6CHYA 2XVXA 4M53A 3ZTTA 3PC8C 4ETMA 5DM4A 1EJ6A 2O7SA 1ZJWA 1ZXLA 4ZI2A 3SFTA 2VNSA 4MUJA 4C88A 3ZWYA 2H1RA 4MA5A 2J7KA 3Q9NA 3B82A 1DQPA 3FB1A 4G8CA 3X2FA 4NBSA 4CUJA 1G63A 5KJ6A 3FDIA 4OHXA 5ARDA 2CK3A 2OT3B 4BLUA 3GVHA 1JYFA 4DA9A 1JYEA 1Q21A 1SQGA 2VL7A 5GONB 4QWWA 1FY2A 1DC7A 3QIAA 4OMCA 3DZCA 1ZD5A 3RV4A 1IVSA 4XKJA 3SE7A 4JLDA 4MWCA 1KQGA 2GK3A 3CV3A 2ODQA 4IO1A 5AK5A 3CG0A 3T3GA 4OFBA 4YJ3F 3B8EA 3WLMA 2CCKA 1XZLA 1DO0A 1ECCA 4OSEA 1XTBA 2X7JA 4XJVA 2VQDA 4D45A 3C3YA 4C4RA 1IN4A 3EFOA 4J2OA 4MI3A 5JMPA 3UVEA 4BEWA 4AJ1A 3TK1A 2BJHA 5CIWA 1EMDA 4LJYA 2WT4A 1Y7IA 3U09A 4V0OA 3T12A 1L7AA 1ZUWA 3HA3A 5EYPA 1FUIA 1M5TA 3EZYA 3GBSA 3BKXA 1XYGA 1AHNA 1M8FA 4O2AA 5FUVA 1S0UA 5C0OE 5TDHA 3COJA 3ZD6A 5F12A 3C0KA 2O23A 2JI7A 2Z6VA 4K8OA 1NHWA 4QUHA 3OM1A 3C8DA 1YNOA 1UIMA 2Z30A 4JJ8A 1SD5A 3B9BA 1FU8A 2HBZA 3PL5A 4JI7B 2D54A 2CHQA 3E61A 1YB7A 1NF2A 3HCPA 3QYFA 5D5HA 3ROKA 4B83A 4CQLA 4KFCA 1MJHA 2CUTA 3G9XA 3LVQE 1RJWA 2Q2WA 2ZJ4A 1AVTA 1CR0A 1HQYE 3O3MB 4RETA 3HCFA 4ER6A 4M0EA 1WXGA 2C0CA 3PXCX 3FOEC 2BKEA 3ED5A 3PJRA 3KR1A 1F8GA 1ULUA 2PQ0A 2YBEA 4CIVA 3IO5A 5F3WB 2O5RA 2Y0PA 5FOWA 1A98A 1I5OA 4AT1A 1VYHA 3V4ZA 3W6UA 2PMCA 4F9EA 3Q8WA 3O7MA 2VP4A 2HRRA 3FUCA 1Z2CA 4HZUA 5SYNA 4G0WA 4ARBA 2VQSA 1KPGA 4P5EA 1WCV1 3KUCA 3UMBA 1E5TA 1FK8A 1VBKA 3A70A 3I1FA 1V9CA 3MEQA 5DBHX 4BKRA 4FW9A 4K88A 3ILYA 3WRXC 1TCBA 4DWWA 4C2TA 1KVQA 2YOHA 1GGFA 3SBDA 1LF5A 3I5XA 1M5RA 2WWYA 5ETJA 4LVCA 1K6IA 3MUOA 4WNYA 2ZIWB 3CNLA 4J29A 2AJBA 3O2SB 4F0JA 3MWEB 3C5VA 4QRDA 1TMYA 2C2GA 5HIIA 2FLVA 4MVJP 1L5GB 3VZPA 3KZCA 1JEDA 3FH0A 4OREX 3HFSA 4U7HA 3DAHA 1EJ2A 4UVEA 4LYJA 1HORA 4DQVA 1G5TA 2ZS8A 3KXDA 4U7TB 4MMXB 4C08A 2RB5A 4L4RA 3WWOA 1KK2A 3EWNA 5DHSA 1QGZA 1Y6QA 3ILSA 4HRYA 4YXFA 1GGEA 1JIJA 1OHHA 2C84A 3H7AA 1R8XA 3ITEA 3PEEA 3TMKA 4E1AA 3B89A 2RK3A 4AYWA 4UBNA 1M33A 1CJVC 3EH1A 3R0ZA 1QF6A 5T64A 2QBYA 5EWMB 4M1EA 4YAKA 3FPSA 4UU7A 1H6CA 2J5BA 3F7NA 2RGUA 1H65A 1VECA 2CF5A 1EFRD 3SE0A 2PS3A 4CKWA 3U6BA 5JDIC 4ZCQA 1I6WA 1Q6ZA 1R66A 3F7OA 4YCJA 5BVGA 3RFUA 2RHLA 3ZDAA 4UDNA 1W29A 1PYDA 3O4HA 2QRLA 4KZPA 1Z6YA 1MJFA 4JEIA 3TQRA 3FKSD 4ZI7B 1SVUA 4P58A 1YOVA 3UH0A 1JTEA 2A5JA 2GJKA 2V96A 2ZB7A 3H2SA 3WGIA 5EXPA 4NZYA 4L7VA 4HGNA 2R3SA 1UBOS 3X0DA 2JVKA 3P4YA 1GGHA 5FPHA 4M46A 1XU7A 2TMDA 4YAIA 2W6JA 4U2DA 1HYEA 4O3FA 5FLYA 3UAVA 1N2JA 5F52A 3LMKA 3NGXA 1SUSA 1Z06A 2G70A 3GARA 3V1TC 4BS9A 3ESQA 2P8SA 4LWZA 2B8JA 5KSOA 1ZA1A 1ZICA 1VG8A 1WPGA 2CKDA 1RABA 4ES6A 3WA6A 2RBGA 4KQJA 3SHWA 1ND5A 2I3AA 1NF3A 1TC2A 2ODAA 1RMYA 1Z28A 2V45A 4RSGA 3NHFA 5HF9A 4XJSA 4XRGA 2JRLA 4EPYA 5CM9C 1E79A 5AK3A 4JUFA 2ZJYA 5EMNA 4JP2A 4RTJA 2V7BA 2KS6A 1DFHA 2B30A 1SXJC 3J7TA 1EHCA 3TNYA 1W0CA 3WB2A 3OESA 1N7GA 2F90A 2Z57A 5B1HA 3T5MA 5EHZA 2EYQA 5KAMA 1YVUA 3I2YX 1ZCBA 5CXSA 3T4EA 4CL3A 3G0OA 3GUUA 4RD0A 3NHSA 4RLQA 4P35A 1QM5A 1C9EA 1JG3A 1RE0A 1CY0A 4A0FA 4BNKA 1U7OA 2AC2A 2ROQA 3JX9A 4H1TA 4E5VA 1GEEA 3E3LA 2AOUA 5AIBA 1C2TA 3PPIA 4LHYA 1SBCA 1Z7GA 2F3TA 2HLHA 3AHHA 2EP7A 1LBIA 3LDGA 3H0CA 4INJA 4KXNA 1Y37A 3Q85A 4DJ5X 3GFTA 1TJ3A 3SZGA 3PL1A 3RF6A 1TVCA 1NYRA 2DZDA 2HYDA 2NYRA 4J1SA 4D57A 5KQLA 3BORA 1GA6A 4I50B 2VYND 2J9YB 4D1YA 4E1BA 3EQ9A 5KKAA 1G6OA 4TV8B 2JJ1A 1N1MA 4FILA 3KT6A 5BP7A 5I8PA 4AN1A 5JEDA 1Z6QA 4ZCSA 3L7NA 5JZBA 3DH0A 5K0NA 2DPXA 5FHRA 3VC1A 3L1IA 5TQ2A 4O4IB 4OHOA 1XR3A 4DA8A 1JDJA 3JQ8A 3SEFA 1JZTA 1JR6A 1CS0B 1ETHA 2JJ8A 3B6MA 4LWOA 1QS0B 2CUZA 5FPSA 1KYWA 2PT5A 3D4OA 3NWBA 4Z9YA 4D7AA 4MVCA 3VNBA 1ADCA 5C9ZA 2AJ8A 3TW8B 3TRHA 3VPAA 1JDBB 2NO9A 3JYNA 6ADHA 4KAFA 4B73A 4BU0A 3H65A 3ZLJA 3PK0A 5J4YA 4NE2A 2P11A 4AS3A 4KL8S 2Z3ZA 3DGEC 2W6ID 2H5IA 1XD2B 1U6JA 2AZTA 1U7PA 3GFGA 4ENPA 3NNNA 5K0EA 2JK1A 3DAGA 5IJAA 2EFDB 4DEYA 3N87A 5A04A 1P4RA 1UBEA 4ZOAA 4UCXA 1VBMA 2O0MA 3H05A 1NXWA 3QPVA 5EQDA 5JG7A 3U1VA 5B30A 1TCVA 4P7JA 1L8OA 2F3UA 4MPPA 3FR8A 1QHXA 2X40A 5KOYA 1CQJA 4UBOA 3UFXB 1ND6A 4AZ3B 1OFIA 1R4ZA 2DBRA 3RADC 5ILQA 4EPVA 2O0HA 1KO1A 1D4OA 1QGUB 3D2CA 3P9XA 5IEBA 1RRCA 2IX3A 3AM4A 3U49A 2ZR8A 2VPPA 4AG6A 1V3UA 3OIDA 1QVRA 1Y5NA 4M9RA 2DQSA 2JFFA 3K5PA 2ZJZA 2HCRA 5IVHA 1RVV1 3WMGA 1EFDN 1IHOA 1NDQA 2GM3A 5TS2A 4EVRA 4BASA 3SYLA 4I7EA 2BGUA 3HDQA 5EKXA 1N5OX 3V2UA 5JD4A 2VI5A 1T0IA 4L9WA 4PYMA 4LY9A 1CE8A 1SVLA 1H69A 1YB6A 2H59A 2WTNA 2Y1CA 4Q3OA 4Y6SA 5HMLA 4RVHA 1Z47A 5COQA 3B7PA 5DSZA 1V8OA 5FI3A 5THQA 1GEGA 5GM2A 4RPGA 4CHTA 1QV6A 2G1UA 4YTEA 2FG5A 1XNQB 4O4HA 5IYZA 1LKZA 3A3KA 2GWHA 2JZNA 2P30A 4JUCA 4O0LA 4RVDA 4BEJA 2DERA 3K70C 3IDZA 1KS2A 2J0EA 4L76A 5HS4A 5DNEA 1PS0A 1MPTA 4MGKR 4R83A 5ECWA 2PD6A 5ED0A 4LQLA 3TJRA 5TMPA 1RM5A 4Z8XA 1L4LA 3U3OA 5HTOA 2Q5JA 3BS4A 1GAEO 2QJWA 2W98A 4LSMA 5NULA 4EG4A 3EOBI 4K6OA 2WBLC 3LSYA 1NVVQ 1XQ6A 2AS0A 1NUHA 1OVMA 2WWIA 3KB2A 2QAGC 5JSFA 3PENA 4G5GA 3N8DA 1AHIA 3NT5A 4F9GA 1IONA 3GFQA 4WUTA 5EOVA 3JRNA 1C1XB 2AN9A 5EQJB 3JQGA 2HSJA 1UEXC 5EHXA 4O4LF 1VPTA 2CXQA 3F7TA 3LQ2A 1FFGA 4KMSA 1S2DA 3KSRA 4IDOA 3MVEA 1DWQA 2GJ8A 4HQLA 4OAPA 4N3BA 2C1EA 1WY7A 2A7QA 2Q5OA 4B81A 4MV0A 4UCFA 4RYDA 3EVCA 4J0IA 3NNSA 1X13A 1HDGO 2YCBA 3E6AA 4M4SA 5CB4F 1FSSA 3JQ7A 2QR5A 1RXIA 1GOTA 3WJ2A 3Q7QA 3DE5X 1DC3A 1SHKA 4MKIA 3G8YA 3MGBA 2AOTA 3ANXA 1WHTB 3F3KA 3QLTA 3UW1A 3WTCA 5KC9A 2ECFA 2J9FA 4DCJA 4DOMA 3OFKA 1CSEE 3BA6A 1I2CA 1XHFA 1AQ6A 4F4CA 2IPXA 3OWXA 4ERNA 1XB2A 1E1RA 3GFFA 1L3CA 3IA7A 5DV9A 5AM2A 5L3SB 3W9BA 1ZM9A 2XMQA 3QXXA 5C18A 2J3EA 4XW2A 4Z7JA 3W4IA 2XOXA 1VYVA 2IEDA 4LHWA 1E2FA 1EM6A 4S1OA 3MYRA 3AF2A 4I9UA 4H1WA 2AFIE 4FLMA 1OX6A 2BF4A 4F8EA 3IP5A 1WD5A 4RK5A 2QW0X 3W1EA 3SFZA 3I1YA 1AURA 3KFLA 1H1DA 3SXJA 1OTHA 1QIDA 1M6HA 4BX9A 2PGAA 3I9OA 3NZEA 2XECA 2P6NA 1EQAA 1PJQA 4LI3X 3EGCA 4XIJA 4RTKA 2H51A 4KXXA 2HAEA 4W9RA 4WCVA 1AS0A 1VJ5A 3FSRA 1J5EB 4QHYA 5HTKA 1JWBB 5DI3A 5IJZA 1UM8A 5AKXA 1TD1A 3LI2A 4N8DA 1MG5A 1HF3A 2PGLA 3HBFA 2QL9A 5HZGA 2J4CA 4DV4B 3PXUA 3AHFA 4GKBA 5ALVA 4QU8A 1K6EA 2VDQB 2AUTA 4U1RA 4JELA 1E2PA 1Z88A 1SVMA 4TSFD 4EJ6A 3IC5A 5DXAA 3I04A 3KBBA 3M5DA 4LV5B 5IABA 2P0YA 5GOTA 1W76A 1X7GA 4QBFA 3R8CA 3RUDA 1U9CA 3WYGA 4CLEA 1IZZA 3K8OE 4EENA 3HDHA 4FUQA 2X5XA 3PSHA 3PCTA 3RS3A 2ZM6B 1D2MA 4YAGA 1FMFA 3Q7PA 1BDJA 1CIVA 3A0UA 1Z39A 1XNRB 1QZZA 2FP3A 2SICE 4LOLA 4BMVA 3A10A 4IJVA 4JAVC 2GXQA 2QZJA 5B1SA 1YZGA 3IPAA 4ER0A 3DMPA 1CJCA 4LV6A 3QWFA 4C4AA 4BVAA 3R9XB 1N6LA 2R5NA 3WWDA 1IY0A 3Q88A 2AN4A 2R47A 4P3PA 3IPCA 1V11B 2XNCA 1DX6A 2JEZA 2RGBA 2PO7A 1P9OA 1MZVA 3JD1A 2QRGA 3LLCA 4URUR 3AUAA 4IIHA 2WWHA 4FGWA 1EVZA 3F9RA 4FLFA 3SS7X 4E2XA 1DCTA 5ER9A 5LKAA 4H1HA 3BUSA 3C87A 3VKGA 3E9CA 4IDFA 1RRFA 3GAZA 1QQTA 1ZD1A 3I76A 1XMOB 2BSQA 5ITVA 4WY5A 3EWSA 2NTVA 5I45A 3D4IA 5HRUA 3ZVMA 3D0QA 1IHDA 5B1IA 5TGTA 3KVYA 2I7CA 4CWAA 1VCHA 2KWIA 1NR7A 5LOVA 3K8YA 4FYXA 4Z7NB 5AHOA 3B3JA 1Q17A 2I2DA 4U00A 1TAUA 1IZ8A 5D3KA 1YB5A 2AW5A 1VE1A 3INTA 2FUEA 1Q77A 3GOQA 4H3SA 2BFEA 3NLLA 2IXGA 4KVFA 2I71A 1NQAO 4KN6A 5BNTA 2EJBA 2JGEA 4RPCA 4D8VA 2NVOA 3PWTA 1I4EB 4YFYA 4BLWA 2C4UA 4A7PA 1D03A 3A6FA 1H0RA 2CMHA 3D3JA 1CZHA 3R20A 4AJKA 4EWLA 3GFBA 5ESXA 3W9UA 2P35A 1BFDA 5AW9A 5DGXA 1HG1A 2BHTA 1QDLB 2I8LA 2ZRGA 3VR6D 1SVKA 4FFRA 4TWAA 2MU1A 2XVYA 3HCNA 1B7GO 5B7GA 1S3SA 5FLXA 2B7BA 4IIVA 4AL4A 4BCCA 3N5CA 1GPDG 1AKWA 5H7XA 3UAWA 2VBFA 3HUTA 4FOPA 4KHZA 5BUCA 1TLTA 3FYUB 3GW8A 2QOEA 3LHSA 1XDZA 4XVCA 2CXUA 3PR3A 1PZNA 4BVLA 2CWWA 1USGA 5T3YA 4DKXA 1JHVA 1PS9A 3QY0A 4MQMA 4QXAA 3WHPA 3DE7X 2WZBA 5K9ZA 2CVOA 4BWYA 1U2GA 2HSEA 1J25A 3R5XA 2WTBA 2P2NA 3FFWA 4G1CA 4DYDA 5ICGA 2DF8A 2OILA 2WPNA 1GRNA 1NAIA 1JPVA 5JFGA 3IBGA 3DPIA 4QO8A 4DUGD 2Q1TA 3RVSA 3OMLA 4HGYA 4KQEA 3IUJA 4C6TA 1XMQB 2EYUA 3OE7D 1UT8A 3L3BA 3NEJA 4DMHA 2P90A 5IKOA 2PTGA 2Y66A 1GTG1 3WFJA 2VBGA 1YXMA 1KYXA 1HV8A 2L18A 3DBHB 4XR9A 3MWGA 3MINB 1NATA 3B36A 3PU6A 3Q9UA 1JU4A 2FAXA 1S3FA 1PR3A 4LX0A 4NBKA 2ZTVA 4R68A 3SQNA 2HJGA 2VPYA 5JH7B 1BDHA 1D6MA 1WPQA 2BMEA 2I54A 4MKGA 4HL6A 4TV9F 3WGJA 3TLZA 3EEQA 4XYBA 4DCOA 5FOSA 1JI0A 1G5IA 3Q41A 4MYCA 2HXSA 4LBZA 4NCXA 1AQNA 3DEYX 2BFBB 2C83A 1UBCA 4R7ZA 2K6GA 2IX9A 1Q0RA 1IQ0A 2H18A 5FF9A 5FHQA 2VDRB 4YMTA 4HDNA 1E7QA 4MQEA 2JFPA 2ON6A 4DVGA 4HEJA 3FETA 4GZMA 4PZEA 4B3SB 4YCLA 1D2NA 3INYA 2WM3A 3GEHA 1EYZA 4MCAA 3RUAA 4L3OA 4FYMA 1ZOSA 2HJVA 3ZIAD 1DFGA 3DTNA 1JW9B 2Z6QA 3GJZA 4NAVA 3PNMA 1ZZGA 1LBEA 3I9LA 2XD4A 2GK6A 3VU9B 3UY4A 4FDVA 2FWBA 2B92A 3DKRA 5TMBA 3HM2A 2F1RA 4KR0A 3WISA 2G8LA 3R3HA 2X23A 1T4DA 4N6GA 4RZHA 1IPFA 4CF5A 4NHEA 2QGFA 3ESRA 2A1UB 3SJUA 2B78A 5CLIA 1AKRA 1D1PA 5B58C 3J81A 3MMPA 4OQLA 5DOVA 3L92A 3UWPA 1P5HA 5JRZA 1L1FA 2W71A 3PKIA 2JIOA 2W2KB 5JWRA 5LYJF 5EGSA 1E0AA 1KO8A 2DQKA 3C3KA 4H7HA 3BXOA 2II6A 4UEWA 4M1MA 4I55B 1OBVA 3EGXA 3KVRA 5MDHA 3MTGA 5J4VA 4JVSB 1QYDA 1SNYA 1GA4A 2JVIA 2O2HA 3L1KA 4GSKA 5KU1A 1SN7A 3OOJA 4RKQA 5I7RA 1L5SA 2H2FA 5K03A 4G1VA 5J1SB 1VE9A 3LPMA 2WY2D 2I62A 3FUWA 1BRMA 3NKVA 4U39A 4EHFA 5IH7A 3SKVA 3ESZA 2JBAB 2FZEA 3OQPA 4MR9A 4MW4A 5DTMA 3UM9A 1JAZA 4R1TA 2XQJA 3H2JA 2I8AA 4EW1A 1RZUA 1PUIA 4Z9XA 4BGIA 1EFUA 1XK7A 3K6SA 1UFOA 5TGDA 3HN2A 5BN1A 1M0EA 1J8MF 1TPZA 1V37A 3D81A 3FUXA 2HLPA 2YJZA 3I30X 2JC3A 3LP8A 4CMHA 2HA4A 2JD2A 2FX5A 3IE1A 3I8XA 1XZCA 5DW3A 2G5CA 3D7SA 1QZ3A 1I32A 3EDYA 3KX2A 5G53C 1B8OA 3A25A 3ZEIA 2WD7A 1LI4A 3EXG2 4PAOA 2I33A 5F9HA 2XZPA 3KOUA 4I9FA 1OLXB 1QP8A 3A1WA 4S2UA 1Y1SA 4IOLA 5AOAA 1RNLA 2WZQA 4RYLA 2Q99A 1X7HA 5IAEA 2OLJA 4PFJA 4CGYA 2AOWA 2Q3HA 3HJAA 4QTUB 4BVGA 2GS9A 621PA 2YRXA 2JIBA 1F0PA 1DTWA 4MAFA 4V0SA 2JFBA 3AHGA 4DDUA 1T10A 3VKFA 2GCOB 2LCQA 4YUAA 1TE2A 5JCPA 1TOAA 4EVQA 2UVPA 1LSOA 3L0PA 1CIJA 4LHZA 3V34A 1NIJA 3VJLA 5CA0B 2ZRJA 5BOSB 4LI0A 4FWTA 4ANFA 1KGSA 2P65A 2RGAA 4HDOB 4OJMX 1E1KA 4CTMA 4RTQA 4OJTA 2GRJA 4B3GA 4J1QA 5KTNA 3CEMA 1ATIA 4JS0A 2VSNA 3NONA 3EA0A 1GU0A 3CRZA 2C3YA 3D0RA 1T3HA 3HY6A 3OT1B 1WSBA 1X1DA 4DDTA 1SVOA 2CBXA 2FN8A 4WXEA 1OW3B 4EKDA 1C2YA 2BI8A 4F6CA 2GN2A 3PHGA 1JBKA 1MC4A 2ZJBA 1XTJA 4CCAA 1GCOA 5BYKA 1T5OA 4M1OA 5AJTA 4E07A 3BX1A 3SJCA 4DLPA 1U7UA 2G8NA 3H83A 5BY2A 4NZOA 3WSTA 1UJNA 3EA4A 2FF5A 3LF1A 1UXOA 3MLBA 3NWPA 3RVPA 4EHKA 3S27A 5JNSA 1W52X 2J9XB 2XYRA 1EX1A 1EFTA 3H2BA 4LXHA 4MRVA 4X93A 5L4LA 3F6RA 3HJCA 3MUFA 3Q6IA 4FFLA 1E9AA 1G8HA 3CTPA 3Q3VA 3TSCA 4ZCMA 1PP4A 2DFPA 3E0XA 3H1FA 3ZW9A 1Z13A 1I4DD 3OCXA 3OOYA 5C7LO 2W8ZA 3GAMA 4QQKA 4C4XA 5IPFA 2AK2A 4OHUA 5H3CA 1HG0A 2L17A 4PZPA 5C8YB 4HYEA 3ZY3A 5JASA 5LQCA 4R8LA 2MYNA 5JBQA 1P0CA 3D7MA 3ASVA 1W0KA 3ORYA 5IVKA 1BGWA 5ARBA 1VA5A 5CAEA 3GH3A 1A7JA 2HQ1A 3L0CA 3MAJA 1JKMA 4LIPD 4DILA 4NJEA 4L0DA 2OO7A 1SXPA 4ZICA 2VYVD 3PNLA 4E09A 3L7DA 5GVSA 1A82A 5CD9A 4PYQA 2FW9A 3ROGA 3HLKA 5FUBA 2WFZA 1Q74A 1BWQA 3ZWBA 4FD3A 2D62A 3IDQA 1Y9AA 5I7FA 1FDIA 2AQHA 3D8NA 1HT0A 5GPBA 3MT9A 1E2IA 3VMFA 4B5LA 1NVWQ 4DF3A 1P0QA 4LJ8A 5IASA 1NN0A 2WABA 2VUUA 3FAZA 5HJ2A 1IWPB 1A2OA 3B5EA 5E3JA 3FLAA 1P1FA 1CNEA 3BTUA 1YFLA 1AG9A 4Y18A 2QUBA 1XROA 5DFAA 5EJMA 4XGRA 2QSZA 1IEXA 1Q0ZA 2B83A 1JIXA 2G9QA 1QQAA 4R9SA 5LXTB 1SIBE 2I6UA 4KJXA 2BI4A 5JMTA 4Q19A 2VC2B 5F23A 1C80A 1E4OA 4M8SA 2XTAA 3AB8A 3OX2A 4AJPA 4D97A 3RQIA 3GVPA 1FZTA 1JGTA 1OU0A 2IVFA 5AKYA 1LSSA 3H6GA 2IIPA 2QPOA 4FKMA 4EY4A 5L45A 4JYZA 2NZXA 3AEQA 3N2KB 3U7QA 3PXGA 3CMCO 5K3EA 3JQ6A 4DZRA 2J30A 3I6BA 4OYYA 1XJ0A 4UBIA 4W5RA 4OFXA 1WLSA 3GF4A 4R84A 3VU0A 4HFMA 1W47A 1QYIA 5IJ9A 5I7OA 2CW5A 4YHBA 3WMWA 4KR3A 1S5PA 4OX9B 1JR4A 3W06A 3HDJA 4PBRA 1CRQA 3FFXA 1S01A 3GJ0A 5D3MB 3CE6A 2JDIA 3NHRA 4KRXA 1E8MA 4AJJA 1FQKA 4CKXA 1HEUA 2JGDB 1KQ3A 3OPNA 4U2KA 4EFNA 3N28A 4RO0A 4D3ZA 1NMQA 1CQIA 1QGYA 1F6WA 4ZJYA 1N5KA 3SQMA 3OQNA 3G2KA 5HBRA 3UB3A 2EZ4A 5A2GA 4D25A 4FSDA 4TL6A 4B4WA 2ZUEA 1A9ZA 2QM0A 2ZWOA 3BJMA 2R7MA 3OLZA 4YV7A 2ZB8A 3SYMA 6REQA 4J1TC 3TQFA 3W7VA 1DKUA 3GGGA 3CRMA 4Q1FA 2VJPA 1U99A 1EGVB 3L7MA 3QBJA 2C5AA 4WKOA 4A1OA 3UJNA 2WJGA 2FVXA 1EE2A 3DXZA 4NSNA 5FPQA 3V4VB 4MVXA 5B53A 4UATA 1GVHA 1PK8A 2B21A 2DJIA 2Y05A 4ILKA 1Z5PA 4K9QA 2GZMA 4H15A 2DWUA 3CZRA 4QXQA 5D3ZA 3PZRA 1KE2A 3MJ4A 1OT5A 4AJLA 5DNYB 3C4JA 2JL1A 3RSZA 4O4JF 1SMKA 1KMNA 3NBKA 4QGHA 2FEXA 4YQEA 3A6JA 3H13A 5A7FA 3TUIC 4YRJA 2AZ4A 4YYZA 1UPXA 1QIGA 3VKVA 1WPXA 3ABSB 3AWDA 4FBLA 2ZDHA 4WXHA 5DXFA 2J08A 4UEJA 3C39A 5H4HA 2W43A 1GQQA 2CNNA 3GXBA 3RYFB 3IRUA 4EKYA 1J56A 5FUYA 3CF2A 3FYSA 3NV7A 4FWBA 2MMCA 4B6FA 4BUZA 2IDJA 4L3VA 4LTMA 1QOQB 3T34A 1MG0A 5J3JA 2O8DA 3HL4A 1IDOA 4RV4A 2PL1A 3RSCA 4IHKA 1NZFA 2HV9A 3KQWA 3PFHA 3SGLA 1C29B 4BN0A 3IYLW 4CLOB 1H9CA 3VNRA 4PSKA 5DSTA 3PKJA 4HPXB 1X8XA 2ORED 2Q41A 3C2QA 3NW9A 3K9NA 3KXIA 4W9NC 2NYAA 2IYUA 5FI1B 3SBXA 1JLSA 3OICA 4AIIA 1FNBA 2HA5A 3TBKA 2GN6A 1BU5A 2JNWA 3C16C 3CUSA 4ARUA 3AF3A 5AH0A 2ZIAA 1NNEA 2BVNA 2QUIA 1RPJA 1XZKA 2ZJ2A 3ILHA 3N1UA 4I1OA 4KBGA 4TXLA 3SYNA 4DIMA 3UWDA 2C7VA 3GPDG 1C9JA 1W5TA 1DXOA 3JZDA 3OZEA 2GNPA 3HL0A 4FNOA 2NQ2C 4GOXA 4I5EA 1LEHA 1KERA 3DV9A 4GT1A 3HB0A 4N5MA 1QUFA 4FONA 1HX7A 3DMNA 4RPJA 5DYNA 4U9IS 4HG2A 3ROZA 1RWOA 2QRZA 2ZYDA 3HUFA 4HB4A 4OBEA 3KK0A 4PLHA 1DXHA 3SHTA 4URHA 4FGZA 4IW3B 1D7AA 4A6DA 1DC8A 2HQBA 4IS2A 1T2AA 1NW7A 4D2IA 1SXHA 3GRUA 2GPJA 3GJ7A 4AZ0B 4IG9A 2DKFA 3IMEA 2QDXA 2B94A 3FLEA 4EY6A 1GKUB 1SXJD 4NYMQ 4DLLA 1CFZA 1O58A 3OAAA 5I9LA 5JFOA 3PYLA 2PR2A 3NKLA 4F5EA 4EKEA 3ND6A 4CI0B 4J6FA 2B0JA 5KB3A 1JT2A 3TOZA 4D4LA 1TUBB 1TZMA 4JBIA 5EI5A 4BO4A 1U0SY 1X3LA 2KQUA 4FN5A 1N7JA 3KELA 3CSSA 3Q87B 3T0FA 1JL3A 4Q12A 1OX4A 5G41A 1F5SA 4E46A 3K0AA 4Q39A 1G1AA 3MRVA 4WJZA 2FXIA 1SOVA 5ALZA 3NTXA 3FRJA 2AF3C 4M76B 1DUIA 1UAGA 2J9GA 1S02A 3G1WA 3ECAA 2IJGX 3OJFA 2R1ZA 3VTKA 4KPEC 1BAPA 2JFUA 4MS3A 3IIEA 1LPMA 3EYAA 4OFZA 1IOZA 4R0NA 4CFSA 2P79A 1E2JA 2EKZA 3TQCA 1LCIA 5IKMA 4A8TA 4WXMA 2EERA 2XDYA 4KVAA 3I8OA 4OM7A 5F7JA 1QGAA 4I0WB 3TB4A 4XQGA 1AIPA 4ZAGA 2Q2NA 5DTJA 2O57A 5T41A 2XSZD 4DY6A 3BWMA 2VOJA 1C3OB 3MPOA 3RTAA 1PX0A 3MWDB 2QNRA 2NIPA 3GG9A 3KL2A 2MR5A 3HBNA 2J3LA 3LD9A 3ZDXB 3HN7A 3JALA 3WL4A 3A6LA 3F4BA 4P5DA 2UZ3A 4UUQA 2Q9AA 1NAHA 1HMYA 3FYCA 4GI3A 1T5LA 3WNCA 3B1JA 2N46A 1T1RA 4XYEA 1J06A 2Z1NA 5EJ5A 3BXEA 4UU0A 4KO8A 1Z2PX 4ND8B 2IY7A 1TYZA 1UBUS 1VSTA 2XYPA 5DTIA 2V1XA 4KPFC 2GHRA 1KSGA 3VC7A 5HX7A 2P5UA 3DZDA 1MFPA 2YN2A 2IHYA 4WHMA 2XGOA 5E6SB 1TQHA 3GH1A 1JZQA 3QF4A 5D3QA 5F7XA 2LE0A 5IJ0A 2XVAA 3PA6A 1LI7A 1AF7A 3NPMA 4LKRA 4AJOA 3IHKA 4PG8A 2UUBB 3QM1A 3T94A 3HEMA 3FMFA 2YIJA 3KV3O 4HNTA 5JNVA 2QTLA 1KC1A 4K5QA 2ZAOA 5IX8A 1RWXA 3QFTA 1Y33E 3A4YA 4ZC8A 1O4WA 2PMBA 3NVDA 3OBBA 3DKPA 4TVOA 3UMYA 2RGRA 1NLYA 4KV9A 3UH1A 3ZJ5A 5CDHA 1OLUB 5HK9A 4OGLA 3PLRA 3JYOA 3L0BA 4TTIA 1JJVA 1GY8A 3BWVA 4KX5A 3HA5A 2RARA 3IAM6 2XKKA 4G0NA 3C7CB 4D4GA 1KI7A 3WL7A 1RAFA 2AI2A 4QUIA 1M0TA 4AY3A 5HR5A 2A5DA 3ILVA 1H2FA 1E6WA 5AUOB 2ZSIA 3QU2A 2EQAA 3DVAA 3S1LA 4E4RA 3EZGA 5IG2A 3U0BA 1OI7A 5KNDA 1YIDA 4I3FA 3CR7A 2FFQA 3V33A 1H9AA 1MA0A 1PR9A 1TTHA 1O4VA 5H0IA 1A5TA 3O92A 4RESA 2QE7D 2BR5A 1KJQA 3DDUA 1B3BA 3KSAC 1V35A 3HYTA 4M0FA 2Q1UA 2H7VA 5LU9A 3WB1A 3UJ9A 1TM4E 1B26A 3RT1A 1EKXA 3KLOA 3CE9A 5DWQA 3P9IA 1AF4A 1E18A 1TEVA 5FRDA 2OV8A 1IMJA 3VC2A 3AFMA 1RS0A 3SR3A 2P8JA 3FSEA 4GQAA 1SVNA 3NBQA 4HB2A 5KYWA 3I2IA 3T0IA 3SG0A 1KFBB 4YACA 1OIWA 1FX0A 1QMGA 4PX9A 4QU0A 4UE3S 4CTKA 2J07A 2CVFA 3B2QA 1TYEB 3B52X 4FI3C 4PC1A 4KNVA 4B6PA 4FR0A 3OTOB 3K70D 4DKJA 2R85A 4AKEA 4O2LA 1QIJA 3EAGA 2OQRA 1G18A 1VMEA 2UZIR 4GOLD 3OFNA 3NX4A 1UJ2A 3A7EA 5DX1A 4G0VA 3HVUA 5K8CA 5KTTA 1U8XX 1UFRA 2J87A 1C8VB 3NIFB 2OR3A 1DSSG 2QYSA 4EG0A 1QBGA 1G7SA 4MVJA 4OL0A 1E0SA 3M5PA 3SJZA 3KOYA 5IKXA 3OUZA 1V5EA 2VHJA 4L4YA 2V4UA 3OU2A 3N75A 3UWMA 1IPHA 1DWOA 3EBLA 4HNGA 4FDTA 3G0DA 1QJ4A 1YACA 3H19A 5CLHA 5HE9A 4QG7A 1KSFX 4GGPA 1U90A 1EUDA 1Q16A 3O47A 2I67A 2C88A 3DBLA 4FXPA 4O2AF 5HFNA 1IBRA 2AD1A 3KPYA 4ZQEA 3ZXYA 2H4XA 3BMQB 4KYIB 2X8JA 3P32A 1UC5B 2ZYRA 4HAUA 3LK6A 3MT8A 3KE8A 4QIHA 1UH5A 2C3PA 4EFDA 1UDAA 2WJWA 3NP7A 1MAAA 3UV6A 1FU7A 4WI1A 3TZLA 3ZCXA 3AVQA 3H18A 3NEYA 4P54A 3ZWAA 2H17A 2OZLB 3GLFB 5M3BA 1T4CB 4H0NA 5ERYA 3UHFA 2OV2A 5JQGA 1KS9A 4N9WA 1G6KA 3OIYA 4NZNA 5EIWA 1Q12A 3PTAA 1M34B 4BLVA 4B3RB 4RKWA 3SK0A 1Y6FA 4DMCA 1K0UA 3REQB 1VKHA 4RNCA 4LPKA 2WJVA 2D5IA 1E4YA 2GN4A 4OCZA 2XGJA 4UHKA 1RC0A 3KLBA 3ABIA 3M9WA 5H81A 1KP2A 1Z5GA 4X95A 1QU3A 1I7LA 2HU8A 1X38A 4S3MA 4QREA 5FULA 4C07A 2JCSA 1DQRA 3ZU6A 1ODLA 3SVLA 4WADA 2G5TA 2GA8A 2FFAA 5AI8A 2SCUA 4EOGA 4DR7B 3FWKA 3VPBA 1NVVR 5FR2A 1U6IA 1J99A 3G5TA 2XQFA 2C4TA 1NVAA 2PCLA 4X3CA 1G8MA 4OQFA 3BMNB 1Q0QA 2EKLA 1TO2E 4N0PA 3EFBA 4V3CA 3I5UA 2ZUWA 3WGLA 3F49S 3IVXA 3F6PA 2X7HA 2G0NA 3NU1A 3P20A 4DZTA 1Q19A 3GLQA 3ZS8A 2IZ0A 3WR5A 3KXPA 1W0JD 2D7DA 1WB6A 3TLGA 4CV2A 4A27A 4C4PA 2NP6A 2Q3DA 4YPVA 1ZXXA 4UARA 2NVUA 3MQ2A 3C6YA 3PVCA 2ATEA 2Y99A 3DAPA 3TI7A 3BJIC 4HX9A 4I6GA 4EJSC 3FNGA 2FPPB 2FPMA 3A05A 1UP7A 4J43A 2I4IA 4HH0A 5HEKA 2G1JA 1E60A 3BK1A 4X6XA 1R9NA 3G6KA 1MU0A 4CLDA 2VK2A 5JCXA 2B9EA 2JZOA 2JGJA 3H04A 3QXSA 4NP6A 1TI7A 3CJTA 3R75A 2XGMA 1LWOA 1UOOA 5CIQA 1RTTA 3MSCA 3WKAA 3BWEA 6NULA 4GUDA 2P2YA 4P4TA 3A9UA 5B7PA 1A4XA 3R3VA 6REQB 2O9JA 4MZXA 2ZM5A 3CN9A 3ELWA 5KUTA 3KZVA 3QVLA 1JHPA 3K4PA 1KEWA 4Q3KA 1KYQA 2ZB4A 1XMIA 3QF7A 2BFAA 5CYGA 5IXYA 5ALHA 1QH9A 1JH8A 1BS2A 1XQVA 4QQFA 2E4ZA 3R3JA 4GPD1 4W1RA 5KPDA 2VTBB 3CVUA 1QGED 1TD9A 3CVWA 1VGRA 2WAMA 3L7AA 1SPBS 3S1AA 4BMZA 4ZZIA 3LLVA 3CYFA 5HPYB 2G09A 2IGTA 3HM9A 1PD1A 1N6KA 1U9JA 2OFOA 4PINA 1X87A 5CU7A 3X44A 2IHZA 5L7TA 2X0IA 1EX7A 2JGAA 1R0CA 2L19A 1O1YA 3OZUA 4X8LA 5FYDA 3TBHA 3R9IA 1XAGA 4HNHA 3GDWA 3P1JA 1QTNA 1J49A 4B46A 4YCCA 1XP8A 2L42A 3LRPA 3EVBA 1Z0SA 3HNPA 2JAOA 2YIDA 3EPJA 3VM6A 2VIIA 4LOAA 1DQNA 1T15A 3HU2A 4BNJA 4YT2A 5CLQA 4KE8A 2C99A 3BDIA 4CZ2A 1H4SA 3P0IA 4Q37A 4CV0A 3SEZA 1H2EA 1I0IA 2J3MA 2GN9A 4QC2A 4URVR 2QL6A 4G5FA 3I28A 4HDAA 2WAOA 3Q8MA 1TIBA 3KCNA 1L4NA 3SEAA 2IELA 2WWGA 1YR9A 2VZLA 1JDVA 2XWBF 3C5EA 4Q9DA 1ZQ1A 4KUHA 4XWTA 1AUQA 1ZIDA 1XL1A 4Q3NA 3LC1O 4YQFA 1EFHA 1N8TA 2H1CA 2VXYA 3ME5A 4MV7A 2ZYWX 4OOFA 4YRRA 4CG0A 4CGZA 4ITVA 1I3KA 1THMA 4RL4A 1RBMA 4YRPA 4JITA 4XB2A 5EXTA 1DCFA 2QW1A 1QAQA 4J3NA 4CMCA 2FN4A 1F3OA 1XRSB 2Q1YA 3OOHA 3LPAA 1AC5A 4R2XA 2GPYA 2A5LA 3HV2A 4D9IA 2WWXA 4KWTA 4ADSG 1JALA 3A8TA 4YBRA 2VO1A 3ON5A 4WH0A 4XA8A 4B79A 2QRJA 3Q6MA 1MX5A 3JWEA 2HA6A 4OQEA 1PSZA 1Z5UA 5CHYA 1B2RA 5ADUS 2NXCA 1UEJA 2WT9A 1QGOA 3D5EA 1D1TA 3EA5A 3OTQA 4TYYA 1QHNA 1YZVA 2W6MA 3USZA 3ENQA 3O4RA 1Q44A 3AVYA 5COAA 2K4MA 4U9UA 1EQUA 2RHDA 2J4DA 3U7JA 3EIQA 5IAOA 1VPWA 5TRTA 1I1OA 2RGNC 3C3WA 3IHTA 3W6PA 5CVVA 2Z6AA 4ENTA 3WHIA 1GAWA 2NO5A 5IZCA 4HB0A 4GH5A 4RU1A 2O0LA 2HD4A 2QXUA 3F8SA 2DPHA 4GEKA 1JX6A 1YL5A 3MOIA 4YJ3B 5TSDA 1N3BA 4ARZA 4DAOA 3KJFA 1GV0A 2EW2A 3RC2A 2OC9A 3JARB 3TH5A 4GX1A 3VDQA 3RS8A 1AQIA 3B60A 3E1SA 3TIFA 2JAUA 3M9LA 2IL1A 4V0LA 4OJKA 3BA1A 4NCHA 1JJ7A 4LZLA 1OWMA 2HJHA 4UM9D 5CURA 1JBEA 1DJNA 3KB8A 4JGBA 5ITSA 3UTDA 3QVUA 2ZVJA 4EY8A 4D4MA 5AYVA 2QF7A 5IDQA 1SBYA 4CKEB 3L4BC 1LRJA 1FBNA 1P7PA 2O59A 1Z0KA 3GUHA 4F6LA 3ICOA 1E2EA 1F20A 4Y0AA 5IHPA 3LWDA 4PYIA 4I1SA 2OQVA 3VNSA 2ZYAA 1N6OA 3V55A 1FDVA 3AEKB 4RDCA 2X8BA 5CEJA 2PGXA 3CVVA 1HNXB 1HNWB 4F12A 2BI7A 4IICA 5TT0A 1QK3A 3HXMA 2O8CB 5K3OA 4M8KA 1NLZA 3PEUA 3I92A 2JCGA 1E6UA 5KI6A 2H3EA 3ND8A 4ZDIA 4UPEA 4ZMRA 7MHTA 1O0SA 1E0JA 1FTWA 4DNXA 4MEJA 1NVDA 1ZI9A 1QHGA 3CX7A 1BU8A 4AM8A 4FYPA 2XOEA 2IH2A 2H1WA 1P2VA 1PWZA 4WNAB 3QG1A 4RSHA 1RJGA 4Q7KA 4WJKB 3LZCA 4LF5B 5E6RB 3NV9A 3VVCA 1CS4C 2C54A 5IXJA 3HEAA 4EG8A 2P9CA 3JYHA 3ONFA 4M22A 5JD3A 1WQ3A 4NFHA 4BNGA 3MW8A 4P4SA 2J7PA 4RGBA 4X90A 2ZRDA 2ZIUB 1FMCA 1K86A 2V58A 2AVNA 3C7KA 3ORRA 2HKIA 3E3MA 1OKKD 3OUTA 1QO0A 4DT1B 5FPTA 3P9SA 4TXJA 5KINB 4JUDX 4II2A 1TECE 4YMIA 4ZANA 5KSYA 2Y6UA 2AWOA 2IP4A 5CUQA 1E1YA 4FD2A 2XUAA 2WIAA 1W85A 3OM0A 1HE2A 2O8FB 3WO1A 4I81A 5A5EA 3OZIA 1BKSB 4PG6A 5IYZF 3HJGA 3I39X 3CPHA 3DHYA 2Z09A 5ALOA 1O7JA 3RT7A 2YV5A 3TVDA 5JS2A 3B20A 5EESA 5AK0A 1WWKA 2FX3A 3FTNA 3QYJA 2PMWB 3HU1A 2F55A 1YRWA 5AKKA 1GSIA 4R98A 3ZYCA 4K9RA 2WM8A 4BJHB 4RSRA 3F74A 5D6NA 1GPLA 3V4LA 4I50A 4BYMA 5IC6A 4F5YA 2P91A 3QNWA 4DPLA 3BOSA 4HGOA 4TV8A 1R88A 4IGAA 4K05A 1PJRA 1NOIA 2ZFUA 4AC9A 1BC5A 4EKIA 1WMBA 3PUJA 2B5VA 3MTIA 4JBHA 2ENUA 2CLIB 4V24A 1CRPA 3PGA1 4LDRA 4D9FA 2ONJA 4BEVA 1PNOA 4NZ9A 1NJ6A 1Z0JA 3DEJA 1CS0A 1VJDA 3ACCA 4D4JA 4MUGA 4OQQA 1J7JA 5DMHA 3LY5A 3KFVA 4BB9A 1KR2A 1JMVA 3AIMA 3TL6A 4CQMD 4F1WA 3T7RA 3PQ5A 3TW8A 1OD6A 1GQSA 3TTUA 3U7GA 4P0PB 3OHPA 4BFUA 3JYLA 4FFSA 3L06A 2BF7A 1Z4NA 1QR2A 4JI6B 1HOTA 3E22B 3O3NB 2GCEA 4HKTA 1AH2A 1IN8A 1IK4A 1OWNA 2QW8A 4KR6A 1XD2A 4MI9A 1CQWA 4JQOA 1Q2XA 5D84A 2XDQB 1UKYA 2JK0A 2ZTMA 5K8JB 1K63A 2Q27A 1EEXB 3QLVC 2H1HA 4PHCA 3OCZA 5BUSA 3QMMA 2AZMA 4JYCA 5FJJA 2XMRA 4H27A 1O95C 5HDBB 3VBEA 2OFWA 1O08A 3O31A 3O6VA 4Y0VA 1GL7A 2VKQA 1Z29A 1E9DA 1SY7A 4J3JA 1Q3TA 2K2WA 4Q15A 5B5SA 4DS3A 3DMRA 2RCYA 1XZGA 1G6HA 3L49A 3QFRA 4S0ZA 1RYHA 2RSLA 2VSOA 1TKBA 2CHGA 4Y8VA 4AZ3A 2R8ZA 4NPCA 1Z7YA 2GPWA 4M0UA 1KRXA 2ZBGA 2ZSHA 4OQMA 1H2ZA 2DQ4A 3W2EA 4X20B 1MX3A 3TSYA 1E58A 2B0CA 1FL9A 2XMSA 4NYIR 1QFYA 2I87A 5B2ZA 4CKYA 2OB2A 2XGSA 3VNQA 2IYTA 3E53A 3HBJA 5LP6A 2EFEB 2RHMA 4QLOA 3PJGA 5J23A 4NCKA 3C6XA 1E6LA 3T7JA 2R1TB 1U28C 1FS4A 3N5KA 4JLWA 2YX1A 3TLAA 3PTLA 3EQ7A 3EY4A 1VL5A 2C0QA 2K7FA 5F98A 4DLAA 4PFKA 3JPWA 4XVQA 1Z7WA 5JBIA 3TW6A 2X0JA 5AT1A 4BDTA 3AJ8A 3ZCRA 1N0UA 1F4PA 3ETCA 4TWRA 3ER8A 2PMKA 2FRDC 3L01A 4U9HS 4HN2A 4QBIA 1AK9A 1QDEA 4DV2B 1GG5A 1GGMA 3S40A 2LCFA 1MTOA 3G2LA 3TQHA 3W9SA 2PS9A 4CF4A 3P27A 1UXKA 1DPGA 3C6ZA 3GJ6A 2R79A 5AJZA 4QAQA 2BM1A 3CF4A 1YRLA 4Y1EA 3RSHA 4A8JB 2IRWA 2QZ9A 4C6HA 4K6FA 3FTFA 4X1KA 1S2MA 4WLEA 4YP5A 2ZPAA 2SECE 2JHPA 3H1PA 2C5BA 4DEXA 4HUJA 3MAGA 4KAJA 4QHTA 4ZU6X 4HGRA 4JI8B 2QTHA 3C3EA 1XTSA 5DNDA 1PQPA 2G9VA 4PGAA 4FFWA 1KP3A 2IBTA 2R00C 3NH6A 2PT7A 3OPYI 2FEKA 2GXAA 3KKMA 4DCUA 5A4KA 1C7IA 4AECA 4FC7A 3RVQA 5K6RA 2E7ZA 4R8VA 1RWMA 1U3WA 1W30A 1P2UA 1QK5A 4AJHA 3ABOB 4TLAA 4Z8YA 1GNQA 2GPNA 3ELDA 3ONNA 2ZIFA 1QOPB 3OMXA 3OPYB 1WW3A 4RXUA 3GLKA 3T9BA 1PO7A 1TU3A 4KWEA 1KKLA 5LOVF 3MRTA 1BMFA 2YS6A 1P33A 3OE4A 4UVIA 4XSHA 3HB4X 2V4MA 1P77A 2Q3JA 1EVQA 3MJSA 3OZSA 4KN8A 1JDSA 1H05A 1V95A 2OBBA 1CXZA 3FOCA 3TX6A 4AO7A 1N2HA 4WAUA 1YMUA 4LZAA 4LY3A 3RNLA 1JNYA 3D6NB 3IKMB 4ALNA 3DV0B 3T7AA 4QUBA 1QIFA 3Q3EA 4QYSA 3C74A 1NXSA 2LW7A 5I9BA 1Z35A 3R7WB 5LD2B 2HSZA 2G63A 1ZCAA 1TT7A 1ZH2A 3D7KA 3RD5A 5I51A 1PSWA 5DYYA 3WGUA 5L3SA 2OVFA 4XDGA 5G0SA 1E1CB 3OM9A 5C1BA 3OZDA 1FJ2A 1IM2A 1ULBA 2A6PA 2NXWA 1RP1A 2WVJA 4LXGA 4LVOA 1G5RA 4NPHA 4RJIA 4IDCA 5KYUA 4EGAA 2IV2X 5CFMA 3N0WA 1PQ4A 4FR2A 2H5LA 4P33A 5DCLA 5KDLA 3N07A 3WGMA 3HYLA 4LTNA 1FFEA 4D0GA 3PX7A 2ZUUA 4KCGA 1LQUA 2YDXA 3TMYA 4AG5A 2VDKB 5K3AA 3GVXA 3GLTA 4DREA 3AWIA 1E5VA 3UXMA 5K99A 1Y3CE 1KK1A 2FR0A 4G5YA 1O6BA 3TN7A 3ZGLA 1TPYA 3GJ4A 4F92B 4KQ1A 3O8OA 1IVNA 3F73A 3OSUA 1YJ8A 5KOIA 1SOMA 4FKBA 2FEOA 4NLLA 1DIOB 1PQUA 1QCYA 5FWXA 1SD2A 4PGHA 2WT8A 1NYTA 4FBMA 4YDSA 3VOAA 1CBUA 3WIUA 4DQUA 3JAMA 1C30A 3A6HA 3UXYA 3CHYA 1NQXA 3BFXA 2YYZA 5E8RA 5FNVB 1SHJA 1MV8A 2W83A 1NDHA 1DCKA 2QN2A 4MKHA 4QOIA 3AUTA 1ZCZA 3BZWA 1P61B 3ZDBA 1OAKA 2VF4X 1XXHB 4RZXA 1USUA 4F3CA 2BHNA 2AF4C 2MYPA 3GXOA 3QLUA 1J5PA 3B7WA 3U3KA 4XGQA 2J9RA 3LXRA 1SA0A 2Z5FA 2WVHA 4P38A 3L0SA 4MGHA 4UOQA 1BYIA 1JXQA 4MUMA 3E70C 3LOQA 5U9CA 1X1CA 2VH2A 3VI3B 3VR4A 1ZD4A 2APJA 4J0GA 3KXKA 5AVKA 1KK0A 4ZRNA 5K09A 4MIEA 1RKVA 1PUXA 1J6UA 4O4LB 4E3ZA 4BN5A 4BYGA 1Z25A 2XXAB 1G8GA 1X7ZA 2YV3A 1IG0A 3NHUA 3NIBA 3DQQA 3DYBA 4DWVA 4HLCA 1ONOA 1WEHA 2OUKA 3AG5A 1HK7A 3VOTA 1CULC 3JS5A 3JZIA 4MROA 2BJWA 2P4HX 3OY7A 1FLNA 2EBFX 4MWBA 3PNYA 4MR7A 5CB4B 2YJ5A 3Q8LA 1T91A 1X6VA 1XEXB 3NVAA 2H08A 2XW6A 4K26A 4Q1CA 1VKRA 3BREA 4IRXA 1LRKA 3WDMA 5JZ9A 4BO7A 2XDAA 1FNCA 1WF6A 2BKVA 4FCTA 2DH5A 1CNMA 3KSUA 1XQ1A 3DTVB 3SMVA 4JP1A 1YS2X 4F2PA 2ZI5A 4W5TA 4E30A 5HJ7A 2GTPA 4ABTA 3GMIA 3R6WA 1CT9A 1Z4JA 2GFIA 3AR8A 3K0HA 2P77A 4G01B 2BH2A 2G5GX 4DCCA 5LDGA 2JF0A 1UWLA 2QB5A 4MPDA 3W34A 1KHHA 1PJSA 1R6UA 4M1TA 4C7BA 3DE3X 3LKBA 3CLVA 2XYGA 4QT0A 1PVVA 5H5JA 5DH9A 3USES 3MQ4A 1Q84A 3DBRA 1C1DA 1ZRMA 2WP8J 3NOQA 4AZTA 4OKNA 2YVQA 3DEHA 1IRIA 3GJ5A 3G7UA 2VDWA 4MRNA 3WGTA 1AN9A 4UVDA 2ZIZA 3O21A 1FP4B 2Q4DA 4NONA 1CY6A 1KQNA 1N1DA 3I5YA 4J0JA 3K1JA 3FYUA 4IFEA 4R6WA 2VOEA 3V1NA 1RHJA 4UREA 3ZGOA 1UDXA 4FI3F 2XCSB 2AFHE 4KJZA 1TTTA 1XPUA 1TAQA 4MICA 1ZL0A 2YS7A 3CSUA 2NUPB 3EX7C 5J2TB 1JAXA 4XFDA 3RVNA 2DR2A 5J4LA 1GAQA 4OGFA 3MJEA 3D02A 1VJRA 3CONA 3A6EA 4X85A 1X14A 2GCIA 1IG3A 3BXZA 3QZUA 4LVNA 3MMZA 5LA6F 2X9QA 3SZUA 1TFUA 3VX3A 1II8A 3WGZA 3EXHA 2ZSFA 5DT9A 4NYMR 2DBQA 2I3BA 2R4TA 2WZCA 2FEPA 4HWPA 1XAJA 4AULA 2BBTA 3T7IA 1A9YA 1U6KA 2BJVA 3FHOA 3LFTA 2I9PA 3M82A 1XJCA 3N2NA 2QA5A 3RUFA 1K27A 2BFDB 3OC0A 4CYMA 3CVYA 3KP1A 3MINA 1SUEA 1Q1GA 3GUCA 3ONEA 3ZI4A 2P78A 3Q3CA 4XX0B 4YT8A 1UODA 1L5NA 1RKBA 3PTZA 4F2GA 1AZSC 5JH7A 4C7OA 3KAPA 1B42A 4G9EA 4KYUA 3RROA 4UDOA 5JBNA 4RULA 3EZLA 4MYDA 3AK4A 3AU9A 3GFSA 3OU6A 2G25A 3KWFA 3D5TA 3T95A 4AS2A 1IY8A 3TG8A 1MC8A 3ER9A 2VAPA 4TLEA 4U7FA 3V42A 4JR0A 4Z9FA 1X7YB 1F8XA 3R5HA 1P1IA 4E6PA 4EVSA 1Z8HA 3OLWA 1RXVA 1FFSA 3I6YA 4BV3A 2D4HA 3E9ZA 1SQ0A 2XKJE 4PLZA 1NSTA 1XJQA 2YHIA 2OD2A 4IHQA 3S55A 3KWMA 1SQSA 3M2PA 1CD5A 1QG4A 4PLTA 4WXRA 1XPOA 5JRDS 1LPAB 5HJEA 1YBFA 1XTZA 1J70A 5JYBA 1G3RA 2Y68A 2WWFA 3CIFA 3V2IA 4DA4A 2E5FA 1IOLA 1QNFA 4QELA 1NRIA 3PQ4A 1RRVA 4FXOA 1JJFA 1P9WA 4ZI3A 1T9CA 4NOKA 3UXHA 2NXNA 3ZTYA 3TLXA 5CDSA 1HPLA 2D3TA 3LHFA 3BCSA 2Z9DA 1NNUA 1SG6A 3BD9A 1SHLA 1EWTA 3STTA 4US2R 5LL6P 1Q3KA 4Z5XA 4AKIA 4K6GA 5TPZA 2PWAA 4GI5A 5IM5A 3O8DA 5JCZA 4NOJA 2CMGA 3IAM1 4H9GA 3WZ2A 3RBZA 5I7EA 1BOOA 1MQ9A 2IC5A 2LNDA 4IQ0A 1FNSA 3D4NA 3RS0A 1OXMA 2E82A 1C9KA 1SB9A 3LIPA 3H8JA 5LC1A 4UTOA 3VISA 4JBLA 3WGGA 4BNXA 4R0MA 3TD6A 4D9CA 4DCSA 1O6CA 4G84A 1CUVA 3QUQA 3JATB 4DJJA 1M6VB 3W3AA 4MULA 4H4DA 3T3NA 2PZMA 1OV6A 2FK8A 2NAPA 1U8ZA 3EW7A 3PVSA 4M7RA 2MINB 3NFYA 4N8EA 1T3GA 2HMUA 3T7KA 2BGIA 1CCWA 3FRHA 4F97A 3JQFC 1CEQA 1ZVMA 4RD1A 3AF5A 4K86A 4AY5A 2KPOA 2PX5A 1Z4KA 3AT1A 4ZV9A 2JBAA 3Q7RA 4D80A 2ZVPX 2HPHA 5DM60 5MGBA 4HI0E 1XQWA 1IJBA 1OYWA 2F9FA 1UPUA 2OHGA 2UVQA 3RWMB 2PIAA 2YWGA 4DWJA 4E3WA 2Q2OA 2VYCA 4KB5A 3GLSA 2N1MA 1RYBA 1KA9H 1LVGA 4QATA 3TXXA 4FEYA 3ZWPA 1WKVA 1TYAE 5TXGA 4ZT2A 2IV3A 2BLLA 2PUGA 3SBEA 3UXEA 2QLJA 2WTXA 5CA1F 1JG1A 5KYTA 4GMFA 1IATA 1SHUX 3I01M 1E59A 5AOVA 1DKLA 5IBPA 1TO1E 4AMYA 1X39A 4RH1A 4X63A 4JI5B 2C2YA 3KM0A 1RXCA 1T26A 2QM3A 1PFWA 3L40A 4P08A 1UBRS 2QX9A 2A1TR 4RGYA 1KYIA 1SU8A 2OG1A 2Y71A 4NEQA 4TV9B 4EK9A 2FG7C 2IPNA 2X3YA 2ZAIA 2ZJ8A 3KLNA 5KNCH 3DTVD 1BEZA 3VOBA 2O8NA 3EPHA 4EEZA 2FGKA 1H66A 1CVLA 2O1EA 3Q72A 2F43A 3FMPB 3A31A 4BZZA 2HHLA 4OXNA 1JPUA 2QVBA 5EERA 1YT5A 2JS7A 3K73O 5COBA 4C0JA 4B0OA 1ESCA 2CXHA 1KRHA 3NM5A 3G8AA 5FJIA 3EE6A 2IXFA 4IDEA 3BE4A 5TE9A 1K6MA 3SFVA 3DZGA 3G3EA 1E8DA 4R9NA 4A0RA 5LM3A 2NPOA 1R5OA 1TQ8A 1FJHA 3V7FA 4UUPA 3SBOA 1E9EA 2M98A 3SF0A 1D2RA 4EY5A 3GDHA 3NC1C 5EIXA 1ZD2P 1NJ5A 4G5OA 1YL7A 2HMAA 3EMDA 3P4XA 1V71A 3N0VA 1BXRB 3HI6A 4LYHA 4MYSA 4QULA 3A4LA 4PRYA 2AG1A 4JHLA 1ZGBA