4H3KB

Crystal structure of a ternary complex of human symplekin ntd, human ssu72 and a rna polymerase ii ctd peptide phosphorylated at ser-2, ser-5 and ser-7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
189
structure length
189
Chain Sequence
b'LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h3kB01
3O2QB 1F51E 4JB2A 3TD9A 1W9HA 1XHFA 2HJ9A 2IPAB 1PEYA 4RV5A 4G0ZA 1NY5A 4KK3A 8ABPA 5IX8A 2A9RA 4W5NA 1ZH2A 2HQRA 3EQ2A 4YRZA 2A9QA 3P9YA 5FBKA 1PHRA 1SXHA 4LX8A 1VKRA 2O20A 1Z2EA 4Z4CA 1YVUA 4EYQA 2FLKA 1C4WA 1MAVA 4GNRA 4MR8B 2JCGA 5KQGA 3NHMA 1FQWA 2NT3A 3MYYA 3HO1A 3A10A 2FTKE 1DCFA 4MR8A 1U2PA 3H5OA 2ZWMA 3H5TA 4MRMB 4WUTA 4F8JA 2B4AA 4G0MA 4MGEA 1JDPA 4KNYA 3QX9A 3O2SB 2PJUA 4MR9B 4MRMA 1Z25A 5CNIA 4ETIA 3IP5A 2FEKA 3OM0A 4JASB 4G0YA 4MR9A 1HEYA 3QLUC 1GCAA 3JY6A 3QK7A 3OQNA 5CHYA 3NNNA 3VNBA 1RZRA 3C6QA 1FFSA 3Q15C 4F06A 3RVPA 1QQAA 4QYMA 4LRQA 2JVJA 2PL9A 4MS1A 4KVFA 1KRXA 3DGFC 2OQRA 2NUBA 1D4ZA 4EY3A 5TE9A 2HQOA 2QVGA 1VPWA 4RXUA 3CFYA 1NTRA 2RJOA 3CLKA 3SY8A 1QP4A 2ID9A 3OLYA 1NATA 2MYPA 5KWSA 3GBVA 3W9SA 4MPTA 1L5ZA 2GWRA 2MSKA 9ABPA 3QEKA 4FE7A 1DBPA 1K66A 3G1WA 5KQMA 3HSYA 4CBVA 2R4QA 5JNSA 2FSPA 2NT4A 3UK0A 1QO0A 2PUDA 2PAFA 4JB0A 3KTOA 5EWMB 2JK1A 4MQEA 5B3JA 1M5UA 5HSGA 2L18A 2WMYA 4OATA 1SRRA 2PUCA 2WRZA 3GT7A 1FFWA 4LE2A 1YIOA 4ZYLA 5JNUA 5EWMA 3Q7TA 3OLVA 3M6MD 1LJLA 5PNTA 1ZY2A 4YR7A 3KKEA 4P98A 2KYRA 4WZZA 3IP9A 2GI4A 2E4VA 3H5LA 2HPHA 5BRAA 1DG9A 4E7OA 1Z17A 2RDMA 3L6UA 2IDMA 5CNMA 5IEBA 3GV0A 3IP7A 1GLGA 2YHAA 4ZMSA 1TJYA 3EJWA 3CRNA 2PUBA 1ABEA 4XARA 4PICA 1EWKA 4IILA 3LUFA 4RSMA 2PE5A 1QP0A 4ML3A 2MYNA 2B1JA 1P2FA 3CHYA 1I3CA 3QX8A 5GOTA 1GUBA 4EVRA 5C5EA 1D5WA 4XAQA 5CNJA 2CWDA 5KQLA 5IUNC 3SNKA 2QR3A 2IYNA 2N9UA 3RVOA 3HK2A 3MIZA 3GYBA 2R25B 3NNSA 1EFAA 3M9XA 2WJAA 3EULA 4WT7A 2PUEA 1RZRD 3C3MA 4IRXA 1CYEA 1DC7A 1M2FA 4O1HA 2IOYA 1Z16A 3NNDA 2E4ZA 4JOQA 5DCLA 4QPJC 1NXSA 4HNQA 2QSJA 1VRVA 2WB4A 1F4VA 2GKGA 3CZ5A 4MS4B 5EWLA 4WXMA 1SXGA 3N8IA 1DZ3A 7ABPA 1BVHA 3MF4A 3QELB 3BRSA 3LKBA 4RWEA 4ZPJA 2W42A 4P1ZA 4QYWA 3OQMA 2JBAB 1Z13A 2YHBA 3GL9A 4KMRA 3CG4A 3SAJA 5JNTA 1ZH4A 1NXPA 4RZSA 2JBAA 3RVKA 3H6HA 3CG0A 3N6VA 1URPA 1USGA 1XWWA 4OTZA 3ROFA 1A2OA 2FN9A 1JBEA 2FLWA 2IKSA 1IIBA 4N41A 1QO0D 3CKMA 5JNWA 1APBA 1ZDMA 3LTEA 1BAPA 3R0JA 2GBPA 4G0PA 2MYTA 6CHYA 4O1IA 1U04A 4IMIB 4XLTA 3OO0A 3TMYA 1AB6A 1E6KA 3O1HB 4MYRA 4Z0NA 2HQBA 1JHZA 3JPWA 2A9OA 4WWHA 1RXIA 3IP6A 1ISSA 1JYEA 1USKA 3C97A 3GRCA 3H6GA 1TMYA 4IMJB 1ISRA 4N47A 4EYOA 1YMUA 4KQ9A 4TLLB 3HUTA 3JS5A 2AYXA 1JWLA 4ZJPA 6ABPA 4OLBA 4KREA 4NQRA 4YP9A 3RQIA 4NICA 4Z9BA 1QQBA 3URMA 3LFTA 2J48A 3CTPA 2MYUA 1EAYA 3O75A 3F6CA 1EHCA 1A04A 5BRJA 4W5RA 2AYZA 5TQ0B 2PUGA 1YS6A 5JNRA 4HYEA 3T8YA 4DN6A 4DQDA 2PUFA 3EAFA 1T34A 1J56A 3N0WA 5TQ0A 1U2QA 1NXVA 1TLFA 1ZHHA 1NXXA 4ZMRA 1KMIY 2FQYA 1DCMA 4NCBA 4ETMA 3LMKA 2LIVA 4YV7A 5DTEA 2F8TA 4HNRA 5KQPA 4KK4A 2RGYA 3O1IC 4N0QA 4OLAA 5IUJC 5C5CA 1JH9A 3KYJB 4H60A 4S04A 4W5TA 4Z4FA 3HV2A 4YLEA 1QMPA 2VYCA 2X7XA 3LUDA 4MLCA 3TX6A 2WJWA 3HM9A 3OMWA 4HNSA 3Q7RA 2WY2D 3E3MA 4Q6WA 2FEPA 3K9CA 3TO5A 1W25A 4WXEA 3KHTA 5D2CA 4OBBA 1TVMA 1OXKB 5JS1A 3EDCA 3HDVA 4FE4A 4RY0A 1RPJA 2HSGA 5KC9A 4EYKA 3KCNA 5EWJB 5IULC 4G0XA 3FMVA 5FBHA 4ETNA 1DBWA 4KQCA 3LUAA 1PEAA 2ID7A 5TPZA 1ZAYA 5EWJA 1TM2A 1A0OA 3HDGA 1QPZA 1D1PA 1NXTA 4M88A 1CEYA 2FXIA 1Y1LA 3LUGA 3Q41A 5T3YA 3LUCA 3DBIA 3JTEA 1D2AA 1PNRA 3DGEC 2WWVD 4F12A 1BDIA 2GX6A 3E61A 1FSPA 4B09A 3HCWA 4KPYA 4OG2A 4KFCA 3KJXA 4Z4EA 3QLVA 4NV3A 1E2BA 3O2JA 1MVOA 3H1EA 4RK7A 3I45A 3T6KA 5E3JA 1DRJA 1FFGA 1DRKA 4RK1A 2RJNA 2QVCA 4NCAA 3HJFA 2ZAYA 4PYRA 1S8NA 1RXEA 1M2EA 3MQ4A 3N0RA 1ZGGA 4LDZA 4LZLA 2CHFA 2NZVG 3OLWA 4LE1A 2E4WA 5DKFA 1K68A 2P4UA 3FFWA 2PLNA 3T38A 1DCKA 4YS6A 1ZESA 2VUHB 3OQOA 1SD5A 4RU1A 1L5YA 4PZ0A 1B00A 3LUJA 3OLZA 3RVJA 1JDNA 3UUGA 3OMXA 1MB3A 2PL1A 1LK0A 3FDFA 4Y9TA 1Z12A 1XHEA 5TPWB 3RVLA 3FFTA 2QZJA 3HVRA 4TMYA 2E4XA 4MS4A 3UKJA 5ED4A 1KGSA 1USIA 1NXWA 2FVYA 3BILA 3QELA 3I42A 5TPWA 1DP4A 5HKOA 2FQXA 3GBPA 4PE5B 4G0OA 5KI6A 1YTUA 4MLDA 3F6PA 3O21A 1AB5A 3JVIA 3B2NA 3IPAA 4E7PA 3IPCA 3G85A 1JYFA 2FEWB 3QLVC 4EVQA 4EVSA 1Z15A 1Z2DA 4UHJA 3HZHA 3GA5A 1LBHA 4RY9A 5T7BA 4Q7EA 1VLZA 1QKKA 4KRFA 4GPAA 1H9CA 2M98A 3HXMA 5IBQA 2I6FA 4N03A 5BQ3A 4Q6BA 5DGCA 3CZCA 3NBMA 4Z99A 2CD7A 4MQFB 4RS3A 1UDRA 3H75A 3EODA 2LPMA 3QEMB 2L19A 4EGSA 4MQFA 1U8TA 2JB9A 1YK0A 2IPNA 5TPZD 3A3KA 4MS3B 2H0AA 3L49A 4O5AA 3JVDA 3QEMA 1JFTA 4QICA 3RVRA 1NXOA 2L17A 3KYIB 2H3HA 1JL3A 3S99A 4MS3A 3CS3A 2M1ZA 2QU7A 2LBPA 2Q5CA 4RK5A 4F11A 2E4YA 4IF4A 2JRLA 3RVQA 3LKVA 3OM1A 3D02A 4RKQA 1GCGA 4XXHA 3DLHA 4TN5A 1JFVA 3Q9SA 3C3WA 3LUKA 4JA2A 3IDOA 4N76A 5HQJA 3RVSA 1P6QA 4RK0A 3FGZA 2LP4Y 5FWXB 1P8AA 2A9PA 4JP1A 1JFSA 1QP7A 3MA0A 4DADA 2MSLA 4MS1B 5FWXA 2P9HA 1PUXA 3VNAA 3HS3A 4Z9AA 2IPLA 4PEVA 3T95A 5JS2A 4XFKA 1BDHA 2QV0A 5IEJA 1CHNA 4W5QA 3KLNA 4RY8A 3OLXA 1ZITA 3QLTA 4RK6A 4YCSA 2TMYA 3HUUA 3N0XA 3NHZA 3K4HA 3N75A 1LJUA 2PKXA 3LOPA 2V0NA 5TQJA 4W5OA 2NZUG 3I5AA 3Q7SA 3A0RB 4D74A 2PUAA 3DZDA 3ROTA 3DLBA 2FMKA 1JX6A 4D6XA 4N0PA 2L2QA 3EGCA 1GUDA 4KV7A 3C3KA 2FW0A 2FN8A 3BBLA 4H3KB 4G0QA 1U0SY 4D6YA 4TLMB 3GWGA 3CU5A 1EWTA 2PMCA 3BRQA 4JAVC 4YO7A 5BR1A 2XDYA 4MQEB 4YGXB 1DC8A 3TB6A 2R47A 3H5VA 4MAAA 4RXMA 1WETA 4Z4GA 5GQSA 5JNVA 3SM9A 4G86A 4UHKA 2QW1A 5CNKA 4G97A 1R8JA 4LDAA 1Z26A 3RVMA 3CNBA 3O1JC 2MSWA 3HEBA 2BGGA 1D1QA 3KG2A 3EQZA 4L85A 5IC5A 1SXIA 2DRIA 3I09A 2FMFA 1PNTA 1QNLA 1Z18A 1ZGZA 3ILHA 1E6LA 2VK2A 3MM4A 5ABPA 1ABFA 1YMVA 2FMHA 5F64A 1BA2A 3KS9A 4RK4A 1YK1A 4EUKA 1OXBB 1EWVA 4XASA 4KZKA 1LBIA 4LE0A 4L4UA 1E6MA 3LUHA 2FKAA 1BDJA 1ZN2A 3RH0A 3SG0A 5KC8A 2E4UA 4EYGA 1JF8A 3FFXA 1M5TA 3KLOA 4F3TA 2VUIB 3H1FA 3H5IA 3OO1A 5IUKC 3F73A 2CHEA 3D8UA 3MMNA 3F7NA 2QXYA 4Z4HA 3BREA 5B3JC 1DBQA 4MR7B 1ZVVA 4Z4IA 3A0UA 4FB4A 5TQ2B 1YS7A 3N53A 1JLKA 4H3HB 5DLEA 5EWLB 2F8SA 4RDCA 4MR7A 1RNLA 5HM6A 3KSMA 3M9WA 4IGAA 2IPMA 5TQ2A 1MIHA 3RVNA 2R48A 4RKRA 4RXTA 2FMIA 3O74A 3QLUA 1MB0A 3JPYA 5FWYB 4YWHA 4S05A 1KRWA 2JVIA 2LUOA 2OENG 1C0EA 2JVKA 3H1GA 3SQNA 3ILYA 3H5WA 1DJMA 5FWYA 1P6UA 2FQWA 5I4CA
chains in the Genus database with same CATH superfamily
3VAYA 3OZUA 5CFNA 3HGTA 3OY7A 5K0FA 1MQ8B 1CU1A 1NRJB 1JAXA 2ZRFA 3KZ1E 4LDNA 2NUTA 1M0WA 2WA2A 2ZANA 1YVPA 3FTPA 1HE5A 1PTJC 3GLHB 3LI2A 3RF7A 4BLTA 1G4UR 4I4IA 5E7QA 2DBZA 1GD1O 4LX8A 1MX1A 3WK8A 4EG3A 2PS0A 3VUEA 4FOLA 5KOIA 1S89A 5IWAB 3S40A 2RIRA 4K3VA 2CC2A 2QM0A 2Z9BA 5KQGA 1K5PA 3PDWA 3JZFA 3O8CA 1N8NA 3ICEA 5AK5A 3HO1A 2C4UA 2ZLBA 5CT5A 4DCOA 4G23A 4MW6A 1D03A 3KZKA 3ZY4A 5FYQA 3MTGA 1E6WA 1YGYA 3UFXA 3V5NA 4UQPA 3LYHA 3PJDA 1CDEA 4XX1A 1DIHA 2CBGA 2CNLA 1PL8A 2O7NA 5KDOA 1SBHA 2Q3BA 3E6AA 3QXSA 4UASA 4DJ5X 3T5BA 4DCSA 1L8XA 1C1XB 4YCDA 4LY9A 3G8BA 2HYDA 4EEZA 5K8CA 5LMCA 5HFJA 5KOHA 3NVMB 2G17A 1PQUA 2REBA 1C1XA 4JK3A 3ZCTA 1N8SA 1PZEA 3QGMA 1G59A 2MMGA 2GESA 2ZRNA 1PD0A 4N7JA 1D4AA 4X85A 3ZK7A 2DETA 5HF6A 4I4TF 3E8MA 1T6ZA 4R5MA 2PZMA 1E1QA 4M2LA 2GARA 4NBUA 4OQEA 4CUKA 2TYSB 4B3FX 3CLUD 2HQOA 3HDQA 4RMIA 3ZX4A 4F56A 5ALXA 4EDFA 4K6GA 4QSHA 4JVSB 1R12A 1MJGA 1W73A 2EFGA 3WLTA 3SY8A 5CLFA 2GCOB 1G60A 3HADA 4NYMR 3THOA 1U81A 1RIIA 2BIFA 3I2FA 3QVMA 2HIAA 5AVVA 4FB5A 2GVNA 1Y8ZA 3GLVA 3SJZA 2GCOA 1Z6PA 2BN4A 3V2IA 2B0CA 3Q10A 4OOFA 4U2KA 3UMMA 2VTBB 1XCMA 4NYIQ 4JUFA 1OI7A 2F3PA 2QUKA 1A5SB 2B7BA 3IUMA 2VTBA 1QJ4A 2CXPA 2QT1A 3MJTA 5GONF 1VC2A 5AI8A 3I9MA 4L5IA 4JEIA 3KTOA 4ZOLF 4BKOA 2PX4A 5U9CA 3OUUA 3R0QA 1M5UA 1FY2A 2L18A 4RX1A 3SI7A 1OH7A 2AMFA 3E1KA 4GSLA 5ETJA 3V1KA 3WJ7A 1XX6A 3OLVA 4Q3LA 5K8VA 1SCJA 1XJCA 2QIOA 3SJCA 2WNIA 3O0TA 4PWZA 2AQHA 1EU1A 2V9CA 3JQFA 4JUIA 1I94B 2XZLA 3H5LA 1G1AA 1Q7TA 3QA9A 5E0OA 3WS7A 2HK6A 2QN7A 2HRQA 2NIPA 4MPDA 4O6VA 2ADMA 1B7GO 2BE7A 1TYEB 1WDWB 2DH5A 2HA0A 3GDWA 3QHQA 4IDGA 4ND4A 4ONEA 1OIXA 3ZWAA 4NESA 2VUUA 4DRXB 3EJWA 5THXA 3OIFA 3AVWA 4IILA 4AYXA 4J07A 2HIGA 2WU8A 4I55F 2DM6A 5G1PA 1SQ5A 1VL6A 4DRXA 5HVNA 1EBUA 2VL7A 3HNRA 1TMGE 1AG9A 1I3CA 2I4RA 5EP3A 5C3MA 1USUA 1VE1A 4H7PA 5IAEA 1VG1A 2CK3D 1KH1A 1G8FA 1TK2A 2CWDA 3GJZA 4JZYA 4UUNA 1G41A 4QU9A 1R4MA 1IOLA 1RWOA 4JFRA 1TQ4A 2CE2X 3FCSB 2CFCA 2IYNA 1PZGA 4M89A 4TWBA 3UTCA 2Z8YM 1R9GA 4EJ0A 3FYUB 2V96A 5DYIA 4CTMA 2IZ6A 3PPIA 1NASA 1V0JA 5NULA 3M9XA 1DNPA 1U1CA 1XROA 5G4KB 1DG1G 1E64A 2WMDA 1UKAA 1C2YA 1SEVA 3FYUA 5F4ZA 4BKPA 3CQ9A 3PFFA 4DQLA 2VHEA 2JIRA 4E1AA 3LCCA 3L1KA 2O2CA 3FPLA 3O92A 1WXDA 5G4KA 4EFLA 2OBYA 2X0KA 4GWLA 5KNBD 3VV2A 1D04A 1SCUB 4JQZA 2GKGA 2W0SA 4GBGA 4DLPA 4V0ME 4J75A 1XN1A 3AFOA 1E5VA 3OKAA 1Z0JA 4BAUA 4AXXA 1SIWA 3D81A 5IN4A 1OSNA 4LVNA 1FVXA 1SCUA 1G17A 2XVXA 5B1DA 1H2RS 4QG7A 3LX5A 1W52X 3FH0A 3OI7A 3GDHA 4QC2A 3ZU6A 4D80A 3CX4A 4KMRA 1MC5A 3CG4A 1DS6A 1B2RA 4BIMA 3O4HA 4R84A 16PKA 4DLTA 4MVJH 1IPEA 1IM5A 3D6NB 4JFAA 3JD0A 1ULAA 3P9SA 1E1KA 2ZXUA 3OT5A 2FPUA 1US8B 3ROXA 3UJPA 1E4EB 1PL7A 1Q3TA 1B74A 1YO6A 3PYXA 1NY6A 1XSEA 3FMFA 2IKSA 4OK6A 4AJPA 2Z57A 4MJLA 4BVFA 2AN4A 1ZDMA 3FOBA 1QOQB 2ZPAA 3T5MA 1U1IA 2GN6A 2JGNA 3PGMA 4RO0A 3PPWA 5BWBA 4IXNA 5IASA 3BAFA 1OZAA 3OO0A 4G1BA 4PBRA 1TLLA 3KOZA 1E6KA 2JI8A 3DYVA 4XUCA 5TX7A 2VJKA 3O8RA 4CWAA 3O94A 2GPSA 1D0VA 1QE3A 2GEUA 2RKWA 1QAOA 2XZDA 3IAM6 2BBSA 3JAWB 4PZUA 1RXIA 4P4SB 4DNFA 5ARBA 1Q7GA 4ECAA 1ISRA 1VCNA 2JH3A 5JPCA 4EG8A 3Q8WA 4WLNA 3JAWA 3TG8A 2DWPA 2O19A 3PICA 4WD3A 3E9RA 2EVWX 2FWPA 2CNOA 4P4SA 1UBCA 5I7HA 5K0ZA 1EUYA 2CZGA 2JLSA 4PLVA 2A0YA 2YOFA 3K8YA 2CLOB 1LD3A 3NIDB 3VYVA 1XXHE 4L9WA 1F12A 3O75A 4DMMA 2GK4A 3BIWA 1DKRA 2FOLA 2OBXA 2VXOA 2CMGA 1A9OA 2KWIA 4KR7A 3PUXA 3S70A 2EDAA 2C61A 3C85A 3HCNA 3NCHA 2PL3A 3BUSA 3WMFA 2HZ7A 4KIUA 1EESA 1Z8NA 1H1TA 1W29A 1W5EA 1E3TA 2Y0BA 3HJBA 4QD3A 4DILA 1CUZA 1ZL0A 4TROA 3TOVA 2AXQA 4TTQA 2GJ9A 4K9DA 1IOWA 1CJSA 3MRSA 2VZLA 2UXBB 4WESB 2BR3A 3EVEA 2OO5C 4FYWA 1JA9A 4J2HA 1A4XA 2WZBA 3IR5A 1GAEO 5LDDC 4WESA 1OT5A 4PSVA 4WLEA 4C6SA 1M1ZA 1A8IA 1IAQA 3D1LA 4KX3A 4WCDA 3CH7A 2OHJA 2VYCA 2OAP1 3HB5X 3T5TA 1OB2A 5CGQB 2ZQZA 3C1OA 2HBZA 4AAYA 3F2IA 1A27A 1DB3A 2WY2D 3UKOA 1CEQA 3L8GA 1FLDA 3WVNA 2ZAOA 2PFGA 3ONWA 3X1YA 4RY0A 2IPOA 4GR4A 3DMYA 2Y0CA 3F5QA 3FNHA 3CRRA 1CR0A 4G0XA 5TJHA 2H4XA 2WAMA 2YWCA 1CY0A 4MW4A 3UJ7A 3Q40A 5B6IA 3BB3A 4KO1S 4G09A 3D4PA 4ZU6X 4OFXA 4GLFA 4DWWA 1YZHA 4MQ4A 4PTZA 4IX1A 4ARZB 5KOYA 1KYWA 3VSCA 2H1OA 4WPGA 1CK4A 1GPWB 1SC4A 3LHKA 1Z5WA 2RHMA 4XWOA 1PNRA 2ZRBA 3CZMA 3TIGA 4K6OA 5ALYA 2XX3A 1A71A 4ARZA 5BYAA 3N2KB 4FX5A 3FE2A 4LXIA 1J70A 4NVRA 2H17A 5KREA 1XU9A 3VTFA 2A0KA 4OG2A 3SKVA 4WBNF 5LBUA 2I91A 1UKCA 1COWD 3N2KA 1NF8A 2JG3A 2VZEA 2P2NA 5DHPA 1E2BA 4G1EB 2BFAA 3I05A 5CHEA 2DKOA 4QOHA 1T3HA 3IXLA 4M22A 4YQEA 3DPUA 1HLGA 2EEPA 5DEIA 1L5SA 3TOSA 1LPNA 1G5IA 2YZ2A 3O0DA 4JJ7A 4P31A 4TQGA 4A2PA 4B8WA 2VJNA 5KVAA 4IMRA 3SZLA 1XQ6A 3M9LA 2BM0A 2H2IA 3COVA 3INGA 5DHAA 4AF6A 2BGUA 2P9JA 4AYTA 1KR2A 4JI5B 3T7KA 2NZVG 4MKZA 2UVQA 4QT0A 4UMEA 5E7IA 4JX9A 3BCHA 2XXJA 4H0CA 4TS1A 5LSAA 4ER7A 3VOSA 1TEXA 3OWHA 1EZ4A 1HDYA 5A4JA 1DC3A 2FSHA 3WLMA 4CLEA 1BGXT 3GLIE 3MXOA 4L3VA 2PL1A 1GKUB 4FMDB 4B4VA 5LZ9A 1L7NA 1M6NA 1YHNA 2QZJA 3R40A 1TPZA 4D25A 3W04A 4ENQA 1YCHA 2ANCA 2FVYA 2PD4A 3LCMA 1IXRC 2J0EA 2PD3A 2J07A 3VR2D 3MIIA 4D3YA 2OBFA 3PC8A 4TSKA 1PZFA 4FW9A 5KI6A 2PY6A 1A9PA 4FKMA 1CRZA 1Q19A 5IH3A 4MCAA 1KY2A 1U0FA 3O21A 3CX8A 3V1YA 3L46A 3R5KA 4UBIA 5I3CA 2WPDA 2PEZA 4DRZA 4EPTA 1Z15A 2M6KA 4L1KA 4EO9A 1EPUA 1XJ0A 2QZ9A 5AXCA 1N8KA 2YFQA 4PRYA 4A0QA 1I2DA 2JEOA 3TMAA 3HB1A 4N03A 3BQ9A 3GGPA 3Q0TA 3A1WA 2B61A 1JSXA 4LCBA 5GZ6A 2PMDA 1EFDN 4FFVA 1LFAA 1OXXK 2CXXA 3IILA 4MRRA 5C1OA 1I9GA 1XRNA 2QNBA 2ZYRA 4IO1A 4ZCIA 2H08A 2VZ9A 3QITA 4OUDB 4M4SA 3A8TA 3ABZA 1HFEL 1H1DA 5EPUA 3PPVA 3SYRA 4F0JA 2KJQA 3S28A 1OASA 4MS3B 3NWEA 2HJSA 3PPYA 4OUDA 1JUDA 1CY6A 2WBLC 1JEDA 3OOEA 4HYYA 3OY2A 4KFSA 1PK9A 5BV1A 1YVRA 1XYYA 2F7SA 1F0NA 1YASA 1ZMRA 4MUFA 4CRWB 5KNCH 4UNSA 4MS3A 5JDIC 1ZA2A 3ZHUA 3U3JA 1R4NA 1RS0A 4JMLA 4RK5A 5BN3B 2WF7A 3U3ZA 2HLPA 1DX4A 1MO6A 2E4YA 5D6OA 3LXMA 5M5BA 3CV3A 3F8SA 4MV3A 3VR5D 5K20A 4GKKB 1CJMA 4INZA 2L42A 4JI3B 2D5LA 3D8HA 1XVUA 1E2DA 1GCIA 1IXYA 2ZCUA 4WLFA 3AU9A 4B3RB 4YMTA 4U02A 4U5QA 2VSYA 4FCVA 3GMSA 1NUTA 1C7RA 1VYHA 2GF9A 2GPAA 5I7SA 1V4VA 4Q7JB 3WWPA 1DTWB 4B1FA 1EEXB 1E79A 3ADPA 1Q3HA 1A7KA 1EK1A 1RI4A 3FDJA 1VI6A 3G8YA 4YUAA 4H2DA 1NW4A 1DTWA 2MMCA 3VAAA 4UBOA 2IW1A 3OEED 2FWRA 2P9CA 2GO7A 2IUUA 5LIPA 3I6QA 5J4KA 5KWJA 3KJNA 2NZUG 2R86A 4IBOA 5DHTA 2YH2A 1X1DA 4HI0E 5DLDA 2HGZA 4HMQA 3EYAA 1VFNA 1P1FA 2C4WA 4CDMA 5IARA 4BNMA 2QRLA 2J3QA 2VAPA 3DE3X 3RTCA 1H8HA 2W48A 4TOIA 1NN5A 4G0QA 4QX6A 3Q4GA 5IF9A 3D4BA 5B1YA 4LYJA 3QU2A 4KB5A 4FDVA 3STTA 1T6XA 1K1EA 2RCYA 3CNQS 5E1BA 5EEHA 3F97A 3QVKA 5IW8A 3TJZA 1ILEA 1Z34A 1SHLA 3HCRA 1ZD3A 2OMEA 3B38A 3EVNA 3LPMA 2P4HX 1X7WA 4CQMD 1NV8A 1NBMA 4ZQHA 1JEEA 2QTNA 3LCUA 5DNAA 1WBDA 1UZNA 4OQNA 1Y3BE 2RH4A 2QW0X 3IXQA 3LXXA 3P1JA 2SKCA 4C87A 1CY8A 1Z26A 1K88A 2J9GA 1HRKA 3P0IA 2Q1YA 2IV3A 3TW4A 2HV8A 2RAVA 1SUIA 2D1RA 2DPYA 2XITA 1F9EA 1KEVA 1NPTO 5IC5A 3ZVRA 2HJVA 5GIPE 2DLDA 4YY3B 4WRRA 3DFZA 4BY9E 1DBVO 2JCXA 2PXAA 2FN4A 3D43A 2ZIWB 3DEHA 3NTVA 3JYHA 4DPLA 3L4KA 4FQ7A 1ABFA 3V3TA 4D4LA 1GGMA 3GELA 3GJSA 2G7MC 3J7AC 1CETA 4RK4A 3M4YA 2QD3A 5BPHA 2SICE 2C9ZA 3TZKA 1FW8A 4P2GA 4XJXA 1MPTA 1LLQA 1ZM7A 4HGQA 3WL3A 4UARA 3OOYA 2FKAA 3GOHA 3K9QO 1V3UA 3DWEX 3NDJA 1OBFO 4PY2A 1VKOA 5FWAA 4C5CA 4D8UA 4EYGA 5JDIA 3R3JA 2PKQP 4E6PA 3RJ9A 2YASA 1X7XB 3ENKA 4YVFA 4A82A 1N2SA 1CS4C 3DQQA 1KYIA 1OLSB 2C5GA 2F59A 3AF1A 3BTSA 3KYCB 1DBQA 3HVKA 3KVNA 5HHTA 3H3FA 3CRMA 5CG2A 2Q9AA 2P8JA 1TLTA 2ATCA 1E4OA 5DBGA 2BBWA 1VLMA 3P26A 5I7WA 1TA0A 5DSXA 3H5NA 4B48A 4R1UA 1ND5A 2VDLB 4NOLA 3IJ5A 3G1TA 4UC0A 1YRQA 1O96B 3WQSB 3W5AA 1TUBB 4B7XA 3OQHA 4YLYA 3CPEA 3BHIA 1MDFA 1E8MA 3HZOA 3IURA 3C70A 4YRRA 4D42A 4L5AA 3A2MA 2W90A 2ARKA 1DAMA 4Q9AA 3WX0A 2JGFA 2WWWA 1AC5A 1ZR4A 4RJIA 5IX8A 5EMMA 1P2VA 1EDOA 1GYPA 1GSIA 2XVYA 4P93A 1MG0A 3ESZA 5DP1A 4F45A 5JAOA 4QUIA 3THXB 1T3TA 2A9QA 4LOAA 2MR6A 1Z37A 4CG0A 1FX0B 3N3BC 1UIMA 1XAHA 1O5IA 1BXGB 3ADCA 3THXA 1C4WA 1F8XA 3MJVA 1BXKA 1TVCA 5BW5A 1FX0A 2H0RA 2IHJA 5C51B 4BX0A 2OR3A 1QC5B 1GVNB 1BXGA 3MYYA 4R2MA 3THRA 5DM2A 3A10A 2PGJA 2QV7A 4PRLA 3T9FA 4RA6B 3QIVA 2AMJA 4WUTA 1XRLA 4F8JA 1Q1QA 1QC5A 1C7JA 1G5TA 1VKHA 4AMZA 2HY7A 5HWSA 2BC9A 1JDPA 4MCJA 1ZSYA 2XWBF 4NJOA 4RA6A 4BMCA 2VKTA 3GUUA 4C3UA 4PLYA 5HIKA 5CEFA 3S3TA 1OY1A 3IBTA 1DUIA 2JZOA 1Q1BA 3QLUC 2OT3B 2XWQA 3ZIAA 4Q18A 2DTXA 4GLLA 4C88A 1CUDA 3TVDA 4EZEA 3KQHA 1RJEA 3E2PA 3FPGA 3V9AA 1ODCA 3T9AA 2OKGA 4AF8A 5JARA 4QU8A 1NVTA 2JCBA 5LMNB 1F48A 2WIJA 6REQB 4ZXFA 4MVYA 1E9VA 1WB4A 3WHKA 2FGKA 2FUCA 2GEDA 2VOEA 1QHHB 4RFVA 3CR7A 3GNLA 6REQA 2X14A 5GM2A 3G2MA 1N5IA 3BSWA 3ANTA 1S7CA 3Q88A 4ZT4A 3LYLA 1QHHA 4IRMA 3EGXB 2XOKA 3TRHA 5D5QA 4EKEA 4W8OA 2HWWA 1FS4A 3QTLA 4H7EA 4IIGA 4Z1OA 1R15A 3OZRA 3PA8A 1PYGA 1L5NA 2NP6A 4L4XA 4CM9D 3QU9A 3AWIA 3L5KA 3Q7QA 1P4SA 1YZ3A 3AP3A 4CQNA 1JHVA 1K66A 2XMCA 3U4GA 3ZD8A 2G1PA 2JBHA 2FRDC 1E3IA 1IVSA 2HWUA 3U26A 1Z82A 3DE7X 5TC4A 1KFJB 2ATEA 3TW0A 1J0BA 1XJWA 1IN7A 2HHJA 5JCXA 2RHGB 1KPHA 2WMYA 3NTXA 3GAZA 4B5KA 2PDAA 3D7KA 4R3WA 1YWGO 4E22A 4URUR 1JZSA 3RIMA 5I6DA 3KKEA 1FFYA 1NVGA 2CUZA 4UOZA 5DYYA 3HY6A 3RSHA 2I99A 2V7PA 3P5BA 1QFJA 2B37A 1XLWA 4MYHA 5HE8A 4C14A 5JADA 3LT5A 2ZBPA 1DAHA 3B85A 3ZHRA 3GV0A 2JH9A 3SR4A 4CIYA 1GLGA 5KBYA 2EIXA 4Z8YA 1SXQA 4QO7A 3MJFA 1NBIA 4HO1X 2PE5A 3MTEA 3O38A 2KX7A 3ZXXA 3D8RA 3L8YA 2V6GA 3D0OA 1JG4A 1NW3A 1IQ0A 3OT4A 4Q21A 4YDSA 1RW4A 2O0JA 3RJZA 1MN6A 1E9RA 1WW3A 2V45A 3ANXA 4IEEA 1CFJA 3WL4A 5KKNB 4L6CA 5LP1A 1GSOA 2OGWA 1PHPA 1FP4B 4O2AF 3L7BA 5CB4B 1RR6A 4P33A 4YAUA 2FPIB 5J23A 3HK2A 1I80A 4JCCA 4EI9A 1FP4A 3IVRA 5L53A 5CB4A 4TMKA 4KVGA 2PX5A 1XZQA 5JZBA 1FMTA 2H7XA 3R3VA 1XQVA 3E5NA 1KEKA 5JS6A 4BNXA 2FPIA 2PUEA 4QYXA 3FTNA 4IZ6A 4IRXA 3D9QX 1YU9A 2PZLA 3FPCA 4NK4A 3TLEA 2WKPA 3R5TA 3SSAA 1EA7A 1Z16A 2FUG6 1PT7A 4AZ0B 5HRCA 5DCLA 2UV8A 4WI1A 3VPDA 1QE5A 4GMXA 2X9NA 4MS4B 1PLJA 4AJNA 3P9PA 4FHZA 4PAOA 1D0SA 1Q1EA 4FBGA 3ZDXB 2ZVJA 3DDHA 3ZW8A 5I8PA 3ZGZA 2OYSA 5CTAA 3GL9A 4NWIA 3QJGA 4GXTA 4R9RA 5FLKA 4BKRA 4X6LA 5L4LA 4BLUA 3UH0A 2J6BA 3BXGA 1IY9A 3EXEB 1GZ6A 3B82A 1LZLA 3E9ZA 3FOAA 3GJ7A 3L6EA 3NVDA 4HJXA 4GOKA 4MUIA 4RPHA 2VZ0A 4WOPA 1R8SA 1XWWA 5K4HA 2B92A 3WE7A 1T2NA 5EXPA 4BWFB 2QI9C 3M81A 4M49A 3I01M 1G5RA 2YXLA 5CJ2A 3X44A 1A4RA 4EA7A 4HQNA 3QVOA 4F85A 1SBTA 3ZTTA 2V65A 3M3HA 5HA5A 2JHFA 1WCXA 1YFZA 3WSTA 2G09A 1K89A 5F33A 2CLFB 3B6EA 3A1FA 4ROTA 2B20A 3HSSA 3U9SA 5I7EA 3U5ZB 4P4GA 2BI8A 3B20A 3CE6A 4KRYA 2D1SA 4JBWA 4XVCA 2ZBDA 1RM0A 2YZGA 4WJZA 1YKFA 2Z58A 4KQXA 5JLAA 4UHCA 1YF3A 2Z2ZA 3COSA 1G7TA 1PWXA 5AVKA 4LJ5A 1U7TA 2FFQA 2INGX 3B70A 2C2YA 2CSXA 4L72A 3OLQA 1PE0A 2ZJYA 3C3PA 2OBLA 4NICA 4P5PA 4TQ9A 5DW3A 3SX0A 5GZ1A 2ACEA 1NMEA 2JFWA 3CTPA 3P4UA 2P1RA 4DQ0A 2CL6X 5FNVB 3F6CA 5HYVA 1ZINA 4NXMB 1BX0A 5JMWA 1H6CA 3BWYA 1IDN1 4D3SA 4EG1A 2GT1A 1ONNA 3L0DA 4Q3CA 4TTSA 1J97A 1YRAA 1MAHA 4FVTA 1VG0B 4QFBA 1KZYC 4YUZA 4H6WA 1RP7A 4DQDA 5BWOA 4NOKA 1KSFX 1VIDA 1HLPA 5FBRB 2C78A 1E5TA 3RC1A 1LGYA 2I3DA 5FUBA 4ZMRA 3CF6R 1L6IA 3O8QB 5IG2A 4U7DA 1IM2A 1FQOA 1AKTA 3J7TA 2XGOA 3DLTA 3ZYCA 5MN5A 2AZ4A 2ZT7A 3LW7A 3K70C 3NBAA 2R6AA 5J58A 2JZCA 2W93A 1KDZA 4DEVA 4ZEMA 5ICGA 5C5CA 3HR8A 4DLNA 4B4WA 1UOPA 4JKIA 4PGGA 3S5UA 1A5ZA 2CSUA 4IMPA 2HLHA 1FIUA 1I0ZA 1FU4A 3L7AA 4O4IF 2EZ4A 1SOUA 1T9GS 3K9CA 2VTVA 3GAMA 4L0DA 5FPSA 4Q9JA 1X8JA 5D2CA 4Q9HA 5HG0A 4YXWA 5T4EA 3RFTA 2V9PA 4B6PA 2I0FA 4MV6A 3U60B 1JQAA 3I0NA 3H19A 3ILVA 3KWJA 3KCNA 2PMBA 5C7IO 1S9HA 4D7AA 3HP7A 2JRCA 1BJTA 2OFOA 3LGXA 2XMDA 4XGRA 3ROGA 4OHFA 3LUAA 2EWMA 3AG5A 2ZUDA 1RYBA 4JR2A 4S1WA 1UQRA 4PG6A 3DVLA 4JITA 4X1IB 4BKUA 4Y2QA 5K0BA 3Q3HA 3O4JA 2BHRA 5FR1A 4OP1A 3HJRA 3E70C 4NZNA 4P22A 1V7PC 1VM6A 3HWSA 1TKRA 1K06A 1T1JA 3ZDAA 1AF4A 3EFHA 4QRDA 2DFDA 2IEIA 2Q4DA 3V4PB 4KWEA 3DONA 3QPDA 5JQGB 5DX1A 1K7CA 4ILEA 2G83A 3WK5A 1EFRA 1NFQA 3WV4A 1AUXA 4FC6A 4C2BA 1YJCA 1Z5ZA 4HWSA 3UMJA 4Z1MD 1E1LA 1L7MA 3WL6A 4JOBA 4B35A 4JB8A 5BWNA 1UEJA 3CISA 4CEHA 2O2SA 3C1AA 1PGPA 4REQB 4KACA 3JQGB 3GLFE 4OQQA 4F2PA 1UMDA 1TM7E 1L4BA 1LA2A 1TRKA 1YU6A 4LGVA 2OZLB 3PC4A 1BOOA 4REQA 1HG1A 1S8NA 3JQGA 4Y7DA 4YJ2F 2VQEB 2QS9A 4QLOA 5AKGA 1ODKA 2OZLA 3WYNA 1XZAA 1IBRA 2VDOB 4C0AC 2QVYX 1GV1A 2XUIA 2P4UA 1D2HA 1KK0A 2W8ZA 3DOEA 3KD2A 1E3EA 5CLIA 1KAEA 2ZYDA 5ECYA 3T38A 4HVCA 2F1KA 2ZDGA 3DDWA 1CNEA 4N7RA 5CB6A 1YDGA 1ZGHA 1XVAA 3RVJA 1JU9A 2VJDA 3ND8A 4EENA 6Q21A 2QPAA 3GUHA 5I9BA 1ZI9A 1GCOA 2CMDA 3MGAA 5ULLA 1Y6RA 5L7YA 3HWX1 3WADA 2B8TA 1YE8A 2Q3HA 3B7WA 3BILA 3NQ41 4GOOD 3WA7A 2FP3A 1U1FA 4G4GA 2GN2A 3E9DA 2FPRA 1I4DD 2BM8A 2ZSAA 1EJ0A 3AR6A 1X7YB 1NVUQ 3JVIA 4WKNA 3UY4A 4GZ6A 3BKXA 5SZJA 3ZGXA 3NMUF 2HXGA 3QLVC 3GY0A 2AFIB 1UL1X 3KEOA 4YMWA 3SD7A 3TN7A 3A3OA 1OX4B 1Z4LA 1EHYA 3HJGA 3HZHA 1KWGA 5JSZA 3AKCA 2VJLA 1U7HA 1PCXA 4URYR 1K7YA 2YJ4A 5D85A 2FE4A 5I5EA 3TXAA 1QWSA 3ELYA 2C42A 2IOQA 4Q9LA 3A3NA 5DGCA 3UC9A 1O87A 3VYSB 1K6IA 2HUNA 2FB9A 1UPAA 4HAWA 1F3OA 1JDJA 1T4GA 2G63A 3HI4A 3HBLA 4HBGA 3WG9A 2YWHA 3BBPA 1NUPA 1PP4A 4F86A 2RBEA 3DFFA 1RBZA 1SKYE 3OZAA 4YP7A 3PFGA 1HMYA 3TBFA 4CLOB 3PQEA 5EXTA 1A8HA 2FA9A 4H4EA 1WUYA 3WMXA 1ZHFA 4OXIA 5CDYA 4HFJA 1CUWA 4OQZA 4WVLA 4CLOA 3KM0A 4MITA 5FORA 4RL6A 5ANRB 2E48A 4RF3A 2JLRA 4MQ5A 2ZJ2A 1MRZA 1NE7A 1R0XA 3ISTA 4RTKA 2YWBA 1O58A 3FZQA 3G5UA 3EDRA 4BV8A 4WNCA 4NYIR 2O8CA 1CUCA 2Q6TA 3HHEA 2PWBA 4KP7A 5DX0A 4C0LA 3Q0EA 3ANYB 5G3YA 5A06A 3EE6A 4EFNA 2C9BA 5IBCA 4XJTA 3ZWQA 3MB5A 1QHYA 2HA2A 5CDSA 1PW5A 3RS8A 1T4DA 1X9GA 1J8DA 1MQ9A 3DBHB 3OJLA 3QP9A 5IANA 3LY5A 3GLGE 5JAHA 4KXNA 2YJ3A 1TT7A 3H13A 3M83A 4NY1A 3IRUA 1LXCA 2GCNA 4XDHA 2ZM6B 1E6UA 1PL6A 3TTVA 1K8XB 4AKEA 1DRUA 1OI3A 2IF0A 4EHDA 3KLNA 1E5DA 3FA2A 3IAFA 3N86A 3TEJA 3LF1A 3WZLA 3C3BA 4F1KA 3J81A 1Y1PA 1F38A 2Q6KA 2FZCA 2ETXA 5KS2A 1H2YA 3K4HA 3G82C 4RFLA 1OWPA 2VAWA 1LTHR 1LLFA 4OB8A 3KAJA 1A76A 3G0CA 5HF9A 1YUBA 1H42A 3B6IA 4D6XA 3SKYA 1O8CA 1JB9A 1TO6A 2ODAA 3FNGA 3HCOA 4PAWA 3I58A 5CVEA 5F2KA 3W78A 1X1SA 3PQ7A 3O73A 3UT6A 3WWDA 4CPDA 4ZK2A 1QR2A 1I7SB 4KO2S 1I0IA 3D7RA 1D2CA 1ZOSA 4B7UA 5CB4F 1KO1A 1U2RA 4MQEB 2DF8A 2P9BA 3IT2A 5JAUA 3ORSA 3IUEA 1KEWA 1P0PA 4Y6RA 1QYXA 2NZJA 1U3TA 2EZ9A 1U7DA 3QM1A 4DKJA 3UJ6A 5AVSA 3VU9B 1S2LA 3OFND 2P1ZA 2GSWA 1T1GA 1ZJ6A 1F2DA 5TVGA 3ORYA 1QLWA 4GXQA 1U9ZA 2QG6A 5CNKA 1U2TA 5CXSA 1TI7A 2Q7OE 4BEVA 3PR1A 5TEVA 1GAWA 2IEAA 3GDOA 4NG4A 1G8GA 3P96A 4OAOA 4OJQA 5LZ8A 5ERYA 2A0UA 2ASEA 4JJ8A 1Y3AA 2WE7A 4DXHA 1YB6A 3FBGA 2QQFA 3BVPA 1K6EA 4KRGA 2WIAA 5GV8A 3RQSA 3BGSA 1MXFA 4ZJYA 2VQFB 1PW7A 4LBZA 3LRPA 3PTZA 2KBFA 2O6HA 4L57A 1VPLA 2Q0QA 2HM7A 1P73A 3OWXA 4FOPA 2HWXA 2VP4A 1OH5A 4QO8A 4DLXA 1RJ9A 1WRBA 2P5TB 4FFPA 5HZGA 3LY9A 1HKHA 5IM5A 2PKWA 3AWDA 4GMGA 2J5RA 3ES9A 2WAAA 3FFXA 2H5LA 3R9IA 1GQRA 1FP6A 1BW9B 3D5TA 4UD2A 4ENSA 3VR4A 3RFVA 1IBMB 4Q4DA 1RCFA 1LV8A 1PR1A 7AT1A 4R1NA 1FSGA 3L7NA 4RMHA 1PR2A 1BHSA 3A0UA 2G5CA 2AD1A 1YS7A 5AHOA 4DARA 5DLEA 3SWWA 3I9LA 1NYTA 3TE6A 2B4TO 3L0BA 4CGZA 2Y1GA 3EGWA 1YBFA 2HMVA 5EJAA 2AIRA 5ILQA 3U1TA 4E4YA 5KVVA 3G88A 1W7AA 5EUCA 2OUIA 4YMIA 3ZGLA 2EX4A 4JBYA 1I5EA 4LV5B 4M8SA 1SQ6A 4P83A 3TR6A 3VR1A 3BD9A 1NNI1 3A4NA 2I6TA 4ARCA 4UVDA 2HCBA 1S1CA 5KYUB 1JG7A 2PN1A 3GFQA 4L8GA 2JKVA 1W9HA 4WFJA 3UHFA 1GLNA 3IOEA 4CQJA 4OAPA 4RV5A 4BVKA 4V1CB 4PO1A 5B3AA 2FX2A 4R7ZA 5KYUA 3VX4A 2J59A 3NHJA 3KUKA 3H4MA 4B3BA 3OA2A 4V1CA 1KU6A 3FYSA 3KUDA 3O1LA 1C50A 3DAOA 3EFEA 2GZSA 4R41A 2NQ8A 3T3NA 4ATNA 2OB1A 4NOMA 1SQGA 3R3XA 2PPLA 2WSSA 3DNPA 3O3MB 2DY1A 3TEFA 4WY8A 2X1VA 2Y8EA 1HT1E 5KJEA 1I14A 2XDQB 1DXQA 3GLHE 2QN8A 4R31A 4ER6A 1ONOA 2UYQA 2DUMA 3NT5A 3UT5A 2FTKE 2A1TS 4RHCA 1R88A 2JGIA 2XDQA 5IVDA 4H7IA 4D4MA 1FYWA 4O4LB 4QTUB 2I3AA 1AT1A 1YH3A 1E92A 3HO6A 4M0MA 4MYUA 4GOMD 4ZD6A 3ZI4A 1UFVA 4I08A 1S4MA 3K1AA 5A2QA 4KI7A 1W88A 4O4LA 2XQGA 4J1QA 2IZ7A 1ZRHA 1F5NA 2ZI9A 3AFGA 5EE1A 2GMWA 3VYUB 4FYMA 4XM0A 5E8RA 4FDUA 3V6MA 1MB9A 5HIIA 3LY7A 5FKJA 5LKAA 2QLBA 3P9NA 3F4LA 4ZC8A 3RVPA 5IT9A 1V16B 1Y48E 2JIDA 4L08A 4S1OA 1BROA 2WVAA 1AX9A 3MD9A 4EAQA 1CNMA 4E70A 3UWOA 3ZPXA 1V16A 2A33A 2I6UA 4PGMA 1J39A 2PTHA 1T4CA 2AD5A 4K9LA 4EHKA 4J03A 3K3PA 1NNLA 4OGGA 4L9SA 4BUCA 1U0TA 3KXKA 5CVUA 4JT4A 4AWXA 7MHTA 1NATA 1W0JA 2FZ4A 2WMOB 4Y9UA 1GY8A 1F60A 4QPZA 2J7KA 5ILOA 1VTKA 4XCXA 1H69A 1THZA 1XRSB 3VZQA 2OFWA 1OT3A 3FGPA 3RRMA 3VMFA 3R7BA 2ONZA 1L6RA 3OU2A 1FVOA 4O0MA 4Q34A 4RLQA 1DQPA 3OPVA 5CR9A 2NTJA 3VNQA 4BRZA 3JU3A 2VYND 3GCDA 1VSTA 2ZWOA 4PQEA 4JB0A 1LPSA 4EI8A 4R68A 1A9SA 2JK1A 1T10A 4HT3B 3LG2A 3LKZA 1PR4A 2JLUA 3H5AA 3MWFA 2Z9CA 2QI9F 1AUOA 5AKEA 3WLNA 3NHUA 3ERCA 4BE7B 2IZ0A 4UHKA 1LJLA 4G5RA 3HGQA 4QNMA 5B64A 1OW3B 2V0GA 4MO9A 3SOPA 1H6AA 2FUG1 2GYWA 3IALA 1NLMA 1P9LA 3TLYA 5ALRA 2IU4A 1JHQA 2ZRLA 5JEEA 2W6JA 3DTVD 1LRJA 2BOVA 3HSKA 1RQXA 3CUSA 4DLSA 1WB9A 4WNAB 1M1UA 1CW2B 1M7GA 3BXXA 4HGRA 1D2EA 1SHTX 1I2AA 4HR7A 3HXPA 2C3MA 4DM3A 4WNAA 4GRIA 2HMSA 2B1JA 2MIIA 3HG7A 4YUYA 2OCXA 5KTSA 3QX8A 2CXOA 1GUBA 2X8JB 3K4QA 2WTXA 5FOTA 1WB5A 4CLHA 1O0CA 1O94C 3KKLA 1N9GA 3TKYA 2QR3A 1IPFA 1W47A 5AO9A 2QRVB 1GT91 2X8JA 1Z0UA 3AHJA 4AKSA 4ZZ0A 3L1UA 5T8KC 1HK7A 1W1UA 2AZDA 1SBIA 1SVSA 2P0YA 4OL0A 3NNSA 2II6A 2QRVA 2JASA 3BX1A 3ZCSA 4MJXA 3VKFA 4KKXB 5AYVA 2QLJA 1RTTA 4C5AA 1I3KA 5DTRA 2X7JA 5DKFA 5B1SA 4QAQA 3KK0A 1L8LA 1G21B 4YJGB 5HF8A 4EP1A 3ORQA 1VJCA 5WRFA 1U3UA 1Q16A 3OE1A 5LP6C 5IJ0A 4MB0A 2IY9A 2B1QA 4YJGA 3DCNA 4L8LA 5CCXA 3U39A 1GGHA 1UBMS 3AXTA 1QH8B 1XZIA 4TS9A 1W85B 3PUJA 5TMEA 5HQTA 5FPKA 2V74B 1S01A 3IESA 3NI2A 3SYMA 4ENUA 1BCRB 4KQJA 1GPAA 3MQFA 1QH8A 2AKAB 3AR9A 3C4QA 1OKKD 3ONVA 5KPDA 3CN7A 4G5YA 4ZDKA 1XEWY 3ICWA 4MH0R 1BCRA 5CVJA 4JXZA 4YHBA 2H4YA 1GYRA 1ZZEA 4OLHA 4TLAA 4J0DA 3L4JA 3MRXA 2ODWA 4Y67A 5DGHA 1G2PA 4H4CA 2LDBA 2ZUFA 2RD2A 4P7FA 1X80A 1IIBA 1C14A 1LBQA 2J67A 2ZITA 1I7DA 1KY3A 1WSDA 3UENA 1ST3A 2DFNA 2PSJA 2ZKIA 4FHCA 4GNKA 4LZZA 4EGSA 2BEKA 1ML4A 2XCLA 3DHEA 3ZE2B 2VJQA 3DZKA 7YASA 2MYTA 1NQUA 1SR8A 3S5JA 1QG4A 5K4GA 4NU0A 1HR0B 3KFXA 2ORIA 2VZ8A 3LW8A 4PPNA 5AVWA 5I45A 4QNRA 3IX7A 2E37A 1U8FO 1ZIOA 5DM4A 1Q1ZA 5CCBA 1R2QA 2B9VA 2EZTA 2J1LA 5ALMA 4QBKA 421PA 3RS4A 4ZJZA 4CODB 4YCBA 2MSEB 4N6GA 3O6VA 3F90A 2Z04A 4ER5A 3SDSA 3JS5A 3WLSA 3I32A 1MZPA 5DW0A 3VSBA 3ICVA 2NP7A 5FP0A 4R81A 1Z4IA 1D3AA 3H84A 3KKZA 1WXIA 2MYUA 4C0HA 1Z0SA 2NOAA 5TF0A 1AK9A 1JSRA 1XTTA 1HT3A 3VO2A 4A9AA 2FPLA 5CBPB 3M33A 3SQWA 4IOMA 3HVJA 2EP8A 4CF6A 4QKQA 4S2EA 2OSBA 1E7YA 1Q6ZA 1Q0PA 2P6MA 4KQIA 4PVCA 3VV3A 4NCHA 5CBPA 5F9MA 1GZ3A 1AA9A 3G0IA 4HNAA 4H6XA 4Q05A 2OKCA 3KLPX 2VHQA 4HAUA 5J63A 5CA1F 3MLAA 1HDZA 2YUTA 1JT9A 1XCBA 1XWFA 2WT4A 4LTMA 2FQYA 1WPRA 1PVVA 1GL7A 3BTVA 4BEWA 4NBWA 4G5HA 3V32A 2V7TA 5AUOB 2GFIA 4KSYA 1RQ2A 1BN6A 1EBFA 1O94A 5I4BA 3K0SA 1MAAA 4HNRA 5H80A 3KVRA 1QWOA 3IULA 3K35A 3W8EA 4YMHA 1CV2A 5BP7A 2YMLA 4J0HA 3NAZA 5HX7A 3MS7A 3LLMA 2G36A 4R6WA 1RYNA 4C6HA 3P2YA 1CY2A 2OLEA 5G0SA 3P8ZA 4EJFA 3G2OA 1YIDA 4JSYA 3SYNA 1PUIA 3HM9A 2GN8A 5DWVA 3X2FA 3TO5A 3GPBA 2QUJA 5ITVA 1Y8QA 1ACJA 2PRJA 1L7PA 3BFXA 3IGFA 1T8YA 5EY5B 4AJOA 5EWJB 3FMVA 4E2FA 5E1OA 2BHTA 4G81A 4YPFA 3IQGX 1DBWA 4KQCA 1PEAA 2M6RA 2HPVA 5TPZA 5EWJA 4IJMA 3V9PA 3W79A 1SY7A 1H5UA 1SN7A 4CXMA 3Q41A 4MV7A 3IMCA 5A5VA 2UU9B 3EB9A 1RJGA 4I5FA 1O6FA 2JHPA 1TB4A 2V7EA 2FETA 2R5FA 3BMOA 4FBLA 2ZBUA 3HACA 2CLLB 1VSUA 4WXYB 5FLEX 2VHWA 2XZOA 5B2ZA 2UAGA 4EG6A 1QZXA 3BSYA 4FJ2A 2G72A 1DARA 2PT7A 3AMVA 1JXMA 3Q72A 4PU0A 3DFMA 4D02A 4CF7A 2OCDA 4AUMA 1RWQA 3WYDA 2HTFA 2CFTA 1KARA 1NM5C 4BQFA 1PSDA 5B1HA 2A2ZA 4K9KA 1M9NA 1E1YA 4HAXA 4QECA 4KBYA 1VJGA 4PZYA 3OOJA 1V41E 1Q50A 1YB2A 1MH1A 5K5EA 4HYQA 3RAJA 1ZWKA 3CJTA 1R9JA 4PCVA 1DCKA 4F4DA 2O2DA 5KHLB 4OXRA 1VDZA 3KZVA 4DLWA 1QK3A 5MGNA 5KTPA 2C4KA 3ZNQA 1RC0A 2PLAA 2V8OA 5JSFA 4Q1BA 4BX2A 4NBSA 4X3CA 3GLTA 2ADFA 1USIA 2JGRA 4OXYA 4MHTA 4K0RA 4KH0A 4QJBA 2YYAA 3PNSA 1KU0A 4L3WA 5AVXA 1J2TA 3R3YA 2JA2A 4RTMA 4PFKA 1F0YA 3N8KA 3T5PA 1RXCA 3VU0A 2WINI 5BN4B 4E3WA 1FTNA 3PE4A 1SA0B 2Z2KA 2NO4A 1H2AS 3EFBA 4QUBA 2QY6A 1JYFA 2BY4A 3D3WB 2FR1A 3AUXA 3LA6A 1P17A 2DGDA 3TQFA 4WE3A 3C3XA 1TIPA 1ZMTA 2IEBA 4OA5A 1SA0A 1LBHA 2PX8A 4TTTS 5EVJA 2I66A 3D3WA 1SVMA 1DOZA 2ZIEA 3NATA 4LRUA 2JHAA 5D3QA 1FTSA 5FUQA 5MHTA 4Z7JA 1MP0A 2VYVA 4LWOA 5DYGA 2AEJA 4KQ6A 4QHTA 3MW8A 4F5WA 5K8UA 1PR0A 2CD7A 3HR7A 2Q9CA 3IDAA 2OXCA 3PXBA 4HATA 4HEA6 4C89A 5AM3A 1I10A 3EODA 1L5GB 3BXHA 4OUKX 3UICA 1AD2A 1JKIA 2V6MA 3E03A 4OJKA 4PXYA 1TOAA 2R7KA 3VYRB 1ZEMA 3T15A 5AI5A 5HS6A 2W6ID 2R5WA 2OV4A 1T6NA 3L49A 5HCUA 3L7JA 1QANA 1XUOA 3NOQA 5PGMA 4RTSA 3K8QA 4G2NA 4BNNA 3Q3IA 2GZRA 3RC8A 2R751 4M8NE 3JQ6A 4RADA 3HYNA 4WXPA 2OP0A 3NDRA 1DX6A 4XPIA 5JFTA 2Z2YA 3QVGA 1G7SA 2P0AA 3FNFA 4UDOA 5KTRA 5G1NA 1FE8A 1JA0A 1UANA 2P5SA 3LPLA 4QDZA 2J30A 4NAVA 4H7FA 3EVGA 1DL5A 3IHTA 4R2JA 1EGQA 1ZISA 2QPLA 4N76A 4BLPA 3H18A 1B16A 3TLKA 4J3JA 3FGZA 2LP4Y 2A9PA 3BT7A 4J76A 1XVTA 2IY7A 3SHQA 2OYCA 2MSLA 4Y1RA 4E2WA 1D4FA 2A14A 3U81A 2UXCB 4BPRA 2AJDA 1SXJC 4YGYA 3RC3A 3AUJB 2QQ5A 4B0OA 4UAJA 2R84A 4W5QA 1B0PA 3CSUA 3NASA 5DVZA 2PR2A 2XW6A 2P9GA 4HQKA 1NM5A 5CK5A 5LVAA 1GFWA 5LA6B 2BJWA 1RYZA 2E1RA 3H42B 3N75A 4NECA 2C2MA 2Q7XA 1NX9A 2FUNB 5E4FA 3DUFA 2YWFA 3AXSA 3BXEA 3IR7A 4K1LA 1GZ4A 4MKXA 4L95C 3N8GA 5LA6A 1IWBB 4JIGA 4LCEA 1CR1A 1IATA 2H7YA 4KAFA 4XSGA 3UJAA 5FBVB 4ZAFA 3I1JA 2G40A 1OPRA 4J49A 3EJ6A 1TCCA 4UE2A 4PTYA 2YQ5A 4E3ZA 2VQ6A 3ETCA 1JPUA 1T5TA 3DOOA 2C4TA 2JIMA 2C77A 1RQPA 3C5VA 4C78A 4NFHA 3DKKA 2OCBA 3TB6A 4HGOA 3HP4A 3IUYA 4DF3A 3BIJA 3H4IA 5T6BA 4AG3A 3RUDA 1JECA 1VCIA 1EWQA 4CR6A 4O2BF 2GTPA 1JDSA 2H8KA 2QW1A 3MT9A 3JAKB 3V7FA 4HB3A 3VR6D 4DDKA 5F5XA 2HHLA 3RVMA 1XEFA 3CNBA 1KJJA 3IOYA 2X0FA 3EA5A 4D8YA 2HXSA 1VE7A 4DIBA 3ICPA 3EVBA 4Q3NA 4DR6B 2Q1TA 3JAKA 4I8DA 4M0LA 1FS6A 1WOMA 1PR5A 2QM3A 4G67A 4O59O 1LC3A 1SCIA 2HLNA 3QVVA 4P2BA 3SDBA 3BFPA 3AVYA 1EFVB 3OESA 1ZA1A 1KAGA 4RPLA 3AVTA 1A8UA 4ZO4A 3NAMA 4BMNA 5HKKA 1F3LA 2V5UA 3ROPA 1GILA 3T7DA 1V5FA 5K3DA 5JTTA 3ZU2A 1EFVA 1U7PA 3CT4A 3G8CA 4E5DA 1R0RE 3FUXA 4EHBA 4EY4A 3VVCA 1K3UB 1CY1A 3MCTA 1BA2A 4TMZA 1LDYA 2HJGA 2ZSFA 4AMVA 1QR6A 1Y63A 2PGDA 4LPKA 4FYJA 2HDHA 4G8DA 5CLQA 3NETA 5A4IS 3SXUB 2J0VA 1NKSA 3VH2A 1YI1A 2GBLC 2XUAA 2Y27A 3IODA 3NTQA 3MRVA 4KYTA 4ZREA 5TS2A 5JJBA 2GXAA 5JJLA 5C35A 3IBFA 2P68A 3EXG2 3TEMA 1ZLXA 2IOHA 3AYXB 3ROZA 3OIUA 5CH8A 4ETWA 3SC6A 1P1RA 3S1LA 3F7NA 5AT1A 2ZAMA 3R6LA 5B1EA 1ZVVA 4MR7B 4NZMA 2C2XA 4F4FA 1XZLA 4BL5A 5JBNA 4RULA 3F2VA 4G07A 2Z1NA 4RDCA 2OBMA 4MR7A 2PWYA 5DHSA 1P1IA 1JHYA 1LW7A 2BFPA 2R9VA 2WJZB 4YI3A 4DOMA 4E46A 2VSNA 1QG2A 4S05A 3LQRA 4R3UC 1DFHA 2OENG 1C0EA 3LBIA 4Y1GA 4ZP1A 2B83A 3E7FA 4IGKA 1SXJA 3S2GA 5JXJA 1ZNQO 4ZVTA 3ZJTA 3JASA 1T2EA 1CUSA 1XLTC 4EPVA 2Z5LA 2IPAB 1PEYA 5HGXA 1KBOA 2QTTA 4ABYA 1FK8A 4BAZA 3ZDDA 1WTAA 1MZVA 3AF4A 3GEEA 4K3UA 4GVXA 2MOKA 3NHBA 4QTZA 3VSEA 3PK0A 3WMWA 3BK2A 4YRZA 4YK7A 4M9UA 3GA0A 1AIPA 5TRTA 1N1MA 4X20B 4BLQA 4D9MA 2WFZA 1K86A 3MGKA 1Z2EA 4L50A 4KDCA 3IUPA 4GPEA 2B36A 1I1NA 4TWZA 1T2FA 1IK4A 4X20A 2EG9A 1Z74A 2BELA 4WJLA 4Q7QA 1EFUA 4IHJB 2FX3A 1WCV1 2V54A 3A9UA 3N7TA 4JH0A 4BQRA 1ANKA 2XUOA 1LKZA 4HN2A 3P19A 1R4AA 1Y7PA 4IHJA 1LLDA 3INRA 3JX9A 4IVNA 3AB7A 3CCBA 1RQNA 3JR3A 5EKSA 5FD8A 3P97A 5KYYA 1N0WA 2AFVA 2B5VA 4EPWA 4ETIA 2YWEA 3CB4A 4PRZA 3NANA 3TYXA 1YNSA 5I47A 5JZMA 2X3FA 3OTHA 3EA0A 3UK6A 4KLRA 4Q9IA 1OYYA 3B3JA 3U4AA 5ALUA 3OQNA 1XF1A 1QRDA 2LCQA 2F43B 2B7LA 1I7PA 1J0DA 4TMFA 4GE0A 3DT9A 3C6QA 3Q15C 2CJYA 4GW3A 3DOFA 2D2IA 1OTYA 1OBOA 2ZYTX 1NLZA 3RFCA 4D41A 3HZZA 4YRAA 3W3AA 4EY3A 2QN6A 2CNDA 5T64A 2HK8A 4QASA 1G20A 2QVGA 1FFCA 3RTAA 1J5EB 3IDQA 4ZVOA 2VOJA 5LP6F 1PFYA 1RZUA 5GPBA 4ZT7A 3FCYA 5EOVA 4ZI7B 4I3FA 3E22B 2O4UX 4BKQA 3WR5A 1KAHA 1QB7A 1GPMA 2N75A 4J7AA 1YCFA 3RARA 1H0HA 5CFPA 2G9QA 3B5JA 3B52X 4HAIA 5B4VA 1AQUA 1G1MA 2PT9A 2ZZKA 4ZI7A 2GWRA 4FYYA 1Y4ZA 3X1ZA 4F1JA 1E1DA 1XZKA 5KQMA 2O23A 4B4UA 2ZSEA 3G8AA 5GV7A 1UPBA 1NMXA 2DFKB 4XB1A 1GKKA 2NT4A 4MI3A 3LVRE 4IJ5A 1N0VC 2FVXA 2YYZA 3T99A 3CX3A 1XPJA 3DE2X 3THSA 4YMUA 1ZWLA 2VYFA 2W2XA 5BNZA 1SRRA 5EPEA 2WSYB 4MUHA 2AN5A 2P0EA 3RS5A 4EWLA 3NP7A 3KXIA 1OWOA 2QSZA 3M6MD 2OZKA 4B7ZA 1ZY2A 4HRAA 4YR7A 4OU5A 4BASA 3RUFA 3TI7A 4R2XA 4M0EA 5J5CA 1GPKA 2OCYC 2QJRA 3B9RA 4Q3DA 3IH5A 4CT4B 3ICOA 3RPEA 1OVMA 3ZYZA 4CMGA 4EHJA 3CF4A 2JCSA 3ODPA 5FADA 2YHAA 4IFTA 1K4YA 5C1IA 3QQ5A 4XW2A 3IMFA 2W2VA 2PGIA 3ST7A 1QGUB 3A2NA 2JAPA 4GECA 3UGQA 4D9EA 1TCBA 2EV9A 3IHLA 2NMVA 4Y2XA 4PG4A 3N9IA 1UKYA 3MT7A 1YDWA 1QGUA 4PRKA 3RLFA 5C4IA 5AVZA 2G7ZA 1VRCA 3OOSA 2D74A 2F2TA 5P8WA 3RSOA 3JQBC 5KQLA 4BLOA 1DC6A 3CWCA 3SNKA 1Q2UA 3LLVA 5JZVA 5GM1A 3LP6A 5DBIA 3RUEA 2PV0A 1R50A 4ZVQA 1NUSA 2I9PA 1HX7A 2G28A 1CQZA 2Y6VA 5LWHA 2ZRDA 4U3JA 4DCUA 4F21A 1A77A 2R25B 3KT6A 1VI2A 3NM4A 1T2DA 4L0CA 3V8QA 1EFAA 3NDBB 2NNLD 5K3EA 4DHEA 2AI3A 2YVLA 3S81A 1UR5A 3V8EA 4ZI5A 4X1YB 3EISA 1MOZA 2B1IA 4MV8A 3P9IA 3M3DA 1HF3A 4I19A 4QUJA 3IEXA 1EAMA 4X1YA 1TL7C 1J21A 1NMZA 2LR0A 2AZTA 4KG7A 4OKSA 4XKJA 5CBKA 4ABTA 1VIAA 3WGLA 2GN1A 1K4MA 3QHAA 7ABPA 5IYZB 1DZ3A 5KQRA 3U1BA 4ZCQA 2SCUB 3K2EA 1Q0RA 4KWHA 2NU8B 3ZBQA 2VRCD 1DEXA 1YE3A 3IJEB 1GKYA 4P1ZA 4RD3A 4YBZA 3X2SA 5IYZA 1E9BA 3KAKA 2SCUA 4TYNA 2OHHA 4X97A 3ZEIA 3MAAC 2XSZA 1IXKA 1YSCA 2P2CA 3C7AA 4OHXA 3DFUA 4G6ZA 5FEMA 1M67A 1G2QA 5DGTA 4IJKA 1I1QB 3N6VA 2IGBA 4GR9A 4RKWA 1P2TA 4FS3A 4ZO6A 5ALVA 5BSMA 1C9DB 1MT0A 4XRRA 2RARA 2B8NA 3W2IA 2Y6UA 3QBTA 4QXQA 4NPHA 4NV0A 4HWKA 3I8OA 4I1UA 5HIJA 1ORHA 3H86A 3OF3A 1NLUA 2ZWPA 3GEHA 3F7MA 4GQIA 1VJ0A 4GYYA 3X1XA 2QR2A 5J2TA 5AIAA 3O8OB 2VPPA 4O1IA 4AYWA 1LBEA 5E8JA 3UXEA 1CJCA 1ZGCA 4D8VA 5K3OA 1TEHA 3K5HA 3PCRB 4N39A 2VDRB 3TVYA 4JWKA 3O8OA 2FW7A 1DGQA 5KNLA 1JHZA 2EJVA 4B9EA 4OKIA 2AHRA 4WWHA 1VP9A 1KTIA 4KXLA 2BFMA 1H9BA 3L1VA 4BBPA 1EFHA 4LGMA 2A5GA 2M1XA 4X94A 5JRDS 2JEYA 2OBNA 3C24A 1DHRA 4TLLB 4BFLA 3VPGA 4CV3A 4JUBA 1CQIA 1XDZA 4CUJA 1T5BA 1YA8A 2ZSUA 2F8LA 5HFAA 4MRPA 1E20A 2V6FA 2O06A 3LLUA 1T24A 4ENTA 1BXRB 5A5FA 4M7WA 1PWEA 3MELA 4TVOA 5EMJA 1NLFA 4ZQEA 1BXRA 1XU4A 4DG8A 3G0BA 5EXDA 3I0ZA 4BQQA 3GMDA 5JS7A 1ZHOA 1ES9A 2ZJ0A 4RA9B 2B5OA 2P11A 1CR2A 3ICCA 2P7IA 1MV8A 1K6MA 4TV9F 2Q2QA 2FGJA 2QROA 4RA9A 3VR4H 3PFKA 4BRWA 1Y7IA 4UUAA 1QHEA 4NEQA 3JQBA 4RZIA 4BZQA 4ZANA 2HCTA 3T4EA 2ATIA 4ARUA 4LMPA 1ZH6A 4YCNA 4ZTZB 1E2LA 3FRHA 3KP1A 3R9WA 3OHMA 5A4DA 3K9WA 2QM7A 3M2PA 4NH4A 1TYZA 3DAGA 1KA9H 1JJAA 2AUTA 1WCIB 3B3FA 3PITA 4W5OA 2FPXA 5AJXA 3HKEB 3D8TA 1BVUA 1CIJA 4MVJG 1J9ZA 2YW9A 3K9GA 3KHTA 5CXUA 5JZ9A 3WDSA 3IEMA 1TFUA 1WCIA 3EDCA 3HDVA 5I7OA 3AHEA 4XDGA 2IYLD 3HKEA 3EIFA 4JQSA 4R71A 4WEOA 3V42A 1V9CA 3RRBA 4D57A 3TFOA 3TQHA 2W6ZA 5HIMA 4H1UA 1PLLA 2RK3A 3ZLJA 2HOQA 3JXEA 2MSCB 4GKVA 4WX2B 1M2VB 3W5JA 2QL5A 3A7EA 5T3YA 5CYGA 2CKDA 1J42A 1XRRA 4I5DA 4UUMA 3MWYW 5EESA 3K1JA 1M2VA 2I78A 5AKXA 3DMHA 2YRWA 1ICEA 2WTNA 5HE9A 2QVBA 4P5DA 5LM3A 5DCWA 2HX1A 5E9WA 1IU9A 1KIAA 3X1KA 4COKA 4C2AA 4MKRA 5J2UB 1S8FA 1SIUA 5J40A 1U65A 1L1QA 2ZJ5A 4UU7A 3I45A 3R7DA 1M2GA 2QLTA 3T1OA 4DWVA 1SHKA 2WU0A 4CTNA 3WIBA 1X7HA 1IYZA 2ZB7A 4GZLA 5AW6A 2CN1A 5CLLA 1UDXA 4IUYA 2IBMA 3DH0A 3DAYA 3KB2A 3ZDZB 1NNEA 4CETA 4B71A 4AK9A 3T3GA 4DA7A 3OCUA 1RI3A 1Q0QA 3T7EA 4CL2A 3G0HA 3LT2A 4IWYA 2ZSIA 3K1YA 5CYPA 2A5JA 4NFSA 4HEA1 4MICA 2QTVB 1GRRA 1MX5A 5F51A 4NZ9A 3D1VA 4PZ0A 1AU9A 4QDOA 3UUGA 3G13A 5AK6A 2DVMA 2ZW9A 2CYCA 1Y4SA 5TPWB 3RVLA 2WZQA 3HFSA 4PN3A 1KGSA 2W7TA 1X3SA 3IDZA 1XQXA 1T8UA 1DUVG 4RVHA 2QD1A 3IAUA 4IXDA 5TPWA 3V8NA 4C6TA 8ATCA 5JSUA 1AK1A 1W36B 3W7VA 3GFPA 3LRTA 5HMMA 5F1OA 1C9MA 4ZYYA 3K5WA 1YTUA 3EZ2A 4H1HA 5DIFA 3F6PA 3O3NB 2PGXA 2ZJ1A 3B2NA 1QVRA 1UBRS 2DKFA 1JQ5A 4MRAA 3S2EA 2IS4A 4N8DA 4TUYA 1L5QA 1CUBA 1SRQA 3UO8B 1JDBB 2ATXA 1ILWA 3MSCA 5MFPA 3I6ZA 5IBRA 4N5MA 1ETHA 1QKKA 1W8DA 1JQEA 4EGCB 3R44A 3B1WA 3U62A 5L7TA 4HTFB 1C1YA 2FOIA 4IDPA 5IBQA 3CLHA 2AYYA 4EB6A 1V26A 2CGEA 2AFIE 2FSVC 2NTYC 2W8BB 2YZNA 3FUVA 3VISA 4DB2A 1U5CA 4Z99A 4HTFA 4BNLA 1W0KD 5AUPB 5ITSA 1TRHA 3B3QA 3IHKA 4MDEA 4O25A 2W8BA 4EHLA 3F0TA 2G4LA 3JWGA 1Z6XA 1N5KA 1KC1A 3AOEA 3CZPA 4G0NA 3KDAA 1U02A 3H87A 3OKCA 2VQSA 4NH0A 2P35A 1BHO1 2ZSHA 3H9EO 4EY8A 2FJUA 3KYIB 3L8HA 4QGGA 1BWRA 1E2IA 2VF5X 4B4OA 4ZI2A 3A4VA 1A8PA 1EX1A 3BGVA 1O0BA 2HYIC 3IA7A 1SPXA 3UG7A 1Z2NX 2Y77A 5C4MA 3KDPA 3BZUA 2HI0A 3HFGA 3TF5A 4DIEA 5ICFA 2VHJA 2HRBA 3LKVA 4DJFC 4DLYA 2DR0A 4RKQA 4IG4A 2Q6OA 3W1WA 4J0GA 3OQPA 3RAPR 4MGIR 3MEQA 4MUBA 5JMTA 1XMVA 3HEMA 2BR4A 2XMRA 4TZ6A 1Y4UA 3RVSA 1ZJWA 3S8YA 2B30A 3TPZA 5E4JA 5CK4A 1GNPA 1A5TA 2QRGA 2XVMA 5B1IA 1FYVA 1GPYA 5EYPB 2C5BA 3BIOA 1Z2PX 3D4IA 1NZJA 5AVOA 4XZ3A 3JALA 4QHSA 3VNAA 5JJ5A 3A1EA 3OC6A 4YRIA 3JV7A 1ZN8A 5EYPA 2ZATA 3PQ8A 3JYPA 3SC2B 4BP1A 1T0JB 3ZG6A 2BDEA 3KR0A 4FYPA 4BEJA 2WT8A 4BWYA 4F3YA 3ZE8A 4XQEA 3OBBA 1WP9A 2IW3A 3SC2A 2LTAA 5TMBA 3RR2A 3TCXB 4CKBA 5HR5A 1FZQA 1JEQB 1HDIA 2DC1A 1KMCA 5K99A 1QIKA 5KWIA 1QZ3A 1S9DA 4IJWA 1FNMA 3ND6A 3B5EA 4BTLA 1BDMA 2W6PA 2B35A 4M9CA 2PFSA 3QXHA 4FFSA 1NRWA 4E33A 2BBTA 2AZXA 1Y1KE 3LP8A 2C4HA 4FKBA 2HAEA 4H3KB 3B1XA 5D84A 5EZ5A 2RGXA 1YFLA 1G9XA 1N6LA 3CU5A 3OA0A 4CTOA 2WPDD 1KHHA 2NVOA 2VF7A 3WJ2A 1XPUA 1ZOIA 2PA0A 2QRJA 3G0DA 3KALA 1KI4A 2ZT5A 3FVTA 2RGUA 1XNJA 3OPYI 3ZDFA 2H1LA 1HDEA 3FR7A 1ZOOA 3DEKA 4CIAA 4ZAGA 4UBMA 4RV9A 3WKDA 2AS0A 4CLDA 2GKOA 2AA3A 1QP8A 4R8MA 1XTIA 1D1QA 4IHAA 2QHXA 3C1UA 4KBFA 3E7DA 4FYIA 2Z8XA 1T9GR 1NUHA 4BO8A 3I9OA 3GMTA 4RD4A 2XE4A 2FSVA 1A72A 3DKPA 3C3EA 4XCQA 1YB1A 3C5HA 1YMVA 2A9KA 5LZ7A 3EH2A 1YT5A 1VG9B 3TNDA 1N1EA 3L8MA 1KKUA 3A11A 3AX6A 3L8FA 5CFZA 4UQLA 2AB0A 2I8AA 1VJRA 1ZEJA 3DXXA 1QHNA 2ZSKA 1SOWA 4BQPA 2X58A 1JLHA 3OZCA 2HA4A 2ODQA 2W00A 4E5UA 1FNCA 3LQKA 5KC8A 2P6RA 1HQYE 2IYYA 4P7KA 2JFHA 1QOPB 3DG9A 3O95A 5BMOA 1AO3A 2UYCA 3ASVA 2Q46A 5EUMA 2OOSA 2FWMX 4NF2A 3FKSD 1E79D 2PRZA 1N5RA 1Q22A 2P4EA 3COWA 3VXKA 3PUVA 4RIEA 4EA8A 1Q15A 3N74A 4R8VA 3PI7A 4H3HB 3S2SA 4QWWA 3GPIA 3UATA 2F8SA 2XNKA 5FO1A 4IUCS 4MRSA 1E59A 4DSAA 4O4JB 4BAGA 2G5TA 2IP4A 3VA7A 2ORYA 4RXTA 3SVLA 4WNIA 4KBGA 4W9RA 5FWYB 1VYUA 2J87A 4O4JA 4L76A 1A1VA 2QN9A 3A1SA 5B3KA 5JJKA 2I6QA 4P86A 3RGWS 2Q3EA 1DJMA 1TT5B 5FWYA 1P6UA 3T3PB 5DU2A 2ZRCA 5DXJA 4EW2A 3OSZA 4RMJA 4DBLE 4G26A 3RRXA 4HC4A 1H8HD 4DDTA 4HNHA 4UTOA 1V1RA 4WOJA 4XUGB 4G0ZA 1PL0A 1XZ8A 3BOSA 4RTQA 1JQKA 8ABPA 4X65B 3WL5A 3EQ2A 2XVZA 2A4MA 3T7TA 3JQQA 1U2GC 2CHGA 2OHXA 5TNXA 2VATA 3VI4B 3WRXC 3WJ1A 1SVKA 5JJCA 4DL9A 4Z4CA 2I65A 2PH1A 2Z4TA 4EYQA 2CLHB 3E9CA 1NBMD 3HCCA 1MAVA 1PUJA 1N75A 1UMBB 3FCUB 3OFKA 4JVOA 1ZSVA 3RANA 2ZS9A 2YZ7A 3GN1A 3KJEA 4ZKDA 2NT3A 1G8YA 1EP1B 3DOUA 3QOWA 2P9QA 1UMBA 1TZKA 3BQMB 2D6FA 1Z7EA 2Q2WA 1RHRA 1SQSA 3H5TA 1IBCA 4GM4A 1L8OA 2GYVA 2WQ7A 2CNNA 3PX2A 1QYIA 5IAAA 1XLVA 2GLUA 2WAOA 1PZXA 5KAPA 2HWKA 3RNOA 3ITKA 1HMPA 2F3RA 2Y2UA 1G9TA 4EL0A 3NYIA 4YT2A 1EDEA 1QAMA 2P3SA 3EW7A 4R2IA 1YB7A 5GOZA 5H16A 1HQKA 3N28A 1SEPA 3F6EX 4XM1A 5AM0A 3RVDA 4EUEA 5HKAA 2RH9B 4CMIB 3G5AA 4N9QA 4MVJP 4PC6A 3TCKA 5HZHA 1RZRA 5HNKA 5H0IA 4NK5A 2DPMA 3K2QA 2EJWA 4BZPA 4MKHA 3KELA 3G0GA 5B3LA 4DR1B 1C4XA 1QVWA 2QW8A 2AUNA 1XELA 2H85A 1Z45A 5IVHA 2F3UA 3KKMA 3RBVA 3AR4A 3HJTA 4C30A 3D0KA 4INAA 2VA8A 4LDRA 2C88A 4GPTA 3ZE9A 4M1YA 5KJ6A 1TW3A 3HUDA 2RI0A 1D1SA 1UOEA 3JZMA 4OQLA 1XD9A 2WHXA 3PE3A 1L4HA 3DS8A 2C8KA 1P0IA 4J1TC 5IWCA 2F4NA 2JW5A 2CDAA 1JFFA 2HL6A 1ZNZA 3AKEA 2ZBEA 3PU6A 4FNAA 2BGNA 4IDQA 5ALHA 3RRYA 2H65A 2X8WA 3SS9X 4EX6A 3R8FA 1C0IA 2PKCA 1YKGA 4P9NA 1XQWA 1QS0B 1KQFA 4WL0A 2R4QA 4Z9YA 2N3ZA 2YL2A 4HDRB 3IRVA 1U2DA 1AHNA 2OO3A 2PUDA 1IBLB 3IKTA 1HFKA 1E9FA 2NV2B 1KZ9A 1O9GA 3I30X 4NMXB 4MNTA 5HSGA 3WLEA 4KLCA 4OATA 2YWJA 4FXPA 2PLWA 2J6CA 2TMKA 1VL8A 2JFOA 2WD7B 4JSRA 4LXUA 3FPBA 5AM2A 1TQ6A 4EM6A 2IH4A 1CY7A 1D2RA 5BMVA 3GRAA 3MT8A 2VAVA 2NVBA 3Q5EA 4MUNA 2QMUA 1PS0A 1KZ1A 3KXDA 1C1HA 1NYQA 3IQWA 3L6UA 1BRMA 4NMWA 1XTBA 4ZPXA 1GLVA 1D4OA 4O1MA 4PVDA 2H29A 3U5TA 1A5AB 4OMUA 1VI5A 2RKOA 3SS8A 5KTTA 4V0QA 3KHSA 3AF2A 1RFGE 3N3AC 1GOTA 1J6UA 3HCPA 3IKVA 3RTGA 4F7DA 3E9YA 1MW8X 2BKLA 3CKYA 2AVDA 3EZNA 4KQFA 1TE2A 4OAQA 1Y8RA 2X1HA 3A70A 3C8DA 4HLUC 5UKDA 5JLJA 1R74A 1Q0TA 1J0EA 4UUOA 1U2GA 1XZHA 3WRXA 4UOEA 1PJQA 1RWKA 4COOA 5GVSA 1NOKA 5FA8A 5IUNC 1G8JA 2ECKA 2CL0X 1NVFA 3LT0A 1C81A 4RC9A 4WCVA 1D2MA 3RWBA 1O95C 4P3PA 1SQ0A 1XRMA 2RBGA 4RE5A 1YR2A 3ZLBA 2J4CA 1R37A 1CUHA 4ESOA 3PX7A 3P9KA 2C4MA 3NT4A 3ZIAD 4WT7A 4FYVA 3WO0A 4B2YA 3DL4A 3C3MA 3PHIA 1CYEA 3BIXA 3EDQA 2AFRA 5F77A 1N4DA 4O1HA 4U2FA 1U9JA 4LEIA 1ECPA 1HY3A 1K08A 1AK2A 1WXEA 2OV1A 4KXQA 3RYIB 2V1UA 3JTMA 3QMWA 4RELA 1MRSA 2NX2A 2ZRQA 4MUYA 3SJBA 1S2OA 2G82A 3EW9A 2XYQA 2HDNB 3RYIA 2FP4B 5LD2C 4LXTA 5D3KA 1G21E 1JW9B 5KX5F 1U1DA 1AV6A 5CLHA 1ZGBA 2C2GA 2XOKD 3VDNB 1C1DB 3CW2A 4XPZA 1NXPA 1T9DA 1DX9A 1ESNA 3QNUA 3O3CA 4IDNA 4IXTA 4RZSA 1W2GA 4W9NC 2VNJA 1BEUB 5JCJA 3UK7A 1OXVA 2VLBA 5JATA 3ZDCA 2BP7A 1N2OA 4ZOQI 1C1DA 4UEWA 4EKNB 1IEQA 3RTBA 3IYLW 2VTDA 4UM8B 4M8IA 5JXHA 3ROFA 2UUAB 1JHAA 2EX1A 3DBVO 5IZ4A 5HF5A 1ZCZA 4WAUA 3WL7A 1E62A 3CKMA 3AF3A 2J9XB 2QUBA 3GFVA 4BFXA 3O8LA 3RHFA 4MO2A 5EUQB 2GCGA 4UVEA 1E8NA 3AEUB 1RD4A 3ABRB 1DAFA 3FMGA 3KT0A 3TIFA 1UWKA 1RJWA 3EZFA 3OJXA 3KQSA 3N5CA 4TTVA 3ZHCA 1NWHA 1WZCA 4L9AA 1SU4A 3AQ4A 4NQZA 2R8ZA 1XVVA 2WYWA 3AEUA 3EXG1 1YJXA 3SXPA 2DCUA 3H8JA 2YV1A 2OTCA 5C8YB 1MX3A 1T1SA 1C7QA 3HRKA 4JI7B 2BEUA 2PHZA 4Q4LA 4R8LA 3RO7A 1FS5A 3WWEA 3IP6A 3H6GA 4WHMA 5C8YA 5ED0A 1TMYA 3VNRA 4PBTA 1GA4A 2YWRA 4PNHA 4JQYA 5I7UA 1ESDA 4A8JC 4ZYTA 2OBBA 3NGMA 4B4KA 4DR4B 3MWEB 1T4MA 1T6YA 2EXXA 1O6CA 1OGYA 4UEOA 3ROKA 3UIEA 1UP7A 3KQPA 3MTIA 4FSHA 4M1MA 3V1TC 5F9FA 3B9QA 5BV0A 4L4ZA 2PKRA 1JXQA 3P27A 5CM2Z 1P7CA 2C57A 3LQYA 1P4RA 1WCWA 1R00A 4TTPA 4CUZA 2XVAA 1TF7A 1ZQ9A 4GOJA 1YQ9A 3FWKA 4BNIA 4FHGA 4EPRA 3GRFA 4RAOA 3QU7A 3WK6A 4LJ9A 2Q45A 2QB5A 3G3EA 2C2ZA 2NSYA 3VTZA 2I76A 1S2NA 4CGYA 3ROEA 4DV5B 2KB0A 2H3EA 2OG2A 3STWA 2EP7A 2PIDA 1XGKA 4JYCA 3IPLA 3CEHA 5AW7A 3GK3A 4AG6A 3SYLA 4IGEA 1IIRA 3UPUA 2XT9A 1YIAA 4XGQA 2C1EA 1XDDA 4H60A 3HV2A 3EUFA 3L43A 3M49A 3WGJA 2X7XA 5ESWA 1WF6A 3BMXA 3L0ZA 5BWLA 3ELBA 2DXIA 1K8RA 2BKVA 3AEXA 2JFZA 4HMOA 3MCUA 4K26A 3KTAB 3L4BC 2YNMA 1L3IA 3QLJA 1ULUA 1I4EB 3H11B 3IT1A 3GCZA 3QV1A 4FE4A 3KBOA 4OY3A 4JR1A 2WICA 1RXWA 3KTAA 5KC9A 3E9QA 4QQRA 5AKHA 2AC4A 4IIUA 2ROQA 3H11A 4YRCA 3TTUA 5KO2A 4QJ4A 2XUDA 4C7BA 4L4YA 3L7OA 5C4GB 4J90A 1R9NA 1QCDA 2IYFA