4H3KB

Crystal structure of a ternary complex of human symplekin ntd, human ssu72 and a rna polymerase ii ctd peptide phosphorylated at ser-2, ser-5 and ser-7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Symplekin
publication title An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h3kB01
1QPZA 3LUKA 3H75A 4EYKA 4JB0A 1NXOA 2FN8A 1VPWA 5KQPA 3Q7SA 3L6UA 4MR7A 4RWEA 4JASB 5DKFA 3RQIA 3OLZA 1USIA 3A3KA 2E4YA 2FVYA 3DBIA 3UK0A 4G0ZA 2RDMA 5TPWB 1QP0A 2X7XA 3GA5A 2NZVG 4PE5B 3ROTA 3IP6A 3OMWA 1JLKA 2W42A 4KK4A 2R48A 3LOPA 1LBIA 3EODA 2JVKA 1BA2A 4HNRA 5B3JC 1BDJA 1XHFA 4RXUA 5DTEA 2F8SA 1NXXA 3HZHA 4MQEB 5JNTA 5EWJA 4KRFA 3HSYA 4PEVA 4Z4GA 4LE0A 3I5AA 3QX9A 4G0OA 1Z13A 4NQRA 1P2FA 1M2EA 1QMPA 2MYUA 1MAVA 1FSPA 3RVRA 1GLGA 3DLHA 3D8UA 5JS1A 2GI4A 8ABPA 4ZJPA 2FW0A 3ROFA 3OMXA 3SM9A 1ZESA 3LUJA 1PNRA 1UDRA 2IOYA 1F4VA 4NCBA 2AYXA 3E61A 3UKJA 1ZVVA 2FXIA 2QU7A 3I09A 4EUKA 1P6UA 3B2NA 4UHKA 1ISRA 3TX6A 4MS4A 4O1IA 4RY8A 1VKRA 4YCSA 1DP4A 2A9QA 2WRZA 1Z16A 5EWJB 2VYCA 1E2BA 1S8NA 5JS2A 4NV3A 1JL3A 1ABEA 1AB6A 2RJOA 3BRSA 5TQ2A 4G0XA 1RZRD 3DLBA 1ABFA 1RPJA 4ETIA 2JVJA 1MB3A 1P6QA 2HQOA 4Z4HA 4WXMA 1PUXA 3GRCA 3KKEA 4Z4EA 3H5WA 3HXMA 2IDMA 1ZN2A 3ILYA 4MLDA 2E4XA 4RSMA 5IUNC 1SXIA 1AB5A 5KI6A 4ETMA 4XASA 4HNSA 3C3KA 3M9XA 4NCAA 5B3JA 5DCLA 1U2QA 5IX8A 1NXWA 3KYIB 1BVHA 2CD7A 1DZ3A 1GCAA 2LBPA 3FMVA 3NNSA 3RVKA 2PUCA 1URPA 2JBAB 1SXHA 3QK7A 1DCMA 1KRXA 4MS4B 3OQNA 1DBQA 4TLLB 4N41A 3M6MD 4QYWA 1QNLA 2MYNA 1U04A 2ID9A 1D1QA 5E3JA 4KREA 1RXIA 3G85A 3QLVC 3DGFC 5ABPA 5TQ2B 3CLKA 3EGCA 3RVJA 5ED4A 1PEAA 2B4AA 4RY0A 5F64A 1U0SY 4RXTA 3HVRA 1ZGGA 1D2AA 2E4WA 5CNJA 5FWXA 5DLEA 2PUEA 1VLZA 2HSGA 3G1WA 1A04A 2FEPA 4Z9AA 3HEBA 4KFCA 1E6MA 3Q15C 2NT4A 3CG4A 4KV7A 5BQ3A 3H5VA 1ZHHA 4N76A 3QELB 4MQFA 3C3MA 2MSLA 4KQCA 2IPAB 3O2JA 1I3CA 3MQ4A 4TMYA 1CYEA 1SXGA 4EY3A 3KYJB 4JA2A 1NXSA 1PEYA 3H5LA 3GBPA 1DG9A 5IC5A 1YMVA 3KJXA 2JK1A 4H3HB 4RK1A 5TPWA 2M98A 3CG0A 2IYNA 1BDIA 2JVIA 3L49A 2L18A 1E6LA 3CNBA 4IRXA 2HQBA 2LIVA 3BREA 3N0RA 3O1HB 5KWSA 1APBA 4F11A 3RVOA 5FBHA 2RGYA 3H6HA 4YWHA 5KC9A 1A0OA 1QQBA 1JFTA 3HS3A 3TO5A 3TB6A 1GCGA 4H3KB 5JNRA 1FFGA 4EYQA 5FWXB 3H6GA 1NATA 2FQYA 2FLKA 3UUGA 1YIOA 3BILA 4RV5A 4MQFB 1KMIY 6CHYA 3FGZA 2PUAA 3OO1A 3SNKA 2PJUA 1YMUA 1EAYA 4KMRA 4MGEA 5T7BA 4G97A 4OG2A 4QYMA 2PUGA 1JFSA 4P1ZA 3N0WA 3HO1A 4N0QA 3QLVA 5TPZD 4LX8A 1KGSA 4W5OA 1NY5A 1OXKB 2TMYA 4S05A 4IMJB 4MRMB 1CHNA 2P9HA 6ABPA 1EFAA 3OLVA 3RVSA 3O75A 4LDAA 4JOQA 2PL9A 4EGSA 3C6QA 4O5AA 4ZMSA 3T8YA 2VUIB 2RJNA 4E7PA 4KZKA 4L4UA 1VRVA 3GV0A 1J56A 1XHEA 1KRWA 3LMKA 4F12A 1ZDMA 1Z17A 1K68A 4RK7A 2QVGA 3LTEA 4MAAA 2B1JA 5EWMA 4P98A 5CNIA 2JRLA 3KG2A 3OM1A 4D74A 4W5TA 3NNDA 4G86A 4YGXB 4EVQA 1Z2DA 5KQGA 4WZZA 2GBPA 4Z0NA 5KQLA 2NZUG 3K9CA 3IP7A 5TPZA 1TMYA 2XDYA 2J48A 2QSJA 7ABPA 1R8JA 5JNVA 4F3TA 3Q7RA 1DCFA 2R47A 1QO0D 4ZMRA 3GYBA 4UHJA 4F8JA 1NXVA 1YVUA 4GPAA 4QICA 5CHYA 2QW1A 3H5TA 2JBAA 4XXHA 1Y1LA 1JDPA 4LE1A 2PL1A 4PZ0A 3N6VA 3JTEA 2E4ZA 1DJMA 3F7NA 1SD5A 4Q6BA 2CHEA 1C0EA 1NXPA 4YP9A 4HYEA 2GKGA 4XAQA 3FFXA 4EYOA 2FEKA 4RS3A 1DBPA 4RK0A 5EWMB 1DBWA 1L5YA 1ZY2A 1CEYA 4ZPJA 4FE4A 3A0UA 3D02A 3S99A 3CZCA 4G0MA 3C3WA 2LP4Y 4MPTA 2L19A 3LUDA 4HNQA 1JX6A 1QO0A 1QKKA 4MR8A 2FLWA 3DGEC 4IF4A 4RY9A 4WT7A 2M1ZA 3I45A 1ISSA 3RVNA 2NT3A 3C97A 3QELA 5JNWA 4KNYA 4OLBA 1TVMA 3ILHA 1Z26A 1ZH4A 4S04A 1ZGZA 2QXYA 3KS9A 1YS6A 2FTKE 3SAJA 1EWVA 4MS3A 4D6YA 5CNKA 2FQXA 4H60A 4OBBA 3RVLA 2MSWA 5DGCA 3N8IA 3O21A 1DCKA 2IPMA 9ABPA 1RZRA 2PUFA 3TMYA 1EWTA 3CFYA 1W25A 5CNMA 2GWRA 5IUJC 2I6FA 4MYRA 1JBEA 3SQNA 4YO7A 2A9RA 2JCGA 4MR8B 1LJUA 4YR7A 1JYEA 3IP9A 5TQ0A 5IEJA 1YTUA 4RK4A 1U8TA 3O2QB 3LUCA 1BAPA 2WMYA 3HCWA 1USKA 1LK0A 2WJWA 5IEBA 3H1EA 5HM6A 2ID7A 2IPNA 3CU5A 2O20A 4EVRA 1M5TA 3GL9A 3MM4A 3HUTA 4MS3B 2N9UA 2QVCA 4IILA 4Y9TA 2FMKA 2R25B 2HJ9A 1B00A 3H1FA 3I42A 4DN6A 3IPAA 4MRMA 4W5RA 1DRKA 2P4UA 3OLXA 4YV7A 3VNAA 5GOTA 4LDZA 2HQRA 4TLMB 1K66A 2YHBA 3LFTA 3O1IC 2PLNA 5BRJA 3RVMA 2QZJA 2FKAA 1M2FA 3KTOA 3CS3A 4YLEA 3JY6A 3W9SA 4IMIB 1JYFA 1Z2EA 4D6XA 1EHCA 3N75A 5TQ0B 3KLNA 1DRJA 1QP4A 3JPYA 2PUBA 2R4QA 2F8TA 2A9PA 3OO0A 2FEWB 3F73A 3QLTA 3CTPA 1A2OA 3OLWA 3H1GA 5EWLA 4MLCA 3GWGA 1MVOA 5TQJA 1ZH2A 5IULC 2IKSA 3CHYA 2OQRA 1FQWA 3CKMA 3HDVA 4KQ9A 1Z12A 2L17A 4OTZA 4MR9A 4OATA 3HK2A 5FWYB 1F51E 3KHTA 3EDCA 2AYZA 3OM0A 5JNSA 3T95A 4KVFA 1YK1A 2GX6A 4Z9BA 3MF4A 1BDHA 4EYGA 3MYYA 3IPCA 1PHRA 4G0YA 3VNBA 2E4UA 2HPHA 4JAVC 4ZYLA 5GQSA 3NBMA 2PKXA 1TLFA 4MS1A 2FSPA 1EWKA 4N0PA 3SY8A 3T6KA 5C5CA 4W5NA 2DRIA 3A10A 2Q5CA 4RU1A 4TN5A 4M88A 5EWLB 3OQMA 4LRQA 5C5EA 3K4HA 4XLTA 3IP5A 1RNLA 4GNRA 3O74A 2FMIA 4XFKA 1LBHA 3EQZA 2FQWA 1QP7A 4MR9B 3JVDA 1TJYA 1P8AA 3F6PA 4O1HA 3LKVA 4B09A 1JH9A 4JB2A 4QPJC 4NICA 4Z4CA 3OLYA 3CZ5A 3QEMA 1QQAA 4Z4IA 3EAFA 2V0NA 2VK2A 4MR7B 4Q7EA 3EJWA 3LUGA 5KQMA 4CBVA 1JHZA 1LJLA 2LPMA 3QEKA 2ZAYA 4MS1B 2YHAA 2ZWMA 4WWHA 4RZSA 3HM9A 3BBLA 2JB9A 1RXEA 2FN9A 1FFWA 4IGAA 1WETA 3NHMA 3N0XA 4KK3A 3RH0A 3HV2A 1Z15A 2H3HA 2PMCA 3O2SB 4G0QA 1MIHA 4Q6WA 1JWLA 1ZAYA 1XWWA 2WB4A 4RKQA 5IUKC 3SG0A 5T3YA 4Z4FA 1U2PA 3JS5A 1JDNA 2LUOA 3MIZA 3NHZA 4E7OA 2E4VA 4OLAA 4KPYA 4RXMA 4DQDA 3LUHA 3QEMB 3O1JC 3OQOA 1D4ZA 5FBKA 1GUDA 3EULA 2IPLA 3QLUC 4JP1A 2WWVD 4W5QA 3M9WA 1OXBB 1D5WA 3Q41A 1MB0A 2WY2D 1HEYA 4EVSA 3MA0A 5HQJA 5BR1A 1PNTA 3NNNA 4YS6A 1C4WA 1FFSA 3T38A 1ZITA 3IDOA 4LE2A 3Q7TA 4LZLA 4WUTA 3BRQA 4N47A 4FB4A 4RDCA 1YK0A 3FDFA 3P9YA 2QV0A 3QX8A 5BRAA 5I4CA 1YS7A 5TE9A 3TD9A 2FMFA 1Z25A 5HSGA 1SRRA 2NUBA 5D2CA 1W9HA 3DZDA 2MYTA 3LUAA 2A9OA 3HUUA 5KC8A 1E6KA 3HDGA 5IBQA 4FE7A 3FFTA 5FWYA 3F6CA 3KSMA 2FMHA 3H5IA 2CWDA 1JFVA 2CHFA 4XARA 2MSKA 1DC8A 3Q9SA 2PAFA 3JVIA 3R0JA 3MMNA 3GT7A 2QR3A 1NXTA 4RK6A 3KCNA 3CRNA 3JPWA 2PE5A 4Z99A 5JNUA 3LKBA 3HJFA 4PYRA 4F06A 4ETNA 1L5ZA 5HKOA 3A0RB 3H5OA 2MYPA 4G0PA 4L85A 4ML3A 1H9CA 1GUBA 4WXEA 2WJAA 2H0AA 3URMA 4DADA 3RVPA 1NTRA 1Z18A 4YRZA 1JF8A 1DC7A 3N53A 3QLUA 4N03A 1IIBA 3EQ2A 3KLOA 4PICA 1TM2A 2L2QA 1M5UA 4MQEA 5PNTA 2VUHB 3FFWA 3LUFA 4RK5A 1T34A 2PUDA 2OENG 2BGGA 4RKRA 3E3MA 1USGA 1D1PA 3RVQA 2KYRA 3GBVA
chains in the Genus database with same CATH superfamily
1J1UA 3N2NA 4G3XA 4MUFA 5C18A 2ZYDA 1OGJA 4UQLA 1OLOA 2FMUA 3DQQA 3K9NA 1T6XA 1J0CA 4QYIB 3RQIA 3T7AA 2E4YA 3WGHA 2AL7A 2WIDA 1S4MA 4IDDA 3TD2A 3OX3A 4R1SA 2VTBB 2W43A 4MVJG 1G0OA 2YCBA 1GN9A 4QOHA 3IP6A 1I6LA 1CVRA 2I2BA 3BB3A 1OBHA 5T6BA 3TAXA 3TM5A 4KK4A 3W6PA 5JCZA 1X92A 1TFUA 3BJIC 3COZA 1I4EB 2VZ9A 1BMFD 1T5BA 1XP8A 1YOBA 4LXUA 3OD5A 1L7RA 2M6RA 5L3SA 3PL5A 4Q47A 3AVTA 1RM4A 4KQ2A 1ZICA 1YZGA 3BQNB 1M1NB 2HPVA 1E2KA 3HLKA 3KBOA 4KDFA 4NECA 4A1OA 4BFZA 1NMYA 3SSAA 1T9HA 3AY7A 2L82A 3CIFA 4I1UA 4DJDC 5FHRA 5JWHA 5AW2A 3QWAA 4XM1A 4YCCA 5TPZA 4TXMA 3ZH2A 4CL3A 3HDHA 1CJCA 3IBSA 1QIMA 4GPTA 4PXAA 4H1VA 4UC0A 5HZKA 4YJHA 3RG8A 5DASA 1B6SA 4YP7A 3WV4A 4B47A 3KZKA 4DC1A 3NBKA 3P32A 1KU6A 2WJZB 4C4TA 2I78A 1K6IA 3SYTA 1RKXA 4IMPA 2PKCA 1I2BA 1KXZA 3BYZA 1KQ3A 5D84A 2IOYA 4D8TA 4K40A 4EHLA 3PGKA 3MGAA 3OFSA 3ZU3A 1U9CA 1WULS 2R1TA 3ZE8A 1YQXA 2AQ8A 2BR4A 4IX9A 4I46A 4MGZR 4NENA 4X84A 5CH3A 1VDZA 3CBGA 4PYKA 3PUJA 3QUCA 4RY8A 4U5QA 1OTYA 5E9JA 2O23A 5AI9A 4EWLA 3NH9A 2R1VA 3GJ7A 5P21A 5AD1A 1A96A 1YR1A 5LYJA 2P6MA 2D7JA 2JL1A 3W2GA 3LE8A 4YMTA 1JL3A 1GAWA 1ZLXA 3CF4A 4F3CA 3QVGB 1PLJA 2QW8A 1XMVA 1CS0A 3BTOA 1VA5A 5CX1B 1MQ8B 3HJGA 2CWWA 1TI7A 3EDOA 4IX1A 4ETIA 1GPH1 3EGEA 2BPOA 3T4UA 3SNHA 4KBYA 4R2XA 1P2TA 3E4DA 4KZPA 4XEHA 4YRMA 1G64A 1QV7A 1QS0A 2IDMA 2VDPB 4G25A 5IT5A 4MLDA 3LCRA 4LYGA 2EIHA 3QKWA 2V97A 3DVSX 2P8JA 4IDEA 2JDIA 1KYQA 1U2QA 4DBVO 1LC0A 2XZPA 5KTRA 3NNSA 2CC2A 4B6FA 2WQZA 2EF1A 2F62A 2P2GA 4ZCRA 4NYMR 1RLMA 3GT4A 1CUDA 3L1KA 4YFYA 2D2FA 4QYWA 4CMIB 1ZVJA 2V9CA 5ER9A 4QELA 4WERA 1JQDA 1A27A 4KREA 1ENYA 3PQ5A 1FTSA 2IVFA 3DBHB 3VJMA 3SDSA 1AXEA 3LT0A 1NSFA 3DGFC 4L5CA 2IYLD 1QF7A 2D0IA 3KDPA 1CCWA 4LZZA 3TZQA 4GWLA 1GSHA 4RF4A 1AE1A 3PKZA 1VOTA 5EIWA 5FWXA 3OMLA 1U31A 1S01A 2HF9A 2HBZA 2PAAA 4JBWA 4YV2A 3U61B 2JHFA 1HEIA 4AZSA 2IUEA 4AJNA 1QU3A 3EW9A 3IQIX 1NF2A 4E09A 3RADC 3HCRA 1TIKA 2EWMA 3GDHA 5DMXA 1QM5A 1SJ9A 3ZIAA 4JUIA 4MEBA 5GWXA 1PEYA 1J7KA 2HA7A 1I0ZA 4FLFA 1BN6A 4H0FA 3MLBA 4B7XA 5HRCA 3V1KA 1UANA 3FWZA 3G59A 1KJZA 1YR6A 2GHQA 1JDBB 1W1IA 3CNBA 2YJZA 3L49A 1L7MA 4AKIA 3M6WA 1YSCA 3FUWA 3UHPA 1TO1E 2EV9A 1DIRA 4F92B 3I9V1 2Z2YA 4MVJM 5D5PA 1C8KA 5H02A 1FZTA 1H65A 3HXKA 4LNAA 1UQUA 1K2VN 3K9QO 4TKUA 1TGVA 2B30A 2P8SA 1P31A 1XXLA 1QWOA 2AR9A 5G4KB 5CA0B 5H8WA 1U0TA 3E8XA 1QF9A 3CO0S 3LH5A 4HEA6 2BC9A 1P7YA 3V8BA 3QJ5A 2CDCA 3BDIA 3H2KA 4B34A 1BHO1 1PEDA 3VU9A 1L5NA 3TQSA 4Q02A 3CKYA 1JHMA 2GJAA 2X5XA 4G5FA 1BN7A 1EXNA 3RFTA 4EDFA 3C16C 4FI3F 1RMYA 2PCJA 3H0CA 2HZ7A 4WZAA 3GPBA 2BMEA 4QPNA 3W3ZB 1LPSA 4ADSG 4KHPB 1NY5A 2AK2A 2J32A 1UBNA 1T9KA 5FXMA 1C0KA 4DSOA 3MCZA 4IJMA 4R69A 4EFMA 2AJLI 3IKLA 3O75A 2GZDA 2PL9A 2KB0A 1R00A 4L7QA 2P40A 3C43A 3C3AA 4Q16A 2PGAA 3CSUA 4W7HA 3FTFA 4YDSA 5G41A 1U28A 5J43A 2OKGA 4MGKR 3ZDDA 4QC2A 1W5EA 2G9VA 3H05A 4I3HA 1CIVA 3BFXA 3NEYA 2JC3A 3QF7A 2B1JA 4EUHA 1GA4A 4XVQA 221PA 2ESRA 2PIAA 4FCTA 1W44A 4PBRA 4YGXB 2YL2A 5AVWA 1JQJC 1TEHA 3A4IA 5BXYA 4H35A 1T8YA 1UR5A 4DR1B 2F3SA 2R6R1 1RJ9A 4ZYTA 1LX7A 1OY1A 2QAJA 2G8LA 4ESVA 4AJIA 2J3KA 3TWOA 4DEYA 3C74A 4HG2A 5C37A 5IWAB 1RXVA 2FV8A 3TLEA 2C00A 5GIOE 1CRLA 2XJ4A 4FEAA 4NKRA 1DJMA 2HJSA 1SD5A 1FFCA 4AI6A 2GM9A 3PG5A 1CR6A 1NXPA 1VG1A 1OGYA 3W2TA 4EA7A 1FK8A 2EYUA 2ZBFA 4KU4A 4LVCA 1RYMA 1FMJA 3BA6A 2I29A 3KAQA 4GP9A 3CX8A 2COKA 2V9ZA 3LYHA 5EINA 3E9CA 1OXVA 4FHDA 5BQ5A 4DIUA 4D99A 3UXHA 1NE2A 4IIJA 4K9OA 2Y05A 5CRIA 1O6CA 1R5BA 1VSBA 4X8HA 4XCVA 4JCCA 2IEGA 3PXBA 5DX0A 5JY1A 2RAPA 5D1NA 3A26A 1EP3B 521PA 3FUUA 3KKMA 2DETA 2LP4Y 3WAGA 3G2IA 4XYMA 4YP5A 1PBNA 3NS7A 1ESNA 2WTAA 5FNZA 3TNLA 1JIKA 4ZVPA 4WT7A 4ZICA 4OA8A 3TQHA 5A7FA 2RGNC 2OCLA 2KJQA 1TVMA 2MSEB 2X6TA 3GFOA 3WGZA 3BORA 2QE7D 1RKUA 2AX3A 2JFOA 4Y1GA 1F2UA 4CWAA 2GO1A 2IOFK 4YRTA 4UHFA 4YCJA 4F6RB 4D6YA 1GZ4A 1XPRA 4HWGA 5JALA 3AONB 3RLIA 4L9AA 3FJOA 1E5VA 1M5RA 1MJHA 4OBBA 3BK7A 1UK6A 2HJWA 9ABPA 3CLHA 4ZO4A 3I8SA 1DRVA 1EVZA 2GCOA 1RYHA 4HGQA 4RA9B 2HC9A 4MGYR 4PRZA 4EKNB 2VP3A 3NEPX 4ZOAA 5DGDA 1UC5B 1GRNA 4YC7A 4QU8A 2A9RA 5BSHA 3REFA 3AEKA 1GG8A 4EMSA 2QN7A 1DUIA 1NASA 1WCYA 3GJ3A 1X39A 2E9SA 2EFEB 3T3EA 1GY8A 4JYPA 1EFRA 2FQQA 1FYVA 3EG9A 4N3AA 4QBFA 1SU4A 1N78A 2ZWVA 4TT8A 4HAYA 2V03A 4BVKA 1L8AA 4X20A 4BX8A 5HF6A 1JEOA 3PC8C 4IDOA 2QPAA 1MAHA 1O6BA 1ZN7A 1ZM2A 2J45A 1M7HA 3E58A 3N3AC 4QOSA 6AT1A 1X1RA 2BJVA 2OHJA 1L5FA 4KG7A 4D5GA 1V41E 2BFNA 4UTNA 3C4QA 4C43A 4W82A 4BTLA 1MXHA 1E2PA 1N75A 1JI3A 4AJEA 1E1NA 4RL4A 3ZDYB 4BBAA 3VNAA 4JXZA 1KIAA 3SFTA 1BQEA 1T1GA 3R9XB 2QJOA 1K66A 4Z4QA 2HU8A 4EELA 4U3JA 2IHZA 1LDEA 1QAMA 2P2LA 4DV7B 2RGNA 1KPIA 3TE7A 2VPYA 1J99A 1UPCA 3DZBA 1X74A 3FBGA 2G1JA 2YYYA 3E81A 3NJRA 5CCEA 5KO2A 1S2DA 4J0KA 1Q1BA 1UT8A 2W2NA 2F2TA 1J0BA 4PCLA 5JDIC 1VGVA 1XSEA 3AR8A 4PAOA 1HT3A 5K05A 1OUMA 4DJTA 5KB3A 4G0WA 2Q45A 4JUCA 1UP6A 1HDGO 1G66A 3E9DA 2W37A 4ON9A 3WNDA 5BP7A 1COWA 1M67A 2HHHB 2V3CC 4LPKA 2OHFA 3H1GA 3O91A 1Q0ZA 2A88A 4HDKA 3HN2A 4RV4A 4DRYA 1N5LA 5ELLA 3A1NA 3FZGA 4FGKA 3SLRA 4DR5B 4JK3A 3U9LA 4M7OA 4KQ9A 4OTZA 4UNNA 2P6UA 4LPSA 4OATA 3W1VA 5FWYB 3A05A 1J06A 3GP8A 4S1VA 1ZISA 2QD2A 3AM5A 1Z29A 3OZGA 4RUKA 2FQ1A 2E1RA 2XQKA 4JBNA 2HMSA 4DQVA 3PC8A 5DV9A 1Q15A 1WCXA 2QL5A 2VJMA 3HE3A 5E9QA 5EC8A 3ZK7A 4HDNA 1DKQA 4XSGA 3ZN2A 3T94A 3QF4A 4GF5A 1CDOA 1LDMA 1B23P 1W5FA 5ALTA 1E89A 1NP7A 3E9NA 2FSPA 3FHLA 3BMNB 1IXYA 1VL5A 3C4JA 4NY1A 2DRIA 2Z2IA 4OMFG 5CA1F 1OV6A 4MVJA 4FSHA 1YZLA 3NAGA 1KZGB 1U0GA 2J33A 1QMGA 1AF7A 1JIQA 2WSIA 3OEWA 1E3SA 1BO6A 2D54A 4FNAA 3L5KA 3RS9A 2NYAA 3VR4H 5EQDA 2ZB3A 3ML1A 4Z5XA 4Q4JA 1T0JB 1YRWA 4G1BA 3UHFA 4AP5A 3LDUA 4WX2B 2AG0A 3GJRA 4ZC8A 1X2EA 3OZEA 4PG6A 3S0JA 3EZFA 3RHFA 4K7JA 1IXSB 4ZRDA 3CY6A 5EEGA 3DQZA 4EH1A 5JDIA 5A0VA 1E1DA 1J5XA 2P91A 1TM1E 2F90A 2G77B 4M8IA 1IIRA 5KHAA 3KQHA 5CJ2A 4F0JA 3SQWA 4CW7A 5FO1A 2IZ5A 1SURA 2OXCA 2W2VA 3I9NA 4E94A 1T10A 1J8QA 3ABSB 2RSLA 2ATVA 4GPEA 4PXSA 2KBFA 3IULA 5ICMA 1NU6A 2ODWA 3IQHX 1KKUA 3U09A 3BD8A 3D3KA 3AW8A 3LDFA 2BUCA 4DM7A 3OE1A 1RAEA 1NNUA 4UM8B 3AMVA 3MTAA 3FNGA 3H0EA 2R7KA 3LHFA 4GVLA 3S5JA 3SXPA 1SR8A 4PWYA 3I9V6 5F52A 3ZHBA 4AVYA 1Q17A 1T5TA 4G9GA 3W4JA 2X4DA 4UEKA 1MIHA 1XZGA 2NO7A 2WICA 3VR3A 3IDZA 4M0DA 3WK4A 2XGJA 2PPLA 4IDFA 4L15A 3RGGA 3TVDA 4BO5A 3U9SA 4I08A 3CF2A 1VLVA 4YJFA 2IBMA 1CXZA 1CYDA 3GVCA 4RXMA 5EIFA 4KPYA 1ISJA 2XCUA 3HMQA 3I9FA 3ORRA 5EAIA 2IYOA 5A02A 5K01A 3O6VA 4ZVNA 5FBKA 4C5BA 1SXJD 3JALB 5LQAA 5KVAA 2QTNA 4OCZA 4QGBA 1HRDA 1SHUX 1VYTA 1V48A 4E6PA 4UXHA 4BXOB 4IDGA 4BJ6A 1MB0A 1XD8A 1XN1A 2G67A 3P1JA 3KTFA 1PNTA 3BTUA 4RORA 1C4WA 1P61B 4YS6A 2UUOA 4RJJA 1ADFA 3IVMA 3EPLA 1Y3AA 1EKXA 1VHJA 1X19A 2XDWA 2RFLA 3EZ9A 2Q5LA 1DBRA 3JZIA 3G2MA 4HPXB 4BQNA 1NOJA 1ZQ1A 2G07A 3W5AA 3H5AA 1BEEA 3UG7A 2OMEA 4S1PA 1D2RA 3TD9A 1H94A 1EVIA 3BULA 1CD5A 1DWOA 1JFFA 2BKUA 1OLSA 2HY7A 4AKHA 1ZP6A 2WF7A 4CMKA 3R3WA 1W5AA 2ZIWB 3C3XA 5BWMA 1ELOA 2AEMA 4EG7A 3FFTA 3HBLA 3AUXA 1TFRA 3AERB 4Q4HA 2NNLD 1K8ZB 1VP3A 4O2AB 1SVSA 3Q10A 3B6IA 3JQ7A 5G1OA 2QRHA 2Z5FA 4QVIA 1TNDA 5A4DA 2MR6A 2NSLA 2PYDA 3AT1A 4JUFA 1NNEA 2W6IA 5K03A 5GM2A 4ZQIA 1KEEA 4J0IA 2D0PB 2QG4A 1NI5A 3DBRA 1B0ZA 1PNVA 3ORFA 4XZ3A 5CPBA 1EMDA 5EG5A 3HJFA 2EFDB 1U9JA 2R85A 1HLDA 2H18A 3A3OA 3FW1A 4PYRA 3S27A 4ZTUB 1MG0A 1GNPA 2ES4A 1SOWA 2V96A 4Y2XA 3U4QA 3OUZA 2BF4A 2DPYA 3QVMA 1C0PA 1YBMA 4R8VA 4P31A 4WLOA 3UMRA 1EXDA 2I71A 3ZNNA 2DVMA 5ALHA 1C4KA 1KJYA 4S1WA 1BVUA 1F20A 1SXJB 3ZV7A 1ZOPA 1NOIA 4YQZA 1OAOC 1XBTA 1QYIA 3QENA 4K0RA 4YPFA 4G5XA 3C6XA 4RZXA 3CEAA 2MINB 1Z3IX 1FTNA 3IODA 4QRDA 1Y4UA 2DLNA 4R0VA 4RFSB 1S3FA 4J8PA 3T9EA 4AMVA 4F2WA 1KFKB 1SWVA 2YMPA 2VP5A 3LY5A 1SHTX 4XVRA 1F60A 1R6UA 3I6IA 1NXOA 5JZBA 1KYZA 4RHUA 2H9IA 3O5AA 3QFRA 1SO8A 3QGMA 4GAEA 4QQRA 2J46A 1KARA 2ZT5A 3OZSA 5B5SA 5CFRA 3RYCB 3G0BA 4EI9A 1G20E 2I3DA 3BH7A 2W6JA 2VLBA 3CKLA 4PE5B 4KLAA 2IEZA 3TTYA 3U81A 4CQMA 5A9SB 3JQBC 4PX9A 1B8PA 4KKXB 1QPBA 2WTEA 4GKJB 4MROA 1R7RA 1VKNA 1AGYA 2AMFA 4DBLE 1R0RE 3JXEA 3BMOA 2HMTA 3LVFO 3IDFA 1JAXA 3GG9A 3PR3A 4LNHA 2RB4A 4HQFA 4Q9LA 4XDYA 4EMUA 2NG1A 1GDTA 5K45A 4LTDA 3RM3A 1T25A 1UJCA 1KIFA 3FWPA 1MEJA 1X80A 5FTNA 3HLTA 4UFPA 4RM3A 2C3PA 3W1EA 4DUGA 1P2FA 4RA6A 1ULHA 1ESEA 3CJQA 4MCAA 2GS9A 3W7BA 1MFZA 2HWUA 5FUMA 3ANXA 2K5UA 3X1YA 4ARSA 2GI4A 2CW5A 1GPMA 4HGZA 3ZWVA 4MQLA 1SQSA 2PKQO 4ZJPA 1CNEA 3OURA 2A0WA 1AKUA 2BI8A 3BWDD 3KTAA 4HBGA 1UC8A 4FHZA 3O8OB 5K3BA 2QLFA 2Z1DA 1SUSA 4AWXA 4LHWA 1Q1GA 1Q5PA 1LFAA 4R8LA 3OF3A 2AI1A 1OAOA 2VYND 5CYFA 3WBKA 3PNQA 2FXIA 4DLVA 1WW3A 1Y98A 1YRLA 3GOQA 3LUPA 4WD3A 4UEOA 3KVNA 3NR2A 3BXPA 1DXYA 4EF6A 4IKOA 2XADA 4NZYA 4XWAA 3UK1A 4PIVA 3ZE7A 5EWJB 3JD3A 5L4LA 3EZ7A 5KMGA 3VH4A 3JQRA 4CN9A 3D9QX 3DKVA 1TD9A 3FYUB 3BRSA 3EDRA 1G1AA 1C9NA 1HSOA 3R5HA 4AN4A 1E62A 3EVDA 3TF5A 1L4UA 2XHZA 3F6YA 4M21A 1DKLA 3TLBA 3MBOA 4PAGA 2O8BB 2VQFB 3HDJA 4IIYA 3AL0C 4CEHB 1BFUA 1KOGA 3NWJA 3C3DA 5KNBH 2D00A 3W5SA 3B1WA 3WNZA 1R6BX 1HYEA 2GPSA 2EJUA 3OJFA 1V5EA 4RDIA 1GKYA 2F4NA 4JJ8A 2H1CA 2AW3A 2PSEA 5FPKA 3WL6A 2D5LA 5L6MB 3WYDA 2QXTA 3KQTA 4NYIR 2IHBA 3D54D 2QZPA 4RW0A 1NN5A 1YRBA 4P4UA 4Z86A 4LCEA 1QNLA 3UBMA 3AIKA 3HYRA 5KWIA 3ELUA 4J0CA 4HVCA 4N48A 1JG6A 2IY9A 3GFPA 2VWPA 2IU0A 3ZY3A 4AB1A 2MT9A 4QBTA 1E3JA 4U4AA 4BMDA 1A9YA 1V16A 4KE9A 3CXRA 2VYVD 3MWEA 1H6DA 1SVMA 4GE3A 1FYFA 3K94A 4OK3A 3ZWKA 4LZPA 4EYOA 4ARCA 4RXTA 1VMIA 1D2AA 1RFLA 2E5WA 1IY1A 1KBZA 1WXQA 3N2ZB 4DJEC 3BE4A 2VUSA 3QPBA 3GX1A 3NOQA 3DMTC 1SHJA 3PE6A 4IQ0A 4O4LB 3STXA 4ZREA 3KL2A 5I7UA 2VSXA 5FUXA 2TMKA 2YXBA 1TEZA 1J90A 2X4IA 1F3LA 1G6OA 1JDSA 1RRMA 2FSUA 1NUSA 3HB5X 4WNAA 3GJ8A 1CFJA 5GJWC 1QVWA 3OCJA 3P0IA 1NXSA 1VKZA 2GR9A 4LHSA 3IR5A 4RQTA 4K86A 4ZOLF 4BUCA 1IPEA 5I7FA 2M98A 3TE6A 4CHGA 4ES6A 2IYNA 1DIHA 1JLMA 3VPDA 5DTRA 3U19A 4C08A 2X6RA 3VR6D 3DAYA 2VDUE 3W9UA 3X2EA 1Z2PX 3MPOA 3VC2A 1IJFA 3GUCA 4IUBS 4J3JA 1P5HA 1E2QA 4INOA 4U7FA 5JCPA 1NVAA 1U3CA 2QTGA 4OQLA 4FSDA 2Z2KA 4UARA 3DBLA 1FFGA 5FRDA 3PQCA 2A58A 2FR1A 4BAZA 3BIWA 4MA4A 1YBAA 4X8MA 4HD8A 1EFTA 1JGTA 1L1EA 2H2WA 4G2NA 1UZAA 4R8RA 2XRYA 4KQEA 2YXEA 5AI6A 4UCWA 4U6QA 5ELMA 3R7WA 3ZI7A 1MA0A 1QV6A 3N6XA 1P2BA 1EAYA 1W4CA 1KMHA 2HCBA 2W58A 2ZVDA 1GRRA 4MW1A 3UWDA 2R6CA 4QYMA 3LF2A 4BQPA 4DGSA 4DQKA 1M6EX 3MD9A 3ZWCA 4FBGA 1N9KA 1QVRA 2JFGA 1AUOA 4IIUA 3UPDA 4L9WA 4W4TA 5A2QA 2A0YA 4IMJB 2I1LA 2W90A 4WASA 4LJRA 2ZRHA 2WM3A 5L95A 3FOBA 3G0CA 3T5AA 4KI0A 4NP6A 4CT0A 3L01A 2GPJA 4EGSA 4CKXA 1XB2A 2CK3A 4I50F 3HXOA 1KI7A 3X0DA 1L5KA 1E64A 5M3BA 1IN5A 4X93A 4BFCA 2BR3A 2EWVA 2J07A 3EXG1 5AJZA 2REBA 3BB4A 3F97A 2L42A 3T4EA 1GAQA 2QD5A 4M37A 2HMYB 3DV0B 4W5TA 3OM1A 2UYGA 3KR9A 1ZJ5A 1KI2A 3T3DA 3FMOB 4JNKA 3G5LA 1G3UA 1VDMA 4LHXA 3HJTA 3DW1X 2IS6A 1VL8A 2FY8A 2CHUA 3DXZA 2QSJA 1NIJA 4PFSA 2H5IA 2R47A 3I76A 3IKMB 4MA0A 5LXTA 1L9XA 3K1ZA 1C1DA 4FTWA 2WU4A 4I1PA 1NXVA 3FMPB 1TQ6A 3H99A 2H16A 1OYOA 4A0SA 3TXAA 2QDXA 2JIQA 5AVRA 1P7ZA 4EQZA 2UUPA 1HOXA 2H2FA 2N42A 2W6OA 1JHAA 2IV3A 2JD1A 1F8GA 4OQDA 3D4IA 4O4HA 1XDZA 1SIUA 2QX9A 4W9MC 3DDNA 4TWAA 2JFYA 3JQPA 1QRDA 1TUEA 3I0MA 5B6PA 5LQSA 1MABA 3O7MA 4ZVRA 5EWMB 1I5OA 4II3A 4MW6A 4NJEA 3GFBA 1NV8A 1N2XA 4YFVA 5TJ9A 2ZSEA 2RG1A 1Z28A 1QFZA 2O7QA 1YDWA 2OHHA 2OLJA 2ZPUA 3OFND 5BUZA 1J8MF 2ZUCA 3DFFA 3FKSA 3REGA 4IV8A 1DMRA 2X77A 4W9RA 4XUCA 4CT4B 2L19A 2EZUA 3K15A 1M8KA 1QO0A 2KW5A 4U6SA 4UVIA 4DOMA 3C7AA 4C6TA 3QFSA 3ZHUA 2XLCA 1EYZA 2P27A 2D74A 4GX5A 3GY0A 4AY4A 1L7AA 1R5JA 2WNSA 2NO4A 3C8DA 1JLHA 1EUDB 2GPYA 4DNXA 3PGMA 4E32A 5JH7B 4N0DA 5KSWB 5A3RA 1PI3A 1RVV1 4JLPA 2H9YA 2V54A 1KK1A 2FTKE 1YFJA 1EWVA 3PITA 4YRDA 5H80A 1C3XA 4YCBA 3DLAA 1BJTA 3RAGA 1BXGB 2VSQA 3PKJA 4PVCA 3RVLA 1CQPA 2C2ZA 2VKTA 2WEKA 3HBNA 1E7QA 1GKIA 2BZSA 4DDMA 2OVFA 3MJSA 1WS6A 1NI3A 3CFYA 5THXA 4A0FA 4OI2A 1WOMA 5H0IA 1RBQA 2CHQA 1G7SA 3ZJ4A 2GBFA 3RANA 1T3LA 5DTMA 5IABA 2AUMA 1LPBB 2BCEA 4RULA 2EC5A 2PS9A 4ZAZA 4PGMA 2ENUA 5FULA 3FVRA 4CEIA 5GY7A 3IJRA 1YS9A 3IUBA 1FMLA 4RK4A 1CF9A 1P4SA 4WKBA 5CCBA 3BRCA 2H4XA 1UF9A 4TPKA 3OEHD 3ZCPA 1X42A 4PSKA 2X2OA 3IIJA 3ZXUB 2OAQ1 3NC0C 3LCVB 4BKQA 3QX3A 3VO2A 4R2KA 2C9CA 3CU5A 1WEKA 4EB3A 4URXR 3F90A 2QMYA 1K5HA 3NHYA 1TU0A 2YKGA 4D0LB 2QIPA 4TRMA 1OLXA 3JQAA 1ETUA 3G2JA 2OV4A 3WICA 3DE0X 1MW9X 1PDOA 4J4TA 1I33A 2XW6A 3I42A 4DN6A 2O2CA 4H4EA 4YX9A 1GZVA 4KLZA 4Y7CA 2O2GA 2IYUA 2Q07A 5JO0A 1ND6A 2B6NA 4GDFA 5YASA 2WUGA 4UNSA 2D59A 1DKNA 2IEBA 1Y89A 4RSHA 1Y3HA 3AV0B 1WHSB 2WJJA 4YLEA 4CLOB 4D6XA 1V8FA 4ZI2A 5BR4A 1OHHD 1GAJA 4QUAA 5K4GA 1HMYA 1X86B 3MINB 4MPRA 1C9MA 4RQBA 1E1LA 2WU0A 1DS6A 2GZRA 1PYGA 3DE7X 4H1UA 4PYNA 4ENQA 1H2YA 1DBVO 1OXSC 5T4HA 3SQDA 3IUMA 4L16A 3FTDA 4GOMD 4TV8A 4HYTA 5F21A 3TOXA 3RYFB 3QKUA 5TQJA 1Z5OA 4HB3A 4KRYA 4DV2B 2QBYB 4UHHA 5FBRB 4RGYA 1JDVA 3LC0A 5HUHA 3DHVA 3ZD8A 4RDXA 1YC5A 3E4CA 4A3SA 5C53B 2HWXA 1EUCA 2L17A 3C2QA 1F51E 5D8DA 1H2ZA 3KHTA 1JA9A 2WVHA 4MCHA 4LOLA 2AYZA 4MVJI 4CV0A 3AP2A 5DO9A 2HIHA 5DJ5A 1I0IA 5AKLA 4L78A 3T95A 4CTMA 4NG4A 4MWTA 1A5AB 2V65A 2DUNA 4RZ3A 1ZUWA 2XUKA 3GEEA 3LOQA 3NWPA 2AS0A 2BBOA 5E1MA 2JJ8A 2OO7A 2B1IA 1T6NA 1L1QA 4M60A 2YWBA 4C4YA 3U7IA 3ER8A 2GD6A 1A2QA 5JSHA 4OHVA 2OUIA 3WRVA 3KKLA 2R62A 5F4ZA 4XSVA 3T6KA 4CIBA 3QVOA 3MCAA 1UT6A 3OOSA 4P3PA 2JJQA 3QM1A 3OCZA 4P5EA 4U2DA 4TLDA 4G8CA 3UAZA 4XVUA 1B8NA 4RD2A 2G36A 2ORWA 1FVXA 1T2FA 1T0HB 2A9VA 3ES9A 3H42B 3WV5A 3QH4A 3T7DA 1FRQA 1LBHA 2AQKA 1L8XA 2ZDHA 4FGLA 4D9KA 2I7CA 1Z45A 4K3UA 4TWZA 3DEYX 3NOOA 2PG3A 1TT5A 2NXNA 3A4YA 3JVUA 3TLGA 4WBNF 1U7HA 2ZTLA 1JH9A 4A2PA 2VA9A 3VZSA 4WOBA 3L02A 4D4MA 4JLBA 1BS9A 3E1KA 3EAQA 5HZGA 3QVXA 4IH9A 5FTJA 1M0EA 1LZLA 3AFGA 3PTAA 5LL6P 1E9AA 4MV9A 2I9KA 2R7MA 3SSNA 3WBBA 1QRSA 1UPFA 3AL3A 3HBFA 1TEVA 1S5PA 3D3NA 4QJBA 1ONOA 2BH9A 2XYQA 3C6MA 3ER6A 3QEKA 3T15A 3UWSA 3VPHA 2ZYSA 3T5TA 5B64A 4AY2A 4D8VA 2D6FA 4X97A 2E6UX 5MHTA 3G8AA 5CURA 3MMZA 5BMVB 1X7YB 2AOVA 2PGLA 4JLWA 2Y76A 4URFA 3RARA 2C2GA 3T41A 3LQFA 3RGWS 5KTKA 2B3TA 5CM2Z 4C6HA 4YAIA 1RIFA 2VDWA 4A0GA 1JEEA 3R6DA 3HV2A 1Z15A 2H3HA 2PUHA 4UU8A 3RTCA 4A73A 4HFRA 4C4PA 4CF5A 2WM2A 5I7VA 4OV6B 1CIJA 2QL7A 1PLKA 4Z4FA 4IOJA 3KYBA 1QYWA 5AQEA 3JD1A 3CUKA 2XGSA 4QTXA 3QYPA 3LUHA 4ZGGA 4DANA 2C7GA 4L0CA 1G291 1E96A 2QL9A 3IHKA 2OZLA 4UTXA 1MGPA 2HHJA 1PW5A 2IPLA 3BIOA 4E03A 1HDCA 1DVRA 1TKRA 4L2IA 4Q0MA 5DCWA 3SIRA 3Q41A 4DQ0A 3HHPA 3PDUA 1K3TA 4IIXA 2BGTA 3RUEA 3MJ4A 5LBIA 1IUPA 1S02A 2NZXA 5F3RA 1DLJA 2QUJA 5DOVA 4PX2A 3VR4A 4E2YA 1U9IC 1SIOA 4H7KA 1JJIA 2NTNA 4GW3A 1X15A 4J6EA 1XNHA 4NS1A 1YUMA 2EATA 4NBUA 1THMA 4ZI3A 1Y82A 3NT5A 4XM0A 3INGA 5L40A 3THWB 1LF5A 3P8ZA 3Q8WA 1T4BA 3HPRA 2IELA 2P30A 3FCUB 1ULBA 1DX9A 5BVGA 4MHTA 1N2CA 1Y4ZA 3S2GA 3VRHA 3QEAZ 1KFEB 1BVYF 1QJCA 1DJNA 5AW6A 4YGYA 2PA3A 5HKKD 1OBCA 2CCGA 4FE7A 4KQWA 5C9ZA 1TYEB 2H00A 3KVOA 1PJLA 3NTRA 1R16A 4JELA 4JHXA 3MRXA 1JIJA 1J21A 2HL6A 4DA0A 5IK2A 1Z4KA 5KNCD 4PFQA 4O2BB 2XWQA 1AK1A 1EGHA 1JXAA 1PSWA 3NALA 1V1MA 5JYEA 5HVNA 2DKFA 4WFKA 1M0WA 3CRNA 3OY2A 1D6MA 1G6HA 2NTEA 2P7IA 4OHBA 3H2YA 2XUPA 4PYLA 1CUUA 5JD3A 4ASUA 1EJ6A 5BUSA 3B3AA 4L85A 4NNOA 4YYEA 1GUBA 2ICAA 4PAMA 5LD2B 1Z4PX 4NCNA 4A8TA 1H1DA 3TOSA 2G40A 3O4GA 2GQ0A 4JJIA 3HVHA 2XUIA 4D7AA 4P0PB 3M3PA 3BE5A 4FZVA 1QRAA 1AJEA 4IUYA 3DYBA 1R0ZA 3F9RA 2HCRA 2N47A 2B36A 3AC0A 3IMKA 4JOSA 1IBRA 1VJCA 2PZJA 1KNXA 4IPTA 2ODBA 3RIMA 2BGGA 4NV0A 4HK4A 4H08A 5CU7A 1FUUA 1P3Y1 1U9IA 1D1PA 1XQ6A 2AE2A 2WAOA 3HCDA 2KYRA 4FFNA 2V74B 1DUVG 4JXKA 3LUKA 5K6RA 4F7DA 1RBZA 3I73A 3M6UA 1SZPA 3I39X 1KU0A 4F4CA 4C7MA 1CUBA 5AVSA 1ZUNB 2CLHB 3F4BA 2C8KA 5DX1A 4GOOD 2QRLA 3WGTA 1OREA 1FJ2A 1EDDA 3LP5A 3SIPA 3DDSA 1I14A 5JSFA 4S0XA 2PTHA 5NLLA 3GA5A 4C3UA 4F4UA 2VWHA 3SSMA 2F1IA 3LHDA 4J7XA 2W42A 2P4EA 2GB4A 2WHYA 4HZIA 3WLLA 5BR7A 4DWWA 5TS3A 1E2JA 4B9AA 1BSVA 2P9CA 3HDTA 3KNZA 4PO8A 2J0QA 1ND5A 3GLHA 2JKYA 1I1NA 3LXUX 4C21A 4HUQB 5KYUB 5KJEA 1YASA 4KX5A 3UJBA 3RQSA 2R5WA 1IZ0A 1CJTC 4A92A 4FFBB 3VMFA 1Z13A 3JQFA 2MR5A 1UBLS 1H1LB 3CSSA 3OQ6A 3OKCA 4LI0A 3SF8A 3LKDA 4HLQB 1CU1A 4F1KA 1S2GA 3PWTA 1N6NA 4QSHA 4XJXA 3A04A 5IDYA 3THOA 2GAOA 3A6KA 3QI7A 3QZUA 3DE6X 2YVAA 3AU9A 3BHIA 3OMXA 4U8HA 2NXCA 3KETA 2GMWA 4QAQA 3IFSA 2X0FA 1WPQA 1IBCA 2F1JA 1SUCA 4R8KA 1NRWA 3LVRE 1U80A 1CR1A 1QBKC 3OAAA 3H2GA 2V8OA 4XCXA 3DF9A 1HI9A 4UHKA 4F9EA 1ESZA 3PE4A 1CUAA 3JD2A 1ZZGA 3R8CA 5AK6A 1YZUA 3PXAA 3LP6A 1WMEA 2FZKA 2EDAA 1GVHA 2IL1A 2J9FB 3IRUA 3V4OA 5C35A 5EIBC 2G6TA 1Z16A 2ON6A 1LQTA 3LX5A 1RWPA 3ZKWA 5LLTA 1FXUA 1KAEA 3K70C 1AB6A 1DLIA 5TQ2A 3L06A 2I6QA 3TTWA 3QVVA 4U2FA 2QP4A 3B7WA 4WXMA 3B52X 1E32A 2FOLA 3GNTA 3FVVA 5AJWA 1PJ2A 1UPTA 2GZSA 2OBMA 3P4UA 4BKRA 1XFAA 1MV5A 3FSGD 3BWCA 4J6FA 2AQHA 4BGIA 4RSMA 1R6VA 4GLJA 4JVLA 1GZ7A 2IHNA 4YN3A 1ZW1A 3DF7A 2B8WA 1AU9A 2D2IA 1H9AA 2ZUDA 3CTMA 1TJNA 1SBHA 2XGMA 4WESA 3LBYA 4R4JA 2XNDD 3WIUA 3CNHA 1KTVA 3DEFA 2J4CA 2CVFA 3M6MD 4TWJA 2MYNA 5KNDH 1Z6XA 2LV8A 1SCKA 1J9GA 1HZJA 5C31A 2C4KA 5CT5A 3ANYB 3DXXA 1E69A 1TW2A 3JASB 1QQ7A 1R15A 3RASA 5HBRA 3WWDA 7AT1A 4HDOB 3AEQB 2X0NA 4QUGA 4ZYVA 5F64A 1CRWG 1KZ6A 2FRVA 1FX0B 2BTEA 1UFOA 4KQFA 4RPLA 2M1XA 2QSZA 4KFRA 3ZI4A 3RO7A 2GUGA 421PA 1A04A 3ZDAA 2HBQA 2G1KA 2ODTX 1MKYA 1K8QA 1W47A 1JU4A 3G5AA 3JVVA 2P9GA 2ZTHA 4U2EA 4Z9AA 4DFDA 1RE0A 3GW8A 1DUSA 3R3HA 4KE6A 2J0EA 1T9GS 2AN4A 2V7TA 4MQFA 3UUFA 3V55A 1UM8A 4I6JA 3OPQA 4LC0A 3IAFA 4G01B 4EUFA 2FNAA 1FP7A 1DOAA 1CYEA 3LHSA 3KYJB 3QPUA 1P0MA 4Z9XA 5IC5A 3GBPA 1DG9A 1YQQA 5KEIA 5KX5A 1ENOA 1RHKA 1ISMA 1T8RA 4H3HB 2BFCB 1RI5A 4GSKA 2AD1A 4OX9B 2B35A 1X0XA 4UDNA 1QFSA 1E3WA 1AKWA 4WFQA 5BYAA 3IT2A 4JH0A 2FDRA 3S68A 1I1OA 4K9MA 5F73A 5IU6A 2D1SA 2VBIA 3FLEA 3A6LA 2ZYWX 3EXHC 5AKGA 2Q8NA 4I9GA 3VXKA 5DN6D 4H1TA 1XQWA 5SZIA 4BGVA 4BVLA 5JV5A 3DM9B 1NATA 1LLFA 1RZ3A 2ZIZA 3AZQA 4LJ6A 4HV4A 4QM6A 3P0RA 3PFNA 1U3GA 4RVFA 2ZROA 4UFOA 3UG6A 2V6FA 5TDHA 3ZC3A 1K75A 2IQIA 3TEMA 4FFRA 1GT6A 2UVDA 3PL1A 1HG0A 4J9UE 4EVIA 5KVSA 3ZZ0A 1BU8A 1HDIA 3KEGA 4ZYYA 5A6VA 4DM4A 2R66A 5DI3A 5C3MA 5BV2P 2B98A 2GYYA 1A82A 4MRAA 1B42A 1YHNA 4PR3A 2GDZA 3LA6A 2VI5A 3QSGA 5E0KB 1RE1A 1VG8A 1Y3IA 4RKYA 5I8WA 1KMMA 2QTTA 2TMYA 2X9NA 2YMLA 4IDPA 6ABPA 3PGVA 3OLVA 5CW2A 3RVSA 1PR0A 4O4IB 4GC5A 3TB4A 3IV7A 1JKXA 2QQGA 3C6QA 3DZIA 3O4FA 4MKFA 4O5AA 1ZC4A 4KXFB 5E1DA 4CI0B 4E7PA 2AG5A 5LDDC 4DCSA 4GI5A 1ZRMA 3LCMA 4K6FA 4KVGA 4A8JB 4JVOA 3QE2A 5C7YA 1CUYA 4EHFA 1Z17A 4P0TA 2XYVA 3PR2B 1Y42X 1A2KC 1Y5NA 3WAJA 5ENZA 2ZJOA 2TS1A 1IOWA 5EOVA 1T15A 4JEUA 3QPDA 3DC2A 3TXXA 4F3YA 3OP4A 3Q3EA 4URVR 4MWGA 2YMMA 4WZZA 5CB4A 2I2FA 1C3OA 2Z0MA 4E2XA 4JI5B 5JAUA 1ZK4A 1PGPA 1QO7A 1TF7A 3DZKA 2NUPA 3IAXA 1GXSA 2XDYA 2I4OA 3M6VA 1WQ3A 3MILA 1ECBA 2AJCA 3RIEA 2PT6A 4D97A 4LZAA 1D1SA 1ORHA 2HH9A 2ONZA 3AYZB 5GZ3A 2XX3A 3GGJA 6Q21A 1QH1B 3EXHA 2Q28A 3MERA 2QW1A 5IAAA 4J0EA 2YX1A 2BTQA 3DMYA 2AOXA 1E2DA 3RUDA 2PL1A 2FDCA 3OZFA 4UM5A 3UMCA 3L41A 2ZIXB 4KR6A 3ED5A 3UQYS 4ARZB 2FSGA 3RKUA 1O03A 2FFAA 1CDDA 4PHHA 1NUAA 1KSGA 1ZD2P 1WLSA 3G0DA 3I23A 4QUKA 2BKEA 3GXBA 4A23A 3K09C 3PX7A 3KQPA 2C99A 1QHHA 4GKKB 1HDOA 2HNBA 1GG5A 2QM8A 3GZNA 5IAKA 1TAUA 2FYTA 5ICFA 1V5IA 1YXMA 1ZY2A 1T43A 4M7WA 3FNBA 1F0KA 4NDNE 1EBUA 3D02A 3H2JA 5TARA 2JJ1A 1P2VA 5DBOA 1P1JA 1SHKA 3PUWA 3K0AB 1PFUA 1PT5A 1ZU4A 3QXXA 1E9VA 3QIVA 5EIXA 4IIHA 3RVNA 3QELA 4MIYA 2QP3A 3ZGOA 5JNWA 2HF2A 3DO8A 4J3NA 2OQ2A 3OT1B 3K20A 4I55B 4MJXA 5JVDF 2CFRA 2DULA 2WT4A 3KS9A 3KX2A 3MB8A 1XNRB 4Y2HA 3SAJA 4YTEA 2R2GA 2J0VA 4BVHA 2DQSA 1XVTA 3RC1A 5EZ5A 2GAIA 2FK7A 3ASZA 1JXQA 3A58B 1VHTA 2G76A 3GMTA 3C39A 4IOLA 1D2EA 2G9UA 4KN5A 2Q0SA 2AEFA 4BOYA 2CNBA 2H1VA 3KAJA 3PI6A 5C32A 1PKEA 1Z3CA 1V11B 2H0QA 2RB5A 3A27A 3L7AA 4ZD6A 2ZUFA 1UPAA 2ZUBA 4D46A 2NW6A 1EE1A 1WMSA 5DNAA 3T3IA 1Q1QA 2QLTA 4QT0A 4DDHA 4GM0A 5KOHB 4R9RA 4ZU6X 1GQFA 2YJ3A 3KT8A 5DMHA 2XEXA 4KW7A 2BZ1A 2BZ0A 1RJWA 3MMPA 2AKYA 4EJFA 2C4HA 4P7JA 4U9IS 3UGJA 1XZQA 2HA5A 3SXJA 3UC5A 2ZTMA 2QX4A 3SEAA 2RE8A 5KJFA 2B0CA 1JHRA 1GFIA 1JWAB 1Y9JA 2NO0A 2XRMA 3KYCA 3N58A 4LY9A 4LFCB 4BJ3A 3MMXA 1GA6A 4CLEA 2WJYA 2Q4DA 2RGXA 3HCAA 2GCEA 3LS2A 4HWSA 4OJKA 4RO0A 2HU2A 4E5MA 4EJSB 2YHBA 3DKPA 3HP4A 4L3OA 4UAJA 4FHEA 2AGVA 2LE0A 4XWKA 2LDBA 4RAQA 2XWSA 3FYDA 5C1BA 3KTOA 2Q5HA 2CSXA 1V6SA 4NPCA 3OQBA 3OTQA 4UNRA 1YD7A 5FUBA 2ZSKA 4MZXA 2LW7A 3SOPA 2HPZA 3QW4B 5TF0A 3LBNA 4D5EA 3K5WA 3ROGA 2EKQA 4G2TA 3F73A 4MI3A 4ZI5A 3AR7A 5TC4A 4RSRA 5L53A 3CZ4A 3EH2A 4AMBA 2XIQA 2WHPB 3H87A 4TT3D 3U3JA 1BMQA 3C5WP 1I8TA 3E7FA 5L7YA 3OQJA 2NAFA 5HFNA 3PQFA 5H70A 4MEAA 3KKOA 3EJ6A 3VSDA 3VYSB 3ASUA 2VHTA 5FBVB 1ODLA 1G42A 3EAGA 1SU7A 4Q00A 3D6UA 4L5AA 2EF0A 4M8NE 2EZ4A 4BQSA 3K6SA 4G65A 3HCFA 3THXB 1T4DA 3S6JA 1V4VA 4UUPA 1GFWA 3KUCA 2F59A 3QNUA 1E7MA 2RG7A 4X1IB 2ONCA 3AKEA 4WY8A 2QY6A 1HE5A 2WJGA 4I66A 4O4LF 5H5JA 3S8MA 1IQUA 2R9VA 1BDHA 2DECA 1CETA 5JSZA 2XBLA 2A4MA 1XEAA 1G6Q1 1NBMD 1SUIA 4X66B 2O8EB 4OPMA 1T2CA 4NCJA 1V95A 2XA2A 3NHBA 2RAFA 3FZQA 1K27A 1ZGAA 1W2HA 2BCJQ 4ZO9A 1V45E 5ITZB 4BWFB 2QJWA 4C0XA 4X45A 3VNRA 5JXHA 1Y8AA 3CRVA 3PWZA 4BQRA 1H5UA 2XBUA 3V1NA 1J33A 1NP3A 5LKRA 1QHEA 3DV2A 2ATCA 1Z0FA 4FHFA 3UAOA 1IN7A 4ACBA 4AJ4A 3LPDA 1UKZA 1P8AA 2G7ZA 3PUIA 1LK7A 1OZAA 2EJTA 1OZFA 2FW1A 4OSPA 1JEYA 4O6VA 1ORWA 3LXMA 4A82A 1RLUA 5EESA 1QCYA 1XXHA 4QPJC 4AD8A 1U0NA 2NIPA 1YDHA 2QTHA 3D7RA 2D2VA 4ZIRB 1RJFA 1W88B 1UQTA 1Z6PA 2EP8A 1YE3A 2NU8A 4Z1MD 3MW8A 2DBZA 3NHSA 3A3NA 3GFFA 4LUCA 2IXEA 5EMNA 3UMJA 1FU7A 2BM1A 2JGIA 1M33A 3IE0A 2P5YA 3PD7A 2XZDA 1CR0A 1KORA 3NTVA 3HY6A 2OPHA 3ZHVA 4MGHA 2NQ2C 3K31A 4W99A 4C06A 4DABA 4WZBB 1RT9A 3IEMA 4C07A 2X9VA 3EGIA 2FEOA 2ZRDA 5HA5A 3GHHA 2I33A 3E7XA 4BYMA 2NPOA 1XK7A 1OMOA 3G8CA 1WMFA 4NH0A 1VJ0A 4AJLA 4XWWA 1AK9A 2A9JA 4M9UA 3E2IA 3D4NA 2NAPA 3NKLA 4HNGA 2H63A 2X4LA 1NQUA 1DAKA 4MK4A 4CPDA 4BMNA 1Y6JA 3CZPA 3PNSA 2YXNA 4CF3A 3BH6A 2ZBRA 4Q3DA 1Y4DE 5F77A 1V8PA 1SK9A 1NQOA 4CLRB 4FVTA 1BCSB 3WIDA 1TYCA 3QLUC 2YWGA 3TTUA 5L7WA 1JZSA 3SWWA 2WTUA 2PA0A 3R9WA 4MVYA 1QIDA 2EQAA 2PZGA 4LZOA 4Q3KA 4JLUA 4YK7A 4D3FA 3GYGA 5F1PA 1CJMA 5EKXA 1XMSA 4Z49A 5JXGA 3ZQ4A 2YVKA 2FEMA 2OCGA 2PN1A 4Y7DA 4RKFA 4DEXA 5FUVA 3L0IB 3RS3A 3QUSA 3AW9A 3DNFA 4ZRMA 5F1YA 1NF8A 2HK9A 4BLTA 4NZNA 4Q05A 5FUQA 3QX8A 4Y2PA 4JNCA 2HA0A 1YS7A 1NLFA 2VYFA 3NHLA 4TRNA 1E7YA 3SHWA 1KVTA 1FDTA 2I4LA 1U1CA 5D2CA 3LQRA 2Z4SA 3QU7A 2X0JA 2B2NA 4B3CA 4YCMA 5KOIA 1SKAA 4EW3A 1BJKA 4FOPA 1XF1A 1A3CA 2YYZA 4NZPA 5C8ZA 3U5TA 4WXHA 2XB4A 2QGZA 4X3OA 4YNBA 3NX4A 1V9LA 5JI2E 4ND5A 3CUVA 3OE7D 1A9QA 1HDZA 2EJVA 3QA3E 4IJKA 4Z7NB 5IZCC 1YTLA 5IAEA 1V96A 1U2ZA 2ECQA 4CG0A 3ERCA 1OWLA 3D2AA 1OFUX 1NXTA 2B25A 1E2MA 1FPQA 3L92A 4DSAA 1GGJA 2BFEB 2W11A 1R66A 1BH6A 4B45A 3WJ1A 2RJ3A 5HRAA 3HKDB 4PQYA 3UIEA 4ETNA 4H0NA 5IH7A 3EGDB 4ZGWA 1N2ZA 3ORYA 4EI7A 1PWXA 4KNVA 3DVAA 1ML3A 4EZEA 2PS1A 2CXHA 2ZZKA 1B16A 2SBTA 3UW3A 1PZGA 1MDFA 5IJXA 3TLJA 3UAGA 3VYUB 3QLUA 4PPGA 4AIRA 5CG2A 4GWKA 1F0NA 2C07A 1YZNA 2R2AA 4YPVA 2Q9BA 1SQGA 4FCCA 4MQEA 3L05A 4JY7A 3RSHA 3FHTA 5F2OA 3ZCUA 1IBMB 5EI5A 1C1XB 1JJVA 3G7SA 2XD9A 1CZNA 1EFVB 2BT4A 1M72A 1H5NA 4MCIA 3UWMA 1O0CA 2VZEA 2J87A 3HVJA 3W2FA 3DE1X 4KIWA 2C5HA 2UZ1B 4OXIA 4ALNA 3GAFA 4RTKA 5A3QA 4FKMA 5JXIA 2H1HA 4MYHA 4DMGA 1AVTA 2DPMA 3HXTA 2MTBA 3CQ9A 4PO9A 2V0GA 1JU3A 2XYRA 5DKFA 1QOZA 4MR7A 4JASB 1ZIYA 1Z37A 1USIA 3DBIA 1H05A 2H1OA 3NZEA 5J40A 1AF4A 1FXWA 5GTDA 1QK3A 4R1MA 5JJ5A 3BJEA 3N39C 2NZVG 2ZCUA 2V7XA 4E51A 1F06A 3KYDA 1N6OA 4AFNA 1TTHA 2DFDA 1VCOA 4EZIA 3AYXB 4IJVA 2CYBA 1VYUA 2HYDA 1OC2A 2F64A 4PRLA 3GLRA 1MO5A 1PWYE 1TQHA 2CN1A 4G1FA 2CHGA 5IZCA 1KSHA 3GFSA 2EBWA 1FW8A 1Q2XA 1EU1A 4GVPA 4WAUA 2C2YA 3DTTA 3EXIA 3I5AA 3OSZA 1OQAA 1PSZA 2WWFA 4NOLA 4D56A 5JANA 2NVBA 2GD2A 4DCUA 1L7EA 1QMPA 3SCZA 1FSPA 4G84A 2X23A 3IDAA 3B1FA 4IR7A 3ZVMA 1Q22A 4BE9A 4UTRA 3LUBA 3B9BA 3MSCA 3U7QB 4LECA 1D6SA 5AVKA 3PQ6A 4TMTA 1DRUA 1DT5A 4J1TA 4DEVA 1JW9B 2V9PA 2YQ5A 4QLOA 4PCUA 1W93A 3BGIA 1KYWA 2QG9A 4O63O 4D4LA 1CSEE 3QUTA 3AK4A 2OXRA 4Y18A 2VNSA 1F4VA 3PXUA 4MHSA 3X1XA 2P62A 3TIIA 4OHKA 3BQ9A 4TS9A 3UKJA 4C78A 2IEAA 4NU6A 2JF0A 1ISRA 4D25A 4MMXB 2WVJA 1BE6A 1UDXA 3QBJA 3QTTA 5AW1A 1T5OA 1YQEA 2A9QA 2O0LA 3HU2A 4TL8A 1SG0A 3MGGA 4ZTBA 4G0VA 1ABEA 1ZCZA 1PD1A 4JT8A 2EFGA 2MSNA 2A33A 4PHFA 3W5UA 3OPMA 4NXMB 1RPJA 2A2ZA 2JVJA 2ECPA 5ECYA 2G0NA 2HIGA 5TMEA 4R68A 2C7RA 4R8MA 3UXEA 4AN1A 1WD5A 2QN1A 5HQTA 1KPHA 5CT8A 3UJHA 2QMUA 2JGLA 3DPIA 5ES3A 1SGWA 4A0HA 1OIWA 5IDQA 4RWZA 2C58A 1NIPA 1B3BA 1N5JA 7MDHA 3ENVA 1ZVMA 2R1TB 2WIFA 4RNDB 3T7KA 1SXHA 4NENB 1QGYA 1GGNA 2F1HA 3EZ6A 1DBQA 4E21A 4KFUA 1Z6TA 3ZGLA 2R1VB 1E9SA 3L8ZA 1CE8A 1KZ7B 1PJAA 3A9TA 4Y67A 4A0QA 2HM7A 5CDUA 3ZWOA 1ZK0A 3K6SB 3K6RA 3Q11A 1CRQA 2X19A 4RC9A 3G2PA 5DCUA 2QRKA 1G7CA 3PWSA 3U4GA 3B13B 2AC4A 3OC6A 3W8NA 2E2WA 4N3GA 1ZOOA 1I2ZA 1SK8A 2HV8A 1QS0B 1Y9AA 3OUTA 3Q5EA 5HILA 1GHTA 2YZGA 5HGXA 1R9NA 4R6XA 2PWAA 5BMVF 1E2FA 1UM9A 3I9LA 4W5HA 3TDNA 1S8AA 3QFFA 2J9YB 5JSUA 4BNXA 3A6ZA 4K6CA 1XCPA 2C9BA 4BVFA 4I4TF 1B76A 3MQ4A 2SKDA 1YDFA 3IOEA 2AE1A 5BORA 1NR5A 3G2NA 2OK7A 1WY7A 4N5IX 1YMVA 3KJXA 5I4IA 3RC8A 2W2KB 4DKJA 1UBCA 3OESA 1YRYE 3T52A 1QVAA 2L18A 2EBHX 1EPUA 2X22A 2VF5X 3N0RA 4LQDA 2ZB8A 3VZCA 1WW2A 1WDWB 3HDQA 3EUAA 1QHGA 5AJUA 4F11A 1HNWB 2OGUA 4YWHA 4DMHA 3PPYA 2AIRA 3TSWA 3FPJA 4QEDA 1TMKA 2CNOA 3D0OA 5IMSA 3U4IA 4V0ME 5FT9A 3WO1A 4DXDA 5FWXB 1CJSA 3H6GA 2W4MA 3CW2A 3E7DA 3SEZA 1Z7WA 5EJ9A 3U13A 2QUIA 2D1QA 2HR1A 2ZVJA 1QV9A 1B8OA 2H7XA 4CGZA 1GGFA 2D2XA 1FL9A 4DLYA 4BFVA 3V3TA 1K7XB 5CDTA 5KNDA 4EG4A 3UCEA 4L8FA 4M9ZA 2R44A 3OQVA 1R4ZA 2XR1A 2JFQA 5B12A 3AQ4A 4DLSA 3L0CA 3WDSA 4XFJA 1FYEA 1NYQA 2VTVA 2XVYA 4FZ3A 1OXKB 5FOSA 3GEDA 2QTZA 1ORIA 1YO6A 3KOUA 3RJZA 2Q62A 4MVWA 4OM7A 4JP2A 4OEHA 2F7SA 2N1BA 3OFJA 4E0BA 2IXDA 1GKKA 2V8BA 1M0TA 3H13A 3S8YA 2AZXA 4TKUB 3ZDCA 3B82A 3TSZA 1NBHA 3IUJA 3LMKA 1UOQA 1AH2A 1MJGA 4O2BF 1N77A 4MWBA 1YONA 4I1YA 1IEVA 4FYIA 3OJOA 1IZYA 5FQNA 3T1OA 1Z2DA 3VU9B 4YMLA 1BROA 1H0KA 4HJXA 1F7UA 1CLEA 5LQJA 1RAAA 5CVCA 4CM3A 1R9MA 1O9HA 1WB9A 2X9GA 3LX4A 3RYIA 1WTCA 3SC6A 3EOAI 3BICA 1JHXA 1J9ZA 4WZAB 4NYJQ 5K7SA 2FSHA 1UOPA 1OFUA 5FI3A 3T9BA 1HQCA 2CXPA 4DRXA 2JBAA 1FRFS 2Q2NA 4HH0A 3W7VA 2TMDA 3ZV4A 5BOSA 3PV0A 1SCIA 5E7IA 2AYYA 4MUIA 2PXXA 3L6DA 2VK8A 4M0PA 3TGLA 3OIWA 3PUYA 1E5TA 4CQJA 1TAGA 3ST7A 2GNOA 5FPPA 4Y2VA 1FUIA 4FUTA 3M3HA 5E7JA 4ESOA 5FBWB 4PNPA 5FR2A 2Q2VA 3ABQB 4RHTA 4G1VA 2F9LA 3VR5A 3N8GA 4TYWA 3R09A 5JRDS 4ENUA 3Q9UA 4W9NA 5K6TA 2P9BA 1CQJA 4MPTA 3JWPA 3P7MA 3VHXA 2A8YA 3C8HA 3M49A 4BEWA 5B7PA 4DHWA 2BFDB 1RJ9B 2KBEA 2QROA 5AM0A 4ZYXA 2UKDA 1MEOA 3ZIDA 3E18A 2AOUB 2QRGA 5TT1A 3ZCTA 1EIWA 3C97A 4JUBA 1SRQA 2ZRAA 4WHMA 1DI0A 4Q34A 5LP1A 2YV3A 4S04A 4LK3A 5B1SA 2G04A 1O9GA 4G1UC 1Z7EA 4E6EA 4IGEA 4NFLA 3T7SA 1U8XX 1C7QA 2RGCA 1CQIB 4MLZA 1H0RA 4HNAB 4QT4A 3WYFA 2G9QA 4KGVA 3O9ZA 1VMEA 5J5CA 5LZ8A 1DCKA 3KXIA 3UY4A 4Z7JA 2O07A 2QUZA 5MN4A 1HBJA 2P1DA 1W25A 2XA1A 3CXUA 3DL2A 2WUDA 3BA1A 3HBMA 4IIJB 3RSLA 3C5VA 1KHHA 4W5WA 2I6FA 4GSYA 1YBHA 2WU8A 5AUQA 4JSRA 4YO7A 1COZA 1T3GA 1O08A 1Q92A 2PH5A 4GXNA 4EW6A 3IP9A 3E22A 3KQKA 1X9HA 1U81A 3M4XA 2UXBB 1MC5A 1Y1QA 3LQKA 2OQVA 3VV3A 4FW9A 4BPRA 4CKCB 1A9RA 3SP1A 5A3JA 4I5FA 5HFJA 3B89A 1F2UB 5F35A 3CR8A 2IWHA 1SCAA 1BWRA 1ZL0A 1PZHA 2N9UA 5EZYF 2J9XB 1GITA 1COWD 1SBCA 4FFOA 2HJ9A 1J97A 2HFKA 3EVTA 3TR6A 3K0CC 2P4UA 1Z4MA 2A5FA 3VPSA 2FPGA 1I9GA 4G89A 4GLOA 1OXMA 2HQRA 4LNUA 5E6UA 3CX6A 4ARVA 1T4CA 1Y7PA 3GDWA 4BO3A 4BNUA 1ADBA 1DTWA 5H82A 2HLDA 4EPVA 1FS5A 3C8UA 4A03A 4S1TA 1KOFA 1Z07A 2WMOB 3AEKB 3BMQA 1P2DA 2OV3A 2WYVA 2XB2A 3JY6A 2O54A 3IXQA 1E61A 1JQKA 3D6JA 3D6NB 3ZPXA 3MNFA 2GJKA 3EG9B 3Q7EA 3SKXA 4X8OA 3S2SA 4BP1A 3FNHA 1ADGA 2A9PA 3F74A 3FAZA 2FUKA 3OO0A 4I2NA 4X20B 3DL7A 4AS3A 4OHFA 1G21E 1I2DA 1NKTA 4YMGA 3EXEA 3IPXA 4L5BA 4OIMA 1DOHA 2VP4A 4MRPA 1GNQA 2NV6A 5I7EA 5IULC 3HFRA 5K3FB 1VPDA 2ALJA 2W4QA 4EO7A 4ENWA 4HTAA 5DLYA 4RTQA 1FQWA 3AP1A 1LTKA 4Y2UA 1U5CA 1ZR4A 3KVYA 4BZWA 1JR4A 4Y0VA 1BVRA 1ESDA 3R7NA 1RYDA 4ZCTA 3QUQA 1VZ2A 1WABA 3QNMA 3R24A 4U3JB 4JV5B 4UCXA 4IWXA 4XB1A 1QGDA 2PU7A 2XQGA 2ZE8A 1HX7A 2YJTD 3MF4A 4F86A 2RIRA 1XU4A 3I05A 5FEMA 2Y93A 1OXXK 4KLNA 4XIYA 3ZV6A 2OO5C 2ACKA 3OBBA 4ZYLA 1WZ2A 1YR3A 5GQSA 4C7VA 1DFIA 4QGHA 4LY0A 4X1YA 1F48A 1SXJE 2UZIR 4GOLD 4WFJA 3VTFA 1IBSA 1T6BY 1EWKA 2A1UA 1Z5UA 4Q1EA 4B3XA 3THYA 3HXQA 3BIJA 4LJYA 3BWMA 3FZYA 2IEDA 4HDKB 2CMHA 3HADA 5FA6A 4I6GA 3B6KA 4H18A 4LI3X 3E5MA 4MRSA 3RBVA 1RNLA 5C5EA 1H2FA 2FMIA 3IPLA 4YJ2A 2QA5A 3D8RA 2VPXA 3EQZA 3FVWA 4CIDA 1QP7A 4NXNB 3V1TC 4X1KA 3EVBA 2JGKA 1U0RA 3QIAA 3UYLA 3P9QA 1ECPA 4UREA 3VH1A 1Z4NA 1NU8A 1SC1A 2X0DA 5JT1A 3VR3D 1M8FA 2ZS9A 2IZ7A 2QN9A 3IQGX 3B3FA 2VS1A 2R65A 1E94E 3AL2A 1FMTA 2VJYA 4UUBA 1WJGA 3VDXA 4F3NA 1YRAA 2VJMB 4TUYB 1E2IA 3B9RA 4O08A 3VVCA 5CH5A 2ZJ2A 3EY4A 1N7GA 1YB7A 2V7UA 4WWHA 4UVDA 1XCBA 3S1AA 4LOJA 2XWJI 2YJNA 4HQ6A 6REQA 1GUZA 2JBWA 1HK7A 2FKNA 1SG9A 4J49A 3LX8A 4KWEA 4RCVA 3RTBA 2FJ0A 1K5DA 4CM8A 4L0MA 1IQ0A 5EQTA 1ICIA 4P54A 4FQ5A 3GPDG 4UXIA 5BURA 4EJMA 4PG7A 2G28A 2CLCX 2P1RA 3MTDA 4Q4JB 5JU6A 4EKEA 1W85A 2DJIA 5DB4A 5JFOA 3NIBA 2JGFA 4YUVA 3EF0A 4OLAA 3R7SA 3U1VA 3J80A 2OO5A 3UTCA 2DHEA 4D43A 1T5LA 5HJ5A 1GTZA 4FU0A 4DQDA 4CKYA 4DZZA 3KR0A 4I1OA 2VK1A 3RFVA 2O7VA 5WRFA 3FBWA 4TTAA 5AKEA 4TZTA 4ETWA 1GUDA 5E3IA 1GZHB 4US0R 4ZCQA 1E4VA 1E9BA 3I2YX 4Z8YA 4Q3EA 1CUZA 4D4HA 3W0LB 3TRFA 4Q03A 4BLUA 5F23A 3DAPA 3JAWA 1OASA 1P5ZB 1U2EA 2XMSA 5CT4A 4ZMBA 2VCYA 5ICGA 2REQA 4A8PA 3RIGA 4G26A 5LZ2A 3SBDA 3U60B 4W7SA 5KBYA 4F97A 4IEFB 1HGXA 1KMQA 4PTLA 2JIOA 1ZH8A 3ZBPA 3SM3A 1WVIA 3LIIA 1EDBA 4EJ0A 1Z25A 1AQLA 2IGTA 2HCJB 3H8JA 4HVAA 4J94A 1LW7A 1SM4A 3LZDA 5F1KA 2C3YA 2NTYC 2HREA 1EWRA 2A9OA 2C82A 2PR2A 4N6OA 4DV1B 3F6CA 3EEYA 4IVNA 2QWXA 2I2WA 3GDOA 3FGOA 3U3RA 3UENA 4J1SA 1UBHS 5FFFA 3E70C 3DCIA 3EFHA 4YIKA 3KB6A 1YCDA 1CC1S 2NVUA 3GJXC 3UMGA 4GI1A 4E30A 4TSFA 5JS8A 1KBQA 2O19A 3NUGA 2DF8A 4UEWA 4NJMA 1T9ZA 1ISGA 2W70A 4NIMA 3C7TA 1SKUA 1QIFA 4KV9A 3NTQA 3Q40A 5BW8A 4YMIA 3A6EA 3MIIA 1G60A 1JAYA 1BGVA 2JFXA 1B8VA 1LI7A 3H5OA 5FH9A 4Q4CA 1BW9A 2YXPX 2WJAA 4JIMA 1F0YA 4DADA 1GPBA 2W6JD 2CYAA 4HWRA 4D0RA 3D3EA 1OLSB 4X61A 3WLNA 4BATA 4CQMD 5D86A 5E6SA 1CJBA 3PQ8A 3CH4B 1SUFA 2OZEA 1AQIA 4M0CA 4WK0B 3BE6A 3TH5A 3VPBA 1SZDA 3ZHQA 2W2OA 4UBKA 4OOFA 2ZE6A 3PLAE 3D2BA 2XCSB 5K0JA 2CVHA 4PRYA 4Q4HB 4QXQA 1I3KA 4ER3A 2V1UA 1Y7LA 3JQ7B 1UBGA 5L3RA 3HKCA 1Q77A 2HTEA 4Y9SA 2LRHA 2AN3A 5AIBA 2J3HA 5BNWA 1QPZA 2ZJAA 1KAHA 1YT5A 2OCIA 1L8OA 4DUGD 5A9RA 3PK0A 5K0BA 3IKJA 4YJDA 1WHTA 2REOA 2P0YA 3EIFA 1NVUQ 1YUBA 3DBRB 4PZAA 3UGTA 3UK0A 4G0ZA 2YV4A 5MN5A 1R4NA 1JI0A 1RJEA 4G56A 4N6NA 3U4MA 3KSDO 1ZQ9A 1TYDE 3ROQA 4D9JA 3FUCA 2Q3DA 3I2HA 2BGKA 1AZWA 2XB8A 2ZT8A 3H17A 4PIMA 3GP3A 5DHRA 3RABA 3U4QB 3EVAA 1ZXBA 5IASA 3P9ZA 4OBXA 4HDAA 3VR0A 1T0PA 3PVZA 1P9OA 2IUTA 4LTNA 4R2MA 4UD6A 3ZGVA 2FMTA 1J8VA 1UJMA 2VQ3A 3MXTA 5CIYA 2JLUA 2OV8A 4IUDS 5JUWA 3EZXA 1BFDA 3IEIA 3FDIA 1JILA 1TQ2A 1ONPA 3F8WA 3JYQA 4ZVTA 1RR6A 4IEIA 4E46A 1H4QA 4ITRC 1GP2A 2P0EA 4CQLA 4OFXA 3ZHCA 2A67A 2ZPAA 3DE4X 3CW9A 3JR3A 4GLLA 3RS0A 1JP7A 5DDIP 3CNOA 1SOVA 4PHGA 3RYHA 4OXRA 4YROA 5CDFE 5JSQA 1T4GA 4XIIA 1O58A 2WYOA 3JQCA 3ESQA 2UUCB 1HKUA 1TVEA 2XYGA 4A7PA 3LO5A 1WP9A 1H2WA 3PPWA 3NRCA 4CTOA 3H97A 2ZU6A 3PDJA 4M6WB 4XWYA 3E61A 4OI1A 3E9RA 3G1UA 1YDGA 2QU7A 4CQMB 4PVDA 4UZFA 5AUOB 5B7QA 1FNDA 4GPZA 1KEKA 3KPUA 2QTWB 4DA6A 3NBYC 3NCTA 4XVCA 3BMOB 4R1LA 1QO9A 4J0FA 4UUQA 4KWHA 3GAAA 3UQZA 1N3BA 3W6ZA 2AMJA 2ZAIA 1YULA 1HA3A 1X80B 3D6VA 4BO6A 4UUNA 3G49A 4P4LA 2VRWA 2VT7A 4R5HA 4EO9A 5IXJA 3ULKA 1XO1A 3PUZA 4RA6B 1J42A 2FK8A 4G4GA 4JQCA 2HW8A 4G07A 3VYRB 1Z7YA 4ND6A 1XRPA 1DQZA 4AYWA 4XX1A 4D3DA 2GEUA 5KKCA 4AX8A 1ZN2A 2AI2A 1VGRA 3OOYA 3ILYA 4Q7MB 3EBOA 3G2KA 1SNYA 2NPIA 3KTAB 4J0DA 1LFDB 1ES9A 3HFSA 3JTMA 4LISA 2I1WA 4Z9FA 4JD5A 5G02A 1FDSA 2G4VA 1L5GB 3A8TA 3EDQA 5DCYA 5FPSA 3VZDA 5BW4A 4ZYWA 3IEVA 4TZ6A 4EDHA 4HWKA 1JLSA 3VZQA 3PFFA 3GOHA 3IP8A 3I58A 5B3KA 1Y9ZA 5CX4A 1KR5A 3CZRA 3EIHA 4MKIA 1ZXXA 1FP1D 1CF2O 1R8YA 1VJ5A 3OZBA 3OZWA 5B6JA 3HJNA 5C1DA 1ZGHA 1C30B 4ZAYA 5KMGB 2P65A 1D3AA 4IINA 1RHRA 3DG9A 1V5FA 3HDYA 2NMVA 4C0JA 4TRRA 1PFYA 2J08A 3DXFA 3LHIA 1KYYA 2J7PA 4GZMA 1S1CA 2CXSA 2EP5A 2R00C 1SVOA 3SYLA 5KYTA 5TMBA 3OI7A 3NHWA 1NMZA 2AXQA 4HRYA 3UJ6A 3F8SA 1C41A 1Z0AA 1VZ3A 3E3LA 5DLEA 3U7EB 1AKEA 9ATCA 1P1KA 3PTZA 5ER6A 3EFOB 4F60A 2JJ2A 4BO2A 1WCV1 1UMBA 1XEFA 2A35A 3MAAC 3NM6B 1Y6GA 1KI6A 3L40A 4PLWA 2NZWA 2EXXA 3GLSA 5K8UA 3L8YA 1E1RD 1G4UR 4ZT4A 1Y5IA 4TV9F 1JFRA 1Q7TA 3NHJA 4G37A 4QXAA 3K8YA 2OLEA 2IYEA 4PNZA 1DFHA 4DY6A 4CKWA 1JB9A 2ZU0C 3TTSA 3A25A 4OGGA 2Q1TA 3G0IA 1YRQA 2IYPA 2PJZA 3HYSA 3U37A 2VF7A 1FNCA 3Q6MA 4AJHA 5KYYB 3QOWA 1HF3A 4R7TA 5KWSA 5E8RA 3UV3A 1V16B 1NRIA 1JTVA 5FORA 4DYVA 3QMWA 1QG6A 1D7AA 1UK9A 4HC4A 3HS3A 1UKAA 3HR7A 2BGMA 3MS2A 2ZP1A 2JLWA 3T54A 4ZYZA 4Y1FA 5ILQA 2GK7A 2H08A 2IHKA 1NJFA 2O7SA 3DOIA 4YUYA 4B75A 3ND7A 4FJ0A 4Y6SA 5AKJA 5G3ZA 3RW9A 3WGUA 4W5JA 5CB6A 2IH4A 1O6ZA 1SC4A 1ZYUA 6CHYA 5A5EA 1AUQA 4BNDA 1ZUIA 3CVOA 3D3JA 3SNKA 1D2MA 4D41A 4OI4A 1KK3A 4GHWA 3BXXA 4M1KA 5AOAA 1E2HA 3ZTYA 4EF5A 1VMAA 3HGQA 1RI3A 5ELXA 4LYAA 2X41A 2PUGA 1XZAA 2GWHA 1W36C 4IFBA 4TZKA 1DXOA 1MD9A 1GV1A 1NRJB 1OC4A 2Y0PA 4WXPA 1YKFA 4US2R 2YCLA 1NP6A 4GMXA 3GUVA 1LVUA 2BHTA 3AVXA 4L75A 3O31A 4IXWA 4QQKA 5HE8A 3FVQA 3B9QA 1W1WA 4JBXA 3UGKA 5CVJA 3T8YA 2VUIB 1BQ3A 1H3FA 4NBSA 3W9YA 4DIBA 1VRVA 2W6NA 1H8EA 1EZZA 1PZXA 2H3EA 2N3ZA 4QXOA 1TIPA 3DBLB 3WAKA 3ZQ6A 2AF3C 4F12A 2Z2JA 3TIGA 3V1UA 4L72A 1RZRD 1IXZA 1W6RA 3IQZA 2PX2A 1S3IA 1EFPA 4GS5A 1UZLA 5FOQA 5L51A 3GQVA 3IP1A 3K9WA 1O8BA 3PUKA 3D8NA 3X1JA 3HCBA 4B6PA 3R7WB 4QU9A 3SYMA 5K8VA 2IV7A 1FVFA 4CR6A 3WKAA 2W93A 1W1UA 2GAJA 2NUTA 2O4UX 1QDLB 3A1EA 3FKSD 3IVCA 1L4KA 1VFPA 4KJXA 2DCUA 4FN5A 7ABPA 2IH5A 1NF9A 1WRBA 4ZMRA 1QO0D 3I37X 3MJRA 2W6CX 3FG9A 4JQSA 1XTJA 4MTLA 1CVLA 3NJ8A 4Q4DA 4DBLC 2ZLBA 4P08A 2BHNA 4QASA 3WK5A 1Z5WA 5DBFA 3YASA 5IBPA 4H31A 2XGOA 4Z7OB 2AHOA 5JAOA 4O8ZA 4YP9A 4XAQA 2OZKA 1Y8RA 1B0AA 1O8CA 2WLTA 3H1BA 3JQ8A 3K35A 4YB8A 3IA7A 1CUHA 3IAS1 3K5PA 3F5SA 3MWFA 4F1WA 4ZI7F 1UWLA 5CFMA 1KO8A 3IQEA 3LT5A 4RBNA 5DTIA 4B17A 1KL7A 5AVXA 1CLUA 1NRXA 1ODCA 2X86A 1KA9H 5JSYA 4E31A 3CNLA 1AQNA 1XTBA 1E7RA 2R11A 1QUEA 4GXTA 4LDQA 4Q1AA 4C0SA 1M6VA 3NVAA