4H3KB

Crystal structure of a ternary complex of human symplekin ntd, human ssu72 and a rna polymerase ii ctd peptide phosphorylated at ser-2, ser-5 and ser-7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h3kB01
3OQMA 4ZMRA 5JNUA 4Z4GA 3A10A 3I5AA 1ISRA 1VKRA 2PKXA 4LRQA 1R8JA 4L85A 1EFAA 2Q5CA 5JNTA 1VLZA 1XHEA 4KZKA 3OLVA 2WY2D 5KWSA 4KNYA 8ABPA 2IYNA 4TLMB 1P6UA 5FWXA 9ABPA 4JASB 3O1IC 1NY5A 3FFTA 4NQRA 5JNWA 3T38A 2B4AA 4QYMA 3HSYA 1BDIA 3O2QB 4IMJB 5IBQA 1BA2A 3OQNA 3IP9A 3CRNA 1JFSA 2AYZA 4MPTA 4YP9A 2W42A 3QEMB 3DZDA 3H5TA 3RVLA 4P98A 1PHRA 3QELA 3HCWA 5CHYA 1MVOA 1JHZA 4WXEA 5KQPA 2NZVG 2QR3A 4TMYA 3HUUA 2PL1A 1NTRA 4TLLB 3A0UA 4MR7B 2MYTA 3RVNA 4D6YA 4RXTA 5PNTA 4MQEB 4KRFA 5CNIA 4MS3A 4MS4B 4UHKA 1JYFA 3H5WA 3IPAA 5IEBA 1PEAA 4H60A 5TPZA 4RY9A 2QZJA 3C3KA 3LKVA 1ZDMA 3RVMA 2A9PA 4DADA 1SXGA 1Z26A 3LUJA 5FBKA 3UK0A 3VNAA 1RXIA 4OTZA 4XFKA 1A2OA 3H75A 4UHJA 2FN9A 1EAYA 1U04A 2OENG 1KGSA 4PEVA 1GCAA 1D2AA 2MYNA 3N0RA 2WMYA 3C3MA 1HEYA 1PUXA 4N76A 3TO5A 1DCKA 2A9OA 4KK3A 1GLGA 1Z13A 2JRLA 4Q7EA 3T6KA 1XHFA 5IEJA 4W5TA 1DCFA 3GWGA 4EVSA 2LUOA 4NV3A 1JDPA 5I4CA 3LTEA 3EODA 2IPAB 3JS5A 1MB0A 4G97A 4O1HA 4YCSA 2PE5A 3EDCA 3HEBA 2LIVA 3A0RB 2WJAA 1JBEA 4LE1A 1BDJA 3LMKA 3G85A 3QLVC 4HNQA 3JVIA 3KSMA 5IUNC 1DRKA 3HVRA 5DKFA 3KLOA 1SXHA 3O74A 1ZGGA 2JB9A 2LP4Y 1ZH2A 3RQIA 3ILYA 1LBIA 1ISSA 3K4HA 4TN5A 3LUCA 4Z9AA 4MS1A 4W5QA 1NXXA 2IPLA 3QK7A 4ZPJA 2L17A 1QPZA 4G0QA 4EY3A 4Z4IA 3FDFA 3BILA 3Q7RA 3EQ2A 1D1PA 1D1QA 1TVMA 3HZHA 4WUTA 4OLAA 1E6KA 1NXTA 2DRIA 2MSLA 3FFXA 5IULC 3OO0A 3KG2A 1KMIY 3HO1A 1TLFA 2CHEA 1JX6A 2PUBA 3K9CA 3OLXA 5EWMB 1B00A 3L49A 1D5WA 4RV5A 4RK7A 4YWHA 5C5EA 4MAAA 5TQ0B 3CS3A 2E4YA 3LUAA 5KC9A 4XAQA 6ABPA 2PUGA 4RS3A 1F4VA 1Z2DA 4MGEA 4PE5B 2KYRA 4MR9B 2FKAA 1W9HA 1UDRA 3QEMA 2HQBA 4H3HB 3GT7A 1SXIA 2VK2A 1JH9A 4YLEA 4Q6BA 2R25B 5EWJA 4F11A 4LX8A 5HSGA 4Z4HA 3QEKA 4YS6A 2RDMA 3IP7A 4MR7A 3EQZA 4RDCA 3RVSA 1JL3A 2RJNA 4B09A 2BGGA 3HDVA 3I45A 4MQEA 2A9QA 4MS4A 2WB4A 4EYKA 3LUGA 4IF4A 2ZAYA 3E61A 5TPZD 1Z25A 3UKJA 3URMA 4G0MA 1C0EA 2QV0A 4NCBA 3TMYA 2JBAB 5TQ2A 3RVKA 3SNKA 3DLHA 4P1ZA 4RY0A 5JS2A 4W5OA 4YR7A 1U2PA 2GX6A 3I09A 3EULA 5DLEA 3TB6A 3JTEA 2R47A 2FW0A 5TPWB 2IPNA 1M2FA 4EGSA 1BDHA 1KRWA 4NCAA 3LOPA 5BR1A 5T7BA 2PMCA 1K66A 4EYOA 2RGYA 2FQWA 3JY6A 1M2EA 1LK0A 3CZCA 4WT7A 2QSJA 1NXPA 1URPA 1DG9A 2RJOA 2YHAA 4ML3A 2N9UA 4MR8B 3S99A 2PUDA 5DTEA 5CNKA 2PUFA 3O2JA 3N8IA 3HXMA 4YGXB 4G0ZA 2FLKA 5IX8A 3HJFA 2FEPA 1QQBA 4KV7A 1E6MA 3EAFA 4D6XA 1M5UA 2IKSA 2CWDA 2GKGA 3P9YA 5IUKC 1NXOA 1YMUA 5BRJA 1CEYA 1QP0A 4N41A 4XASA 1RNLA 4RKRA 3SM9A 1L5YA 2ID7A 4M88A 1PEYA 1DJMA 4XARA 4H3KB 4N47A 2FEWB 3OM0A 5HKOA 3GA5A 3H5OA 4RK4A 4LDZA 3SG0A 4RKQA 1MIHA 1USGA 3F6CA 5ABPA 4RK0A 2FTKE 2FXIA 2QVCA 3HDGA 1YMVA 3KHTA 2L18A 4FE7A 3KLNA 4YO7A 5FBHA 4HYEA 4EVRA 2FMIA 2CHFA 2VUIB 3OMXA 2FMHA 2FEKA 4RU1A 4O1IA 1FQWA 4RWEA 5EWMA 2PL9A 5TQ0A 3JPYA 1QKKA 3H6GA 5IUJC 3QLUA 3MM4A 2NUBA 3JPWA 2GI4A 4G0OA 1Y1LA 4HNSA 1KRXA 1YS7A 3H5VA 4G86A 3FGZA 5EWLB 4LDAA 1ABFA 4Z0NA 1DRJA 5CNMA 4ZJPA 3T95A 2MSKA 2XDYA 5IC5A 4OLBA 4RXMA 3RVQA 4DN6A 1USKA 2FQXA 4KREA 3LUFA 1DP4A 2FSPA 2M98A 4PZ0A 2O20A 1GUDA 4Z9BA 3N0WA 3BBLA 2PUAA 1M5TA 1QO0A 4FB4A 3B2NA 4IGAA 3M9XA 4RSMA 5F64A 2M1ZA 3CG0A 4NICA 5FWXB 3KS9A 3RVRA 5JS1A 1EWKA 1JFVA 1L5ZA 1NXVA 1OXKB 3N6VA 2HSGA 3QLTA 4LZLA 1ZITA 2JBAA 3CTPA 1E2BA 4Z4CA 1YK0A 3KCNA 3G1WA 1DC7A 3Q7TA 5GQSA 3MA0A 3H6HA 1ZGZA 3RVOA 5JNSA 4MYRA 3UUGA 1BVHA 2ID9A 1Z2EA 2WRZA 5B3JA 5KI6A 3Q15C 1QNLA 2R4QA 3DBIA 3SQNA 3R0JA 4GNRA 1ZN2A 1JF8A 3H1GA 5KQGA 3HS3A 4JAVC 2H3HA 1FFSA 3HV2A 1DBWA 1DBQA 3MYYA 1FSPA 3RVPA 1ABEA 3BRQA 3LUHA 1JFTA 1Z12A 4MR8A 4N0QA 1T34A 2GBPA 3OMWA 4MLDA 3RVJA 1TMYA 2R48A 3ILHA 3CG4A 1RZRA 5BQ3A 2AYXA 2B1JA 1NXSA 2IPMA 4QICA 4EYQA 2NT3A 1JWLA 1PNTA 1U8TA 5KQLA 4WWHA 3GBVA 3NNSA 4S04A 1APBA 1A0OA 4MQFB 4KMRA 1I3CA 3GV0A 2WJWA 4F06A 4E7PA 1JLKA 3MIZA 3OM1A 3O75A 3O21A 2F8TA 1EHCA 1JYEA 4PICA 1ZHHA 4HNRA 1NATA 3M6MD 3TX6A 1J56A 3ROFA 3O1HB 3L6UA 3C97A 2HQRA 3OLWA 2VUHB 3N53A 4EYGA 3ROTA 4E7OA 2JVIA 3F6PA 2MSWA 1CYEA 4KK4A 5BRAA 1H9CA 1IIBA 3KKEA 1FFWA 3I42A 2V0NA 3A3KA 1YVUA 2NZUG 3GRCA 5T3YA 3QLUC 1ZH4A 2FMKA 1P2FA 3DGEC 2QVGA 5DCLA 3CNBA 2P9HA 1MAVA 2MYUA 5ED4A 4ETNA 1SD5A 3Q9SA 2X7XA 4G0XA 2PUCA 3CU5A 1JDNA 1YTUA 2E4XA 2JK1A 2PJUA 3MF4A 1QO0D 2CD7A 3H5LA 3BRSA 3LKBA 2E4VA 1QMPA 4GPAA 4PYRA 4JB2A 4CBVA 3DGFC 4KQCA 3KTOA 3LFTA 1VRVA 2P4UA 1YK1A 3KJXA 5KC8A 3MQ4A 2JVJA 1ZESA 2LPMA 1GUBA 3NBMA 4EUKA 5JNRA 1GCGA 2FN8A 3CFYA 4S05A 2I6FA 5B3JC 4ETMA 1U2QA 1VPWA 5EWJB 5C5CA 3OO1A 2IDMA 3N0XA 4G0PA 3MMNA 4OBBA 1WETA 2QW1A 5JNVA 3D02A 1U0SY 4YV7A 4WZZA 4D74A 1A04A 4YRZA 2NT4A 3H1EA 1USIA 4MR9A 4MRMB 1SRRA 1RZRD 5TQ2B 1S8NA 4RXUA 4XXHA 4Y9TA 3OQOA 2J48A 3IPCA 4N03A 5FWYB 3N75A 4N0PA 3Q41A 5TE9A 4KPYA 3SAJA 3NNDA 3LUKA 1W25A 3F73A 1P8AA 4MLCA 2HJ9A 4ZMSA 2TMYA 1YS6A 4QYWA 2H0AA 4MQFA 3CZ5A 1DC8A 3C6QA 3BREA 3IP6A 3NHZA 3O1JC 4JOQA 4JB0A 3GL9A 1LBHA 4RY8A 4F3TA 3M9WA 4O5AA 2PUEA 2A9RA 1DBPA 4RK6A 1CHNA 3QX8A 3W9SA 2E4ZA 4OG2A 3RH0A 1AB5A 2QU7A 3H1FA 1LJLA 2OQRA 4OATA 3EJWA 4G0YA 3CLKA 1EWVA 3NNNA 5TPWA 1Z16A 2JVKA 2PLNA 2IOYA 3GBPA 3QELB 1RPJA 3OLZA 3HUTA 5CNJA 2L2QA 1NXWA 2F8SA 2E4UA 3GYBA 3H5IA 4KVFA 3D8UA 4F8JA 3HM9A 1QQAA 1TM2A 1Z18A 1EWTA 2ZWMA 2HPHA 4LE0A 4MS3B 2FMFA 5E3JA 4KQ9A 3DLBA 3LUDA 4Z4FA 4W5RA 4W5NA 4RZSA 3TD9A 2LBPA 4IRXA 3CKMA 1F51E 1MB3A 4EVQA 4FE4A 5TQJA 1XWWA 4RK1A 1OXBB 3QX9A 1DCMA 5HM6A 3EGCA 4RK5A 1QP4A 1D4ZA 1C4WA 7ABPA 1DZ3A 5KQMA 4QPJC 3F7NA 2VYCA 3T8YA 3KYJB 4XLTA 3Q7SA 3E3MA 3VNBA 1ZAYA 4DQDA 2FLWA 4LE2A 3NHMA 3QLVA 4JP1A 3IP5A 4ETIA 3HK2A 3O2SB 3FMVA 4L4UA 4ZYLA 5GOTA 4Z99A 2GWRA 4IILA 1Z17A 3IDOA 4F12A 1K68A 2E4WA 1LJUA 4WXMA 5DGCA 3JVDA 2HQOA 1FFGA 2FQYA 2L19A 4JA2A 1P6QA 2WWVD 4IMIB 2JCGA 1ZVVA 1RXEA 5HQJA 1ZY2A 1QP7A 2YHBA 3FFWA 4MS1B 3SY8A 1E6LA 3KYIB 1YIOA 4MRMA 4Q6WA 5D2CA 5EWLA 2PAFA 6CHYA 1Z15A 2FVYA 2MYPA 2QXYA 3CHYA 3OLYA 1PNRA 4KFCA 5FWYA 1AB6A 1TJYA 4Z4EA 1BAPA 3C3WA
chains in the Genus database with same CATH superfamily
4AT1A 4PAWA 4OQNA 1EEHA 1B42A 5JOQA 2D4HA 1K6EA 4URWR 4KQ2A 4R1SA 1M1NA 4YAKA 3NR2A 1EZZA 3TLJA 3UJPA 4OAPA 5AVUA 1WVGA 4OBWA 1KORA 1IOZA 2W4IA 5J2UB 1R6UA 3LO8A 3HEAA 1ORDA 2B4AA 2H08A 2YS6A 1ZIPA 1RIIA 1QUEA 4FSDA 4JLKA 4QYMA 5B53A 4B6EA 4QOHA 4A16A 1R3DA 4MMZB 3TYXA 1Q50A 4AJIA 5LDDC 2OM6A 1WCV1 1QVVA 4CF3A 5JBIA 1TM1E 2F2TA 1FYEA 4BU1A 4FLMA 4WXRA 3PEWA 2KJQA 2VJMB 3D7NA 4K6MA 4OVKA 4ZOAA 3MTDA 4CM1A 3PDWA 2EQBA 1RYMA 5AHOA 2H1RA 4EDFA 4KXVA 1I5OA 2RHTA 3W6PA 3I39X 2VHWA 4JL8A 4N3AA 4YAJA 2HDHA 4X24A 1L7OA 5DYGA 1YS1X 3HYCA 3SPXA 1H8ED 5K8LA 5CNIA 1H2WA 1WD7A 3PR3A 3NMUF 4BOYA 1IG0A 1OZGA 4BMOB 3AIKA 5BXYA 5CVTA 1JQ3A 3QUSA 4UVDA 1KERA 5BSGA 2QZJA 3JAKB 2XWSA 3KBBA 3MPOA 1KAMA 2Y99A 3DXZA 4LV6A 5AJWA 3ZE2B 4AG5A 8AT1A 2A9PA 2GXQA 4OKIA 4DTIA 1OJLA 1YQGA 3P45A 1R6BX 4TXJA 5FBKA 4B4KA 3JSAA 1ABBA 4IOJA 5IFKA 1S3SA 3STUA 2O3UA 4RCZA 1R27A 3A06A 2GZ3A 1M34A 2W2NA 2JANA 3HYSA 4ND3A 2JLZA 1DAGA 2PT9A 3KR0A 4B6SA 2P91A 4IHJA 2PZKA 2W22A 2QL5A 2AFVA 3NHPA 4IP0A 4ZV9A 3VAAA 2QMQA 2NIPA 2IYEA 2O8FA 1MAHA 2QGNA 4GBED 5HP4A 3PUVA 1IEVA 4WN3A 1QH1A 2IEYA 4F2GA 3GRYA 3Q11A 1THTA 4AF7A 4YJGB 1MDBA 2LE0A 4JQYA 4ZVPA 1VIMA 5C8XA 2VWPA 2WILA 1DRKA 3KUKA 4KQJA 4P84A 5DP2A 3KLOA 5KYUA 1PQUA 3IOBA 1DTWB 2PMBA 3AC0A 3HCEA 1LS6A 4FINA 5AOAA 4D9BA 3P4UA 3K4HA 4DE5A 4G81A 4YB8A 1R0WA 3EIEA 1Y0BA 3I01A 4MS1A 3HKEA 3OZCA 4HDSA 4ZEOA 1CQXA 1YZVA 2GN1A 4XVQA 4B43A 2J85A 1CETA 1OIWA 2KE5A 1E20A 3IKLA 3R3JA 4RCYA 1NVWQ 4A0FA 3UCFA 4P7FA 3JQ8B 3AUUA 4YY3B 3UHJA 4KFUA 4M9UA 5HA5A 1CW2B 3BIXA 1T6NA 3DDCA 1M3SA 1VG9B 5LQAA 1CUJA 3THOA 2CHEA 3FZEA 4OFZA 4TXLA 4TMKA 2ZIVB 1XRSB 2V0CA 4CUZA 1JU4A 2WM9B 5HWSA 2QP4A 3WL8A 2DJIA 2IELA 3LKDA 2GJKA 1XYYA 1E5TA 4MP6A 4RV5A 5I9SA 3T06B 1YL7A 2I3BA 3OQJA 3Q5GA 4HN4B 1IHUA 1Y4UA 5JD4A 5HFNA 3U16A 1NWCA 5ALDA 3WYAA 3H04A 3DOCA 1P1FA 3WO0A 1GQFA 3TQFA 4EMSA 5C35A 3Q3CA 2OK8A 1VMIA 4NZPA 3T7RA 1ADBA 1E2UA 2Q4TA 2XZOA 1SIBE 4C7OA 5BN5A 3ZDQA 4JJFA 1GSHA 3ZLBA 1JH9A 2B8WA 1RAAA 1NVBA 3M1IA 4YLEA 1PLLA 3HKCA 1Q0PA 4IGKA 1ETHA 4GEKA 3KAKA 4BC1A 3DUFA 4YDQA 5KSZA 4RQAA 3VKHA 2FPOA 1MRZA 1Y42X 2H2FA 3PXAA 3FW1A 5H5JA 4BLVA 1DQSA 2NXWA 4AJ4A 2I66A 3TLMA 3CF4A 5EXPA 2C0QA 1YNOA 5JALA 4YRPA 4F97A 4DDMA 3QGMA 1S3FA 3CWZA 2OV6A 2XA1A 2P11A 3DLHA 4WOBA 3NUGA 3OA0A 3QWBA 4NJMB 2NO6A 4EG5A 2VR1A 5DRTA 5CR9A 2PRIA 5DLEA 3EULA 4V2IA 3IUQA 1GCOA 1HURA 1V1MB 4N1AA 4W6ZA 3F5DA 5J1TB 16PKA 5AKEA 2Q3DA 2IPNA 3QZUA 4YMLA 3E4DA 4TWBA 5CW1A 3B1YA 3F9RA 1A9PA 1PS8A 1XJCA 3F5QA 1NIPA 4MV6A 1E89A 5KYYA 4OQMA 2Q5IA 4BMVA 1U4OA 3HP4A 4CUJA 2QSJA 4GH5A 4R2LA 3UNXA 1KZ6A 2N9UA 5K20A 4KCGA 1WZUA 1ONOA 4RJTA 2OO3A 4U2FA 2PUFA 2YQZA 2DPLA 1RU3A 3HXMA 2R1UA 1ID1A 1RI1A 1M2KA 3OJWA 2C9ZA 1QQBA 4DSAA 2Z1MA 3FVVA 3L77A 3NANA 3EF3A 1OI7A 2FH5B 2HIAA 4TTAA 2IZ6A 3ICVA 4QYTA 5L6LB 1JE0A 3PG5A 1M74A 2B0CA 1MW8X 5A4MS 5KX5B 2PT7A 3TBFA 3AVTA 3WGOA 2EZ8A 3SYMA 4DJDC 1LDYA 1OXMA 2AOTB 3ETCA 4F3KA 8LDHA 4MW0A 4D4IA 4MWTA 3JWHA 1J9GA 1MQAA 4B0OA 4IRUB 1P18A 5HKOA 3W6ZA 1OWMA 2ILTA 3QNWA 3ZXYA 4LYEA 2M6KA 2ZW9A 1BC5A 4NE7A 3F6CA 5IM4F 4DM3A 5ABPA 4YJ2A 1ECLA 3KEFA 1ZHOA 4YP6A 3V2IA 2QVCA 1GRRA 4FE7A 5M04A 3M6LA 5FBHA 1YJAA 3OOSA 1ML3A 3LZDA 3VNVA 1DO8A 2IZ1A 1AY0A 1ZONA 3VYSB 1FQWA 2IW3A 4XSVA 4IJUA 1Q74A 3GUZA 4Y2PA 2FZKA 2A0YA 4F5ZA 4G4SP 4EA6A 4QUBA 2IZ7A 2ZU6A 3L41A 4RHFA 2IYRA 1GAWA 1YE8A 5JQGB 1A2KC 3IBYA 4GVXA 4XFJA 4XYBA 3RVDA 1NVDA 4BFZA 4DCUA 5HZMA 4MW9A 3V9AA 1YZKA 2Q0QA 3BZWA 4R3UC 1GT6A 3ZWVA 3E35A 4DXDA 2PLAA 1LI7A 4OLHA 4UVHA 2Y0BA 2AUTA 4D0NA 3TRJA 5EHNA 3EOBI 3NBZC 1UEIA 2BWJA 1GYQA 4AIIA 3TI9A 4UD6A 3TRHA 4IDHA 4WJKB 5FNVB 1WCWA 4ISCA 1Q95A 2IU6A 3SYLA 1NM5A 2QX9A 1AK1A 1L1RA 1G4AE 1QH8A 4K9QA 1QJ4A 4C2UA 2M1ZA 3COZA 1BQEA 3PI6A 2JHGA 3BTSA 4E2YA 5CBPB 1VE6A 3TGPA 1QZZA 5JS1A 4QGBA 3WLMA 1NUAA 1RXVA 4II7A 1HL7A 3N5KA 1JXMA 1QIEA 2FDRA 4LE1A 1TZBA 3RUHA 1O0BA 1E3DA 3Q7TA 4G63A 4GXRA 4OA8A 3FWPA 4KWIA 3MA0A 4KFSA 4MUGA 1DAOA 4HB4A 4BBPA 3EVFA 1UXGA 4DDVA 1Z2EA 3S1SA 1QX4A 3AR7A 4XRRA 2ZJOA 1KKLA 2EWMA 2HA0A 3KOXA 3I83A 1FDOA 2YXNA 3I9LA 4P81A 4PN3A 1IZYA 2H3HA 3GZNB 2F3RA 1OLOA 2WVHA 3IXLA 4C3VA 1DARA 1V5WA 4RY2A 5AKZA 4Z7OB 2H16A 1V47A 1GVHA 3MYYA 3RVPA 3ZYCA 5EIBC 1E1LA 1DT3A 1TYDE 3LUHA 1P7YA 4N0QA 2FFRA 2W0MA 1XJQA 3PT9A 3T4PA 3ED5A 3E5HA 3OQBA 4G25A 3KAPA 4J4TA 1GZVA 3WK5A 3OHSX 4EHFA 2CL5A 2UVPB 3CG4A 4E12A 3LT0A 5L3SA 3MUNA 4WK2B 3BK7A 3U44A 3NDRA 2VEDA 5GGYA 4LXGA 1I01A 3Q9LA 4V2UA 1NDUA 1BO6A 1L6IA 4WWHA 2NTYC 3KUUA 3LRPA 3OJLA 4TS9A 4NENA 4XOIA 5FOTA 4F86A 4JITA 1CZHA 3RUPA 4BMPB 3T3IA 4WNCA 5JO9A 1F60A 1RDFA 4IIEA 4LKRA 4UD2A 3TEMA 1UOQA 5CB0A 1K6JA 5EHQA 3AESA 4X90A 4BRZA 4RTJA 2ZE5A 2HXGA 1VJCA 1VL8A 4RZIA 1LQUA 3T3PB 1WVIA 5GIOE 2NO1A 4POOA 4DC0A 1BHJA 4V0QA 2V9PA 1BX3A 3L6UA 5KU1A 4C6SA 1SHJA 3Q87B 2X77A 3NVKI 4XOUA 2O0HA 2C99A 1K2WA 1AS2A 3ROTA 1KQFA 1L4LA 1OOEA 3GFQA 4P7GA 4TX1A 1U1CA 4KYTA 4AIRA 3COSA 1TA4A 2XRZA 4RJ2A 5A4JA 3VDQA 3BZUA 3Q1KA 4YWJA 1RHQA 3RFUA 2D2FA 2CYAA 4NXMB 3ZBPA 3E2IA 1GR0A 1PWEA 5JCXA 3PDHA 3GMIA 3QV2A 2GT1A 3N2ZB 3WGVA 1T6ZA 2DEUA 1ZH4A 3DGEC 2HEIA 1DJQA 1DELA 3FMGA 4EITA 1IAQA 2H8KA 4PZLA 2WQ6A 4AU1A 4V0KA 3RWOA 3IXQA 1HRKA 2XLBA 3FOEC 1SCJA 1YR1A 1BXRA 2ADOA 2WSIA 2G08A 3P0HA 1O3YA 1O5TA 3GPDG 5IM4A 2QLTA 1KFEB 4B46A 5CYFA 2P2GA 3ZWYA 4KWTA 4Q4HB 1MGPA 2BD0A 2WZCA 1R1DA 2PEYA 3G2HA 3LHFA 3OVMA 4N7MA 2ZVDA 2IYZA 4KPUA 2CNOA 1H9BA 2CFIA 1MT3A 2O2IA 1OA0A 1X39A 4IIJB 1SCIA 2VPWA 3ZCRA 3MWYW 2IU4A 4PYIA 2GH1A 4ZC8A 1LUAA 3JALA 1N6NA 4C4PA 1WMSA 3KV1A 1BQ3A 3D2BA 1ULSA 5DT2A 3SS7X 4C0HA 1C50A 2WSMA 3ZY6A 4CF4A 2R6DA 1EH5A 3EVCA 1C8KA 4GZLA 3QENA 1OVGA 3OU6A 2I6FA 2YVAA 4R68A 4WLOA 4YRGA 2JIRA 2OXEA 2XEDA 1B3RA 1ZI9A 2O7RA 2OUKA 3IUJA 4OHCA 1MC4A 4S12A 5HF8A 1QX3A 1C0IA 1WXHA 2Y71A 4GMXA 4J94A 2I03A 4PFQA 5FJJA 1PR6A 5JU6A 2AOUB 2IHTA 5JNVA 3DTVA 3WIUA 2C8LA 5ISMA 3HR7A 4KZPA 2B8JA 5TR9A 1L0BA 2IZ0A 3EXAA 3W9BA 2GAFA 5AXBA 4A8JC 1QQ6A 1KZ4A 5CVVA 3TE7A 3LT1A 5TE9A 5D1HA 4IIYA 3EGEA 3VUEA 1BS2A 4NZOA 2EHJA 4DB4A 1JG2A 4ZMSA 1CNMA 4FHEA 4NESA 1RE0A 2RC5A 4X1OA 2J0UB 4IFEA 4YQYA 1HT3A 2B4YA 2H85A 2I99A 5IKEA 1DC8A 3E53A 4RTPA 4OQYA 4E0BA 1K6IA 4DCJA 3RYCA 1JDBB 2PZEA 1NG9A 4GPZA 1PWZA 1CR0A 1BWQA 2HU2A 4NOMA 3RC9A 2R97A 3J7TA 1XI2A 3ZBUA 3WKBA 1XVLA 1WMDA 2QK4A 3ZCPA 3LTNC 2QU7A 1CR4A 1PEKE 1W94A 2OQRA 2YXDA 4ND8A 3WYDA 3SHQA 2R3SA 1ZGAA 2E7ZA 2PLRA 1T8WA 4Q1VA 4I8XA 3ACCA 2FZLA 2ATVA 3BQMB 1YZ3A 2NQ2C 3VNRA 1N2GA 4NI5A 4WFIA 2I4IA 4IX9A 4ZREA 3BM5A 1V37A 4R8MA 4FKMA 4BVHA 4D8WA 1Z4IA 1PZNA 3WQSB 1K75A 4BE9A 4C0XA 2C5EA 5K0ZA 4LE0A 3UUFA 1KIAA 2C9MA 1QYCA 1SUDA 3QITA 4R1OA 3KKNA 4RZSA 1GU1A 2PUWA 4GR9A 2FETA 4NULA 5DTJA 4ARVA 3SE0A 1IBKB 1Z0AA 1PZEA 2ECQA 3PV0A 4EK9A 5AVTA 2D1RA 2VUTA 5CA0F 2YWDA 4NOLA 5CG1A 2C03A 1V7QA 4GM0A 1NSYA 3QBJA 1O0CA 2WOOA 2ZR8A 3HCAA 5T57A 4IV8A 3SOPA 4F4UA 3OTOB 3U49A 1TQDA 1JHMA 1Z6XA 3BWEA 2Y4NA 1IBMB 4TRRA 5AVKA 2GPWA 1I14A 2EF1A 3QPDA 4LYHA 4ZCQA 3TSYA 3W06A 4AC9A 5AKIA 5ILGA 5JY6A 1TIKA 1LZLA 1ZAYA 4CGZA 4J1NA 2Q2OA 4L16A 1EX9A 3T5TA 4KYUA 1TJPB 5SZKB 1EHIA 2IFTA 3CURA 1U81A 1HV8A 2WUDA 1MTOA 4L5JA 4P0TA 5DK6A 5DNEA 3TS1A 4YRMA 1VE3A 3WP0A 2NO5A 2P6UA 2OV2A 4Y9RA 4ZEMA 5A71A 3CKYA 3NOVA 1FXSA 3FOBA 4KWHA 3PQEA 4BQIA 3LU1A 3DTVD 4LNAA 3A3OA 3DO5A 2W6QA 3AI7A 1NY6A 4BGIA 4X61A 3C48A 1CUWA 1KO8A 4PR0A 3HHPA 3U7EB 3D3KA 4REOA 3PCTA 1QGED 3BXOA 3A9CA 1PFGA 2QXYA 3CHYA 1ZCFA 2X3FA 2YZ7A 4QNNA 4UM5A 1RM5A 4TTRA 2B4TO 2Z2IA 3CUUA 3DYIA 3T9AA 5LNK6 2G7MC 4TT3A 3ZD7A 2I67A 4YRRA 5BQFA 1DOZA 4D5EA 1R8JA 4GSYA 1N78A 1A4IA 3A6ZA 4RMIA 2YIVX 1XD2A 3B6EA 3C7KA 1MT0A 1GGMA 4GZ3A 3V4SA 4TL8A 2IXEA 4L8VA 4OKSA 1T0HB 1HE5A 5NLLA 3TIGA 4NVRA 3DKRA 2OHGA 3IAM6 3QVOA 1WKCA 5E95A 2QG9A 1OMOA 2HMUA 3E7PA 2QJRA 1KAEA 1ZNWA 1Z62A 3DE2X 4OYYA 5BN4B 3DO8A 3FZGA 2G0TA 1G6OA 3QE4A 4Y9UA 2YC4C 1JFSA 1O94A 1Y5LA 3G2NA 4WZAA 3ZDYB 1B43A 4DKXA 1W96A 3D0OA 3ICCA 4RD0A 4Z0HO 2HA5A 2WK1A 4HNGA 1U7WA 3A6DA 1XKQA 2GM3A 4ASUA 2X0FA 3EPKA 5HUQA 4RZQA 1FW8A 5T3UA 4DQVA 4AVYA 2XDAA 1NLFA 3EVTA 4TMYA 4X00A 3CRVA 4Y2QA 4BNKA 5KVCA 3WA7A 1GGFA 2MYTA 1EEXB 1GG5A 2KSQA 3R7FA 3Q40A 2CFRA 1SURA 5BSRA 4UDXX 4MS4B 3HXTA 1AN9A 4O4LB 3RIXA 3Q5DA 4DABA 1SZPA 1KOJA 3B7PA 3BE8A 4PHHA 4HPWA 3H9GA 3EPJA 1C7RA 2YRFA 4A1OA 2PXHA 1DPFA 1GL3A 1PG0A 2AA3A 3KSRA 4RAOA 1C1XA 1GXSA 5ERXA 2DJ5A 4ZAGA 1SG6A 1Q2UA 3N8KA 2AH5A 2FN9A 4KUGA 5E8JA 3MPUA 4DF3A 4DCVA 3CV3A 1OH6A 5CX1B 3E18A 4MVJF 4CG3A 1ISGA 1SVUA 2A9JA 2ZJ6A 4Z3OA 3BORA 1GM5A 4HB2A 1E94E 4MIYA 4N4AA 3KLPX 3GWGA 3MWLA 4ID3A 3WC4A 4W9NA 3OEHA 4BNHA 3EMBA 1FSGA 2NVUB 3NYWA 1FFXB 4Y0AA 4F4DA 4RS4A 1UXKA 1H2AS 1SOWA 5K0FA 5EIXA 1BKYA 3ZI7A 4BN4A 5MFZA 5A06A 1TYBE 2V6IA 1OAKA 5AOBA 4HNQA 3WDLA 2VHJA 2Y1OA 1Y3BE 3VTFA 4OSPA 3HVRA 2B25A 2JHFA 4IX1A 2Q7OE 2IC5A 3IQEA 4MARA 1UMDA 2I6GA 3EY4A 2I2WA 5CM2Z 1SZDA 3ZE9A 2CF5A 2WWWA 4TN5A 2P9JA 1Z0FA 3Q7EA 1FS6A 1KJZA 2VA9A 4KDCA 1RWBA 1K63A 2B99A 2HF8A 3R3WA 4UARA 4O4JF 5FV4A 4EY3A 4YONB 2H57A 1VBMA 3AXSA 2HA2A 1GV1A 4TT3D 2DFLA 1ADCA 1S2NA 1ACMA 1SVSA 1SVKA 3IDSA 4JL5A 1RC0A 2PUVA 2HREA 1JIVA 3FI0A 3OF5A 3JV7A 1HQCA 1G6Q1 1WPXA 3KLMX 4URYR 1VDMA 3PQ6A 3UV3A 1GTL1 4P4NA 4IXMA 4GW3A 2WAXA 4A91A 4L4XA 1F6WA 2FMTA 4JXKA 5CIQA 1PJBA 2VQ3A 1H6CA 1D5WA 2L69A 2ZYSA 4YWHA 3VR0A 5I47A 2R6HA 3PXGA 1QIIA 3GAFA 1FTYA 2NXCA 2PSDA 4LIPD 3ZY5A 1DQYA 5AMXA 4EPTA 2GJSA 3O31A 1CY7A 5F5LA 2F4NA 3O38A 1PS0A 1XRPA 1O94D 2B7CA 2QZ4A 1DRWA 3QBTA 3E3AA 3WHKA 1EZ4A 1U0NA 4IDPA 4MMYB 4KAJA 4II3A 2WDPA 4FLEA 4ASUD 3QLEA 4IL5A 4ZQCB 1EP1B 4UHHA 3KZOA 1EG2A 4GWGA 1KDTA 1VLJA 1TB4A 1WE2A 2VYFA 4Q93A 1N4AA 3EQZA 3PNMA 4JFAA 1FSFA 2AEFA 3RVSA 4ARZB 2II6A 1JDJA 2EVWX 3FTEA 1UJBA 3GVIA 3CGGA 4MI6A 3DOEA 4JI7B 3E61A 3P0JA 4F4IA 1KI7A 1ZIDA 4M38A 2PYIA 2H63A 1NP6A 2QV0A 1Y4DE 2ZZKA 1H42A 2QOEA 2ZSDA 3BFKA 4FZJA 1IVNA 1WLSA 4IDCA 4LYFA 4PLWA 4UBJA 2VC2B 4X3CA 4AP5A 1DEOA 2RGDA 4I5EA 5TT1A 1CY2A 1WNFA 1IRXA 4MWOA 1U2PA 1R0XA 4BGDA 1JKFA 1WMFA 4IHQA 1GCUA 1BN6A 1RRFA 3QF4B 4FVTA 1JEQA 1JFFB 3EXHA 3GVCA 4MPRA 4NYIQ 1YFJA 3KEOA 5BR1A 1Z6PA 5T7BA 2NACA 5CCXA 1KEPA 1E2GA 2W58A 2WYHA 2RGYA 3L04A 3OEHD 1F14A 3I9KA 4CMCA 3O2NA 4LF7B 1E7QA 1R18A 3F6YA 1KY4A 1U1DA 1O6FA 1CD5A 3DZKA 4LV8B 3SQWA 1Z0JA 2BVNA 4MJXA 1ZEJA 1S02A 2XMCA 3TLEA 4G0ZA 2XE4A 4J6EA 4NCNA 1L3CA 2FEPA 4FMDB 1EFVB 3EFOA 3WY9A 3DZBA 4LYAA 2FOIA 3R7BA 1NQUA 2Y0EA 2EG9A 4DHEA 4JP5A 3P9YA 4IBOA 4D3DA 3KE9A 2WVAA 3JWPA 5EP3A 2WWIA 3G2JA 1QU2A 1OC4A 2VNSA 1Y6JA 4RGYA 1DIHA 2B1RA 3RBZA 2IE8A 3BK1A 4WHMA 2ACVA 4FFVA 3NS7A 5KNCA 1N0UA 1T2DA 4QXPA 3K9WA 1L5MA 1XROA 4YJDA 1N2JA 3R20A 3NC4A 4UHCA 1JS1X 2PUHA 1DEHA 4E11A 4O2BF 2C2XA 3H7IA 1DRUA 2FXIA 3UXHA 3QU9A 4MQLA 3KLNA 3T0FA 2FMIA 3ZWXA 5BQXA 1ES9A 3U7GA 2YMMA 4LHVA 3QVUA 1T4MA 4JP8A 4YT2A 4QT0A 1XLVA 2ZBDA 1P7CA 5BPFA 3H6GA 2ZJ8A 1A9QA 4ZXFA 4K46A 1V39A 1SKMA 1OAOC 3EVZA 2GF2A 2EP7A 3DP7A 3LZ6A 4K2AA 2X86A 3AEUB 1UWKA 3LFHA 4PZDA 5IDWA 1QRTA 2I6QA 2WV9A 1Y3FE 3DR5A 3H5VA 4G86A 2E85A 3DNMA 4J3NA 1LX7A 3GDGA 5SV2A 4O4JA 4TKUA 1ORWA 2V6GA 3JYOA 1K88A 1JJVA 1XQ9A 4IOMA 4DN6A 2GCGA 3BL5A 5CAEA 2RHWA 1RQXA 1UINA 1W36B 4BNUA 1XTPA 4X7BA 1GUDA 4P82A 4EFKA 1HE1C 3RTEA 1W29A 1SY7A 1AKUA 4FB4A 2G88A 2OG1A 2YUIA 2PX6A 4PQYA 4AKIA 2BGUA 5ICCA 1J0XO 1ZGJA 3NDBB 2XAAA 5KNDA 5I8WA 1QVAA 1YS9A 3IHTA 4KX3A 1WBBA 4J91A 5EY5B 1NBWB 4V24A 4R0MA 4NKRA 2WYVA 2PH3A 5CDGA 5EFZA 4CV2A 2HB6A 1VI2A 2G67A 5AW9A 5A4DA 3SCZA 1NT2A 3F47A 3TW0A 3BWYA 4XZ3A 1WTCA 1S2GA 3OT1B 2XQFA 5KQGA 2CV2A 2WTXA 1CZKA 3PP8A 2PGNA 4HYQA 4OGKA 2OYRA 3VYRB 5K4GA 2X4IA 4V0NA 3CUWA 1SWVA 4MXDA 5E1BA 3S7TA 3SEQA 2GZAA 4C3ZA 4UOEA 5IJWA 1MXFA 1L5LA 5J43A 5JJIA 3DXXA 3W6NA 5E3HA 4F6CA 3EDOA 3KZVA 4BNWA 1MTZA 4HQNA 1HTTA 4ZVNA 1F5SA 5P21A 4QFBA 2W43A 3L1HA 1JSXA 4DUGD 2W37A 1BYUA 5G4LA 4RPHA 5CIWA 2O14A 4B6PA 3H9EO 1TECE 3A3YA 2H4HA 4PNPA 4BQFA 2BEVB 2M1XA 3RYFB 1H3EA 3RIEA 4HNUA 1GD1O 2WJIA 1A9SA 4EHDA 4RUKA 4M0CA 3NP7A 4WOKA 3X1MA 1TLLA 5KNCD 1NAIA 5TVGA 3MIZA 4YJHB 2WM8A 5L4LA 1PQPA 2HT1A 1FYDA 2VJPA 4S0ZA 3PJRA 1GRVA 1L4YA 1BZYA 5CMLA 2IU3A 4X97A 3BMCB 1WA5A 3FPHA 3G0IA 3WLQA 1FZQA 3S29A 4MWZA 1YE3A 2D59A 3RIYA 1ZL2A 4XSGA 4ZI7A 1YVPA 4YC7A 3S70A 2W00A 2QX8A 3P71T 4LRSB 5B1EA 4C43A 4RA9B 1RLJA 3CPJB 3DQPA 1EFKA 3QV1A 2SNIE 4E7OA 2Z9DA 3DR3A 1F4PA 2ZB3A 1CYEA 1XQVA 3GOHA 4EHAA 1R4AA 4I2VA 1WLYA 4WLNA 4GOMD 4NSNA 3UOAB 1NW4A 3FJYA 3P20A 2BHTA 1KPIA 4ZYZA 1X1DA 3FWYA 1FMLA 2X9LA 5EYPA 2FX5A 5A4AA 5ELXA 3WRXA 3NUZA 3WTCA 3BD6A 2H00A 1G9TA 2R4UA 4DLRA 2DFNA 4JI5B 5DGTA 3ZH2A 5JC8A 4RDHA 4O2BA 3N8NA 1XRNA 2IEBA 4CMIA 3S5JA 4DBLC 2J9GA 4OHUA 3M4YA 1G20A 4FUQA 2XLCA 1ND6A 1RACA 1HETA 1PG5A 2WM3A 4MCHA 4LBYA 3DFUA 3E1GA 4N5DA 2C2MA 3A7DA 1QMPA 5KNDD 3M0EA 5AHXA 4ATNA 2ZI3A 3OPQA 4Q3AA 2B61A 2WAOA 3FPSA 4GS5A 2B4QA 5BOVA 3WGLA 1N2CE 2QUJA 2QXUA 3GGCA 1Y9ZA 3UWDA 2PS9A 1C7ZA 1GTSA 1VHWA 3E58A 2PNFA 4PN7A 4ZA2A 2X76A 2WG0A 1TCVA 2FUG1 3N2NA 4O59O 5AJTA 5JNRA 5BW6B 3ZU5A 5ALKA 4GX2A 3L0DA 3NM4A 4OP2A 2VJCA 3WK9A 4KWCA 4RPLA 1ZMOA 3A37A 3HKCB 1ZU5A 4ZCMA 3FDJA 3DUFB 1LY1A 3LYAA 4TTQA 3KSUA 2NTJA 4L22A 2R751 1EB9A 4DMGA 2VWGA 4DNXA 4AQYB 3ELUA 4J7UA 2YHIA 1QYWA 3I2GA 1SUBA 4W7IA 1V96A 4D6PA 5J4HA 1TO6A 3ELYA 3TNDA 3ZIDA 3GAAA 2ZI5A 4HZGA 5L3ZA 2HMTA 1GNTA 3ZGLA 2RI6A 3EIFA 2O59A 5CB6A 4EW6A 1S8NA 3FPLA 4WESB 4JT8A 3VTZA 3MTGA 1QE3A 3IV6A 3MFYA 4QVGA 3SAJA 1P1JA 4M1KA 4FWTA 5A9TA 3PRKE 1IN5A 1EFRA 2H1OA 3CTMA 1QRSA 4EJSA 3H84A 2DH5A 5U1PA 3SP1A 2IZOA 3TLKA 2WHQA 4BKPA 3GLFB 3U09A 3BREA 3HP7A 3MT9A 1TCCA 2VQSA 3GL9A 3K92A 4R8KA 2NUPA 5LYJB 1NF9A 1Z34A 2QBYA 1FSZA 2KS6A 5EKTA 2J9ZB 1XD8A 1PRYA 3DB2A 4PSUA 3AW8A 3UGTA 4Z7NB 3GLSA 4M0KA 1PWXA 3WIOA 1BX0A 1IONA 2P2YA 2ZJ7A 1FFYA 4QHYA 4LVOA 3DV0A 3B48A 3NXSA 3LOUA 1HKHA 2VUSA 1Z2NX 3BZBA 2GLTA 4IIGA 3K0CC 5IDQA 2JVKA 3KVVA 1IXZA 2X42A 3UKOA 1VHTA 5CNJA 4QDZA 1OYVA 3E9ZA 2B9VA 2I1QA 2YJGA 1L4KA 3KWJA 3LQ2A 5G0SA 3CLRC 5KHAA 3QPAA 3KZXA 2C95A 3M81A 2GO1A 1PQ4A 1WU7A 1UDAA 3JQAA 3SX4A 3RADC 4GF5A 2IXTA 1A9ZA 4EAAA 3GLIA 1KI2A 4NJEA 4RIIA 4OQXA 2P3LA 4GRAA 3T7DA 4YJ2B 4JWKA 4LVUA 3GFSA 1XEFA 3NDPA 5FORA 4EVQA 5LIPA 3COYA 1C3VA 5TQJA 1JSCA 1RI2A 3SDBA 4URHA 1CC1S 5TJHA 1K5DA 4L1KA 2G0AA 3QU2A 5T8KA 5CFNA 2J30A 3G88A 1SXJC 2CVQA 2EZUA 3AUSA 3NW9A 3U39A 2QE6A 1OREA 1JFLA 2Z4TA 3N39C 1ZZEA 1M54A 5HKLA 3BCRA 4EB3A 4G09A 4Y18A 4EKGA 3MGAA 1H2HA 3O3OB 4AX8A 1SG0A 2IYYA 3PXBA 4G2NA 3ZKAA 2P2NA 3T7KA 5EOVA 4YRIA 1OLXA 2JGDB 4MEAA 5TMBA 1YA6A 1EKXA 4AI6A 3UV6A 1NI5A 1CB7A 3Q7IA 2QLMA 3OPYI 2VT7A 2N46A 1EXDA 1RKXA 1QZTA 5CH8A 1FFGA 1VLQA 4MVJP 1I7SB 1Z5OA 1BGXT 2I1LA 2X1MA 4CM6A 1C5KA 2QYSA 2Q2VA 1FBTA 3OJCA 3VR1A 3U7QA 4YDRA 1E4EA 1OV4A 1CNEA 1QK4A 1ULUA 1Q0QA 1NKVA 3SLKA 4LWPA 3OEYA 3WYCA 4ZICA 2D2VA 3IIEA 5GWXA 4C5CA 2JKZA 1BAPA 5B55A 3R75A 4NYMQ 5JNUA 4DIEA 1EFRD 4J0QA 5THKA 1X87A 1ISRA 4ZVTA 1SUFA 3C70A 4L85A 1EFAA 1FRFS 4TTIA 4DJJA 3A1EA 1PR5A 2JI7A 1U8EA 4GYKA 2D74A 2NVWA 4TTJA 5DLPA 4OB6A 4C3OB 4EJFA 5BYAA 5AI8A 2WT9A 3BE6A 4I6EA 4TLMB 3ZGZA 3L0PA 3CVWA 1XZKA 3IERA 3NDJA 4BP3A 5FWXA 4FFWA 5AKYA 4BS9A 2PZLA 3HCOA 2O48X 4HH3C 4U9HS 3VZPA 9ABPA 3ADBA 1AMOA 1Q5PA 4MP8A 4B3BA 2B0JA 4IVPA 1ZSYA 2GEKA 1BDIA 2LR0A 1XU4A 2QRPA 3IP9A 4MQ4A 1WY7A 1ZEMA 3G68A 3KRTA 1H2RS 1YDHA 1WQ1R 2N47A 3ME5A 4PSDA 4YP9A 5BMOA 4UAUA 1SCKA 3RIHA 2ZCVA 2ZYGA 1NULA 5F52A 4B4UA 3M2TA 4L2IA 5L3SB 1PR1A 2QTFA 1NMSA 2BTQB 1WZIA 4CIBA 5HS4A 3AERB 4L9WA 1VE7A 1JSRA 3DM5A 3MB8A 2GTHA 2NZVG 4G4GA 4QTXA 1DC5A 4MAFA 3VC3A 4CW7A 1O8BA 5KDLA 1H9AA 4DW8A 1VGQA 3WADA 2Z3WA 3L9XA 1RAEA 3JQAD 2GA8A 3WWYA 2XUGA 1QB7A 3H5WA 5F2EA 2XTNA 3KFLA 1DKRA 2AC2A 5FAXA 3WIBA 3W4JA 121PA 3C3KA 4G0NA 3D3QA 4Q1BA 3EH1A 5JJ5A 1R00A 1K6MA 1U7ZA 2XUIA 3LUJA 3L8FA 3JQBC 2DY0A 5AT1A 2FWAA 3ES9A 3UWPA 5DYNA 4C0JA 5KQRA 1WSBA 3WGIA 4MA4A 4H16A 5FPTA 2CL7X 2W4QA 3ECSA 4PRZA 3BJRA 3DAFA 5BXQC 3L06A 4UXHA 1YRAA 1PIWA 4NYJR 1RRGA 4FI3F 4ZAWA 4N9QA 4RHTA 5CVJA 3ZVRA 3OWXA 4N76A 3VO2A 1GLGA 1Z13A 2Q6LA 3FOAA 4ZODA 3IE1A 1XALA 1WUTA 2Q7DA 3CYFA 1F20A 4WY5A 3U6BA 1NQTA 2OUIA 4TXNA 2D1YA 2ZB7A 2ASEA 2HWYA 2VPIA 5DLYA 1MB4A 3C5WP 1U9ZA 2XNKA 5BURA 4KQGA 5GJCA 4GL2A 3FVRA 1JN0A 3HDHA 1O95A 4YJFB 3D6NB 2ZVPX 4IXTA 3IVMA 3LMKA 1N2SA 3M6IA 3N0TA 5AKLA 3ORHA 2P6OA 2V7WA 4HSGA 2R84A 1FNCA 4URUR 3U26A 4C7XA 1CQJB 3WZMA 1S7CA 5EE0A 3UYKA 3CE6A 3PDCA 1MP0A 3FYHA 1Z0IA 5FBZA 3LV8A 1NVUQ 1YGYA 4DQLA 4R1LA 1G19A 4Q9KA 5HRCA 2GM9A 1DUVG 2UYHA 1N3BA 2OCXA 2RK6A 5A6VA 1B26A 3AEQA 4Q39A 5F33A 4NDNE 2D2XA 1V9CA 4UU7A 2ZWPA 1V11B 1R0CA 3NBXX 4Z4IA 3VGPA 4ARUA 1QOQB 4LBZA 4OMUA 2NTEA 3ADCA 1NU8A 3OIYA 3M7IA 3PE3A 4NH4A 5FV7A 4QT4A 4B5KA 4W1RA 2PXXA 1AVTA 2OZEA 4IFBA 4MWGA 2E89A 4CI9A 2AI1A 1KS9A 2GILA 1A5BB 3OLXA 2P7HA 5F35A 2WNIA 5MFPA 1Z4QA 1SH7A 3EZ7A 3L49A 5C5EA 5JZ9A 4DQXA 4PNEA 4CMBA 3U3ZA 5CDSA 1L7AA 3SVLA 1K4YA 1UDWA 2OHJA 1M8PA 4C2TA 1XZ8A 1G21E 2JFFA 3F8WA 2ZRMA 1MH9A 2WSLA 1D2EA 2ZANA 2JJ2A 3OQHA 1UDRA 5A4IS 2HIGA 2HQBA 1P9WA 1SXIA 3TAHA 1VFNA 2L0XA 3WBJA 2EFJA 2JRCA 1W1IA 2FX3A 2WU1A 4G26A 5B1DA 2GBIA 4DWWA 3HKDB 3PF8A 1IJFA 2D7CA 3J81k 4OJMX 3SSMA 1V41E 2OGUA 1XZQA 4YS6A 3PHCA 1R9NA 4WDRA 4B7AA 2PFKA 4L4YA 1MPXA 2B36A 1UJMA 3O4HA 4ZOCA 5IVIA 4ALLA 4PGGA 1CCWA 4EGAA 5BSTA 2VCHA 5K8TA 1CRWG 3K53A 4CR8A 2IA5A 4UXJA 1C9NA 4MKXA 1Y9DA 3R3XA 3PLRA 2AKAB 4FHCA 3QWFA 3ZI0A 3ZUGA 1WXXA 4LF4B 4BEJA 3L0BA 1TL7C 2QRNA 3O9ZA 1CUXA 2VOEA 2E0IA 3LO5A 5BUCA 1OHHA 3VOBA 1A97A 1NQ5A 2WFLA 1VHJA 3RKSA 1PN3A 2D0PB 4NAVA 5IJ0A 5ALMA 2GDJA 3HJFA 2GYWA 3UUWA 3E9CA 3PXCX 3HH8A 4E1VA 4EYOA 3E7WA 1CUUA 3GLKA 1KJYA 3ORFA 3MJVA 3ZHOA 1S1CA 1LK0A 3D5QA 4JP3A 4MR8B 3Q2IA 1BWRA 3DDSA 4EGCB 1O95D 3EQ8A 3FLBA 4WBNA 1UMBB 1T36B 2XI4A 4XEHA 4JU8A 5AKJA 3N2EA 5GONF 3UB3A 1G9SA 1P7PA 2FLKA 3JRNA 4QXOA 2Z0MA 3IX7A 1UJ4A 4RESA 1E2QA 4DG8A 1NJFA 3V1LA 5DSZA 4ZIRB 1L5SA 2ZRGA 3GRKA 2ZI4A 1O54A 3O0TA 4N41A 1OFGA 1UQUA 4IGIA 2ID7A 5JANA 4B3MB 4NFYA 4D4GA 1T35A 1DJMA 1P3Y1 3PU6A 3TMKA 4D9MA 6ADHA 2Q4BA 3LNTA 1HNXB 3OM0A 3RANA 2ZB4A 3GA5A 4FDMA 3LRXA 1RRKA 3D1LA 3NEAA 1TTQB 3BXPA 3OCUA 3HRHA 4L3WA 3EH2A 3DHNA 4RK4A 4ZVOA 3GELA 4KR9A 3WB0A 5CCDA 1P8JA 1X42A 2YC2C 4KRYA 1E0SA 5JZVA 2Z9CA 3U48A 2Y05A 4BFWA 3COPA 3MEQA 4HRAA 4DV1B 4N7BA 2CXHA 4U7HA 4ZEVA 4DMMA 1ORTA 2C9BA 1C9DB 5MGNA 1TEHA 2V4ZA 3BL8A 4AF8A 1M0EA 1IUPA 3BXFA 3OU2A 1NI3A 1X1CA 3OE4A 1E3TA 1ZKMA 4G0OA 3TSOA 4CMAA 4OV6B 5BSHA 2WIDA 2Q3MA 1YS7A 1MB2A 2X0IA 3T94A 2JJ2D 2ODQA 1L5GB 4FM9A 4DA0A 1TIBA 4KG7A 4WUVA 4JUAA 3CZAA 2RAFA 2FQXA 4DJEC 2EJWA 4B44A 1CVLA 1O9HA 2IOHA 3CLHA 2WP0A 1MORA 1B0PA 1FP1D 1UWCA 3BB1A 1RLOA 3BBLA 4PC7A 1M5TA 3ZJYA 5KVSA 1EWQA 1QO0A 4DUGA 2VF4X 3HLTA 3R3YA 4WNYA 1Y6QA 3INYA 2WLSA 4IGAA 3EGXA 2FQQA 4XWAA 3NEPX 1CLEA 2HRQA 4Y6OA 5F64A 5JS8A 3KS9A 1BWSA 1IBCA 5GZ1A 4R9NA 4DDWA 5BNWA 1QK3A 2ZZMA 3CEAA 1GZ4A 2Q0HA 1L8XA 5HPYB 1JEDA 1FYFA 1OIVA 2Z5LA 3NKFA 2JKVA 2I71A 4TRJA 2IBMA 3FYTA 3PCRB 1H4TA 1R12A 4FW8A 2QQGA 1Z2PX 5DX8A 3RVOA 4O8CA 5E4JA 5CDFA 4D02A 1XB2A 1OHHD 4PS1A 2FR8A 4E5PA 3PX7A 3FYUA 1TUGA 2O50A 1ZVJA 2IKQA 3SHTA 3UMVA 2R4QA 2C07A 4LTMA 2FZVA 2FPIB 2O8VA 3SQNA 4LF8B 4Y6LA 2DUNA 1EUYA 3VDMA 2VT2A 4FIZA 4YAGA 4ZDJA 5B2FA 1C0PA 2JLUA 1OZ0A 1QRDA 4YAIA 1OT5A 5AWFC 4FC7A 4IJQA 3FPKA 4RHUA 1C4OA 1II8B 4OQQA 4I1SA 3RRMA 3T7SA 3SJZA 2HHAA 2WG1A 1BFKA 3RAFC 3CT6A 5DNCA 2TMDA 4HWGA 2B1JA 5CVCA 2BIFA 3L0IB 1FUYB 1WPRA 4DLSA 4AZ0A 3L8YA 2HSZA 4INZA 2YMPA 4ENRA 2PXAA 5LMUB 4YV0A 3Q9UA 2ZQZA 4HX5A 5HOEA 5KQSA 2PVSA 3IEXA 1QHIA 4FHDA 4U00A 3CKKA 4V02A 1A0OA 2C94A 4KMRA 3TWOA 5I6DA 5KYXA 3C3AA 3VNUA 4LTNA 4RFSA 1TZCA 2DUMA 3GPIA 4EO7A 4M76B 4BCDA 2C82A 2AUMA 5DNAA 3RS5A 3Q3IA 3GVHA 3ROFA 4D42A 5LBTA 1SQ5A 3ZD8A 3EPRA 5GIPE 1FU8A 1MLDA 1T1JA 2B7BA 4GX5A 3ZWAA 2I2AA 5LIRA 4JI0B 2RD2A 1ONNA 1XAHA 2KMLA 5GONA 1OU0A 4AROA 2I9KA 1QS0A 1YC5A 2HJRA 1MPTA 3L1VA 4BBAA 5FEUA 3GX1A 1SIUA 2UXDB 2XECA 3TQCA 2QD1A 1UMDB 3JQRA 3I42A 1FYWA 2V0NA 3RYIB 3D8NA 1YIDA 3CRMA 5EE1A 4AURA 5K7SA 3WKDA 4ZFNA 1CT9A 1XEWX 3W0LB 1UT5A 3BSYA 4A2QA 1JG4A 3I92A 1UC4B 3BB3A 4NOJA 4BHTA 1EE9A 1RC1A 3DKKA 2CJPA 2HH9A 1OH8A 1FU4A 4C30A 1MA3A 1Q91A 1O9GA 4RD6A 3FUCA 4BEBA 3FRIA 3AZQA 2POQX 5DP1A 4CKBA 5EP1A 4EW2A 4XIJA 5LMZA 1UDXA 1QM5A 2FW1A 2PJUA 1YZFA 1GCIA 1QO0D 2CFTA 1LPBB 3OOJA 3EZ9A 2YR0A 3KDSE 3OJXA 4ZQEA 1HOXA 3VO9A 1JDUA 1HA3A 1U31A 2QIOA 3I72A 4W1PA 4B34A 3MG9A 4MO9A 2P4QA 5JFOA 2GN6A 4HJRA 1QV7A 3DGFC 1M1YE 5CTJA 5DTRA 5MHTA 4QWMA 1BQ4A 4NQZA 3UYLA 1UBJS 4R0NA 4IQFA 1VTKA 1X70A 1IHXA 5KKCA 2XQIA 1ZESA 3E8XA 3K5IA 1UBTS 1USUA 2YZMA 4OHKA 2RHRA 4XEUA 5G41A 4Z7JA 5B5SA 2I62A 5KCZA 3NJ8A 3ELDA 1GCGA 4LZOA 5I7UA 1ITZA 3O7WA 3EEYA 3VO8A 3G5TA 3E4CA 3ONVA 1MQSA 2VDQB 1XZIA 3G0DA 5DTQA 3WLLA 4WDQA 2FUNB 4G0PA 1LGYA 4KXFB 5E7MA 5JCZA 2EKBA 2F90A 4W7SA 2HPVA 2QW1A 3S44A 5TNXA 3DJYA 4LCEA 3D3WB 1WZNA 1P3DA 2ODAA 5E0KB 3JZMA 1KI4A 4I5IA 4R9VA 4D74A 2NT4A 3CN9A 2BE9A 3NT5A 1YUNA 3O3NB 4NBRA 4V39A 1K4KA 2C9YA 4ZAZA 4ZZ2A 1LLDA 1P5FA 2R8YA 4HQOA 2O7NA 3LRTA 3WBBA 5TV2A 2I7DA 1G55A 1Q0HA 3P1JA 2HA7A 4JZKA 4KPYA 3O4FA 2P9BA 1E1CA 1DFGA 4CM4B 3D4OA 1KH2A 2V7XA 1ZCBA 4W9MC 1G2PA 1JEQB 2O2HA 2JFUA 4CDRA 2ZRAA 3IBCA 3KJIA 3M34A 4YV1A 5A9RA 2HMWA 3D6UA 2H5JA 3HVKA 1ZGBA 1N25A 2HF2A 2PUEA 4CMGA 3B1VA 2EJUA 2AJDA 3PEUA 2IVZA 2QPAA 4CKZA 1IWBB 3P7MA 5A05A 3KPVA 4FMCB 1KDRA 2ZDGA 3RH0A 5DBGA 4QO7A 1L7EA 1RRMA 2YWFA 3SNHA 4LK2A 2GRAA 4IJWA 4CCWA 2WE8A 1KFBB 1YDEA 4N3GA 2OB1A 3D7LA 5G0TA 5JE8A 4C4SA 1N2EA 1B8OA 2AK2A 2VEOA 2JLVA 3T1NA 2ADMA 1E58A 5AI5A 1H0KA 4MWSA 3PXDA 4H1TA 3T9BA 5IAKA 2PKYX 2OR3A 1AZLA 3I30X 4OK6A 3LQRA 1F3LA 3UJHA 5K3EA 1G8MA 2IHZA 5F1PA 5F2OA 3AT1A 4DT1B 1C8VB 2GXSA 4G1VA 1V1RA 3ONEA 1A8PA 4DQKA 1HNWB 3R3SA 1OLUB 1YASA 2MTBA 4F71A 2AKEA 1UWLA 4XGIA 3O6VA 4GKJB 1A7KA 3HR8A 3L6EA 4OMFG 2G17A 5EVJA 4BMCA 5KOJA 1F7UA 3ITNA 2LW7A 5SZJA 5DM1A 3W3ZB 4FEGA 3ZHVA 2EX1A 3R41A 3SR0A 1KVQA 3E23A 3DMHA 2E2WA 4Y9DA 3NRBA 4EG1A 3BD9A 1SKQA 3R0VA 1QP4A 3DVAA 1QYXA 3HBAA 1M0SA 4Q4DA 1I3KA 4PPQA 4BO6A 1JDBC 1P73A 3T5GA 2BSXA 3C6KA 2GK6A 2PQ0A 4WKCA 2C4VA 4LXXA 3B6ZA 4R1MA 2EEPA 4YLYA 1HDXA 1VI5A 1BXGB 3N2KB 4KBGA 3QW2A 3ROKA 4HNVA 3U3KA 1FW6A 5EZ6B 2WSSA 2Z08A 1XPOA 1QWOA 3C2QA 3H2HA 3NIBA 4IILA 4L27A 3USCS 2VQEB 1ZKDA 1CUIA 3KYCB 3UAOA 3BFVA 1K8YB 3DFMA 4YA6A 1EVYA 1X1TA 5C4IA 2OCBA 4YUYA 1WJGA 4UAGA 1SB9A 3L8GA 3QF7A 3GH1A 2WD7B 2P4HX 2JCGA 3JZDA 4RQUA 1UFQA 4DLLA 1G7SA 1EDOA 2UDPA 1F0YA 3OY2A 3H83A 4HN2A 1D0SA 2GRUA 3KYIB 4Q82A 3PFCA 2VXOA 1FJHA 1M33A 4L4SA 3CBQA 4MQ6A 4U5QA 1XQXA 3AKCA 1X8LA 3EXIB 1LKZA 1EFUA 2BKLA 3OG9A 4ZMRA 3JAMA 4PINA 3G6WA 3A10A 3QKRA 2QRHA 1HI9A 1U8YA 5D01A 1KSGA 1EK1A 1FTSA 1FSSA 1G5RA 1MJ5A 2I2FA 2CZGA 1OD6A 1QCYA 1HF3A 2CNNA 2X1VA 3AJEA 2Y1FA 4FW9A 3KJZA 1OAAA 2WC1A 1GPYA 2DUWA 1NY5A 3LA8A 2IBTA 5LMNB 2R8RA 4BKOA 2QSYA 3NATA 1M8GA 5CJPA 1BA2A 1QGOA 1SKBA 3Q1LA 1XTZA 2RFLA 4U6SA 2AYZA 4G56A 4EG6A 4DBZA 2VH5R 3CONA 4OXXA 2J46A 4CTKA 3DMDA 3KQUA 4G8BA 4DMCA 2GBLC 3Q98A 4V0OA 1X7XA 2FLVA 3Q3HA 2ZI6A 1US8A 1CNFA 1D2CA 1E8MA 1A5TA 1GL9B 1RYEA 3LQ1A 1R5JA 3A0UA 4I3GA 2C42A 4MKGA 4MR7B 4V3CA 4CKWA 2ZRLA 2XX3A 3QHPA 4NG5A 1LV7A 3H8WA 1OVMA 3QJYA 2QS9A 5JLJA 1U2DC 1TD1A 2ISQA 3BH7A 4D41A 1KK1A 3BFJA 3EGDA 2QMYA 3ZNOA 4YRKA 1HPLA 1M76A 4DA9A 3URKA 3E84A 1XVTA 4ZI7B 3TTUA 4LMRA 2BONA 1P1IA 3VTAA 1O6ZA 1IY9A 4C0LA 3GNLA 1A2OA 1QDLB 2NVOA 2RGXA 4LJKA 1SQSA 2DFTA 4IR7A 4E2XA 1LVHA 2GBGA 2HNKA 5I7EA 2XMDA 4FBMA 4XR9A 3HEMA 1VJ0A 1REQB 2I3DA 1IN6A 2I2BA 3L02A 3LWZA 3VOAA 5C2JB 2YJ3A 1DQZA 2A9VA 2XMQA 2UVDA 1RHJA 3MD0A 2PKEA 3INGA 1QG2A 5EJFA 4F6LA 2YASA 3JARB 5CG2A 5HZHA 3A6JA 4OB7A 2YN2A 5C4GB 1DCFA 1NW3A 1FTGA 3CH7A 3HCRA 4BO5A 3T5PA 4FS3A 1L5OA 1RC8A 1D9XA 2W2TA 3HQ4O 3GLQA 4M1QA 1I8TA 1TZMA 2JIOA 2FJPA 3HNPA 4R8SA 2PKQO 4QOSA 3PX2A 4X1KA 4XIFA 5IH3A 3F49S 1LV8A 3A0RB 2WJAA 2WSSD 1MEEA 3D2CA 3FCOA 3PNPA 2HSWA 4HZUA 1VKHA 3MJDA 3JR7A 3MOSA 5CDFE 1T0PA 1YI1A 3HADA 3QQ5A 3QVTA 4PO9A 5L51A 2FZEA 3W77A 1LD3A 3LC1O 1BH2A 2HBQA 3AYZB 3QOYA 4XQ9A 2YDYA 4ZRNA 3JWGA 4CQMB 2EBHX 1G20B 1ZH2A 4DRZA 5D84A 2C3YA 5AP9A 3ILYA 3U31A 3OTGA 4IS3A 1RAHA 4Y8VA 3Q4GA 5EINA 2GVZC 3DMPA 2ZBPA 3T7CA 1EPUA 3ZWWA 1MJGA 4N6NA 5H7XA 3TVYA 1IE3A 1G17A 3L1IA 4IQ4A 1KL7A 2ZB8A 5A3SA 3VI4B 4F72A 1J22A 1D1QA 3M49A 4OHVA 4XQCA 2UUOA 1E6KA 4O4HB 3ZX5A 5AVQA 2VP2A 4LNUA 3KG2A 4RETA 3RFCA 1LRJA 4QVKA 3QMVA 1SBYA 3C7AA 1JX6A 3P0IA 4GUAA 5TGZA 4HHEA 3ZJTA 4Q3KA 3BCHA 2I6TA 3C8HA 6NULA 1HR0B 2BCEA 2OE2A 2YXLA 2AZTA 4PHCA 2YHIB 1K6XA 3TINA 4KH1A 3UG6A 1PSWA 1TT5A 2G9VA 2PTGA 3CX7A 1TRHA 1SHUX 3G0GA 3SFTA 7REQA 3VPGA 1KK0A 3OFNA 3IE2A 4P3KA 4RL6A 2YWGA 4TUYF 3V3TA 4ZHQB 5LQCA 2FKAA 5HKAA 1Z8DA 2QN1A 1MABB 3BXEA 3FNBA 3QEMA 4NBNA 4A0HA 1GFIA 3KKZA 3MGCA 5FIUA 3WLKX 3LHKA 4K87A 2YOFA 4BO2A 4DWOA 4ZCRA 2QM8A 5LU9A 1QH9A 2XNJA 4AJLA 5AFSA 4QEKA 5DLQC 3WL5A 5DF1A 4AZ3B 4JX8A 3V1MA 4OI2A 2RDMA 2GCIA 3NHFA 4DKJA 1TTTA 2K2QB 3WYEA 4MUIA 2FZWA 4JJ8A 5LP6F 4OP3A 3IOMA 1KPGA 5ALQA 2GZSA 1XR3A 4M89A 3WWZA 4CEJA 4OREX 1HDEA 1IK4A 2GGSA 3NTXA 1IVYA 3AHGA 1VPEA 4BPRA 1NRJB 4F4CA 3U5ZB 1AQYA 3CF6R 1D4FA 1JHVA 4LXUA 2XMZA 5EJAA 3GFOA 4NOKA 4AZWA 3A4MA 1GTG1 2W9XA 2Y6UA 3PUWA 3OSUA 1SXQA 5HKBA 2XYHA 1I1QB 3N7TA 3FHOA 1QE0A 4X93A 1HT1E 2WOJA 3KCQA 1DXHA 1X7YA 1EA5A 2GEFA 1U8UA 2ZYTX 4HB0A 1SU7A 1MJNA 1UBUS 2O0LA 5DM0A 3WB1A 1W8DA 2G9UA 3U7RA 1GYPA 3EZLA 2ZR0A 3OKAA 4NP6A 1MEOA 3JQAB 1C0KA 5DTEA 3M1LA 2MINB 2PJZA 1KY5A 1T9ZA 2ZRPA 2WYWA 3GW8A 3TTVA 4DIUA 5BMVA 3GLIB 1TPYA 1C3EA 3O2JA 3ZZNA 5A7HA 4MZXA 1BE6A 2PQ2A 5F21A 3EF0A 1CZRA 1FLAA 5BNZA 1WDMA 1PYDA 1NBHA 2D0DA 1IBSA 3DE7X 3Q85A 4RDIA 4Z9XA 3GQBB 3WS7A 3KPWA 4D6XA 1ZG3A 4D56A 3V9PA 4L3VA 5DI9A 4EMBA 3CH6A 1GGVA 1WPQA 5SICE 2HDOA 2VHCA 3FYSA 3F2VA 2FWRA 3IV9A 4XASA 2ZUTA 4ZVLA 3TKYA 1H0SA 4NY1A 2ZI9A 1TCAA 2BFFA 3LCJA 4YRQA 3ECCA 1YJ5A 2W2KA 1TADA 5EJ2A 4W5WA 2HA6A 4HNAA 1OTXA 4RD2A 1JQKA 1FUKA 1I0ZA 4MP3A 2B1GA 2I78A 2OORC 4RKQA 1TYAE 1W44A 3SS8A 4MYTA 3GLTA 3WG9A 3AR4A 5HJ7A 1B0UA 2UKDA 5JDCC 4KYVA 1EFTA 3RTGA 3FSEA 1LS1A 2WHYA 3O9MA 3DMGA 4D82A 1D4AA 1T91A 4IQGA 1CV2A 1KVTA 3DWFA 3HG7A 1TQ4A 3ANYB 1I9CA 4GUDA 4OYLA 4R2WA 1Q0SA 4ZP1A 4YI5A 3GPCA 3I9MA 4YQEA 4IDDA 2CXTA 2XBMA 1FEZA 2GI4A 1KOLA 3C6YA 2QW0X 1ZJWA 3OFND 4BNYA 2IBSA 4WIAA 5LZ4A 4O2LA 3AM3A 2ADFA 4KO1S 3AEZA 4A23A 4ARIA 3K1AA 1HC7A 1XCPA 3P2IA 5DXJA 3JVVA 2P67A 1H5NA 1Y7TA 3UMYA 2C04A 4G0WA 2VYQA 1AHHA 2XJ9A 3KHUA 3KTFA 4UUOA 4PY2A 3GFRA 4KREA 2FSPA 4CTOA 2TRSB 3SLRA 4L76A 2C1ZA 1DZIA 3G9ZA 4Y2VA 3PHHA 4J3JA 3NFYA 4HAYA 3WV4A 4K88A 1BJTA 4NICA 5FWXB 1U90A 2HRBA 4CMEA 4Y30A 1SQ0A 2O2SA 5LOVA 1I80A 5E6UA 2HSGA 2FN3A 4Z4CA 1OILA 1V3UA 1VDZA 4FNMA 4MQ5A 1U0TA 4XI9A 2VHZA 4ALMA 4P83A 4ALKA 4YUWA 4XD2A 4JVMA 3HHEA 3RC8A 4J9UE 4ZTZB 2Y4OA 4LQDA 1L4GA 3NIGB 2FZCA 2WTBA 1TYCA 1UXHA 1VXRA 2HNAA 3KJGA 4L2IB 2GD1O 5DFAA 3AYXB 3C7DB 4GNRA 4RBNA 1JF8A 5LDHA 4FGZA 5HCNA 4NV0A 4AJJA 3OUZA 4ZD6A 2QQFA 1EXVA 1I33A 3EDMA 2CNWA 2QQ5A 3PICA 5BT8A 3IQWA 2EJCA 2VJOA 3EXG1 4OJNA 3U6KA 3GNSA 4PBSA 4H4DA 4WZBB 5LP6A 3U5TA 3OMWA 2PUTA 3K70D 1O1YA 3PA8A 2FSVC 2E6KA 4RGBA 4YCMA 1JR2A 1MFZA 4F2DA 3IT0A 4L75A 4NV1A 2TMGA 4WMLA 5JSZB 1WW8A 1MFPA 2C5SA 4QTUB 1UXIA 1RZRA 2C5AA 2AYXA 1NXSA 1E1DA 2XKJE 4XJXA 3L84A 3ZU4A 1E3WA 2X7HA 3OTQA 5DYIA 3VAZA 2JC3A 2ZEJA 1W36C 4MWDA 4DLBA 3DLIA 4PZ9A 4ZJZA 5C3UA 1RWNA 1QGUB 2GLUA 3NNSA 2C97A 3ER9A 2VJNA 5FA5A 3AFOA 4XQGA 5EPUA 2ZCUA 1UM9B 1PR2A 4X8LA 1M72A 1YACA 2D54A 3EVDA 2DT8A 2ODWA 2QLJA 1EHCA 3D64A 2C7GA 4MV9A 5DB4A 2DHRA 1ZJ6A 2RSLA 2C4UA 4HNRA 4N9WA 1J56A 3IPLA 1F7VA 1SK8A 4K9NA 2BZSA 1SOVA 5EE3A 1YJCA 2WUWE 1XAIA 1NZJA 3SBOA 2BJVA 4I1OA 2ATCA 5IWAB 4V0LA 4DCGA 4ZRDA 5AW1A 2JH9A 3Q10A 2Q5OA 3ZHTA 4AMBA 4KGXA 5IM5A 1DWOA 1IIBA 1P2UA 3KKEA 3O8DA 1X1SA 2EATA 3H3XA 4RYLA 3CUSA 1Q20A 1YVUA 1CUSA 4PX5A 2KM1A 3VMFA 2GCOA 3RGWS 1T5SA 1KEKA 4TZ6A 1JQJC 4KQ1A 4AX4A 1E9FA 1K8RA 4GO1A 2RBGA 3PQDA 5FTMA 3LCCA 3VNSA 2ANBA 2PD4A 3NTVA 4N5HX 2XV1A 5C80A 1GZ7A 4W1SA 1XAJA 4KPGA 1OLSA 3MUEA 2PD3A 2X7XA 1T8PA 1G8PA 1YR3A 2PUCA 1JDNA 2PSEA 3ZE7A 2X5NA 2PGOA 4RD3A 3TRFA 1U4NA 1CUBA 4XLLA 1UBMS 3MRXA 4JQSA 2FZ4A 2GF9A 1QK5A 1W0CA 1DT5A 1BMQA 1RYZA 3ANMA 5F4BA 3BDVA 1UJNA 5DGDA 4DM4A 5BVGB 2C7PA 1VE5A 4JC8A 5JT1A 3J7AC 1PW7A 2CLKB 1EBFA 2KHZA 4JLNA 1R0BA 2YWJA 3EF1A 4MZDA 2IWHA 1VRVA 2OB2A 5G1NA 4CQLA 3E7FA 5FH9A 2KB0A 3KETA 2C4MA 2HF9A 1Y8QB 1K0FA 1K8QA 4EWLA 2DHEA 4GD3Q 5BUZA 3RHSA 5J3JA 3TQOA 2BHLA 1ZZGA 4MHOA 2EFGA 1OB5A 1M34E 3DC2A 4R69A 4RPGA 4MUFA 1L3IA 3ZOKA 4E3WA 3WYBA 2IH5A 4KXLA 4N6OA 1U2QA 3A04A 2IYWA 4TWIA 2DULA 3N0XA 3T5AA 1V0JA 3MMNA 3PUHA 4FDLA 1QHHB 1XMJA 2CNWD 4R54A 4LMBA 1IJEA 1IPHA 4CEIA 2AFHB 1W88A 2WHPB 3D02A 1UWVA 4Z7QB 2AD5A 1B2RA 3N2YA 3S2YA 2HTEA 3IHWA 1XPJA 1P75A 4DGSA 2POCA 2BGKA 4XYMA 4MR9A 2VNHA 4J1QA 5ALLA 1RZRD 2ZBQA 5HG0A 2B83A 4F5DA 3GT3A 4NYJQ 5FWYB 1GR1A 3D4PA 3OZRA 1BW9A 2C8KA 3WWPA 2Z2JA 4OJQA 2FSHA 5A3JA 5JZBA 4IJKA 2XZPA 5CA1F 4C08A 2QUHA 3IO5A 1EUCA 4AUNA 5GADl 1L2TA 2CLCX 2EDCA 4J0EA 3CZ5A 4OQDA 1M73E 1X1AA 4FT4A 5J2TB 4CIVA 2QNRA 4B73A 4BP9A 4WNAA 2BT4A 1XEXB 1JAHA 2JH3A 1WG8A 5EHXA 3TUZC 1NF8A 5JDIA 3LHSA 2OO7A 4AN4A 3VI3B 1NUTA 3EC7A 2CL6X 4RK6A 4H59A 3EUWA 3HDQA 3RTCA 4WBNB 3I5MA 4P5PA 3H16A 2ORED 4IS2A 4UMDA 5C8ZA 4G8JA 5LA6B 1JILA 3HB7A 2HMAA 4I1UA 2FEXA 4L0QA 4YAOA 2E82A 1NP7A 4R9RA 4RJLA 4NEQA 2K2WA 3JATB 1T4DA 1EQUA 3B9PA 3R0ZA 5L3RA 3DO6A 4PO8A 1XKTA 2NAPA 5F1KA 5DTIA 4N3CA 3DV9A 1H3NA 3F3SA 4GKBA 3JU3A 2D3WA 2OFFA 3IA2A 1PUJA 1HDCA 3DDUA 5LQSA 5TMEA 5EJ7A 3D0KA 2P6RA 3VHLB 3CZMA 5GZ3A 2HBRA 5KMGA 4C78A 5AKKA 1TM2A 1SUEA 2V7EA 2ZWMA 3D6FA 4L6AA 5B3LA 2H4FA 2FMFA 2N1MA 1VECA 4G3XA 4D45A 3ANSA 2FPPA 2IIBA 3LX8A 1MD9A 3OETA 5JTTA 2DBRA 4JEHA 3GFBA 3RUIA 1F51E 2GVNA 2NZXA 5KWJA 3DL4A 1O97C 1BVRA 1OFTA 1ZJYA 4YH1A 5EMHA 4N3BA 3TLAA 1W76A 4DQUA 2IHUA 3PFNA 4MJLA 1JUDA 4DMLA 4D97A 4ZU1X 4X1IA 2ZJ2A 3BTOA 4JYCA 5FBLB 2WBLC 1HG1A 3VR6A 4C05A 1R8YA 3SGLA 2XHEA 3RKUA 7ABPA 2XRFA 3WX0A 2FZGA 4NNJA 4MGHA 2JBHA 3EIQA 3KXPA 3L7MA 4IYRA 5JZSA 1FJXA 1KDPA 1DQRA 1SKYE 3AJ9A 3Q72A 4TLBA 1DS6A 3TDMA 4RENA 2PG3A 1QCCA 2NP6A 4JSTA 4M55A 4M0MA 4Y1RB 1E9CA 4X92A 3VVMA 4BVGA 4DQDA 2FLWA 3SKYA 2O8CA 2XZTA 4OIMA 4C7KA 3S2UA 1JJBA 5AUPB 4I4TA 1CR2A 4YQZA 5GOTA 1XJ5A 2FGKA 2PGAA 2GWRA 2OHVA 1Z28A 4GI3A 4B71A 1RPAA 5LU8A 2P6MA 2BI4A 2QTVB 1LW7A 1L7VC 2WF8A 4TL9A 1SQGA 3HXLA 5ECYA 4LJ4A 4NBSA 4Q16A 5IT9A 3IULA 1P6QA 5DI3B 3DCJA 3BH6A 1Z8HA 3MS7A 1ZY2A 1OASA 2LNDA 3CW2A 3FFWA 1UJ2A 4MUKA 4Q12A 4KEAA 3NB0A 1XCMA 4JODA 4OA5A 2R8ZA 2Q07A 3KQOA 4I9HA 3ZNPA 4KFCA 3TQTA 1XK7A 3C3WA 2FN4A 1T8YA 2VCYA 3AF3A 3OQMA 2YW2A 3QE0A 3GLGE 2R4TA 2QR5A 1PBTA 2PKXA 3RDPA 1ZVMA 3FYUB 1MGOA 4BWGA 5C46F 2HWKA 1PJSA 2GCPA 2Q3HA 2VT6A 2VK1A 1JALA 3L4BA 3R23A 3AI3A 4ZVVA 3T3DA 4CKEA 2ZVJA 4G8CA 8ABPA 4OHFA 5CDHA 3UT5A 1Q7BA 3KLBA 4IM7A 2FSFA 4MH0R 1NDQA 4BQSA 4MCIA 2QSZA 3FFTA 3ZVNA 1E0KA 1J7JA 1JGTA 2ODNA 3GRZA 3QP9A 2PMKA 3OIDA 3S5UA 1QE5A 5DXFA 3O91A 3VJRA 3L1JA 3OPNA 2HGZA 3R4VA 3IHLA 1N36B 4KOAA 1DEKA 1YJQA 3RYHB 2W2XA 1GOTA 3DDZX 4FMBB 3MWEA 4NNOA 3VPSA 4KE7A 4N12A 4IEFB 1L4FA 3MNFA 1EYZA 2EARA 1CUCA 3BGIA 3BIWA 3BQNB 3WK4A 3EFEA 3RU9A 1VMAA 2EQ5A 4NU8X 2BLNA 2BC9A 4MW2A 3B8HA 3HSSA 3ISVA 1IEXA 3VO1A 5DBFA 4DSOA 1IBLB 2DERA 1YR6A 3UAGA 4RXTA 1XL0A 4KN9S 1KO4A 3FPFA 4OI0A 1Q1QA 4MQEB 5COBA 1QDUA 4AD8A 1P2DA 4F84A 1JRLA 1RM0A 3QPUA 2C98A 3REQB 1F2TA 3C87A 4FWBA 4CE6A 3ZY3A 3NTRA 4X20A 3DOUA 1Q0RA 3R3UA 3KL2A 1J0BA 1WS6A 4HUJA 4M87A 1M2OA 2DKNA 3ZV7A 1E63A 1P17A 4DLWA 3T5DA 5BSKA 5JARA 3O8OA 3OZFA 1PWYE 1XCLA 3FHLA 3PFBA 4Z3DA 5JSFA 4JC5A 2JASA 3EXEB 2OENG 4UQLA 1ODFA 2WZQA 5DULA 3OFJA 1T9HA 2SECE 3VR6D 4BAGA 2HR1A 5CK5A 1CR6A 1Y1SA 2GFHA 2QYHA 1Z5GA 1Y8RA 3RRFA 5BRNA 4D92A 2D3TA 1KMHA 2JRLA 4KK3A 3T6KA 1EB8A 2XB4A 1IWOA 1D2GA 3B9QA 4UDNA 3SZRA 1AXEA 1I4WA 3EW7A 3NV9A 5FRDA 1JTVA 5H4GA 1O96A 3K6RA 4A9AA 3KB6A 3MJ4A 1XXHB 1Q3KA 3GUHA 3HGMA 1VPLA 1D2NA 1IEWA 4CLHA 1OTYA 3QUTA 3WLNA 4AY3A 5BSEA 5CPFA 1V3QE 3PGLA 4I1PA 3AVXA 1QTRA 4YP5A 1D7AA 1X6VA 3KSMA 2NPFA 5J59A 1X13A 2WM2A 5ED0A 3CCBA 2VDJA 3EBOA 3EZYA 3V7YA 4EB0A 1LLFA 3O8QA 5HE8A 3SEFA 2QUZA 2WA2A 3CIOA 2GFQA 2ZP1A 3OT5A 1T0JB 4TV9F 4F3NA 1EJ6A 2ONKA 3K9NA 1P72A 3GG2A 4GM4A 3A9WA 3QNMA 3VKVA 2R60A 3DZFA 3DG9A 4P80A 2O1SA 2CVZA 1KYZA 3M1AA 4ZCLA 2AEMA 2R7KA 3BILA 1XU9A 2EWVA 1AHIA 4DLUA 4U4AA 4A8HA 1Z22A 3IYLW 3PNOA 5EE5B 3MJSA 3U3RA 3EQ9A 4Z1OA 1QOPB 1CJUC 2ZWAA 4IEEA 3PF9A 2YFHA 1FBNA 1QHXA 1D0IA 1TLFA 1VA4A 4FZ5A 1Y3DE 4Z0PA 2PEZA 1N8TA 4OHBA 3R9IA 4BNJA 3EUAA 3SZGA 3WHPA 1DFHA 2YFYA 4KJXA 4MYCA 5JRZA 3ZS9A 4UTVA 2RBEA 4MVCA 2OCGA 3CVVA 4LQ4A 1P4RA 1OU4A 2C8VA 2I76A 3PPXA 2PUGA 1KU6A 4GP6A 4P7KA 1K98A 2W70A 4Q9DA 3SIXA 2QTBA 4OP1A 5B6JA 5KWEA 3Q3VA 2QG4A 2XRMA 1N1MA 3GO4A 4BRSA 1N34B 4PFSA 3EEOA 3PC4A 1ISIA 1PGOA 3ONFA 1K3UB 1JIQA 1W5FA 2C1EA 3P5BA 1XX6A 1ZH6A 3DUWA 3CH5A 1AKEA 1CZUA 4OPMA 9LDTA 3GGPA 4DUPA 2BFAA 1Y37A 5JBQA 1JKJB 3FAZA 2C2BA 3TZLA 4DHWA 3ORSA 2HOQA 2VOJA 3MILA 3NM5A 1NFRA 2YHSA 3S1LA 1ZN9A 2PS0A 2YZGA 3AB8A 5KNBA 2V6BA 3OOEA 3GI1A 2C4WA 1ZRSA 2DLCX 1RBZA 4GNKA 2ZBUA 2HGSA 1RCFA 2O3QA 4GR5A 2NO7A 1BE0A 4O2AB 3LYLA 5EEGA 5F5NA 3EC1A 5DBOA 5JS2A 4QUJA 3I9V6 2O1EA 3V7FA 2PBZA 1N8NA 2PQMA 4N54A 3IAUA 3A4TA 4ZZIA 1L4EA 3K0FB 3VDRA 4DR3B 5FBQB 1RQNA 3VXKA 1F6DA 1P1CA 3LXMA 4MKRA 4NMMA 4TV8B 1XMQB 5DBIA 1JT9A 3N2IA 1ZFNA 2ZQ5A 3LL4A 1RTKA 4JQCA 1PBNA 1YJ8A 3K4PA 4A6XA 1EFPB 2GNPA 3Q8KA 2CHVA 2EW1A 1J90A 2HV8A 2N42A 3QMMA 4JIGA 1E5DA 4P8RA 3SZMA 4FK8A 4LI0A 5EIEA 2HDWA 4MKIA 4KVZA 5IX8A 2VFAA 1GPKA 4IJVA 4BQNA 4YCAA 2GZHA 1FX0A 3BIJA 3QOXA 4DOMA 4JI2B 3ABRB 3VZRA 5T67A 5CEJA 4B6QA 1PKEA 1XQ6A 1CR1A 3TZBA 3IEVA 5J4YA 3MSXA 4EW3A 3BTVA 5ALNA 4U2EA 5EUQB 5HFJA 3TPFA 4DBVO 1L6RA 1A76A 2NV2B 4OI1A 1TKCA 3IL2A 3LI2A 2OKGA 2FEMA 3NRJA 5KWIA 2O7QA 1E9VA 1FFHA 3JQ7B 3QA9A 2D1SA 4PX9A 5DOVA 5TY0A 1AO3A 3KQTA 3EA4A 2OAQ1 2C4NA 3DYVA 1LDEA 3LP6A 3D9QX 3SBEA 4UASA 4P3NA 1QNFA 1K5HA 1KQGA 4YJ3A 3TDKA 5EWMA 4E22A 3WL7A 2SHKA 4QLAA 5TQ0A 4OH7A 1NOKA 1IJKA 1P4HA 1G98A 2G40A 3KWLA 1QF9A 3R6DA 3QMWA 2Q2WA 2YYSA 4TV9A 5KEIA 1L7MA 3FWHA 4PYNA 3C3EA 5KTSA 1U0HC 1WQ3A 4F9TA 1FQOA 1GFSA 2R65A 2BDEA 3DNPA 3C8MA 1YO6A 3T5CA 1A88A 1DMRA 3AVWA 1IK6A 3NHSA 4BV2A 1H4QA 2PZ8A 3W8DA 4Q3OA 2NZWA