4H3KB

Crystal structure of a ternary complex of human symplekin ntd, human ssu72 and a rna polymerase ii ctd peptide phosphorylated at ser-2, ser-5 and ser-7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Symplekin
total genus 67
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h3kB01
1DG9A 2IPMA 2A9QA 4YR7A 2N9UA 4L4UA 4F3TA 4MPTA 1XWWA 3I5AA 1BA2A 1YK0A 2QVGA 3OLXA 3G1WA 3RH0A 1ZAYA 2F8SA 1TM2A 3N53A 3HJFA 4HNRA 2FTKE 2QXYA 5ABPA 2FLWA 3DLHA 4KRFA 5EWLB 2ID9A 3OQNA 3OMXA 5B3JA 2IPLA 3Q41A 3QLVA 4DN6A 1LBHA 1KMIY 3TB6A 3R0JA 2PKXA 4MQFA 1ZVVA 3RVNA 1NXXA 3UUGA 5KI6A 1QP0A 5C5CA 3Q7SA 4XARA 4XASA 1NXSA 1YK1A 2FMFA 5CNIA 4IMIB 3DGEC 5IEBA 4JAVC 2W42A 3N8IA 4IRXA 1QNLA 1SD5A 3HV2A 4RY0A 1NXVA 4O1HA 3H1FA 3GWGA 1K68A 1ZY2A 4LE2A 2PUGA 4NCAA 3VNAA 4YCSA 2VK2A 3VNBA 4B09A 3O1JC 1JYFA 3JTEA 3BRQA 5BRJA 1BDJA 2PUAA 4O1IA 2M98A 4UHJA 3T6KA 4LE1A 4Z9BA 1Z18A 4RK4A 1U0SY 2GWRA 2MSKA 1JDNA 4MR8B 1DC8A 4N47A 1TJYA 3MIZA 3CHYA 1DCMA 4RXMA 4IF4A 1U2QA 3IPAA 1DCKA 4F12A 4W5NA 5DCLA 4MR7B 2FSPA 3CZCA 2IYNA 1PNTA 3O2JA 1P6UA 3JS5A 1SXIA 3HUTA 1JFVA 4W5QA 2ZWMA 2I6FA 1PHRA 4KQ9A 5HM6A 1ABEA 2QR3A 1C4WA 1LK0A 5JNWA 3ILYA 1YTUA 5CNJA 5GQSA 3L6UA 1NATA 2M1ZA 3KLNA 1M5TA 4MQEA 3GYBA 4G0MA 3GBPA 3IP6A 3OLWA 2LBPA 4RY8A 2PUDA 2E4VA 2JBAA 3KLOA 1EFAA 2FKAA 4WT7A 1ZDMA 3H6GA 4PYRA 3TD9A 4ETMA 1L5ZA 1P6QA 4KVFA 5FBKA 3FFWA 1EHCA 3HS3A 2PMCA 4RV5A 4Z4FA 4FB4A 4MR9A 3D02A 3FFTA 1DRJA 3RVOA 4EUKA 4MLDA 2FEWB 3CFYA 2PE5A 2A9OA 3C3MA 2R25B 3A10A 3B2NA 3MMNA 4OG2A 3KCNA 2VUIB 4EYQA 3TO5A 2HQOA 2MYUA 3O1HB 4H3KB 3K4HA 3IP9A 3N0RA 2ZAYA 3KSMA 1F51E 5CHYA 3SNKA 4RU1A 1EWKA 5KC8A 4KREA 1Z26A 3NHZA 3C3KA 2PJUA 3H75A 2MYTA 4Y9TA 4RWEA 4ZPJA 3KTOA 1DBPA 7ABPA 4HNSA 1P2FA 2HPHA 5I4CA 2FMIA 2E4XA 4MS4A 5BRAA 3OLZA 1NTRA 3IDOA 5HSGA 2LUOA 4ML3A 3I09A 3LKBA 3C97A 3EJWA 3D8UA 4Q7EA 3RVRA 1ZH2A 4HYEA 2HQBA 3RVMA 4ZYLA 5KWSA 4DQDA 2LPMA 2QSJA 4D74A 1DBWA 2OQRA 1D5WA 1M2EA 2PAFA 1FFSA 2FQWA 2DRIA 8ABPA 3F6PA 5DGCA 3MM4A 5CNMA 3F7NA 3CG0A 3MQ4A 3NNDA 5TQ2A 2RJOA 4H3HB 1HEYA 5BQ3A 4XXHA 1QQBA 5CNKA 1Z2DA 2H0AA 2YHAA 3KYJB 1AB6A 3BREA 4W5RA 2VYCA 3CZ5A 3H1EA 1XHEA 3H5OA 4IILA 4MS3B 3Q7RA 1TLFA 5KQLA 2NT4A 3HCWA 2CWDA 5FWYA 4KPYA 4FE4A 4WZZA 2CHEA 4Z9AA 3OM1A 3CNBA 4M88A 1K66A 2FQYA 4EVRA 4PICA 1PEYA 4QYWA 4TN5A 3LKVA 2V0NA 4ZJPA 2TMYA 4KK3A 4EVSA 1A2OA 1JBEA 3OMWA 4W5OA 3RVSA 5FWXA 4Z4CA 3DZDA 3QX8A 1NXWA 5IBQA 3FFXA 3A0UA 2XDYA 4LX8A 4OLBA 1A04A 1P8AA 3ROFA 4MQEB 1CHNA 3OLYA 3DLBA 1BDHA 2IPNA 3JPWA 3KYIB 4NV3A 4D6YA 5DTEA 1ISRA 3DBIA 3O75A 3I45A 3HVRA 2GX6A 2HJ9A 1PUXA 2FQXA 3OO0A 4XLTA 4MRMB 1L5YA 2H3HA 2VUHB 4N41A 4Z4GA 2FMHA 1T34A 3HXMA 3BRSA 3JVDA 3IP5A 1M5UA 4P1ZA 5IUJC 1Z17A 1JFSA 4MS3A 3LUKA 5TPZA 3TMYA 1APBA 1QQAA 4MRMA 3GRCA 4RXTA 3GV0A 2JCGA 3C3WA 2PUEA 4RK0A 3EAFA 3QEMA 3LUHA 4E7OA 2E4ZA 1NXPA 1QO0A 3N0XA 4G0XA 4NICA 1MB3A 2QZJA 1B00A 1QKKA 3CLKA 4RKRA 2FN8A 4TLLB 1YIOA 4RK6A 1JWLA 2MYPA 2RJNA 1YMUA 2IOYA 1OXKB 1CEYA 1ISSA 3M9XA 4TLMB 5TPWB 3H5WA 4LDAA 5B3JC 4RK7A 2P4UA 3N75A 4G0OA 1OXBB 2X7XA 3N0WA 5FBHA 2F8TA 4LZLA 3OQOA 3UK0A 4O5AA 1ZHHA 3QEKA 2WMYA 5KC9A 1JL3A 2J48A 2JRLA 1WETA 5KQGA 1RPJA 4YWHA 1PEAA 2O20A 5EWLA 1JYEA 5JS1A 1EAYA 4G0YA 1J56A 4G0ZA 5HQJA 5JS2A 1SXHA 1W25A 4KMRA 3SAJA 1GCGA 1USGA 3RVLA 4JASB 1R8JA 1USKA 5EWMA 1VPWA 4Q6BA 3SQNA 3H5IA 3M9WA 6ABPA 1USIA 5EWMB 1FFWA 5EWJA 4OATA 4QYMA 3CRNA 1Z13A 1DJMA 3P9YA 3EGCA 2AYXA 1M2FA 1DZ3A 2NT3A 2P9HA 2PLNA 4Z99A 1PNRA 4OLAA 1KRXA 3HUUA 1ZGGA 1RZRA 3QELB 1Z12A 9ABPA 1MIHA 4JB0A 2JK1A 1RXIA 3HEBA 2FVYA 2GKGA 1DC7A 2MYNA 4JA2A 3EULA 1ABFA 2LIVA 3LUAA 4WXEA 2KYRA 5JNRA 5JNUA 1JDPA 3CKMA 3H5LA 3Q9SA 3LUGA 4F11A 3MYYA 4IGAA 3E3MA 1YMVA 2E4UA 2PUCA 4S04A 1MB0A 1NXTA 4ZMSA 3W9SA 4YGXB 5TQ0B 2HSGA 3EQ2A 3T38A 5TQ0A 4JB2A 4EGSA 4G0QA 4JP1A 1DCFA 2NZUG 3HDVA 2FN9A 3O2SB 4EYOA 5IUKC 1D2AA 1MVOA 3O2QB 5TPZD 2NUBA 3GA5A 4YLEA 1DP4A 2ID7A 2FEPA 4RZSA 4WWHA 1JHZA 1YVUA 3KKEA 4D6XA 4MR7A 4YS6A 1MAVA 3NNSA 2A9PA 3GL9A 3HDGA 3HSYA 1Y1LA 1A0OA 4YV7A 1JX6A 4MLCA 2CHFA 4MYRA 4KV7A 4YRZA 4KZKA 4Z4HA 4N0QA 3Q15C 4N0PA 3QK7A 4MR8A 4MR9B 3CG4A 3LFTA 4RXUA 3LTEA 3Q7TA 1KRWA 3O74A 4Q6WA 3S99A 1SRRA 3H5VA 2IKSA 2WWVD 1NY5A 3JVIA 1YS6A 5FWYB 3KS9A 1S8NA 2JBAB 4NQRA 2E4WA 3URMA 3F6CA 4RSMA 4RKQA 1LJLA 2WJWA 3C6QA 5HKOA 2WJAA 1Z2EA 1UDRA 1FFGA 4MAAA 2BGGA 1Z15A 6CHYA 5D2CA 5TE9A 3G85A 3RVPA 1SXGA 2QW1A 3UKJA 2OENG 1LBIA 4YO7A 1D1PA 4IMJB 4E7PA 5JNSA 2FLKA 2FXIA 1D1QA 5F64A 4EVQA 3QLVC 3EQZA 2IDMA 1VRVA 1ZESA 2Q5CA 3E61A 3LOPA 2B4AA 3NNNA 1TVMA 1E6KA 5PNTA 3IPCA 1D4ZA 4W5TA 4WUTA 4HNQA 1JF8A 1JLKA 1XHFA 3RVQA 3SY8A 3HK2A 5DLEA 5KQMA 1BVHA 1RNLA 4L85A 3NHMA 4P98A 3FDFA 1U2PA 3BILA 4QPJC 4TMYA 4Z0NA 5IULC 4NCBA 4PEVA 3MF4A 1EWTA 2AYZA 3QEMB 4JOQA 2NZVG 4H60A 4KNYA 2GI4A 4EY3A 3O21A 2RDMA 1YS7A 5C5EA 1ZH4A 3KG2A 4GPAA 1CYEA 2R48A 3M6MD 1QP7A 2R4QA 3H5TA 3HZHA 3A3KA 1QO0D 2FEKA 2HQRA 3I42A 4EYGA 1U8TA 1QPZA 3LMKA 5KQPA 1NXOA 1QMPA 3QLTA 3L49A 1W9HA 2GBPA 3JPYA 4RS3A 4Z4IA 3DGFC 3BBLA 2JVIA 2L17A 5JNVA 1JFTA 2JVKA 3OO1A 1U04A 2L2QA 4FE7A 4MS1A 1ZITA 2QV0A 2WB4A 3EODA 2A9RA 4F06A 4ETNA 5DKFA 3TX6A 2QU7A 4G97A 1GCAA 1Z16A 2L19A 1GLGA 3JY6A 4RK5A 5IUNC 4KQCA 4G0PA 4KFCA 3RVKA 4MS4B 2LP4Y 2PUBA 4QICA 5E3JA 3SG0A 4LDZA 3EDCA 1ZGZA 4WXMA 1LJUA 4ZMRA 3LUDA 5JNTA 3KHTA 1RXEA 4N76A 4LE0A 3H6HA 2WY2D 3ROTA 4MGEA 4DADA 1RZRD 1AB5A 3KJXA 1DBQA 3LUJA 1QP4A 2B1JA 2FW0A 3MA0A 3HM9A 1VKRA 2JVJA 1URPA 4G86A 1KGSA 1F4VA 3QLUA 4N03A 2E4YA 2WRZA 3FGZA 3CS3A 4RY9A 2MSWA 3CTPA 3OLVA 3LUCA 4EYKA 5EWJB 1E6MA 3RVJA 2PUFA 1FSPA 1FQWA 3IP7A 5TQ2B 3T95A 3GT7A 1Z25A 3LUFA 4OBBA 4LRQA 3RQIA 1I3CA 1BAPA 5T7BA 5GOTA 1TMYA 1IIBA 2QVCA 3QLUC 1C0EA 4S05A 4XAQA 1E2BA 4MS1B 2IPAB 5IEJA 5FWXB 1BDIA 3GBVA 4UHKA 2FMKA 4KK4A 5IC5A 5IX8A 3QX9A 1EWVA 4Z4EA 3O1IC 4PE5B 3FMVA 3OQMA 3ILHA 4XFKA 2CD7A 3K9CA 4OTZA 1E6LA 2YHBA 2PL9A 1VLZA 2RGYA 1H9CA 5ED4A 4CBVA 4MQFB 5BR1A 4ETIA 1ZN2A 1DRKA 5T3YA 2PL1A 3HO1A 4RK1A 2JB9A 2L18A 3SM9A 4F8JA 3T8YA 5TPWA 2MSLA 1GUBA 3NBMA 5TQJA 3N6VA 3OM0A 1JH9A 3QELA 1GUDA 4RDCA 3H1GA 2R47A 4YP9A 4PZ0A 3F73A 4GNRA 3CU5A 3A0RB
chains in the Genus database with same CATH superfamily
2BFFB 2QUHA 4NBKA 4ZAXA 1VLLA 1Q5PA 1BE8A 4ASUA 3HACA 3N2LA 1UPBA 3JAMA 3OCUA 2VUSA 2NG1A 3SDBA 1LEHA 1PFGA 1JHOA 1G60A 1FRQA 3QOWA 4N7RA 4U3JB 4RX1A 4E14A 1SUBA 3AEQB 3LP5A 3AVWA 4DCTA 2ZUFA 1IZ9A 2P2SA 2OCGA 4LZPA 1XKXA 4NU0A 4RLSA 5JDCC 4OI1A 4YDQA 5JQWA 1W87A 1RQNA 1SC3A 4UE2A 3DLPX 4K7JA 3AKZA 1V5EA 2FUKA 2GN6A 2ZAGA 4WOKA 2V6JA 1PEKE 3WVNA 4E6PA 1TD9A 4QTUB 3PUVA 1L8OA 4E1VA 3ZCRA 2EG5A 3KVOA 3QM1A 2O3SA 2EJBA 2D0PB 2JEYA 4O2AA 4QJ4A 1OVGA 4A2QA 3ORRA 3N3AC 1A7UA 3K71B 1S89A 3OA2A 4XASA 3DFKA 3C43A 3T35A 4EGAA 4Y1EA 1M1ZA 1PLJA 2FFJA 3DHEA 5EQJB 3AI1A 3BK7A 2HTEA 4ZO8A 2JGRA 3Q0EA 1SD5A 1SVMA 2YH2A 3FIUA 3GD7A 4O2BF 5BVGA 3MWJA 4UXHA 2FUCA 1F2UA 2QXTA 4NCAA 2ZBPA 3IMKA 2IEIA 1TJ3A 4D4HA 1IOLA 1X1QA 1Z47A 1C30A 1YBVA 1YL6A 1ZK4A 2WYWA 1BDJA 2Q41A 1U5BA 1XKLA 4O1IA 3MBOA 5E1OA 3H4TA 2QR2A 4CM7A 1C3JA 2UYCA 3QFSA 4B4KA 4ER3A 1RAEA 2J4FA 1GNVA 1X8KA 2Q5JA 2XLBA 3C16C 3CNLA 2PMFA 4KLNA 4C43A 1NXQA 5ICMA 5JASA 3NATA 4BFVA 3QKUA 3ETCA 1E2FA 2C94A 3J80A 2SKEA 4HCJA 4XYMA 5IXSA 2GOYA 1U2QA 2I3DA 4AZ3B 1YNSA 1Y5LA 4LRTB 1JA9A 4MR7B 3I8OA 3K4PA 1OX4B 4EG4A 2Y1KA 1N3BA 4CF7A 3VZSA 1XEXB 4FS3A 2GCPA 2HSJA 1AJEA 4UBIA 3ZGVA 4WK0B 3NC0C 4NZYA 1J42A 1XCOA 1GTL1 1G17A 3ANSA 3FCXA 4H27A 1OI3A 5JJCA 2DECA 3FYUB 3F9CA 1C4WA 1QPBA 2R4TA 3QVOA 4RY2A 4X6LA 5EE3A 4DHWA 2CC2A 2WSSA 3PDUA 5J1SB 1Q7GA 3KEGA 1OFUX 3N1UA 3AINA 2V7VA 5C1DA 3AB7A 2JIQA 5BT9A 1Q84A 1TECE 2I7VA 2X2EA 2PHZA 3I23A 3KU1A 1PL7A 3T7TA 5IH3A 3K94A 3TCNA 1B3RA 5DEIA 1Z2PX 3MS4A 1JTEA 1S6YA 3W5VA 2RARA 1CBUA 1RHJA 4JFAA 1RQRA 3C45A 1CDZA 5ELXA 4RV5A 1IQPA 3O8CA 2VQEB 2DR3A 3VRHA 3G9ZA 4KN9S 3UK7A 4L22A 3KHKA 4CFSA 1QKJA 2XD4A 4J91A 1Z5NA 3WYDA 3ES9A 1PDWA 3HDJA 3W5SA 3AWIA 4BHTA 3VOSA 5TLSA 3IEMA 3N87A 3PQ5A 5H1YA 2QQ5A 4EVRA 4HLQB 5AIBA 2GKOA 3L7DA 2WZQA 2V7WA 2IYYA 4OQYA 3HJTA 4BX9A 3I62A 1X7XA 2HJGA 5JRZA 1PZGA 3ET4A 4IV0A 1F9AA 4LNHA 1U2EA 4WJZA 5AKLA 1LXCA 1D04A 2JGKA 2GZAA 4DS3A 3TBFA 3QXJA 2Z1NA 1P9WA 3BCUA 2DBRA 1TEXA 1KP2A 3KTOA 3V1MA 3VTKA 1XPRA 2JFOA 1MNAA 5C1BA 2ONCA 2ST1A 2ZIVB 1JLLA 5COBA 4QGBA 1ZIOA 2QD4A 2QG9A 3E3OA 3LHSA 2ZS9A 3OIGA 1JMVA 1RI2A 2R6HA 3ONVA 3ESAA 1MH9A 4HG2A 3GB9A 5EJGA 1XXHA 5HQ3A 4MEBA 1OC2A 4Y0VA 4WK2B 4R3WA 4BZPA 4BO7A 1F2DA 1QIEA 1DXOA 1YRQA 4HDRB 4D74A 5KU1A 3TG2A 4KPUB 2XUKA 3JASA 4OGLA 3BDIA 4AQ7A 2WICA 1C4OA 1NGSA 3FVRA 3SF0A 3W04A 3R3JA 1TM5E 4AUMA 4KIJA 3ZDAA 4JCOA 1D0VA 3LLVA 1HEYA 1NF3A 1XA4A 2H1CA 3QLEA 4JJZA 4ZOAA 2ZAIA 3EG5A 2C2XA 3CR8A 4KYIB 4MV0A 4XXHA 1G98A 3P9PA 4MHOA 1B6RA 4PX2A 4A16A 3ZZMA 2QRUA 3GH1A 2PKYX 3HMQA 3B8EA 3ANMA 3UF0A 4PG8A 4OI0A 4W9NC 4B0OA 1DI0A 1PIWA 2AJTA 2AUTA 4V39A 3OZAA 3ZGOA 3SXUB 2NVBA 4G0VA 3Q9UA 2R8RA 3G23A 3Q85A 4QULA 3DVAB 3N5KA 1Z8HA 3OM1A 3VVCA 3ZGYA 4DMRA 2H57A 1LUAA 3I01M 3L92A 4PICA 4P33A 1I33A 4QYWA 1BRMA 2G09A 4WA7A 4NC9A 4NV1A 3U13A 1FYXA 3TIGA 4ZJPA 2JFXA 3UHJA 5J4KA 5IYZA 3CVUA 3EDMA 5C4IA 1ZM3A 2Z8YA 2H65A 4BNIA 4LZAA 4R16A 3EPHA 5JV5A 1MU0A 3UUFA 4DANA 1M5RA 4M46A 2YNMA 1CB7A 3LPCA 3NUGA 1PHPA 1JDZA 2YV2A 1EBUA 3ROFA 2B4KA 4HNTA 2IYAA 4ZT3A 5H81A 1W7AA 2WBLC 3FSRA 1GEEA 3NP9A 1Y3CE 3ADBA 2FA9A 2Y1EA 3GC6A 2AA3A 4TXJA 4WV3A 1OIWA 3OBIA 1PSZA 4RHUA 4GR9A 3CF0A 3AHIA 3JW8A 3IDAA 3OO0A 3PA8A 3KZCA 3R09A 3TLGB 2HA5A 3V80A 3I52A 1FVHA 4M6WB 1UDBA 3RBAA 4DDTA 1M8KA 3FSGD 2YUTA 3LBIA 3VJMA 1Z83A 3E5NA 1D2RA 4J0CA 4MMYB 5JIBA 3DL0A 4FIDA 1BD3A 1P9OA 4F11A 5AVUA 5K0GA 5KQSA 1AHIA 1JNXX 1PNQA 1QG0A 1VJ1A 4GPEA 4BZQA 1BQ4A 1VCOA 3U49A 3UFBA 3UWOA 3LSYA 1VHWA 3LYAA 4IJ6A 5TIIA 1X13A 4RHYA 3AY6A 1PV1A 2ECQA 3O93A 4IJQA 1A4RA 4U5QA 4BFXA 1NXPA 1P73A 1XP5A 2P30A 4R8VA 4CFZA 3N0XA 3RS7A 1JAIA 3UW1A 4FFBA 4RQTA 2GRUA 3UAVA 4AX8A 1CR1A 4OQNA 5FHQA 4J0QA 3C5CA 1OYYA 4RK6A 3RS5A 3UT5A 3V46A 2PLWA 4ZYXA 1RLMA 4WGGA 2XNDD 1B16A 2QMQA 3S5UA 3IESA 1OXKB 4TYYA 1ISSA 1R15A 2FQQA 4O4LB 3VZRA 1DUVG 1NKSA 4JJFA 3D8TA 4YRAA 3KFVA 4UVIA 4BNFA 5KSZA 1HT0A 1I7NA 5K3CA 3B51X 3SMQA 4N8DA 2F8TA 4NOMA 1UJMA 3PFNA 4X3PA 2UUBB 2KWIA 1SCAA 1W9MA 4JP2A 4B6EA 4GMKA 4EY5A 2H7YA 3ZKWB 4NYJR 4UEOA 1T9AA 1FJ2A 1R6BX 3AEYA 4MGZR 5KQGA 2VHCA 4HAXA 4YAGA 4W9RA 4EQZA 5I7SA 2QX8A 1N36B 1KQPA 4DLLA 3D81A 3G8BA 3ZNPA 4D56A 1UMKA 3CWCA 1SXHA 1U1DA 5KB3A 1Z75A 1X9GA 1H5NA 1RAFA 2VCYA 1II0A 4RF4A 5FBZA 4G5QA 3ZYCA 1KH2A 2EFHB 3H2JA 4CMAA 4P0PB 5BMVA 3O7WA 2NYUA 2AI1A 2IZ5A 4PAMA 1CE8B 2I78A 2PSJA 2G5GX 4FHFA 3ZXXA 2AYXA 4P8RA 1Y33E 2EP8A 1OIXA 4DPMA 5C7YA 2D74A 4ZU3A 1JZQA 2F59A 4PN3A 3GAAA 4JB0A 3LPAA 5TS2A 1DX4A 1RXIA 2G40A 4NI5A 2MYNA 3T3GA 2QUZA 4HBGA 4HGQA 3HBMA 5TF0A 1G3UA 5D3QA 3QOYA 4LW8A 3K0CA 1YA8A 2ORVA 3P9ZA 4F5YA 2WWFA 1KYIA 1XTRA 3TLGA 3E3NA 1UIRA 4MPJA 5GWXA 3OEYA 5SY6A 4R8SA 1H2YA 4MKIA 1VJRA 3BE4A 4HLUA 4U7WA 3THSA 2ZCVA 3KTDA 1I9CA 2ABWA 1CZOA 2NO9A 2ODBA 1XVLA 1PX0A 3UB2A 5C1PA 1OB5A 5JD5A 3HR4A 2WAMA 5I5GA 1E1QD 1RJFA 5A4AA 4DV1B 3AIKA 4IQ0A 4EHFA 1HOTA 1QHHB 1SWVA 4QGFA 1EP9A 4MIKA 4R1UA 4OSPA 1V3VA 3H3FA 3PGA1 4KV7A 2JCYA 3PNKA 4YRZA 5JCZA 4N0PA 3ZQ6A 4BZXA 1LI5A 4JQCA 4Y1GA 1KQOA 3JQ7B 3TQTA 4P7BA 5F1KA 1AQNA 3QKIA 3FCSB 3GT3A 3PKJA 5EKSA 4KXWA 3B13B 4TGLA 2PZFA 4B6FA 2QTVB 2O2DA 1EFRA 4D26A 1NYRA 3KJHA 1YVDA 4NQRA 3SVZA 3SXUA 5HW0A 2Q5HA 3MS7A 5I01A 5JTTA 1DWUA 4YCMA 2P8JA 3M3HA 1LLQA 4P35A 1JHPA 1OC4A 2W2LD 4J3JA 4QGGA 3TPZA 4DJEC 1DKQA 3U1VA 1PSDA 1A2KC 3UHOA 1JR4A 2V6BA 2PWBA 3MJFA 3O8RA 1RKXA 5HMMA 2Y1FA 1M2VA 3CR7A 4OK6A 4UVGA 2NUPA 4G1CA 5EIAA 3FM9A 5GGXA 3VU0A 2X5NA 4BN5A 4DB4A 5JSZB 4JITA 3WFJA 1N4DA 3EVZA 3P19A 4HH1A 4YUWA 3EBOA 1JXMA 4I9HA 1QHNA 1M2GA 3UKDA 4HWOA 4Q4JB 1M1YB 1PJ8A 1VJ5A 4HI0E 4AZ0A 3IL2A 1M2JA 3G2IA 5CFMA 1YI8A 5EIHA 2BSQA 1KHTA 2Y27A 2XTJA 3HRHA 5IDYA 4J16A 5LDDC 4K0KB 1WXQA 5HZKA 5C3UA 2OPBA 4AP9A 2EQBA 3MWDB 2QQ0A 5DHUA 1AUOA 5ALGA 3ZH2A 4M8IA 2XI4A 1U2PA 2QTHA 2R1TB 1KE2A 2O2EA 1TW2A 4AM8A 1MRZA 5JFOA 1I2ZA 1ZM7A 3QEMB 1KYQA 2V6IA 4EAQA 4H60A 2JPDA 5HM8A 4YLYA 1WXWA 1XG5A 2XUHA 5C5EA 4YMUA 3UBMA 2IE0A 3FHJA 1FX1A 1D2EA 3ZU6A 3DUFB 4N82A 3E8MA 4JI3B 2F43A 3EGWA 1FYFA 1ONBA 1U8TA 2IUTA 4LEIA 4AIIA 4RJTA 1BWPA 1Q1ZA 4KCGA 1KSHA 2YN4A 2PFSA 1J9ZA 5J9FA 1U2GC 4RHCA 4AULA 5A03A 1W9HA 2OHVA 2Q9CA 3M89A 1O95D 1QB8A 3BX1A 3QVUA 4BDSA 1WKCA 1B15A 1VFPA 5AW3A 5IJWA 4ND4A 1UIMA 2YXDA 5JNVA 1LV8A 1OV4A 3KKLA 2ZANA 3OJOA 4NYJQ 3I05A 3BQMB 4FVTA 4M36A 1SUEA 2GZRA 3D2LA 3IPLA 4NCKA 5AK0A 5TR9A 4URXR 1XNQB 4JLWA 2OCKA 4DDWA 4NCIA 1KI6A 3HCCA 1M2HA 3CUKA 3K0EA 2WB4A 5G3ZA 3C6YA 3SLGA 1FLAA 3GRFA 3QPVA 1A5TA 5HHTA 4E15A 2WF5A 5JE8A 2R6R1 2B82A 4P2BA 4R3NA 1MZPA 3JQAA 1MH1A 1QH9A 1F12A 1SVNA 3C3PA 3QNWA 4YPVA 2FWRA 1TAQA 5JHGB 3U7HB 5ARCA 4U8HA 1JECA 1O8BA 2JJMA 2FVXA 3QXSA 1BKSB 2R8XA 2CVZA 2FPIA 3LH5A 2BHNA 4M1EA 1JAZA 5GM2A 4YVFA 3WMWA 1JKIA 3PIIA 1Y3HA 4XGNA 5CR9A 4IBOA 2GPNA 3HA3A 4HS4A 5J4VA 1V7QA 4G37A 1BS1A 2YWJA 2F00A 3U3KA 2X5XA 3WWOA 2PH7A 4UZEA 1FLVA 2WU1A 2UYHA 2OBLA 2PQ6A 1FXWA 4LMRA 1RZUA 3CGGA 4OJTA 1E3SA 4AZ3A 4C5CA 4C7XA 5I7UA 2ZZMA 4ESEA 1DXHA 2WTNA 5LKAA 3IOBA 3O3OB 3BMNB 2JIOA 3CS3A 3EVGA 2ZRLA 2FG5A 3DAHA 4Q00A 4CMKA 5BNZA 3I37X 2Z8XA 4XWGA 4EJSA 2PUFA 2A84A 1B1AA 1ODFA 3F5MA 5BSVA 2EHDA 2PXXA 3T1OA 4DSOA 2V45A 3NLLA 4EFDA 1EP2B 1KO8A 3W4KA 1T0UA 3FVQA 4GI7A 1OBOA 1R6XA 3V8MA 3WQHA 2R11A 4F6LA 4RMHA 3CNOA 4J8PA 4GWGA 2SKDA 4TPKA 5FPTA 4BBJA 5JCOC 3TL6A 3IUQA 2J5XA 1A8PA 3GH3A 3U62A 4OGKA 3ASUA 2MHCA 4KSCA 3VR2D 1CQIA 2DWQA 4FBGA 2IU6A 2WU8A 3GHHA 5HFNA 5COQA 3CLTD 2XVAA 5HCUA 4ALLA 2DBVO 3DF9A 3G7SA 3H3JA 6REQB 5CLFA 3DEZA 2HIHA 2IH4A 3TINA 1VSVA 3EC7A 4IDGA 3CVJA 4GZ3A 2HGSA 2J0QA 4G25A 2I33A 4GGOA 3KJGA 4ARUA 1C3VA 1TIBA 1PG5A 1CDEA 3GD5A 3IALA 5GONA 2GHRA 1JEJA 3ZE6A 3F2VA 4C2UA 2PS1A 4AW9A 1YCDA 1K08A 2INGX 2R79A 4LTDA 3G1WA 4EPVA 4Z7QB 2J08A 4I4TB 1EVQA 4NZOA 3T3NA 3GPIA 3QYFA 4F93B 3CUUA 4HAOA 4IQ4A 3W77A 1UPCA 1T8YA 5EEHA 5F7JA 1AV6A 3U61B 2CE7A 4CUKA 1Q2UA 3GVPA 3ORQA 1E7MA 1BIFA 3RTBA 2AS0A 3KDAA 2VT7A 4YMWA 1NQTA 2A2ZA 4ZAZA 4WCFC 4ANFA 1XEFA 4BO3A 2AQIA 3BTUA 1JN0A 2DFTA 5JD6A 4ZALA 3TB6A 4ESVA 1DC4A 1SM4A 2FWMX 3R0JA 3OJ0A 1U8YA 2JAUA 1GQRA 2XCOA 4C88A 2R00C 2LIPA 2PUHA 3EGIA 2NUPB 4GW3A 4PVDA 5F73A 3T7SA 3L3BA 5LU8A 2OC9A 2FMFA 1MEJA 4ZVVA 4IMIB 4YTEA 1GYQA 2C5BA 4KE7A 5JSQA 4GI2A 1FJHA 4WCVA 3TEFA 1V5IA 4UTNA 1AKTA 1ULAA 1ZWKA 3OICA 1Y5RA 3BWEA 4M60A 3KR1A 5JCXA 3U7GA 3FOFC 2A5FA 3T9DA 4N0DA 3CMMA 2OA0A 1I32A 2WIKA 3T34A 3CLUC 4B09A 1E7SA 1FTWA 2UUPA 4WXPA 2VF4X 2BHLA 1GD1O 4HEQA 3HXLA 3T9AA 5HRCA 1JT2A 3VPXA 2V6MA 1RFGE 3V8NA 4BX3A 1CSEE 1H8HD 2FETA 2GNOA 1U8AA 2V7GA 1BRTA 1KC3A 4YJ2B 3T5CA 4EI7A 3R44A 4EUSA 2O3RA 2VT2A 1JDNA 1KPHA 4KODA 1WVIA 1PQYA 2BFFA 4LJ7A 5AHXA 5IBPA 4DG5A 4ITRC 4C06A 1O95C 4AJNA 5A3SA 3QKRA 3ELWA 3RS4A 1FMFA 1M1YA 3H19A 4HDSA 5DCLA 4N5HX 5FQOA 5K2OA 2IELA 2VN8A 3IBFA 2JLYA 2YCLA 1FW8A 3MSXA 4H0FA 4DCSA 4TZ6A 1CF4A 5WRFA 4DJJA 4V24A 5D5PA 2DOKA 1GY8A 1O94A 2PX2A 3AFOA 1B6TA 1C3OB 3H4VA 3A9TA 3FDXA 4QXAA 3TR5A 4GQBA 3WJ7A 3R8FA 2WKRA 2QD1A 1GPLA 2I2DA 3H2SA 3KQWA 2DHCA 3EUAA 3PBKA 5AHOA 5DPMA 5EZQA 1NMXA 3MJHA 2VJKA 4B85A 2J09A 4BC1A 2K7ZA 2QTWB 4II2A 2B35A 3FDJA 1AOXA 4D9HA 4NFSA 2JBAA 2K2QB 1OAAA 5AM0A 2IYEA 5IHPA 1U0EA 3P9KA 4N6NA 4EECA 2AWNA 1WHSB 1DFIA 1P1IA 1ISHA 1L5ZA 3D8HA 4I55A 5DVZA 1M1NB 4MRSA 2G82A 3INGA 3DR5A 4I08A 4YIHA 5HIIA 3ZHYA 5B6JA 4C7OA 3I5UA 4AB1A 4OYYA 2RHBA 5HJEA 3DT9A 3EA0A 2QJOA 4DLVA 3ZNNA 4AVYA 2XMSA 2ZTHA 5DTRA 4EYQA 5IVIA 2QAIA 2AN5A 4YACA 4DQKA 4U2GA 4AU1A 1Z82A 1SBCA 4MQ5A 4FW8A 4HRYA 1CVRA 1P1FA 2E5WA 2JCBA 3MLAA 1IN1A 1GAQA 1T1GA 5LPNA 1EFDN 4Y0NA 1WMAA 1GAEO 4O3FA 1XXLA 3EVNA 4YP1A 5HCIA 2PJUA 1TQ6A 2CN1A 1OIVA 2WR8A 2XUAA 1DAHA 1N9KA 4HNSA 4YNBA 3I72A 4OHKA 2IODA 5I4CA 5IC4A 4Z4EA 3NXKA 5CAEA 1LSSA 3ABQB 4HUJA 2ONJA 1W0JD 2YV4A 4FTWA 3AHEA 4GZLA 2F8MA 1E3WA 4U00A 3DQZA 1AA9A 3IURA 3PUWA 3K9FC 1I1HA 2C0CA 3KBBA 3ZR4B 5HPYB 1ZCJA 3ASZA 1DIBA 3E81A 1TYCA 3P9QA 1FFSA 4FFVA 5AKZA 3L84A 1ZOPA 1Z6YA 2ANBA 2G5PA 4A1FA 1GAWA 1MX9A 2C4UA 4L76A 3LX8A 1MB2A 2JIBA 4FS8A 1OXTA 2GTHA 5I3ZA 2C96A 4CL0A 3DE4X 4CMEC 4N6OA 3OCVA 1XAIA 4LFAB 2VXCA 2BONA 1Z0DA 1YFZA 1BFDA 1S9DA 1SN7A 1VCNA 2VBGA 4WL0A 2OZKA 4NE2A 2FHSA 4KXVA 1QBKC 3KALA 4DXDA 3OMLA 4Z3OA 4AYTA 3RSSA 1XHEA 1M67A 3NQ41 4S1VA 1SPXA 4S2UA 2XIJA 4D9KA 3KZKA 3WX0A 5JAOA 4AO8A 2X5KO 3KFLA 5EIOA 2BEJA 2CHEA 4MKHA 3IIKA 4I4CA 1FMTA 1Z6QA 3BAFA 2DPHA 3IRVA 2DKOA 4M6WA 4A9AA 3ENVA 2R2GA 3ZJ4A 1RPTA 3WWYA 2CBZA 5C37A 5FNVF 4IIJB 2JD2A 3WIDA 4UBMA 1RQ7A 1ECFA 1VDMA 4UULA 3CVWA 1LNSA 5BY2A 1C3EA 1F38A 3AJ9A 4UAGA 2NAPA 5EKTA 3O4GA 1VLHA 4BNJA 2QUIA 4FZ5A 2JIZD 4S24A 1JZSA 3AOGA 2ZSAA 4JS0A 4ES6A 4KC0A 1ZSNA 3CSUA 1OBFO 2IOQA 1FUKA 3EWNA 3GLRA 3JZMA 1RR6A 4UDYX 4D9EA 4OGFA 1P8AA 2PGLA 4GGMX 3ZHQA 3MT9A 4MSUA 4DRYA 3LNCA 1JSRA 4YI3A 1NZJA 3NZEA 4QTYA 2NZJA 1BKYA 2JGAA 2V8BA 5DK6A 3VYWA 3FTFA 2C07A 3HUFA 1ZSVA 3KZNA 4P7FA 4C14A 2QRPA 5A4FS 3BE8A 1DOZA 4H3SA 2HREA 4H9GA 2QD5A 4WRRA 5THXA 1C0KA 3TZ6A 1JSCA 2J0VA 3DWEX 4GMFA 2QI9C 2HRBA 3H9JA 4HWTA 4Q4HB 4RKFA 4DNOA 5AJVB 2C7GA 4G5RA 4XIIA 4ABTA 2CF5A 3QWFA 4UE3S 1FCJA 2IXEA 3CYFA 4FD2A 2JGLA 2FY8A 4Z49A 3X43A 4ZRDA 1H3NA 4ZKEA 1QQAA 3P2IA 3ZZNA 2GYVA 1AKWA 1BX1A 2EZUA 4CN9A 3KQYA 4EFMA 4F92B 2NZ2A 4KWHA 5A5VA 1HDRA 3B53X 1IWOA 5DP2A 5LIPA 1SEVA 5DMXA 1GUAA 2POQX 4CEHB 3P0HA 4OH1A 4PW0A 3U3ZA 4ENVA 1O7JA 1R12A 3AR2A 1YQWA 3IERA 4JJ8A 3CJRA 4GX5A 4R1OA 1AY0A 1UPUA 1QKKA 1EK6A 4IR7A 5EY5B 3CJTA 4IO1A 1EJ6A 1NBEA 1JLRA 2YDYA 1A2QA 1T43A 1TYZA 3VO1A 3BMOB 3UTDA 1VI6A 4IKEA 1K9VF 1R5BA 2CXOA 1E66A 3F4LA 4PLZA 4X9XA 2D4HA 3ZTTA 3Q6MA 2ETXA 3N75A 2K87A 3WBKA 4DM7A 2RGDA 4F2PA 1TK9A 4MCHA 1IAQA 1MAWA 3OQOA 5HYVA 1ACLA 4Q7LA 3R0XA 3QVMA 1G63A 3DEHA 3V6MA 4DPKA 4UNRA 4R68A 4QOJA 2AR0A 1PEAA 1QX3A 4TKUB 4DWOA 3H13A 1XRRA 2ZWOA 4PGAA 4DSZA 1XCBA 1QG6A 3GJXC 2XCUA 3ZE2B 421PA 1EDZA 3GFFA 2VQ3A 3W3AD 2ET6A 3OOYA 5AW1A 1RJDA 2C3PA 1NMEA 2B4RO 2ZOSA 2CYCA 3QVKA 3I92A 4JEIA 1PQ4A 4MV4A 3D6FA 3B1YA 4HGRA 1SXJB 2OB1A 1E1NA 5D84A 2WNIA 4LQLA 3KAQA 2VJPA 3DE1X 4JKIA 4L3OA 3S7ZA 3ED1A 2E3JA 2P1ZA 3NBUA 2D06A 2I6QA 3ZZTA 2HC9A 3RKUA 1SAYA 2C20A 2ZULA 2CJPA 4UREA 4WXYB 1LY1A 3GQVA 3F7TA 1K4YA 3IUBA 5EN4A 3UGTA 1N5IA 4OK3A 3K0AB 4M0EA 4U0KA 4ZHQB 4NXNB 4U9HS 4NULA 1E3EA 5I5EA 2XKAA 3CKMA 1MJGA 1WNTA 3H5NA 1DG3A 3LWBA 5EIBC 3RUPA 4BMNA 2GARA 1U7WA 1KSJA 1RPNA 4H3VA 3OEEA 3UWSA 3LXRA 3V1NA 3T61A 1U1GA 3WOHA 3KJFA 1WZ2A 1X9IA 1INLA 4I5DA 4EY7A 3OOHA 1R0XA 1E4OA 1IWPB 1MD9A 1E8NA 3K1ZA 3FNIA 1EA7A 1ETHA 2UYOA 4G0QA 3NEJA 3O2SB 4KKVA 4PQRA 3A2NA 5AKHA 1LA2A 3GA5A 3KXLA 1GSOA 2ID7A 1HMYA 1XEXA 3BXEA 4D9FA 1JHZA 2QJWA 3WWCA 3DL2A 3OIUA 1HNZB 2QZPA 1ZK0A 5B1YA 3AUAA 4I8IA 2YHUA 3CUWA 4DXAA 5KMGA 1R8XA 2XUQA 1WDLA 5DXAA 1NVBA 3Q15C 2OLJA 1YUBA 4Y2PA 3K70D 3I9JA 4MO2A 1SCKA 2BBOA 3PX3A 3WDLA 4JBNA 2PG3A 3L4EA 4BNZA 2D2FA 4PRZA 4Q6WA 4ZCPA 4I4IA 1YONA 2BUBA 3LQRA 4ERXA 1P5FA 1WUIS 3V8RA 1G8HA 3A1SA 3FB1A 5A1TA 4OMUA 5IM4F 4YN3A 4F38A 3AERB 5BNTA 2DLCX 1IRIA 1Z0AA 5DLPA 3TD2A 3RG2A 3SXJA 3VC3A 2XCQA 1JTVA 5FYQA 4CXMA 3AUYA 1LJLA 1CQPA 2Q4EA 2FRDA 2B1RA 3C6QA 3D4OA 1WZCA 3G0IA 5AVWA 5FLKA 2OXFA 2QRVB 4IDNA 4NMHA 2F1RA 3IO3A 1RRKA 1SXGA 4DAOA 1H2WA 4YO7A 3EG9A 1QHGA 5K3OA 2VWGA 2HRQA 2AR9A 3AKDA 3NDJA 4AMVA 4DV5B 1XIVA 1SQ6A 2I1WA 2VTDA 1EVZA 3GGOA 4K6HA 4ARSA 4F04A 1QR2A 1ZESA 1Z0JA 1JDBB 4P7KA 2O8CB 1DVRA 1Z6TA 4UOQA 3IPCA 3N86A 3LDFA 4ILEA 5AK4A 4ZOQI 4BY9E 2XXAB 2H4XA 2GZMA 1AKMA 4HDMB 4INPA 2WIDA 3AEQA 1MP0A 1MAAA 2P2YA 3HU5A 5IH7A 4L85A 2AN3A 4OL0A 2QT9A 2MCFA 4E11A 2OGSA 5ADWA 4ARIA 1JR6A 3AG5A 5EUBA 1IVSA 1NBMA 3Q7EA 1USUA 4ABYA 2FZVA 1YOVA 2X3UA 1WX1A 1QVAA 2O2JA 3A9SA 2BZGA 3A9WA 3BMXA 5ENZA 2VBFA 4Q1BA 3VU1A 4DJDC 4DWWA 2JFNA 3EQ8A 3NYRA 3H2BA 1N9GA 1B42A 3DAPA 1XVVA 3ZJTA 4R81A 3MINB 3KETA 1X7DA 4EYGA 1HKHA 1Z29A 3E48A 3W2FA 5JSKA 4WVLA 2ZQYA 4IW3B 2GEKA 1WEHA 4YRFA 2VZEA 2HCFA 1GZUA 4OXKA 3V32A 4WOJA 4LV6A 1ZBQA 3S2EA 4M55A 4AAYA 1SH7A 3D7RA 1DNPA 2O54A 3OD5A 1TKAA 2RHWA 2C9OA 3O95A 3E7PA 2YJ5A 2PQ0A 1GSIA 1TNDA 3GOQA 4MKGA 4YAKA 5C9ZA 1PI3A 3F6SA 4PHCA 3MB8A 2QX6A 4MRAA 2P2DA 2R86A 3KZMA 4JLSA 2CNWA 1TVEA 1ENYA 1PU2A 2RAFA 2XUIA 3FVVA 4LGMA 3M6IA 5LA6B 3CC8A 5TY0A 2X15A 3TX6A 3EARA 2DSNA 4HFNA 4HLUC 1VE7A 1G5FA 4GE0A 4RNCA 5JZVA 3TXXA 3QFHA 3SBOA 2PZBA 3DPUA 2PUBA 4QSMA 3KB8A 3T94A 1H05A 3RADC 221PA 2HJRA 1TQ8A 3EZNA 3TOCA 3VC1A 4XW2A 2KSQA 3MJ4A 4G1MB 3W05A 3EF1A 3NO4A 2M6SA 2NXCA 1PV2A 3KHTA 2ZXUA 2F6RA 4QLAA 1P7YA 4E70A 4QQKA 3W1VA 1BFUA 3LJKA 2IP2A 3L7LA 1SQFA 2Z3ZA 1EB8A 2ZSIA 3LZDA 4YPFA 1X1BA 2EF1A 3L4BC 1WKVA 3ND5A 4N03A 3LLUA 4Q02A 4FLFA 3S2IA 2Q3DA 4EJ2A 2RHLA 4QEDA 1T5BA 4W1PA 4GICA 2HLPA 2BMDA 4YT8A 1IUPA 1XZFA 8LDHA 1GZDA 4JVLA 3QUAA 5JZ9A 4EZBA 3F7OA 1V7CA 4NCXA 2X2PA 5AOBA 5ILOA 3TAXA 3WWZA 5B64A 4HHEA 3M5DA 4IRMA 1S2DA 4B6PA 2GPSA 1RRPA 2UZIR 3N07A 4MO9A 2WTMA 4RVNA 3USCS 4QFBA 2C2BA 3EC1A 3AJAA 4Q1AA 1PEDA 3A7EA 4GAEA 1UZNA 5EFZA 4TKUA 1GA4A 2TMDA 4UHFA 3HABA 4B3MB 1Z73A 2CXHA 2I65A 3DMRA 2HF9A 1TI7A 1HE2A 2QTNA 4Q4AB 4L8YA 3HL0A 3LO8A 4MWDA 1SVKA 1YJXA 4RESA 1A4XA 5D87A 1J5XA 1RVV1 4LF7B 3UXYA 1YJQA 2RAPA 4RFLA 1QZZA 1VLZA 2VZ9A 2FRDC 3GUZA 3KQQA 1NW9B 1MO4A 1P31A 1TM1E 4JUIA 4E1AA 1SVSA 3GZNB 1L7BA 3LGXA 3LXMA 2GVDC 1E2NA 5B3KA 2VTKA 4IDDA 4C0AC 3DD1A 1I7LA 2BLNA 3I1JA 2YOFA 4GNRA 2A1IA 1UBFA 4GP7A 3CU5A 4NEHB 1ZD8A 4AS3A 3ZGLA 1V8BA 1L2TA 1OLOA 2JFGA 3OZTA 3VDMA 2JIRA 4E5PA 3PA6A 2ZRBA 4LC9A 2ID4A 4D8YA 1P0FA 2W2KA 2VSYA 3KU4A 1XQWA 4G5OA 1YK0A 1A5AB 1FRVA 2D13A 3KSRA 2R5NA 4DKJA 1F7UA 2XGGA 3IAAA 4HNUA 1NI4A 3CT4A 2MOKA 3U56A 4U6SA 2B69A 1S4QA 4FONA 1YBMA 2O52A 1YZYA 3SP1A 3Q12A 4JEUA 1LBHA 2REXB 2LRHA 1O77A 3H16A 3KELA 3VUEA 2JEZA 3L6EA 1FSSA 2BSXA 4PZPA 5CK5A 4IIYA 1XTZA 2VAVA 3KR9A 1ID1A 3TTSA 3UA3A 4H31A 1JZTA 3ZV5A 1B41A 1K8ZB 2Y1OA 4L75A 2H1VA 1WCXA 4M76B 1QNLA 4YCCA 2D6FA 1K68A 2FFRA 2ZYRA 2YRWA 1DKLA 1HF3A 3N0VA 4KQIA 3R3UA 4PFJA 4C0LA 5BRJA 2E37A 1SIBE 1UQUA 5FI0B 4ZT7A 2LCQA 1Y9ZA 4PZCA 5IBCA 1GPUA 4MWSA 1Y9EA 4ROSA 3EZYA 1PD0A 2WSSD 4Z9BA 1E0DA 3RJMA 2O59A 3SC2A 2H3EA 4RZQA 2EZ4A 1O6BA 2VJCA 1H22A 4K9DA 4S1PA 3EN0A 4IF4A 1HMPA 3HDYA 3AWDA 2BISA 4KXXA 4MW2A 2R4UA 2NYAA 1NRWA 1KZGB 3B85A 3CEJA 3HXTA 3T3DA 4DQUA 2A5JA 1SXIA 4JLAA 1L4HA 1H0SA 1UBKS 2C5EA 2O0MA 2YQ4A 3ENQA 3GFRA 1SD2A 3UEOA 1XEWX 4I1UA 3PDHA 4B34A 1ABEA 2DBYA 4YRDA 2QMOA 2QR3A 4YJ2F 1SXJE 1DX6A 2JGIA 4MV6A 4MCIA 1U0JA 2FPPA 4ZJYA 3ABSB 3BA1A 4XOIA 3SD7A 5J58A 5I9LA 1M5TA 1TO6A 2XEXA 3BJEA 4P3NA 1XUOA 3GBPA 4OJQA 2PUDA 2LBPA 4B3TB 1GITA 2GNAA 3GZJA 1C9JA 1Q92A 3DH0A 3JZDA 3W6NA 4PCLA 1ND6A 2YHIB 4BEVA 2R87A 2OZPA 3BSSA 4TROA 3SHWA 3LQYA 4EW2A 1XT6A 1YQQA 2XYHA 1NWHA 2R8ZA 2GCOB 4L6CA 3R3VA 1G42A 1Y89A 3ICPA 3U7RA 1GPWB 2Q3EA 4RD6A 2FEWB 3IR5A 1ZK1A 3PE4A 2D5CA 1SB8A 4PO1A 5KYWA 4PLGA 2R25B 1L5FA 1KBQA 1GCIA 5I7FA 1X42A 3PVCA 1FRNA 3QBJA 3TW0A 4K5QA 1JDBC 4LJ5A 4TTQA 4QU9A 4B6SA 1DX9A 3I9NA 2C29D 3ICVA 4WZAB 2GJ8A 5CURA 3U16A 1HNXB 4NZMA 4WLUA 2F8SA 4GL4A 4J0FA 5AOAA 3C3BA 4KYTA 3H99A 1EWKA 1WB4A 2CVHA 2ZE6A 4XUDA 3SNKA 1ZI9A 2P7HA 4EZIA 2O8FA 3KYBA 3A2LA 2GPTA 4MZDA 4EF5A 1ZLYA 4O59O 4RWEA 3LCRA 1DBPA 4EEKA 1YULA 2W8BA 4XUCA 3INYA 2E4XA 5L3ZA 1Z7GA 2VF5X 3UWDA 3ZY6A 4HFJA 4W9MC 4Q3KA 1DBRA 4LRSB 5H70A 1VLJA 1H23A 5ULLA 1JEDA 3DM9B 1UUFA 1PJQA 2FSVA 3PYXA 4G9EA 5JFTA 2EGUA 3CUTA 4FDTA 2IXBA 2XMCA 4KWCA 4OH7A 3UMJA 2MR6A 1WCWA 3DNPA 3FNRA 5G4KA 2J3KA 1UBTS 2P9TA 1F0NA 1QK5A 2XAAA 1XZIA 2DFPA 4G67A 3MQ4A 4XYGA 5CNMA 3FNHA 3IDZA 3GNQA 4D7AA 1TQHA 3IILA 1NJSA 4DLXA 1GPMA 1AUXA 2VJDA 4F21A 3CX7A 3EE6A 3B1JA 1F8XA 2F7SA 1VKJA 1OGIA 2PZEA 2C03A 1T9GR 3HB1A 4IXNA 3DMGA 4FSDA 5D5HA 2J0EA 5I8PA 2X8WA 1VKOA 1RFLA 2GETA 3FDZB 1L7QA 3A6ZA 2X8JB 3RC7A 2RI0A 3DOOA 4YT4A 3AJRA 3MD0A 1YA6A 2SCUB 3H04A 4IILA 4Q4DA 3GMDA 1OH5A 1A7JA 1JBKA 4O4IA 5SV2A 1E92A 1R6TA 2CFRA 2HMYB 6NULA 4WZZA 4NIMA 2ZITA 3S1AB 1K66A 4IIEA 1WF6A 3NG1A 2WAAA 1K5HA 3VU9A 1PWZA 2ZBRA 2PT6A 2EVWX 4ZQFA 2NU9B 1TTTA 1ZCBA 2TMYA 1FNMA 3PICA 5EMNA 1T1EA 1JBEA 1PDVA 3QIAA 4E08A 3RVSA 4ZVOA 2B21A 4GX0A 1CJVC 4X7BA 5F4BA 5M5BA 1NXWA 1OI7A 3E03A 4QU5A 2ZJ5A 3KM0A 5EXPA 4LX8A 2W0SA 2D8AA 2J07A 1CF9A 1SA0B 5EFOA 1Q0UA 5JSYA 1I7PA 3NBAA 4FK8A 1TT7A 3DLBA 2XB8A 3T7RA 1VLQA 3EGVA 4OJMX 4QWWA 1KARA 4CLRA 3O75A 4BFYA 4WNYA 1N6HA 5J63A 5KDLA 1PUXA 2WOJA 2GJ9A 4FDLA 3ENKA 3FUUA 4DRXA 3KKMA 5A5FA 1MAHA 1YHYA 2I76A 2VDRB 2VP5A 4PV7A 4TXLA 4C6HA 2AVNA 3QPUA 1QYCA 2A9VA 4QSHA 4TVKA 3QXGA 3HXMA 1BN6A 3LG2A 2AKEA 1WHTA 1JFSA 3H1TA 4JGGA 1FMLA 3ZIAA 1JPVA 3BBPA 2Y2UA 4YO8A 4DCNA 1LU9A 1KZ9A 3E7WA 1PZMA 3L7YA 3OWOA 3PC2A 3V4ZA 1Y3DE 3FJYA 3IAS6 4MTCA 1UKVY 4HVTA 4HGYA 2JLVA 3QU5A 2PD4A 3OQ1A 3OD1A 2JD0A 2E4ZA 2HMAA 2QRGA 1QO0A 2XRFA 3DE0X 1ZKMA 5ED0A 5FL3A 4UNPA 4C22A 3CURA 1Z2CA 1M6EX 4I50A 5A5GA 3VOAA 2VNAA 1R6UA 3KEOA 3R5SA 2A57A 3AEKA 5LKRA 3BMQB 4FPXA 1YRBA 2H1RA 3NAGA 4LK3A 3PGVA 3DQQA 3RIEA 3PC3A 3C98A 3MWGA 1JG1A 5TPWB 5KO2A 3G8AA 2CMFA 1PLLA 2E49A 3T0IA 2UU9B 3O2NA 4L74A 1X77A 3FUXA 3HLYA 3DZ8A 1Y0BA 4K0RA 2YC2C 4DTCA 2VK4A 4AY6A 1U31A 1XAJA 1JQEA 1U7HA 1OGJA 3KYCA 2B92A 4LZLA 4IV5A 1E3IA 3OIDA 4LWZA 4JMLA 4LTMA 5HDBB 3OCJA 4DDMA 5DN6D 3H18A 3P2JA 4OUKX 5DZSA 5IPFA 2DF8A 4EKDA 4GYYA 1SHZA 1DJPA 1UJ6A 2XWPA 1T6BY 3A9CA 3MINA 4MW5A 2OHXA 4IGKA 3O31A 3LF1A 3S6JA 3ZWNA 1LW6E 1NUTA 2X2FA 3HYNA 4IHJB 1R0LA 4R4JA 5HQJA 1BQEA 4EJ6A 2H8KA 3CCFA 1D6NA 4G9BA 4MX8A 2X8JA 4ZRMA 5KCMA 3QE3A 3H2HA 3V7NA 4BMOB 6PFKA 5JFGA 1CRQA 2JFUA 2CKMA 1BU8A 4CG1A 1X9HA 5GY7A 5LZ8A 4BE7B 2QL9A 3CLUD 3D8RA 3AZPA 4GO1A 1ZU5A 3REQA 3V6LA 4D9NA 4EB8A 2DWOA 2HK6A 6ABPA 1USIA 2ATEA 4V0QA 2EW8A 3F5FA 1L8LA 3DBLB 1QHIA 3NM5A 2XBUA 4OLAA 1SOMA 1Y63A 3PQDA 1NX9A 4LZWA 5HQTA 3LOUA 4C21A 3A4TA 3HEBA 1XMSA 2H59A 1DC7A 1ULTA 1T24A 4QYTA 2OM2A 1GV1A 4Y2QA 1EUDB 1ULHA 3EG9B 2E4UA 4AJJA 4IDOA 2XNKA 5I45A 1W44A 2W8BB 3TUZC 5D3MA 2ZJZA 3AVQA 3OQIA 1EG2A 4IQGA 4BGDA 1YBAA 4OHVA 2JLUA 2X4DA 4H7PA 4Q9NA 4C6RA 3ZDBA 1IH8A 4M7PA 3T1HB 3BHNA 3HDVA 4YRNA 1SCIA 1FP7A 1Z4QA 3V4VB 1MLDA 1Y8QB 5JMPA 2VVTA 5EJMA 4ALJA 4WWHA 3QLJA 4UNIA 2OYSA 4B3RB 1A71A 4TMXA 3LHKA 5AJYA 4DGSA 3FNEA 5A4MS 3ER8A 2BCGY 3UCXA 3AY3A 3MJSA 4YR9A 1LBQA 5BVHA 2A1TR 4S0ZA 1YQXA 3L8ZA 5JXIA 3HFGA 3TZCA 2I4TA 3VSDA 3OOJA 3MCVA 5DGDA 3H9CA 4FMDB 4RIEA 1BW9A 4TS3A 1G1MA 1VIYA 4CF6A 2AHOA 1YT5A 2DY0A 4HADA 3Q3CA 1NIPA 1PX2A 5CM2Z 3A3NA 5H59A 3FZNA 4ESOA 1J49A 1N75A 1NF8A 3KS9A 4XOUA 1NASA 5I8ZA 3UWMA 1WO8A 1QYIA 3JTMA 4L9SA 1IE3A 3D1LA 4GPIB 5IAEA 4BQRA 5C1OA 3T7AA 3I9MA 4C9BA 3H7IA 3P2YA 1TKRA 1MOZA 2GLTA 4JBLA 5JQGF 2VR1A 2FW8A 2AG8A 1WSAA 2R6JA 2KW5A 3SBEA 3JALA 5AI9A 1OX6A 2OXRA 3E9RA 3RVPA 2YMMA 4E51A 1FYDA 3U17A 5HKAA 2UZ4A 4IUCS 3JQ9C 5CM8B 4NDNE 3OPXA 1RRFA 1DV1A 2ZVJA 3PB3A 4A6XA 4EVQA 3S5JA 3G82C 3T9EA 5G0TA 3IULA 1AF4A 1N0IA 1U6KA 1U6IA 2P9QA 2QYHA 4M9RA 4MPDA 4DA8A 2QD2A 1QLHA 4DJFC 4F5ZA 4L15A 4ZREA 5C7OO 2JANA 5PNTA 1R64A 2EL9A 4WUTA 3M5WA 3OTHA 1LRLA 4XD7A 5DBHX 1L5GB 4BGIA 4DV6B 1O96A 4ISBA 3JARB 3SY8A 5DLEA 4C0BA 4ZU1X 5CVEA 4I9NA 5G02A 3G5UA 2Y92A 2ZSDA 4P98A 3N8KA 2YWFA 3CSDA 5AKYA 3IQDB 4C7JA 3L9WA 4JOQA 5L9AA 2CUTA 1VCHA 5L7YA 2XMQA 1RPAA 4M1KA 2O7SA 2WWXA 3UNXA 4UUNA 3VC7A 1QM5A 1Z62A 2QRNA 3LAWA 3MUFA 1BXRB 3DT8A 4UATA 2BCEA 5A04A 3A6PC 5J5AA 1KEEB 1GPKA 3R1IA 4EKGA 2VJLA 3H5TA 1FTSA 2ZJOA 4WI1A 5M34A 2PBZA 1UBUS 2BMWA 2I03A 3A3KA 4J43A 3IEVA 2QSZA 3FWPA 4FSHA 4FGUA 2W2MA 1NJ8A 1JALA 3H6KA 4DR6B 3JPYA 3SFVA 3BL8A 3K2EA 4RS3A 3GRYA 2P6RA 5MGNA 4WKOA 4EBFA 1XVAA 2X8LA 3UQZA 2F3UA 2J1LA 4JXXA 5BSRA 3ZV3A 3QWHA 1XTPA 1ZITA 3NORA 3TNLA 2ZI3A 3KWJA 5AJXA 2QLBA 1II8A 1WY7A 1K3TA 3PGKA 1I5OA 2PR2A 1TOAA 4ZQHA 4A15A 1JAYA 2RG1A 3OETA 3NH9A 1NBOA 1ZC4A 2HT1A 4MS4B 3HDHA 2R6AA 3DYVA 2ZQZA 3HO6A 1AH2A 1LBSA 2RGWA 3AVPA 3D6NB 2HL6A 4WESB 3UMGA 2FSSA 4FUTA 3TRDA 1T4CA 2OESA 2FMTA 3IT0A 4L4XA 3AVUA 2G76A 2XNHA 3CEMA 4NDZA 5L8VA 3NWJA 2AFVA 4A8JA 1TYAE 3GDWA 2JBHA 3JU3A 3H6HA 1E9EA 2ZJFA 4O6VA 4AJ9A 4NSNA 4B6OA 4Z2AA 1ADFA 1VI2A 5LFAA 5FOQA 1NN1A 4IOLA 4OI4A 2WTXA 2PSSA 2O9JA 2Q3JA 3FMFA 4JUAA 3AG6A 4L9AA 3G1TA 1NTOA 1OFTA 3L1VA 3NBXX 3FGZA 2O23A 4IWNA 3VI3B 3EIXA 3V34A 2O8EB 4MPRA 4NMXB 4CIVA 2RHTA 4MCAA 1TW3A 2WYVA 4JP3A 1NJ1A 2Z58A 5F52A 5EWJB 3QW4B 1NNEA 3A28A 1P0MA 3WNVA 4G3XA 3WLEA 2GEDA 4URUR 4EG8A 3Q5DA 4Q47A 5JCJA 1DZIA 1NT2A 1LNZA 2QM8A 3QVSA 4UBKA 4LJSA 4KOEC 4RTKA 5C2JB 1G9XA 1JR3E 4X95A 5AHWA 4LAFA 2DERA 1UDAA 2Z0MA 4IQFA 1YS1X 2WP0A 4TLBA 5AW8A 4YDSA 4QRDA 3TK1A 4C0JA 4RZHA 2QOEA 3N70A 4MW6A 4TV8F 1D4FA 2ZJBA 4GBMA 1YUMA 5BW4A 4LSWA 5AM4A 5K3AA 2O2CA 3F5DA 5K5EA 1JHVA 5T3YA 1VPTA 3N39C 2ZIWB 3WYEA 5HILA 3ZHVA 4BJHB 4RC9A 3QXHA 4AWBA 3UN1A 4RKEA 4PLTA 2QPLA 2ZBFA 4E5UA 4RDCA 4ZGGA 1Q1BA 4JEHA 3PHIA 3A0RB 4KGDA 3QYJA 4FFBB 3WLRA 1DG9A 2FF5A 2XYGA 4GDMA 1NE7A 3LVBA 5E9JA 3WQBA 5DHRA 3ZIUA 4FQ5A 3LFUA 4AMZA 5BSEA 3AF3A 4HEA1 3DKVA 4LF5B 4RPGA 3I5AA 1FJXA 1KI7A 3RYTC 4J0EA 1QVRA 1EH5A 2B37A 3CBGA 4OQZA 5I9BA 3E15A 2C0PA 4GRIA 3VDNB 5IT4A 4UDOA 3G2JA 3EGEA 3C7AA 3GUHA 3KEMA 4NDAA 1MF7A 3DPIA 3IXLA 3A8TA 1GZHB 3LW7A 4I3HA 2P3OA 3UUEA 4QXMA 3K53A 1GZ3A 3CF6R 5B3JA 2CHVA 5B1IA 4DVJA 5K03A 3DCNA 3WZ2A 4E0BA 1SZCA 5TGZA 4N8EA 1GFSA 4KLCA 1BE0A 5TEWA 2UZ1B 1PYGA 5TSDA 2NTNA 3VYVA 2OMKA 1NLFA 4G81A 2XB2A 3ICOA 5CB0A 4AXBA 2MDTA 3MK31 3D4LA 3H9EO 2UVPB 3IUYA 1N77A 1QWOA 4MYUA 5J3JA 1P4AA 3BQ9A 4OQEA 5FRDA 3ZHZA 4MGIR 4U0JA 1OWMA 5T8KC 4CIAA 2XDWA 2EKBA 4GU5A 1V11B 5CGZA 1X8XA 3SQMA 1GYPA 1OILA 2Y1DA 4G24A 3ZCVA 3M1AA 1NUAA 3DTYA 1M7HA 4FUQA 3BCHA 4FR5A 3L8CA 2WAOA 5FBWB 4UHJA 4A5OA 2EX1A 3CW2A 4M8NE 2AXNA 4N7MA 2P2CA 4R6XA 1WVGA 2HB6A 5FNZA 3VOTA 4EHIA 1U0SY 2ZLBA 1E7YA 4QNNA 4RVDA 2V0CA 4XX0B 1A5ZA 1TJYA 1TLLA 1HDXA 4XDGA 4YCSA 2XXAA 4DSTA 2JA1A 1JJVA 1TAHA 1PFVA 4ARBA 1LDGA 1ZXLA 3FRHA 4CMEA 2EBWA 2Q9BA 3K0HA 4PM4A 3CZCA 1C80A 1UPAA 2IYNA 2BJWA 1TA0A 1Q16A 3JXEA 2D59A 2HBRA 3JS5A 3HUTA 5ELMA 4ZVMA 5HF5A 3LUPA 5C53B 1E2DA 2ZBEA 3DSRA 4O2BA 3VSCA 4F8YA 2BYTA 4HDKA 1HOXA 1G18A 1GLNA 2DFVA 2P90A 1VIMA 3GOHA 3PNVA 4YMSA 5L4NA 2AL7A 1E5TA 1DUIA 2QT1A 2J41A 2VAPA 3IV7A 4LYGA 5HJ7A 3PUIA 2W6QA 1MIOA 3O92A 2C0QA 4O63O 3SIWA 5CEJA 3Q1KA 2AOUA 4RLHA 4LDJA 3X1ZA 3WYGA 2WWVD 4DLKA 3LM8A 2OBNA 4CLOB 4IEEA 5IT0A 3PVZA 1RXYA 4NKRA 4Y0AA 1VGVA 1Z5ZA 2NYRA 1K6MA 4JFRA 1W36B 2FPLA 2PZLA 1DRVA 2REQA 1NQ5A 5CCDA 1NVKA 2HA3A 3D0QA 3FFWA 1A1VA 2VCHA 4NFYA 3ZS9A 3ZPXA 1NF2A 1R2QA 2GTIA 3D3KA 3H0KA 4XKJA 4Y9SA 3SJBA 1V8FA 2AJBA 2R7LA 4JSRA 3QKTA 4R1PA 4R8LA 3CFYA 5TVKA 3OHSX 2BKLA 1ORTA 1DMRA 4I8XA 2AB0A 2VEDA 3SJUA 1L3BA 5LYJF 3DVAA 2JH9A 3ORHA 2MYUA 3EOAI 3FYDA 4HNAA 3RRYA 1E1LA 2LGJA 1WXIA 1YR6A 1G5PA 1N2GA 2VNIA 1PO7A 3IP9A 1DKOA 1UJCA 4GSYA 5EIXA 4FBLA 5IVDA 1SC6A 3WY9A 3ZWOA 4EK9A 2G83A 4MV9A 5AI5A 4RU1A 4YXWD 4DMHA 3S1SA 1GG5A 3QG5A 1K7FB 3T54A 1CFJA 3NHZA 4QUGA 4XFDA 4GDFA 1R3DA 4FI3C 4TMFA 5NULA 4C1NA 1PVOA 1J7KA 5E9QA 2HJHA 4LXUA 1LW7A 1PZEA 2J6BA 2O07A 1GPJA 3NRJA 4Y6LA 1NTRA 4D8VA 4PS1A 1DRUA 1NMZA 4Q3BA 5I51A 4MUHA 2PBRA 3E53A 3ZDZB 4ZVPA 3TI7A 2H1SA 2RJ3A 1OH7A 1HM5A 2XQJA 4PCVA 5CA0F 1JHYA 1R8QA 3FH0A 4E3ZA 1ZHFA 4P4LA 1SCBA 3D6TB 1YZNA 3VZCA 2JAQA 2HU7A 2OAP1 3F7NA 2GVNA 1CS4C 1ONSA 2RJOA 4X5OA 5BQ3A 3DVLA 3ORSA 3PENA 3LY5A 3WGTA 5CTAA 4U2DA 3ZKAA 1PGNA 4D9BA 3U4GA 1QE0A 3RCBA 1I3KA 2VQFB 1AB6A 2VJNA 2CXSA 1PT5A 4Q1CA 1ESCA 4I55F 5GV7A 4CODB 1XZKA 4TQ9A 2VLBA 1L5NA 5FTLA 5G4LA 2CWDA 2PWZA 1CHDA 4M9UA 3PNSA 3BXPA 3E18A 3NJRA 3LCCA 4PFSA 6REQA 1H2XA 2P1RA 1MQ9A 2RE8A 3PPIA 4CF5A 4JXZA 1W2WB 2Z95A 1PQPA 2NV2B 2YWEA 3E84A 3CLRC 3M5CA 3P0JA 4QQNA 5ALYA 3A2KA 1JDTA 2GK4A 3VNQA 4C89A 1DIAA 2HU8A 4JBIA 3QX8A 2W48A 3QNMA 3V97A 2WMNB 2QLMA 3JWHA 4HVAA 4TWZA 3SFZA 1KJNA 4BMPB 2BGJA 5IMSA 4XB2A 2CLMB 2R6FA 2BI7A 3GPBA 2HK7A 5DNCA 5B3AA 5BP7A 2EIHA 5JSFA 2ZPUA 5L3VA 1XRLA 3C7CB 3HNPA 3HWRA 2E48A 4K9NA 5CYPA 4S1NA 5EGNA 3EVCA 4EZEA 3VA7A 3JPWA 1M2VB 5DOVA 1T9KA 2X6RA 3QJGA 3PEVA 2B1QA 3LK7A 4O33A 4BRZA 5IKXA 3DV0A 3QPWA 3BMNA 2GX6A 2O2ZA 4QOFA 3QVVA 1FFEA 5D3MB 5LLDA 3PC8A 1XGKA 4RANA 1Q7BA 4N41A 1AE1A 1DEAA 5KREA 1FSFA 1VL8A 3ZS8A 2AN4A 5HDQA 2X9VA 2WHEA 4RSGA 2BH2A 3QQPA 5IUJC 1GNPA 3GBSA 3MTGA 4HGZA 4KDEA 4KUEA 2W93A 2DFLA 4MS3A 3TMYA 4R2XA 3VJRA 3PL5A 1O6ZA 1CYDA 2GN1A 2IYLD 3B5IA 4G5HA 4MUIA 3B1ZA 3VZPA 1XTSA 2Q7XA 3DE7X 3NHKA 4UC0A 5SZIA 3SYKA 2AVDA 4NJOA 4L5JA 3U6KA 1QQTA 2BUCA 2YVQA 2R1TA 4JROA 3ADCA 2QGZA 2WUDA 3AGQA 3DCYA 2HX1A 4RVGA 2FWPA 4UMFA 1FTYA 3NTXA 5A62A 4MVJI 2ETVA 2HPVA 2PANA 5J2TF 1E9FA 1SXJD 4BO8A 3AFIA 5JOQA 3W5JA 3R3ZA 4AXXA 4RZ3A 3WRYA 5H4GA 4UM9D 4IV8A 4BPRA 4ZI7B 3PU6A 4WFJA 4WLFA 5AWFC 1BDMA 3JQRA 1N32B 1G7RA 4IIJA 1MJFA 4L8LA 3FCYA 3R6WA 3L8EA 2X9GA 3N7UA 4MUEA 1YCFA 3S1LA 5D8DA 4AMUA 1GAJA 2YOHA 2JH3A 2B34A 4YAIA 4X62B 3TLEA 1EIWA 3UY4A 1W76A 4XVQA 3RVDA 5BUQA 2DTDA 1VG9B 3OF5A 4YT5A 5FUMA 3FPBA 2DJ5A 1NW3A 3W3AA 4GZ6A 1EAYA 1Y8RA 4EMSA 5D85A 5K3FA 1ZMOA 1W581 2BMJA 1EJBA 4QODA 1G38A 1W25A 2Q99A 4KMRA 5AJUA 1E60A 1GAXA 4IHQA 5AVQA 2C4HA 1CY4A 3AL0C 1TZBA 2IV3A 3V48A 3V8BA 1COWD 1J2YA 3E23A 3LPLA 4DYHA 3PKIA 3AY7A 2LXNA 1ADYA 2DTEA 3C6MA 1K3UB 3NM6B 5EWMB 2PNJA 1KR2A 1LDNA 5E0OA 2WZCA 1L1FA 2QNRA 1RXSA 3RVBA 1FDSA 5CIQA 1N5OX 3KBOA 4CKWB 2XCSB 3QOXA 1RZRA 3N2YA 4JI5B 2RG7A 1XA0A 1KIMA 3UG6A 1N2JA 4CV1A 3OQJA 4NK4A 1IY0A 1KR5A 1W5FA 4NAHA 3IPXA 5EIBD 1UBNA 1GXSA 1ZQ1A 4ARZA 5KNBH 3O9MA 1P81A 2G17A 4I5IA 4Q9IA 4IGIA 1YMVA 1Z4JA 3OZIA 4MA4A 1MB0A 1RJWA 3FI0A 4WUVA 4B80A 2CV2A 4EUKA 1O94C 3IBCA 4TSFD 2DFNA 2D2VA 5KVCA 1H2HA 1FLDA 1DAFA 2I5PO 5TARA 1FVFA 5TQ0A 3W9YA 3WI7A 2AI2A 3ZU3A 3GDOA 4BWGA 4CM8B 1NP7A 3AL2A 1E2QA 2J3LA 3WSWA 1EFPA 2JL1A 5G0SA 3KPJA 4REOA 4CTOA 4D0SA 1UAAA 2NUBA 4G1BA 4O4JF 1AHHA 4PWZA 4ALIA 4OCZA 4MWTA 3T7EA 3PG5A 3I8SA 1CUJA 3PEFA 2ZYDA 2A9PA 3FOWA 3HDGA 2N46A 1CQJA 2JI6A 3P20A 5DNDA 3DFMA 4PZUA 3FFAA 3VAAA 2RGUA 3QFRA 1U0LA 3PUZA 4KZKA 4N0QA 1RIFA 2Y1WA 4P58A 3AR8A 4PLWA 4BE9A 1H0HA 1G3RA 2WM8A 3C0KA 3PI6A 2IZOA 4ZVQA 1O1YA 3U3OA 4EEXA 4B3FX 2O8EA 2QNBA 1L7RA 1ZZGA 3VU9B 1KRWA 2H1FA 3HN6A 3M3PA 2OD9A 4M0UA 3TLBA 2IKSA 3I39X 4HRXA 4IS2A 3SKXA 1R18A 4ZKDA 4G1FA 3HCRA 1ATIA 3ESCA 1UK8A 2OVFA 2CJFA 4X7MA 1PFWA 4KSBA 2ZDGA 1ZD2P 3SC6A 4YECA 3F6YA 3S28A 4V1CA 2V7TA 3AU8A 2HADA 3KPYA 1E79D 4J0DA 3IJEB 5F35A 3NKFA 5HA5A 1AZSC 4RV9A 1NURA 6CHYA 4EG1A 2RH4A 2Y0EA 1DSSG 2RB4A 3DLAA 3Q3GE 3HZRA 5LZ9A 3EPRA 3FZEA 5IG2A 1SG6A 1QRUA 5BW6B 1J70A 3EF3A 3HCEA 3L0PA 4OIFA 3RIHA 1CY0A 1QYXA 3IR7A 2UDPA 3PPWA 4M53A 3LHIA 1IM8A 4GSKA 4OEHA 4X90A 1G4AE 2YN0A 4NL4H 5B37A 3SJZA 3ZWQA 2GF0A 2BGLA 1KJYA 1JF8A 2A9FA 2E9SA 2N3ZA 3QE4A 1BXZA 1ENOA 3DOEA 2B3TA 1RNLA 3FJ1A 3NPAA 3TGPA 5H8WA 5DSXA 4AO7A 1I5EA 4C7BA 2WIFA 2FG6C 1GUFA 1PFQA 3C3CA 5AD1A 5IJ0B 1ZNQO 2JJYA 3ZWKA 1O3YA 1JVSA 1WDKA 3GP5A 4ICIA 2G1UA 4KQWA 2ZJ2A 4EFNA 1OLUB 3NETA 3R7SA 5CB4F 4HN4B 1ZH4A 4KAXA 3STUA 1Q95A 3KEQA 1EQUA 2VHVA 4XIFA 4R83A 2VDLB 1X7HA 3LQQA 4H16A 1BS9A 1W85A 2I29A 3HY6A 2IDJA 3O8OA 3S70A 3UB4A 1T8WA 1X7GA 2WABA 4FMPA 1M2OB 5U4XA 4B8WA 3ZKWA 4G26A 1KTVA 5A0VA 1HXHA 5JS6A 4C07A 1L9XA 1RWVA 2KI5A 3ID6C 3V7FA 1AMNA 5EMHA 4ZZ0A 5CFZA 3IQIX 1XU7A 5C80A 4MXDA 1IUOA 1P2VA 1G6OA 4Z86A 2X23A 1X8LA 4KZPA 4KPUA 1UBSB 1IB6A 1SOVA 4KXLA 1AVTA 4O4HF 2IC5A 3WL6A 2QV0A 2J3MA 2R7KA 1NNLA 3HVJA 1FXUA 1N6OA 4JQSA 4RORA 4UEJA 5SYAA 3T52A 5AVYA 5K8JB 4FFPA 4IQ8A 3IDFA 1Z16A 4MKZA 5CEFA 3W34A 2FKNA 4G2NA 2MT9A 8GPBA 1LQUA 3ZE1B 3B5JA 4BU0A 1W36C 3TZHA 1MX1A 3GDHA 2CCKA 4G8DA 4XM0A 4DZTA 1ECLA 2NQ8A 2OKCA 2J32A 2J7KA 2OCYC 1GRNA 1NVVQ 4H1HA 4IVPA 5G2OA 3X3HA 4EB3A 4RM2A 3BSFA 4IXDA 4JVNA 2H5IA 4JP5A 1C7ZA 1D2NA 1P9RA 4M1QA 1NVMB 1K0UA 3AC0A 2R00A 1Q15A 1SIWA 2QTAA 3GJ6A 3QKSA 5GONB 2BKUA 1VYHA 1D3AA 4ZMRA 5JNTA 1CR6A 1P7VA 2ZI9A 1ZEJA 4GEKA 2ODEA 2GYUA 3U44B 2ZE8A 3KCQA 4BKMA 1X94A 4TMWA 1PNVA 2B2NA 1AK9A 1M54A 2JI8A 1J06A 4G86A 1QTIA 3V2GA 1Y1QA 3PNBA 3A06A 2WRZA 2B6HA 3F6RA 2OVBA 4QHTA 4RIIA 3U40A 3W8DA 2YWCA 3TYXA 2IIQA 2ZG6A 5I7AA 2WI8A 1IHYA 2WU0A 3F8TA 3SC2B 4MB2A 3Q9NA 3TMAA 2YV5A 4J9UE 1MABB 1HUQA 1F0KA 3DZKA 4Q05A 5AVOA 1O94D 1JB1A 2AKAB 4JLVA 4TLCA 1CCWA 1EVLA 1W5EA 3K4QA 3TTVA 3UJHA 2COEA 3ABOB 3RYCB 1FEZA 1JR3A 3B3QA 2XWQA 1XP8A 2ES4A 3LCVB 1G8JA 1JVBA 1YQDA 3IBGA 4UEWA 3ZEAA 3EXHA 1G2QA 5F9MA 2VCEA 3IDQA 2ON6A 5JPDA 4UHHA 3JCZA 1V37A 1NLMA 4O5OA 2EQ5A 1WU8A 4QFCA 2HWKA 4JJ6A 1GQSA 4MHSA 5ALZA 3FYUA 4XFKA 3WR5A 1RCUA 2D2EA 2OC4A 2BTOA 4FN4A 4HZIA 1UKZA 3C1AA 4GVPA 4OYHA 5DHSA 4X1IB 2X8AA 1EUDA 1H9CA 4QBKA 4CBVA 5ALQA 1THGA 4GP9A 3UMSA 3KQTA 5F76A 1THMA 4WCFB 2ZETA 4PRYA 2D5BA 1C1XA 2YXBA 1M2KA 3N8GA 4ZP1A 4F4DA 5IAAA 2CF6A 4B76A 1Y8AA 2C3YA 1UWVA 4PO3X 3DMHA 1PJSA 4V38A 3WA6A 4KO4S 1KQ3A 1ZW6A 2HFJA 3G2OA 1WUYA 5F7ZA 1XQ9A 4WFIA 3S27A 1E9DA 3DDWA 1WPQA 2AC7A 2DPXA 2ZUDA 4KQ6A 4MPTA 4PZLA 2I4OA 3ACCA 4E4YA 4IIDA 4CKCB 3L7IA 3A9RA 3UBTA 2VIIA 4Q3LA 4CVNA 1RI4A 4F8EA 2NU6B 1LTQA 3JWGA 4E09A 4ECAA 3RF6A 1YA4A 5KYYA 2NU7A 4U2KA 3FAZA 1KORA 4RL6A 3WRYC 4IHJA 1HFJA 4LNUB 5FTKA 4L08A 3B7GA 2OXIA 3LBNA 2KLHA 2QG6A 1Z7WA 4LV8B 4MVJA 5C8ZA 3MMXA 5JZBA 3IJPA 3KHSA 1BX3A 3SF8B 1AKVA 1PE0A 9GPBA 1JV2B 3R7AA 3D0OA 4C3ZA 5T4HA 4QHSA 3VTAA 5JI2E 2WJ3A 1NRIA 2O7VA 2NSDA 4RGVA 4Q66C 2HT6A 2O3JA 1YACA 4LE2A 1ZY2A 4C4XA 3EXFA 3HB5X 4DUPA 1EBBA 1UL1X 3AEKB 3IIIA 3N2GA 5C46F 4RTOA 3HXQA 1UXIA 2F1JA 3K5WA 1TMGE 2H1WA 4I1YA 2XYVA 1PAUA 1U8CB 1UFVA 4U3JA 4G5FA 1EVKA 4V0SA 3ZLBA 4AICA 2GWRA 1XYVA 2WJGA 2RAUA 3MIZA 1GA6A 4HGNA 3BMCB 1K8XB 2YVUA 4LI3X 4PQEA 1J22A 4R7GA 3RU9A 1DCKA 4D4JA 2TECE 3JZAA 4V3BA 2E21A 1X2BA 2ZYHA 4RCVA 1V47A 3X2EA 1EXVA 4OIMA 1O9BA 4XD7D 3R7BA 4N39A 2QP3A 4EKNB 2FLVA 2OXTA 1L5QA 3JYOA 4KQ9A 4F9TA 1F20A 2K2WA 5JQGB 2OGUA 1UAGA 1C0PA 3OY7A 1Y3FE 2HIMA 2V54A 2P79A 3LBYA 1KYTA 1XJQA 2GRAA 2I99A 3B70A 1H9AA 3HV0A 3M4JA 1K63A 2R7AA 3VMMA 4WBNB 1VPDA 2WD9A 5CFQA 4BEBA 3GYBA 1XRSB 2XOKD 4CRWB 2NMVA 1EZZA 1S2MA 1DQSA 1TMOA 2N0SA 3A6KA 4K9OA 4WA8A 5D1NA 3RLFA 3U4DA 4D43A 4HJXA 1W30A 3ESYA 3BC1A 4FDUA 2HMUA 3AP3A 4ARAA 1LD3A 4O4LF 3IJRA 4F6RA 3OPNA 1AS0A 4F2WA 2DCUA 1SBYA 4H1TA 3UATA 4BLRA 1KFBB 5HE9A 4C7MA 1RBYA 2FN3A 4FHEA 1O58A 1TZKA 2NQ2C 3N3BC 4MV3A 4QZVA 5LLTA 3A1CA 5AVSA 1JUDA 2W6NA 3V00A 1US8A 3Q2KA 5DISB 4UU1A 3I6BA 3TCKA 4YY3B 3TO5A 1IUNA 2V5AA 2B6NA 1BO6A 4G63A 3EVAA 3K4HA 4HB3A 4NNPA 2YYZA 1ZD3A 4RSRA 4X1OA 5AW2A 3LDHA 1WBBA 3KSMA 1F51E 1RABA 2C8VA 5KC8A 5KZMB 4IIHA 521PA 4MWBA 5LJLA 4KQXA 5BN1A 1IG3A 3EIHA 2Q2NA 1N2OA 2CKDA 2RKOA 2MYTA 4LRUA 2JAOA 1GTJ1 4PANA 2JI7A 5GPBA 1Z36A 2QXUA 3VVBA 2XQIA 1P2FA 4J4TA 3J7AC 5H68A 3WGYA 3DZCA 4WDQA 4D02A 1Z5OA 2XAUA 2XWJI 5G1NA 4CCYA 5BRAA 4IHAA 4DA6A 2NO6A 3BKWA 1XZMA 2OMEA 3OA0A 2OV8A 2BMVA 3QBEA 4JOCA 4O2AB 4XLZA 3ZXUB 4ACBA 4FWBA 3GCWA 4ODIA 2J0SA 3KDPA 1NDQA 5EXEA 3O8DA 2C7QA 1ZS9A 1L4BA 1YWGO 5KKAA 3EVDA 2V1UA 4C20A 1CS0A 4LJKA 2P8SA 1JQBA 4AKSA 4TL8A 5IFLA 2FWJA 2G70A 1W59A 2Q2OA 3W0LB 4HXFB 4JJ7A 3AHDA 3DBRB 4E13A 4MV1A 2NWQA 3GEDA 3R4CA 1PJ3A 2IEZA 2WTAA 2XV1A 3CCBA 3D8BA 4H3HB 4HRVA 3H5AA 4OQ4A 4OBEA 3WJ1A 4BFLA 2ZIAA 3RS9A 9LDTA 5LZ2A 1XN1A 4R9SA 1DELA 1ST2A 4Z3DA 4BS9A 4XJTA 1N5LA 1MQ8B 3I2GA 3PX7A 4XDHA 4BYGA 4N9QA 2XD9A 4WZBA 3OU6A 4H1VA 3HN2A 2ZE7A 5EJAA 4A0GA 4MMXB 2J85A 4OJYA 2O14A 2QZZA 3HCWA 2IKQA 4GNKA 4OHPA 3AFGA 1GPYA 3Q6IA 4LYYA 4RF3A 4UHDA 4FU0A 3KSBC 3E8SA 2FQYA 3LQ2A 3BMCA 4XE5A 2C57A 4BU1A 4UHBA 1Q11A 1O97D 4RHTA 2DUUA 1H5UA 3B1FA 3G6KA 1L5OA 4WJKB 2GZ1A 1YR7A 3H17A 1EX9A 4FCTA 1A2OA 4B0PA 1E20A 1DEHA 3GRRA 3A32A 4P32A 4Y7DA 1IWBB 4L3WA 4EWLA 2UUOA 5LQNA 1ESMA 1MC1A 3C8ZA 3TAUA 4EUHA 1CUVA 1KXJA 1QQ7A 3LGAA 3KWFA 3EQ7A 2VRBA 4OHYA 3L0SA 4COOA 3QUQA 1KS2A 3WIBA 5CT6A 4TM7A 2IOHA 3OLYA 4Q4CA 3CIFA 1BDHA 2CL0X 1CJMA 4HS9A 4P53A 3TTYA 3VHXA 2YJNA 3MUEA 3TVTA 3PSAA 4YXFA 3S2UA 5CHEA 3HSKA 4MVJD 3NAZA 1SB9A 3CEAA 3R2JA 3NU1A 1NY6A 2ZKLA 3EZ6A 4HWKA 5LD2B 1MXFA 2GBGA 1BZYA 2WM3A 1Q17A 4EJSC 5F9HA 1E0AA 2WPDA 1M5UA 2C88A 4RQAA 2QE7A 3QV2A 4UFNA 1E96A 1KH3A 1W1WA 2X1MA 3AJEA 3G7NA 3OPYB 5EHNA 1M6NA 3FUWA 3R6LA 1U2DA 3LT5A 2GCNA 3DFFA 3MGCA 4BV8A 2VJAA 2AJ8A 2HM7A 3GYGA 2JCGA 4JLPA 2G06A 2ZJYA 3C3WA 3R23A 4OFZA 4PSDA 4YFYA 5ENVA 3EPKA 2JARA 2ZIUB 4KO3S 5IKOA 2GZDA 2O1XA 2O2HA 3NX4A 3JQEA 5IMBA 4FW9A 4XGQA 3AJDA 4N40A 4NJMA 2P68A 4NICA 1WV0A 3OAAA 1KZ7B 2ZYTX 1Z6XA 2H2GA 3RUFA 4B35A 2MYPA 3ITEA 3HPQA 2DH5A 3LWNA 4LKRA 1HX7A 4QDKA 4CM9D 1WA5A 2CLIB 1LF5A