2IDMA

2.00 a structure of t87i/y106w phosphono-chey
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 40
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2idmA00
2FLKA 3EJWA 1U8TA 3D02A 4DADA 3CTPA 2IKSA 1EHCA 3G85A 4LE0A 5BR1A 3LUKA 1NXVA 2L2QA 5KWSA 2VUHB 5KC8A 2VYCA 2FLWA 3A0UA 4RZSA 1JLKA 2IPMA 1ISRA 1NATA 2P4UA 3H5IA 2B1JA 3I5AA 3T8YA 4JASB 3QLUC 1JBEA 5TPZD 1KRXA 4Z4HA 3JY6A 2FN9A 3NNDA 4MR8B 2LIVA 3KJXA 5B3JA 3C3WA 2OENG 2JBAB 2NT3A 1JFSA 4H3HB 4HNQA 4ETNA 4WXMA 1SD5A 1AB5A 3Q9SA 5IUJC 5TQ0B 4O1IA 9ABPA 2IPNA 2M1ZA 4D6XA 1FFWA 3SAJA 4RV5A 1H9CA 3O2QB 4MS1B 5IUNC 7ABPA 1Z15A 5IBQA 2XDYA 1BDHA 1ZHHA 4WXEA 3URMA 1ABEA 4KQ9A 4EGSA 1LBHA 2VK2A 1LBIA 4OLBA 3HCWA 1L5YA 2JVJA 3KTOA 2CHFA 1QNLA 1PUXA 5IEJA 5FWXB 3QLTA 4MGEA 4KNYA 2L17A 5T7BA 1GUDA 4RK5A 1YMUA 4KFCA 1MIHA 1PHRA 3KLNA 2E4VA 3LUDA 2DRIA 3O75A 4MR8A 1CYEA 1Z25A 2QXYA 2GWRA 3FFWA 2JBAA 5TPWB 3T6KA 1QO0D 8ABPA 5GQSA 3OLVA 4ETIA 1ZAYA 1M2EA 1D1PA 3O1JC 3VNAA 2WJAA 5IUKC 3HXMA 4RXMA 5TQ0A 1ZN2A 3RVPA 1RZRA 4YR7A 4KRFA 3OQOA 1DRJA 1P6UA 1LJUA 1ZGZA 5HKOA 1M5TA 1I3CA 4MS1A 1JF8A 1EWTA 3N75A 4MS3B 1Z18A 1JFTA 1MVOA 3CZCA 2FMIA 3KCNA 5CNMA 2FVYA 4NCAA 4MQFB 5E3JA 2CWDA 4Z4CA 3LTEA 4RK4A 1IIBA 2LPMA 2HQRA 2TMYA 2FSPA 5FWXA 4QICA 4Z9BA 2IOYA 4HNRA 4XAQA 3HS3A 3GWGA 4W5RA 3NHMA 3DLHA 4ZJPA 3H5WA 1NXOA 3CU5A 2L18A 4KK3A 2N9UA 5TPWA 3NNNA 3F6CA 1YVUA 3TX6A 1KMIY 5FBHA 6ABPA 4GPAA 3CHYA 3UKJA 4RS3A 4MPTA 3RVMA 4O1HA 4XLTA 4ZMRA 5TQ2B 1DBQA 4RDCA 4MS3A 1SXIA 4KK4A 2Q5CA 3LKBA 3OLZA 4MQFA 4XFKA 5BRJA 3JTEA 1YS7A 3SQNA 3A0RB 1U2QA 3DZDA 3O1HB 1ZVVA 3EULA 3CRNA 1DG9A 1RPJA 1D5WA 3H5LA 3CS3A 3QELA 1TMYA 2QVCA 2WMYA 4OG2A 1C4WA 5TE9A 3P9YA 3HM9A 3CG0A 4HYEA 3T95A 3ILHA 5C5CA 1DRKA 1USKA 3M9WA 3N0XA 3HJFA 4EYGA 4TMYA 5JNSA 1SXHA 3SY8A 3HEBA 4UHKA 3CFYA 2QR3A 4RK7A 2F8TA 5TQ2A 3OLYA 1USGA 4DQDA 2LBPA 1TM2A 3RVNA 2QU7A 2CHEA 1L5ZA 4IILA 2IPAB 1YMVA 4DN6A 3H5VA 2PUEA 2PMCA 3W9SA 3A10A 1RXIA 1QO0A 3FDFA 3N0WA 3Q7SA 1QP0A 3FFXA 1A2OA 3KYJB 2JCGA 1W9HA 1DC7A 2FMFA 2H3HA 5I4CA 2FEWB 1DCKA 1P8AA 5CHYA 4TLMB 4RK1A 3MA0A 3O74A 1M5UA 1SXGA 3K9CA 4G97A 2ZWMA 2VUIB 5DLEA 1NXTA 3MIZA 2WB4A 4Q7EA 4N47A 5HQJA 3H6GA 5CNIA 3OM1A 3QLVA 3RH0A 2MYUA 4M88A 2R25B 3OM0A 5IX8A 3EQ2A 3DGFC 3HZHA 4W5TA 4KMRA 4Z99A 4EY3A 4N0PA 4Z9AA 2RJNA 4G0YA 2ID9A 4IMIB 3N0RA 4KV7A 5FBKA 2FN8A 1J56A 1BA2A 2E4ZA 3HSYA 1E6KA 3QEKA 4G86A 4JA2A 5KI6A 4EUKA 5JS1A 1DBPA 3OMXA 4WZZA 5KC9A 3KLOA 2RDMA 3LMKA 1MB3A 3NHZA 3HDVA 3VNBA 3H75A 1VLZA 3M9XA 1ZH2A 4RKRA 4RY0A 4WUTA 4YLEA 4MRMB 1K68A 4N76A 3C6QA 3S99A 4S05A 3N53A 3B2NA 2IPLA 2HQOA 4RK0A 4RWEA 4ZPJA 3O1IC 1Y1LA 3KSMA 4LE2A 5DCLA 1ABFA 2R48A 1U0SY 4KZKA 1BAPA 1P6QA 1GCAA 2PUBA 4H60A 1MAVA 3JVIA 4LZLA 4JB2A 3H5TA 3JS5A 2J48A 3SM9A 4OTZA 2FQWA 3ROFA 1YTUA 1U2PA 1JDPA 1FFGA 1JYEA 2FMHA 5DTEA 3RVLA 3MQ4A 4YCSA 4JAVC 1XHFA 1U04A 3RVOA 3C97A 3GRCA 2PL1A 3KKEA 5DKFA 4OATA 2FQXA 2R4QA 1NXPA 1ZITA 4MRMA 3HUUA 1GUBA 1LK0A 3TD9A 2PE5A 1JFVA 2WRZA 3RVKA 4MR7B 1YK1A 5D2CA 5GOTA 4Y9TA 1TVMA 5JNVA 5KQPA 3EAFA 4S04A 2MSKA 2A9QA 4H3KB 4MR9B 1SRRA 5EWJB 3RVQA 3IP5A 5ABPA 3HUTA 4QPJC 1LJLA 5TQJA 3LUJA 3C3KA 4GNRA 1EWKA 1HEYA 1ZDMA 1R8JA 2FQYA 3E61A 1EFAA 1AB6A 4TLLB 5PNTA 3MM4A 2M98A 1K66A 1TLFA 3QLUA 1JDNA 2NZVG 2IYNA 5TPZA 1C0EA 2L19A 3A3KA 1QPZA 2FW0A 2RJOA 4IMJB 3CLKA 4LDZA 4NV3A 2FXIA 3ILYA 6CHYA 2JB9A 3Q15C 3UUGA 4MS4B 4MR7A 5B3JC 1Z2EA 5KQLA 4Z4IA 2WWVD 1QP4A 2GKGA 3UK0A 2V0NA 1BDJA 4G0ZA 1QP7A 1JWLA 1DCMA 3FMVA 2O20A 2JK1A 1ZH4A 4MR9A 3QK7A 5EWJA 2MYPA 2WY2D 1QKKA 3IP7A 3OMWA 2E4WA 4G0XA 2X7XA 4E7PA 3L6UA 1EWVA 3H1EA 2GX6A 4G0QA 3JPWA 3OLXA 2JVKA 2A9RA 1F51E 2YHBA 5BRAA 2NUBA 3E3MA 3CZ5A 2E4XA 1D1QA 1YK0A 5ED4A 1QQBA 2R47A 2FEKA 3C3MA 3LKVA 1DZ3A 2B4AA 4YP9A 4MS4A 1E6MA 1ZESA 3KG2A 4N03A 4YV7A 3EQZA 4RY9A 1KRWA 3TB6A 1NXXA 1E6LA 4KQCA 1JHZA 1OXBB 3HDGA 1JX6A 1CHNA 4QYMA 1VRVA 3IPAA 4EYQA 2PUDA 3GT7A 1Z26A 3O21A 1RZRD 1DJMA 2HPHA 4Z4FA 3BREA 4F11A 3QX8A 2HJ9A 4L4UA 2NZUG 1XWWA 3KHTA 2HSGA 3Q7RA 4ETMA 2W42A 2AYZA 3R0JA 2MYTA 3GBPA 3QX9A 4EVQA 3MF4A 1TJYA 1NXWA 4LDAA 4WT7A 4G0OA 5JNUA 4MLDA 4LE1A 4F12A 4F8JA 2MSLA 2YHAA 3I42A 3EODA 1BDIA 4F3TA 5FWYB 1GCGA 3GV0A 4P1ZA 1VKRA 4FB4A 3LFTA 4WWHA 5C5EA 4MQEB 4ML3A 4RK6A 3H5OA 1Z2DA 3OO0A 4ZYLA 3T38A 3EDCA 4IGAA 4YWHA 3IPCA 1VPWA 2MYNA 3I45A 3EGCA 2ID7A 1M2FA 1NXSA 3GA5A 4LRQA 4RSMA 2MSWA 1F4VA 3OO1A 1T34A 3LUFA 3N8IA 4FE7A 4XASA 1W25A 4XXHA 5HM6A 1A04A 4YS6A 2BGGA 3Q41A 3GBVA 2F8SA 1D2AA 1QMPA 1DP4A 4IF4A 3OQMA 3F7NA 4RXTA 4PZ0A 2PLNA 4Z4EA 2PUAA 1GLGA 5FWYA 4UHJA 2PUGA 5DGCA 2A9PA 2QV0A 4NICA 1BVHA 4MQEA 5HSGA 2E4YA 4W5QA 5CNJA 4OBBA 3LUCA 2A9OA 5JNWA 2OQRA 3GL9A 4EYKA 3L49A 1ZGGA 1JH9A 2E4UA 3NBMA 4QYWA 3OLWA 5EWMB 3LOPA 2QVGA 5IULC 3I09A 4RXUA 5JNTA 3TO5A 4IRXA 3DBIA 3QEMB 3IP6A 3BBLA 4F06A 4NCBA 3JPYA 1MB0A 4RY8A 3RVRA 4N0QA 2H0AA 1FQWA 4RKQA 1EAYA 3LUAA 1USIA 3O2SB 4LX8A 4RU1A 4HNSA 2JVIA 3MMNA 5CNKA 2FTKE 3F6PA 4Q6WA 3K4HA 3JVDA 1PNTA 4Q6BA 2LUOA 3LUHA 5EWLB 1ISSA 3DLBA 1PEYA 4PEVA 4W5OA 4PICA 2WJWA 3M6MD 4YO7A 4JP1A 4MAAA 3HV2A 1A0OA 1URPA 4Z4GA 3LUGA 1NY5A 1PEAA 4PYRA 5EWMA 5KQGA 5IEBA 3RVSA 2PL9A 3QLVC 3IP9A 2CD7A 2RGYA 3G1WA 1OXKB 3GYBA 3N6VA 2NT4A 5KQMA 2GI4A 3QEMA 4B09A 3BRSA 1P2FA 3QELB 1YIOA 3F73A 4XARA 3HVRA 1FFSA 2FMKA 4MYRA 5F64A 5IC5A 1S8NA 3TMYA 3HO1A 4TN5A 2KYRA 1RXEA 3H6HA 3IDOA 2I6FA 2QZJA 3RQIA 1JYFA 1D4ZA 1XHEA 1UDRA 3SG0A 4EYOA 4KPYA 4OLAA 5JS2A 1DBWA 1JL3A 3CKMA 5EWLA 1CEYA 3D8UA 3OQNA 1PNRA 2PKXA 4MLCA 1B00A 3CG4A 4PE5B 4EVSA 1APBA 5BQ3A 1YS6A 2JRLA 2PUFA 3RVJA 1DC8A 2IDMA 3FFTA 1Z16A 4JOQA 1QQAA 1WETA 2FEPA 3BILA 2HQBA 1Z12A 3KYIB 4O5AA 3KS9A 3SNKA 1Z13A 2PJUA 3Q7TA 3DGEC 4G0PA 4CBVA 1NTRA 4KREA 4FE4A 4P98A 4L85A 2GBPA 3NNSA 2PUCA 3H1FA 3ROTA 4D6YA 4ZMSA 3FGZA 4JB0A 4YRZA 3H1GA 2LP4Y 3HK2A 2P9HA 1FSPA 1ZY2A 4G0MA 1RNLA 1E2BA 2QSJA 5T3YA 4E7OA 1DCFA 1KGSA 2QW1A 4KVFA 2ZAYA 4YGXB 3CNBA 4EVRA 3BRQA 4W5NA 3O2JA 1Z17A 4N41A 2AYXA 5JNRA 2FKAA 3MYYA 4Z0NA 2PAFA 4D74A 4NQRA
chains in the Genus database with same CATH superfamily
1V41E 5ES3A 5KJ1A 4QEZA 3BJMA 4ZVVA 2IS4A 3QOXA 5ADWA 1SCDA 1WR8A 4LQDA 1TQHA 3G85A 3KPJA 4GMFA 5FHRA 4G09A 3S40A 2Q1SA 3IB6A 3Q7PA 1YV9A 4ARAA 3WNCA 1XU4A 2OHXA 3MT9A 1HG1A 2XYGA 2OV1A 3IPRA 3QUQA 5H0IA 3R9KA 1YF3A 3KQWA 3HVRA 3LVQE 4RUKA 2H6EA 4HZGA 3BZUA 3BAFA 3ZIUA 3CPEA 1N32B 3K2QA 1A2KC 3JQ8B 1FDVA 5AFSA 1X92A 2LIPA 1GZ6A 4H7JA 4ZOEA 4C01A 1WPGA 2WSMA 3IHTA 5CX1B 5TPZD 1Z29A 3INTA 4MI9A 2WWYA 4E5MA 3AB7A 3KJXA 1XMPA 3K8YA 3N74A 3NQ41 3IIJA 2GD1O 1EFVB 3SJ7A 1NBIA 3KE8A 4M1WA 1XPOA 1HDZA 1N0WA 3MJCA 4M9RA 2IP2A 4UBJA 2NP6A 3DEAA 5U9CA 3W2HA 1R5OA 4QTXA 3PBKA 4LNUB 5HFNA 1KJNA 2HQSA 3RNOA 2XGOA 1AF4A 4BO9A 5BR8B 4B6FA 3O9ZA 2FA9A 4BVKA 3BFVA 2W93A 1SOUA 4ZRDA 3KVYA 4PCAA 5DMHA 2ACVA 5JSYA 2AOUA 1X1AA 1SCNE 5IDVA 2V97A 3P97A 4UBMA 3UB2A 3VBEA 4DA4A 1K7EB 4JC0A 3AEZA 1CUHA 2FX3A 1RYBA 4LS3A 4IV0A 4ZPXA 3GPCA 4RJJA 4TVOA 3RV3A 2IRWA 4I50B 4BVJA 3TQSA 2DR0A 2WYOA 3GFTA 2WVJA 1UZAA 1SBNE 3CXUA 2H1IA 3K0FB 3U0VA 4G4SP 1NNUA 1X3SA 5H3LA 5K6AA 3PDIB 3ONVA 4IXDA 3Q2OA 1BE6A 3C48A 4TYWA 4P7GA 5ITSA 3PJRA 2BKLA 2WQ6A 4Q4AB 2QXUA 3KKQA 1X86B 4B7UA 1MA0A 1U7OA 1VLQA 3LCVB 4N5DA 2XUDA 2Y0PA 4D57A 3H0CA 3PGA1 3TSZA 3PKZA 2HR1A 2IHKA 1L7NA 1JHMA 1MMFB 1ZXXA 2IHUA 2QQ0A 2VSYA 5ECDA 5CVVA 1T6NA 4PX9A 4UE3S 1NFQA 3GRYA 2TMYA 1SNYA 2RK6A 4I1RA 5DF1A 4ZP1A 5E0OA 1AH2A 4HNRA 2ACWA 2B94A 1AKTA 1OBOA 4P7KA 3LH5A 1M2KA 4HB0A 3KXPA 1V8OA 2DWPA 4Y0VA 5KWJA 2YWGA 3SFZA 4DDUA 2Q0HA 1TB4A 5A3VA 5TV2A 2A5FA 4PLHA 2A2ZA 5L6MB 5MGBA 4GLJA 4LVOA 4BIIA 2A30A 2QY9A 2AEMA 3MMSA 1J0AA 3E1KA 2WKRA 5L40A 1Y8QB 1N34B 3PUZA 1TUGA 3GJZA 1J8FA 1MRSA 1HORA 2VHUA 4PVCA 3ACDA 1MFZA 1P7ZA 3RWMB 5DU2A 1GAJA 2D2VA 4J7UA 1U1EA 1CC1S 1YZFA 5HQTA 2AZ4A 1KE2A 3D6NB 1UMKA 2UUOA 2VUUA 1VKHA 2QTRA 2DHRA 3KR2A 1DFGA 2BLNA 4IJMA 3ZGLA 4B4WA 1CZNA 3G5LA 4IMRA 8AT1A 4OMFG 2GNOA 1PS0A 2F59A 3JXEA 4TUYF 3WOHA 3ZLVA 5EZ5A 3T15A 2YRWA 3KL4A 1MIOB 3HBJA 3E0QA 5U4QA 4FFWA 2X9GA 1NG9A 1VBNA 2WKPA 1SVUA 4LJYA 1QGUA 3ETNA 2CNWA 5ALRA 2CZGA 2FRDC 4O2BB 1F0NA 1F6DA 3M9WA 3D8NA 3K16A 4I4TF 3MLBA 5EKTA 3TTTA 5HK9A 3OCWA 5JNSA 1YXMA 3DOOA 2WINI 5IZCC 3IHWA 4W5HA 2K7ZA 4N49A 4DE5A 1FQKA 1WCIB 2P2GA 4LWOA 1J8QA 1WQ3A 3V2UA 4H0NA 2FSHA 3NH6A 1P17A 4IILA 2IPAB 2ZJ6A 4L27A 2HADA 1TMOA 1HOTA 2ZXFA 4DN6A 4J1NA 2ENUA 1WXEA 1Q3TA 1WD7A 4JP2A 2G5PA 3NDBB 5K0FA 2AN9A 2VHXA 5MFZA 4CEHB 4M8IA 3WNVA 1M1YA 1MJNA 1R0SA 2YV4A 3BIXA 3IUYA 4C21A 5E7MA 4EJSB 2B99A 1M2GA 5FADA 1HQDA 3OEYA 3L4EA 1I7QB 1N2ZA 3MA0A 4GE3A 3VH4A 2O8EB 2ZSIA 4EENA 1F7UA 1GPAA 1P74A 5JPCA 1XCBA 3ESAA 1I80A 1T2CA 4YRMA 1QG2A 2CFTA 2ZDQA 3FDZA 2AEEA 2A92A 3MIZA 2QW8A 4K6FA 1XMSA 3TQFA 3K9FC 5C4MA 1X1RA 2PAAA 3NX4A 5HQJA 3H6GA 1XLTA 4MUJA 3PKIA 2PFSA 4NF2A 3UJDA 5F73A 2OCGA 4I9FA 2C3OA 2WUWE 3EQ2A 3Q9UA 3O84A 1SVMA 4WOJA 4Z99A 1NDQA 1B1CA 1RQ7A 1ZUNA 1J24A 1NI4B 1PNOA 2ID9A 3IA7A 2XLCA 3PGJA 4MWDA 5FBKA 3TFQA 4CG2A 3PLAE 1H3EA 1SUIA 3K94A 3QU4A 3VR4D 3ZYZA 1PKXA 1U1DA 4GXQA 1XRQA 1NW7A 3FIJA 1NLYA 3T7DA 4R3WA 1CVIA 4XR9A 2B37A 2JI6A 5B58T 1ECGA 1FNNA 1L4KA 2CDBA 3HBAA 1TQ8A 4D45A 2XMQA 3SHWA 2OORA 3DKIA 4AN4A 2Y1LA 2XH8A 4QOGA 5SYMA 3SHTA 1PWHA 4A82A 4CR7A 4X60A 3ROKA 4DKJA 4DR4B 2AK3A 3NBXX 4ALNA 2ZJOA 4LQCA 1PQUA 1M73E 2I34A 3FYHA 3MGBA 4OL9A 1EZ4A 4FX5A 4XD7A 3IR6A 1FA9A 1FUUA 2WIAA 2EJTA 1CLUA 1CTQA 1ZMTA 4ZU6X 1N78A 1WF3A 3DD5A 1FU4A 5DBGA 1MOPA 5KNCD 4LE2A 4GLLA 4I66A 4JGBA 3HDJA 1U9ZA 2BFBB 3C5EA 1JPVA 3WLMA 2NO7A 3RUPA 1E59A 3NVKI 3AM5A 2WKQA 1XMQB 3D8HA 2Y0BA 3DOUA 4N7RA 1FUEA 4GQAA 4XFDA 5NULA 2AOXA 4YT2A 3IDAA 3NFRA 2AC7A 1JU4A 3AUUA 3FW1A 1NUAA 3G82C 4WFJA 2YASA 4OKNA 4EHNA 5IABA 1NVEA 5G0SA 3S29A 2Q5JA 4DG8A 2OPHA 1BMFA 2IEBA 2H52A 4FDMA 2OBMA 4IQ8A 4M4SA 1WMBA 1XNQB 3W9YA 3GYGA 1GPKA 2VOEA 4C2BA 4DDVA 3W7VA 4ZJZA 3L07A 3O8OA 4FOSA 4J75A 1VBMA 2D7CA 3RJ5A 4F5DA 2X3FA 4IGIA 2DR3A 3FJ1A 3TKYA 2AW3A 4CTOA 2CL0X 2BKAA 3KTAA 1SXPA 2P2YA 4RD2A 1WW8A 3CNQS 5CLQA 4AF8A 3H2YA 2GZSA 3IV9A 3ADBA 2RGCA 4GM4A 4XLZA 5JW6A 2ZTMA 3H2JA 3IP5A 4K6CA 2VTBB 1SA0B 2C4UA 1GZ5A 1R88A 2PYIA 2ACKA 2BHSA 4K9RA 4WXHA 1DDOA 3SICE 3LUJA 2SKEA 4JC5A 1KOFA 5BNWA 1EVQA 1YBHA 5JWHA 4FEEA 3LQ1A 4B2PA 4MQ5A 3V4VB 4FDAA 2JHFA 2ZW9A 3MM4A 3PEVA 1PSZA 1MOZA 2G0TA 1C1HA 2PSHA 4CMIA 4W9MC 3U44B 4P0QB 2C2YA 2PUJA 4N7BA 1BYIA 1QIGA 1XA4A 2JCBA 3AF4A 4IMJB 3NG1A 1XKLA 2CLSA 5ADHA 1E1DA 1PV2A 3ABZA 2BE7A 4MIOA 4BO6A 2J9GA 3EWSA 2Z5VA 3G5MA 4XX0A 2AMVA 2R79A 1EX6A 2WSSA 2CDNA 2ZOSA 3IQWA 3OIFA 4G5QA 1IK4A 1IJEA 3D2LA 1DDGA 2QQFA 1U8UA 2PCLA 3W3ZB 4EHLA 1L1EA 1U6KA 2D1QA 1JDSA 1KSGA 3QVGB 4S24A 4X85A 1Q22A 3PUXA 2Z09A 1UKCA 3FHTA 1IN6A 4P53A 1JHOA 2GFQA 1I3NA 2GAJA 1X74A 1OFIA 1QZXA 1SMKA 1NQVA 1T2UA 3G5TA 4R1PA 3HR7A 2QM7A 3L6CA 3X1WA 5DTQA 5CA1A 3CVYA 2HNAA 5DZSA 4TOIA 1SU4A 3UCFA 1NBAA 5JASA 2J41A 3AP1A 1TW2A 1L4EA 2OLEA 2QTZA 1KR5A 3H1AA 4D44A 3KQLA 4LSMA 2X8LA 3BWXA 1N7HA 3C7KA 1RKBA 2X1LA 2QN2A 3WXMA 3F90A 1T5BA 4MQBA 1RJ9A 1TVCA 1R8SA 3GT7A 2NPFA 3SSAA 1DAEA 4TSRA 3K31A 3S55A 4FYVA 4D99A 2HL6A 1ZJ5A 1A5ZA 2QEQA 3QX8A 4U2DA 3RE1A 4KXQA 1Z4OA 1RWWA 3GJ7A 2VYVA 4RCYA 1C8LA 1YQ9A 3QV2A 1EB8A 2XADA 4IRMA 2MYTA 4HPXB 3GT3A 4NH4A 4X61A 1IQ0A 3GD7A 3QX9A 3QZUA 2VJMB 5DO9A 4DLAA 1YB4A 5HIAA 1NONA 1I4LD 3K6RA 3ELYA 3M83A 4S1WA 1J97A 4GX2A 4LE1A 5SYNA 2ZZKA 2HQ1A 3HCPA 4HDRA 2MMGA 5JZOA 4HNHA 3V8BA 2FGJA 4Q12A 4BGIA 5ARCA 1XQWA 1QHFA 1XEFA 1HDXA 3D0QA 4HVTA 2GCOA 5EHGA 5HBGA 2GFIA 4DA9A 1LLUA 2WNIA 4MUIA 2B3DA 1T5DX 1TIBA 5E95A 2H1WA 5BSUA 2ZPTX 1RWMA 1UZNA 3QF7A 3ZHBA 3FOZA 1CUFA 5CBKA 1VPDA 4C0SA 2F1HA 1G3RA 1NVAA 1QIHA 2F67A 2WF7A 3Q7QA 2ZJZA 4GI7A 4OYLA 1EVZA 3S1SA 2BN4A 5ALOA 2BFCB 3OE7D 1A95A 3NTQA 4GUDA 4MRSA 3N9IA 5HUQA 5F1KA 5IS2A 2DECA 1VB5A 1LI4A 2Z56A 5I8WA 1OBHA 2GJ4A 4K46A 1U9IC 1KQ3A 3ABOB 2WV7A 2XT0A 3P9ZA 1GZDA 1S96A 1PNQA 1EDBA 1VGRA 1P0QA 3GJQA 3A32A 3L0OA 1MO6A 5C7IO 5DHQA 4UCQA 1DPGA 2G77B 3KOYA 1GLGA 1E8DA 1L1RA 5FWYA 2JGKA 3DAOA 2ZSAA 3H86A 4DAOA 3M6UA 5U1PA 5AM1A 4M1ZA 1KDPA 4ATNA 5LMUB 3ZD7A 1VZ3A 4W5QA 4GL4A 2XSZA 5JSFA 2ZRDA 3MLAA 3KYDA 1T0IA 1OU4A 2OQRA 2VH1A 1KI1A 1P9RA 4AMVA 4EYKA 2YC2C 1EG7A 2FR8A 1TVEA 5ECGC 1U7HA 2YV2A 4KFRA 4FJ1A 3P4YA 1U7TA 1J2YA 3AF5A 2OPBA 3G79A 1BHSA 3H1BA 1JIQA 4QODA 1A5AB 3IP6A 2IBSA 5I01A 1O4WA 1MB0A 3ZWOA 3LDAA 4DV1B 3SS9X 3HN2A 4KH1A 4AJPA 1PUJA 2XGMA 4IV5A 4CMJA 4EMBA 3GCGA 3NM6B 5EKXA 1UXJA 4RU1A 2C9BA 2P5UA 1TKCA 3RF6A 3LY7A 1KJJA 1J23A 1UBEA 2W4IA 4UU7A 3PQ6A 4WY2A 5LP6F 4LRXA 1PWEA 5HE8A 1T2AA 4YJGA 2G04A 3QKSB 1Y3IA 4JNCA 2Z2JA 5AKLA 3WLFA 4NU8X 3J81A 3LSYA 5AVWA 3RSOA 1JEOA 2BJHA 2P67A 3IO5A 1TW3A 4UDNA 4ZIRA 5E1MA 3HV2A 1Z5UA 2F1KA 1HSOA 1PEAA 2GGSA 1E8NA 4PYRA 3VSEA 2CVQA 2QHXA 4AKHA 2B3TA 1XRRA 4H7IA 1VKNA 4UU0A 5FJJA 2OT3B 3PJEA 3MB8A 1A1VA 4N9QA 1S8NA 1S1CA 4HN2A 4KE8A 3NIWA 5LC1A 3HCEA 1Z2CA 3AETB 3CLUD 4LC9A 1LH0A 4LIPD 2DY1A 1TOAA 2FWAA 5IDYA 3ETGA 1AQIA 4RHUA 3QEAZ 3P96A 4CR6A 3ANXA 3RFFA 1AKQA 1K6IA 1C50A 2XVAA 2ZBVA 1LU9A 3BA6A 3DTVA 3IBSA 4KPUB 2ONYA 1G3UA 5I8PA 2V5VA 1J49A 4RHYA 3T5MA 3H11A 4PVDA 1H0RA 1B00A 3ANNA 3IUQA 3R5HA 3N6XA 2PKQP 4FOLA 4IUBS 1ZNWA 2PQ0A 3G13A 1YI1A 2QE7A 3SJBA 1IB6A 3FFTA 1U99A 1KO1A 2WP8J 3DBLB 3LHKA 3I1FA 4LRUA 1M6VB 4UAGA 1E9CA 1G5FA 2WIJA 3HXTA 3KVNA 3M5PA 1DB3A 4LDQA 2QI9F 3KS9A 1C4OA 4ZYVA 1UJ2A 1NI3A 3TXYA 2ZI4A 4YJ2F 2W98A 1RYZA 2YV1A 3EUWA 3GDHA 1N8KA 1NN3A 2HXSA 2RGDA 2WC1A 4FFPA 4UKDA 2AYYA 3L8EA 4C6SA 3CH4B 4H59A 4DLRA 1SIOA 1V9CA 2JEOA 3CZAA 3GFOA 3LT5A 1AQ6A 3P7MA 3SBOA 4BZZA 4ZVNA 7YASA 1Z45A 4E5KA 6REQA 3A2MA 2YTZA 4BFTA 4C1BA 4QUHA 2GBLA 1AV6A 1RXVA 2C5LA 3BXPA 1SUBA 1PR2A 3D2CA 5KAMA 1G7RA 5DYIA 4H3SA 3GFSA 4OX9B 2VEDA 4F86A 3W2FA 4G36A 1VG1A 1PGQA 2DQ4A 2PZBA 3KFXA 4I5EA 5T57A 3STVA 2IHBA 5A02A 3RVDA 4LRWA 3U40A 1N8NA 1T1IA 2X23A 4U39A 1W46A 3D02A 1E6CA 1HEIA 2B5OA 5I9IA 3RU9A 2PT7A 2YZ2A 4RSHA 5ALTA 1Y89A 2NMVA 5AUOB 2ZTLA 4OKIA 2IU6A 2EYUA 4F38A 3NYQA 3NUQA 1NGSA 2XWJI 3DJFA 4A73A 1DTSA 1NATA 2GLTA 3KC2A 1THTA 1R0LA 2BJWA 3NRBA 1ORIA 3RFXA 1D2HA 2X5NA 1Z4QA 3IIEA 1P4JA 2JNWA 1QBGA 1SD2A 2HA5A 3EUAA 3LS2A 3E03A 1T6BY 5CCDA 4CLEA 1E3EA 1DAIA 5KZMB 2BTOA 1SVIA 2Q0XA 5B3JA 3V5NA 2R97A 4H3HB 5HS6A 1B0UA 2QYOA 3C3PA 4E14A 1P39A 4H1UA 3M5CA 4HT3B 1EE2A 2Z2YA 2GH1A 4JELA 4RA6A 5B7PA 2OE2A 2F6RA 5K0ZA 1XDDA 3DZCA 4DQLA 1BEUB 1MAWA 2V5UA 3GFGA 2J3KA 4IHJB 5ESWA 2XDYA 4XE5A 4A8TA 2F9MA 4BQFA 2FEMA 3EXFA 4GMKA 1L3BA 3VGJA 4FU0A 1RRFA 4CM9D 2D1TA 1D2MA 1BE0A 4NX2A 1Q5PA 4ZVOA 3QLTA 3CSDA 5D3ZA 4WFKA 1Q1EA 5SY6A 1NBEA 3DP7A 2X41A 4EF5A 1N92A 4GDFA 5KNBA 5FV7A 1DG3A 3HB0A 4BLWA 1Z25A 2GPYA 2ZQYA 3W4IA 2RGEA 1QO0D 2BOVA 4A2CA 4C22A 1C4KA 1AN0A 4YR9A 1XTVA 1ZN2A 1AA9A 4U2GA 5HA5A 4ZCSA 3FSGD 2JFQA 3T5BA 1ND6A 2R86A 2UV8A 5K6RA 1N7GA 1AS3A 3MJSA 4N9WA 2RI1A 4GOMD 1L8QA 1BRMA 1SOWA 2BMDA 3CZCA 3R0QA 4DDKA 5HQ3B 2UXCB 2QX4A 5JO0A 5J4VA 3HVJA 1SG0A 3V97A 3W5JA 3RYFB 4D92A 2QQ5A 4ZO7A 1GGMA 1NQXA 2DHQA 2IUEA 4DEYA 5H02A 3FZEA 1XNJA 2Z3WA 2QTVA 3ROEA 1GWNA 2ID4A 4MV6A 4YLGA 4PY2A 3C3AA 2ZYHA 5FI5A 2N9UA 4XSVA 3U3KA 1CY1A 3K2EA 4PO3X 5HIMA 1T4BA 2QU8A 5FBHA 5CEFA 5ENZA 2GCPA 5T4EA 3FTCA 5DT9A 3E70C 2JG3A 1XB2A 4GSKA 3UKJA 3JYOA 2XIJA 5H81A 2IELA 3NVMB 2BFFA 4EGCB 2IPOA 1JA0A 1XGKA 2JGIA 1H8ED 1OBVA 3N8NA 1R8QA 1WMAA 1KMCA 5IAGA 4W7HA 3E1SA 1Y34E 4XFKA 1VLVA 4I4IA 1P77A 4QPNA 1XVVA 4F6RB 1LRKA 1P7YA 3PF8A 4QRDA 3IR7A 3VDXA 2WM3A 4P32A 2UUPA 1US8B 5BT9A 2IYOA 2P6MA 3WK4A 3NBQA 3DL2A 4LZPA 2PLWA 3K05A 5YASA 1G21B 1YZHA 1ZA1A 2XMGA 5KYYB 1QB8A 3H99A 4AUNA 4K6HA 4AJ1A 4UOEA 3BEDA 2H1FA 2IYLD 3GGCA 3IQDB 1G8PA 5TE9A 3L4SO 4AULA 2G76A 4CHTA 4H4CA 5EERA 4BVHA 1LSSA 1WHSB 3GT0A 1PS8A 4AZ0A 3ZHQA 3D6HA 3WGMA 1VRCA 2FMUA 4YJFB 1G18A 4K26A 1SEPA 4AAYA 5FWAA 3S2GA 4EA9A 1TYDE 5A4JA 2DXIA 1EK1A 4J6FA 3UAWA 2BKUA 2VZLA 4M36A 3Q3GE 1EHYA 3UPTA 4Q4LA 3VKFA 3U7HB 1O97C 4ESOA 1G5PA 5KNCH 4X20A 2OMEA 3ICOA 3W9SA 3NGXA 3WAKA 1N6HA 1WNFA 4Q4HB 2JEYA 5A7GA 2FSVA 1R0KA 2LVBA 4F2DA 3DMTC 1RHUA 1MN6A 4GP7A 3TOVA 2H3HA 3IVMA 4LBZA 2SBTA 4RM2A 3FZYA 1RKUA 3OX1A 4DCCA 4TT3D 4HDSB 3VU8A 1R10A 1RRKA 5FOTA 5B4TA 1CY4A 1T5TA 4DTCA 1I3OA 4MPDA 5FYQA 3WGTA 4EAQA 2ODEA 3KVVA 2ECPA 3QENA 3Q9NA 4L0MA 2GF9A 4QPCA 4UZEA 2ZG6A 3G9TA 1O8BA 2EEZA 4CF3A 5A5GA 3F67A 2A0FA 4GPTA 4GSYA 4Y0NA 1FMFA 1FPMA 1LQTA 1XN4A 2RAUA 2XQGA 1P5ZB 1MH9A 2FPIA 4YK7A 5IVKA 1YI8A 2JH9A 2O05A 3N2EA 5JH7F 4JQSA 3UH0A 2J0VA 1LXCA 5KQSA 4LK3A 2YJNA 1E2JA 4HPJB 4YUAA 1EGQA 5AKZA 1KC3A 3NUZA 4GYKA 1Q7GA 3E9RA 4GECA 2R6DA 1NWHA 1KEVA 5K0LA 2ZRCA 3KLOA 2H0RA 3GC6A 4H0FA 4MJ7A 3AHJA 4LJAA 4BCBA 4D42A 4EW3A 3EPJA 3K32A 4DIFA 5CB4F 4DV7B 3DPUA 3MTEA 3PV0A 5EYPB 1Y8ZA 2GPTA 4H31A 1JR4A 1QPBA 5I7SA 3LQYA 3AUYA 3D6FA 1NUUA 3OPNA 1GZ3A 1OYOA 4OV6B 2QG6A 3DE1X 2JFFA 3G2HA 1I9CA 2AVDA 3QEJA 3X2SA 1VECA 2L0XA 3CINA 1VL6A 1XJWA 4NHEA 4OYHA 1FXWF 1YS1X 3H65A 1HOXA 3MGCA 4OD0A 4BFSA 2R48A 4CG1A 5CDHA 3O26A 1E5XA 3O4VA 3UT6A 1EUDB 3WDKA 5KX5F 3U62A 4JI8B 2HW8A 4TQAA 4LZLA 1BYUA 2CYCA 3O8QA 4DARA 3F6YA 5LU9A 2AFHA 3OJOA 3A70A 4ODIA 5DTEA 5CD1A 5KYWB 2Y92A 3ADCA 1F7VA 5AHXA 4R9NA 3DZFA 4JL8A 1QC5A 3FHLA 3W8FA 2W2OA 4M9XA 3RYCB 3CVJA 1OFGA 4B75A 1FP6A 2XYRA 3FDIA 3O38A 4J2OA 3ZUGA 4Z1MD 5IXYA 1PJTA 4G4JA 1KZ4A 3RT7A 5GINE 1FSGA 1K5PA 4C4ZA 5A9TA 2C61A 4GICA 3AKEA 1I0LA 3BDAA 1TUBA 3LD9A 4HRYA 3WQQA 3H4IA 4RL4A 5CM9C 2X7HA 1HY3A 4PGHA 4EB3A 3UJ3X 5KQPA 1VCMA 5AW1A 3WI7A 2MSKA 1EYZA 2YX1A 2WABA 1UR5A 3KB1A 4IDPA 4LV8B 2IYSA 1IL0A 3CYFA 3E84A 1YCHA 4UVHA 4B6JA 1TL7C 5BMVB 1TCUA 4PNPA 3LBHA 1QG0A 1TGYA 4YAFA 1AN9A 4AZ3B 5A1TA 4GNRA 1O1YA 4KP7A 1JG2A 4H7KA 3AI3A 4BWYA 1W94A 2VHEA 2NAPA 1D6NA 3ZH9B 3LXXA 2ZBEA 3AHDA 2FW0A 4EFDA 5B4UA 1CUAA 1F4PA 1LBSA 1U0OC 4C7BA 2PX3A 4AJEA 1KI9A 2FFAA 3EF1A 3PD0A 4TL6A 3WK5A 3NKVA 3V1TC 1OLUB 2A58A 1ZZEA 4MP6A 3I3OA 3CZRA 1Y6GA 3N7AA 4M1EA 3UMFA 3FAKA 1SCKA 1UL1X 4QG7A 3ZVNA 3GLIB 3TFOA 3A36A 3QBTA 2FWRA 3OUZA 3BIFA 4LJRA 5CCBA 1CZLA 4E08A 4EATA 4FDTA 4PLYA 3IULA 2XE7A 2AR9A 2VWGA 2WJIA 3CUKA 4PWYA 3A6HA 5EJFA 4BBPA 2P6PA 4HFMA 1K92A 1WXIA 2VBIA 1OHHA 5J5CA 1C5KA 2XDWA 3TN7A 1GPH1 2PX2A 5DCUA 5BSMA 1TTHA 3L6UA 4I81A 3NDPA 4G0VA 1ONSA 4M38A 4AYTA 3BXXA 3IVAA 5BRAA 4TKLA 2R8EA 4BO4A 4I55F 1YK0A 3WAJA 1MFPA 3D8RA 1Y3BE 1FL9A 5CVEA 3EC2A 1N2CE 3GNSA 4II2A 2C7QA 4OA8A 3MBKA 4G5YA 5C53B 4UCWA 4LF8B 1C1XB 1KXZA 1P4RA 3LT0A 5KOJA 3F6EX 5E1OA 4XYGA 3BTOA 4M1YA 2Q1TA 3SPXA 4DMGA 3P4UA 3DBHB 4F8YA 2RAFA 1YQDA 2Y0DA 3U7RA 2QGFA 1IJKA 1GSOA 2IDKA 1VL8A 4QYSA 1R6VA 4UBLA 5FTNA 5ICMA 5IMSA 3UA4A 1O03A 4CTKA 2G17A 5MN5A 1AJEA 5B1EA 4PX5A 3IMFA 3DSRA 3LQKA 4QE3A 1TJYA 3TRFA 3L0ZA 3NHBA 4AMUA 4WGGA 1ZJ6A 2OECA 4N3BA 2XECA 1GZUA 3L4BC 2D59A 1IULA 4QUDA 3WOVA 1F1BA 2WKSA 5L7YA 4P08A 5SY4A 3IELA 4BNUA 4B8YA 1ABBA 2RKBA 3KR9A 1J7KA 4BU1A 1UP4A 4BVBA 3EEFA 2O5VA 1U3DA 4P36A 4EHJA 3O8BA 1B7GO 4ML3A 4BV8A 2CXQA 5DN6A 4EKNB 2B8WA 4FNGA 4WUVA 2FSGA 3ZZTA 1X6VA 3UTCA 4DIDA 2B9VA 4IGAA 3AR5A 4YWHA 2QRPA 3VO8A 1Y42X 5CBPB 5C31A 1J0XO 5TJ9A 3A9WA 4C4RA 4NIMA 1TJNA 3PHLA 4WBSA 4C0XA 4U7PB 2AJ8A 3OO1A 2ORWA 4NZNA 4MUAA 3OZXA 3M5DA 4Q3BA 2OL4A 2CLIB 1G38A 2W6PA 3IR5A 4YMVA 1LBTA 2IP4A 2QMEA 3M6AA 4R3NA 1SR8A 5HCUA 2JKVA 5G0WA 1KNQA 4IF4A 3HKBA 1UPAA 4H08A 4DLKA 4Z7QB 1JHYA 2HJRA 5T4FA 2W6ID 3OFNA 4PZ0A 3IUPA 2R6R1 1ULZA 1GVHA 1ZM4A 4LYFA 4MYSA 4PFSA 1WKVA 3HJRA 4PS0A 5G53C 3IKVA 4CJXA 3VVMA 2G4LA 3OG9A 2QV0A 2R2AA 2FRDA 1NOIA 3LL7A 4NU0A 4QT0A 4RHXA 3ZLBA 3EC1A 1G55A 4QBFA 2I99A 5IZCA 1ZRHA 1XA0A 4MVJA 3EVDA 5COQA 1TUEA 3GL9A 1TRKA 1GNSA 2REOA 2YJGA 3HGTA 5ALPA 2A0WA 2F3UA 4UDXX 1MOQA 3AVWA 3SEFA 3HSKA 1GY8A 1F60A 4HH1A 4M0FA 3U48A 3VPGA 4AY4A 3OTGA 4F60A 1NQ5A 1GDHA 1BWQA 1R4MB 4G37A 2OQVA 1HFEL 5KJFA 1QZZA 2GA8A 5LMZA 1LTKA 2V5AA 2C7OA 5FA6A 2REBA 1K8ZB 4RKQA 1WW3A 2PL3A 1OH8A 2MT9A 5LVAA 4KR7A 1AKNA 1Z8DA 3L02A 5LQSA 5JZBA 1EXWA 1JKXA 1R12A 4LXYA 3O95A 3TVDA 4EL0A 2Q3DA 1FDWA 4H4DA 3WADA 4UZFA 3ZWQA 4CQMA 1NRJB 2J5BA 4NCJA 2WJWA 3D0KA 1DLJA 4YJ3A 4DM7A 4NEGA 1Q91A 1OX4A 1PV1A 2ZT5A 4YQEA 3GOHA 1FMTA 4L16A 2WIFA 1EFRA 2BGKA 4L57A 4U6QA 4Q4JB 1KKMA 2G9NA 3RVSA 5C0OE 2FFHA 4D1YA 3OECA 4EHDA 4RVCA 1P5HA 1UBHS 4JLNA 3K8ZA 4OAQA 4BJHB 2HDOA 1H69A 1EVLA 2IUFA 3PNMA 1ZSNA 4Z9FA 4REOA 1B6RA 2V7VA 4BPRA 1BGXT 2FZ5A 1VIMA 5IAKA 2Y1GA 5HKLA 3U4GA 2NU9B 1A8SA 1K8RA 2MINB 3R3JA 3KU4A 1GUZA 3QEBZ 3WS7A 1DTWB 2LDBA 5FHQA 2CUZA 3DT8A 5JS2A 4C76A 5CXQA 5KWIA 2ZUFA 4LZAA 2CCKA 2UZ4A 1V6CA 2OK8A 3D4LA 4BTLA 1F2TA 1T91A 1PNRA 3AQ4A 4FYJA 1AA6A 1JG3A 1G4AE 2QENA 4HGNA 1GA4A 4L3VA 5E1DA 3O82A 4AJ4A 3V4ZA 5HHTA 3T3GA 4Y67A 3IPLA 3WMRA 2DTDA 1DXQA 3NWPA 5CDFE 4CRWB 4K9SA 4ACAA 3T1NA 2GN9A 3T7SA 5M34A 2WFZA 2EFCB 3H97A 2JW5A 3SNKA 4L74A 5IDQA 2QX6A 5JXGA 4AQYB 4GM1A 4QIHA 4JI0B 3MELA 4LOIA 3TRDA 1SQGA 2NYVA 2RHHA 4MUFA 4OXKA 3CF4G 4BZXA 3AM3A 3GHHA 4HP8A 5I45A 3HXKA 3Q2IA 1ZCFA 3OX2A 1V3TA 1E79D 4RM3A 5FUYA 2EVWX 3EW9A 3MJVA 2VJNA 4IVQA 4WCFB 4DILA 3FG9A 4F6CA 1CE8A 3E18A 4WEOA 1KGSA 2DUNA 2CXXA 4N3NA 4QECA 4POOA 3ZXSA 4LBWA 5LMCA 2B82A 4GI1A 5JBQA 1B23P 3HZOA 3GWZA 1P7WA 1EFTA 1Z17A 2JLBA 2Y6UA 3WC4A 4TS9A 2O8DA 2JJ1A 2BEUB 2IV7A 4JI6B 2Q6TA 2C5SA 1GQOA 1UJNA 2XB9A 2ZFUA 3F74A 5FPQA 4WK4B 1E1QD 1SUWA 2B61A 2F3TA 2ZI9A 4JHLA 4OYYA 1E2MA 2FH5B 5I7AA 3UENA 3T9EA 1AHPA 2IYWA 1M2OB 4Z49A 3PRHA 1OGJA 1UWLA 2YQZA 3L1HA 2R8YA 3Q0TA 4Q1CA 2DE0X 4R01A 3VR5A 2BGRA 1IHOA 5MDHA 2AD1A 2BT4A 5J2TB 3CZMA 3DOEA 2RD2A 2I7TA 2HK8A 3JASB 4LGVA 1YS2X 2VR1A 4KFSA 1S6YA 2WD7A 3ZHCA 3H5IA 4CIDA 1MB2A 3W7AA 3OJEA 2C03A 3ZCXA 1GQ2A 2YJZA 2VYFA 2X8JB 4PFKA 3ZY2A 3OEHA 4H7HA 4DUYB 4QXOA 4YCCA 2Y9PB 1LV8A 1JKJA 3FPEA 3PNBA 4GI2A 4GO1A 3OY7A 3B5IA 3JY6A 4G8DA 1E2IA 5K05A 2B1QA 4LPSA 3UYLA 1VGQA 2QRHA 4QBKA 3VYUB 3DE3X 4KX3A 3OTQA 1KYXA 1H4SA 4P86A 1G59A 1RJGA 1HT0A 5AXDA 4MAFA 4BQOA 2CUNA 2PZAA 4MUMA 5JHGB 1AUOA 1DEAA 1L6IA 1YDHA 2DAPA 2YW2A 3QLEA 4MS1B 2C5HA 1TK9A 2GKSA 3PVCA 2BDEA 4MQMA 4ZEXA 1IG3A 4QBGB 5DI3B 2FUCA 4F4CA 3W5DA 2FWNA 1M0WA 4JLSA 1BDHA 3U81A 3PWTA 5ETJA 3EQ6A 3GB9A 4MPJA 5AJTA 3UG7A 4C0KA 4DM4A 3U19A 3W3AH 1Z7GA 3KTOA 1IQUA 2HHHB 3G5UA 4DY6A 5F9HA 2FK8A 3EAGA 3I9KA 2L17A 2ZRGA 2P9FA 3PI6A 1H6AA 3E23A 1G291 3Q72A 1N1GA 5KYNA 2P5TB 4KQKA 1I5OA 4MR8A 3V9AA 3ABIA 3FUWA 2JJ2D 1JDUA 3E05A 4E03A 1XSEA 3TZKA 4Z51A 5TX7A 4FHFA 1C9NA 3VO2A 4ENWA 1DOHA 2W2VA 3IXLA 4BBAA 4F3NA 2RHWA 3GPLA 3LCMA 2AFIE 1X7GA 1GZ7A 3PIRA 2Z5FA 2F64A 2BMEA 3KBBA 3QKWA 1MVOA 5CNMA 3T7TA 4BASA 4NCAA 2FVYA 4DIBA 4MQFB 1G3QA 1FS6A 2C31A 3C8DA 4FMDF 3I9OA 4ND4A 3DEYX 1XIVA 3CT6A 4XVUA 4FGUA 4CLOB 3HJAA 4NONA 3THXB 2IOYA 4AFNA 2QJWA 1V2HE 5EAIA 3W2IA 1GZ4A 3FTEA 3KSAC 1CD5A 3AF3A 4FMCB 3SU8A 3AHFA 3L6OO 1NXOA 2PQMA 1XZDA 4IYRA 3D3JA 4KK3A 4B4UA 2XKJE 2ZXEA 3AU8A 1YU6A 1U4NA 3NNNA 3T1VA 1QS0A 4U2BA 1MHTA 2GERA 1TDJA 1QVVA 4HR7A 1FB5A 9LDTA 1QE3A 3QQPA 5DM2A 2RBEA 3WRVA 1E63A 1VYHA 1WCV1 2J9XB 2PGOA 2Q5CA 2REXB 2XKAA 3OPYA 2JCSA 4IUYA 2UVQA 3LKBA 2CLFB 5EJ9A 2DSTA 1GQYA 3TJRA 3O9VA 2GYVA 3BORA 4LFBB 1L7BA 1U9IA 1NVMB 2R6CA 3M49A 2DWOA 1A50B 4Q9LA 2PGAA 3OZCA 5EIBC 5AW6A 3I9LA 3H5LA 3W04A 4M0LA 5BVGB 4ZCLA 2EJCA 4H35A 4REQB 3VOAA 5JAHA 1AGRA 1BQEA 4MK4A 4YGYA 1YR2A 4N7JA 3F8WA 4H2DA 2V6JA 1CJVC 4KIFA 1VSTA 2IGBA 4XCXA 3U5TA 3F6BX 1ICIA 4HF7A 3NBZC 4CMCA 4IP0A 3H8JA 4P0PB 2GDZA 2CHUA 2QORA 5EY5B 4BJ6A 4U5XA 1P7VA 3A4MA 3TUZC 1Y1RA 1G6OA 3T34A 4DV4B 1USGA 1I2MA 2CFCA 1Z73A 2PKCA 2QU7A 3DHVA 1IY8A 2FEXA 3GRAA 4WXRA 3FVTA 4RD0A 4HNGA 4V1CA 2W70A 3FUVA 1SU8A 1NZFA 2R62A 1X1EA 2NW6A 3N8KA 4GMDA 4TT8A 2KBFA 2BBSA 4IDDA 1E1NA 2Z30A 3T94A 4NMHA 1MC8A 1KAHA 1JXQA 1UMBA 3LLMA 4AJHA 4CMHA 5C4GB 4G5HA 2Q3HA 1MHPA 3N8HA 2IWHA 1N4DA 1RLTA 2E21A 2H48A 2OAP1 3NANA 4NDZA 5FBWB 2GSDA 3SOZA 3NYRA 4JGGA 1RKXA 1CY8A 1L9KA 2VP2A 4ZOLA 2ZJ0A 3KZKA 2PXAA 4L3WA 4U7FA 2FPLA 1G6KA 1JTEA 2XCIA 3T3EA 4C0BA 3EPKA 4M98A 2WB4A 5CEJA 1PJ2A 2JFNA 1P1CA 2OILA 4WBXC 2HLDD 2N75A 2EP5A 2XDQB 4M88A 4UOZA 2CNOA 1JIKA 4FILA 1KPIA 4X0EA 3JQDA 5M5BA 3JZAA 3A2NA 4IHQA 3LLSA 4P4GA 3UM9A 5K0GA 3RFVA 2Q2QA 3K20A 4JX9A 4RMIA 1Z0KA 2HIHA 4C06A 1FUKA 1LW6E 1JHDA 2CHQA 3EA0A 3O8RA 4JKIA 4KQWA 2EJVA 2IYYA 4LEIA 3U9LA 2O8FA 1U9JA 2GN8A 5KC9A 3O3CA 3ZV4A 1SXJB 2D74A 3RRMA 4UM8B 5B6IA 1K0UA 3SMVA 3NYIA 4S3MA 2Q4TA 4XIIA 2AJLI 3HMKA 5BUQA 1RR6A 1OTXA 2GAOA 1ESMA 3AFNA 2BMAA 3IV6A 3AXSA 5ILGA 3X1DA 1YBAA 2ZVPX 4WIAA 2BSAA 3E3OA 3GT4A 3O4RA 4RY0A 3ZY4A 4YAGA 2PX6A 4UREA 3C6QA 5DGXA 4DA6A 3PU6A 3QE2A 4R8MA 3I04M 3PC7A 5DHSA 2GXSA 2AQIA 5KTNA 3WX0A 4YT8A 5IP5A 2VNIA 1ZIXA 3QVXA 3ANMA 4KZKA 3EARA 4YEDA 4O63O 1F20A 4EQ6A 3L8FA 2ROQA 4PPGA 2X6QA 3TRHA 5A3JA 3H5TA 3SC2A 2AV6A 3PXDA 5AVXA 5DBEX 1ONBA 3EIFA 4TXHA 1FLNA 4MQ4A 3O8CA 5BOSB 4L4SA 4BFVA 2JEZA 4BX2A 2XCTB 4LXGA 2ODQA 2NX2A 2YN4A 5ALZA 5KVAA 2MR6A 4Y2UA 1U8EA 1XHFA 5C81A 4E1BA 2H00A 3HTXA 2AW5A 1BOFA 2Y8EA 2X0DA 3KU1A 3WNZA 3BL8A 3PC4A 1A9XA 4TYYA 1W5BA 1FLDA 4QAJA 5JLAA 4Z3DA 3W5AA 3AI7A 3VO1A 2O2EA 4AG5A 4BMVA 1TQ4A 2ZIUB 5D2CA 1ELOA 2JCXA 3N0VA 4J1SA 1EGHA 3R7FA 5C32A 3U7IA 4NBWA 1I7SB 4UPEA 3U4MA 4S04A 2ATEA 4KQEA 821PA 2VJDA 4H1HA 2OBFA 5C35A 1A9SA 4YAEA 5BV2P 4BZPA 1H2BA 1MOSA 5AICA 1R4ZA 5AXAA 2SHKA 5H3HA 1WZUA 5TB5A 4BRWA 3A04A 2I2DA 1XRLA 1HDEA 3RSHA 5BNIA 1OKKD 2PS1A 4G5FA 2JARA 4LCEA 2HFJA 3ZPXA 3OZSA 1K66A 2QMYA 1NJGA 4BWFB 1Z75A 2YUIA 1F6WA 3M6XA 3FXAA 1T9GR 4TS1A 3ZJYA 4IFEA 3UJNA 1UT6A 3CIOA 1OT3A 1M8GA 3ILYA 3Q15C 1IXSB 3JW8A 2KLHA 3NHAA 4RPKA 3H9QA 2YS7A 5BPFA 1UFKA 4W82A 3ZS9A 4BLVA 4HLDA 1ENPA 4ZTBA 4B45A 1VLHA 2PU5A 3NORA 2XCLA 5DM0A 2X5JO 3ETDA 1GL7A 2IHVA 3U3JA 1T8WA 3TSYA 4J2TA 2ONKA 3ECCA 1D8TA 3LDGA 4XI9A 1IATA 4DR3B 4AY3A 4UBOA 2WY2D 1ZIDA 3U0BA 2YV3A 1J09A 4OHXA 5JVDA 1C7ZA 2V7PA 3B1YA 3TL2A 3G0BA 4N3AA 5K7SA 3W8RA 1DARA 4QFMA 1FSZA 2C29D 1Z7EA 3OLXA 3V1NA 4ALIA 3DS8A 2FXVA 3E3MA 4V24A 5K8UA 1U7UA 3L7IA 4LWZA 4Q1EA 4ERNA 1JR6A 3M3HA 5K09A 5H5JA 3VR6A 2P90A 3O7MA 4AMBA 1F8UA 3DWFA 1NJ8A 3HKEB 3WGQA 5HDQA 2B4KA 3IMEA 1CZOA 4REMA 4N03A 1SBHA 1JLRA 3AF0A 1SQFA 1YR8A 1NLUA 1T2NA 3BZBA 5B30A 4EYQA 4I9HA 3BXOA 1NASA 3F8TA 3GH3A 5TY0A 3TIFA 4OSEA 5FI3A 4BZWA 2NSHA 1P19A 2SECE 2HF2A 3A9SA 5A9SB 2ZR8A 3EXIA 1REQB 3Q7RA 2QT1A 5JQGA 13PKA 3FTPA 3DBRA 2R0QC 2A84A 4MKZA 3II6X 3KZ1E 1VHDA 4JLWA 4EYSA 4Q66C 2QVBA 4YREA 2PX5A 3LU1A 1V3UA 4ANFA 1R15A 1XTPA 3OOEA 4RMNA 1DRVA 2FPXA 3AMVA 1H66A 2H2DA 4AZSA 1T24A 2PPVA 3T4UA 4GZ3A 5I7EA 1OBFO 3MWKA 3IJEB 3G8DA 2JLCA 3D4NA 3WYGA 5EE5B 2D5BA 3TD6A 1Z2AA 3R3XA 3H5OA 2EFYA 4P4UA 4UMVA 3RJMA 1JS1X 3WSWA 2X4IA 2H9YA 2ZI5A 2UZ0A 2X22A 2J9FB 3PUJA 4R9SA 4BNIA 2O8EA 1Z0DA 4FMBB 1EUCA 4RHEA 4CEJB 2WFMA 4EPRA 3ABRB 4BKQA 4LRQA 4XIFA 4LFCB 2WSBA 4BCDA 2QMQA 2HA6A 5A4KA 1ML3A 1RLIA 4U9IS 1SK9A 1EEXB 4Y3UA 2L69A 4JVNA 4DIOA 2AXEA 2WVHA 3IH5A 1R6AA 2HHLA 2AN5A 3OY2A 3P27A 4I6JA 1WQ4A 1DP4A 3CRW1 4YC7A 5EKSA 3R7WB 3PGLA 3KR0A 5D5PA 1PLLA 1TAHA 2HZ7A 2Q3LA 5B57C 3FYUC 1UXHA 3FZNA 1DU4A 5DNCA 1NBWB 2ZBFA 1O2DA 2Q2NA 4L7VA 4YP1A 1JIJA 3NGLA 3ZZ0A 4YXFA 1XXHE 4FNMA 4RQAA 2OYCA 2I4OA 5DHFA 4OBBA 2F1IA 4OFBA 3ETEA 3D8SA 2G3YA 4MGIR 3ZYCA 2YXLA 2ZRAA 1AF7A 4S1VA 1UAYA 1ZRSA 4J7CA 2AF4C 2GTHA 3D4PA 1MPTA 4N3GA 2OCBA 2QNBA 3EH1A 3BMOA 4IRXA 3DBIA 1ZVJA 2ECQA 3WGVA 1B8NA 1JR3A 3DMTA 4GXNA 2PA0A 2H0AA 2HBZA 3FA2A 4XWTA 1NV9A 4W6ZA 4X1IB 4OQLA 2YFQA 4DY4A 1CZRA 1DJLA 4JDUA 4LUCA 4L5IA 2CFSA 4U2CA 4Q6WA 1COWD 3JRNA 1SIWA 1D5CA 1JR2A 1N5OX 4P84A 1AUXA 1IUOA 4BNGA 4DIUA 4IJUA 2Z2XA 1JECA 4BE4A 5EWLB 3AEQA 4H0CA 5IJ0B 4BO0A 1ECBA 1NDUA 3ET5A 2G9QA 7MHTA 3IP8A 1Q14A 3L46A 3DKRA 1GYRA 2QS9A 3ITNA 4XQEA 1HL7A 1CZKA 1SB8A 2G6BA 4RF3A 1KK0A 4BFWA 1INLA 3AL0C 3K0BA 3ROPA 2OXRA 4K6GA 5FIUA 5K0EA 2LV8A 3BN3A 5KQMA 3QTLA 3ENZA 2PMBA 1XQXA 3LF2A 4N5NA 3MNFA 1PK8A 4MYRA 4WK6A 5IC5A 1QRDA 2XXBA 4E4YA 2GTPA 1VJ5A 2I5PO 4TN5A 2EU8A 1DJQA 2H1HA 3TEFA 1CNEA 4L8VA 5K3FA 3L7MA 3DKPA 4RETA 1Y1KE 1SU6A 5FBLB 2BAGA 1ULTA 1ONOA 1X8KA 4N65A 4PLWA 1UDRA 2V9ZA 3S1AA 3VOBA 1MR3F 3B52X 4JL6A 4AT1A 5I51A 1KY4A 1OH5A 2IE8A 4RTSA 3K8QA 1WTAA 2LRHA 1CEYA 1UM9A 2J5QA 2WWWA 4K7JA 4O0LA 1U8ZA 3DXYA 2ZVQX 3LGXA 1ZINA 4EY6A 2PUFA 4XFJA 2BEWA 4WSOA 1NSTA 2A7XA 4JLKA 1HYQA 3EPPA 2OXTA 3KSUA 1R0YA 2QZSA 5EE0A 1GNLA 2P9CA 4IVRA 4D3XA 3T61A 3D1JA 2AK2A 1K7SN 1P62B 2GHIA 4PXSA 1ZI6A 4B0PA 4CFSA 4WCDA 1KIAA 3GLFB 3DMHA 3UBMA 1VL1A 1TK3A 1KK1A 2PJUA 3CLVA 3VUEA 4Q1AA 5HX7A 1X7WB 2D00A 1CQJB 3GROA 1NJ2A 3TYXA 2AZDA 1FF9A 4RBNA 4BMSA 1GILA 2O6HA 3I12A 5K0CA 2GR9A 3B12A 2DBZA 1T3ZA 2JAPA 2XCSB 4AKIA 3L1VA 5DYYA 1YS4A 1H2FA 2Y68A 1JLLA 4PYNA 4GIBA 5KCZA 1E2FA 4Y2PA 2I1QA 5L3ZA 3U56A 2PFKA 1MAUA 4PLCA 2Y66A 2BMFA 1YQEA 4KWEA 4RVOA 2E18A 4UUMA 3AO0B 1YBFA 5BUZA 2YWJA 5L53A 3KKZA 2AX3A 4KUHA 1WEKA 1KFKB 2VF4X 2ZVJA 3A31A 2BGUA 5BSVA 5FR2A 3O3MB 3FSEA 1CUCA 4JP3A 3VBCA 3P9SA 1YRQA 3A4VA 3OPXA 1TT5A 4KIUA 4L9AA 2X0JA 2LCFA 4U4AA 3CLRD 4EPVA 5KKCA 3DTNA 4MUGA 4Y2SA 5I7FA 4MX8A 5IVPA 2P4HX 1CRWG 3BKXA 1K9SA 2NO5A 4EEZA 5EVJA 2HWKA 3TM4A 2F3PA 1II8A 2WJGA 2JH8A 2BKEA 4C07A 2IOQA 5JEDA 3GCWA 5G3ZA 5IANA 5FL3A 1Y4DE 2JC3A 5ALDA 4GL2A 4O29A 3UW3A 1JWBB 3J80A 4P93A 4AI6A 3OURA 4G26A 4LMRA 4PLPA 4RHCA 2H2IA 5DOVA 1FMCA 2HUNA 3D6VA 4C4OA 4XQCA 5ES4B 1W5AA 4F2HA 2HJVA 2BMWA 2AMJA 3I34X 4RTLA 3WLEA 5DHAA 4YT5A 4LOJA 5JAZA 1ECJA 1UWCA 3DOCA 3SEAA 1R18A 2QA5A 4K3VA 3EVGA 3AERA 5D51S 3LOUA 3M8KA 4W1PA 1XTRA 5HMLA 3BGSA 3OZDA 3A3OA 1U3TA 1GITA 4B6SA 3NR2A 3UAVA 4ARUA 4G65A 3MCAA 4B87A 4MHOA 2XTAA 2BCJQ 3NIFB 3O7WA 5AI0A 1I2BA 3JR7A 3PSAA 4PG4A 4X3OA 4XYLA 5CFQA 3CM0A 5LXTA 4R2XA 3NBAA 4RZHA 2O2IA 1MC5A 4WNAB 3K8OE 2Y1KA 3Q2KA 4LF6B 4DLWA 4B76A 4Q01A 1V5FA 4E30A 1CYEA 2BFAA 2GZAA 2VHYA 1MAAA 1XCPA 3G59A 1FP7A 4BO8A 1FW6A 1SB9A 5BSRA 3E8MA 1UBOS 2C1ZA 1XD8A 2VDLB 2ZUBA 3HXMA 2OOSA 1TFUA 5FULA 4YR7A 3ASYA 3K5PA 1NW5A 3G9UA 3MWJA 1XO1A 2XNJA 1L7DA 2WWHA 5JANA 1H9AA 5L7TA 4IOKA 1C3EA 3L82B 2YIMA 2R44A 3TR6A 1QUFA 1XQ9A 4HN9A 4DMRA 3H4VA 4QXAA 3SEQA 3CNNA 2G6TA 3U3OA 4LOKA 3AQIA 3UANA 5EESA 3VI4B 3UMBA 4BATA 2Q41A 1XYGA 2D7DA 3ZWCA 1UDBA 4YIHA 1KTIA 3L4BA 1CR0A 4PGAA 3MHPA 1E1CB 4UTZA 1KARA 3RTBA 4O3MA 4YCJA 3O4GA 4E4TA 2C2OA 2DPLA 2HOQA 3HXOA 1MGPA 4KEAA 4FLFA 3S2UA 1GEGA 4B3XA 3EF3A 3MBIA 1IBMB 1P4HA 1ZBQA 1F38A 1ESDA 1U7ZA 2GJKA 2ORIA 2YUTA 3EGDA 1MX3A 4Q9IA 3TQHA 2PRSA 3A14A 4CCYB 4CNQA 4F5ZA 3Q8KA 3SZMA 2QZZA 5FPYA 3TTWA 1O95A 1QH8A 1QFSA 2ZPAA 1W36B 1JHUA 4P35A 1YGPA 3LI2A 1E8MA 1Z6XA 1VQ1A 1XAJA 2XB6A 2ZJFA 4FT4A 3RANA 4E5SA 5ELLA 3RS0A 1T8UA 3ZHRA 1SBYA 2O3UA 3EXG2 5JO9A 1PBNA 1PQ4A 1UDXA 3DE0X 2B20A 2I1LA 3O1LA 4FINA 4LXUA 4F2PA 4Z3KA 4OLHA 4QAQA 2XD9A 3O1HB 4WOBA 2XUJA 3OZGA 2QQGA 1EM8B 5B3KA 1VKZA 3WRXC 4ER6A 5A0TA 2QVCA 5LOVB 4KNWA 1QWSA 3JWJA 1STOA 3GR6A 4KN5A 1S3SA 3OESA 3VH1A 2BFWA 1DV1A 2BI8A 3DLCA 3N0XA 1FFDA 4JQCA 2ET6A 4DLUA 4Y1FA 2WHPA 5CP8A 1SBIA 4P3KA 2P77A 4BMPB 3ESRA 3ZZMA 4FDUA 3HNOA 1XT6A 1FCJA 4UHKA 4K03A 5TQVA 5GWXA 4C4TA 4OP1A 3JYNA 3O8DA 5DTRA 3NONA 4KGDA 3OIUA 4CNBA 2PMFA 3GK3A 1I51A 2JKYA 4A5OA 3VAAA 5C8DA 1YMVA 5BSHA 3GGOA 4H1TA 4HX5A 1W9MA 5UKDA 2WIBA 1ZGHA 1FDIA 1T9KA 1UPUA 3S70A 3EUEA 3VYRB 3W5UA 3V7NA 1R4NA 1FDUA 4M7PA 4TV8B 4GUAA 3SD7A 3VZSA 2C7PA 2C77A 1L8OA 2CJFA 2QTNA 3TVTA 4FBLA 2J59A 5EXDA 4A36A 4EGAA 1ZP6A 2VF7A 1O94D 3ZX5A 1VMKA 1PK9A 3BHJA 4ENTA 1Y0BA 3CVOA 4LI0A 4ZZ0A 5IC4A 5ISMA 2ZBUA 2QP3A 5FL7D 3UWPA 4OUDB 5CA1F 1M5UA 4QFCA 1ZOLA 4AZWA 4ABTA 1XDSA 1U31A 3HUFA 1IMJA 3LHSA 1ACLA 2JZCA 4M21A 5JSZB 3CPSA 1JEAA 4R0NA 5JS6A 2WUDA 3IT3A 3R3UA 1MPXA 4C0WA 1JLHA 3VYVA 4QLBA 3VPHA 1LV7A 3EB9A 1NFRA 3NT2A 3FRHA 1D07A 3HO6A 4M9CA 5M7EA 2NN3C 4DEXA 3L2OB 4EG4A 1HBJA 2XGJA 4MARA 3TR5A 3AG6A 3ZJ5A 3N0RA 2XNSA 2XVXA 4V0KA 4BIMA 1J56A 1BA2A 1ZM7A 4H17A 3LT4A 2JFWA 4NKRA 3ICQB 5KI6A 3TGPA 3RIMA 4RYLA 4MXDA 4Q4DA 3OVMA 2R68A 4RHTA 4ILKA 2X0EA 1SHZA 3G8YA 2XB8A 4JGIA 1TCCA 1ZVMA 2ZSJA 3UTDA 5KHOC 4EB0A 1RWQA 4G8JA 2CXSA 3GG9A 4UFPA 1KY2A 3H2BA 1GQRA 1N2HA 1QORA 4JI7B 4C4SA 1D2CA 1TM1E 3RBAA 4CM6A 2RJ3A 3GHYA 1WE2A 4S0ZA 4WUTA 1DEHA 1P1JA 1GNQA 1H8HD 1GGEA 1K1EA 2HLHA 1UOQA 4OM8A 4G1VA 1AV7A 1PYGA 3LY9A 4K40A 3S99A 1E7YA 1XNGA 2ZUDA 4OGWA 1FVOA 3R3YA 3QKRB 3K4PA 3RLIA 2O1EA 3NRJA 2PV7A 3OSZA 5EMKA 2CLDX 3P20A 2JIOA 2XE6A 5DCLA 2A1UA 2Q28A 5C9ZA 1SCAA 1EZZA 1U28C 3AEUB 5REQB 2VUTA 4CKWA 1PW7A 5KKAA 3AUFA 1BAPA 3DEJA 3WFJA 4YLYA 4ARCA 1UOPA 3CX4A 1NTOA 4PLTA 4RZIA 1CR6A 4W7SA 4AK9A 5IG2A 4P54A 1CQZA 1QVZA 3SM9A 3B9BA 2ODTX 2FQWA 4MCAA 3DVSX 1E4EA 4DZRA 2QYHA 1Q17A 3HVHA 3ORSA 1FFGA 1NBHA 1JYEA 3G0GA 3MTJA 5G4LA 3QYPA 1I7DA 3L0PA 3NASA 2B7CA 5FRDA 1VJCA 3ZWDA 5K03A 2CFIA 4JS0A 5SZKB 2GNAA 1M1YE 1V26A 3UIEA 5ANRB 3WP1B 4EG7A 5JCJD 4ILEA 1P2UA 1GUBA 3OJ0A 5HKKD 2GBGA 5KYTA 1MTZA 3A6GA 1XEXA 1CY7A 1O58A 2ZIXB 2IYVA 4I8DA 4EHFA 1JQJC 2CNLA 5LKAA 3CEJA 2C7GA 3I2GA 1OA0A 5LPNA 1WB5A 1LK5A 1ZOIA 3GNTA 2GQ0A 3WYFA 3ESZA 5BUCA 2PKWA 3DL4A 3N70A 3KB8A 4R16A 1QJ4A 2ERXA 2ZJ3A 4XIGS 3MT0A 4TKVA 1Q19A 3AM4A 4XSHA 4P3NA 1FQJA 1V9LA 4P4SB 2YWFA 3HUTA 1I5RA 1YZVA 4WXPA 4JR1A 1WXFA 4O4LB 4D0LB 1IC6A 3C7CB 4JP5A 4DV2B 1E3TA 1EWKA 2V8BA 2FQYA 3MQ2A 4RD4A 1CBUA 3SC3A 2AZXA 4NMXB 2UYGA 5AJWA 3FX2A 2H5JA 1LDBA 3P9QA 3AV3A 4DLNA 1C0EA 1V16A 2WZDA 3H3JA 4EJ0A 5JISA 1WUYA 2J3DA 1B8OA 3IQEA 1OYYA 5LYJB 4HNAB 2C78A 1CVLA 2HNBA 1VJ0A 3KOUA 1J4AA 4B79A 4ZODA 1UK7A 2JLRA 4DLPA 1Z5OA 3GLQA 1MB9A 4L8GA 4TRRA 1X7XA 2GKGA 3TS1A 2ZRPA 4FFDA 2P79A 4G0ZA 4NDAA 5DRTA 1M0TA 1U8FO 2WYWA 3P71T 4YPFA 3VDMA 1ZO8A 3MFQA 2IEYA 1MQ8B 2VXCA 1FFCA 1VGVA 4F3KA 4AQDA 2I55A 4IDBA 1LFDB 1P45A 3LA8A 4XA8A 4JVOA 3FCXA 4I19A 1DPFA 4DUGA 4OGFA 2X7XA 4R69A 3U4CA 2DPYA 1XPRA 2P1DA 1C0KA 1K4YA 4OQYA 4R98A 1JNYA 1TJ5A 2V3CC 2HU2A 2X0KA 4ZDKA 4S35A 2EZ4A 3OOJA 1ZC3A 4TTRA 3UBTA 3LKVA 1UKBA 1DZ3A 5H59A 1MO3A 3AVYA 5LR6A 5F7JA 1LQUA 3CMMA 1Y1QA 1XZEA 1NXXA 2V59A 1E6LA 3LCRA 3EHEA 4IUCS 2QX8A 3QY9A 1JPJA 1NIJA 2C2GA 5ALMA 2WE8A 3QYFA 2AUTA 8GPBA 3BSFA 5J5VA 3QU2A 5TC4A 1HKHA 4MI6A 4ZVKA 4GLOA 3VSDA 3HSSA 4RJLA 3CBQA 1QFZA 1OLXB 5I5EA 4YPOA 1ULBA 3FIUA 1MUUA 1ODTC 4JUBA 1UANA 4ARSA 4TVSA 5LQDA 1P18A 1K7YA 2BFPA 2EIHA 2K5UA 4G0OA 1UPFA 2IY7A 3MJEA 4WT7A 4OQPA 2HI0A 2PX4A 1YZLA 1SC1A 3EVNA 3K1AA 2BI4A 2MSLA 5DHUA 3UV6A 1QAMA 4S1OA 4LK2A 5HKBA 4K2HA 1V11B 4IKPA 1KEEA 1BDIA 1I3MA 5D3MB 3R6GA 1WMFA 3T3IA 2HO5A 3JYHA 4JBWA 4UPDA 1A4UA 2X0RA 3TG8A 3A25A 3U4QA 2QMZA 4V0NA 1TPYA 4RPCA 4D2IA 4GKKB 1RAFA 5DN9A 2V6GA 1DUSA 5A04A 4ZQFA 4GR4A 7REQB 1AUVA 3P2MA 1XKXA 1J42A 3G3EA 1RXUA 1FX0B 2DKNA 2IZ0A 3EVFA 4B71A 2CGEA 4NJEA 3WKAA 4B17A 1JEQA 2LKDA 3CGGA 3TLKA 1HQYE 3N8DA 1EBFA 2RGRA 1BU5A 2H8KA 4ZVSA 1F5SA 1M8FA 4US2R 2RH8A 3GBVA 4ZK6A 2JGJA 1HFJA 1N5DA 4KTTE 3T9AA 2Q1WA 1V96A 3D1VA 3K1JA 4O4HA 3PC2A 2OB1A 3D59A 4MWZA 2EZ9A 4OYRA 4BP1A 4ZICA 4FWTA 2B5WA 2FQQA 2RHTA 6PFKA 1YR9A 3WIVA 3T12A 1ISIA 1WDKA 2YICA 4LMPA 4Q3KA 5HSGA 5JNUA 2XKKA 1ZD9A 4CM4A 4QGGA 3ZWKA 1JQEA 1ZGAA 2F1OA 3MINB 4HS4A 5F9MA 4D81A 3K0HA 4K9QA 3OTIA 5JC8A 3T7KA 3IUSA 2GWHA 1R0ZA 1UF9A 4C7OA 1W96A 3DOHA 2HXGA 2YNMD 3LOPA 3HBLA 1LPSA 3GZNA 3B2QA 3WKEA 5B58C 2XTNA 4HWPA 2HMYB 4L22A 3FCEA 1ZI9A 3DLTA 1VA5A 1UCFA 3W8EA 3H42B 2GBFA 3OT5A 3T0IA 1T9AA 3IEKA 2HJWA 3GXOA 1KP3A 3NV9A 10MHA 5JY1A 4C4YA 1UK9A 2ZIEA 3SSNA 5I5GA 3O47A 4DV5B 1OXVA 3CWCA 5CNKA 1KI6B 3FD8A 2OD7A 3R6TA 1M6HA 3O9MA 1F0YA 2F1JA 1ZN9A 2ZRIA 3JVDA 3PXBA 4ZCQA 3RC7A 3ZCSA 4YCMA 1DX6A 1PG2A 2P35A 1DC4A 4H6XA 5LJLA 5A3RA 1OYWA 2FQ1A 2P41A 4L95C 3L04A 4Z4GA 2DF8A 2O48X 3ICWA 3QHQA 5L3SA 1ADFA 2QVZX 3TD2A 3CZ4A 3GJ4A 2CD7A 2P3LA 3C70A 4HKTA 1H2YA 2HCRA 4Y6QA 5HRUA 3I1JA 1QLJA 3IPXA 1E0DA 2O4UX 1YIOA 2WJVA 2XNKA 4S12A 1TKBA 2OM6A 2IV2X 3RS2A 721PA 5MFPA 2NU7A 3FF4A 5D86A 2GRJA 3FMPB 5CM2Z 4AS2A 4B46A 3FKSA 3SM3A 1KYQA 2PN1A 3ZS8A 2H7XA 4X6YA 1ZR2A 2QZJA 1E2KA 4XVHA 4JI3B 8ADHA 1H2ZA 1JYFA 3ANYB 4NC9A 1N5JA 2JLXA 2ZQZA 4INJA 4L4XA 5J2UB 3PCTA 3RTEA 2CLOB 3ZWPA 4DUZB 2ZAMA 3BXFA 1NW8A 3D4OA 3O2NA 2Q1UA 1E3SA 1S01A 2PNFA 3CJRA 3MS7A 2F55A 1N9GB 2ZIZA 1O96B 4UM9D 1GG5A 4H27A 2VT2A 2AFVA 4OMUA 1J2UA 4ZU1X 1NUPA 3GA0A 3ZOKA 3LFHA 3ZDZB 1NJ6A 1J1ZA 3E5NA 4WKNA 1HNXB 1IWPB 1BMQA 3OPVA 4P3OA 5DGHA 4F0JA 1W2GA 4WBNA 4KITB 4B44A 4O33A 1RRGA 1Z4KA 1PS9A 1X8XA 3EQ7A 4YP0A 4EG1A 1KTVA 3SVZA 1UBGA 2A0XA 3PC8C 2VJQA 4LXXA 3NNSA 2PA3A 3TI7A 4DR7B 2R3SA 2VPQA 3WKBA 2QBYA 4MUHA 3G8CA 5IAAA 3DF7A 1C2TA 2W58A 4WASA 1IXZA 1JFRA 4OUKX 2PJRA 2VHCA 4HL6A 5AR1A 3AP2A 4PO1A 4EVRA 5JFOA 4Y2JA 4I4CA 3DXXA 3W0LB 5JQWA 5LCXA 3OT1B 4N41A 1X0VA 3MYYA 3RS4A 2AI1A 1PTKA 4W8GA 4D74A 3R0XA 4N5IX 3R76A 2B0CA 1PZHA 1JDBC 3KETA 3EZ6A 1FRZA 1CQWA 3QFTA 4PN3A 2DEUA 4WLOA 1NBMA 3N87A 3NAGA 4RZ2A 2FZVA 4CLDA 3ASUA 4YQYA 1K5HA 2Z5LA 4PXYA 4D6PA 3BFJA 4K6MA 1A7KA 2G7MC 4EI8A 2ZSHA 1PT5A 4NMMA 4R7ZA 3SSOA 3OQ1A 4XDYA 4DXAA 2QRVA 5JMWA 2X4GA 4JXZA 3I5YA 5D3KA 5FB3A 3MRSA 5E7QA 1DL5A 2BHRA 1H3NA 3PQFA 3U7QA 3ZW7A 2PZJA 5DBOA 4BO2A 4QJ5A 2FP3A 1YB5A 3ZE8A 4CG0A 5KHLB 4MDEA 4ZI7A 1GPYA 1SC6A 3UMVA 3C6KA 1JBEA 1PHPA 4CEIB 1WTCA 3FPFA 1KAMA 3OQHA 2F4NA 2JBAB 3PFKA 4B3CA 1CY0A 1RS0A 5FLEX 1Z8HA 4QNRA 4PG5A 3ZCQA 5KMGB 1XZQA 2HTFA 1DIBA 4N5HX 5GJWC 2O2SA 4GOXA 2G9VA 4ZGGA 3L5KA 1U0BB 2M1ZA 4CLRA 1VHQA 4NESA 5B1IA 1PUIA 1YB1A 4YRGA 5IK2D 2RK4A 5BYBA 5AKHA 3T54A 1FFAA 1QUEA 1VSQA 1Z15A 2W2NA 5EQFA 3I3SR 1ODJA 1I30A 1RRVA 4ZT3A 1TZKA 3GGSA 3RRNA 1E5LA 1T3SA 3CWQA 1IZYA 2GLXA 2HUPA 1EIWA 3TGWA 1Z74A 1SOVA 1QNLA 1RFGE 4LX0A 4EKDA 2B8TA 1GUDA 2VDMB 3B9QA 2XTZA 2FZ4A 1YMUA 3FUTA 5EIXA 1NN0A 2G1JA 1YUNA 5CT6A 1ZOPA 2Y0CA 3HDTA 2B34A 3EEOA 4D3DA 4A6EA 3NBFA 4WJKB 4UD6A 5GQSA 2VQEB 3EC7A 4O2LA 4BP3A 1JHPA 5B36A 3O1JC 4GQBA 4V0MA 5KSYA 3K5IA 3OIDA 4LZJA 3RVPA 3WHLA 4KSCA 3DTYA 1FP4B 4CDRA 1S2NA 2JFHA 3K1TA 4PZEA 1MDFA 5IT5A 4XVCA 1NQWA 1JF8A 5A06A 3CW8X 4HN4B 5JWRA 1QQ5A 3H8SA 1N6RA 4C6HA 2QRNA 1HURA 1CB7A 2CWDA 1YA4A 2BLLA 3NM5A 3WZ2A 1E1LA 4M0DA 5LDHA 1M2JA 3TI9A 5ITZA 2V3VA 5L3QB 5LQRA 4O4JB 5AOVA 1B2LA 3D9QX 2IXAA 1J9GA 3ELWA 2X3YA 4L72A 1NX6A 1RVDA 4F2GA 1UBMS 1Z6QA 4KO8A 5A4FS 5J4HA 2V7UA 2B4TO 5K8LA 3Q1LA 1GTJ1 4IO1A 3KPUA 4RKYA 4W1QA 3EYWA 4F4UA 1MKYA 4QXQA 1Z5NA 3Q7IA 4ZO9A 3F6CA 2BFNA 3AB3A 4C89A 2C99A 3DMPA 3KEOA 6ABPA 3PRKE 3R9XA 1PD1A 3F3YA 3G23A 3WGKA 4C87A 4MP3A 5C8ZA 1SG6A 3CN9A 3D5EA 4O1HA 3I5MA 3O91A 4XUEA 2M1XA 1C0IA 2CN1A 1K8YB 1E9SA 2ZJ7A 1E3MA 4NNOA 3M2PA 1LDGA 2FHSA 5FA8A 3DQQA 3TAXA 4W7IA 3UT5B 2QLFA 1ADGA 3CV3A 3O8LA 2QTHA 3ZCVA 1YZYA 5JWOA 1LFAA 3NWBA 4WCVA 4J6EA 2FFQA 2V03A 3BH0A 2ILVA 3CRNA 7MDHA 3DDZX 2VRBA 2JGDA 1G4HA 3FYUA 3IPYA 1YBMA 1IN4A 2HM7A 4YMUA 2FSUA 2WAXA 2IU3A 3VXKA 5DNVA 4GRDA 5BOVA 2KBEA 2HEIA 3O03A 3LRPA 3C98A 4Y2RA 1GRRA 2WJYA 1MRZA 2D8MA 1YC2A 2H07A 1BH2A 2TMGA 1N6NA 5DSTA 5JE8A 3VX4A 1ZNQO 3WYBA 1ZD2P 3D4BA 2IXFA 3BXZA 3WV4A 1KAGA 1JI3A 3A9UA 3CFYA 4QYXA 3UMSA 3LF1A 4TYMA 3DAFA 2LBPA 5DASA 4AROA 5ADVA 2ZB4A 1BJTA 3DLAA 4OBEA 5AKIA 2G9RA 4GKJB 1T26A 2OQIA 3HFSA 4R05A 4KO2S 2P6RA 4WTOA 1EQ2A 2CVHA 2DWUA 1P5FA 2C2HA 3OQIB 5KYUA 5GPBA 1DC7A 3T4PA 2VI5A 3AHCA 3ZU6A 4YALA 5SICE 2NUTA 1PL0A 3Q5DA 1HLDA 2FEWB 1PLKA 2J4DA 1NYLA 1YOBA 3EX7C 3KKMA 3JD2A 5E4JA 1RP1A 1ZK3A 3BOSA 1TZ2A 3ICCA 1QLWA 5TGTA 1X80B 2PDAA 5EIWA 4PIMA 3UICA 2POQX 4DVGA 4NXMB 2XZLA 1NSFA 3COZA 2DCUA 2OEPA 1QHHB 5EG5A 4Q7EA 5P8WA 1P91A 1G8GA 5CNIA 3GRRA 1VKJA 4NFLA 1WB4A 5F9FA 3AIOA 1IVYA 4GMXA 4BV2A 3MWDA 3V00A 1E64A 3DDCA 4C0LA 2GKOA 2Q29A 1JXOA 2WDPA 2D3TA 4Q1VA 2WU1A 3QEKA 4C3OB 1H42A 2LTAA 5DSZA 4BNDB 1B0ZA 2WYIA 4LTMA 1CUGA 4XYBA 3ZV7A 2UUCB 4BX9A 1RRCA 1L7QA 1K0FA 5I9NA 2WSSD 3DCYA 1XCGB 2QN3A 4HAUA 1C9DB 1O57A 1ZVQA 4S1PA 2B2XA 5FDFA 3H75A 2JI4A 1JA1A 1U94A 2Q21A 4IOLA 2IBTA 1A9PA 5MF6A 2G83A 1MCZA 1SEVA 1QGYA 4NH0A 4N0DA 4DMLA 4UEWA 1SKUA 1GAWA 4ROSA 1ZUHA 2WF9A 2BFEB 1GU1A 3EG5A 4RWEA 5G0VA 4LXTA 5KVSA 4ZPJA 4M9QA 2QAIA 3KUCA 2ZM5A 2OAQ1 4EG8A 3AEYA 2YZNA 1QX4A 1RZ3A 2CB9A 4QGAA 1W1WA 4WZAA 4LRSB 4JC8A 2ZPUA 4ZHQA 2GO7A 5AIAA 3AESA 1T9BA 4J29A 3DUFB 1OQAA 1R5JA 1DBSA 2BPOA 3WGIA 3AVQA 1AKYA 1V6SA 5G41A 1U3CA 1ZIOA 1JDPA 5GONA 4WESA 4MI1A 4U63A 3RVLA 5EFZA 2X2OA 3DLPX 1XVTA 1WUHS 2G40A 4WN9B 4BLPA 4YCSA 2RGWA 1OWMA 1F4LA 2VYVD 3GRCA 5GV8A 2E4AA 3PHJA 2CF6A 4FFOA 1J70A 4I4TB 3R1IA 2ZUCA 3VX3A 3GLIE 5L6LB 4M9UA 4YTEA 2B98A 3AYZB 2WRZA 5J2TF 3RKUA 3JWHA 4ZDIA 4MVJF 1KZ9A 1PFGA 2E5FA 3DKKA 4ZVUA 4Y9TA 5EN4A 5I48A 3M2TA 4OPMA 4D43A 3Q3CA 2BL4A 2PSSA 1KS9A 5EQDA 5FOXA 4YXWA 3QEOA 3ZDRA 4D9KA 2PYZA 1RLOA 1SPXA 1SRRA 1ORRA 1OI3A 3MT8A 4MO9A 2IXEA 2WU8A 4QOEA 1KQGA 2MR5A 2W4MA