2IDMA

2.00 a structure of t87i/y106w phosphono-chey
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 40
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2idmA00
3OLWA 1CEYA 3QLUA 4Z4HA 1M5TA 1YK0A 4KQCA 5KQMA 1OXKB 1JFVA 3QELB 3QLTA 5JNSA 1L5ZA 2YHAA 3HS3A 3NHMA 5F64A 5BQ3A 1YVUA 2RGYA 3RVJA 3LOPA 1Z16A 2VUIB 4YR7A 3L49A 4Q6WA 5TQ2B 1P6QA 2MYPA 2FN9A 3JS5A 4OG2A 4RY9A 5TQ2A 3FDFA 3GV0A 2E4YA 1ABFA 1RXIA 2R4QA 3Q41A 4IGAA 4ZYLA 5IEJA 3RVSA 1YTUA 3HZHA 4EUKA 5DTEA 1AB5A 1U0SY 1BAPA 4ZMSA 1ZGZA 4H60A 1JBEA 1JHZA 3KTOA 4OLAA 4OATA 4N47A 1XWWA 1P8AA 3RVLA 2FKAA 3VNAA 3CZ5A 3D8UA 3JVDA 4G86A 4KVFA 3DBIA 4IRXA 3JPYA 4H3HB 3MYYA 4PE5B 2QVGA 5IUKC 3RVKA 5E3JA 2RJOA 4MS3B 4YS6A 1LJUA 3KKEA 1KRWA 4Y9TA 1J56A 3OO1A 5C5EA 2H3HA 5KI6A 2QXYA 1JFSA 5EWMB 2QV0A 3H5VA 3K9CA 1UDRA 4W5OA 4WWHA 1EFAA 4HNSA 4M88A 4N41A 4RU1A 1NXPA 4KQ9A 2E4UA 9ABPA 5IEBA 1RXEA 2MSLA 3H1EA 3MQ4A 5IC5A 4YP9A 3OQMA 2W42A 3QLUC 4WZZA 1GUBA 4ETNA 1Y1LA 4UHKA 1A0OA 3B2NA 3N0XA 3SG0A 4JASB 5DCLA 4Z4IA 3HUUA 4IMIB 4KV7A 1A04A 3HM9A 3F6CA 4HYEA 4Z9BA 1GUDA 2FSPA 1M2EA 5CNJA 3FFWA 2WJWA 2KYRA 1QQAA 3O21A 4OBBA 4NV3A 3TO5A 3A3KA 3OM1A 3HCWA 2AYXA 2L19A 1T34A 3I09A 4IMJB 4L4UA 4RDCA 2JVIA 5TPWB 5TPWA 1VPWA 3H1FA 4EGSA 1RZRA 4OLBA 2R25B 4Q6BA 3HK2A 4B09A 3RQIA 2QZJA 2R47A 1QQBA 2PKXA 1U04A 5CNMA 3H5TA 4RY0A 2WRZA 1D4ZA 2FEWB 3T8YA 3RVPA 2MYUA 3OLYA 4RXTA 4Z99A 2WWVD 4MR9B 2NUBA 1ZH2A 2GI4A 1NXOA 5EWLB 4YGXB 2JVKA 2L18A 5KWSA 5BR1A 6CHYA 3NNSA 4G0XA 4P1ZA 4G0QA 3SM9A 5HKOA 2JBAA 4W5QA 3KG2A 1BVHA 4XFKA 3S99A 5FWXB 4RXUA 2Q5CA 2CD7A 2WB4A 2FMIA 1FFWA 4MLCA 5EWJB 1W25A 3CKMA 5EWJA 3CS3A 3RVMA 4Z4CA 1JDNA 5T7BA 3H6GA 1D5WA 2WY2D 1ISSA 5JNRA 3HJFA 3KJXA 1DC7A 1JYEA 1PEYA 3BILA 6ABPA 1VRVA 5HQJA 5TPZD 5KC8A 1ZH4A 3LUGA 4RS3A 1KGSA 5PNTA 2XDYA 1DZ3A 2FLWA 4KPYA 2QR3A 3F73A 3H5OA 4TN5A 4RKQA 4KFCA 4Z4FA 4D6XA 4MR8B 2OENG 1FFGA 1YS6A 4TMYA 1PEAA 2QW1A 3IP7A 3IP9A 4Q7EA 1CYEA 1EWTA 1XHFA 2DRIA 3BREA 3SY8A 4N03A 1WETA 4KRFA 4PICA 1DP4A 2TMYA 3CLKA 4WT7A 5D2CA 3G1WA 2FMKA 4PYRA 3OMWA 1DBWA 2B4AA 3H5WA 1VLZA 3OM0A 3SAJA 3EODA 3KLOA 3O2JA 3LUDA 3Q9SA 4W5RA 3OLVA 2MYTA 4HNQA 4RK1A 4NCAA 2JK1A 1Z17A 3KLNA 4LE1A 2X7XA 1QO0A 5JNTA 2A9RA 1JWLA 2BGGA 2PLNA 1JH9A 1JDPA 3NBMA 2J48A 1ZY2A 2IPAB 1EHCA 1NXXA 1DCKA 1LJLA 2A9OA 3HXMA 3H75A 4EYKA 3URMA 3CNBA 3G85A 1ABEA 2MSWA 5TQ0A 1QNLA 3LUFA 3CFYA 1QPZA 4RK7A 3QEKA 2IPMA 3H1GA 2MSKA 3OMXA 5JS1A 2I6FA 1NXTA 3C6QA 3F6PA 3TB6A 3I42A 3O2QB 3O74A 4EVQA 3CZCA 3ILHA 1NXSA 1JX6A 4LDAA 3GL9A 3KSMA 3MMNA 1A2OA 3KCNA 4MAAA 1U8TA 1C4WA 3GWGA 2A9PA 1Z2DA 2ZWMA 4WXEA 5EWMA 1Z25A 2B1JA 2L2QA 3MF4A 3MM4A 3NNDA 2PMCA 4KNYA 3CG0A 4RKRA 3RVOA 2PUGA 3QX9A 3I45A 3RVRA 1F4VA 4GNRA 2PAFA 2FXIA 3A0RB 3Q15C 2E4ZA 4ML3A 4LE0A 4EVRA 4ZPJA 1RZRD 2F8SA 2IPNA 4MS1A 1R8JA 2ID7A 4DN6A 1JYFA 4G0YA 5B3JC 3SNKA 4RK6A 1AB6A 5CHYA 3OLZA 3Q7RA 3HEBA 4ZMRA 3IP5A 2FW0A 3CTPA 1JLKA 3N0WA 4O1HA 2MYNA 3GBVA 1TJYA 3RVQA 2JB9A 3E61A 2E4VA 2L17A 3LUAA 5FBKA 3CHYA 1PHRA 1DJMA 3JTEA 2NT3A 2FTKE 3QLVC 3NNNA 3JVIA 4TLMB 4XAQA 2QVCA 4XARA 4TLLB 2QSJA 3T95A 4YWHA 1SXGA 4L85A 2A9QA 3UKJA 2O20A 2IPLA 1DCFA 4LRQA 5FWYB 3CRNA 2FLKA 3L6UA 3LUKA 1QKKA 3EQ2A 5IUJC 2FVYA 2FN8A 2QU7A 1SD5A 2PL9A 1DG9A 1ZESA 4D74A 1USIA 2E4XA 1PNRA 1ISRA 5IULC 3A0UA 3UUGA 3LTEA 8ABPA 1E6MA 2PUAA 1M5UA 1W9HA 4G0OA 3Q7SA 1KRXA 3FMVA 4UHJA 2FQWA 4WXMA 1XHEA 2LBPA 4RWEA 4E7PA 2PUBA 1ZAYA 4NICA 3HO1A 2JBAB 4MS4B 3IP6A 2VYCA 4Z4EA 3QX8A 3LKBA 3M9WA 1DRKA 5TQ0B 4XASA 1HEYA 5GQSA 2HJ9A 3C3WA 3HV2A 3T6KA 2VUHB 1P2FA 1TMYA 5KC9A 1MIHA 5JS2A 4KREA 3TX6A 4CBVA 4YO7A 3O1HB 4PZ0A 2CWDA 2FMFA 4FB4A 4KMRA 4MS3A 1ZN2A 4RY8A 3GA5A 3HSYA 3M9XA 3IPAA 1U2QA 1APBA 4YV7A 1QO0D 1GCAA 5CNKA 1MVOA 2M1ZA 4ETIA 2LIVA 1URPA 2IOYA 3W9SA 2OQRA 3O1JC 5KQLA 1SXHA 4W5TA 1BDJA 1VKRA 4LE2A 2N9UA 5IX8A 1P6UA 5DLEA 5KQPA 1Z18A 1Z2EA 2FQYA 2VK2A 3H6HA 4EYOA 2NZVG 4LX8A 3EQZA 1BDHA 4EY3A 3Q7TA 3TMYA 4GPAA 1ZITA 4KK3A 4E7OA 2CHEA 1D1QA 1YMVA 2GWRA 4O5AA 5T3YA 3QEMA 1ZGGA 4RK0A 1ZHHA 3E3MA 1PUXA 2LP4Y 3BBLA 5TPZA 1CHNA 5CNIA 2FMHA 3TD9A 2JVJA 1QP7A 1Z12A 3UK0A 3O75A 1LBHA 1SXIA 1B00A 3DLBA 1USKA 1FFSA 5GOTA 1C0EA 2PL1A 1GLGA 3DZDA 3P9YA 4NCBA 2FQXA 3QELA 1DRJA 2CHFA 1QMPA 3BRQA 3IDOA 3VNBA 4RK4A 4YCSA 3A10A 1NXVA 2HSGA 3C3KA 4JB2A 3EAFA 4MGEA 4PEVA 4MQFB 4NQRA 1Z15A 3N6VA 4G0MA 3SQNA 1BDIA 2ZAYA 4KZKA 4JAVC 1OXBB 4G0PA 4S05A 3N75A 2JRLA 4P98A 3GYBA 5ABPA 4N0QA 1QP0A 3R0JA 1ZDMA 3MIZA 5FBHA 4LZLA 4MS4A 4ZJPA 5FWXA 2ID9A 2LPMA 2HPHA 3GRCA 1MB3A 4QPJC 5I4CA 3BRSA 3T38A 4ETMA 5DGCA 1K66A 2V0NA 2WMYA 1RNLA 1NY5A 3IPCA 4RK5A 1FSPA 1QP4A 2GX6A 2WJAA 4O1IA 4MR7A 4MR7B 2P4UA 3O1IC 3FFXA 1YMUA 4Z4GA 1KMIY 2IDMA 5HM6A 3N0RA 4IILA 2GKGA 3JPWA 3MA0A 4YLEA 4Z9AA 3CG4A 3O2SB 3DGFC 2HQRA 4QYMA 3HUTA 3ROFA 3RVNA 4MQEA 1EWKA 2HQBA 3LUJA 4MQEB 1NXWA 2NT4A 3EJWA 4YRZA 2GBPA 5BRJA 4F3TA 4S04A 2JCGA 5FWYA 1BA2A 4F12A 3F7NA 1LK0A 4HNRA 4F11A 1GCGA 2FEKA 1IIBA 1LBIA 1Z26A 1K68A 4EYQA 1RPJA 4XLTA 4LDZA 3M6MD 3ILYA 4Z0NA 3QLVA 1FQWA 2R48A 4H3KB 2PJUA 3N53A 2IYNA 5HSGA 4EVSA 4DQDA 3OQOA 2F8TA 4QICA 4RXMA 4JP1A 1DBPA 1PNTA 3KS9A 3N8IA 2HQOA 3EDCA 2RJNA 1DCMA 1TVMA 3HDVA 5TQJA 3DGEC 3OLXA 5BRAA 5C5CA 7ABPA 4RSMA 1EAYA 4G0ZA 3RH0A 3HDGA 2FEPA 3FGZA 3H5LA 5JNUA 1M2FA 2P9HA 2PE5A 3LUHA 2PUDA 3I5AA 3K4HA 2H0AA 5JNWA 3KHTA 4G97A 3NHZA 5B3JA 2LUOA 3EULA 4FE4A 1E6KA 2AYZA 1YIOA 2IKSA 3QK7A 1USGA 3OO0A 3DLHA 4MQFA 3KYJB 3LKVA 4F8JA 5DKFA 5KQGA 1DC8A 1F51E 4JOQA 1YK1A 5ED4A 1JFTA 2RDMA 4MR9A 3C3MA 5IUNC 5JNVA 1EWVA 4XXHA 4JA2A 5EWLA 1MB0A 2M98A 1JL3A 3LUCA 2YHBA 1MAVA 5IBQA 2NZUG 4MYRA 3C97A 4N0PA 1E6LA 1S8NA 2E4WA 4MRMA 4N76A 4MRMB 3CU5A 1JF8A 3H5IA 4EYGA 4F06A 4MS1B 3EGCA 2PUFA 4OTZA 4MPTA 3JY6A 1NTRA 4D6YA 3KYIB 1D1PA 2PUCA 3GT7A 4WUTA 1I3CA 1L5YA 2PUEA 1H9CA 1TLFA 3HVRA 5TE9A 1U2PA 4IF4A 4MLDA 3GBPA 3LMKA 4DADA 3ROTA 1E2BA 4KK4A 4QYWA 1SRRA 3QEMB 3OQNA 4RV5A 1Z13A 4W5NA 1D2AA 3D02A 1NATA 3LFTA 4FE7A 1DBQA 1ZVVA 3FFTA 1TM2A 4RZSA 4JB0A 4MR8A 1YS7A
chains in the Genus database with same CATH superfamily
1C8VB 3QIVA 1L7RA 1C7RA 1ZK4A 1GSOA 4HATA 4W4TA 2UZIR 2ZB8A 5IG2A 4GAEA 1HV8A 1OXKB 1TKBA 2HB6A 3QLTA 4PWYA 1N34B 1DAEA 2X13A 2Z6UA 1AKMA 1WDKA 1KIMA 1YVUA 3M4NA 3EEQA 3TEJA 4QVKA 1NDQA 3AZPA 1MVNA 2QAGC 5ALKA 2F3PA 3BMQB 3T7IA 4B79A 1WVGA 4L1KA 3HG7A 1NMXA 2JJ8A 2SNIE 3FDJA 2HFKA 3G0DA 1E4OA 3RARA 4B7XA 1MA3A 1W0KD 4H6VA 1S2LA 2BZ0A 1ZN9A 4EZBA 4C4AA 1OTHA 1U8CB 1DC3A 1LLCA 2P5YA 4CR7A 3AWDA 3MCVA 4D45A 2OOKA 1OWMA 4JR2A 1K4MA 1VIMA 2HPVA 4G25A 4PQYA 5ENDA 1YL5A 4HQFA 3U31A 3VTFA 3ZHTA 1Z8NA 1EVYA 4PZZA 3NTOA 4X85A 3GMIA 4DLAA 4LYJA 2HWYA 3QMMA 2NU8A 1J00A 2DLDA 4FDMA 4RIFA 3DBIA 1J1ZA 3IT0A 4QNMA 1H2HA 3K4QA 3OIFA 1OBOA 2GBFA 2ZI5A 4RFVA 1M6EX 1YJBA 4AY4A 4CQLB 3BMNA 5ITSA 1LC3A 3KEFA 4I14A 5J63A 3RRJA 4BKQA 2RJOA 3AH8A 4R68A 3FHJA 4ENQA 1GU0A 5CLFA 3LPNA 1I2BA 1KDYA 3IQEA 4RKWA 1DAFA 2LVBA 3IKVA 1U3UA 5IWCA 4PCVA 3EAQA 4LY9A 3TBKA 3ER9A 1QVAA 2G88A 2TSYB 4W9NA 2VK4A 4HDOB 1UEXC 4N0DA 2QBYA 3ZHYA 2C0QA 2D54A 3QGMA 2Y99A 4TMTA 4ZOBA 4N41A 2NP7A 2QM7A 4PFJA 1C81A 3VYRB 1T2FA 2CXUA 3G17A 4ZCQA 9ABPA 3FNEA 3DEZA 2WIAA 4FS3A 2MSLA 3PIIA 4R8LA 5C8ZA 5BV8A 1L1RA 1PT8A 5M3BA 1GUBA 4F92B 1NJ5A 3VKFA 3FHOA 3WLOA 3KT3A 2HA0A 3U4HA 5DM60 4UVEA 2R0QC 1RYDA 1UAYA 5KTOA 1QXSA 3G2JA 1XA4A 5DCLA 4IW3B 5DK6A 3RRYA 2FFAA 5EUMA 3W8NA 2RIPA 3OOYA 1QS0B 4CHGA 1HFEL 5LUAA 1XVAA 2VYND 4IJ6A 3A6ZA 2CF5A 1NFQA 1E5XA 5CLGA 3HYSA 2X14A 1Z22A 3RYIA 1XIVA 4EGFA 4YT2A 3PNOA 1CY1A 1J7KA 1N7HA 2N47A 4HDCA 3K6JA 1HE5A 5TRTA 2YV5A 3DW1X 4LY3A 4KU4A 3WMWA 2FRVA 3MYRA 4RA9A 2BEKA 2GQ0A 2O0MA 1RQ7A 5BO5A 2PMEA 1YOVB 4KQ2A 2P6RA 1Q12A 1K89A 5GIPE 2BMFA 5JPIA 2WF6A 3NOXA 2HPAA 2OPBA 4HNAA 1T6ZA 4IPTA 1K6JA 1YHNA 2LXNA 5IH7A 1NBME 1NF8A 3T9DA 1MQ8B 4NFYA 2EU8A 4R6WA 4NBLA 3K1ZA 4RZ2A 4Z99A 1QZTA 3LY8A 1TJNA 3TSZA 1H3FA 2GI4A 3FMFA 4C4PA 3MGKA 1JHAA 2DX7A 2ZM6B 4CMBA 1PL8A 1X14A 5KVSA 1C0IA 1SU7A 2PQ0A 2XCOA 2IYRA 4LG1A 3KG2A 2H63A 2CLFB 1I6MA 3OWOA 1DJLA 1ZUHA 4FIZA 1UADA 3PC8C 4LMRA 4XB2A 5FWXB 4LFBB 3IDSA 4P93A 1O0BA 1JEYB 4NABA 5KHAA 3SYRA 3F5FA 4LKRA 4R2MA 3VDNB 3GPBA 1XZMA 1FTQA 1QIIA 3NCHA 2WY2D 5B3LA 5KHLB 2XE8A 1KKLA 2GZ1A 2OV6A 1Y5LA 5CDHA 4M55A 4RHTA 4MAFA 3SHWA 2YIDA 2MOKA 1Y48E 3JQGB 4B6SA 1Y7HA 1JT2A 1I4LD 1X2BA 3U7RA 3IE1A 1A2BA 2P6NA 4Y6LA 2H1RA 1I2DA 5L95A 5B7NA 3VR4D 4BUJA 4OM8A 4PRLA 2QAJA 3NV9A 4PX3A 3HO8A 4PU0A 5TMEA 1FU4A 2H9IA 5JH7A 4H3VA 2JCBA 1R7RA 3HRIA 3IP9A 4UPVA 1XMIA 1I1OA 4XDHA 3WQRA 4Y2VA 1IXSB 4EJSC 2M32A 1YZLA 2OB1A 4ZQFA 3L0SA 3H5WA 4F5YA 2OGTA 1HBJA 1GVHA 2E9SA 2ZSIA 1JILA 4NFSA 2CUZA 2QZ9A 3RBVA 2HPZA 4RWZA 3ELYA 4D4JA 3KJNA 2M6KA 4H16A 3HNRA 5CFZA 3ZJUA 2WWFA 3NORA 1NVEA 1FNCA 1N2BA 2V5VA 4JXXA 2C88A 2IPAB 4RVHA 5A0FA 2INGX 3HCPA 3DOOA 1ZM9A 1KAMA 1MRNA 3INGA 3CNBA 3PF8A 1PQPA 4G24A 3VKUA 4GM0A 3WLNA 2MSWA 1MX3A 1NPDA 4QARA 5CFOA 1XTQA 3DBRA 2ZJ2A 3A1FA 2NU9B 1GAWA 4XD2A 3L6OO 4QKQA 2EGUA 2NUAA 2J0VA 4L16A 3BS4A 3CNQS 4MK4A 4W5JA 1SMKA 3DO8A 1E3TA 1DAGA 3I9FA 3B1XA 3OJFA 1GPNA 5FR2A 1Y9EA 1JDTA 3FN4A 2GRUA 1NIJA 3N8GA 4PNHA 4UDOA 2OUKA 2V6JA 4G1BA 4BO8A 2JIDA 1TRKA 2FE4A 4AULA 2X42A 3EA4A 2B61A 2WSIA 1F6WA 3GWGA 3DDCA 4LRXA 3H7IA 1C8LA 4MO9A 3P2EA 1XEFA 2RGNC 4FGJA 3GZNB 5BP7A 5I4BA 2YS7A 2P9FA 3I45A 3T9AA 4OFWA 1A97A 2VLBA 4UQLA 4WCFC 4MLPA 2QRGA 1VIVA 3G6KA 1R4NA 3IPXA 4MV4A 1RZRD 5EQFA 2XB2A 1I3KA 2QNRA 4KODA 1QVWA 1AQNA 3H1BA 1MIOB 4PAQA 4AKSA 3JZFA 4J2TA 1D2EA 4YDSA 1F0NA 3GAFA 3KPUA 4JQCA 5DE3A 2XUAA 3C7TA 5E3IA 4TVSA 2VYFA 1I1HA 4QSMA 4PONA 4U7PB 5EIBD 1T25A 2OK8A 3DVSX 2IYZA 5BV2P 1FNNA 3E61A 3A9RA 3LUAA 3DVLA 5FBKA 2ZS9A 3MPUA 1U7PA 4WRRA 3WGIA 3HHPA 2QRJA 2FTKE 3AOGA 2EVWX 1JDZA 2G40A 3S81A 4L3WA 1FUEA 2BH9A 3FW1A 2OHXA 3B7PA 1XUOA 1KZ7B 2CFTA 4PGMA 5FPQA 3FPSA 4NMHA 3T95A 4D8TA 1XKQA 4QDZA 1PL6A 1H2YA 2IPLA 4COKA 3L84A 4Y1RB 3OLCX 5KSPA 4X6XA 5DNCA 4Y2YA 3V8NA 3LUKA 1RBMA 4UD2A 2E0IA 1CIVA 1EFUA 5IFKA 3D3WA 4JQSA 1GT91 1QOZA 3BWVA 3IBFA 3RNOA 3TZCA 3WAKA 3JQAB 1ECFA 2HDOA 2WMOB 4HAYA 3PUXA 3D59A 2JGMA 4F4UA 1XL0A 4I55A 4LBVA 1T5TA 5GVRA 4J6FA 3SX4A 3T7AA 2R5WA 2WD8A 1W6UA 4BVKA 3O4IA 4BV3A 4JX8A 5KTPA 4BZPA 2HU2A 1Y6GA 2F1OA 2PHZA 3NVMB 4BNLA 4CLEA 4MEAA 1KFKB 2V4UA 4Z4EA 1G6KA 4QG3A 4RENA 1TCAA 5GGXA 3K70B 1NDHA 1X7XA 2DETA 1F2TA 2Q2VA 1Q16A 1ZJ5A 2IITA 5IU6A 1MDFA 4JWKA 3R7SA 3FNRA 3NOVA 1X0VA 5TV2A 1EFVA 1TEVA 2OESA 3E5MA 3AI7A 5C51B 5FAXA 5FOTA 5D3ZA 5CJPA 4WASA 4Q05A 1TAGA 1Z3CA 2DVMA 5KDLA 4MKIA 4B85A 3KQYA 1RT9A 1X1EA 5DH9A 4OD0A 3LFUA 2R751 3DM9B 3WB9A 1RFGE 3KBOA 4B84A 4HB4A 3DKPA 2Z43A 1PYGA 1QFJA 2G9UA 5AOCA 4D1YA 3WL6A 1NT2A 1PFVA 2ZRHA 2XTZA 1Z0AA 5EIBC 2QBYB 4CTKA 2W93A 2O8FA 1KEKA 4HFMA 2O2XA 4GMKA 3UZUA 4IP0A 1V8PA 4NYJR 4E6EA 1KI2A 1OVMA 5IM4A 1Z2EA 4HH4A 1WCIA 4Z3KA 4EY3A 1OXUA 1MRZA 2W83A 3I1YA 1Q44A 2X40A 1TQDA 3LP8A 1NT4A 3R3ZA 4PQEA 1CK4A 2ZVPX 3PC3A 1MD9A 5D7BA 1D1QA 3KYDA 4HGOA 1HH4A 3SEFA 4RHYA 1ZGGA 3K8ZA 1TM4E 3IP1A 1P7YA 2CXOA 1QWOA 2E5FA 2WIKA 2WOJA 1SIWA 1MABB 3HBJA 4WQMA 2AFHE 2OBNA 2WSBA 1AGYA 3HJTA 1TVEA 1PD0A 2CVOA 3DTVB 1M9NA 3L07A 1LBHA 2C96A 4D4MA 3HXLA 5EE9A 1U0HC 2J3IA 2PL1A 4I1OA 8LDHA 3H2YA 4Y0NA 5A03A 1E8MA 2FQXA 3FTDA 2WF9A 4RANA 5CD9A 1FP1D 1FU8A 3DWFA 4UE3S 1Y8QB 1NW5A 2QJOA 1EZZA 1YOVA 6Q21A 4F72A 1YB4A 3IMCA 4AZ3A 1SUCA 3OX1A 2C3UA 1L7DA 3R3UA 3TIXB 1ZXXA 4RVFA 1I5EA 2WZQA 4OUKX 2YXPX 4JAVC 3KZNA 1KYZA 3AHHA 1KJZA 1XRPA 4KVZA 4AMUA 1SIOA 4I3FA 3JATB 1TUBA 1WDWB 4RLFA 2OK7A 5BVGB 2VQDA 3PXDA 5J2UB 5ERYA 1BW9A 2BLNA 3I3OA 1N1GA 3SQLA 1W1IA 4KYUA 2ZJ4A 3ORRA 3TI9A 5FV7A 1I7QB 4QPJC 3BB1A 4XDZA 2DE0X 1O6ZA 2IVZA 1AXGA 4GZ6A 3IPCA 3G68A 3IJEB 4EKDA 4OCZA 5AHRA 3L8ZA 1ZJYA 3IP8A 4OQYA 2GEVA 1U2GC 4YAJA 3O0DA 2CLHB 5C8YB 1RHQA 3TDNA 5IVHA 3C1AA 4Z4GA 2LR0A 1L0BA 1CERA 1BS9A 5AK0A 2BKXA 3UB4A 4CMJA 1PDWA 1M3SA 1WXXA 2P7IA 3ERCA 3DUWA 2HEIA 1DWPA 3JSXA 2E1PA 2JD2A 1V2HE 3NASA 1DVRA 3SVZA 4FDTA 1LLUA 3BK2A 3I4CA 2DUNA 1DLIA 4UE2A 3FFBA 5BRJA 4KXUA 4QJBA 1R2QA 1XCJA 2JAXA 3VSAA 1I6KA 5BSFA 3QOFA 5U4XA 1JDBC 1M33A 5EZYA 3ASVA 3WJ7A 3V8MA 2G72A 3AHIA 2ZXEA 1GZUA 3KCQA 4OHVA 3VPBA 4DIEA 5I4KA 4MI9A 3EZGA 1XNGA 3S40A 1ADCA 1WOMA 1SUSA 2H85A 5KNBA 2BEWA 5ALRA 4BX2A 4OQZA 4CKBB 1M1NA 3RSCA 1T4DA 4AW9A 3THYA 4CTJA 2DPMA 2A1UB 4LCJA 3TTYA 4HPWA 4KBYA 4DQDA 3DQZA 1NASA 3OQOA 1KY3A 1XJWA 2QP4A 1NQXA 2WAOA 3LKZA 5J5AA 4DSZA 4HT3B 3W2GA 1AKEA 4C89A 2FOXA 2J9FA 3HDGA 3HYRA 3Q5EA 4OA5A 2EJTA 4DLKA 4A5OA 2IXDA 4GOOD 2YVAA 2PL5A 4KJZA 2ADMA 3DL2A 3CLUC 1T3SA 4XLLA 3U4QA 1OH6A 4LYEA 2BI4A 3KHTA 1E1MA 3LDAA 5JD3A 2O8CA 3LECA 1G64A 3N2YA 2WABA 1KDZA 5JSUA 5M04A 3VX4A 2KBFA 4DEXA 1SJ9A 3KR1A 4GXRA 2V5UA 4BLPA 2RFLA 3S8YA 3GELA 3EIWA 2VJCA 1YK1A 3W2FA 3B60A 1PT5A 3G9ZA 4BECA 5H4HA 5LZ5A 2ZWIA 1C9YA 2OZEA 4ZC8A 1I4EB 4A2WA 2YHBA 1KQFA 3TTVA 1X7ZB 2ZUUA 1E6LA 2HDWA 3KXLA 2FDXA 3TVYA 4BAZA 5LWHA 2DQSA 5C1OA 3BWCA 3FYTA 2GBLC 3UW1A 3ECAA 3HGMA 5HQ3B 1W4BA 4ZREA 4CEIA 1NTRA 1Z37A 4XTRA 1WXHA 3TLKA 4D4GA 4ZP1A 3VPXA 4Z53A 1SB9A 4LHXA 4REQB 3KWLA 3C39A 1HF3A 2WPNA 3HVRA 1MC5A 4UUPA 2HO5A 3CVXA 3NX4A 1Y1KE 1IZYA 1OMOA 1IH8A 3PPWA 3L8YA 1TT7A 3VKVA 3KQPA 3S2GA 1Y5RA 3DT6A 3U7GA 2ZK7A 2VZ0A 1QO9A 2PT5A 4M8SA 1XSEA 1OFIA 2P2CA 3RRBA 5CYOA 2JD0A 3VZQA 4R3WA 4TVOA 2C3PA 4JGIA 4UBIA 3WMFA 1N0UA 1DC4A 3IOYA 5KREA 2BKUA 3QLUA 5TJ9A 3OIWA 3CISA 1HPLA 4WFIA 4KE8A 4MVJG 2ZLBA 3MZ0A 4PHTA 1PJQA 3QA9A 3WBKA 4DJFC 3OQHA 3R23A 1TDJA 4UZFA 1ESCA 3K0BA 3V48A 4F85A 4M0EA 1DBVO 3FHCB 2V03A 4YR7A 4ETWA 1E6WA 3IAM6 1ATIA 3LGSA 5K3BA 5TQ2A 2I1LA 1SOAA 2VL7A 3PSHA 3OZRA 1NBIA 5A7FA 1Y4ZA 4YC7A 1F2UA 1V9CA 2ZITA 5B6IA 2OXTA 1KFEB 3QFCA 3O26A 3LSYA 4CLDA 3QENA 2PKQO 2VTKA 5AJVB 3KLBA 3OAAD 1ZGZA 4ARIA 3W9UA 4PXYA 1OKKA 3RYCA 1T4BA 3DP9A 4JLVA 4A9AA 1CUWA 4J2HA 1W87A 1YJAA 3VC7A 4BASA 4RTSA 1AD2A 2FZLA 1ZBQA 4HFNA 5CPBA 1E2DA 4HLNA 3F7TA 1G18A 3BXOA 4JJFA 4KVFA 5JYEA 3GFGA 3QOYA 4B5KA 2EBHX 1E0JA 3ACDA 1YV9A 4BGIA 2PZEA 4CUZA 3PE4A 2NUPB 4OFXA 5C1IA 3OP1A 4GUDA 3S2SA 5FNVB 4RDXA 3GRYA 3QG1A 4OGGA 2B21A 4IS2A 4MV1A 2WUWE 1T24A 2BUBA 2X5XA 3RSFA 4E5DA 4MPJA 4R05A 3TNYA 3BFKA 4Y2SA 3AU9A 1Z06A 2QN6A 2XOKD 2CDBA 4JL5A 4WBNF 1BX0A 3BQ9A 5AW6A 4LYAA 4ALKA 2B4KA 1FLAA 4LF5B 1THZA 1EFAA 1W6RA 3B6IA 1MOSA 3RAFC 1Z28A 1PZEA 2FUEA 3FVVA 1PLJA 1VJ0A 1WW2A 5IBCA 4WKGA 4QLOA 5A4JA 1GNTA 3V1YA 5EJIA 1FFHA 3KPVA 3RKSA 2W2XA 2V5AA 4EFMA 3ETHA 1DX6A 4HDQB 4Z7JA 4PO8A 5HW0A 3FBWA 1I33A 1BYUA 3OA2A 2OKGA 4V0QA 1RP7A 4D46A 2ATVA 3KKOA 2GN8A 4MW9A 5ILGA 3ZQJA 4RVUA 5T8KA 1MW8X 1C4OA 4LWPA 3UJ3X 3GEDA 4Q3DA 4DMHA 4P2GA 3B52X 1WW8A 2IEAA 3C43A 2CJWB 3MWDA 4KV7A 3VR6D 5AKJA 2ODQA 3AY7A 2ORWA 3PZRA 2ODAA 4B74A 1JV2B 4D8YA 4NMLA 1LBSA 1U02A 3E0XA 3EMBA 5EUCA 1M8FA 3RRFA 3WMXA 4JBXA 4BEWA 4BNTA 3PICA 3O21A 1FYXA 3JRWA 4NV3A 3PJEA 1RYYA 3ROPA 5CVUA 1SG0A 1UR5A 2ZAGA 1K08A 2Y2UA 3TQRA 1JQJC 2AH5A 1U0NA 1B1CA 1C5KA 1L4UA 2P3SA 4CETA 3O82A 3OJWA 5IVPA 3FHTA 3I6YA 3SFTA 1KTVA 4TMFA 3W90A 4RY0A 1K88A 5F12A 4DGSA 4X65B 2VXBA 3LNCA 4C3OB 2ICAA 4LJ9A 4CM4B 5HOQA 1X7GA 4DIUA 2WG2A 5P8WA 4ARCA 3NTRA 1FDSA 1WD7A 5HQTA 1Z75A 2GFHA 3W4JA 4ZKDA 4YGXB 2PZJA 2EBFX 1MW9X 3PGVA 4OXKA 1GAQA 3IUBA 1ZUNA 3DPUA 4P1ZA 4F2GA 5GIOE 2A9JA 2V8BA 4JP5A 1EP2B 3R44A 2FGJA 4P7BA 3S2FA 1BW9B 2PWAA 2HWUA 4RXUA 1HC7A 2GEKA 1YRYE 2D5BA 4P3PA 4JD5A 1WPXA 2QD1A 1J9EA 3PRYA 1R88A 3I1IA 4Q21A 1GSHA 1PEYA 4IDDA 2AMYA 3F7MA 1RTKA 2CHGA 3UPTA 1VRVA 5MFZA 2F9MA 1ZEJA 1P1BA 1JEQA 3RHZA 1J9ZA 2ZIXB 4R2XA 1KK0A 1QV7A 4FSDA 4D0SA 4PFQA 3P2YA 2HAEA 4IFTA 1YI0A 1DADA 3G5AA 4DMKA 2P1ZA 4XUGB 3HP1A 5JH7B 5CB0A 1TU0A 2B0CA 4YMIA 4J0KA 2R6ZA 1AO3A 3EGIA 1E2JA 3S2ZA 5FBZA 1MZPA 4YXWD 1LSSA 4F38A 5GGYA 1TTPB 4W7SA 4IQFA 1DP4A 3VR5H 4B46A 2JFGA 3SAJA 1NX9A 5ADHA 1PR5A 4HSEA 1JIXA 3ER6A 3L18A 4BJ3A 1LFAA 4MP8A 3MGAA 4RQBA 3GNSA 4BFUA 2B69A 4C43A 3H2ZA 4GGMX 4I1IA 1Y98A 2F8MA 1BKSB 2QVYX 2GAIA 1FLVA 1NQVA 3INTA 4D82A 4QUAA 2QRPA 1H69A 4LHWA 1UBEA 4YA6A 3BXEA 3ODPA 3Q98A 5K6TA 4KH1A 1TYEB 1WLYA 1KXZA 1LF0A 4HSGA 4ZAGA 1BVUA 1ESZA 5JQGB 4D02A 1GUFA 4ZVQA 4GYWA 4P4NA 1X3SA 1SELA 5AK4A 2BYTA 1E7WA 1OIVA 1OBHA 2H1VA 1JTVA 2J31A 4BO2A 5C31A 4YMVA 4CQLA 5FORA 1B7GO 3WLEA 2D4AA 1P0PA 3A37A 4INZA 2EYUA 4NG4A 2PBLA 3MBOA 4F4DA 3DE7X 2V7VA 3JD3A 2O6LA 2VSYA 1UJ2A 2Z95A 3PNYA 4GIBA 4HG2A 5K20A 3BH0A 3TZKA 1EYZA 1L4LA 2EHJA 2O7VA 1IEVA 2YJ6A 3CPHA 1Z2DA 3CPEA 4LYGA 4AJPA 4POOA 5K9ZA 4BX9A 3QWFA 5H1YA 3BKXA 2CXHA 4TM8A 1TQ2A 4IY1A 3KHKA 3ZHCA 2IHKA 2PAFA 3UXHA 2ZJ1A 4EB3A 2IJGX 5HJEA 5B30A 1WXWA 1U81A 4GGPA 4UDXX 3VOAA 1Y5MA 4L7VA 1IQUA 3L6BA 4V0RA 1WBBA 4EY4A 4CEIB 1M34A 2D2VA 5ICEA 1AB6A 2ATEA 4QU5A 1ODSA 1OVGA 2CVPA 1SOVA 1JTFA 1SVLA 4QGSA 2QNBA 5EKDA 1R4MA 2HSZA 3NTUA 4NOLA 1RRMA 5BNTA 1ZCZA 3UMVA 1SU8A 1QS0A 3AJAA 4NDAA 4UHDA 3EUAA 1TOAA 2XNKA 3RVQA 4LHYA 3OZVA 1B4DA 2JS7A 1EUCA 4NYMR 2RHBA 1PHRA 3JTEA 3BT7A 1Z7EA 3BICA 3IB6A 2XF2A 3ZHXA 4EPYA 1E60A 1OIXA 2ES4A 4K9MA 4LWQA 5AWFC 3H5AA 3VRHA 4TLLB 4E13A 1EK6A 3KQKA 1OBVA 1X1DA 4PAGA 5EKUA 2C4KA 4LCBA 3MWLA 2E49A 1FSFA 2O20A 2UKDA 2BGIA 3QUCA 4LVCA 4RA9B 5J2TF 4ZI3A 5EUQB 3CRNA 4A8TA 1VSVA 1T13A 4CFYA 1SB8A 2QI9C 3MTDA 5LFAA 1NE7A 2DWUA 5ARCA 4OFZA 1UPTA 1E9FA 1SU6A 4RZ3A 3NJ8A 4Q1BA 5KVVA 1E3JA 4MOWA 3DZHA 1IXKA 4QXRA 2FH5B 5CA0F 1W0JD 1UT5A 2I55A 2PDAA 3A6KA 2E6KA 1QE0A 2RK3A 3HA5A 5DN9A 4PRKA 3TCKA 1VYUA 5FRDA 5AKZA 5IJ9B 4LC0A 4J16C 3P9RA 4TN1A 4MS4B 3A6JA 1MJ5A 1N5KA 1V1MB 3DZKA 2ZYUX 5JSZA 2GSDA 4QHYA 4P83A 1XWFA 2X1LA 4BAUA 5L45A 2VBIA 2VHYA 2GSWA 1W5TA 3BD8A 1Q7RA 4ITVA 3VV2A 1WDMA 1XZQA 1YKSA 3PDHA 3WYAA 4B6QA 3PYLA 4J1TA 4X61A 3CO0S 4BBPA 5LBIA 4DZRA 3WKBA 5BSGA 3RG2A 3PUYA 4HGPA 3OEHA 1RMQA 5FNVA 3D8NA 4XEHA 3T3NA 4I99A 3CCFA 4MW1A 5ES3A 3L1IA 4PSUA 7YASA 3S55A 3DCIA 5DXAA 1G20B 1RQ2A 1J9GA 1SBQA 2G28A 2J0UB 4LZPA 4LF4B 3UAZA 4JH0A 4IDEA 4CLRB 1WHTB 2EX4A 4L57A 3IXMA 2W6IA 3JQRA 1TIPA 2C5EA 3VH1A 4WKBA 2I65A 3DL4A 4AYTA 1A9SA 4C06A 1AU9A 1Y6RA 3L7IA 4BFCA 4TL7A 1LTHR 3K2BA 5JVDF 1GD1O 1ACLA 2F8LA 3TBHA 3NHUA 1DZIA 1GQYA 1TGYA 1VKRA 3JZDA 3K9GA 2YX1A 1MX5A 4LE2A 3RC7A 4AKEA 3UMCA 4D79A 4MCAA 5BR8B 4ZODA 2D1SA 1P2TA 4OQQA 1NGSA 4XYBA 1EM6A 2Y0EA 4U0JA 5B1HA 4MEBA 1ZJZA 1PD1A 2V6IA 2A5JA 2V7XA 2FI1A 2GCPA 3QXXA 2B78A 2GN6A 3I5YA 2I0FA 3UY4A 3DMDA 4LPKA 1PUXA 4O4LF 4B6RA 1R8QA 2DHEA 2JFPA 1EX7A 3HCEA 1KP3A 1ZGHA 2CNNA 3MQ2A 4DUGD 3TLGB 1ZOLA 1MFPA 3TNDA 1MV8A 5EVCA 2IYTA 3C3PA 5FBVB 4S1PA 2OG1A 4AWXA 1DB3A 1NJSA 1VA4A 3E9CA 1C9DB 1MO2A 2QL9A 3ICVA 4FJ2A 4KXWA 4D9GA 1OU0A 1BWQA 3KB8A 3SC4A 4X6YA 2XDAA 4NOJA 2P2ZA 4HV4A 3SHFA 3EXG1 3T3MB 2C2KA 1L7MA 4EL0A 3ESZA 1U2GA 1CUJA 3SQXA 1OXBB 4U9IS 3IO5A 3TZBA 4IAOA 2F9FA 4EELA 2V0CA 4ZN6A 5IZCA 1HX7A 4UU0A 1FPMA 4C7MA 2BZGA 5BVGA 2NQ8A 3IBSA 1E99A 4FT2A 1GV1A 2ONYA 2FGKA 3FGOA 1JS1X 2W6ID 3REFA 3VPHA 1ULTA 3HDJA 2JGFA 1K66A 2AEMA 1VKHA 1GTG1 2RB5A 2DPXA 1FSPA 4MX8A 4ARVA 4JXKA 1YE3A 2MT9A 2OXEA 1MEEA 2PTGA 3B48A 1R9JA 1D9ZA 1LLQA 2HLHA 2OFWA 3O1IC 4LW8A 4O4HA 4TYPA 3UYLA 4A4DA 2GAFA 5EIAA 1DAMA 4IIJB 3RK1A 2VJKA 1AHHA 3S2IA 4BQQA 4BZWA 1G3IA 4BMYA 2E1RA 4KO3S 5F3RA 3BE4A 1ZC3A 3JD4A 3EEFA 4MHTA 2XOEA 1EWKA 3ELBA 1IE3A 3FCEA 3L93A 4LISA 4N6NA 1U2SA 1XZ8A 4U5XA 5F78A 3NAZA 3DDSA 1BXRA 2G17A 1AK2A 2NO7A 3HJRA 4S04A 3HGTA 2ALJA 2W71A 2Y1OA 5E6SB 3MHTA 2CUNA 4B40A 3FPJA 5FWNA 1NVDA 2I7XA 5GY7A 2IYUA 1ZK3A 3BDVA 2XCTB 1Z26A 2PRKA 3GWZA 4J94A 1B8NA 4P92A 2AHOA 2J5QA 4DC9A 1NFRA 1G2OA 4EW6A 2FR0A 2NXNA 4G4IA 1ENOA 2PMDA 2QMOA 4TS3A 3SEZA 4S1NA 1L5OA 2R48A 4H3KB 5JSYA 3DTVD 1N9GA 2CXPA 3E9NA 1P1IA 3K0SA 1AHIA 2WU3A 1X80A 1B15A 1FA9A 3DLTA 4NE2A 2DQZA 1FDWA 3DE0X 3E3NA 1N8SA 3IA7A 4X1IB 4LC1A 4PPFA 4G1UC 3HDVA 4XZ3A 2HZBA 4MUEA 3U37A 1EG2A 5JJBA 3OU6A 1UJ4A 1V16B 2VTEA 3E1SA 2BGJA 3FGZA 3GJTA 2ZJ8A 2FJUA 3M6IA 4S1WA 5JQGA 1JPNA 1X39A 1BKDR 1BGVA 2J87A 3A7DA 3N58A 1VHLA 1S89A 4Q1FA 4DARA 1JYSA 1PJCA 1D0IA 3G0HA 1ODCA 2W43A 3IAAA 3QUSA 3GLGE 3PX7A 3TGWA 4NU8X 2W0MA 2EATA 4EA8A 1PDOA 5H4GA 3K71B 3R8FA 1FUYB 3EULA 2GK7A 3P52A 1BO6A 4YAEA 3QK7A 3C6MA 3DLHA 2VP0A 3GG2A 1TK9A 2VDMB 4D9HA 1CEQA 1JSXA 3RRNA 3HJUA 3A4LA 2SECE 2P27A 3CCBA 3TKAA 2FR1A 1Z82A 3AEZA 4ND4A 4UBKA 4KITB 4EPTA 1X7ZA 5AVUA 1OU4A 4C2UA 2IHBA 3UMGA 3AO0B 1DCTA 1W46A 4PYJA 1E58A 1QZZA 1UFVA 4QBIA 1OJLA 3L04A 3KSUA 2BZ1A 1PF7E 4DJEC 1LS6A 3QBEA 3TZHA 2AXNA 1MOQA 4B43A 4REQA 4BQFA 1L7NA 4GM1A 2GS9A 2ZRNA 1U2PA 3O1LA 4FMPA 4TV9A 4B33A 1E2BA 3RSGA 4BN5A 1T6XA 4H1HA 1RRGA 3HADA 1IUOA 5FWAA 1K8XB 4GMFA 4XWYA 1CJSA 3ZWXA 1JU9A 3QY0A 1MHPA 1XCBA 2IK8A 3D3KA 5DGXA 1S2NA 2HNAA 4DRZA 5JC1A 5SZHB 1GDTA 4BE7B 2C1EA 1ES9A 1FXWA 1FUKA 1SO8A 1TEXA 1YS7A 2HFJA 3LVBA 3CSUA 3RFTA 4CIXA 1IPHA 2GEJA 2FY8A 1GNPA 1WPRA 1Z73A 5I8ZA 3OZAA 5JAUA 2VPXA 1E9BA 1PWHA 2PGDA 2XAAA 5BQ3A 3WYCA 1GCOA 1Q2XA 4QDOA 1NZFA 4PCLA 3C98A 1BA3A 1U3CA 2G9ZA 2QTNA 4GEKA 1DJOA 2P11A 1CKEA 2ZIEA 1Z16A 1VJ1A 1SEVA 4Q6WA 1Y37A 2WHPA 5TQ2B 2UXDB 2HGZA 2FN9A 3DBHA 4O4HF 3UJPA 2FVXA 1RWVA 1P4JA 2XNSA 2CK3D 3NM5A 3NV7A 1F2UB 4QYSA 4AF6A 5KJ6A 1JJIA 2QDKA 3HXPA 3A11A 1LW6E 2IQIA 3LIPA 1O6GA 3ND7A 3HKCA 3NM4A 2XF8A 4IWYA 3VDXA 4F6RA 4EEKA 5D85A 4OATA 2OXRA 5D3QA 3H9EO 4JA0A 4XW2A 4XIJA 1K06A 5WRFA 3BJZA 2O1XA 3LC7O 2FKAA 1QFYA 4NZYA 5EJ7A 5DYGA 2K6GA 5CDTA 3RASA 1CPYA 4Y9UA 2F64A 3MPOA 4HLUC 4NDZA 3QSGA 5CXSA 3EYAA 1XEXA 4WOCA 4F3CA 1UFRA 5JASA 5IBPA 4EH1A 5L4SA 3DYVA 1MR3F 1V9SA 4E15A 1E1QD 4RTPA 3KKQA 4RO0A 4HPXB 1Q22A 3DMTA 4Y9TA 2WLSA 3CVVA 1WXFA 1OH5A 1J97A 4PZPA 5DNWA 3EF1A 4GC5A 5K3FB 4EHNA 3V2HA 3FR8A 1E1RD 4CL0A 2E48A 2IDZA 3QEOA 3ZD9A 2AD5A 1G21A 2FMUA 2FJ0A 3H5VA 1V8FA 4P82A 4W5OA 2V8OA 4DNPA 3R7AA 1XZPA 2PS3A 3MFYA 1YJCA 2TRSB 4XH9B 4BNWA 4I8IA 1GZVA 2CJYA 2DWOA 3IS3A 1DAKA 2PVSA 4WLOA 4FFBB 3T15A 1JB1A 4CJXA 4MVJE 4LK3A 4Y2XA 2FMTA 2FUG1 3IHTA 5B58C 5IC5A 3MQ4A 4OGFA 4WZZA 2EYQA 4K03A 5EGSA 1Y1LA 2B8TA 4BVHA 1GPUA 1LSUA 1X0XA 3AVQA 2D6FA 5B4UA 4IICA 3SC3A 3V8VA 4QT0A 5EMLA 1P75A 2CJWA 1N25A 3IGFA 3KKMA 4I0WB 3WL7A 1RW4A 2WMNB 4W9NC 4BNZA 2GZRA 1QONA 1ZD1A 3MLBA 2WNHA 2OL4A 3G1UA 1WAMA 1IQRA 3N2KA 2H2AA 4QDKA 4KPEC 1KDOA 1JI0A 1WHSA 1SGWA 3GMSA 1POXA 2I6XA 3KD3A 3SZUA 2OSBA 4CM1A 5E1DA 1JJ7A 4L4UA 2XA2A 4WY2A 1LX7A 3C6XA 1C7ZA 4B09A 4O4JB 2OHJA 3RQIA 2R47A 1PSDA 3G2PA 2PGIA 1IHXA 3QHPA 2NYAA 2ZPAA 3CUEF 3IJ5A 1IZ7A 2KMLA 2Q6IA 4NS4A 1JR3D 4RCYA 2MYUA 2C2WA 2XRYA 4ZAFA 5TB5A 3W4KA 3URKA 2O8VA 4Y6QA 1BJTA 3IKMB 4ENSA 8ADHA 5I45A 3U1BA 3MWFA 3IVAA 2QN8A 4KPUB 3K0HA 1WCYA 4X3OA 5KWSA 1DELA 2Y4OA 4LOKA 5DGDA 1RWWA 1WB9A 2EDAA 3AEQB 4G5RA 1FXWF 2E55A 4OQLA 3HVUA 3MVEA 4QJ5A 5AKXA 1IRIA 3WB0A 5A04A 1Z6QA 2OORC 3VYWA 4UXJA 1XTRA 1QTNA 1KQGA 1TIKA 2YMQA 3ACCA 3R3JA 1VFNA 3ZD6A 3R9XA 4Y6PA 5T7BA 1XZJA 4DCVA 4DDHA 1KNXA 4Q1VA 2D7CA 1DC7A 4N3NA 1S5PA 4D4LA 5PGMA 3RTGA 4MUIA 5I7AA 5BXYA 2GEBA 1VKZA 2WHRA 3OOWA 4IG9A 3SS7X 4WY8A 1WUKS 1IN7A 3HP4A 1YZKA 2FLWA 1Z29A 2AZTA 3KR2A 3KXKA 5I7EA 5FFNA 3H5OA 2VT2A 3GUCA 3FHLA 2CB0A 4WFQA 3LWNA 1W2HA 5EXSA 3RREA 4C4ZA 3IMFA 5IWAB 4Z4FA 1YR8A 1FFGA 2BBSA 1FE8A 4GLOA 4E5PA 1SUIA 1PK7A 2XZTA 3IP7A 1EG7A 3WV4A 1ZOOA 5KZMB 1ST3A 5J4KA 3K6SA 3MEQA 1ZOIA 5ADWA 4YJGA 4Z2YA 3DHNA 2Y92A 2IHJA 3Q9SA 5KTKA 4Q3CA 2B5OA 1R8SA 3HKEA 4A8PA 3UBTA 4PC1A 1DJNA 2CT8A 1L6IA 3AUKA 5H3LA 2GTIA 2IUUA 1FBNA 1NNLA 1TFRA 2YV4A 3HCDA 4PGAA 2X7XA 3S7ZA 1FL9A 4XRGA 3NKVA 4YUWA 2JFNA 2VCHA 1S3SA 1VL8A 2IUTA 1E63A 4HBGA 4UBMA 3UPUA 1JH9A 1W85B 1XOIA 4QSHA 3T4PA 3K16A 3CC8A 2C5AA 2ZRGA 3K7EA 1TYCA 4HQ6A 4M9RA 4LDRA 4R8KA 1V3TA 4ZPXA 5HEKA 5T6BA 2UZ0A 4OHRA 4LY6A 3EQ7A 1V16A 1XKLA 3GEHA 4KIGA 1C7IA 4RJLA 3AVVA 1GCIA 1RC8A 2YINC 1CZRA 3H2KA 3QEKA 4X60A 2C0PA 2Y1CA 1DIGA 1TNDA 2G4CA 1BKYA 4LHSA 1NKSA 2NUPA 2OE2A 3V42A 2D1RA 2OO3A 3G8YA 3O74A 2I1VB 1KOFA 1W4AA 2A0WA 3EXFB 3I8SA 4MQ5A 4DNQA 5FV4A 3EXHB 1RIIA 3AK4A 3GL9A 4M46A 3T3HA 3EIXA 5BWNA 4BRWA 1F7VA 1BCRB 4K9PA 3DE5X 4JI8B 1G9XA 1C3OA 1DINA 2ZIZA 2SKDA 3FDZB 4ZQEA 3BH7A 3RUFA 3EHEA 3QFRA 4XQ9A 3VVLA 3WLLA 5BY2A 2OMKA 3DL7A 3N87A 3VVMA 1TTQB 4DGQA 5E1OA 3EBLA 4I5IA 3FTEA 2IPNA 3PFBA 3O31A 2PZBA 2BDEA 3FRJA 5B3JC 1EX9A 1V11A 3IJPA 1X7WB 4S35A 3DOCA 5EAIA 2QB5A 4ZEWA 3IIEA 1UJNA 4KQJA 5IF3A 4V1CB 4O1HA 1JXMA 4K2HA 4RSGA 2H4XA 4YHBA 1QG4A 2BM0A 4BGVA 5KOHA 4LDPA 1H2XA 2B0JA 3G5LA 4LZJA 4U39A 1YQUA 5BWOA 2DFLA 2GZDA 3L3BA 3RV3A 4GYYA 2EKDA 3QVJA 1ANKA 4MV8A 1DJMA 1SC4A 4ZCLA 3ET5A 3NNNA 4TLMB 4DSTA 1GTVA 3HL4A 4XAQA 5FNVF 5FTWA 4ZVSA 3V1NA 2YCLA 4C76A 4TKMA 1EJBA 3MTJA 2PXCA 2GZHA 1KAEA 4J16A 1MQAA 4D4KA 4MWZA 1DQNA 4H7EA 1ZBDA 2YMMA 2I7CA 1DJPA 1L7VC 5CK4A 4N48A 2PZKA 1UEIA 4XSVA 3TVDA 5DYYA 1DUIA 2AOTA 3NDRA 2CMFA 1SRQA 3UXYA 5YASA 2IZOA 3GDGA 3U3MA 1FX0B 1W4ZA 3FETA 5C1PA 3QJGA 3A6FA 3IDFA 3ISJA 5DISB 2KLHA 3HV0A 2Y27A 4HVAA 5ECDA 1M6YA 1LLDA 2OO5C 1NQ5A 4JNKA 2PUBA 4FCWA 2XYGA 5BYBA 2PWYA 1XJCA 4YBRA 5K8JB 4HCJA 4G1MB 3IP6A 3JCZA 3NAQA 4J90A 1F60A 2PZ8A 5BQOA 1SM4A 4DBLC 4LJYA 3FPKA 1R3DA 1RM0A 3UCEA 4FNGA 1XRQA 3HCRA 1QGED 1TMYA 4PGHA 5KC9A 2RBKA 3RK4A 4YUXA 4C30A 3DR5A 4XIYA 5AK5A 3TX6A 2QXTA 4L15A 2J6HA 2W2NA 2ORED 4JUCA 4XR4A 2VSNA 1MAUA 1GZHB 2R66A 2OFOA 4FCCA 3VU3A 2JG3A 4D98A 3SJBA 4NYJQ 2BV3A 3JYOA 3VR0A 4Y8VA 4J0HA 4NVRA 2A0KA 2Y9PB 2VCEA 3SVTA 4DB2A 3JQ9A 4G5FA 5HZGA 4BTEA 1KIFA 1QO0D 5KUTA 4HMOA 4OBXA 5DYIA 1XCMA 3DFZA 3FYDA 4FMBB 4OIFA 5CT9A 5AW0A 1GPKA 2XB8A 3L77A 4XE5A 4EAQA 1GVNB 2GBIA 4YNBA 3W9SA 1HFJA 4B4DA 3QEAZ 3KVRA 4MRVA 4MKZA 3UO8B 2ZRFA 2P91A 5DI9A 5IX8A 3KAKA 4YCMA 3WNBA 1CX9B 1YRWA 2GK6A 1PG2A 3OJOA 2GN2A 5JAZA 5JXHA 3CR8A 1Z6ZA 2BMAA 4YJ3B 1O77A 4DWWA 5HCIA 4BVGA 4X1OA 1IY8A 3PWTA 2R6CA 4GPAA 1ZITA 3OEYA 2YQ5A 3WC4A 2A9KA 1OV4A 1R4ZA 2YIMA 3WL4A 1IJKA 1U0EA 2BD0A 1XCLA 1NQTA 1UP4A 1QCYA 3UTDA 5A4DA 3E3MA 4QGFA 1I36A 3A1VA 3ZXXA 4LVOA 3ZUGA 3ZCSA 5L51A 5CNIA 1HKUA 3RPEA 3N7TA 4TKZA 2IPXA 1HE3A 4JXJA 2CXNA 2YBEA 4NYIQ 3SJAA 3ZE7A 2YJGA 3K09A 4HC4A 1TFUA 4M1SA 1JKFA 1UBGA 4RZHA 3UWPA 3KQHA 3A1TA 3FWZA 4IXTA 4EYEA 3A2KA 2WDZA 1RHRA 1KOLA 1M74A 3K5PA 1KBZA 1HT0A 4ZVLA 3UAYA 4NZPA 4F5ZA 4FHFA 4EITA 3OZTA 4A6DA 2FFRA 1RWXA 1KH3A 2OBYA 4UEWA 1CBUA 1Z7WA 3G3EA 4JKYA 5EXXA 1U31A 4XX1A 2B94A 2O06A 3GAZA 1AT1A 3F96A 3UAXA 3EEOA 3PEYA 3T94A 2AK3A 1DJQA 1ZMTA 5FL7D 3ZCPA 1QQ7A 4AJ4A 3AIIA 5AJYA 3N05A 2CHQA 1CE8B 4WINA 3SZRA 5FOQA 2O5CA 1ZAKA 4OP2A 1XJQA 2XB9A 5J5VA 1ZDMA 2G7ZA 3U7EB 1H9AA 3AX6A 2R79A 4UUMA 3EXEA 3MTGA 1GUYA 2ZCJA 5EJFA 4EY6A 3GVIA 1I51A 1YXMA 3K15A 1BU5A 5COBA 3COSA 1XNRB 3ZH2A 1T0PA 3O73A 3VHRA 3CZ4A 2GX6A 2ZAOA 3BFXA 3CJTA 1K86A 1R0ZA 3VJLA 1OX4B 3LQRA 4C0AC 3F6EX 4DR4B 1UJCA 1T8PA 4AF8A 3M2TA 3LF2A 1ZVQA 5HM6A 1AMUA 5ICCA 4J0JA 4BNMA 3TZQA 4Y67A 1P0MA 2PPVA 3K72B 4BMSA 3NTQA 4QYIB 1KJWA 1USWA 4P81A 5E9JA 4RFSB 3WI7A 3ZVNA 1DE0A 4H1VA 5E6RA 1HT3A 3RIHA 3HLTA 5KNLA 1JAZA 3AKEA 2W6OA 3ST7A 4C07A 1G38A 1GHTA 4DM3A 2GBPA 4INOA 5BR4A 5K8VA 2Y67A 3H8SA 1K8ZB 4YALA 2JCGA 5FWYA 2RK4A 4FYWA 5IXYA 3AF5A 1LK0A 1Y42X 1GCGA 2AEJA 2VDQB 1U7XA 3D7RA 1KO5A 1YRBA 3FAZA 1PJRA 2JLRA 3NU1A 4GRIA 2ID4A 4XLTA 3PA6A 2B7BA 3BMQA 5HMMA 4IDQA 3AESB 3DLAA 2HWWA 1QVRA 4Z0NA 2RI6A 2X1MA 2WKQA 6GPBA 5LOVB 1OGIA 3K8QA 1U7TA 3MCWA 1EDBA 3PFNA 1GKUB 2IQ5A 4ENPA 5HKKD 5F98A 1Z08A 4O2AF 1LDEA 3K6RA 2YRXA 3H2HA 3FPAA 4YT8A 4DUYB 3OE7D 4FZJA 4BX0A 5BRAA 1ZD9A 4DYHA 4AG6A 4C9BA 4K5QA 4WJLA 2X8BA 1HSZA 3OC0A 2ZUWA 5HFAA 2B8JA 4LTMA 5BOVA 3EGOA 3DAOA 5ULLA 2DWCA 3C85A 4IXDA 3Q1LA 5F1OA 2QQ5A 3T1VA 1YVRA 1CS0B 1MC8A 5FO1A 5IKMA 1IM5A 3B6EA 4NFLA 4C87A 4MYCA 3LXMA 3UIEA 3NHZA 1LD3A 2ZJZA 4ZYWA 3EXFA 1UOOA 4JLNA 1QHGA 1Z88A 2WFLA 3FTNA 2HBQA 5ALIA 4L7QA 4MQFA 2VYVA 5GJCA 4C4TA 1EFHA 1T1EA 3PLRA 2XCUA 5K7SA 2SICE 5COAA 3ZHQA 2JLWA 3FTFA 1RKBA 2COKA 4D43A 3TK1A 2X7JA 1MBZA 4XPZA 5BORA 5BR7A 5AHKA 1SFRA 4U02A 3NIWA 2YZKA 3NGLA 4QUGA 4OYLA 1F48A 2I2WA 1T5BA 2E2WA 2Q5IA 1U3TA 3F2IA 4MW5A 2G1PA 4X54A 4NC9A 3CU5A 3B1JA 1J8MF 2AOXA 1KI3A 1UXGA 1Y6QA 5HS4A 2W2KA 4C0SA 1SKQA 2WM8A 3VZBA 1G8YA 1P7WA 2JAOA 3CM0A 5KWEA 4BP1A 2C2OA 3CZMA 4XIGS 1KRHA 1I32A 3P96A 4EGAA 1K6IA 3KEMA 2EBWA 1G5HA 2BF7A 2ZRIA 4TV9B 4AMVA 1TA9A 2P9ZA 4CT4B 3S4YA 4J4TA 1QB8A 3A3NA 3IAHA 1TD1A 2DKOA 2XEXA 4HX9A 3JAWB 3WXMA 1YDWA 3QEMB 4QA9A 2DFPA 3L0DA 3D6VA 4EB8A 5E2IA 2SHKA 1NC3A 4OHKA 2J0SA 1H5QA 2O1WA 2Z9CA 5CR9A 5DHPA 2FHSA 1EXNA 1TM2A 4ZT7A 2ZBQA 4MW0A 4F3YA 4XD7A 2I2FA 2XECA 3ZWVA 3UJHA 4MR8A 3UOAB 4YRIA 3MW8A 2JI7A 1M0TA 2AGVA 3OLWA 2AJTA 5JI3E 1J24A 1ZGJA 3MUEA 2ONJA 3RJZA 7REQA 1M5TA 3ITNA 4GBMA 1Y80A 2HLNA 4CQJA 4BBJA 1M8JA 1W94A 1ZCJA 2B4QA 5F64A 5DJ5A 2Z08A 3DVRX 2O8EA 1XU7A 1UK9A 4RMNA 5L3ZA 2ECKA 1ZMXA 2DT8A 1GZ7A 1F38A 1N0IA 3C1UA 3QKWA 1XMSA 3QNUA 4YRRA 3OKAA 2ILTA 2REOA 2QE7D 2V9ZA 3O4JA 4MP3A 1JA9A 4V2UA 5IYZF 4ALLA 1JWAB 4I6GA 5L3QA 1VG1A 4D9EA 1EVZA 4N18A 3JARA 2FPIA 1MU0A 1JG1A 3O8BA 3ETLA 2PYDA 3BZUA 3EVTA 3GZTB 3R6WA 4EUKA 5A02A 5JALA 1YU9A 2O23A 1IJEA 3U48A 2WG0A 1PBNA 5JDCC 3WLFA 3WHIA 2RGGA 3CZRA 3M49A 3RVLA 2WU8A 1B16A 4GR5A 2WMDA 4G86A 5FJIA 4BVAA 3CLSD 2QAGB 3USZA 4IUBS 4AJLA 5KNBD 4PE5B 3ETDA 4MMYB 4PTYA 2B8NA 2QN7A 3OTIA 2ODWA 5K0NA 1VHQA 3RYHB 1II9A 2L0XA 1N75A 2ZW9A 1SC1A 3QBTA 5DEOA 5FL3A 3ROKA 3RVKA 2GPYA 4K9QA 4EI7A 3OZIA 4OJMX 3VYSB 4BGUA 3WLMA 3KJZA 2BBOA 1LJUA 3P0JA 4N5HX 1NF3A 3O8OA 3P0HA 4KR6A 5CW1A 4F9EA 2H54A 2YFKA 2WFAA 2I7VA 3SQMA 2IPOA 4GLFA 4ZAXA 1UC5B 1QF6A 3NHLA 3STTA 5AUOB 3T3OA 5F2KA 2RJ3A 2VRCA 4L8WB 5JATA 3E84A 4YQEA 1T0IA 5M2QA 1BXRB 3OIVA 3VU9B 3NP9A 5KNDH 5ECGC 1UMBB 1T4CB 2DHCA 1I9GA 3AR4A 2CUKA 2EG9A 2ZR0A 3OZFA 4LV6A 4TKLA 4XUDA 1H6DA 2RH4A 1W59A 2G3YA 2I3AA 3ZV6A 5JJCA 2AZ4A 5A06A 1BFKA 4J7CA 1UKYA 3X1XA 1XELA 4KDFA 4JI7B 3FWHA 2IXBA 3ETGA 3JQBC 3F9CA 1T3GA 1MP0A 1I0ZA 2BHSA 2VTVA 4B2IA 3DEJA 3GT4A 3I4FA 3SHTA 1J2JA 5B55A 1GL9B 2I78A 3N8KA 4XWKA 1DXYA 3A9CA 4DDUA 1MUUA 1COWD 4I8DA 2CZQA 5K4AA 4N5NA 1YZTA 1R5JA 3FUXA 1SXQA 3VNRA 5EE1A 3T34A 3V7NA 2KM1A 4ESOA 4NYIR 5KYWB 5AW1A 3TW0A 1T4GA 5K0EA 4KR2A 1GRRA 4FXOA 1P0CA 1ZC4A 4CG3A 1SK8A 4OBBA 3MJ4A 3EUFA 3UFBA 1L7PA 1WA5A 2GF2A 2W2VA 3ESDA 4ZT2A 3V8BA 3ONDA 2QTVB 4ZYYA 4MDFA 1R5OA 2AYXA 2OR3A 2P5TB 4EW1A 5K4HA 5I9SA 4KFTA 3ZN2A 3F5MA 3CNHA 4OHXA 4C2TA 3WRYA 1EWRA 2X8LA 2PJZA 3HK2A 3B9RA 4DILA 1H2RS 2IXEA 3P2KA 5E1BA 4BFYA 1SCBA 3I04M 1KJQA 3TAUA 3IMKA 3OLYA 2C5SA 2VIIA 1T10A 1C0LA 4JZYA 1GU7A 1VXOA 3P7MA 2XSZD 2VI5A 4UAVA 5IH3A 3ROQA 1QH9A 3BIFA 2QZSA 4YRCA 4Q4JB 3IESA 3PI7A 1RCUA 1V0JA 4HK4A 4AS1A 2OCXA 2NTEA 2HDNB 4QODA 5EIEA 4DV1B 1AV7A 3O4VA 5K8IA 3GQBA 5KKAA 1Q0ZA 2QT9A 4Q7MB 1CRWG 3SIXA 2W37A 4HFJA 5JPDA 1PJ4A 5AQEA 1JIQA 4TTJA 4B6PA 5KNCD 3I6ZA 4BKOA 3BSYA 3R9XB 4TZ6A 4JUIA 1CUBA 3FVRA 4QASA 4NJMA 5G3ZA 1GKKA 3KSRA 3AIOA 2G04A 4WXPA 4HUJA 3VPDA 4CE6A 5IDXA 1XMOB 1K7EB 1ZSVA 4D41A 5KC8A 3LUGA 4EJ6A 3E2IA 2C7QA 1H66A 2VG8A 4CKCA 2XDYA 5A4KA 2NTYC 3ZVKA 3CB2A 5TT1A 2IUYA 2EV9A 3OX3A 5K1ZA 4KFCA 4GH5A 4D6XA 2I6GA 5AJTA 1HWYA 5DVZA 4EG5A 4K26A 2FZGA 4B8YA 1RWQA 2DRIA 3AV3A 4MMXB 2PZFA 2QUIA 1EFRD 3GLQA 4OJKA 5HDQA 1OA1A 1IZZA 4OLJA 3PTAA 5F21A 4DLBA 3E9EA 1QG2A 3BGVA 3HB5X 5EMMA 3EODA 4DG5A 3WAJA 1K8RA 5AI6A 5CBPA 1VE6A 2WTAA 2PGJA 3ZY5A 2ON6A 2C92A 3PQ8A 3ZCUA 4UW9A 5JEDA 3L9XA 2HBZA 3ZNOA 1NMSA 2BFNA 2VP5A 4E31A 2Q5OA 4TV8F 1E94E 1TYZA 2QGZA 2XSZA 4J4HA 1TAHA 1DTWA 2X6TA 3BAZA 1EZ1A 4TSFD 4Y1GA 5HGJA 5A05A 1K3TA 1HI9A 4UJ5A 1D2MA 1NF9A 1NSTA 1QGOA 2PRZA 1PSZA 3FVWA 3CVOA 3R09A 4ZEXA 3SZ3A 4EG6A 3VU0A 4ECAA 2FPUA 2BMDA 4UVDA 2HMTA 4YYEA 5TS3A 1NXTA 4UFOA 4DXDA 2CW5A 5C8XA 3G23A 4JBLA 3GGSA 4RSRA 2OYCA 2D1QA 4AMYA 5MDHA 2BSAA 4MUFA 4BL5A 2OTCA 4IDNA 1LFDB 1SY7A 2Y0PA 2IYFA 5I7UA 1A2OA 2AFRA 4NV1A 2C04A 3L6EA 4DYDA 1YZHA 4F56A 3WLQA 4N3CA 2BBWA 1VL5A 4H7PA 1W76A 3FDZA 1CLEA 3D6JA 3J80A 5CEEA 4YT5A 3BA1A 5CDYA 4A8JC 2CYCA 1FMTA 1SKMA 3DDWA 1PBTA 2X0EA 2XZOA 4IMPA 2P0EA 5CIYA 1X8LA 3B3AA 1ZWKA 1FDTA 4GX0A 1V5EA 3N1UA 3ZCRA 3PJRA 2W2KB 4RZQA 1JDUA 4IIYA 4R3NA 5GONB 3SNKA 4CQNA 4E5SA 5EPEA 1L5HB 3AW9A 1GUAA 2FF7A 4YMSA 1D8AA 2LWIA 2ZZKA 4D4IA 2V7QD 2OQIA 4O0MA 1GQRA 3PDUA 4KWEA 5E8RA 1EESA 1IVNA 1ZN7A 1TVKA 3NS7A 2ZRMA 3FPEA 1OE0A 1QLWA 1NP7A 4AD8A 2Q41A 1KMNA 3SMVA 1BEUB 1IEQA 2G08A 4A73A 3B2QA 2VKQA 4I81A 1DHTA 1N6OA 1KK1A 1L4MA 1BX3A 3DTVA 3FKJA 4X8HA 5AD1A 3AB7A 4B0OA 1KZYC 4EKGA 4JQYA 2VRWA 1Y3CE 1B8OA 2C2YA 2YZ7A 3AM4A 3VKGA 3VH4A 5B1SA 2GXQA 3KRTA 4G8BA 4IM7A 4I50F 1O87A 5EPOA 3ZZ1A 4OV6B 1UBFA 3FLAA 2OO7A 1XPJA 3C8HA 4LTNA 4OH7A 4W7IA 1ZICA 2HCFA 1BNCA 2XZDA 3ITKA 4KAJA 5LDGA 4PZDA 1S7GA 4AECA 3L6UA 3VR5D 5B7GA 3UFXB 1WULS 2GASA 1VMIA 5ESWA 5B1EA 1MEOA 1P4HA 4TTQA 1T9DA 1N5DA 5AOVA 1DG9A 4I2VA 4B81A 4JC4A 2KBEA 3I9V6 1FDRA 1PQYA 2AT1A 3IIJA 1CUHA 1JMYA 3I6MA 1I2AA 4XYEA 5ENZA 1E6MA 5BV0A 1D2HA 2ABWA 2JGKA 1B0PA 1OR8A 2XA1A 3HYTA 4FT4A 4G0OA 4HDNA 3FMVA 4DLLA 2YIJA 1QKIA 1EI9A 2YWCA 3GUHA 3T35A 1TM3E 3D64A 4NICA 3ANNA 4EYSA 1XV5A 2Q8QA 3GDHA 4BZZA 3OF3A 1RABA 3MTQA 4YAFA 4C0KA 4MTCA 3IIIA 2H7VA 3WOVA 2J5XA 3NBFA 5KTRA 1RQGA 2FUNB 4UNPA 1FP6A 1T3HA 2WKRA 4L2IB 4L4SA 1RPNA 1EBBA 2VJPA 3KE9A 3WGLA 4BNNA 1Y6FA 2DFDA 1SCIA 4DLSA 1ZU5A 4AQ7A 1IXZA 1QZXA 3I72A 2AXEA 3I53A 2RGBA 4KMRA 4QOHA 1THMA 2QW0X 2B98A 3BEDA 4RY8A 1A50B 4N40A 5TY0A 4D3SA 4UCXA 2C58A 2XW6A 1BE1A 3QBJA 4EKNB 3U4GA 1ZNXA 2C61A 4EVIA 2CV1A 2VOJA 2OAGA 2XUIA 1V3UA 2QZ4A 1JU3A 4JLJA 4EDFA 4UXHA 4TMXA 3FJ1A 5DOVA 4C5BA 1JHUA 2NGRA 3EFHA 1ILEA 3ZJTA 3ZJ4A 1A8HA 3F74A 1AV6A 2DFNA 3Q4GA 4FEAA 1B8PA 1WNFA 4QGAA 2PD3A 4UE6A 2H5LA 1O95D 3DXFA 3I6IA 4DQ0A 3S8EA 4W5TA 3KJIA 2X9NA 4JSTA 4HN4B 2B6HA 1DDIA 1I3LA 1Z7YA 4MWDA 2XYQA 3UCXA 3CVJA 3L7YA 3ZEAA 1HNXB 3AERB 5BSUA 1B76A 1G5FA 1DWUA 3L7MA 2VK2A 4UXIA 3SKXA 5KKNB 4LX8A 4UEJA 5C37A 1ONBA 1VHTA 5HF9A 1YDGA 2B1IA 1O6CA 1R0BA 4PHHA 4E7OA 1RYHA 3ZR4B 2NACA 4BDSA 2IP2A 5CB4F 1JHXA 1KSHA 4UHEA 3ZYZA 1RTTA 3BBLA 3WFJA 3LYHA 1IRXA 3QXJA 5TSDA 4I2NA 1XTBA 4CR6A 1G8JA 2DTDA 2G76A 2KWIA 4P35A 4K3UA 1XPRA 1E66A 4WK2B 4MHOA 1RVV1 2ISSD 5CDFE 1GTMA 5AW2A 5CCBA 4OHYA 3BPSA 1PJ3A 3H9BA 4G8CA 2FPKA 3VPSA 2BJWA 5BYJA 2W4MA 4IINA 1OI3A 2QE7A 4KQIA 1GNQA 3EC7A 3P5BA 1MFZA 3OPQA 1WY5A 4NIMA 2PJDA 4LV5B 1Q7TA 1U4OA 1FBTA 4RADA 4CLXA 3THRA 1QH1A 3N2ZB 3ORQA 4D3ZA 4X97A 4PNEA 3EPHA 5AHOA 1C2YA 3D5TA 4M8IA 2YRWA 4NQRA 1H05A 1U9CA 3T5DA 4FFRA 5DBEX 2X2EA 2ZXUA 3M6WA 3V4VB 3PK0A 3VJRA 5C0OE 1RWMA 2XITA 4AN0A 4YRMA 1B6RA 3H19A 4Y0VA 3GYBA 3F4BA 3F8SA 1G2PA 4Y6RA 3M6LA 2I4TA 1DKMA 3CURA 1BDBA 4JHLA 3SCZA 2I4RA 4FQ7A 3UA3A 4D56A 3TMKA 3O94A 2PX2A 4B4VA 4L3OA 2EKQA 5M7EA 1SQFA 1YGPA 4KIUA 1HA3A 2Q3JA 1N2ZA 2V45A 1Z4OA 1U8ZA 5ALSA 4CMEA 1P4SA 1Y0BA 4MW7A 5AICA 4IZ6A 1NA5A 1NY5A 4RK5A 5F2OA 2CZCA 5LA6F 5E3HA 2R8RA 1OX4A 1N6HA 3G0IA 4LY0A 5DCUA 2NSDA 3WK4A 1SBIA 2G4VA 3FFXA 5KOJB 2BTOA 1WLSA 4QQFA 3BK7A 2ZRQA 3RC1A 5CH3A 5BN5B 1KYYA 4DZTA 2VSXA 2ZREA 3QX7A 3NGMA 4IILA 1GKYA 1NLUA 4Q4CA 3D0OA 3MA0A 2WUEA 4KN8A 3W8EA 5BSMA 3COJA 2D7DA 1JG7A 4BMDA 1USUA 1NV9A 1P80A 1PN3A 2FXVA 5HA5A 3ROFA 3S5JA 1OB5A 1LPSA 2CXQA 5J1TB 3GU3A 1QGDA 4B6EA 4DM7A 4F3TA 3DH0A 4Y6GB 2J3QA 4JB3A 2P4HX 4ALMA 3EIEA 4HQOA 4E03A 3I64A 3MJVA 5E0OA 1GOTA 1QF9A 3KZMA 3NH6A 4FGWA 1O5IA 2IE0A 1XLUA 3SLKA 2YHIB 4BBAA 2XYVA 4XYGA 1TD9A 1AZTA 1QJCA 2NPOA 4I1UA 4LDZA 1CDZA 5CAEB 1XAIA 2M6RA 2AV6A 2UZ1A 4QNNA 3CUUA 4HVCA 4DUGA 3QVUA 2Y0BA 3JQQA 2CJXA 3ZK8A 4YJ2A 1MAAA 1EVLA 5J3JA 3QMPA 3TR0A 4RKYA 5JWHA 4RXMA 4DIOA 2X76A 1ZMRA 5KNDA 2D8MA 3EDCA 4J9UE 4YI3A 2FOIA 2HI0A 4HADA 5TQJA 1KHHA 1XNHA 4EJSA 4A26A 1CUSA 1EAYA 2QGFA 1IU9A 2FEPA 1VA5A 4DVGA 2XRMA 4HQNA 3TOXA 1PTJC 3LE8A 4I6JA 5ALYA 4QEZA 2R9VA 3RUHA 2QYTA 2FQQA 1IULA 1J25A 3AETA 5LBTA 5A4FS 1E3LA 3PEVA 3AHEA 3BWXA 2Q0HA 2BM1A 1I3OA 1PP4A 3NHJA 1F20A 2IEZA 5FA8A 5F5XA 1ESEA 3WIBA 4XM1A 2XQIA 1KA9H 2B3TA 2E4AA 3ZHVA 4F8JA 4RAQA 1V6SA 4ZU6X 2QR2A 5JWRA 3U44A 2FX2A 3MOIA 5AIAA 2GCGA 2D59A 3BKWA 1SA0B 3KQMA 2AG8A 3ID6C 3N2GB 4IBOA 5LQMA 3ZOZA 4KE6A 3MUNA 4CF6A 3ZJVA 1X7DA 1RWNA 3DEKA 2YYYA 1NM5A 1QUFA 4XRRA 4R2WA 4M99A 2Q8NA 3BSWA 4DBLE 2WINI 1K9SA 3B6MA 3PDIA 3P2MA 2FWMX 1ZU4A 1G8FA 4WOBA 4WBSA 3HBLA 1MOPA 4FOOA 3O83A 4TXHA 4MCIA 2PUCA 4HLCA 1HEUA 4FSHA 3CB4A 4ZRDA 1L5HA 4ZV4A 1NG9A 5FI3A 1M6NA 1W1UA 4Z54A 3JQ9C 4DLPA 3V1UA 1JHQA 3U5ZB 2Y76A 1N2EA 1Z5NA 3AB8A 3N7AA 4GRDA 4NBNA 3ZJ5A 1KE2A 1PGJA 4MP6A 1Q83A 1Z38A 5EEGA 1ZNZA 2G9NA 2AN9A 1EINA 1AS3A 4JC0A 1KSGA 1O2DA 4ZOLF 2ZR7A 1NATA 4J03A 2RHRA 1X6VA 5F23A 2IDJA 3CLTC 4OP1A 5JCOA 3CGGA 4PWZA 2WNIA 3K0CC 5KMGA 4QRIA 3Q3GE 4KR0A 4DL9A 3EH1A 2EFGA 3STHA 5FCDA 5KQMA 3DMNA 1NAHA 3SVLA 5KPDA 4GMGA 4B47A 1AM4D 4D3DA 1Z68A 4M1KA 5B57C 3FDXA 3GLFE 3FG9A 2VQEB 4WPGA 1Q0PA 3VHQA 4OI1A 2V6BA 2VDRB 5I8PA 1WV1A 2A7QA 4YRNA 3VI3B 1F5SA 3T06B 4NZNA 4ZYLA 4JJ8A 4ABYA 3B7WA 2RCNA 1EFKA 1DV2A 1NXQA 3OU7A 3A1NA 3CLUD 3E3AA 2A2ZA 3RAPR 2CE7A 4I1YA 4WXRA 1C0KA 1J49A 1XWIA 2XDQA 4FEGA 5DHTA 1WBDA 4GVLA 1QK3A 1XQVA 2VP9A 4PINA 5F1YA 2M6LA 3RS7A 5TIIA 1MB4A 2PMWB 4X1KA 1PO7A 1E6CA 4W7HA 5TGTA 3FXAA 1JI3A 4PPQA 3E8XA 3A4IA 3M8KA 4UM7A 3BHMA 1UZUA 4JLBA 2ZDQA 4LOIA 1NRJB 4ENVA 3LLVA 2XPCA 1YBHA 3C3DA 2WQ7A 2CDRA 1SC6A 1CF2O 3NMUF 1NI3A 1WSWA 2DSNA 4JITA 5AI9A 5JAOA 2R4UA 3WMEA 3FFAA 2RC5A 1FVOA 3TFQA 5LDDC 3MMZA 2NVUB 5DM1A 3RT9A 4H1WA 2OB2A 2YC4C 3F98A 4XJXA 3LYAA 3JRNA 1N5LA 1I30A 1QQ6A 3PA8A 2QQGA 4AWBA 2C8LA 3E27A 3VU9A 4E08A 4L0QA 5GPBA 1UMBA 3WGVA 4M0PA 1K92A 3N8HA 2QM3A 3V8QA 2KB0A 2V58A 1NTOA 2VBFA 2A9FA 1E59A 2F1IA 2BHLA 4JYCA 4P9NA 3W77A 4IDGA 3H8JA 2WVHA 4P31A 1E0SA 1OFTA 1CR4A 2G5TA 2AMFA 1QX4A 2PGXA 4FGSA 4QFMA 4ETNA 2BVNA 4X8MA 3A05A 4BY9E 2C9ZA 2CY0A 1FTSA 3Q1KA 1E5VA 2VXOA 4EP1A 3D8TA 3H1AA 1GPWB 2CDNA 3TAXA 1YL6A 1MENA 3LQFA 2CEAA 3VZCA 1YZUA 4UM8B 2ZULA 1ZL2A 1WZIA 1L8QA 4FZ3A 2Z8XA 2HCBA 4IDBA 3Q87B 1FXUA 4NULA 2FK8A 1W4RA 3I1JA 3LOUA 5CNJA 4F4CA 3HEMA 5LMZA 3VHXB 3C8UA 3DUFA 3LVRE 2I8AA 1KJ9A 3DOEA 1K6EA 5IW8A 3OQIA 4FYPA 5JY6A 3TO5A 5DNYB 2PSEA 4M6WB 2IE8A 2ZU0C 5CRIA 3NWPA 3GLGB 3SK0A 1U7ZA 3HY6A 1YFLA 1IEXA 3PNKA 5L8VA 3P5SA 4HAVA 3QYJA 4FBGA 4HEA6 4Q6BA 1KO4A 3BG5A 1P2DA 5F9HA 1U04A 4R41A 2K7ZA 1DOZA 3OKPA 4PLYA 3H5RA 4RF3A 5IDYA 3VOBA 3IL2A 4LOJA 1QYIA 4R1MA 5A5FA 16PKA 3ESCA 2W4QA 1NDUA 4KQ6A 1KOGA 1NXOA 5AKHA 1HRDA 3ED1A 5AW9A 2PRSA 1A9XA 4G0XA 1VMEA 4RCZA 1DKQA 3BJIC 4WIAA 1VLLA 2QTWB 4X3CA 521PA 4TMWA 1YRHA 4QXPA 4MIOA 3VPCA 4Q5IA 3S99A 4EHFA 1A3CA 2B2CA 2X23A 4LEIA 4X93A 1WJGA 4BTLA 2OFPA 3CZ9A 2EFJA 4LXUA 4F9GA 1Z4MA 3ZYCA 1OBCA 4O2AA 5DYWA 1UPBA 3N76A 1LF5A 3FUTA 4NJMB 1VBFA 3KJXA 4H7HA 2ZSAA 4DA9A 5HTKA 3DFKA 3ESBA 1G1MA 4PLFA 4FHEA 3SDSA 3WGTA 1KR5A 1M1YA 1E9AA 1QQ5A 1XLTC 1OX6A 3ITDA 5LP1A 5MN5A 1ZH4A 4DKXA 1JHDA 2W11A 4R9VA 4JMLA 5H9WA 1N1DA 1PZMA 1BEZA 2B4RO 3T54A 1RBZA 2C83A 2H2HA 3ZWAA 4DR6B 4HGQA 1RLTA 3EYWA 4BB5A 1G98A 4XGKA 5GV8A 1YS6A 4X64B 1VI6A 1PL7A 2V4MA 2JH9A 4R0VA 4FFLA 2BFCB 3SY8A 3UICA 1ICIA 4DABA 2TMYA 1H8ED 4EUNA 5IJ0A 4KN9S 1E1CB 3FZNA 3MCAA 3MT8A 1I14A 1G3QA 1FFBA 2ONCA 4MYUA 4PHCA 3O91A 4U7GA 4Y9SA 3ZS9A 4DPKA 2GYVA 4ZDIA 1J09A 1RPTA 5BRNA 3E5RA 2O07A 3UVEA 4B2LA 4EUEA 1IJBA 2YQZA 2NO5A 4PYOA 1PQ4A 3CX8A 1R50A 1XO1A 4LE1A 2MDTA 3PUZA 3PDJA 1KYWA 3K0EA 2NLOA 1JWLA 3CUTA 2UUAB 3A1DA 1TM5E 5HE8A 5D00A 3NWEA 1MDBA 3UM9A 4B6GA 1PJTA 4IDFA 1DIHA 3U49A 3T9FA 5TC4A 3VSCA 4U2EA 2H2GA 5EL0A 1NXXA 2WJVA 2A9OA 3LTNC 1JA1A 1U8EA 1G5QA 1JJBA 4PO3X 1W48A 4Q03A 2QLBA 4GSKA 1O8CA 1P4GA 1LA2A 2C9MA 3R3HA 2G0NA 1LS1A 4JGBA 2Q49A 3R7DA 1Z4JA 1E0DA 3OIDA 4DIMA 4H18A 2CLOB 4RK7A 3WVNA 4C7XA 5AW5A 4XB1A 1O3YA 2ZU6A 4L5JA 5AVVA 3F6PA 2HYDA 1OFVA 1E98A 1WZNA 3BCSA 1O5TA 1C1DA 1KFJB 1GPAA 4QTZA 3UOGA 3ZLTA 2HLPA 2BIFA 1T3TA 3G0OA 4F04A 2CNBA 5ITZB 5LP6B 4BRZA 5BN3B 5BWBA 5EMHA 1HOTA 4Q1DA 2R65A 4X90A 1AQJA 3H84A 3MXTA 4WUVA 4EFKA 1SHZA 4RA6B 1UKBA 1WM1A 3VC1A 2PA0A 1US8A 2R5FA 5SY9A 3K5HA 3PYMA 4UASA 3RVOA 2Z5VA 3PPXA 3ANMA 1Q0LA 2X6QA 2XQFA 2PZLA 4J49A 1MO5A 4HZUA 1C50A 1T4CA 5HIJA 2X4GA 4YWJA 2C98A 3P0FA 2HDHA 2OUIA 2P5UA 2QVZX 4DN6A 3F47A 3PC2A 1GL3A 2Q3MA 5K6RA 1KY2A 2Q2OA 3JYLA 1S1MA 4KZPA 4Z1MD 1WVIA 3CF4G 3ES9A 5CHYA 2VHEA 3OD1A 3AFGA 1I7LA 3HUEA 5DHSA 3U26A 2Q4BA 3GMTA 3Q12A 4X91A 2BPOA 3KT6A 3UA4A 3OCWA 1QORA 3OZCA 2JHFA 2D2XA 3EEYA 5G0SA 4KR9A 2NZXA 2L17A 2FJPA 4Q3BA 4C4XA 2HM7A 2QTAA 3TKYA 2PY6A 5JW6A 1SD2A 1N0HA 2QN2A 3N8DA 3L43A 4NNJA 2XQKA 3WLRA 1D4FA 1DUVG 2J5KA 3QFFA 4P08A 3SKVA 1FNMA 5F77A 5B3KA 4HUTA 2H17A 3I01A 4HUQA 4YFYA 5IT0A 4HAOA 1L5FA 4GI3A 4KQXA 2C7RA 1QYRA 2W0SA 4BE4A 5BQXA 4ARUA 1QKKA 4BV8A 2Q5QA 3HB9A 3RVBA 4CM7A 1Z62A 2QS9A 3LGAA 4P5PA 3SJCA 1HLFA 5JAIA 1UPA