2IDMA

2.00 a structure of t87i/y106w phosphono-chey
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
127
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
molecule tags Signaling protein
source organism Escherichia coli
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
total genus 40
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2idmA00
3FFTA 2FW0A 3QX9A 2WY2D 1P6UA 3FMVA 3DGEC 1QP4A 3MA0A 3JTEA 4P1ZA 2MSKA 4ZMRA 1QO0A 3BBLA 5BQ3A 5JNSA 4P98A 3A0UA 3KS9A 3NNNA 4OTZA 4L85A 5EWJA 1XHEA 3CLKA 3C6QA 4YGXB 1AB5A 3MQ4A 3C3WA 1RZRA 2JRLA 3HXMA 4XFKA 1JDNA 2FEPA 3H5VA 4QICA 4ZPJA 3CZCA 4LDAA 2GKGA 3LUCA 4MLDA 1L5YA 1SXHA 2R47A 3RVOA 2M1ZA 2QSJA 1DP4A 2HPHA 2QVCA 3EAFA 3H6GA 3QEKA 4G0PA 4YLEA 1Z18A 2E4YA 1KMIY 4QYWA 3S99A 1Z25A 2B4AA 4RZSA 1PNRA 4Z0NA 4LE0A 4MS3B 2PLNA 3JY6A 3SG0A 1QQBA 4KMRA 5DKFA 4S05A 3C3KA 7ABPA 4MLCA 3CU5A 1WETA 2F8SA 1D2AA 3H1FA 2FSPA 1TVMA 4YRZA 4YO7A 3ILYA 4TN5A 4F06A 3HCWA 5JNTA 2WB4A 1PUXA 1Z2DA 2PL1A 4H3KB 5CNIA 5IC5A 5ED4A 1BDHA 4WT7A 3RVKA 3H1GA 1RPJA 2WJAA 4LE2A 4W5RA 4ZJPA 4KREA 1K68A 4D74A 5C5EA 2HQRA 5CNJA 3HM9A 1TLFA 2CD7A 5FWYA 2Q5CA 4RU1A 1FFGA 4LZLA 4DADA 5IX8A 2QVGA 3OMWA 4WXMA 4MS4A 3EULA 2M98A 1D4ZA 2QV0A 3RVRA 3CNBA 5KQLA 1YS6A 2FKAA 4RK6A 4RV5A 4ETMA 4MGEA 5KC8A 3HJFA 4N47A 3O1JC 3QEMB 1URPA 2E4XA 4O1HA 1RXEA 1MB0A 2QR3A 4TLLB 3OMXA 3LOPA 4KQCA 4RXMA 1JYFA 1U0SY 2IPMA 3ILHA 4QPJC 2PUDA 1USIA 2QU7A 1T34A 1EAYA 1MAVA 5CHYA 3M9WA 3MMNA 1ZAYA 4Z4GA 4M88A 3MF4A 4JA2A 1NXSA 2IOYA 3O21A 1ZH4A 4MQEB 4RY9A 5B3JC 4FE7A 3QLTA 5ABPA 1ZGGA 4KNYA 4W5NA 3LUDA 4MS4B 3A10A 5GOTA 3O74A 3R0JA 1JX6A 4D6XA 5BRJA 1E6LA 1I3CA 3OQNA 3A0RB 1QPZA 5KWSA 5HM6A 5TQ2A 1E6KA 3F6PA 1A2OA 2XDYA 3EDCA 2FLWA 6ABPA 4ETIA 2VUIB 4RY0A 3F6CA 3SNKA 5TQJA 3KTOA 2JK1A 1ZN2A 4EYGA 3VNAA 1DCFA 3HDGA 4N0PA 4H60A 1JLKA 2AYXA 4UHKA 3LFTA 2A9PA 4NCAA 1NXOA 1YTUA 5TPWB 4OG2A 4ZYLA 3IP5A 5FBKA 3F7NA 2BGGA 1JBEA 1NXPA 3DBIA 3OLWA 5EWLB 5KQGA 1DCMA 4EGSA 3QLVC 2R25B 1BAPA 4Q6BA 3BRQA 2WRZA 2FQXA 3LUHA 4NCBA 3N53A 1FSPA 3CHYA 1J56A 1Z17A 1JFSA 3QELB 1GLGA 5JNWA 4Q6WA 1ZY2A 4Z4FA 2IDMA 5TQ0A 4EVRA 3H75A 1A0OA 2NT4A 4IMJB 5EWJB 3H5TA 1KRXA 2FVYA 1EFAA 2PUFA 3CG0A 1NATA 4HYEA 4RK5A 4XASA 3CFYA 4UHJA 1ZITA 4JB2A 3Q7RA 2OQRA 1ZGZA 2MYPA 4G0MA 4IILA 4KPYA 4OLBA 4TLMB 3KCNA 2GBPA 1Y1LA 4Q7EA 3DLHA 1SRRA 2FN8A 4G86A 3C3MA 4YV7A 4MYRA 4IF4A 1OXBB 4JAVC 1P8AA 3RVPA 2FTKE 3LUFA 3TD9A 1TJYA 5DLEA 3CZ5A 3QLVA 4PZ0A 3Q9SA 4JB0A 4F8JA 2QXYA 5TQ0B 1F51E 1QNLA 3GBPA 3HZHA 4MR9A 5JNRA 1LBIA 3H5IA 2L2QA 5FBHA 3T38A 1U2QA 2HJ9A 3TX6A 5JS1A 4RKQA 2E4ZA 4LDZA 2L19A 3HV2A 4N0QA 5I4CA 4IGAA 3RVLA 1GCGA 1S8NA 2FQYA 2PUBA 3Q7TA 1LK0A 3MIZA 2RJOA 2A9OA 1NXTA 2R4QA 3LKVA 4RDCA 3I09A 1RNLA 2ID9A 3IPCA 3O1HB 4Z9AA 4MQFB 4B09A 3URMA 1D1QA 1DG9A 1YIOA 2MSWA 2X7XA 3EQ2A 4G0ZA 1JDPA 1Z26A 3I5AA 4EVSA 1BVHA 5B3JA 4MR8A 3IP6A 5DTEA 1H9CA 2CHFA 3N0WA 1DC7A 4EVQA 3NNSA 2MSLA 1U04A 4XXHA 1DZ3A 4QYMA 4WUTA 4KV7A 3QLUC 4RXUA 1ZVVA 1DBPA 3OM0A 5F64A 3KLNA 3N0RA 1JH9A 4IRXA 3UK0A 1LBHA 1JL3A 1M2EA 3I42A 4WWHA 2JB9A 2IPNA 3Q7SA 4RKRA 2B1JA 4RK1A 4ETNA 5IULC 1DRKA 1NY5A 4PYRA 1GUBA 1ZH2A 4KK4A 3CKMA 3H5LA 1C0EA 4YP9A 5BR1A 4G97A 4MQFA 1NXXA 4RWEA 4NQRA 3L6UA 3OQMA 4F3TA 3Q41A 1QQAA 2RDMA 1OXKB 4MRMA 2LBPA 3RVQA 2L17A 3M9XA 4DN6A 1P2FA 4Z9BA 2VYCA 2LUOA 2FMKA 3K9CA 4MR7B 5EWMB 2JBAA 1YVUA 1MIHA 4JP1A 2HSGA 1BDIA 3G85A 4N76A 3GWGA 1E6MA 2NUBA 3LUAA 4D6YA 5KQPA 3HDVA 5CNMA 4KRFA 5DCLA 3ROFA 1VKRA 3CS3A 1M5TA 4W5TA 3LUJA 5TE9A 3T6KA 3MM4A 1DJMA 4JASB 3T8YA 2JVIA 3I45A 3OLVA 2WWVD 6CHYA 5PNTA 2P4UA 4Z4EA 4ZMSA 2E4VA 3DLBA 3HSYA 1Z16A 2LPMA 4MQEA 3LUGA 3UKJA 4MS1B 3EQZA 1P6QA 1M2FA 3SQNA 3LMKA 2JBAB 3OO0A 1GUDA 3GL9A 1USGA 3NHMA 2NZUG 3RVSA 1W9HA 3HO1A 4RK7A 4YCSA 1U8TA 3D8UA 3BREA 4KVFA 3QEMA 3SM9A 2NT3A 1DBQA 2PAFA 1QP7A 1W25A 3CG4A 3RVNA 2IPLA 4WZZA 5E3JA 4XAQA 2E4UA 4EYKA 4G0QA 5TPZA 5IUNC 3KSMA 4KQ9A 5FWXA 4Z4IA 2V0NA 4F12A 8ABPA 2R48A 3GA5A 3IP7A 3TB6A 5TPWA 4OLAA 3H1EA 3HS3A 2MYNA 2ZAYA 3F73A 2JVJA 4Z99A 5KI6A 3MYYA 2PE5A 1QMPA 5IUKC 1PEYA 4EY3A 3CRNA 3KLOA 4HNQA 3KG2A 1E2BA 4PE5B 1CYEA 5CNKA 2FLKA 3RH0A 4CBVA 1APBA 3H6HA 1YK1A 1EWVA 3HK2A 4W5QA 4WXEA 3GYBA 3JS5A 2IYNA 1M5UA 3FDFA 1USKA 3N75A 3P9YA 1YMVA 5JS2A 4G0XA 4L4UA 2GWRA 4LRQA 1JWLA 2IPAB 5FWXB 2KYRA 1C4WA 1CEYA 3C97A 3EODA 5GQSA 3RVMA 1JFTA 4FB4A 3G1WA 3ROTA 3LKBA 5IEJA 3OQOA 1SXGA 1VRVA 3FFWA 5IEBA 1BA2A 1XWWA 3DGFC 4MS3A 1Z12A 4MAAA 3LTEA 1HEYA 4YWHA 1NXVA 2FN9A 4EYOA 2FEWB 1ISSA 2FMHA 2GX6A 4DQDA 4PEVA 2I6FA 4N41A 1QP0A 2WMYA 1ZHHA 1PHRA 2J48A 2VUHB 1VLZA 1ZESA 2PL9A 3IP9A 3KKEA 3OO1A 2JCGA 4H3HB 1EWKA 1JFVA 4MR9B 3EGCA 1ABEA 5IBQA 4Y9TA 4RS3A 3B2NA 1RXIA 3DZDA 3KYJB 3N8IA 3SY8A 4E7PA 4XLTA 4EYQA 1JHZA 5FWYB 1Z15A 3E3MA 5T7BA 2JVKA 3HEBA 2A9RA 2FMFA 4LX8A 1ZDMA 3LUKA 3N6VA 5TQ2B 3KYIB 2AYZA 3BILA 1YS7A 4RSMA 3O75A 3QLUA 1GCAA 1DC8A 1L5ZA 2NZVG 3D02A 5T3YA 3TO5A 1MB3A 3IPAA 1NXWA 1YMUA 2HQBA 1U2PA 3A3KA 3GRCA 4YR7A 3W9SA 3O2JA 4NV3A 3RVJA 3JVDA 3IDOA 2MYUA 4MR8B 2PUGA 4G0OA 4W5OA 5BRAA 4MS1A 3HUUA 4TMYA 1FFSA 1F4VA 3GV0A 5TPZD 5HSGA 5DGCA 1ABFA 3HUTA 1KGSA 2LIVA 1IIBA 3O2SB 3JPYA 4Z4CA 3HVRA 4PICA 9ABPA 2VK2A 3QELA 2WJWA 4GPAA 5JNUA 2PUCA 3QK7A 2PUEA 3NNDA 3OLXA 4IMIB 3QX8A 3GBVA 5C5CA 2DRIA 3K4HA 4HNSA 1SXIA 2IKSA 5JNVA 2HQOA 4OATA 4MRMB 4KZKA 4F11A 4NICA 1ISRA 1UDRA 3JVIA 2F8TA 1D5WA 5HQJA 4KK3A 2ID7A 4MR7A 2PUAA 1JF8A 2PKXA 1TMYA 1NTRA 2OENG 3H5WA 4KFCA 2A9QA 1CHNA 3VNBA 4XARA 1LJLA 3Q15C 2H3HA 3CTPA 2ZWMA 4OBBA 3H5OA 5EWLA 1B00A 2FMIA 1QO0D 2H0AA 3OM1A 3UUGA 4EUKA 1YK0A 4JOQA 3SAJA 3BRSA 4ML3A 1EWTA 1Z13A 1BDJA 1QKKA 1A04A 1SD5A 2CHEA 4HNRA 2FXIA 2O20A 4S04A 5IUJC 3TMYA 2N9UA 2FQWA 4YS6A 1LJUA 1PNTA 3GT7A 4Z4HA 1K66A 2LP4Y 2L18A 3L49A 4LE1A 3EJWA 3KHTA 5D2CA 1FFWA 3O1IC 2W42A 2CWDA 1KRWA 2RGYA 4G0YA 5EWMA 4MPTA 2YHBA 1Z2EA 3KJXA 3FGZA 1DBWA 5KC9A 2FEKA 2PJUA 2QZJA 4RY8A 2E4WA 1D1PA 2GI4A 1VPWA 4N03A 3E61A 1JYEA 3RQIA 2RJNA 2P9HA 4RXTA 1AB6A 5HKOA 1PEAA 3FFXA 3NHZA 4O1IA 4GNRA 3OLZA 1MVOA 4RK0A 4RK4A 3O2QB 3T95A 1RZRD 1EHCA 3N0XA 1TM2A 2TMYA 3OLYA 3NBMA 5KQMA 3JPWA 1FQWA 3M6MD 4E7OA 4O5AA 1R8JA 2PMCA 1DCKA 2MYTA 1DRJA 2YHAA 1XHFA 4FE4A 2QW1A
chains in the Genus database with same CATH superfamily
4NBNA 4TMWA 1BN6A 4FXOA 3RFXA 5KWVA 4DHEA 3VKHA 2J46A 3G0IA 4CDGA 3TF5A 1UQTA 3BTVA 4BNDB 3MXTA 1ZD3A 4U3JA 3W3AD 2ZYIA 3GR6A 1W88B 1B7GO 3PUVA 1O96A 2PT7A 1VI6A 3ADPA 2HHHB 1H2RS 3C74A 2J9XB 4L85A 4EQ6B 5LDHA 1D07A 1I3NA 1QZ3A 4PTZA 4O6VA 4XOIA 3MHTA 4YXFA 4XM0A 1XHEA 4FN4A 1QPGA 2GSDA 2WTBA 4CKYA 4D5EA 5K8TA 3JD4A 3OBIA 2GJ4A 1P5FA 3BMQB 4ZPJA 1QX3A 4P86A 1IMJA 2B1IA 3AYZB 3I2JA 3IQDB 3RVOA 1V39A 1DJQA 2CNKA 2R47A 1W6UA 1QBKC 2IQ5A 4QXAA 4MYUA 1UM8A 4CMIB 1MZPA 1QP8A 4C7MA 1KMIY 1WCIB 2JCSA 4HN9A 1EHYA 2IUSA 3PGVA 4QJIA 2HSZA 1JIKA 2B4AA 3DW3X 3IDFA 2XY4A 1Z5NA 4Z0NA 4UNRA 1T26A 2G70A 1L4HA 1V3QE 1WVMA 2EJVA 1N57A 2BELA 4LZZA 2E37A 1QQBA 2P9ZA 4TS1A 4DT1A 5BQOA 2LDBA 2OMEA 1CRPA 4OOEA 1SCUB 1ZRNA 1IDOA 2VAWA 3MAAC 2OQ2A 4HH1A 1VPVA 1O1YA 3G68A 3KZCA 4EQ6A 2XGJA 5LQSA 1NFQA 3V48A 1KJNA 5CYPA 2I8CA 4C89A 3M82A 5ESXA 2GHRA 3DWFA 2VJMA 3G7UA 1Y3IA 4UXIA 5JTTA 1PL0A 3LP8A 3K09A 3ITNA 3EWAA 5IT4A 1S3GA 3GLTA 1NLUA 2PS9A 5CNJA 3R20A 4QX6A 1TIBA 4X0EA 2Q5CA 2QKYA 2C07A 1FFGA 4H31A 3BWEA 4KNWA 1G8FA 1LTQA 5I7VA 1RPNA 3KAPA 1KXZA 5KTSA 3CXUA 5EPOA 3RVRA 4DBZA 3LLCA 5THKA 3GRUA 4NFYA 1DXQA 1M8JA 1FX0B 1ZZEA 4CMJA 1HL7A 4AXXA 3WA7A 1UBJS 1IUPA 5K3FB 2ZRPA 2QR5A 4L78A 3RIXA 1NVEA 4C06A 5B1IA 1OAKA 4XIFA 2Y1FA 1BCSA 1EJ2A 2B8TA 3T5MA 5AK5A 3HVIA 1KMHA 3AB3A 3LYUA 5CHYA 3KEQA 3M9WA 1HO3A 3DYBA 2VZ8A 3WP1B 3TPFA 2HX1A 3FW1A 4KQMA 3S2UA 5ALQA 1JDVA 1KK3A 3X0DA 5C46F 1U81A 3KE8A 4BKMA 1KO4A 1I1HA 2PTGA 5GV7A 4LNAA 3P0JA 3WO0A 3HCRA 2LDXA 2H0QA 2NWQA 1ZRSA 1BDMA 4CLRA 1Z6PA 4DDVA 2WQ6A 3O3MB 3VPAA 4E0BA 4MQ6A 4I4CA 4ZMBA 1XJCA 4D6XA 3P0HA 5BRJA 5BV7A 2A4MA 1A4XA 1YZFA 3KTAA 4PYOA 1NVGA 3VZBA 5B1HA 1TAGA 2QWXA 4EA9A 3JALB 5K3FA 3HCDA 2YWXA 2GYUA 4R68A 4X3OA 1EK5A 3U81A 1WDKA 1KBOA 5B36A 3WKDA 2ZANA 4EUNA 1MJGA 3HDGA 1CJTC 5DI3A 2VDMB 3IQIX 1E2FA 3OF2A 3I05A 1KSHA 1UBGA 1JJBA 2PH7A 1SXJD 2ZQ5A 3DE0X 2CFRA 3M89A 4Y2QA 3WLQA 4EMBA 1SVSA 2D0PB 1QTIA 1PEKE 4DIEA 4BO7A 4ADSG 3FTPA 1P29A 3IAFA 3MJCA 4DJJA 4LF9B 1B1AA 4HX2A 4XYGA 1JWAB 2H5IA 2XVMA 3KVRA 5IAGA 5DXAA 4EA7A 5KQGA 1CQZA 3QLVC 1XD8A 3EDOA 5J63A 3OOYA 1Z17A 1KFBB 3R0ZA 3KOZA 3WWZA 2J08A 4L4XA 4KL8S 4EGCB 5EMMA 5KSPA 4AC9A 1SC4A 2ANBA 4MEAA 1KZHA 3FUWA 3M4XA 3R5JA 3U6KA 3PRJA 5J43A 2ODAA 1I24A 3TJZA 1XDZA 2DH6A 3VR2A 2RGEA 2IT1A 1ITZA 1C2YA 1Y81A 1Z3CA 3GD5A 1JG1A 1JHAA 3FYDA 4NOMA 2AFRA 5AFSA 1R37A 2HFJA 2QM7A 1X1QA 2EJCA 3KCNA 3DVAB 1KEPA 3MSXA 1OR8A 3ROPA 1PT5A 2XCIA 3SIRA 4JZKA 4N6OA 4DWJA 3JZDA 1BXRA 4X8MA 1M2GA 3SSOA 1JR4A 4MHOA 3AESA 3NKVA 3II6X 1EXNA 1PQ4A 2J3KA 2CV1A 1DKLA 1Z56C 2IZ5A 3C3MA 4MW0A 4D8VA 2ZRBA 4DAEA 3QMWA 5FL7D 4PN7A 3PDHA 1U1CA 2ZRKA 1X9GA 2EATA 5FUMA 2XOKA 3B3AA 4OX9Y 2VTEA 3RT9A 3RYHB 2QXYA 2IXEA 3K31A 2D0DA 2R2GA 1NV8A 2QB5A 1R4NA 3DPIA 3KR1A 3LVFO 3R3ZA 2J7KA 3VOAA 3FETA 1VIDA 1C4XA 2FRXA 3LIPA 2VZ9A 4QEDA 4REQA 2LXNA 4GDMA 4IHKA 1Q15A 1S7GA 3Q8WA 5FBHA 3IB6A 3T38A 1P1RA 2QMOA 1OW3B 1IRXA 3QVSA 3LZDA 4PYNA 4X95A 3RAPR 4B3CA 3W4IA 2ZRDA 2GJSA 1P3DA 2ZCVA 4O2LA 1NP7A 1RJEA 3UA3A 1HFKA 4YYZA 1TIKA 5JRDS 1B8OA 5IJZA 1L8AA 2B2XA 3MGAA 1GNLA 1BH6A 1DBIA 4R2MA 4DC1A 2PUBA 3MIZA 4QPPA 3HO6A 5ALUA 1GPUA 2FJPA 1Z8DA 4FYIA 3TXYA 1UBNA 3LF2A 2J3MA 1C9MA 3TTWA 1UOEA 4HY3A 3R3JA 1RWWA 5ENZA 2R751 3FH0A 3IR5A 1Y8CA 4G3XA 1N8TA 1OI7A 3BXEA 4RF4A 1UBTS 2C94A 4EJ2A 4C08A 4D9JA 5JAZA 1DDOA 3L6OO 4GECA 4B3TB 4Q1AA 4QQFA 3HJUA 4GWKA 2MSLA 1U04A 2IEBA 2P2CA 2XQJA 1C0KA 1JH9A 3BK2A 4OO3A 4HDSA 2WIGA 5AW9A 4XLLA 3H5RA 5F5LA 2HU7A 2KLHA 4NOLA 3RS3A 2NU6B 2OBYA 3UJ8A 3ZYCA 3CTMA 3ILSA 1K5HA 1LWNA 2OEPA 3MUOA 4DNQA 2J3QA 2RHRA 4EJ6A 4XYEA 3WLTA 3W5DA 3U40A 2VSQA 3H7IA 3O38A 5J23A 4KK4A 3OIYA 4CL8A 4MVJA 4G97A 4G81A 1NXXA 4GGOA 1G66A 4PIMA 5FOUA 4MWZA 3VR2D 4YPOA 5BQXA 3T3EA 3TGLA 3ZDAA 2WU1A 3U37A 5EE3A 1Z39A 2FQQA 4RE5A 5CD9A 5IMSA 4BLTA 2ZIFA 5DSXA 4TV9B 1J97A 2X2EA 1RXUA 3TZCA 1N2CB 4JQCA 3RNOA 3E53A 4E03A 4EJSC 2NTYC 3HRHA 3LLVA 1YVUA 3B8EA 1JXOA 2O4UX 1P31A 3IOBA 3D6NB 4P6VF 4YDQA 2CL6X 5F1OA 1SFRA 1XLTC 3E22B 3FI9A 4ZD6A 2HW8A 3FOAA 4B73A 4RSRA 3O9MA 3NDRA 4WBNF 1C9YA 3CS3A 4LTNA 4X6LA 4Z6KA 5JALA 3RHFA 2PBRA 3GMDA 4LJ5A 3GB9A 4WQMA 3L2OB 4EW2A 4TM7A 4PAOA 5HDQA 4LF8B 1NUAA 1H65A 1KP9A 1QANA 2JGJA 3R4VA 1V6AA 3GEHA 4TXJA 3WK6A 1G2QA 3W2TA 3GROA 1Z07A 5DW0A 1G5FA 3I61A 2UYCA 1KI6A 3DJFA 1KOFA 4U2FA 5EUQB 4KAXA 4LZWA 2HRBA 3D8SA 1GG5A 1R5OA 2AI2A 3I0NA 2J0UB 3I5MA 3OO0A 4YJHA 4IJMA 2H4WA 2KE5A 4IWXA 1XNGA 2YNMC 1QZUA 4OL9A 1P2GA 2V5UA 3SIPA 1F2UB 3WGIA 1VL0A 2BGNA 1JQLB 2NXWA 4MVJE 4CN8A 2O2DA 4X45A 5I7FA 3DM9B 2NT3A 2N1MA 5LQRA 1L5VA 5I9IA 3WB9A 4NE7A 3BZBA 1ODSA 1PJ4A 3GUUA 4JYAB 3L6BA 3LKDA 2J45A 3M3HA 4OX9B 4XDGA 2G1KA 2Z57A 2YVLA 4HT3B 1TYZA 3KKLA 3RUAA 1MC4A 2PZKA 2XUIA 5BN5B 3ROEA 3OY7A 5FR2A 3H1EA 2CLCX 2QP9X 3HB0A 1H4TA 1QS0A 1ZH0A 4Z99A 4HUTA 1Y1QA 2AQIA 1E1RD 4XWAA 3QUQA 3CSSA 2O8VA 1EBFA 2QNRA 1P9WA 1T9GS 3F47A 3DAOA 1APBA 5HWSA 1F12A 4WCDA 4PXSA 3IQFA 3ENZA 1EWVA 1ZJYA 2GK3A 4B40A 4Y2SA 2N0SA 3AILA 2ZIZA 5FP0A 1KAHA 4FDAA 4M7RA 2WMOB 3UAYA 1GA6A 1OLSB 1K8QA 4XB6B 1ZGCA 3N0TA 5IKOA 3NAMA 4OJMX 4CUZA 3GLQA 5KYVA 1DOZA 1T13A 2BBSA 3BB3A 3EXEB 4RADA 5EHQA 1ZONA 3WWEA 4CUJA 1JFTA 1F48A 1M7HA 1YL5A 2OM6A 1Z36A 1UMKA 3FLEA 3NIGB 2RMKA 3AKCA 1E2QA 1XVLA 2C8LA 5L51A 3HCBA 2ATCA 2FWJA 3H84A 1PO7A 5FT9A 1L0BA 3QW2A 1ZVQA 2J3EA 3MGCA 3VR3A 1FQOA 4GQAA 5LZ8A 4DKJA 4TTVA 4DIBA 5GVSA 1NXVA 2YZ2A 4CM3A 1IJKA 4II3A 4ZVOA 4DQDA 1N32B 1EXVA 4R0VA 3KBOA 1SBHA 2IIPA 4FN5A 2PL9A 2W2KA 3JU3A 3UXMA 2QW8A 1XKQA 1E2PA 1Z29A 4PLZA 4EATA 5F2EA 1CS0B 3UYKA 3TNJA 1VMDA 3IT2A 4XX0A 1E7QA 5DASA 4NARA 2W0MA 2WAOA 3KYJB 4UEKA 4ERXA 1UKCA 4ARBA 3SY8A 2ZTMA 4QUKA 1SBZA 4HDQB 5AM1A 2M6KA 2VP0A 2BDTA 3BTSA 2HK6A 4QJ4A 3AR3A 3JQ9A 3QFFA 5FWYB 4F85A 4AICA 2HJVA 2AN5A 1W44A 2SKEA 3F1LA 3BWDD 3UKDA 4F71A 3AJEA 3M6FA 1JSZA 2FU5C 2I3DA 2CLDX 3A1WA 5FWDA 1Y4DE 1GZUA 3ABOB 1ECFA 3HLYA 3GGGA 5FF9A 2OCKA 4Q12A 3HH8A 2ZVJA 2JI8A 2FZVA 2AZ4A 2Y1LA 3BIWA 3F49S 3NYQA 3QFTA 5DLDA 4ED9A 3O2JA 3JVDA 5ALTA 3W2FA 2F43A 5JO0A 4CT0A 4U7DA 3HLTA 1NN5A 1NI4A 3C41J 3TECE 2XWBF 1MFZA 1WR8A 3WWYA 4ALMA 1LPAB 5IF3A 3DLAA 4U8HA 4MS1A 1RQ7A 3EG5A 5CCXA 1ZEJA 5AJXA 3R7DA 1SQ6A 5I4IA 1EJBA 1RAIA 4KHZA 2VDKB 4P7KA 1KY5A 1HE5A 4F93B 1EUDB 1ABFA 1KO8A 5JOQA 5KNCH 1GPLA 2OC4A 1GU0A 3V55A 3VPCA 1KWKA 1DXOA 4NTZA 2I2BA 2YW9A 3IT0A 4H7HA 5GJVC 3WK4A 2OYSA 4US2R 2BGLA 2OAP1 3TW6A 3AONB 3Q88A 2AG1A 2HA5A 4QEKA 1Y4ZA 1UDAA 2VJQA 4UM5A 1B3BA 1DX4A 1Z4NA 2HREA 2IL1A 3GG2A 5BT9A 2VTBA 1QJCA 3GC6A 4YCDA 4LHVA 4DC9A 1YC2A 5I8PA 1RWOA 1VBNA 3P0IA 4X44A 4F11A 1ULTA 1ISRA 4K05A 3ZV5A 2WICA 5IXJA 5FR1A 4MUHA 1JF8A 1QHEA 3S7TA 1PJLA 5J40A 1Y37A 1U2DA 3OPMA 5C5IA 1V2GA 3QHAA 1MO3A 3QYAA 2PYDA 4F9EA 1N75A 3LBYA 2FDXA 1GDHA 1GNSA 4PYKA 2QTFA 1A7UA 4C6SA 3Q4GA 1OE0A 2JCXA 1WCYA 2YWRA 2QRUA 1DT3A 2ZIEA 3QPDA 4EUKA 3ANLA 5DWVA 1D4OA 2XQFA 5FORA 3RRXA 1W9MA 4JXKA 1U7XA 3ZCTA 1EWTA 2RGUA 4BNFA 1QKKA 3DV0A 4LOIA 2VTBB 2ODEA 2ZUVA 2BN4A 4DHWA 1V47A 1UR5A 4H0CA 4Q03A 1PYDA 3ONWA 4YJ2F 5K45A 3IT3A 2Z8YM 3W3ZB 2NQTA 2I4OA 1VHQA 2L18A 1Y34E 5AKYA 5AVJA 3IPXA 4YMGA 4DCMA 3RD5A 5EL0A 3MGGA 2IC5A 1QTNA 2ZK7A 4I19A 4J4BA 3V80A 1YCGA 3A3YA 4G0YA 1RMQA 2BGTA 4GMFA 1Z2EA 1T4CA 3KJXA 4ROSA 3FG9A 4UCQA 4BO2A 4NOKA 4R7TA 4ZEWA 3P9QA 1Z38A 2XVAA 4FFBB 2XCTB 5KPDA 3F5MA 1U2GA 2PU7A 1QFXA 1S8OA 2VNKA 4XQ0A 1N0WA 1X7ZA 3AEQB 4QT4A 1JYEA 3LT4A 3JWHA 4DLAA 3Q7IA 4ZFNA 2B83A 1PEAA 1FYVA 2QLFA 5F9FA 3IRUA 3R0IA 3IRVA 2C2KA 1YZKA 2JIDA 5FFFA 3BK1A 3C5HA 4Q9LA 4RS4A 1ZBDA 1UBEA 3HU3A 3PJGA 1X80B 3DCJA 4RLFA 1EHCA 2Q4EA 2COEA 8OHMA 2C7QA 1EQUA 1V5IA 2G76A 4HUQB 3VYSB 1O9GA 5C7YA 4RACA 1EFRA 2IZ1A 1R8JA 3H2IA 5ANRB 2ZRHA 3I72A 3BERA 4XGQA 4BNKA 1D8AA 2OYRA 3MTIA 4YJ3F 1KIMA 2FP3A 4RMHA 5DSTA 1XG5A 4BX9A 5D3QA 3WMXA 4EO4A 3VJRA 3ORSA 1M34A 2I4NA 5JNSA 2XTNA 1SKBA 3NKFA 4P98A 2AE1A 2IS4A 4B81A 2JI6A 3CPEA 1L4MA 2HL6A 5BWMA 5IZCA 3FPGA 3LRXA 3PQ8A 4R51A 3AZPA 2ALJA 1RCUA 1C3OB 5KBYA 1L5YA 4ZOEA 1E66A 3RHTA 2M1ZA 2ZAMA 4G0PA 4G26A 4HPWA 1HFEL 2ZJYA 2V98A 3GO4A 1IOVA 1G8GA 4QFDA 4RZSA 1A9RA 2GZHA 1MBZA 2SECE 1TTPB 3B6EA 1WULS 4FNAA 2PLNA 2WSLA 2V59A 4DYDA 1PZMA 3KQMA 3JQGA 3QVJA 4KO2S 1P7WA 4KMMA 3WGZA 7ABPA 4TVSA 1G63A 3NWEA 4YBRA 3V4PB 2AEJA 5IT0A 4CQLA 4J9VA 3E4CA 4HD8A 2OBLA 3LHKA 3EPPA 4LVNA 3IGFA 3LC7O 2IE8A 1QAMA 1TT5A 3REGA 3SJUA 4M0PA 1UUFA 4XYBA 2EJTA 1UAAA 2EDAA 2G9UA 1U3GA 2G83A 4Y6LA 3PKIA 2W70A 2XKKA 5TMEA 1KI6B 3JD3A 3CLSC 5C5EA 2O2IA 1PWHA 5K09A 2C2YA 3FYUB 3KEOA 1M1YE 1C9KA 5BPHA 2PTHA 5MFZA 3SC6A 5HM8A 1PE0A 3DTNA 5TIIA 4YHHB 3ZXYA 2XOKD 3UJHA 4ZI7F 3HB7A 2WAAA 3CNBA 2LZ0A 4QRDA 5H7XA 4MRRA 3AY0A 4Z0PA 1T3HA 2ET6A 3QE9Y 4EOGA 1FFXA 1XVTA 1IHXA 4MVJD 3S1LA 4PNPA 4Y1FA 3UOAB 3K1AA 3R9XA 5BOSA 2UUOA 3OUTA 3DFUA 4JJ6A 1NR5A 3LCJA 1K8XB 3CR7A 3KD3A 4P4GA 1Q7BA 4I6EA 5D5QA 4BMSA 1BHJA 4QDUA 1AKVA 1C0PA 3G0GA 5BN5A 4Z4GA 1U02A 2CJPA 2QZSA 4M88A 3AXTA 4UDNA 5IK2D 1ZH4A 2EBFX 4M49A 4CIDA 5CITA 2JPDA 2PUJA 4FBGA 5FADA 5BMVB 5JCOC 2CLHB 3H6KA 3EYWA 2Q21A 2Q0QA 1I7PA 4G4IA 4AJIA 4MS4B 5M29A 5JDCA 5MFPA 2OZEA 4QT0A 2Q6IA 2R85A 2BVNA 2D3WA 2GEDA 2VSYA 3EHDA 3M3PA 5E6RB 5TDHA 4H08A 1X7XA 4EWLA 1AK9A 3LU1A 4JLKA 4MVXA 4Q7QA 3VSAA 1P77A 3FCXA 4W63A 1RQ2A 4KAAA 3QW4B 2ECQA 4OBWA 4EF4A 1D2RA 4DCTA 5K7SA 2KLBA 3ZWWA 2QMYA 4D0RA 4ZEMA 1NE7A 3RYCA 2WUEA 1Y4AE 3PPVA 5CVVA 2I55A 2ZROA 5C3UA 1EZ1A 4PHGA 5FBKA 2DWPA 4WLUA 1Z5VA 4RAOA 2BGGA 1J2JA 3IV9A 4O4IF 5EWLB 2VYFA 5HF6A 1BH2A 4EGSA 3ZGXA 1E8MA 1GRCA 5I3ZA 1P7YA 2NO9A 2WRZA 1KJ8A 1V8DA 3H86A 3JQBC 4RJTA 1K3FA 3QELB 1KQNA 4PO8A 4B6QA 1RAAA 2GJAA 1FPMA 4KQFA 1YOVA 3GX1A 4CDMA 3SE7A 2C7VA 4IMJB 2RAPA 1UXHA 4I2VA 5EHZA 2YXBA 3MJVA 4J2HA 1OBFO 3T7KA 4RK5A 4B75A 3SXJA 2HIMA 2WF7A 5B1EA 3MRVA 2PGDA 1K86A 5CB4F 5IFLA 1UZAA 1L4YA 1FRNA 4RZ2A 2VDUE 3W90A 4CM9A 3MTEA 2O8BB 1J0AA 2GJ9A 2WJ4A 3ULKA 4WZ6A 4AN1A 4C03A 2V6IA 4NNPA 2R8OA 4MVJG 4P92A 3SBXA 1EM8A 3HJGA 1WVGA 4M46A 5BWNA 3LSYA 2IZZA 3TZEA 2AUTA 2CZCA 4JC8A 3T34A 3Q11A 3TEFA 1P8AA 3DP9A 4K9OA 2X2FA 1KZ1A 1GRQA 1L8LA 3CZ5A 1ZGJA 3ZI4A 2QJFA 3MAJA 4H6VA 5LFAA 2OC9A 1YOVB 2C4VA 3E7WA 4ERNA 1D9XA 2W4QA 2ZCJA 1NI4B 4WOBA 5DT2A 3MW8A 3KYBA 2FEAA 4QFBA 4B7ZA 2WSSD 2ZSUA 4R4JA 4REOA 3MD0A 4D41A 4JITA 4JDPA 2YICA 4DR6B 1KYQA 2KJQA 2SHKA 5FTNA 5CT6A 4I8XA 2FQYA 2PJDA 4JUFA 1QORA 3Q7TA 1LK0A 3T4XA 1EGVB 1F14A 5LCXA 4B34A 1SCBA 3CB4A 3V8VA 1YFJA 1A9PA 3B12A 2B25A 2H48A 3O1HB 1JJFA 4OIFA 5AJTA 3OQ6A 1VYTA 5BYBA 1YIOA 4XGIA 2I5PO 1JE0A 1T6BY 1F8GA 1U2TA 1JDPA 1WQ4A 4G0ZA 4N3AA 3UJ6A 1QE0A 2GRAA 4K9PA 4EVSA 1FP7A 2OGTA 3A04A 4CKZA 5JT1A 1T8YA 1VL8A 3UWSA 4MQBA 2VTDA 4EDFA 3U1BA 3F67A 4X65B 1K3TA 4LMPA 4A2CA 2W2LA 1U0OC 2UVPB 2AH5A 3LZ6A 4HRVA 1SCQA 2WYUA 3QLUC 4RXUA 5EIXA 3VR6A 2Y27A 4J90A 1I6KA 3ZNQA 1X8LA 1O5IA 4ZV9A 2XNKA 1B0UA 2X8AA 4RETA 1KOLA 2QD1A 1SXJA 1U0FA 2VAPA 1XAHA 3AEUB 2YWBA 3IEKA 1BSVA 3UJBA 1OX4A 3O3CA 3U5TA 1YRBA 3AV3A 1IN1A 2P3QA 4INJA 2IUUA 3RADC 3L0DA 4LFBB 1GLNA 4LDJA 1EUCA 1LV8A 2Q6TA 4KU4A 4AU1A 5A9SA 1W96A 1ZD9A 1ZH2A 2BP7A 3GVCA 3H5LA 4AULA 1OAOC 1A7AA 5BR1A 3GP3A 2CMKA 4N6NA 5CFOA 2AX3A 4M9QA 5T8KC 3DAPA 2QUZA 3GJQA 4AIIA 4DSZA 4MW7A 3ABZA 3L6CA 1RABA 2NOAA 3STHA 4AZTA 5DXFA 1RPZA 2HK8A 3L0PA 3KO8A 4WOPA 3T15A 8LDHA 4FLFA 4DQVA 3K53A 3ROGA 2EYQA 2EW2A 1TCUA 2JRCA 5HCNA 1DQPA 1ODIA 4D9NA 3N2EA 3JV7A 5JD5A 1DL5A 4Y2PA 4DLRA 4CLEA 2Z6VA 3ANTA 4I5EA 5DNYB 5DCLA 3CX8A 1VKRA 3CEJA 2WF8A 3RTGA 1CJBA 1QB8A 1QH1A 4IJUA 4PCAA 1RI2A 1JQBA 1FNMA 1K27A 1CJCA 1WXFA 1Y3HA 2YVQA 3BCSA 3G9XA 4J0IA 4NVRA 1WBBA 4GKKB 4MO2A 1R50A 2FE4A 4NU6A 3FCOA 3WLMA 1QCZA 3I58A 4DQLA 2CDRA 4MVJM 1CLUA 1ZSNA 2E4VA 3I6IA 4HJRA 4S24A 5ESDA 4P3KA 4EPYA 3T54A 4D43A 1EFHA 2PLAA 2E3JA 2GHIA 4TMZA 3TINA 1R15A 2IZ7A 4LMAA 3L1UA 1A96A 1RM5A 3HB9A 4OEHA 4V3BA 1HNWB 1V95A 4AF7A 3O8RA 3NUGA 1PR2A 4IPTA 4CDRA 3HXOA 3GPIA 3TBFA 3FYSA 4HVLA 5DTJA 4FFSA 1YZHA 2A5DA 2ZI7A 4R8KA 5ECYA 3PKZA 3QXJA 2G4VA 4JI4B 2BTEA 3VKUA 3EMBA 1U7UA 1L1FA 1W49A 4UCFA 1ADBA 2H31A 1WUJS 2IPLA 5C5DA 5E3JA 3I04M 5AUOB 2ERYA 2BM9A 4L4YA 3I2FA 4X9XA 4DSOA 1E3IA 1XU9A 4P80A 1ENZA 3MQFA 2E6UX 3QX3A 3U3JA 2I91A 2YMMA 3AB7A 3KCQA 1MLDA 1CUUA 2J85A 1HDYA 4L08A 4PAMA 2FUG1 5D5HA 3W1EA 4REQB 3F1KA 5B7NA 1UFVA 4RD0A 4DZTA 5F73A 4OFBA 5KJ6A 4J49A 2G9RA 1EI9A 1EFLA 2IH2A 1IEXA 1O94D 3P4UA 1DIAA 1RDFA 3JQCA 4LOAA 4X8LA 2CHUA 4LDQA 1GA1A 4MGHA 1JDSA 1V2HE 1QFJA 1CNMA 5LQMA 4AURA 1HWYA 1R4MA 1T29A 3R3VA 4QNMA 3HDJA 5GGYA 2O2HA 2X14A 3PTAA 1AY0A 1FQJA 1HQCA 3E5MA 1M5UA 1RRFA 4FHCA 3ITDA 4MPJA 3VI4B 1KFKB 2VRBA 1OFUA 3N1UA 2H16A 3DH0A 4BMOB 2G28A 2BWJA 3BCUA 3D5QA 1NIJA 4WERA 4D80A 2HFKA 2WP8J 5LA6A 1MT3A 1N6RA 3OCYA 4A2WA 4DMUB 4E5PA 2XR1A 3P4YA 4JFAA 4Y6OA 4DMKA 3QOXA 1VCNA 4ND1A 2HNKA 1YVDA 2H2FA 3GJ4A 3HI4A 5K0NA 2WFAA 3A1UA 3UJ3X 3WNQA 4CYMA 3OZWA 4YJFA 4ZGWA 3DZBA 2Z3VA 3UAVA 4MDEA 2IW1A 5KB3A 2YIMA 3CY6A 1G5RA 3BHIA 2VDWB 1A5AB 1ESZA 1YS2X 2KBFA 5KVSA 2Q6VA 2DFKB 3L6DA 3LL4A 4XB1A 5AW4A 1Z83A 3CM0A 1GSAA 3Q12A 2OXEA 4KX5A 1ZHHA 4LK2A 5EKTA 1R00A 1KOJA 3RJZA 4H3HB 1GVNB 4QXQA 5FOVA 5GTDA 1Z8FA 3CLUC 2YWCA 3O8CA 1R6XA 2BOVA 2CFCA 3JQQA 1YDWA 4ID3A 5JXGA 4LY6A 4LRXA 4QBIA 3DZDA 2E49A 3GVPA 1J1UA 2OM2A 4WZAB 4BQRA 1J8FA 3OE4A 2C2BA 1CUFA 1C7IA 4S1PA 3INRA 4Z2AA 1CB7A 4DR7B 1NW9B 1LRJA 1YT5A 2QMEA 3UK2A 4EY8A 2W2MA 2WSIA 3Q3JB 3DDUA 4M87A 2G08A 4JVNA 3DE3X 2EBUA 2WVHA 1ZJJA 2RK6A 2BFEB 4M21A 3EVEA 5K20A 2XOEA 4UD6A 3GHYA 5IJ9B 3WGYA 2OHOA 2ZI4A 3MNFA 4JC5A 1IVNA 2OFOA 4HDKA 2NZVG 5T3YA 2JFHA 3NEPX 5ALDA 2V8BA 3S68A 3UBMA 1XRQA 5AQEA 3GRCA 3A1TA 3LO8A 5EY5B 1SKQA 3L02A 3HDTA 4WUVA 3IKTA 2MYUA 4M8SA 2FZCA 3I8XA 4XQ9A 3H19A 2PSFA 1ORRA 3MINB 2OHGA 4IHJA 4U7TB 1WNFA 2DEUA 4J1TC 2A0XA 4MWOA 1H2XA 3W8FA 1LXCA 3CVJA 3L0CA 4MVJP 3BQMB 1ESDA 5B7GA 2QN9A 3GV0A 4GRDA 4C4OA 4WCFC 1LEHA 2VQ3A 4OP2A 1DCTA 4JOCA 4TMVA 1PCXA 3TUJC 4C7BA 2Y0CA 3JPYA 4R9RA 5LM3A 3DLPX 1XTIA 1M6WA 2LVBA 4FZJA 2FGJA 3QTBA 3DB1A 3OCWA 3QELA 1ZG3A 1S5PA 3ED5A 3OEED 2YHIB 3TRDA 1WB5A 2X0IA 4F8EA 3EFHA 3EGWA 4OKSA 2PHZA 4ISBA 2F2TA 2DRIA 1L3IA 1HC7A 3K4HA 1NVMB 4HNSA 4OLFA 3K0CA 1O95C 3KT0A 2J5XA 1U0HC 4FMDB 4FYVA 4Q48A 1E3TA 4MRMB 1DRUA 1ORWA 2WKWA 4ZXPA 4C6HA 5A0TA 3NLLA 1Q83A 1BYUA 1V1MA 3U80A 1AVTA 2CCJA 2W6NA 5HQJA 4F5EA 3SZ3A 2WU0A 3JZAA 1SMKA 4LOKA 2NO0A 2W43A 4HZUA 1PLJA 2Q5JA 2WE7A 4XA8A 4FDVA 2CJXA 5TB5A 1W6RA 4UTVA 3G7NA 3H0EA 3SSAA 2VQFB 2WIJA 4RPJA 4B3SB 1LX6A 3GBSA 1A5ZA 3BRWA 4AY5A 1IXKA 3V1TC 2A0KA 2IXFA 3IAS6 3PTZA 3X1KA 5JQWA 1JI3A 1SU8A 5DEOA 5E6SA 1BCSB 3PENA 5T67A 3DBHB 1QHGA 2ZRGA 5LMZA 3UOGA 1BXGB 1V0JA 5EJIA 3TLBA 4KBYA 4WY5A 4KWEA 5I7UA 3GT7A 4LKRA 5JJKA 2RAUA 1PN3A 1VHJA 2Q4BA 2QTBA 4MDYA 1A1SA 3OZ7A 3UO8B 1XQ1A 2GO7A 3WTBA 1P8JA 3FPCA 2JCBA 5AVKA 2RGYA 3GMIA 1C9NA 2H52A 3RAJA 5KTYA 4ZOQI 1P4GA 3I4FA 3KTAB 4L0QA 1XPJA 1J90A 2IHVA 1BS9A 2NM0A 2OCXA 2ON6A 1GSHA 1NXQA 1UK8A 2ZSHA 2ZBDA 3IUSA 4JBYA 5EIWA 1L7VC 2V9CA 2GZAA 3ASVA 4ALJA 4F4JA 4ZZIA 3UAXA 5CB6A 1C7QA 4W5WA 5DK6A 3B9BA 2RBGA 4DNPA 1JDBB 1PGQA 2XDQB 3H1TA 4C05A 4C7XA 3DBHA 4PYIA 3OPYA 5DI3B 3LRPA 1GFSA 3CE6A 1SZDA 1L7AA 4L22A 1RZRD 1HYGA 1IZYA 4D46A 1N8NA 4J91A 1ORTA 4IQ0A 4D9KA 4QUEA 3ZY5A 3JPWA 4L9RA 3VBEA 5H83A 3EN0A 1Y6FA 4K2HA 2YV1A 3GLIA 1IY9A 4GPIB 2R60A 4CEHB 3U7IA 1S4QA 2TMGA 2FW0A 1O97C 2C31A 4ZI7A 2JLXA 2XAUA 3JTEA 5AHWA 5IYZA 2MSKA 3ONDA 5H3HA 4HO1X 5BQ3A 3HUFA 3LHSA 4HUJA 2FN7A 3KQSA 2ZITA 1AXEA 3KS9A 1QHSA 2B0CA 4P58A 3LBIA 2A94A 2H4XA 2QRZA 2PKQP 1UK7A 3AJAA 3HVUA 4WN9B 4YV0A 4YNBA 4RQUA 1S2NA 4PNHA 1U1FA 2O07A 3A8TA 2C0QA 2I0FA 2J6IA 1FTNA 2JRLA 1PSWA 1YJQA 1FDVA 3PC8A 1H93A 1H23A 2FZ5A 2VPWA 3CV3A 1RAHA 1M10A 1K88A 1SVKA 2JFPA 4HYQA 4RZ3A 4HN2A 5JH7A 3G0HA 4QXRA 3BL8A 1HLGA 3ELDA 3H4TA 3N59A 5HFAA 1RWXA 2QVCA 3E1GA 3EAFA 4ODIA 3TE7A 3CSDA 4RTKA 5AOBA 1WB6A 3VQTA 5JVDF 5FPHA 1JA9A 4OB8A 5DIFA 2P41A 1TEVA 4DLSA 5IDXA 3WRYA 1TCVA 4GNKA 1JIJA 3SG0A 4KMRA 5C2JB 4OM8A 1VHLA 2Q1UA 4C3UA 4K5QA 4A6PA 3CU5A 3QG1A 3JQ8B 3BXZA 4LJSA 3H1FA 4RUKA 1TPYA 3V9PA 2FSPA 1Q2UA 2E2WA 5H70A 4E3ZA 5H8WA 4KIWA 1PT8A 4L3VA 2BI4A 3PS9A 3C48A 1R4NB 5CNIA 1OZFA 3AERA 3O4IA 4W6ZA 1B0ZA 4JJ8A 4ESHA 4DDWA 3SQWA 3V3TA 1K68A 4D74A 3KXPA 2WAYA 4N0DA 1X9IA 3B78A 3KJGA 3G88A 3A4NA 4FUTA 4BB9A 3AUYA 2WD9A 4J4TA 4BHTA 1QG4A 3GPCA 3GH1A 2Q50A 5LDDC 3N9IA 1NR7A 3OT5A 4RPKA 5BNZA 3F2VA 3LIIA 3NHFA 5DOZA 2C4UA 4IF6A 2BBOA 1ZK4A 2CUZA 4BNTA 2WP0A 2QMUA 3EVNA 2QR3A 3H9BA 5LQDA 2C9OA 2CXNA 5K05A 1GNVA 3UFBA 1ZHOA 1RJ9B 3Q85A 3B7WA 1XNQB 2VNAA 5IWCA 2HU8A 2B6HA 1T2UA 4RC9A 3E3NA 1ZINA 3AWIA 4PGGA 5IT5A 3ZJ5A 3ZWYA 3LC1O 1KAOA 2WWTA 1KFEB 3BDIA 3BJRA 4EH1A 2ZI9A 2FG6C 1KBQA 2CCGA 3THOA 4D81A 2W37A 1M2WA 4X94A 3K70D 1K4YA 5EJMA 2Z2YA 4BO5A 2CT8A 1TZKA 5BV8A 1ID1A 4J1QA 1HTWA 3LT2A 3V4OA 4UNIA 4W5NA 1WF3A 2IDZA 3INTA 2YZMA 3TDKA 4EYEA 2X9LA 4R1NA 2XUDA 2DERA 4PGAA 3ZCVA 2BONA 4FSDA 4KO4S 2P7HA 4MUNA 3KSAC 4NHEA 3BA6A 1M6HA 4O4HF 4JGIA 3RIMA 4PS0A 2XE6A 2D7CA 4URZR 1NLMA 1EH5A 3W9YA 4F4DA 4NDZA 1D2GA 1JZSA 2IGBA 4L8WB 1OREA 2O8CA 1E0JA 2XGOA 4OHOA 4X84A 4RTPA 1ZN2A 1YZYA 2P9JA 3D81A 5G2OA 1GPH1 2RIRA 4EJFA 1C2TA 4XJVA 4HEHA 3ER8A 2H18A 1CBUA 3D9QX 3OQJA 4NCAA 2GM3A 1I0LA 2YV5A 1SURA 2ZDHA 4BO6A 2WYHA 5IDWA 5ITVA 3MZ0A 1EVIA 2W6MA 5K0BA 1TF7A 4MW6A 3QWIA 1DCMA 3FYCA 4K28A 4G9EA 2R25B 2BY4A 2DFPA 3FBTA 3BRQA 3IIKA 1OXUA 3FOBA 4RVHA 4ITRC 1K8ZB 4NU8X 2V65A 3OPYB 1OWLA 3QH4A 4H35A 5AUPB 3QU7A 5T57A 2B30A 3VNSA 3NCTA 4UEOA 1ESNA 3GT0A 2BI7A 2EGGA 1C9JA 4Q6WA 7ADHA 2O8CB 5HUQA 5BVGB 3OJOA 1DVRA 1CNEA 2JAUA 4CM9D 2BBTA 4DMRA 1OXMA 3GQVA 5CYFA 1AIPA 3NBFA 5E6UA 1O94A 4U2DA 3U0BA 1YFZA 4AG3A 4EPVA 1A50B 1T9ZA 4B74A 3IILA 3NETA 2WHYA 1G7TA 1AZSC 2H29A 3DT6A 3HFGA 5TLSA 1E2LA 2Z1NA 4C14A 1TAHA 9GPBA 4A8TA 5EXDA 4L28A 1QF7A 3GGDA 4OMFG 4P4LA 5KKCA 4NJMB 1ML3A 1Y80A 5IN4A 2VBFA 1FLDA 3JRXA 5MGBA 1ZH6A 4GE3A 4UD2A 2I6TA 5AVSA 4FOSA 5ERXA 2RD2A 1PJSA 1POWA 2F9LA 2OGWA 2VRCA 1RYMA 3PNQA 4RL6A 5JE8A 1VLHA 5ICFA 4XKJA 3SM3A 1X38A 1Z7YA 2C82A 2JGIA 2Q5OA 2QM0A 4IX1A 3QPAA 2A3NA 1F51E 3CBGA 1QNLA 2VNHA 1HDZA 2HF8A 2R84A 1YASA 2FOIA 1RACA 2FI1A 2A7QA 1G17A 4RMNA 4R16A 2XNCA 4FPXA 2J9GA 5JNRA 1U5BA 2GILA 3JATB 5K8LA 1XQYA 1H8HD 2AGVA 4FP9A 2SNIE 1CVLA 1A5TA 2Y9MB 4CKWA 3FWZA 5DM4A 5A9TA 4GM4A 4B3RB 1LLDA 1NQAO 1Z33A 1IY2A 1LQTA 1RQLA 1WO8A 1BE6A 1NN0A 2AFIB 3B36A 4NJMA 3RB8A 1EXWA 3VUEA 2FRDA 4G0WA 5EESA 4QGFA 1HMYA 1CQJA 5T4HA 1P1HA 3WZ2A 3EUWA 2H5EA 2QAGA 3FJ1A 5F77A 2ID9A 1AOXA 5A4AA 1N6LA 4BQNA 1KPIA 3BQNB 4Z9AA 3PGKA 3L7KA 3MT8A 5CR9A 2PR2A 1B6TA 3WLOA 4XEHA 5FWNA 3V33A 3I5AA 2FN4A 1X8JA 1U4SA 4P8RA 1NVAA 1MRSA 2GTPA 3DZHA 4PVDA 5IKXA 4XXHA 1XV5A 1XNHA 2YWGA 2VQSA 2A9KA 1FL9A 3UK0A 1MJ5A 2JIZA 3S2SA 1JL3A 1T1EA 1U6JA 4ZVRA 1D04A 3I42A 4ZJYA 3CO0S 1RI4A 3EHEA 1P2TA 2IPNA 4UFNA 4B5LA 4TROA 5LWHA 3T5AA 5EOVA 5ALLA 1JHVA 4YLYA 1MOSA 4WCFB 5KVVA 5LLSA 4EB6B 4FEYA 2YYSA 4BBPA 1SBTA 4YP9A 4C4AA 3S5UA 5JROA 3AGQA 3NM4A 1UZMA 2ZYDA 3EG9B 1YIDA 2J3LA 3H1AA 1AKYA 3ER9A 2B2NA 3STXA 5JXWA 4Y9SA 1NQ5A 4DRYA 2XTJA 1U9YA 1RHRA 4D0GA 1L4NA 1MB9A 3HG7A 2XH8A 1DI0A 2X2OA 5AJUA 5EGSA 3ESYA 4PQYA 3S5JA 4IINA 4TX1A 3X1ZA 4J6EA 5M34A 1QIDA 2QX4A 2XYQA 2ZB7A 5DX0A 5HX7A 4RKFA 3W8EA 3TQSA 1ZQ1A 2Q41A 3JARA 2AEEA 1ECPA 1P1FA 1ZCJA 1SQ0A 2NO7A 1ZN8A 5DNEA 1P44A 1TQDA 3TAXA 1WPRA 3INYA 1TVEA 2X5KO 4LY0A 1O6BA 1H69A 4XR4A 1B2RA 4ZKEA 2P4UA 1TZMA 2Q29A 2VNIA 1DTWA 1XFDA 4QUBA 5JLAA 3UMBA 3TLYA 2VA8A 1KQFA 4S12A 1A98A 1GPMA 4ZO6A 4FDMA 2P8SA 4E46A 3WGTA 2C84A 3PRHA 4MS1B 3RTCA 3ZGYA 2Q8NA 2JAXA 5LIRA 4WDRA 3BUSA 3GN1A 4Y2GA 1HL3A 2EBWA 3CW8X 1CUJA 1YCHA 4IZOA 5KNDD 5LLDA 3U7QA 4GDFA 4MIYA 2OK8A 4NBKA 3RJMA 1X39A 2G7MC 2O8EB 4HCJA 1F1JA 2C03A 4TT3A 4YXWA 3QXHA 2ODTX 3STTA 3K6SA 2EOAA 4C22A 5IAAA 2QTLA 4LN1A 1ZNQO 4IYRA 4NL4H 3C4JA 3W2EA 4BVLA 1PF7E 5JZSA 5J2TA 4XQEA 2JH3A 4DY6A 4WN9A 4MDHA 2ORYA 4WZZA 1HRKA 3DXYA 2AOTB 2GSWA 4J3FA 5FOXA 1HT1E 4CF3A 4D97A 1NF2A 3P9ZA 3KV1A 2NZXA 2L69A 3MBIA 4OYLA 3UGQA 1XZAA 1JHOA 3BA1A 2G80A 3UF0A 4HAYA 1NJ1A 1Q21A 5AYVA 4JXZA 3UA4A 1N5LA 1BS1A 1Y4SA 2WF6A 3ANMA 3MYYA 2DPMA 1R0WA 2QLTA 1N8KA 2WDZA 4ND5A 3VYTB 4JNKA 4L50A 4A1OA 3BAFA 1OAAA 3HCNA 1JQJC 4UCWA 3RH0A 4KH1A 4CBVA 1BOFA 2I8AA 2FUCA 5ITZB 2I87A 4O2AA 4RESA 1W47A 4MUAA 1V11B 4TQ9A 5CTAA 4O4JA 1SVNA 5IU6A 2VG8A 1GQ2A 4ALIA 1I6LA 5JMWA 3B6ZA 3DMNA 1USKA 4D3SA 1T0IA 1JKIA 4M37A 5D3MA 2VHQA 5CPBA 3DWIA 5AK6A 1DJOA 3O8QA 4MVJF 4LJ4A 5ALSA 4L4UA 4IIHA 1DEAA 1JQ3A 1UPUA 1SN7A 2P7IA 1C0IA 1I3LA 5EXEA 1T91A 3WXBA 2CNWD 3WFZA 5AW1A 2P6MA 3HDHA 1PR4A 1GUZA 5GQSA 2IKQA 2HWKA 3KBBA 1C50A 3MWKA 3UB2A 2AMYA 1YAJA 3LA8A 4TZKA 4M0EA 3ROTA 5A06A 4MW2A 4LXYA 1ZRHA 3W1WA 3IUNA 2GOYA 2COUA 5BNTA 3G9TA 2WSSA 1RWPA 3O1LA 4WBNB 2X6QA 1S2OA 2ZWIA 1YQUA 5AW5A 2JBWA 2ZSDA 2J0VA 3UHPA 1WUIS 5CM8B 5ICCA 2BKXA 5A4DA 5KQSA 2BEWA 4B2PA 2ORED 4TN1A 4RDHA 5ADUS 1YAHA 1AJEA 2NYUA 1QVAA 4Y9TA 3E70C 4OL0A 3N8IA 5TX7A 2BZSA 4LZJA 3HGTA 3HC7A 4GVPA 3QHQA 3R9KA 5I3CA 1GR0A 4N9WA 4AAYA 4ZVQA 5CA0B 5E4JA 4MA0A 3IA2A 4EKNB 3AUKA 3AVQA 1L1RA 2QLJA 3EXAA 4YJDA 1K5DA 3RJ9A 2C4HA 3I9FA 5IM5A 3T9DA 3SQOA 3TEJA 5JY1A 4RJLA 5TQ2B 2A67A 4W1QA 1G3IA 3J7TA 3NO4A 2KX7A 2JASA 1C1DB 1EXMA 2A5YB 4MINA 4EMUA 4L1KA 4CM8A 3K0FB 3IDQA 3V3KA 3D02A 1N5OX 3OIGA 2VH2A 1KAEA 4P3NA 4AD8A 2Z0MA 2G07A 2Y1KA 4ZRMA 2ORWA 3HN6A 3WGGA 3CZ4A 5AVQA 1MP0A 2WM8A 4TRRA 1MA0A 1Q3KA 5NULA 3FWKA 1AK1A 1J0EA 1W0JA 2H06A 1XMVA 2HBQA 4HK4A 2JGMA 4X20B 3EIXA 4NATA 1CDOA 2AG6A 2B35A 4UQOA 2DUJA 5IVIA 1Z7WA 3AOGA 4A0QA 4U02A 5AM4A 3SLKA 1HPLA 3R3YA 3ZTTA 2UUBB 5EJEA 1H22A 4BQIA 1KGSA 4KPGA 1TCBA 1YHYA 1E8NA 2JFNA 2VT2A 3HYRA 4C88A 5C52B 3MLAA 1NBMD 3UKOA 3VR5D 4LSMA 1CR6A 3FY4A 3LFHA 1C1DA 3PXDA 4WFIA 1CVIA 2XKBA 4IMIB 3S0JA 5K8UA 2PUEA 4L6AA 1ZISA 3TLZA 1G1AA 4LJAA 4XD7D 1T5LA 4WINA 1T36B 3PDWA 4BNIA 2CBZA 2Q4OA 4NAHA 4RD4A 4MEJA 2VWHA 3N0VA 3UH1A 2RE8A 1HR0B 4WK4B 4Q1VA 1IL0A 4MUFA 2PUAA 1YC5A 1NJ8A 3VNBA 4B32A 4DY4A 1WD5A 2HMUA 1X42A 4KMOA 4EJSA 1YS1X 3PXUA 5MN5A 1ISJA 1DARA 2R6HA 1G98A 2ABWA 4J2TA 2X9QA 2Q9BA 4QYTA 4Z0HO 3A05A 4HQLA 5CYOA 1JSXA 1XQ9A 5FNZA 2HYDA 2PV0A 1JZTA 1M0SA 2IELA 1YQXA 1UKBA 3FCYA 4A0HA 3EIWA 2C9BA 3LAWA 4X6YA 3T3IA 4EHHA 4ZCSA 3C85A 1XTPA 3H9QA 4YIKA 2VL7A 3MJDA 4HAOA 5L7WA 2O20A 5J3JA 3C7KA 1K8RA 3R76A 3IKVA 4GOKA 4M1KA 1N6IA 4NZNA 4Q19A 3GP8A 4OAQA 1L3BA 1PNTA 4HLNA 4CCSA 3O4VA 2H4JA 5JJBA 1TX4B 3LHIA 2XZPA 2BHNA 3H97A 3LW7A 3ZDXB 2BKUA 3GDOA 1FFWA 4M1OA 4PRLA 3DWEX 4CLOA 1GCUA 3JASB 4Y0VA 2CYBA 1I3OA 3TK1A 1L5HB 4L5AA 5KC9A 1BHQ1 2HOQA 2QMQA 3OCVA 1QK3A 1J99A 2QJTA 2D6FA 3PCTA 3U16A 3LBHA 3Q0EA 4Z9YA 2BFBA 3L4JA 1UEIA 4E32A 3OQBA 3TOCA 2E87A 3VZQA 3ZDBA 3HWRA 1T1JA 5CP8A 1IRIA 3MUNA 4IGEA 3RYHA 1QIFA 3DQQA 3ZH9B 3FPFA 3EPJA 5AICA 1ZP6A 1ZS9A 4Y67A 3UZUA 2WJGA 3EIOA 1RTKA 4JBHA 4MMYB 5FHQA 3R6DA 2X7HA 1NNI1 2CDNA 5ALRA 1O54A 3QI2A 4RO0A 4ZZ1A 4FFDA 2HMWA 3AEKB 5KNLA 4WD3A 3WBKA 3QXXA 3KVOA 3PLAE 2QTNA 5E2IA 3IDAA 2Z3WA 1B15A 2JJ2D 1W1UA 4WOKA 4YY3B 4ZMRA 4UBLA 4ZC1A 4PC6A 2PGLA 2PYZA 1OXSC 4PPQA 4B33A 2IIVA 2COKA 1LLUA 3KU4A 5I4BA 1RPAA 1CIJA 1R12A 1ZH8A 2QX9A 3I6YA 5ARCA 1X0VA 2C54A 1TF2A 4GMDA 4UC0A 1FIUA 5CAEB 2GBFA 8MHTA 3C5VA 2JGLA 1A4UA 4WJZA 1GZ5A 2O8DA 2DPLA 3DMHA 4F6RB 3H5VA 3TSOA 1GV1A 2HD4A 2JGFA 3WGKA 2Q3HA 2GKGA 3PEEA 3NWJA 5TJ9A 4BUCA 5DMHA 3EUFA 2RHCA 3D6MA 2JFQA 2H2IA 4YLEA 4D8YA 1IH8A 2J5RA 3AF5A 1IHDA 2GVNA 4OJYA 2FW7A 3T7EA 3ZWBA 3AIIA 5KVCA 4ZVUA 1KJJA 2WUWE 5FAKA 4CTKA 3DD1A 2Q3FA 4CI9A 4G9BA 4M55A 4UMVA 3AFGA 3KJHA 2YZ7A 4F9GA 1GZVA 1UKEA 1YVRA 2BFOA 3HA3A 1DIRA 4CZ2A 4BRUA 3LX5A 4KN8A 1WDTA 3OPYI 1I6WA 1QGZA 3GGPA 4QC2A 2EAUA 1Z5GA 3HKEA 1TLLA 3ILXA 3OQIA 3G59A 3WWOA 5LZ2A 1KMMA 1PV1A 1USVA 2ZB2A 4KN6A 5C1IA 3RVKA 1KI8A 3CF2A 2NZ8A 4NE9A 4EEKA 4KREA 1GUAA 1SBQA 3KKQA 4HJXA 3ERCA 3AIOA 4MI9A 4M9RA 1PGNA 3JVVA 4JMPA 4NCXA 4NOJA 4LZLA 4AJOA 1T0UA 2FVXA 3HXQA 4X66B 2P91A 3P2IA 3QKWA 1QBGA 2P77A 3E81A 1TAUA 2H63A 2QUHA 2WWGA 2XIJA 2PZ8A 4ZVTA 4ND2A 1URPA 4KW7A 2HT1A 5EXPA 1YJ5A 2GQ0A 3NWBA 4UPDA 1IBCA 1M2KA 4A3SA 1NZJA 4LBWA 4F3CA 2XWSA 2NSYA 2D0OB 3EGVA 1I5OA 4E5NA 1BE8A 1E62A 1NJ6A 3IURA 5AR1A 2ZJBA 4KXXA 2IOYA 4I99A 5T41A 1JPVA 3NTVA 4BL5A 2DHQA 3L1HA 5E95A 3IV7A 4QDOA 1F8XA 3GARA 2YN0A 1D4FA 3MPOA 4YJ3B 1N3YA 2KHZA 3AR2A 3IAM1 1Q19A 3NJ8A 4LBZA 1SKYE 1HETA 3TKAA 4BWYA 1CLEA 1NRXA 4J0HA 4PSKA 2GCIA 1U8AA 1PVOA 1P33A 4MVCA 3OQNA 5JZMA 3PFCA 3AVUA 3MTGA 3FDXA 2WWFA 4BVBA 3VPBA 4A82A 1R6AA 1E6KA 2OGZA 2PS1A 1L7MA 4E33A 1PNOA 1E4YA 1UP6A 6ABPA 1A3CA 1PFKA 4ZO7A 1WUKS 1QFMA 4CKEB 5DM0A 5HF9A 3A25A 1UJ5A 1NYLA 1X86B 2GD6A 3DEKA 5DYWA 4DV1B 2EF0A 1US8A 3K35A 4H60A 4DG9A 4EFKA 2CLIB 2FW9A 3EVCA 3ML1A 4BV8A 1EK2A 4KNVA 3IUQA 4NPHA 1W2GA 1NGSA 3D7MA 5DBHX 5DXJA 2F1OA 2H9YA 3VYRB 4EUFA 1GTG1 1SQFA 1XD2B 1Y8ZA 1IZ8A 4H7JA 3BVPA 3IP3A 4MRAA 4QO8A 2X8WA 2R7AA 1V35A 3DBIA 3OLWA 2VJAA 5HCIA 2XMRA 4PCLA 1AG9A 1BAPA 3BC1A 4EMTA 5K5EA 3K09C 4I9UA 3ENWA 1PJ8A 1UPXA 3F5SA 1H2ZA 4II7A 1HBJA 1HDEA 4MQLA 1NMEA 2C1XA 4W5HA 3DTYA 1S2GA 4BQFA 1GLGA 2GLTA 2W6JA 4D3XA 4BKPA 2R1TA 4CR6A 3SXUB 3BEDA 2BMJA 2EKPA 1KZ6A 1R6DA 2WAXA 3DNPA 1MGOA 4G1MB 1U8YA 4HYEA 2I22A 4XASA 1H85A 4ZAVA 2HR1A 1HX7A 1XJWA 5ECDA 2BC9A 3ZUGA 4EK9A 3OEHA 4H1VA 3TLEA 5CLHA 3QVTA 2MMGA 4OK5A 1KYVA 4NXMB 3DUWA 3F6SA 3H2SA 4GYJA 3FHCB 3A9RA 4LEIA 2EBHX 2HYIC 3E8SA 1ZD4A 3UMYA 3OZSA 3AR9A 4NYMQ 5ARDA 3WV5A 1IM5A 4GS5A 4K6FA 3KYCB 5ALMA 5GJCA 3VOBA 4JAVC 4LZPA 3WRXC 2JHCA 1W48A 3DBLA 4HRYA 3EISA 1CE8A 4C0SA 4UW9A 3FZQA 3IHTA 2UZIR 3H4VA 4G9GA 2VZ0A 1UMCB 4XJSA 3EGDB 2WEKA 3L8YA 4QQNA 4TUYF 1GL6A 2W2KB 3VO8A 3VAYA 3W7BA 5JHHB 2VT7A 4S0XA 4UATA 1V4NA 4XGKA 1QG0A 4BMCA 1FFYA 4KX3A 1H3FA 1U5CA 3KFVA 4H77A 1AGYA 3S1AA 2QE6A 3N87A 2D2EA 3DA8A 4IEEA 1ZOSA 4DLUA 3HJRA 4PSCA 4KLAA 5IBCA 3D4IA 4ZYYA 2ZLBA 4LCEA 3OUZA 4NCJA 4JYCA 1JP7A 4RGQA 1ORHA 4D4IA 4CL0A 3DEIA 1IUKA 1Q3HA 4Y2YA 2Y4NA 1G21A 1ICIA 5B4VA 3OKPA 2VSXA 5GOZA 2AXNA 2RJOA 2BCEA 2R4QA 4JK3A 3VPHA 3LKVA 2ZIXB 4RDCA 3CRW1 1LLQA 1JA0A 2WDPA 3EF0A 1TM4E 3LLSA 2AOUA 4B80A 4QWWA 4BKUA 3UC5A 4YRCA 1N3IA 4AECA 2XWJI 4ARUA 1WMSA 2CBXA 4L4SA 2QJWA 4CQMB 3A6EA 3I62A 4EG4A 3EVZA 2MWMA 1R6TA 1V8BA 2Z56A 4OKNA 2BT4A 3NHYA 3A3NA 1DC7A 5BOVA 2MMCA 1ULHA 2ZRLA 2YUTA 3LLMA 1IAQA 4NIMA 3VU3A 2Z8XA 4V0KA 1HZZA 2X5XA 4HFRA 4YP0A 5C7OO 4OQYA 2YVKA 3WDLA 1Z0DA 4BBZA 3N0RA 1RS0A 1JAHA 2IW3A 1SCNE 4MROA 3SX4A 2BHSA 4OB6A 4BLSA 4C4TA 4DWVA 1G5TA 2JHFA 1N4AA 2HGZA 1NX9A 4W8GA 5IH7A 2UUCB 2NPOA 4RX1A 4C87A 4PV7A 2J9FB 2X0FA 2BEUA 3I9V1 2BR3A 3ZIDA 3AVWA 1B26A 3B38A 1WCV1 4U8GA 4DV2B 2X0KA 3BHJA 2I62A 4ZIRB 4UMFA 3OQMA 3L6UA 2ZTUA 4QTYA 4RZIA 4P93A 6REQB 1TCAA 3CVVA 4FT2A 2DPHA 1KKMA 3HI6A 2P30A 1P2FA 1PWXA 1RI5A 4CT5A 5ICSA 4MV5A 5AUNB 3CRMA 3WNCA 4FUQA 4DSAA 2GTHA 1NW8A 3K70B 1SCDA 5KX5B 5C8ZA 2RBEA 1UKYA 2B3DA 2JEYA 1ZNYA 4G07A 3X2SA 5ELXA 1QKIA 2K6GA 1V43A 1ZK1A 2QGZA 3EEIA 2LCQA 1JIXA 3GLHA 1CJVC 1N36B 2GWHA 3TTYA 4R1QA 4PHFA 3ZDYB 1C4OA 1YWGO 1MH9A 4V1CB 1H6AA 4WCVA 5JVDA 3ZWXA 3WOHA 4JCOA 4OA5A 4LSGA 3I73A 5K4GA 3ZDFA 2XCRB 5HJEA 4O02B 2X3FA 1YV9A 3FDZB 4UOQA 3U3XA 1PWZA 3RREA 2GCPA 3OKAA 4TLEA 3KR2A 4TV8B 1Y9JA 2BYTA 2C8KA 1EFUA 3VPGA 1A4RA 2WWIA 4ZOLB 2DQKA 1G8AA 4FGJA 5T6MA 3PCRB 5JCXA 2A2ZA 1VQ1A 2WMDA 4BDTA 2VPTA 7AT1A 1N5KA 1ZL2A 4ZO4A 4QDKA 1BWPA 4PLPA 5EJ5A 3ZR4B 4AJNA 3TL2A 1FRQA 3VO9A 4E4RA 4D8TA 2NMVA 1V8ZA 3F90A 3KAKA 3KVYA 2N46A 4BMDA 3CG4A 4N7JA 1K6IA 3SN6A 1KI2A 3T1NA 1TPZA 1G64A 1LVUA 2E4UA 3UV7A 4KLZA 3RRBA 4EHAA 4BNNA 4LVCA 1AZTA 4PU0A 4O59O 4QYIB 4YCLA 3SS8A 4L5CA 5B58T 2A8YA 1A9YA 1B42A 1DRVA 4OH7A 4P82A 3DD5A 1I3MA 3GA5A 3NIFB 3EZNA 2JHAA 3QFHA 3HR4A 1L6RA 3LWNA 3R77A 2JL1A 2NUTB 2B6NA 3NTRA 4FR5A 1GPJA 4JEUA 4X1IA 3VR5H 2P4EA 1NC1A 2P2YA 3DKPA 4HGZA 2PX8A 4C5CA 3UWDA 2ANCA 3GLKA 1JG4A 3GAZA 4FE3A 5EUBA 3MPUA 5G40A 3CZPA 1TVKA 2QLLA 4EHIA 2IYOA 3MSCA 2WQ7A 5LP6C 4NLLA 2YCLA 4WE3A 3A9VA 5HRCA 1GNRA 2PLFA 2XDWA 4EY4A 2WR8A 2JD1A 4DUZB 3U39A 3ILVA 1IG3A 3OIWA 3L18A 4KZPA 1TT7A 1YU9A 2LR0A 4X90A 3AJ8A 1JEAA 4X62B 3AR7A 1OI4A 3F8WA 3JQAB 4LA4A 3G1TA 2P4QA 3ACBA 4FS3A 4OMUA 4R5MA 1YQQA 4YRFA 4A8JB 4RWZA 1NQWA 2BRUC 2WHEA 2QOEA 3BD9A 3TFOA 3DHVA 3PHIA 4TS9A 2ZIAA 3T9FA 5J2UB 4CNQA 4EGJA 1J00A 1K0FA 3OECA 1E2IA 5CT8A 4OHVA 1Y7IA 3OX3A 5ER6A 2QVZX 5CFPA 4OQDA 5DTQA 1UKZA 1HI9A 1Z12A 5HK9A 1TVKB 2WA1A 1QRTA 1HORA 4MB6A 4Z3OA 1Z4IA 2H8KA 1MAAA 3BSSA 1PVVA 5EZQA 4C7OB 2YTZA 3CR3C 4PPFA 1D1TA 1OTYA 3C7TA 5GY7A 3DG9A 2ZBEA 4AT1A 4ZGBA 3W5CA 3BMNB 4J7CA 1B74A 2BSXA 3L05A 5IAEA 3KPJA 5B1DA 3WYAA 2V7GA 3PFNA 4M7OA 4F5DA 3VTAA 1C1HA 2B20A 4FEGA 2QQ5A 3L1KA 5SYAA 4LHXA 4AZ3B 4L5YA 3VAZA 4MI1A 4GP7A 5AK3A 2JVKA 2ILVA 1XP8A 1XQVA 2FMFA 4XI9A 1TU4A 4L57A 5ISMA 3ND8A 2YH2A 3MEQA 2MINB 2IOQA 3D8BA 1NM5C 3SR0A 4NHOA 4B4DA 10MHA 2IE0A 2VJCA 3JWJA 4MAFA 3RARA 5EXTA 3BILA 2Q46A 4P36A 3O75A 4JWKA 3WQRA 3SF0A 3TO5A 3FJYA 3AVVA 1P7CA 2YBEA 5DM70 4BGVA 1G5QA 1C3LA 4UU0A 4HBZA 4UUBA 3AZQA 2IU0A 4CU5A 5ALZA 3P9IA 4FWBA 3D3WB 3ZI7A 3L3BA 1FBNA 4JT4A 5CBKA 3KUUA 4G23A 3L40A 4G37A 1EWQA 1E4EA 3GEBA 5B2ZA 3T61A 5JSKA 1HE2A 1UMBB 4GE0A 1DG3A 4Q1EA 4YRGA 1NPTO 1R4ZA 2NZWA 2XVZA 2YW2A 3S44A 3AKEA 2PRSA 1QZZA 2C3OA 5U9CA 1SOUA 1SXJB 1XRJA 3O2SB 4I5FA 1K5PA 2OR3A 2P6NA 3R7WB 1JAZA 2CB0A 2ETVA 4QO7A 3L04A 5F3RA 3BXGA 3RFCA 4RTQA 4XUEA 3ZBPA 4Z4QA 4K2AA 5JIBA 3WLRA 5CGQB 3OQ1A 1IE3A 1WW8A 4EI8A 5DCWA 3ENQA 4ZOBA 4X7MA 1MJNA 3I28A 3TIGA 2JLUA 4OJQA 3HSSA 4MIEA 2G77B 1JXAA 2VHTA 4NBLA 2HQOA 1GG8A 4R3UC 4IIBA 1Z0IA 3PKJA 2F43B 4A2QA 3ES9A 4GZLA 4MJLA 1VBFA 1EX6A 4WBSA 3T12A 3OEWA 1HMPA 4GOLD 4YTEA 3AF6A 4KFCA 2OZLB 3VVMA 5I47A 2ZYSA 3KSBC 1E4EB 4ZEXA 1MW9X 4G67A 4C6TB 4HAUA 1XZEA 5FV7A 3ZEIA 2QQFA 5EWLA 1ZIXA 2GJ8A 1XEAA 3OVMA 4JWTA 4K3VA 4PG8A 2HSWA 2R8RA 1A7JA 1RRPA 4KKVA 4A1FA 2BKAA 3NS7A 2WBLC 2DHDA 3E3AA 3TSCA 3KYDA 3REOA 4KYVA 4IHQA 5TXGA 3LECA 2PVPA 1VKOA 4R83A 1TECE 1Z13A 3VVLA 5HMMA 2W2NA 4UTOA 1T0HB 3Q3HA 4MYCA 2VDLB 1KDZA 1PTJC 3NYIA 5DHQA 1KVRA 2PFKA 5LA6F 2WUDA 4TMXA 5CDTA 5GZ6A 4E4TA 2YMPA 2ZFUA 3K0AA 4GI7A 1E9RA 3OJCA 1FS5A 1I7LA 1REQA 2BAGA 3CLTC 3AHHA 4LS3A 5DZSA 3QBTA 1ZJWA 4PZEA 2W42A 1POXA 4LJ9A 1O03A 1YS4A 2JA1A 3A6JA 1H1LA 1J6UA 1M2HA 3L8FA 1XU4A 3QU9A 4GYKA 1XFAA 1BDBA 4U6QA 4TKZA 3S6JA 4QGHA 1P1CA 5CFQA 3GDHA 2H1LA 2NO1A 3LWDA 2RB5A 3V34A 5AVWA 3LCRA 1KEKA 1GQQA 1U1DA 4LQDA 3Q6IA 5GP1A 3RSZA 1GPKA 4U7PB 3W6OA 3OU7A 4ZI3A 1F38A 1O87A 2GZRA 3E9EA 2QP4A 2I76A 3Q9LA 1PK8A 1NP6A 3RS5A 3G82C 2PM8A 2WSMA 2TMYA 3OLYA 5DBGA 4G4SO 4R1SA 3H2BA 3I1JA 4J0CA 3NAZA 1T9GR 4U9HS 4I4TF 3ZY2A 5CB4A 3HA2A 1VP3A 4X7BA 4OJTA 5I48A 3CUWA 3PNMA 4YT4A 1KBZA 2AXQA 1Y1KE 2VSNA 3OURA 4FE4A 2PNJA 4DIKA 2BFDB 3D4OA 3WMWA 1GAQA 3VVBA 3Q72A 1EBBA 1L7XA 1UDBA 3U44B 3I32A 5JSFA 3ZJ4A 3W2HA 1UFKA 2I4RA 2PUVA 3O6VA 5F33A 5A3SA 2C7PA 1RYBA 2E18A 2H7VA 2ZWPA 3M0EA 1GDTA 1X7ZB 3DE1X 5C4MA 4GL2A 3RHSA 3THYB 5FA6A 2XX3A 2W98A 4JVMA 1HSZA 3SKVA 3WLJA 2IHYA 3EVBA 1M8KA 1CB0A 2DFLA 4AWXA 3HXMA 1P5HA 2EEPA 2VDOB 3PX2A 4LECA 4WXRA 3UWPA 1D2EA 1JI0A 1ZA1A 2C59A 4FBLA 1SNYA 2GVZC 4M7WA 2D7JA 1SXHA 3L0SA 2R8XA 3VC2A 4XVUA 3DWGA 1II9A 3NR2A 1GCOA 4MUGA 4YH1A 3ZW8A 4FEAA 2DPXA 4QG7A 1C30A 4FOPA 4DJDC 3Q2IA 1QYRA 2IZ0A 1LCIA 1VGQA 5GM2A 3JY6A 1L4FA 5HW0A 3GLHB 4W9NC 2LNDA 4B6SA 1WOYA 4I4TB 2GXAA 1SKMA 4K0KB 2I2XB 2ONZA 2UV8A 4NP6A 2F8SA 4WESB 1ND5A 3THYA 1TVMA 1XYVA 2QK4A 3O84A 4IDQA 4R1OA 5LNK6 3D2BA 3FDZA 4URWR 1JTVA 1UPFA 5A7FA 3L8DA 2DWOA 5HQ3A 2I6XA 1CJKC 1FU8A 4UZFA 4ZDWA 1LVHA 3ECSA 1N1GA 4ZJPA 1JAXA 3TSWA 4WKCA 4DB4A 1KH2A 2Y92A 5L7TA 3H0CA 4NJOA 3B51X 4QKQA 4DADA 3GRFA 4PFKA 1SHUX 3OMWA 4QAQA 1OH6A 4NXNB 1I36A 1NUPA 3F6YA 3NGLA 1PQYA 4N82A 2AFIA 3VZRA 2QV0A 1GJRA 1H0KA 4ZHQB 3M4ZA 1E99A 2FKAA 1M2NA 1YI1A 4YQFA 2FPIB 521PA 3DEYX 2EZUA 5K3OA 2XBLA 2XRFA 1ENYA 1N7GA 2H11A 3GVHA 4GBGA 4BS9A 3BXPA 3ZV7A 4RXMA 3QRWA 3W78A 4ZT3A 1NUQA 2Z9DA 3LY7A 2OG1A 3OMLA 4JLNA 4B4OA 3L92A 3OM8A 4HDAA 2QU7A 2J5BA 1M1XB 3BH6A 1EK1A 2OWEA 3JWIA 3LX4A 4PQGA 3G2MA 4QUAA 4WEOA 1M83A 3MF4A 4JA2A 4MQEB 4WNAB 1H2WA 3VHLB 3IEPA 3HMQA 1HDCA 3LUDA 5D85A 1U0RA 2DBYA 1GZ4A 5GOTA 4EL0A 1Z68A 4OJNA 1QGUA 1JX6A 1Y3DE 2CL7X 3I01M 4IILA 3ZI0A 2GA8A 3H9EO 1CR0A 1I2ZA 2IYAA 3PV0A 3RT7A 5BW8A 3NXSA 3UMJA 3X2EA 1WUTA 2LKCA 3RC8A 3EDCA 3WGJA 5BOSB 5KYGA 3KX2A 1AHIA 5KYUB 3HP1A 2I4TA 4FIDA 3HPRA 1MAWA 2FAXA 1JLKA 3R24A 3EXEA 4Q7MB 2DF8A 3O92A 3PF9A 5AHOA 5CH3A 4JHXA 1YTUA 2D2XA 4Q47A 3AUAA 2AF4C 3RFUA 4Q00A 1YRAA 4Q3NA 3V1YA 2G25A 3MN1A 1YO6A 1T2NA 5EMHA 1LK7A 2DBZA 1WM1A 4JLMA 5LBTA 1ZD2P 5LD2B 5KEIA 3O73A 3I01A 4WLFA 4XFKA 3ZCRA 2PSHA 4ZQHA 3K9NA 1YBVA 3C4QA 4I9FA 1I01A 1B23P 1S9DA 3E48A 4GOMD 2WJ6A 4A0RA 4BQPA 2XUGA 1Z8HA 3LVRE 4JBWA 3UHAA 3ZZ0A 4GHWA 1P5RA 3MJRA 1CW2B 3ZNPA 1JPJA 3MVEA 3BYZA 2YFYA 2WG0A 2FVYA 1Z0JA 2BD0A 3KJNA 3DFFA 4O4HB 2ZYGA 1VG0B 4Q9AA 5F52A 3CFYA 3O5AA 3WKCA 1NG9A 1CRZA 1WUHS 1P5JA 3BMOA 1K2WA 2IHBA 2A88A 2PSJA 2VRWA 1ONSA 2SKDA 5CH5A 4KH0A 3SF8B 5CK5A 1D6SA 1X7HA 2BRUA 3I34X 1EGHA 4OLBA 3I1FA 1ZUD1 3PXAA 3TB4A 4UBKA 2HK9A 4AZ0A 3CCFA 3CNOA 5IZCC 4URXR 5COAA 4YV7A 5JXHA 4MYRA 4R2IA 1E2HA 1NW5A 4HEQA 1IEQA 2P69A 4HGRA 1YKGA 3UPTA 4YAGA 3IT1A 3AYXB 1ZHFA 5DLEA 2ZGVA 4Y0AA 2RGRA 1C1YA 2RGGA 2JBHA 4NH4A 3X3HA 2AC4A 1PDOA 2I4LA 5EKDA 5EP3A 3OWOA 4FMCB 3UHOA 3W7VA 2PG3A 1W85A 2AKYA 2Z4TA 4UUOA 2F3TA 1P18A 2IZ6A 2PPLA 3E58A 1W581 2DBQA 2X8JB 3SSMA 3P96A 1LLFA 3GPDG 3PJDA 3GLIB 1H2HA 1L5RA 1XWFA 4IICA 4NESA 1SOAA 2R0QC 1CIVA 1BWSA 2CFOA 3IELA 2JARA 3ABSB 1KJQA 3D4PA 1IZZA 2ZJ5A 1I9CA 1EG2A 3LDAA 3IIEA 4YRQA 3T9CA 5I4CA 4KXYA 3FDJA 5EFOA 2MSDB 2VVTA 3QIAA 3A14A 4X91A 5FULA 1S8NA 5A7HA 2PBFA 1JWBB 1DAHA 5E0KB 4YV2A 4IJVA 2H51A 3G79A 1HLFA 2PMBA 5AH0A 3WLSA 4I14A 1J8QA 1F06A 4L95C 3G9QA 1IATA 3BWYA 1PK9A 3AUFA 2GPJA 4TQGA 1N92A 2I2CA 5CX1A 3FFAA 3QFRA 4JU9A 1Q0PA 2VCEA 4JUBA 4B3DA 1ZOLA 2X7XA 4DXAA 4Z9FA 2VF2A 5BQ5A 5LYYA 3DEAA 2GXSA 4UHEA 1CUVA 1YSCA 2GGSA 1QGOA 4LVOA 3N0WA 2OILA 4W7HA 1ACJA 2O50A 3T7AA 3BE8A 1P4HA 3EBOA 4C4RA 2ARKA 2GBGA 2TMKA 3GLFE 3HUDA 1WXHA 1ZVVA 3FNQA 2HMVA 4S2UA 3QWBA 1Q77A 1VHTA 3C6MA 1ZCAA 3OJFA 2J9YB 1P4JA 1WTCA 3P9NA 1UOOA 1L1EA 1N3LA 3DXXA 2PZAA 3VR6D 1PS8A 5E7IA 3DV0B 1PYOA 1TKCA 5HQTA 4XWOA 2ZSKA 3C3JA 3DONA 2QLNA 4LV8B 2NG1A 1J23A 3DB2A 4YLGA 3GLGA 1CUDA 2HJWA 4MRMA 5F78A 2FZWA 5DHTA 1R1DA 4GVLA 3A3OA 4M0CA 3D1VA 4TS3A 5HYVA 1M2VA