2IDMA

2.00 a structure of t87i/y106w phosphono-chey
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
127
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 40
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2idmA00
1U04A 3MM4A 3OQNA 4W5RA 5BQ3A 2X7XA 2QZJA 2PUCA 5ABPA 3LKBA 9ABPA 4W5TA 1TM2A 1JYFA 5CNJA 1FSPA 4KK3A 2IPAB 3Q9SA 1QO0A 2H3HA 2ID7A 3CZ5A 3F6PA 3OLWA 3Q7TA 1QMPA 5KI6A 3HCWA 5KQLA 1I3CA 4RK5A 2FEKA 1PEAA 1NXPA 4DN6A 3SQNA 2Q5CA 3IDOA 3N53A 7ABPA 5IULC 1PNRA 3H5TA 1DCFA 3RVLA 2JCGA 5TPWB 3N6VA 4TN5A 1D1QA 1W25A 4L85A 3R0JA 1CHNA 1P6QA 5PNTA 4N41A 2FN9A 3L6UA 4KMRA 1DJMA 1QO0D 2JRLA 1USGA 4PYRA 2QR3A 3GRCA 4KZKA 3TD9A 5DLEA 4Z4IA 1Z16A 2IKSA 3I45A 1AB5A 2HQOA 1YMVA 4JOQA 3RVPA 4KNYA 1QKKA 3LUCA 2W42A 1Z13A 1U0SY 3C3MA 2CD7A 4YS6A 1JL3A 4XARA 1W9HA 3C3KA 4MYRA 3KJXA 2JVKA 1E6LA 2QVCA 3IP7A 5IBQA 5B3JC 2FTKE 2YHBA 1BVHA 3QLTA 2R48A 1RZRA 3KYIB 4IF4A 4XLTA 2FW0A 3HUTA 1MB0A 3BBLA 1EAYA 1CYEA 2XDYA 2ZAYA 1JH9A 3QLVA 4IMIB 1JWLA 3CFYA 4QYMA 4ETMA 3HO1A 1AB6A 1M5TA 4KRFA 1HEYA 4RK6A 4EUKA 5TE9A 1BDJA 2QSJA 4ZPJA 2JK1A 3KSMA 4HNQA 4RK1A 5FWXB 1RZRD 2PUDA 1E6MA 1Z2DA 2NT4A 3D8UA 2LIVA 1OXBB 3D02A 4KV7A 2JBAA 2AYXA 1K68A 1P8AA 1E6KA 3KHTA 5HKOA 3QLVC 4ZJPA 1KRWA 4MQEA 1FFGA 1YK0A 4EVQA 5JNWA 4RKRA 1APBA 1DBWA 1Z18A 5FBKA 4B09A 1DRKA 1A0OA 4MR9B 1JX6A 4P98A 5FBHA 2A9QA 4RKQA 3OO0A 5T7BA 4WUTA 1EWVA 1LJLA 4EY3A 2GWRA 3C6QA 4RY0A 3I42A 3N0WA 4KQ9A 4RK7A 2CWDA 4YLEA 4D6YA 1ZAYA 1PUXA 1NXTA 2JVJA 2QVGA 2VYCA 3L49A 4GNRA 4MS1A 5ED4A 2M1ZA 1A04A 1FQWA 2E4ZA 1DBPA 1ZN2A 3MYYA 2GKGA 2QW1A 3OQOA 1L5YA 4LX8A 4H3HB 4PICA 3SY8A 1DG9A 6ABPA 1JHZA 4RY8A 1YIOA 4QPJC 4KK4A 4MGEA 2FSPA 4HNSA 4O1IA 4FB4A 1MAVA 2GI4A 3KYJB 4S05A 4EYOA 1P6UA 3IP9A 4G86A 3CG4A 3EULA 3OM1A 3EQ2A 3I09A 3HSYA 4RXUA 5TPZD 3Q41A 2H0AA 3Q15C 3OMXA 4MRMB 1NXOA 3NNSA 5GOTA 3S99A 2PMCA 4EYKA 1OXKB 5TQ2B 5TQ0A 2KYRA 1JDNA 3F73A 1A2OA 5IUNC 1DCKA 1MB3A 2IYNA 3HXMA 2N9UA 4RXMA 6CHYA 3QX9A 4G97A 5CHYA 4YP9A 1NATA 2DRIA 3O21A 4ML3A 3N0XA 2NUBA 4W5NA 1R8JA 3H5VA 1SXGA 1GLGA 3GV0A 4JASB 4D6XA 3M9WA 5F64A 3A0UA 3KKEA 4CBVA 3QELB 4H3KB 3O2QB 4Z4GA 3OMWA 4O1HA 2PUAA 2R25B 1BDHA 1QQAA 4W5QA 3LFTA 3QLUA 3T6KA 2I6FA 4EYQA 1ZESA 2O20A 3HS3A 1TVMA 3CKMA 1QP4A 3OM0A 2HQBA 2P9HA 2E4YA 3SAJA 3DLHA 3GWGA 2A9PA 3LOPA 5CNKA 1ZH4A 2FEWB 3QEMA 4MS3B 1VRVA 5EWMA 5B3JA 4H60A 4ZYLA 5EWLA 3A10A 1ZITA 3O1JC 2IPNA 5KQMA 2F8TA 4F3TA 1YTUA 4NICA 2P4UA 4HNRA 5EWJA 3IPCA 3QLUC 2FMKA 1DC8A 4MR7A 3HVRA 4XFKA 3QX8A 1QQBA 4RK0A 5DTEA 3FGZA 5GQSA 2MYTA 4JB0A 3MQ4A 3MA0A 5IEBA 4E7OA 2HQRA 3CTPA 1T34A 2VK2A 2E4WA 2OQRA 4KPYA 3NBMA 2MSLA 2JB9A 4GPAA 1JDPA 4DQDA 3BRQA 4Z9AA 4W5OA 4DADA 4FE7A 4RU1A 5T3YA 1D4ZA 3EQZA 4WT7A 3SM9A 4MS4B 3RVSA 5CNIA 2GBPA 2IOYA 3BRSA 3M9XA 3JVIA 3N8IA 4ZMSA 2JBAB 3LKVA 3IP6A 2WB4A 1CEYA 1YK1A 5I4CA 1FFWA 2FN8A 2VUIB 2HJ9A 4Q6WA 4RY9A 1YS6A 3G85A 4F11A 2TMYA 4MLCA 4NV3A 1K66A 4RWEA 2L2QA 1UDRA 1ISRA 3JTEA 1C0EA 1DCMA 2PJUA 3GBVA 4Z0NA 5JNUA 4S04A 4Z4HA 4KFCA 1XHFA 3H1GA 8ABPA 2OENG 3DBIA 5KQPA 3EGCA 4LZLA 2FMFA 2GX6A 1Z15A 1ZDMA 5IEJA 3H5IA 1L5ZA 4KVFA 3W9SA 3KG2A 4Z9BA 3TMYA 2PE5A 2E4XA 2L17A 2FMIA 4G0XA 5KWSA 4JA2A 1QP0A 1SXHA 3KTOA 1YVUA 4WXMA 4YO7A 5IUKC 3RVJA 1DP4A 4G0MA 4N03A 3FFWA 3H5WA 5DKFA 4ETNA 3CLKA 1M2EA 1JYEA 4G0YA 4IGAA 3NNNA 3O74A 3UUGA 3MMNA 4MQFB 5BRJA 1MVOA 3HJFA 4TLMB 5D2CA 1XHEA 1ZH2A 5FWXA 2PKXA 4TLLB 1BDIA 3QK7A 4G0PA 3KLNA 3TX6A 3FMVA 4E7PA 1E2BA 3KLOA 2IPLA 3LMKA 4MAAA 1VPWA 2NT3A 3T38A 5TQ0B 4XASA 3RVNA 1JF8A 4FE4A 1FFSA 4OATA 3ROTA 3JS5A 4EYGA 1VLZA 4IRXA 5JNTA 3DLBA 3FDFA 4YWHA 2R47A 1BAPA 3LUFA 3JPWA 4Y9TA 3H75A 4MR9A 4D74A 3TO5A 1NXSA 3F7NA 4ETIA 5C5CA 3OO1A 4IMJB 4MR8A 4OBBA 4G0QA 1SXIA 2NZVG 3OLVA 2AYZA 4Q6BA 3EODA 3N75A 4RK4A 3RVMA 1GUBA 3I5AA 4JAVC 4XXHA 1JBEA 1Z26A 1QNLA 5IC5A 4YCSA 2PUFA 1D2AA 1ISSA 2PL9A 4OLAA 4L4UA 1GCAA 1PHRA 3LUDA 3KCNA 2WWVD 3O2JA 1LBIA 3DZDA 3RVQA 3K9CA 3E3MA 3UK0A 1TJYA 3QEMB 4P1ZA 5EWMB 1D5WA 3NHMA 5BR1A 5EWLB 1EWKA 3VNAA 4NQRA 3HEBA 4LDZA 1F51E 1F4VA 3O75A 3DGFC 5EWJB 2WY2D 2PUBA 3FFTA 2F8SA 2FQWA 3DGEC 4MPTA 3FFXA 1J56A 4PZ0A 4MRMA 1WETA 1P2FA 2MSWA 4RV5A 3HUUA 1DC7A 2A9OA 1NXXA 2YHAA 4YGXB 3CRNA 3CS3A 4O5AA 4QYWA 3H1EA 3QEKA 1YMUA 1Z25A 4EVSA 4ZMRA 1QP7A 4JP1A 2A9RA 1RXEA 3C3WA 3RVKA 2FLKA 1NTRA 1Y1LA 2WMYA 3O2SB 5E3JA 2ZWMA 2CHEA 3EJWA 1JFTA 4F12A 1EFAA 1Z12A 3HZHA 1TLFA 5FWYA 2LPMA 3HK2A 3LUHA 1KGSA 3P9YA 2J48A 4Z4FA 1GUDA 1ZHHA 3QELA 2FEPA 3BREA 2IDMA 3LUAA 3OQMA 5KQGA 2JVIA 2FLWA 2RJOA 3EAFA 4F06A 2HPHA 4NCAA 4UHKA 3RVRA 2NZUG 1JFSA 3BILA 4N47A 3CG0A 5JS1A 4N76A 1Z17A 1JLKA 3A0RB 4Z4EA 1MIHA 3CNBA 4RZSA 4HYEA 4YRZA 3H1FA 2LUOA 3A3KA 4KQCA 5TPWA 3N0RA 4MQEB 1NXWA 4PE5B 4G0OA 2L18A 4MS3A 2RJNA 2V0NA 3LUKA 4OTZA 2FXIA 3O1HB 2QXYA 1BA2A 1LK0A 1SD5A 3HM9A 1USKA 1GCGA 2MYNA 2RDMA 2VUHB 4OG2A 4WZZA 5JNVA 5DGCA 2FQXA 5KC9A 1LBHA 3T8YA 1PNTA 4UHJA 3ILYA 3OLYA 2CHFA 3CZCA 4Z4CA 1C4WA 2FQYA 5HQJA 1NY5A 2E4VA 1D1PA 4MS1B 3RVOA 3C97A 4TMYA 3RH0A 5HSGA 4NCBA 5KC8A 1DRJA 1U2PA 1U2QA 5IUJC 3IPAA 3IP5A 1Z2EA 3G1WA 3OLZA 1M5UA 2LP4Y 3JY6A 4LDAA 4MS4A 4KREA 1ABFA 5BRAA 4WWHA 4LRQA 1DBQA 2B4AA 3HV2A 1ZGZA 5IX8A 3H6GA 2QU7A 4EGSA 1RNLA 3VNBA 4MLDA 2PAFA 2E4UA 3GBPA 3UKJA 1TMYA 4EVRA 4F8JA 3LUGA 4RXTA 2ID9A 4PEVA 3MIZA 5DCLA 2PUGA 1RPJA 2WJAA 2FKAA 4N0QA 4MR8B 1VKRA 2PLNA 3B2NA 2BGGA 1JFVA 3H5OA 3TB6A 1RXIA 1EHCA 1ZY2A 3T95A 2LBPA 3ROFA 1QPZA 1KRXA 3OLXA 2MYUA 5JNSA 4N0PA 4RDCA 1S8NA 1URPA 4JB2A 4YR7A 4M88A 1PEYA 3RQIA 3HDVA 4LE2A 5TPZA 5HM6A 2MSKA 1SRRA 2IPMA 5JNRA 1EWTA 3LTEA 3Q7RA 2L19A 2WRZA 2HSGA 2PUEA 1M2FA 1USIA 2R4QA 3MF4A 3KS9A 3O1IC 2RGYA 3ILHA 5CNMA 1U8TA 4XAQA 2B1JA 2MYPA 3K4HA 4RS3A 5TQJA 3HDGA 3EDCA 3NHZA 4MQFA 2FMHA 2WJWA 4LE0A 2QV0A 4YV7A 3JVDA 3URMA 3SG0A 1DZ3A 1KMIY 3H6HA 4OLBA 3E61A 3NNDA 5JS2A 3GL9A 3GYBA 3LUJA 1H9CA 3SNKA 1XWWA 1ZGGA 4QICA 4RSMA 4G0ZA 3GT7A 1LJUA 4Q7EA 5C5EA 3F6CA 3Q7SA 4IILA 4LE1A 1NXVA 1YS7A 4MR7B 2M98A 1IIBA 3CU5A 1ZVVA 3GA5A 1ABEA 3JPYA 4WXEA 1B00A 3M6MD 2PL1A 3H5LA 4Z99A 5FWYB 2FVYA 3CHYA 5TQ2A
chains in the Genus database with same CATH superfamily
1FUUA 3RJZA 4JENA 4LWZA 1SXJE 1KAOA 3B52X 3KB2A 4TMZA 3QG1A 4IQFA 1S8OA 5ABPA 3IRUA 2G77B 4CLRB 2NVUA 3KT3A 1FSPA 1UQTA 2BSAA 3CO0S 4PG6A 5EQDA 1WD5A 3KTAB 4ARUA 2H8GA 3A32A 2D62A 4N7JA 1DMRA 3N86A 1OC2A 1R15A 2Q5CA 5CJJA 1SUAA 2OK8A 2QE7A 3F96A 3SS9X 3UOGA 3PHHA 4BJ6A 3K3PA 3RVLA 2RBEA 2ADMA 3O0TA 1UMCB 1ACLA 2BE7A 2PX0A 1KQGA 3AH8A 1FDIA 3NVKI 4HVLA 5JMTA 3G2KA 1E1LA 4XJSA 9GPBA 3QHAA 1UZAA 4W5HA 4EMUA 1N57A 2MOKA 3AETA 4G4SP 2ZXEA 4CFYA 5J4LA 3EPJA 1H2FA 1W35A 3T5MA 3T9FA 1XEFA 1IB6A 3H0KA 3I45A 3AM4A 2HQOA 2QJTA 1FYDA 2XB6A 4RTKA 4FWBA 5AHXA 2AYYA 2ZT6A 4QYSA 2A0YA 5AW1A 2XVAA 1RCTE 2XADA 3ZNOA 5A6SA 3UWSA 2R79A 2Q1TA 3C3KA 2R6DA 3OVMA 3TEJA 2RARA 4DQLA 4EQ6B 1QRSA 1TUEA 1E6LA 2FZKA 5IBQA 3QBTA 2HIAA 3MWDA 3ZWYA 5K20A 1QJ4A 3L6RA 1QLHA 1BVHA 1V71A 1BXKA 1N0HA 3HWX1 3E3NA 2IXAA 1RWKA 1M3SA 1WQ1R 1TZKA 1SA0B 5A1JA 3L8MA 3B6IA 4RD4A 3GNQA 4D02A 5CXSA 4D2IA 1MQ9A 2XB4A 3C3DA 3QLVA 1Q7CA 1XA0A 2H2FA 3HCRA 4BMSA 4KRFA 4M8LA 4B8ZA 5K6AA 2I3AA 3I9V1 2Q6IA 4LOIA 3BZBA 2WINI 3BRWD 1NW5A 5A2QA 2AA3A 2ZJOA 3ZW7A 5DCUA 1BSVA 2VF7A 4NMLA 2QD5A 2RGNA 2FHSA 2OBBA 1UM9B 2VPIA 2VYNA 2YN4A 1XZNA 2WTNA 1TTPB 2CXQA 4MI1A 4YCBA 2LIVA 5CB0A 2RHDA 4AZWA 1HE2A 1H2HA 1SVLA 3H11A 4BO4A 4RJ2A 2QAGB 4H35A 5JCXA 3ORFA 3QLVC 5JBNA 3KETA 3H4MA 1VE7A 1G2QA 5K6AC 3R3YA 4EY8A 4IOMA 5SYNA 5LN1A 4IXDA 3RYCA 1O6GA 4D25A 2ALJA 3GLRA 3HN2A 4U9HS 3BXFA 2NU7B 3RYIB 2FI1A 3A06A 3HU2A 3HGQA 2OXTA 3A6HA 4EY3A 1T25A 4NARA 3C1UA 4XPIB 3C6QA 3ZV7A 1DL5A 2ODPA 1WUHS 3G02A 2WG0A 3KAQA 1J49A 3LHSA 4G0NA 3U4IA 4XX1A 5GWXA 3UGKA 2Y9PB 3UHAA 4NCXA 5AHOA 4IDAA 1SJ9A 3AX6A 3PEFA 2UVQA 2VNAA 3LHKA 3VYUB 4I1VA 4AJHA 4ZICA 1QP8A 2Z5GA 3R3UA 1N8TA 2IW1A 3DYVA 3ASZA 3NYIA 5CVDA 2AEEA 3AI3A 4WNAB 4B82A 4EX7A 2I1VB 2D5AA 1YIOA 4LSGA 4RLQA 4MGEA 1YZ3A 1V43A 4DAOA 3HJBA 4NS1A 4B4WA 3OA2A 2O8EA 1E58A 4G86A 2ZRJA 3OM1A 3RUCA 2GGSA 3DEJA 3NOXA 2IE8A 4XVCA 5BWBA 3ZY5A 4RIFA 3UBMA 2ACVA 2P0EA 4BLTA 4C7JA 3P9NA 1U0OC 4ZN6A 1H66A 2FSVA 2O4UX 3IOMA 1IBRA 1HDZA 4HGPA 5D7BA 1O1YA 5KS2A 3CBGA 4ZZIA 2PZGA 3GJSA 1G66A 4RJJA 5AVJA 1GNSA 5B58T 3EARA 1IU9A 4OXKA 3L0YA 4X1OA 3C16C 2RSLA 4RPJA 1GWNA 4J07A 4L78A 4QQRA 4Z53A 4RTJA 4OGKA 5JI3E 2ZBFA 5GMOA 2OV4A 1H85A 3Q2KA 4UM5A 5AMXA 1JQ5A 1XZBA 1WZUA 1R8SA 2P8SA 1NW3A 2I80A 2G82A 3C4QA 3DV0A 1T4MA 3K0FB 2CMKA 2WU3A 2XEXA 4X62B 2NOAA 1PS0A 1FMLA 5EJ6A 3L0PA 2YL2A 4PY2A 2PUAA 4ARIA 4QVKA 1II0A 2ZS9A 4FYJA 1NT2A 1Q11A 2PDAA 5CB8A 2X8WA 4RF5A 5LD2C 3AHGA 2BE9A 3N76A 2OCAA 3F2IA 4BV3A 2ZBRA 4AN0A 1K7FB 5DPMA 3BD6A 1NY6A 1T3TA 2QMZA 2E4YA 2XTNA 3QW2A 5K51A 2A9PA 1CZHA 5AW3A 5AW9A 2NQ8A 3EAGA 3LT4A 2R6FA 2GAFA 3JZDA 1ZH4A 2Q6KA 2P2SA 3BPSA 5KINB 1KVQA 1ZD2P 1Y1SA 2VRBA 5U9CA 2WJYA 4DPLA 1NUHA 4ZYLA 1NC3A 1P29A 2V74B 1KU0A 1L1FA 4UE2A 3ZWDA 4WAUA 5FWNA 4QSMA 2BKEA 4V1CI 4YN3A 1AGYA 3RSHA 4EIWA 3QX8A 3IVAA 3RASA 3VV2A 4EZEA 3PNQA 1XNHA 3MQ4A 2Z4TA 3LHFA 1J2UA 3GJ8A 1TEVA 2R6CA 2Q99A 1UMDB 2B83A 3EQ8A 3ILXA 4OHBA 4PFKA 5DGXA 3HUEA 2YBDA 1REQA 3FTDA 1P1JA 3ESYA 3FHJA 5JSYA 4HUTA 5AVUA 1Z5WA 1E4YA 1SBQA 2BHTA 2P6PA 3NTOA 3QU5A 4Z9AA 2PMFA 2H92A 3EQZA 3IDSA 1W5TA 2PKYX 4OQPA 2J5XA 3O73A 2C97A 4QOGA 4ZODA 3QEAZ 2XDAA 4C76A 2R1VA 3I2HA 1ZBDA 3ABRB 4UUNA 4AYTA 5DULA 4X6YA 2P9BA 2AHOA 1FFWA 3AU9A 3HKEA 1OLSA 1QF9A 4YVFA 3STVA 1JG4A 1XWIA 1T9BA 1R27A 4WVFA 2XWPA 1EU1A 4MCAA 2V54A 4J1TA 4B45A 1GUAA 1JQ3A 2YR0A 3RG2A 4B4OA 4D9NA 1KI3A 4OH1A 2PLAA 5DM1A 2L2QA 2R2GA 4BBZA 4UHBA 3NANA 1WEKA 1UDRA 2O2EA 3FBGA 5B7PA 4GOLD 1LJ8A 1F2UA 4C78A 4F3TA 3G0OA 4OSOA 1F9AA 4YP7A 4G26A 4RVDA 2E1RA 3LQKA 3FVTA 1KWKA 4QASA 1XN1A 1Y4ZA 4JQZA 4J6FA 1CUHA 4R2XA 4E4YA 5A4AA 1U0RA 2G9VA 2PS0A 1TT5B 5FFNA 4G8BA 2ZVQX 3OTOB 1F12A 2BGRA 2IHUA 4LJ7A 5IEJA 1K3UB 3G1UA 2C5BA 3SIPA 4ZOLF 3IIKA 4HH0A 4PV7A 2DPMA 2QKYA 4RE5A 3PLAE 2ZREA 3PUHA 3TL2A 1ORVA 2BIFA 1DP4A 3OOYA 5AI5A 1I36A 1W1IA 5H68A 1RQLA 2QA5A 4DXAA 5HKKA 2PSJA 2EW1A 1HKUA 1G8HA 4H59A 5G1NA 2WJVA 4KYVA 5J1TB 1J1ZA 3FNRA 4HDRA 4R1QA 3R7WB 4F45A 5JFOA 2DKOA 1RJEA 1RABA 1M8KA 4GICA 4J4TA 4TLMB 3WGQA 4A8JB 4QDZA 1OIVA 3QU9A 2PPVA 3BMNA 3PXXA 4NABA 4DTCA 3GROA 3RFXA 4D57A 1CUCA 3K05A 4M1EA 3OJFA 4IJKA 2ERYA 3QV2A 4WL0A 2FPIA 2GUWA 4FNOA 2J32A 3RSFA 4KH0A 2YCLA 1TC1A 5BNZA 1EQAA 4PLZA 3EPLA 3WICA 5FCDA 3KHUA 4A1OA 1VLZA 4L3VA 1B26A 4HC4A 4KKXB 4WJZA 2ZIZA 2B4QA 2WZBA 2J6HA 3OC6A 3WWOA 1NN0A 1W7AA 1MBZA 3N2GB 4BV9A 1Z29A 4MR9A 4BO8A 3B3FA 1Z7EA 4UHFA 5TR9A 1T26A 3S2YA 1UEJA 4QTYA 3TO5A 3K4QA 3R1IA 4O3MA 5L3QA 4V0MA 5ALTA 1CRQA 2HX1A 4GKJB 1XX6A 2A1IA 5EPOA 1AV7A 1N5LA 1SUDA 1JIUA 1YFZA 4OQMA 4ZCPA 3LRXA 3RYHB 3ZDDA 3IELA 3G0IA 1C1HA 4KLRA 1GTL1 5HIMA 4CKYA 1GL7A 3KR9A 2EQ5A 4XXHA 2CXNA 4YCSA 1ISSA 1IQUA 1SC3A 1EGQA 2HR1A 2DT8A 4DA9A 4IOKA 2DVMA 2F1KA 2P2YA 2M6RA 1G8KA 3IBSA 2MCFA 2VQ3A 2GBFA 3N6RA 3QTBA 3L0OA 3DEYX 2G67A 1DB3A 3ICVA 1FC0A 4RNDB 3WLAA 1IQRA 4GWGA 5JZ9A 3A9TA 3TXAA 3KFVA 4BNVA 1R7RA 2ZJ1A 4KQ1A 4E5SA 2Y71A 1Q17A 1OF1A 2XUGA 4ISBA 2PM8A 2X0IA 1JQEA 3FFTA 2F8SA 4E32A 2GRUA 5F2NA 1RHUA 3TVYA 3GRKA 3L93A 2QVYX 1B0ZA 2K5UA 1YR3A 1NULA 4ZVQA 1E3DA 1UZNA 3HB9A 1QG0A 4UTVA 2YHAA 2PBRA 3QMMA 2CF5A 4N6NA 4PQGA 1AZLA 4MYSA 4ER6A 5BUSA 1IWOA 3T1OA 1DAEA 1NVVR 1Z36A 3H1EA 3NYRA 3QEKA 4H1VA 4AW9A 1V1RA 3FZQA 5JD3A 1S2IA 2RAPA 2VPPA 5CMLA 3C48A 1T6BY 5AI9A 1VYTA 1LF5A 4HAOA 4ZI3A 5HQTA 4NZOA 5MDHA 2XYVA 4I9GA 2FE4A 2FFHA 3S2EA 1LH0A 2LPMA 4HCJA 4BC1A 5FWYA 2IDJA 1B76A 4Z4FA 3W8DA 1WY5A 1PBTA 3QELA 4KGZA 3TGWA 4RFSB 4BE4A 1N2HA 5LQNA 3RAGA 2CLHB 1B8VA 2IDMA 2P75A 3BREA 1OXTA 2PQ6A 3PE3A 4R51A 4YMSA 3L8FA 2RJOA 1JG3A 1ESEA 4ZI7B 2J7PD 4FE3A 1Q92A 2NO5A 4RPIA 1VTKA 3CLHA 3DFFA 3K0AA 4FGSA 4X84A 4CTNA 2D5IA 5CDUA 4AJLA 2ZR8A 4PAMA 4PAQA 1LRLA 4BO6A 5CVTA 1GL6A 4QXAA 4DNQA 1KDTA 4JJ4A 1A50B 1Z8HA 5D5PA 5H83A 4PE5B 4G0OA 1NP6A 3BFPA 4WLNA 4B6OA 3C5HA 2H4FA 3Q2IA 4KYTA 2K4MA 3VR1A 2I6UA 3SDSA 1WAMA 1K75A 1GCGA 1TQ6A 2OCPA 3FVVA 4M49A 4CF4A 1Z62A 4A0QA 5JSQA 1WUIS 4YY3B 3GFTA 2J9ZB 5BUCA 1SZJG 2O2XA 3DT9A 1JU3A 3H9QA 4UHJA 2J87A 2DLNA 2Z8XA 3LGXA 2AK3A 1NVWQ 4J0DA 4L22A 5EN4A 4BGIA 1HUQA 3HU3A 5JJCA 3ITKA 1JALA 4L5JA 4QDXA 5I45A 1IZ0A 2CLEB 1U2PA 1A8UA 1YZQA 3CN7A 3Q3JB 3QLJA 3RW9A 1CS0A 5IUJC 5ERGB 1KDZA 4HX5A 3OLZA 2AXNA 1A88A 2HGZA 4IMRA 3COJA 3NMUF 1AHHA 3DMNA 3L8HA 1AQ6A 3DHWC 1ABFA 2VXOA 3TI7A 4XIFA 5D01A 3UHFA 3EZNA 3E15A 1TC2A 4FMCB 4QBTA 5EE0A 5M3BA 2I4MA 3UJCA 4ZRNA 4EGSA 3PUJA 3WIBA 2IEAA 1JT2A 1S2NA 2PAFA 1W4CA 3DZCA 1UBSB 1X7ZA 1SNYA 1YZTA 2ID9A 5PGMA 4JC4A 3DJFA 2W48A 4YJFB 2ZB3A 3UKDA 3YASA 1U3DA 3M4ZA 3WYDA 2HHHB 2HA7A 2CMDA 2X4GA 4P7GA 1XLTC 221PA 3OEHA 3T9EA 3WP1B 1HURA 4W7SA 3KEFA 3TCKA 5BSWA 1VB3A 2O5VA 3CRMA 3FPLA 4LYDA 1ZY2A 3TB6A 3TUJC 4BFVA 4EY5A 2EFJA 1KAMA 4DV0B 1WBBA 2N1MA 4RKFA 4HFJA 5ITVA 5KTOA 2W6OA 1AC5A 3PHCA 2DBQA 3R6TA 1S02A 4D5GA 5I7OA 4WPGA 4D56A 1STOA 5H3HA 3VU8A 5AW8A 4IJ5A 3AVUA 1XJQA 3MK31 1T2CA 1NDUA 3OP4A 5JNRA 2CXRA 1XI2A 2EP7A 3D8SA 3BXGA 2C82A 5CXUA 2JDID 1Z0AA 3AUSA 3DDSA 3L40A 2VQFB 1OREA 2R7LA 3L77A 4HH4A 3KS9A 4A15A 4Q03A 1W36D 4KVAA 4D42A 3RSGA 3UF0A 2VDQB 3PC3A 4LQDA 1VE3A 2SHKA 4XD7A 2XDQB 4RPLA 4NFYA 1MU0A 5KO2A 4LE0A 4GXTA 2JL1A 4JUBA 3U26A 4YAEA 2ISCA 4HKTA 1H6AA 1OI2A 2CL6X 2XTZA 3TZ6A 3TIFA 2XMBA 3ILVA 4KPGA 2VNJA 3NNDA 3OFJA 1KDPA 1IWPB 2BFEB 5DI3A 3AGQA 4ENRA 3JWEA 2ZS8A 3GFGA 3CISA 3CUWA 5C5EA 5ITWA 1EGHA 2QTNA 4LE1A 2W6ZA 3FXAA 1J7JA 3G5UA 4P6VF 1IIBA 5KJEA 3O3CA 3HKCA 4MJLA 5ESWA 3WADA 4JYMA 3U7FB 1PJ3A 2DWPA 4KN6A 4HUQB 1KEUA 1YNSA 2FVYA 2OZVA 1LDGA 2C5AA 3CUYA 2AOUB 5E2AA 1V48A 5L53A 5BWNA 3O8DA 3W4JA 1YQWA 1EWRA 1TM2A 3FB4A 3VHQA 2Y1EA 2KBEA 2HA4A 3LSYA 4ZQEA 2G06A 4KWCA 1BDMA 4D8TA 2K87A 1R1DA 2FCAA 1RHMA 2AEJA 4X8OA 1FTWA 3DCIA 3EMDA 4LTNA 1V2GA 4L4SA 4DR5B 3F5FA 1QVAA 4QNRA 4NBSA 5NLLA 2B4YA 4DLAA 1PJBA 4IJMA 3BJZA 3MGGA 3C43A 2CXHA 1P6XA 3TKYA 5AUOB 3DHEA 3EHDA 5TT1A 2IYWA 4FUQA 3SJ7A 1QF6A 4P5DA 2ZVPX 4KFSA 2FN9A 1RWWA 3DE4X 3T9AA 2Z6QA 3P0RA 4OJNA 2NU9B 1QYVA 3DUFA 4QPCA 3TS1A 1EWQA 1G3QA 3FKJA 3V4PB 1IOWA 4EY4A 3TNFA 1RRMA 3N2EA 1CW2B 1QKKA 4NXNB 1O95A 3BSWA 4G89A 3BMQA 3NHSA 3CE9A 2CJPA 4G41A 2H7YA 1BCSA 3SSOA 2ZJZA 5IN4A 4GS5A 1I1OA 1WKBA 3PRKE 4HLUC 4MOWA 2F3PA 4DJEC 3DP9A 4DARA 1XD9A 4BRZA 5FLXA 5F73A 2XUKA 1R0SA 1RZRA 3ZY6A 3HA5A 1OBHA 3O3NB 4RCYA 3WLKX 2ZYUX 5EIEA 3GLFB 1O0BA 2IXBA 3AL3A 3GDFA 3VPGA 1UJ6A 4RPCA 1J0CA 5A7FA 5K7SA 4RD2A 4E88A 3MHTA 1GU0A 1IG0A 4KO4S 4WOKA 1Z4MA 3LZ6A 3WISA 4MIKA 3L5OA 4HMPA 1BJTA 5DOVA 3HO1A 3GFQA 1N3LA 2O3QA 4WDRA 4UMFA 4MRPA 4G4JA 4Y1FA 1IEQA 1IOZA 2IS2A 4BPRA 3UHPA 1T5BA 1O6ZA 1CY6A 1T5OA 3W9YA 4DXDA 1PTJA 1WPQA 3ZEAA 1KJ9A 1UT5A 3P52A 5HIAA 1ZM2A 3PZBA 4WK0B 2Y68A 2HK6A 3A1CA 3UXMA 1KFJB 3DKVA 4HWOA 1FNDA 3OPNA 4JR2A 1K7SN 1KNQA 3NIGB 3FTEA 4HMOA 4O4JB 4XRRA 4FC7A 4QWMA 2QYSA 2ZIEA 1WABA 4E15A 3QENA 5BR7A 2ZE8A 2PQ0A 2SBTA 3HADA 5C4MA 2P7IA 1ZUWA 4RKRA 1APBA 4KR6A 4A6EA 2PT5A 5EMMA 2NUPB 1SPBS 3IMEA 3UQYS 3CUUA 3ZU6A 4QKQA 2PSEA 5JIBA 3HMQA 1GARA 1PTJC 5FBHA 1G20E 3CR3C 4RKQA 2ECFA 3LQYA 4CUJA 2CXXA 1VPVA 4HH3C 2R7NA 3CRVA 1TCUA 5CIWA 4BDSA 2VQEB 1GTJ1 5JAIA 1K2WA 2QLJA 1OYVA 3KWFA 3FLAA 3N0WA 4KQ9A 4QXPA 2CWDA 3KL2A 5CR9A 3U60B 1KYVA 3P20A 4MJ7A 1T2VA 2VOEA 4FGZA 4MB0A 4WNYA 4HB4A 2XOKD 3RS5A 3QTTA 5BMVF 2AOTB 2H5LA 1O89A 4JC0A 3R77A 2XRYA 1U9JA 5K3FA 1EVIA 4RF3A 3II6X 3WRWA 3LLMA 1O87A 2X22A 4YJ2F 5EKUA 5HZKA 3DLAA 2D5BA 4G0VA 3P2KA 3R3SA 2HADA 5LXTF 4C4PA 1RAAA 2BFPA 2G08A 4PICA 3V46A 4JR1A 1DG9A 1JHZA 3PXDA 4N0EA 3EXG2 4C4AA 4O4HA 1UWLA 5ALZA 3JZMA 5KTPA 3UTDA 4BNXA 4B40A 4NH4A 3OCVA 2MSEB 4OGWA 2N1BA 3MTJA 4M0CA 4REQA 1WDTA 5FULA 3IL2A 4BFTA 1VLQA 3DCNA 3CNLA 2QB5A 3NVAA 1MIOA 3AI2A 3AUAA 1GKKA 2H0AA 3ZNNA 2R4TA 4JYPA 1G1MA 1MF7A 3B3QA 3JQRA 5KNDA 5D00A 3QVXA 4JQOA 1NNUA 4LZPA 5HM8A 1H2XA 5AQ1A 1PJAA 1ZUHA 2C8VA 2GCEA 2YIMA 3FIJA 3GEMA 1YONA 3KQQA 4MK4A 4PZPA 5IJ0A 4HB3A 3THWA 2O8FB 4DNPA 1DCKA 1NUTA 4X6UA 1VGQA 1RYZA 4FT2A 4U00A 5TJ9A 5DTQA 6CHYA 4JXJA 1W5FA 4CG2A 1T2DA 2IBMA 4JXZA 1UFVA 2CV0A 5KNCD 1PJ8A 1M8FA 3A6PC 1UOOA 4ZALA 4FONA 1EXVA 4PX5A 2AMVA 2JHPA 1M7GA 4TLAA 2JGIA 8AT1A 3WLPA 5CBPA 3KKEA 4TTAA 1N9GA 3PIRA 2QVLA 3L6EA 1UZMA 3S5UA 2OQVA 4HXFB 1AN9A 5FOUA 1OXMA 2H2IA 2V4MA 4RLSA 2C42A 3LP6A 5BN4B 4C5CA 1LBQA 2OM2A 3ZJYA 1GXSB 1Z0IA 4X45A 5DSZA 5HA5A 5DM2A 1NGSA 3OSZA 1PP4A 3QVOA 3I32A 4Q1VA 3ER9A 3MSCA 1M0EA 1QSGA 2IHZA 4WNIA 2OPBA 1K6JA 5FL3A 4LHVA 4EYEA 5TIIA 5JALA 3SOPA 1RBYA 1I2MA 2I4TA 1XDUA 4TX1A 2Q29A 5FOWA 4EMBA 1R37A 5B3JA 3KPWA 2CVQA 2HTFA 2Y67A 4BFSA 5EEHA 4PCVA 3T1TA 1RP1A 1DWOA 2PO5A 1EFRA 4Z49A 2FFAA 1PT6A 3MQ2A 2X8JB 3KDAA 4UBMA 5I7FA 2YJ6A 4XFKA 4TROA 1YC2A 4GQIA 3U4QB 3WAGA 3HFGA 3PGA1 2LKCA 5AXAA 1Q1QA 3WL5A 2V0GA 4QU0A 1F06A 1T34A 3KKZA 5EMKA 3U4HA 4MUMA 4QDKA 1D0VA 4FWTA 1W2GA 1T8RA 4HDSB 1JFRA 3SEFA 4GPAA 4IGIA 4IW3B 2FPRA 3WOVA 4FMBB 2IZOA 4O2LA 5CFRA 3I34X 3TW4A 3VH1A 3PDIB 4UM7A 4HDKB 2DJIA 1RC8A 2CJXA 2AI3A 3KTAA 5L95A 5LQJA 4I19A 4Y9DA 4QUEA 3BWXA 2NZJA 1C50A 2HL6A 3LKVA 1M1NB 3ZCRA 2QV7A 1UMCA 1J39A 2JK0A 1RADA 1JHAA 4RMIA 1YE8A 3EVDA 3QH4A 5LZ8A 2IP2A 3PRHA 4PX2A 1XR3A 4RORA 5KPDA 5FPTA 1FFAA 1JFFB 1N9KA 3PJDA 1SVWA 3VKGA 1YJ5A 1BFDA 1DT3A 4I1YA 1RLTA 3SQXA 1ZUD1 1G16A 2VPYA 3OT4A 1NBOA 3M3HA 4ZVNA 3CRQA 4L5CA 1ZD5A 4N0DA 1VCNA 3R4CA 3PR1A 3SHTA 3FIUA 1U0FA 2OBXA 5JYBA 2Q3BA 1IY9A 4W1PA 2FWNA 2WJGA 2PCLA 5KQPA 1K27A 2V0CA 2HOQA 3O3MB 4OP1A 1SBNE 4YO8A 2WC1A 1RWOA 1K98A 4IIJF 4RTMA 3GIDA 1I2AA 2NACA 1JWBB 4PC6A 3S2GA 2YJ5A 3VVCA 2VHXA 4WZAB 3K8OE 5AP9A 1Z9BA 3CWQA 4OLFA 1OZAA 1SA0A 2FEAA 2VAXA 5CM9C 2HV8A 5DKFA 3SYMA 3PJRA 1Y37A 2QLNA 1NSFA 1C4KA 2YHIB 3K15A 1AKWA 3HSKA 4MPPA 1Z5ZA 1XIVA 2REBA 3AZOA 3TLZA 4MQFB 3T3PB 1W49A 5K4GA 2O0JA 5KPJA 1PU2A 4TLLB 4WFQA 2OPHA 3FSJX 2OV2A 3HC7A 4FR5A 4ZAXA 5LNK1 1TM1E 1LVHA 4YH1A 2ZSDA 1MAAA 2CHQA 2C7GA 4AZVA 4R1MA 3AUYA 9MHTA 3EGVA 3W0LB 3Q3VA 4CEIA 1OOEA 1QQ7A 3L04A 4NBLA 5FUMA 4EYGA 3K5PA 5GZ1A 5IASA 3RNLA 2C2MA 2L42A 3GZNA 1RU3A 3B48A 1LBTA 3CJQA 5HP4A 1MEJA 5IAEA 1Z33A 1P80A 2XSZD 1TKRA 1E69A 1IQPA 3FBWA 2B9EA 1JRLA 4BJHB 4E33A 1SKAA 2Y77A 4MHOA 1DKNA 4FMDB 5L3RA 1V5IA 3I04M 3AP3A 4A2PA 1BMFD 4XPIA 2EF0A 1TJ5A 1YDWA 2ZBEA 2IW3A 4HOYA 2AYZA 4Q6BA 2QAGC 5ED0A 2ZWIA 2NQ2C 3TE6A 4CM9A 4EABA 3JD3A 3BK2A 2W6QA 2R5NA 4GWLA 4YT4A 1TXGA 2JKVA 4FGLA 2O8VA 1T9HA 1MZVA 5FLYA 2PL9A 3VI3B 2X42A 2FWMX 2V6JA 1WF3A 2JD1A 3B6JA 4TTVA 5E2IA 5T8KC 1DINA 3HBLA 3P1JA 2OYRA 1N32B 3KCNA 2WFAA 3A36A 3OH8A 2WWVD 4WNAA 3ZGXA 4IBOA 1D3AA 3O9ZA 2AZDA 2Q0SA 4TS4A 2HEIA 1TJYA 1CXZA 2LRHA 1TM3E 2Y1FA 3O2NA 1PT8A 2NSJA 5AOAA 1O97D 5HQ3A 1QRTA 2VHZA 2ECQA 5TEWA 3TZHA 5BR1A 5A4MS 4DJFC 1EUDB 1RQNA 5DW3A 1ZJWA 4J2TA 4V0OA 3M5WA 3O75A 4X65B 3SKXA 2BAGA 1X7GA 1QG2A 2O1SA 1GUFA 1U2DA 1IUPA 4CKCB 1DC7A 4TWAA 3WGHA 1R0YA 5GONB 3MPOA 2H0RA 3MTGA 3K1JA 4QUDA 1JUDA 2BHRA 3E27A 4QYWA 4DNXA 1A1VA 2PWAA 5BWCA 1D6SA 3GUVA 3H17A 1I3OA 4R2MA 3WJ7A 4YAGA 2ACEA 1R74A 1IHPA 3L7KA 4OI0A 3JAKB 4QJIA 1JFTA 5I7EA 1ZK1A 3GGSA 5G3ZA 1Z12A 3DQQA 3H5NA 2O2CA 4ARSA 4BX2A 2OGUA 5T64A 4LJ4A 3K0FA 1P2UA 1L4GA 1VL6A 3GN1A 4DM7A 4EG0A 3E7FA 2JLCA 3HVIA 5JE8A 1NJFA 1QGED 4L5BA 1O6BA 2ATXA 1O94C 1N3IA 4Y2QA 5B1IA 3BT7A 3UW1A 2K6GA 4I46A 3UMSA 3BMOB 4I4TB 1ST2A 4Y98A 4PC7A 3GLHE 4CMJA 3IQIX 4DIDA 4F91B 1E5TA 2EFGA 1WPGA 2EKDA 3GPLA 1LZKA 1QHEA 2WA1A 2Y1KA 2EL9A 3DPIA 2JLUA 2EKZA 4M7PA 5FBWB 1K08A 1DMSA 4BE9A 5D3ZA 3GDGA 4F4HA 1X42A 1RJ9A 2RJNA 4LC9A 4RZ3A 3RU7A 1T5LA 2YOGA 5KMGB 5MF6A 2F1IA 2YJZA 4GW3A 1LK0A 5FOXA 3HJGA 5GGXA 2H4HA 1TI7A 3QKRA 1VIVA 2PG3A 3DBRB 3FOZA 1GRRA 3N6XA 4JLKA 2OORC 3G8CA 2JH9A 1K1EA 1LBHA 2I0FA 5FORA 2KX7A 4KLZA 4BIIA 2A8YA 1AD2A 1Q7TA 3PFIA 4EY7A 1CY4A 2F67A 4RENA 3IAS6 5M7EA 1UMDA 1R5JA 2XX3A 1JDBC 1B2LA 4PR0A 3S44A 1HDOA 1CQZA 1YTLA 2VTVA 3R2JA 5CU7A 1KOJA 2QRGA 3RVOA 4L8YA 3V5NA 1GRVA 3DOEA 3MCUA 2J5QA 2OVFA 3PFGA 3GGCA 3W3AA 3A37A 3CZMA 1DQSA 3H3JA 4IH9A 1NHGA 4ZV4A 1XTSA 1BMDA 3C3YA 2ZE5A 4UE6A 1NOKA 4KIUA 3CH4B 3GFVA 5BSTA 3U4DA 4DEVA 2IS4A 4D99A 2Z4SA 3HV2A 1JR3A 3MFQA 2ZUWA 3LYUA 1CJSA 4GMDA 3GD5A 2O6HA 4O4LF 5CA1B 4CXMA 2Q62A 1UBNA 3ESXA 1RNLA 1C9YA 3CZQA 2VBGA 3OPYI 4NEGA 3OQVA 1R4MA 5LLTA 3MBIA 1CG6A 4DUGA 4ESVA 2PGOA 2Q2OA 4OKSA 1B6GA 5ALXA 3AESB 3E1KA 3D0RA 3AXTA 2ZRKA 4YMTA 4GQAA 4LOLA 3TLBA 2Y92A 4I55F 2VDMB 1V95A 2R7KA 4L16A 1DXOA 1Y48E 2HA2A 2PLNA 5IF9A 3MJEA 1F7UA 5FUXA 4JR0A 3UJNA 1ZMBA 5HS6A 3AEQB 3K2EA 1XMOB 3NWOA 1K3TA 1XJCA 3D5QA 4TRNA 1AE1A 5DYNA 4G36A 1TT5A 1ZUNB 5C31A 3TK1A 3OQPA 4RDCA 5LA6B 4F0JA 3GA0A 1QB7A 4YECA 1EVZA 2BL4A 2NSLA 3UATA 5I7UA 1V96A 1DC5A 4LJRA 3FVRA 1M8PA 1EI9A 4JCOA 1ZM9A 5HM6A 1YQTA 1ZC3A 3CUVA 4KQIA 4ZT5A 2CDBA 5ECYA 1K0FA 3RB8A 3PX3A 2FWJA 3UWPA 4EB6B 1FA9A 4IHKA 3ITNA 1PLJA 4D7AA 2COEA 3ILHA 4HFNA 5JO9A 4BCBA 4XAQA 4F60A 1KOFA 6REQA 4QRDA 1RXYA 2MYPA 4RS3A 2C7QA 3R7WA 3A9RA 3CJTA 3T0FA 1KMMA 2MHCA 4EG6A 2Z2IA 1HMYA 4A8JA 1Q20A 4FS3A 1QDLB 3NTRA 1AKRA 3RK0A 5F7XA 1D6JA 4Z2AA 2CBGA 1CIPA 2YS6A 3E61A 4TXMA 1R6TA 3FLBA 3SIXA 2ZETA 2I7TA 3EBOA 3K30A 4HJXA 4MO2A 1E79D 1Y1PA 3GCGA 4IG9A 4X97A 1IHDA 4U7FA 1MT3A 821PA 3LVQE 4C87A 3ANYB 3WLIA 2QK4A 2J45A 1WZNA 2ZUVA 4CMIB 4EI9A 5DW0A 3I37X 1UBJS 4JLDA 2DG2A 4HNAA 1YS7A 4HZGA 3FCOA 4G9GA 4CCYA 2AG6A 2QX6A 4K26A 5K0BA 1OVGA 4L9AA 4CQMD 4YEDA 3M6MD 4RM3A 3N2LA 3A28A 3CHYA 1VE6A 2FY8A 1NBHA 4CV2A 2OEPA 4D6YA 2Z57A 5JFTA 1T10A 3MCVA 3PHJA 1G2PA 1JKMA 3RYHA 9LDTA 5SZKB 3W2IA 2X23A 4UQOA 3UO8B 5HRUA 4K6CA 1I1NA 2W6NA 5LQSA 5C7OO 2Q0HA 2OAEA 4UAGA 1FRVA 2C0CA 3V8NA 1ZNWA 2GTPA 2JLAA 3ZBQA 1C14A 4QUKA 3OIFA 5CGZA 4RK5A 3T54A 2WYHA 3DDCA 1TFRA 4CHTA 4UNIA 4Q47A 4YGYA 4DUYB 2PJZA 3OY2A 2X2EA 1WW8A 1NLFA 4MWSA 3HLYA 1CY2A 3QVTA 1VP3A 2QROA 3ZU4A 3WP0A 1VIMA 3NC0C 3OG9A 1U0BB 3CCFA 1BOOA 2P11A 4QLOA 2CJYA 3ZTYA 1T2EA 3FTNA 1ZP6A 1B14A 2W11A 2VPWA 1RLUA 3KDSE 4ZO7A 3ZWQA 4F96A 3N3BC 3QITA 3IPRA 1OH6A 5JDIA 2NXCA 2PXXA 2R4UA 1LCIA 4KNVA 3AR8A 3HKDA 4KNYA 1L5RA 3DSRA 1NPTO 2R751 2QMHA 1N5MA 1J22A 2CL0X 2OA0A 4WERA 2HSWA 4AIRA 3EUWA 1UJNA 2AJ8A 2E89A 2WAOA 2HDOA 4B2PA 4L8FA 3PNVA 3DZHA 2H29A 4B80A 2QVCA 1C3JA 3H9GA 1XD2B 1G8JA 2YHBA 3AY6A 3NH6A 4OLHA 3TKAA 2C95A 4JLSA 2KJQA 5FB3A 2IOQA 3E0XA 2EWVA 5LOVF 4XWWA 3CLTC 2GOYA 2LVBA 4D9MA 2FW0A 4GP9A 3H1TA 1B16A 1UC8A 3G2JA 1L4HA 3F2VA 1XC7A 5LCXA 1JH9A 2XUZA 3UJHA 2YV4A 4FEAA 4NTZA 1P1FA 1DOZA 4RK6A 4YP1A 3TDNA 4EUKA 2EV9A 2JK1A 2XNJA 2X3FA 1YZYA 5AJTA 2C1XA 3BJRA 4E1AA 1PCXA 5B2FA 2BHNA 4H7JA 4ZI7A 2OXRA 1GUYA 4GX2A 4UVEA 4BY9E 1YE3A 3WGJA 4BO5A 2J3LA 2R65A 1QORA 2Y6VA 1SCNE 5EPUA 1KKMA 2OC4A 3PQ8A 4FXPA 3SD7A 1J2JA 2IRWA 2PRSA 5IVKA 3OFND 4EKEA 3HWRA 2PANA 4CE6A 2QTVA 3KHTA 1OLOA 5IDVA 1I32A 1Z6PA 2H18A 1COWA 1N36B 4OJMX 2JGRA 2V9PA 3TFQA 5JCOC 5H80A 2Q1SA 2GN6A 5FI0B 3UK6A 2P9GA 1SQ6A 3GJ4A 4R8KA 2P6OA 3JSXA 4HPJB 4F9TA 2GUGA 4EKDA 4ZKDA 2EX1A 2J9GA 4ZEMA 5E2BA 4QFCA 4BJ3A 4DIMA 5L3VA 2DFVA 5BWMA 2NG1A 3RBZA 1PFQA 2QVGA 3BIFA 5JR3A 4WBXC 2ZJAA 5ALQA 4PLHA 1H6CA 3DMTA 1R8XA 1Z6ZA 3OF3A 4QUIA 2CHUA 2R5FA 5B53A 1GVHA 4HDNB 5C8VA 3E05A 4R3WA 4W5JA 1SPXA 1U0TA 4BFZA 2YHSA 4OJKA 3KUCA 3LA6A 1UBLS 4LMRA 1E2DA 3L8GA 2C2HA 4HNSA 2G6TA 2QTMA 1RKQA 2HRCA 3G3EA 3UQZA 2R0QC 3VDNB 4QOIA 3TW0A 1J21A 1L4YA 2JHCA 3GP5A 4BMCA 4LCBA 4U7WA 4ZVSA 4AWAA 4AYWA 1T8PA 3GRAA 5HWSA 4KAAA 1MJ5A 4V0RA 5DYTA 3H9JA 1N0IA 2AKAB 2I76A 1HSZA 5KYWB 5LIPA 3I3SR 4MUAA 3OMXA 1P9NA 4Z4QA 1DAKA 2R86A 4YJFA 2P35A 4PO1A 2ZUTA 4JV5B 1LBSA 1PJZA 3BGIA 3EK2A 4HB0A 4L08A 2VDPB 4RDHA 4EYKA 2P79A 3FETA 1NVTA 1VMKA 4FJ0A 4OY3A 4UEKA 2GJ4A 4Z1OA 3FPAA 3PSAA 1MB3A 5ESDA 1G60A 1E0DA 2IXTA 4NESA 3HXMA 3IQGX 4PXYA 1MVLA 1XPJA 2GJSA 1TJNA 2LR0A 4KQMA 4N6GA 1YF3A 3GJ0A 4CR8A 2CUZA 2FOIA 4C9BA 2D3TA 3SKVA 1I7QB 1HDIA 4PSKA 1MPXA 1U8FO 1VG8A 4WEOA 4JT2A 1Y5NA 2NSHA 3QKUA 4BP1A 1RKBA 3MTAA 4NL4H 2Q9UA 3FCEA 1OBFO 1ZJJA 2ZDQA 1M34B 3IUBA 4G81A 3GA7A 5E6SB 1A69A 1JAZA 2OSVA 2B8WA 2BMVA 5CVEA 5D86A 1EP3B 1TU4A 3MMPA 3MB8A 5I9IA 2I3ZA 3DO5A 2Q6TA 1XLVA 1DU4A 2JI4A 1EFHA 2FAXA 3GWGA 3LOPA 4INZA 4MZXA 1FZQA 3WBKA 5CFOA 2VI5A 1GDTA 4V3CA 2QRNA 3JR7A 5DBHX 2FR8A 5HKLA 5ILOA 3CNEA 4MS3B 1D5CA 4PWYA 4QJ5A 2BFEA 4JEMA 4RHYA 3A10A 3U48A 5KQMA 3O31A 2XODA 3EZXA 3GVXA 3MMZA 4JVSB 2X3YA 5EWJA 3IPCA 4GOXA 3QYJA 4LSMA 5FOSA 2CLIB 3WHIA 3UB2A 1F5NA 2H2AA 2QYOA 2CZGA 4KB5A 5DTEA 1VL8A 1QQBA 1VIAA 2WTXA 1I6KA 1EP2B 4HUQA 4OLJA 4QRHA 4PGMA 3VR2A 5LU8A 2JIOA 5FQOA 3A6GA 2AOUA 1YOBA 2DFDA 2I2XB 1BOFA 3I64A 4RGYA 3T5CA 1CDDA 2BEJA 1BYUA 3C39A 3ES9A 1HLDA 4BNFA 4UE3S 4Q1CA 4R5HA 2BONA 4DADA 4RU1A 1CP2A 1Z4JA 5A06A 2D7JA 3SM9A 1DUSA 3NVDA 5C0OE 1KTVA 3H99A 3LIIA 3M9XA 4ZYTA 4Z6KA 2V96A 3EY4A 4ZVRA 3I3OA 3L8EA 2IEBA 3TLEA 521PA 5FQNA 1UC5B 2I4LA 4IWXA 4KXVA 1OWNA 3RD5A 1M10A 4F11A 1K7CA 1QHGA 4LTMA 1T3ZA 2NU9A 4HXGA 1Q15A 1YZHA 5IDQA 1L4KA 2P2DA 3IR7A 5CITA 1N34B 2BJHA 1ESDA 4CUZA 1Z2PX 5C1DA 5DBGA 5F2EA 3VSBA 1FY2A 2FJPA 4DLSA 1AKMA 2WLTA 4HBGA 2DX7A 2F6RA 4ESHA 3DR5A 3FR7A 3ISVA 3AIKA 2BUBA 3EDQA 1JEOA 2W4MA 2XMPA 1EVJA 8ABPA 5LQMA 4D4KA 2TSYB 1MR3F 4QAJA 3FMOB 4Q18A 5ADUS 2Q3HA 2UYGA 4TSFA 2FN7A 4G5YA 3CCCA 4LHWA 3U7QA 1KZ1A 4LSZA 5GZ6A 3W9SA 4NHOA 4YYZA 2A5FA 1MABA 4TSRA 4URXR 1RDFA 4ZV7A 3GLFA 2VJKA 2QYHA 4J91A 1WS6A 4LIPD 2GEJA 4J1NA 2HF9A 4YHHB 3OPMA 5K0NA 1JHDA 3NONA 3H5WA 5D5QA 2HGSA 2ZYGA 2Z3VA 1V6AA 5DK6A 3R09A 5FV7A 4M1TA 5K3OA 3EEYA 3PI6A 3IESA 4UVHA 4H16A 3WQQA 1ECLA 1WTCA 1EJ2A 3RTDA 5JXHA 1ZI9A 3RO7A 2IOFK 4BFLA 2ZJ8A 1EZ1A 2Y27A 1ETHA 1QCZA 2NTEA 3FSEA 1VQ1A 3D2LA 3PLRA 3AFGA 3MJVA 1QDUA 1BX1A 4G0PA 3E58A 4E4RA 1GU1A 1F48A 2J3KA 3DOCA 2E4AA 3SHWA 1QG6A 4MWZA 1BKSB 1VCMA 1W46A 3GMSA 4DIEA 3WQSB 4I6GA 3MCWA 3U7QB 3UMJA 1NF3A 2H4WA 1VBKA 2R47A 2ZKLA 4N0MA 3V7NA 5FL7A 5SV2A 1HWYA 1PWHA 1S4QA 3EEFA 4H17A 3ZZMA 4UBLA 3LT1A 2HU7A 2NUPA 1M2NA 8ADHA 3K32A 3UJAA 3AR4A 4XTCS 2PD4A 2MINB 3L7IA 1QS0A 4NBUA 5FTKA 4UHHA 1E5QA 1P2BA 3QEOA 1IXSB 4X1YB 3GARA 3RTGA 1V3VA 5FXMA 4CR6A 1Z34A 1FS5A 4TZKA 3AOEC 4TXHA 3RVBA 3ZPXA 3NM5A 5F9FA 1M1ZA 1ZH8A 3JQGB 3RVMA 4ND6A 1WVIA 4OKIA 4ZXPA 1JBEA 2AOTA 1NOJA 1Z26A 4GE0A 2AD1A 1V9LA 2A7XA 2Q3JA 3DVAB 2E85A 3RC7A 2NUTA 2IF2A 5BV2P 4EM6A 3I5YA 1MH1A 4LZZA 2HRBA 4MIOA 3IEMA 1HDCA 5KYYB 3KNZA 5LC1A 2O2YA 3V9AA 5JNSA 1IN1A 3H4TA 4E46A 1QH0A 1DO8A 2CW5A 3A2KA 3G6WA 3I8OA 4IP0A 1YQGA 3T06B 4A8PA 4CDGA 3UK0A 4D79A 1LWOA 4QHSA 2X9NA 1HLGA 4KO3S 5K03A 3QEMB 1EGVB 2WUDA 2VPXA 3QVSA 4K6KA 3EMVA 3UKOA 3W2GA 4UBJA 4XUEA 2HMUA 3HEBA 4GOOD 3UJPA 4Z2YA 3LL4A 1EJBA 3JQFA 5MN5A 1G6HA 1ISHA 1I4TD 4G07A 4GX0A 2ZBDA 3OOSA 3BZUA 3HQ4O 3P71T 2A67A 3WIVA 1DIBA 3VKUA 3HUUA 4DLBA 3H13A 4H2DA 1P0FA 4AY5A 4DZZA 4RDXA 3V4SA 1KDOA 2WWFA 2WTUA 1IHXA 2CB9A 4R8MA 4AP9A 3RLFA 5HCUA 1E1CB 4O2RA 1FTYA 2DY1A 2IITA 3IT2A 4NU5A 4BYMA 2QTTA 1X70A 1E62A 3ZDYB 1BU8A 4KLAA 1HXHA 4AECA 2WM9B 4JKOA 3A70A 5L4LA 4GQBA 3HDJA 4OKNA 5U4QA 1DEKA 4PAWA 5JS8A 2CLCX 3FMPB 4AULA 1X3SA 3I4FA 5E3JA 1J24A 2ZWMA 3EJWA 4AZ0B 4DG8A 1TYCA 4UULA 4BUCA 4D9GA 2D7DA 3ET4A 5TJHA 1SD1A 2OHFA 2A5GA 4R1NA 3SXPA 2IEZA 4ENPA 2GO7A 3VZQA 2O50A 4URVR 1ZM7A 3OQHA 3COSA 2H57A 5ALRA 2YQ4A 3EVGA 1Y1KE 4OOEA 4P84A 3I83A 5HUQA 3BRCA 1X9HA 5M2QA 3O4GA 2VDKB 2ZTMA 3ND7A 5BN4A 4Q7QA 1KDRA 4HNVA 1LLQA 2HCBA 4PN7A 4KE9A 4K9MA 1T3HA 3KYDB 3D4IA 3A0RB 1I6MA 1EE9A 3PFCA 1V41E 5FIUA 1EDZA 4X44A 1DV2A 2WHPB 2WNIA 5BYAA 1GNQA 3OEED 5CA0B 4TLBA 5EJ8A 4KQCA 5GVRA 2IUTA 1GPWB 1UAGA 5DT2A 4B0OA 4ZCQA 2C5FA 1QYCA 4QGHA 3RKSA 1JG6A 3VR5A 3FPJA 3PGLA 3WSTA 2XMDA 5FNVF 4CFZA 1OTHA 3WRXA 1TIPA 3FD8A 1G5PA 1H2ZA 2X8JA 2ZRQA 2QRJA 1OH8A 1OAOA 5IH3A 4BZQA 4DCCA 1D07A 3FDZA 2QM3A 3O82A 4JBIA 3VMMA 3U4QA 4GYWA 1TLLA 4CMBA 2EW2A 1DJNA 4MV0A 4OI2A 4Z4CA 1Z0UA 2IYTA 3RF7A 2FQYA 3P9PA 4FM9A 1D1PA 1ULHA 3P2JA 3ONNA 3TM5A 4YALA 3F6EX 2XZPA 1I7LA 4YBRA 2CLKB 3RH0A 4NCBA 4A26A 1LDNA 1PW7A 3HCBA 4HWPA 5F33A 1CR0A 2AJBA 3PDIA 3IUEA 4HDKA 4KU4A 1UPTA 2BTOA 1Q6ZA 5IDYA 2VYVA 3D6MA 2IOFA 1BVUA 2Z2JA 5IABA 4MMYB 1U7ZA 2JBWA 4HT3B 4ZRMA 5KNCH 3IIEA 2E37A 3CNNA 1Q22A 2WQ7A 2R85A 2YWCA 4JDPA 1OW3B 4TMWA 2WTBA 3AC0A 1H2AS 1NFQA 2VBCA 2ODTX 3VOAA 1QYDA 1VCOA 2Q1UA 3JQ8B 4R3NA 1JFFA 4R9VA 4ZARA 5G53C 1FEZA 5CB4B 3U62A 3TTUA 3K2QA 3L18A 2A86A 2VJMB 1RPJA 2ATIA 2P6NA 2V8BA 2LIPA 2VJCA 3VZSA 4ZRDA 2V4UA 3CW2A 1IUOA 4RZHA 4YRDA 2F1OA 1U8AA 2G4LA 1PFGA 3Q3HA 4ZOAA 2AWOA 8MHTA 2X4LA 3GMIA 1IPFA 1SD2A 5AJZA 1S4MA 1BE8A 1SEPA 3UB4A 5HFAA 2NVWA 4N0PA 2B7CA 1SHLA 5HHTA 3IMKA 4TKVA 5TMPA 3VI4B 3C7DB 2UUOA 4CRWB 1UIRA 2ONYA 4CEJA 5JDCA 4KQWA 1WCV1 1J6UA 1EMDA 3PXBA 3PVZA 4MAFA 4X3OA 1S6YA 4PG8A 2ZQ5A 2FMTA 4LYYA 3EISA 4Y6PA 1U8EA 3X1DA 5J1SB 2A5DA 5BSUA 2W70A 3T0IA 5JPDA 2YHIA 5F23A 4M7WA 1EIZA 4FFBB 4EI8A 2Q5JA 4I5FA 1QIMA 3NHZA 4MQFA 3ST7A 2PL3A 2VA8A 2QU8A 2UUBB 1TPYA 1SUFA 1WMSA 4ODIA 1DQZA 2HV9A 1D2NA 3HRHA 5ALHA 5JDCC 1BIFA 1KOLA 1OFUA 3DXZA 3FI9A 5JCJD 2F8LA 3QNWA 1J5XA 1GPUA 4BB6A 4YHBA 1SZDA 2V5AA 3TL3A 3PL1A 3U5TA 2IY7A 4O4IB 1RACA 4Q4AB 1NXVA 1OBCA 3FBTA 3HCEA 1BEEA 4CI0B 4EW3A 4Y18A 3OSUA 1FRNA 1N2EA 1QGDA 1W4ZA 2VZ8A 1VJ0A 3A1DA 5F1KA 3TAUA 4RZ2A 1PR3A 3I6ZA 3NWEA 1NJ2A 1P2SA 2GA8A 3FGOA 2YHUA 4YJDA 5M34A 4OHWA 3G9UA 2GKOA 4H7DA 3EG5A 4QT0A 2AR0A 3LKBA 3PD1A 3CX7A 2QRUA 3U7RA 3ZS8A 1LY1A 5DYGA 9ABPA 2XE4A 2QF7A 3DV9A 1C7QA 3F6PA 2NSYA 2QT9A 2CEKA 3ETJA 4GBJA 4F6CA 1N1MA 3VGJA 5B1EA 1NXPA 3HJUA 1JEYB 3RRXA 3FZEA 4WZBE 2V03A 3N53A 3SQOA 5IU6A 1SBYA 1G9TA 3H5TA 5DM70 1WTAA 4NK4A 2B78A 3NZEA 2QD3A 2AE2A 2IEGA 3AERB 1ZFNA 2FGKA 4L85A 3MSXA 2DB3A 3C7CB 4L27A 1BCRB 1PEKE 4FQ7A 3ZHTA 4B34A 2B4RO 1P6QA 2A1TS 2VXBA 2PX6A 1DJMA 1ZONA 2O2HA 1BQ3A 2W6CX 1EUDA 1HT0A 2JLSA 1X1SA 3BFKA 4WLUA 5JWHA 4BECA 4D4HA 2GEKA 4OQXA 3T15A 4G5FA 2C7PA 3K1YA 3QU7A 3VKWA 4AJJA 2HBRA 3DNMA 2NO9A 2HLPA 2EHJA 2IP4A 2IDZA 3CZAA 1GPLA 1LRJA 4YRTA 5FPQA 2VF5X 3TX2A 4CKCA 2CD7A 2BEWB 1MTOA 2GPJA 1R5BA 3ICCA 3TXXA 4NRDA 4UTXA 1E1QA 5GM1A 5D8DA 4BFUA 3R3VA 5CLGA 3HM2A 3GP8A 3I0MA 4S3MA 1NBMA 5BQPA 2RGGA 3N7AA 3PA6A 4EUNA 2QNBA 2QYTA 5EZ6B 5J5AA 2W6ID 3JAKA 3UM9A 2GJ9A 4ETWA 1NM5A 1B2RA 1ZW1A 2BCGY 1Q95A 1SURA 4HPXB 4AKHA 4GOMD 4JJKA 1DRUA 2WWIA 4G63A 2XDYA 1J9EA 4PC1A 3AONB 2KSQA 3ACDA 4D0RA 5TGZA 1U65A 1M5TA 3DMDA 3FPKA 3S4YA 3WK9A 4OUKX 3G2NA 5JMPA 3BERA 4C3UA 3G89A 4OQLA 2XVMA 4WRRA 3CH7A 2IYOA 2W71A 4QL3A 3TB4A 2J67A 4E13A 3DEIA 3BMOA 2H1WA 2GHRA 5AIAA 3VZCA 2HTEA 4OHOA 1UXIA 1LBEA 4TUYA 3EZ9A 2MR6A 2X2FA 2GZ1A 5HJ5A 3PGJA 5IBCA 3GLTA 4XTRA 4OQYA 2HHAA 1YGYA 2JAQA 2JBAA 2JJQA 3L84A 2C9DA 4U7TB 4FLMA 4MI9A 3VR6D 2VP5A 5ELXA 2I4NA 5HKOA 1V7ZA 2MTBA 4Q02A 1FFGA 1QM5A 2IXDA 2M2IA 2IIBA 1B8UA 5L7WA 2EBFX 3DBVO 5IHPA 4K46A 1FSSA 5KMGA 1TJ3A 1K9SA 5BV7A 3I28A 3R76A 3GY0A 3VNSA 1Z4NA 3D7NA 1V45E 3EW7A 4Y9RA 1NA5A 3GEEA 2P9QA 2PX5A 3DBRA 1ND6A 1U8YA 2EIXA 1L5QA 2O3RA 3PHIA 3B82A 4OK3A 2I5PO 3EXFB 4JGIA 1LPPA 5BV8A 2FGJA 2H1LA 1I24A 1UK8A 1U7TA 2JVJA 3GGOA 1SKUA 2AN1A 2WJJA 3F6BX 3Q3EA 2QX4A 2WVHA 1I5OA 3V00A 1OAKA 1BXRB 1Y3DE 2O7NA 3PXCX 1EK0A 2VOJA 5B7NA 2PBZA 4RO0A 3HP1A 1Z68A 1RRKA 3VVLA 5E6RB 1D1TA 2ZWAA 2AEMA 1IEXA 2C0QA 2QVBA 2ZK7A 3GGPA 5K3BA 4JS0A 1NMQA 4QPJC 4QPZA 3UW3A 1OWOA 1MAVA 1YQ9A 1D9ZA 2Q41A 3HN7A 2GWHA 1M2VA 2CNWA 2P1DA 3KBBA 5CA1A 3AR3A 4GVLA 5FKJA 4KXFB 1ZMTA 4R7TA 3WZMA 3SHQA 3TSAA 1IRIA 2P0AA 4MRMB 2LNDA 4AURA 3QTLA 1WX1A 3AESA 3AG5A 3KZ1E 4E5VA 2XCTB 3SXUB 2HFKA 2YFYA 4ICIA 4Q4JB 5TQ2B 3V42A 1K89A 1X13A 3GJTA 4U5XA 1RD4A 5DXJA 1TKAA 2FW1A 3IB3A 2P40A 3AEQA 3GG9A 3D54D 2QD4A 1RMQA 4TZTA 4N9WA 4X60A 5FFFA 4AJ2A 3FYSA 4BO7A 3E8XA 1Q2UA 4AMGA 4C0WA 5HOQA 1ZUNA 2K7FA 3TTYA 4MTCA 1OQAA 1SHTX 3AY7A 4FZ3A 1P2DA 2GAIA 3JZIA 5LA6A 2P9EA 5F76A 3SICE 4HLDA 4GD3Q 3N0XA 2NUBA 1KI9A 3PQ6A 1IK4A 2VP6A 5COBA 4TWJA 2WTMA 4D6XA 4ABTA 2YYYA 1U11A 2HPZA 3DZJA 3TOXA 5I9TA 1YR6A 3KSDO 4CBVA 1I5EA 4LRXA 1QX3A 4EB6A 3PEEA 2ILTA 3AM5A 4UTZA 3BICA 1GV0A 3GMTA 3C3CA 3ONDA 2FDCA 2I2CA 1FXWF 3HY6A 2OB1A 5CUQA 1JKJB 1MGPA 1R00A 4K9PA 4EI7A 1C4XA 3E84A 1JHVA 1FSGA 3OCCA 1NOIA 3WL3A 3BX1A 4BASA 4F21A 2Y3IA 2AFVA 4K2HA 3I61A 4G9EA 1VLLA 3QYPA 4W99A 3QVUA 1GCIA 3WKBA 3DLHA 2CDNA 4KQGA 1CNFA 2OL4A 4MA0A 4B3TB 1U31A 3GZTB 5HJEA 5JD5A 2A30A 3STWA 2JFOA 1GEGA 1PSWA 3ACBA 1PGOA 2OYSA 3P32A 2PRJA 4NICA 4L6IA 3IC5A 3TYXA 2PJRA 2Q6OA 1G5IA 1U2RA 1XZ8A 3C15C 4GDMA 1DC8A 3LHIA 4EO7A 3AB3A 1VL0A 4CL2A 5AH0A 1FTSA 3COVA 1W8DA 1P4AA 3ESCA 4QGGA 4DSAA 1GGMA 2OGWA 3N58A 1TW2A 2VVTA 4K5QA 2OQRA 4O08A 1QO7A 2X6QA 3IIMA 1A4RA 2YZGA 4H4EA 4NBTA 1F5SA 1V5GA 4RW0A 4ZVTA 5LDGA 4DLTA 5MN6A 4EHJA 2C9CA 3U09A 2GZ3A 3OCZA 3QU2A 3HE3A 3W7AA 2QS9A 1S3FA 1Q16A 2Y2UA 4LF5B 2X86A 4XRGA 3UAGA 3RUEA 5L51A 2JLVA 4H6WA 2GS9A 3FM9A 4UASA 1M6NA 2YVKA 2XXAB 4ND4A 4DMKA 3AF5A 3I73A 2H3EA 4DKXA 3CX8A 4F8EA 1NSTA 2AL7A 2BKUA 3IP6A 4KN8A 4MRRA 4FP9A 2GZHA 1Q7EA 2B69A 4IQGA 3HBJA 3KIPA 1EHYA 2D8AA 5AK0A 3K09A 4WNCA 1OYYA 4D8UA 2WFMA 5T4EA 4JLJA 3WB0A 1J06A 1NUUA 1JMKC 4LDJA 4WECA 3REGA 1P73A 3C6BA 1BWPA 3GW8A 4Q5IA 5EXEA 2CEAA 3BHJA 4B6PA 2DCUA 3E5NA 3I9NA 4QYXA 2XQIA 5T4BA 3RAPR 4B43A 1KOGA 4FDAA 1E1KA 4NYMQ 3AVYA 1MO5A 2VDUE 2H1RA 1XRMA 3X1XA 5I9LA 3QMWA 2X0KA 1XHFA 3C24A 4DDHA 1P1IA 2OENG 3NV7A 3C6KA 4Z7JA 3KQNA 3ZVKA 3SVLA 1XD2A 1P7CA 3EY9A 1I0LA 2I2AA 4G5GA 4PZYA 5AVWA 1NN5A 2WUGA 3WBFA 1ENZA 2CKDA 3LQFA 2QW0X 3BHIA 1QP0A 2DWUA 1AU9A 1OY1A 4F5DA 3L1IA 2XRFA 4YO7A 3CVWA 4LQ4A 1GA6A 3UJ9A 2NUAA 2V7QA 4C3OB 1EGAA 1JT9A 3ENVA 1CIJA 4M36A 5CDGA 4IIHA 5F9HA 3MIIA 2GM9A 4HX2A 3VR3D 1DBIA 5KJ6A 3X1WA 3B85A 3BXEA 2QGFA 1CV2A 2GLXA 1ZL0A 3ETGA 4G1EB 4EGQA 1F6BA 5CDFA 5KX5F 1HNXB 1A1SA 1XZLA 1R8QA 2CZQA 1H1TA 4B3GA 3IDZA 4F84A 3WGIA 2F3SA 3FDXA 5KNLA 1TZCA 3LQ2A 3LMKA 3FCYA 1HA3A 4YLYA 2UYHA 1W96A 3LO8A 2FX5A 1VPWA 4MHTA 1C7ZA 3LWDA 2IC5A 2BH2A 2JJ2A 3OX4A 2D0DA 2HWXA 4J7UA 2FSIA 2XQJA 4KACA 3ZHRA 4TYPA 1U8ZA 2F1HA 2G9ZA 4LRYA 5DEIA 3F71A 5ALKA 1C8VB 5CLJA 4JBGA 3RIHA 3NJ4A 2OB2A 4JSTA 1RQ2A 4EG5A 1MA0A 2NYVA 5IDXA 2GCNA 2W83A 3EXAA 5C53B 3RAJA 3A6ZA 4NMWA 5E9AA 3E9YA 5C5CA 4L57A 2XUPA 2VT6A 3NDPA 4TWIA 4B6QA 1D2RA 5E7JA 1NZDA 1X1TA 3EF3A 3H97A 3FTCA 1QE3A 3N75A 3W4IA 1P0CA 4F92B 4FYMA 1M8JA 2XOXA 5C4IA 4P54A 2WVAA 3W2EA 2V7WA 5THQA 2BWJA 3RG8A 1V3UA 2FZGA 4MKXA 1CZUA 1E2UA 3T7JA 5K0EA 4HDNA 3MINB 1E2MA 2XZLA 3D6AA 2AT1A 2GF0A 1WUKS 3EIFA 3LK7A 4YCDA 3V9PA 2X8AA 2XYGA 3U7IA 4BCCA 4X66B 2GYVA 5KVSA 1E3LA 4JJ6A 2IUFA 3NFYA 4BAGA 3OE7A 3MJCA 3JRNA 1IN4A 1TUBA 3BH0A 5J43A 3LF1A 4P0TA 3HUDA 5SY6A 2OXEA 1NV9A 2B8JA 4D8VA 1B8OA 3VU3A 2QLLA 3A6JA 3UPDA 1ZXLA 4KVZA 3ZNQA 3TW6A 3TUIC 3EUAA 4F5YA 2WJIA 1FRZA 2OKCA 2V8OA 4UM8B 4XIJA 2OV3A 2FCRA 3HXPA 4J29A 2PO7A 4NOKA 1Q2XA 2PZFA 5KB3A 4JP1A 4M9ZA 2J0VA 1SKYE 3RRFA 3HBAA 3VNQA 1C5KA 4G1CA 2IZ5A 1NTRA 2KBFA 2Y99A 3IE2A 3KK0A 3WKEA 1WVGA 2PYDA 3DT8A 4UFOA 1Y5LA 1AZTA 2WWTA 5C80A 1E61A 5I9NA 4TVSA 3HK2A 4WKPA 1C9MA 3LUHA 3W06A 1DVRA 1YD7A 4TKZA 3ZIAA 2XCUA 2WQ6A 4HQFA 4BXOA 3D8RA 3A1SA 3DPUA 1U7XA 3EVEA 5A62A 1L7QA 2ASVA 3ZCQA 3H9CA 4RJKA 5EIAA 3SE0A 3WGTA 5INTA 5JFGA 1QQ6A 1M34A 4AAYA 1XZFA 2R66A 4F06A 1GGKA 4UHKA 3C3AA 1JFSA 3DLTA 5TY0A 2NTYC 2V3WA 2XUOA 1CQJA 4US2R 5CX4A 3T5GA 4E0BA 3NETA 5DISB 3DLPX 1V16B 2YIVX 4JP2A 1WDWB 4CLDA 1T3GA 5BUQA 4PZDA 4AS3A 4S35A 1I0ZA 3HHPA 4MS3A 3DL4A 2YNMA 2D59A 4KXMA 3CVJA 3L41A 3L46A 2PKQO 5FTJA 5L7YA 1S8AA 4B31A 4TYYA 1PRYA 4LZNA 4C08A 2W2XA 1USKA 2GJKA 3E6AA 3ER6A 3FSGD 4A6PA 4U8GA 4OO3A 3ROKA 1ESZA 2BT4A 2M1XA 1XLWA 4K03A 1ADGA 5TX7A 4ZT3A 3OLYA 13PKA 3B89A 1BS9A 1K88A 1KZ7B 4R1LA 2EQAA 4RHCA 5DSTA 4EUFA 4TM7A 1ZS9A 5G4KB 3S70A 1E18A 1RI1A 1UWCA 1GSAA 5B4TA 1XZGA 3GX1A 1LI5A 4HYTA 1PJ2A 4DYHA 5DJ5A 4AM8A 1DEAA 4BNGA 1L4UA 2JZNA 3DO8A 2CXPA 1C41A 5A71A 5JSHA 2GFHA 3IAAA 2ECKA 1TKBA 4YBZA 3AUFA 2VDWA 3HYNA 2JH3A 1N77A 1KJIA 2I7VA 3KJEA 3I9OA 3C1AA 1SXJB 4DANA 2E1PA 1QGUB 3WNQA 1NKTA 3M8KA 1P4SA 4B35A 5DZSA 2A4KA 4IR7A 2ZCUA 4E07A 1P4GA 4URHA 2E4UA 1TFUA 4TRRA 4B17A 1ZQ9A 4EVRA 4F8JA 1Q0PA 5BW8A 3T5AA 3PNYA 1PQWA 1TYAE 5EIBC 1SVNA 5BVGB 2Z2KA 3MGAA 2G04A 1ZR4A 1WSAA 3ETLA 3QBJA 4P7BA 1QPGA 3PYLA 3JARB 1TKCA 5KVQA 1DE0A 1NUAA 1HLFA 3V7UA 3B2NA 3LP8A 1S3IA 4YAJA 5EIXA 1X15A 2CUNA 2DHCA 2DHEA 3KFXA 4I08A 4IUYA 1KE1A 3SI7A 5EJ2A 1JXMA 1X0VA 1XAHA 1MEEA 4MVJD 2FWBA 2JRCA 4ZHQF 3QWBA 1WU7A 4PR3A 3DJYA 3CF4G 3OU6A 2HDWA 1PV4A 3NCTA 4DRXB 5J4VA 4EENA 5COAA 4O6VA 3B1WA 3PWKA 1PWEA 2XTJA 4KH1A 3D5TA 3A1WA 2AFRA 4JBWA 1ZEJA 2V6BA 1BYIA 2RMKA 2C61A 4LXXA 3HB4X 4MNTA 4U7GA 1SQ0A 3RS7A 2IJGX 2WHEA 5F21A 5C3MA 1ZRHA 1KH1A 3EUFA 4NNOA 4NYJQ 3EWIA 4KO8A 4BMPB 2HF8A 2B1JA 3V33A 5E6UB 4P4UA 4M86A 2BFDB 2VPTA 3W5JA 3I9LA 1GNRA 10MHA 2C5EA 1R4NB 1CNEA 3LPLA 1YASA 2GT1A 3QKWA 1QR2A 3GEIA 3N2KB 3CURA 3A9UA 5AM0A 1JV2B 2ZE6A 3PUYA 421PA 3EW9A 2WD9A 4JEUA 2COUA 3GUYA 2HH9A 4L75A 2WU8A 1ZUIA 3L0ZA 4OSEA 1HZJA 2WWXA 1EGMB 4P83A 1P61B 1Z6QA 2QBYB 3HDYA 4OB6A 4CPDA 3VPDA 1B00A 1C3OB 2JGKA 1WMEA 1KPIA 3U3JA 4BGEA 4CDMA 3GT3A 4G1VA 4KFRA 3SP1A 4FK8A 4NNPA 3VOTA 4D0NA 2R8PA 3KO8A 3VJRA 3VSDA 1HQDA 3HB5X 1DARA 2AZMA 4F46A 2Q3FA 4I1RA 1P1CA 4KXLA 2GHTA 5AVVA 1JKIA 3JQGA 3PNLA 4PNEA 3L0CA 1ISPA 1AY0A 1KEEB 2GESA 3FRHA 3K5HA 3VSCA 3CZ5A 4K0RA 3TQHA 1J5PA 3KQKA 1QMPA 2QPOA 1ULZA 1UF9A 3AEXA 3LC1O 3DVAA 3DW3X 3CW9A 1NAHA 1TEXA 1CKEA 2VL7A 4L28A 3IDOA 5KYYA 5IULC 1HSOA 5G1OA 2HW8A 2X0EA 1U28A 3AUKA 4KQ6A 4NY1A 4D8XA 2B8NA 3N70A 3PI7A 5DX8A 1D1QA 4BDTA 4CQJA 2CCGA 3B38A 4F7DA 4AY2A 5IXJA 4GO1A 5IF3A 1NI4B 2EFCB 4OJTA 3WLSA 1T2FA 5DLQC 1USGA 3WFIA 2J5KA 2O14A 3GRCA 4W4TA 3E82A 5DLEA 1Y9AA 3GEGA 1RRVA 1KI8A 1Z2OX 3GH1A 1PK8A 4ND1A 2OCBA 4MKFA 3BB1A 1CB0A 3I39X 4C7VA 2FVXA 3IXQA 3OIYA 2XJ9A 2D5CA 4MKGA 1GFIA 3N3AC 3ZWBA 1FMJA 4FYHA 2WSBA 1E1CA 1QWOA 1QHXA 3AVPA 3CF6R 3KJXA 5K8VA 2RGBA 4C2UA 2H2WA 4NDNE 4AZ3A 4NNJA 3WWZA 2R48A 3M3DA 4CGYA 3MRVA 1Y9EA 4MYCA 3S2IA 3QYFA 4Q7MB 3MN1A 2X6RA 5LP6F 3ESQA 4LNUB 2OZLB 4A03A 3BBLA 3OU2A 4AZ0A 4FUTA 4EEKA 4LAFA 4M9UA 1E1RD 1G8SA 1SRQA 1BGXT 4V2IA 1JLMA 2YJTD 1YBAA 2RI0A 5DNUA 5FTLA 5LPNA 3NX4A 1P3DA 3CFYA 4QC2A 1JWLA 1PGPA 2QJWA 3ULKA 1SIWA 3PUXA 1JVBA 4EPVA 3RUHA 4BNNA 3R7SA 3PLNA 3CH5A 5EP3A 2H08A 3UGQA 3BKWA 1BFKA 1N2XA 1QFJA 1X9GA 3CBQA 1ZSVA 4A6XA 5ICFA 5EIOA 3E8SA 4HRXA 4DKJA 3FYUC 3OWOA 4B8YA 2ZVDA 4CMHA 2WHPA 2QL6A 2DPXA 2ORYA 1L5HB 1RM3A 2ZIAA 3GJXC 2WAMA 5JO0A 1YK0A 1NZJA 2DFPA 2H4ZA 5JNWA 2BGTA 4UTNA 3GLQA 4J2HA 2Z56A 3JWJA 1H4QA 2HCTA 4G4SO 4MKRA 4P98A 3BHMA 4OYYA 1L8OA 3QW4B 3T7CA 3BQMB 5T7BA 4WCDA 3GRZA 4EFLA 1HETA 3V1TC 3KTFA 1IHUA 5EJIA 3L4BC 4JJ8A 1VMIA 5EYPA 4IZOA 1PUXA 2I6QA 2QQEA 4LEIA 1Y7LA 1CQIB 3ED1A 1YS1X 2E4ZA 3ZV4A 3LBNA 1ZKDA 2R11A 1ITZA 2CSUA 2QW1A 3SZUA 1YUMA 2O1EA 2QP9X 3OBBA 1D4OA 2R6AA 4LX8A 1KE2A 3D2CA 4PCAA 2NV6A 3E35A 4RY8A 6ABPA 3L4KA 3HI4A 3LUPA 2GAAA 5JQGF 1H1DA 3E7WA 4NZ9A 1GSHA 3UJ7A 3IP9A 4UNSA 2ATEA 3KPUA 1R88A 2OC9A 3Q2OA 3RE1A 3X1YA 4XA8A 3TZLA 4B3RB 4DMMA 1FZTA 3JQ8A 1T1EA 5CB4A 3MVEA 3E9DA 3O4IA 2ZROA 4YJ3F 1N78A 4IX1A 4DJJA 1Z0KA 2ISSD 3O84A 2VJMA 5C8ZA 2QMEA 3K6KA 4AP5A 1FSZA 3PNPA 2E48A 3ZQ6A 4EHNA 5HK8A 2WJ6A 1UDXA 2Z5VA 3PUZA 1TNDA 2HA3A 4ZA2A 4Z7NB 4IAOA 5K6TA 2N9UA 2XKKA 4FOLA 3GCZA 5CPBA 3ZHOA 1ZOPA 5CDSA 1YMQA 3AFNA 4JLOA 3ZUGA 1XRQA 1DG3A 1F8UA 3PKZA 1CDEA 1Z8FA 1ISIA 1Y5MA 3QE3A 1GKUB 5C7IO 4UQPA 3KX2A 5REQB 1IN6A 1N6KA 2VJPA 4MQBA 4M1MA 4A0FA 3E0QA 3KWLA 3VU9B 1PR5A 4BQIA 4J0QA 4DJAA 3ROMA 1GPJA 1U2SA 1Q3KA 1B1CA 1MO4A 2GN8A 3LP5A 3NBZC 5CH5A 5C5DA 1WMFA 1XCPA 1Z4KA 2G1UA 5CJPA 3C85A 1MN6A 1ZESA 3PF9A 3UFXA 1ODKA 4RLFA 4FFBA 4TT8A 4RDIA 2G9NA 3OD5A 3IQZA 1JSXA 3KZOA 1NUPA 3MGKA 4CIXA 4L02A 4UXJA 4J75A 2XWJI 3LKZA 2JLXA 1JNYA 2CNNA 3OQ1A 4ZP1A 3ERCA 2FJUA 4P35A 3Q9LA 4DMRA 1F8FA 3VPFA 3T94A 4O4IA 4Q3CA 1CERA 4MQMA 3IV9A 2G7MC 3UJDA 4AG3A 4C05A 2ZSJA 4JB0A 3OF2A 4KR0A 3MFYA 2W2MA 4YUXA 3LUBA 1AOXA 3K1AB 3M6LA 4ARCA 1V1MB 4TLEA 2QR5A 2VKTA 4IFTA 4P53A 4ZV9A 1S2OA 2EP8A 3ASYA 1OGIA 3LGSA 1TA4A 3OOJA 4YACA 4EGJA 1VLMA 2VR1A 2QUJA 2ZJ6A 5C52B 1Y6GA 4CKEB 1RHRA 2EF1A 2QUKA 2V9CA 2LKDA 1HQYE 2GBPA 3O8LA 1IQ0A 1DKRA 1UBHS 2OGSA 5T6MA 1KJNA 1WZCA 1AK9A 3GGGA 1JEYA 2Q45A 3G2PA 2NV2B 2XT6A 3KUKA 2QLBA 3T41A 3D0KA 1A96A 1EA5A 2WSLA 2A33A 2WB4A 4P86A 3LYHA 4XFJA 2P5YA 4Z8YA 2JAHA 4OQ4A 2WTAA 4W9NC 4EW6A 1YS6A 1E5XA 1SCQA 4E5NA 4GZLA 5IFLA 1KQ3A 3TQTA 3JVVA 1KFCB 2RIPA 4JJGA 5EUMA 1I2DA 2QGZA 4YQFA 1NVVQ 2QUHA 3LA8A 3RJ5A 2WP0A 4B3IA 2PMBA 1MV8A 4YQEA 1UXOA 4Z0NA 1VPTA 4X0EA 1UFKA 1NMXA 1CUBA 1GZHB 2BEWA 4QFMA 2YV5A 5D7NA 3RIGA 5LYJB