2IDMA

2.00 a structure of t87i/y106w phosphono-chey
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2idmA00
3LTEA 4PEVA 1E6KA 3VNBA 3OO1A 3MMNA 3QEMA 1E6LA 2WB4A 1QMPA 4MS4B 2FTKE 1SRRA 3CG0A 4TLLB 5KQGA 5C5EA 2FEKA 2V0NA 3URMA 3CU5A 2CD7A 1ISRA 5JS2A 3CS3A 1Z25A 3ILYA 4Q7EA 1ZAYA 2NUBA 2WJWA 1LJLA 2LIVA 1W25A 1Z2DA 5B3JC 2MYTA 8ABPA 1C4WA 1Z17A 3OQOA 1BAPA 4RWEA 3P9YA 1RNLA 3C3KA 2PKXA 3EQZA 3QLVA 4RK0A 4E7PA 4YLEA 2RJOA 4EYOA 4NICA 1NXPA 4RK5A 2PL1A 3IP5A 1LBIA 1NXTA 2JVKA 3RVSA 3CFYA 3NNDA 1ZGGA 3NHMA 2TMYA 2IKSA 2A9PA 2VYCA 3EAFA 4MQEA 2VUIB 1NXSA 1D1QA 4YP9A 4YS6A 4WXMA 4OLBA 5KC8A 3O75A 2GX6A 4Z4EA 2HJ9A 4N0QA 3D02A 3IP6A 5KWSA 4MAAA 3H5LA 3OLVA 3T95A 2X7XA 4WXEA 5CNJA 2WY2D 2QXYA 5FWYA 4RKQA 3GBPA 5HSGA 1PUXA 2FQXA 1FFWA 1Z26A 5IUNC 2RGYA 1DC7A 1W9HA 1TVMA 1KMIY 3KLNA 1L5YA 2L18A 3RVOA 1GUDA 3F73A 4H60A 4YWHA 2VK2A 5IX8A 2PUFA 3IP7A 1GCGA 4JP1A 1P6QA 3FMVA 3IPCA 3T8YA 2WJAA 4NV3A 4W5NA 3O74A 7ABPA 2FMFA 3LKBA 4FE7A 4MRMA 2WWVD 1JDPA 2FEPA 5IEBA 4DADA 3HO1A 2MSKA 4ETMA 5EWJB 3NNNA 4TN5A 4S04A 4N41A 4LX8A 2FQWA 5TPWA 2L2QA 3HZHA 1SXIA 1NATA 4MQFB 3Q15C 3KKEA 4F8JA 1ABFA 1YK0A 2JBAB 1QKKA 3KS9A 1USGA 5CNKA 1XHFA 4ZYLA 3BREA 1D1PA 5GQSA 3O2JA 4ZJPA 3O1JC 2LP4Y 5TE9A 4IMIB 3KTOA 4DN6A 4RS3A 2R25B 2A9QA 1RZRD 3SY8A 4MR9B 5JNSA 4OATA 1VRVA 4MLCA 1U8TA 2FQYA 4G0XA 2QZJA 4FB4A 3OLXA 5TQ2B 3Q7TA 2R47A 5DKFA 2ID7A 4N76A 1SXHA 2NZVG 2OENG 3F6PA 4EVSA 2YHAA 5EWLB 2I6FA 1JFVA 1JFSA 5JS1A 3RVJA 3GBVA 4E7OA 3ROFA 1YMVA 1C0EA 2PUEA 4H3HB 5TQ0A 3QEMB 4IILA 2FSPA 1YS7A 1QNLA 3OMXA 2M98A 3GA5A 2FEWB 2QVCA 4Z4CA 2B1JA 3RVPA 5KC9A 5KQPA 3HM9A 3H1GA 1E2BA 4JASB 3H5WA 1JBEA 3CG4A 3LUHA 1U0SY 1TM2A 2PL9A 2YHBA 3N0XA 4MS1A 5D2CA 2E4VA 3MIZA 3E61A 1YVUA 3D8UA 2IPNA 3EGCA 4HYEA 4L85A 5ABPA 9ABPA 2QW1A 3N53A 3JVIA 1YMUA 3HXMA 4O1HA 4GNRA 3HK2A 1D4ZA 2GI4A 2MSLA 3H6GA 4KRFA 4IRXA 3RVLA 2QR3A 3O21A 4MS3A 3KYJB 3G1WA 3FGZA 4IGAA 1EFAA 3DBIA 3FFTA 2L19A 3HUUA 2QV0A 1U2QA 2MSWA 1BDIA 2IOYA 2LPMA 3L49A 4G0ZA 3CZ5A 1MB0A 4MQEB 4RK4A 1RPJA 2DRIA 3H5OA 2A9OA 1Z15A 3H1EA 5TQJA 1M5TA 1URPA 4ETNA 2WMYA 1YS6A 3OM1A 3CHYA 3BRQA 4OLAA 2JB9A 3QLUC 1XHEA 1UDRA 2FMHA 5FWYB 2RJNA 1USKA 3W9SA 2FKAA 3CRNA 4PE5B 1QP7A 5DTEA 5HM6A 1R8JA 1DCMA 4EVRA 4Z9AA 4EYKA 2AYXA 2MYNA 2HPHA 1PNTA 1JHZA 2IPMA 1EAYA 3QEKA 4N47A 1MIHA 4G0OA 3OO0A 5HKOA 1RZRA 3K9CA 4MRMB 1ZH2A 1H9CA 3BRSA 1NTRA 1HEYA 3CLKA 4RKRA 2H3HA 4F06A 4LE2A 2PUDA 3QLVC 1MB3A 2L17A 2ZAYA 3T6KA 2FMIA 5TPWB 1K66A 3JPYA 3HDGA 4WUTA 4XFKA 4G0PA 3MA0A 1FFGA 2GWRA 3JY6A 4QICA 4YGXB 4D74A 4W5RA 1JYEA 2WRZA 4FE4A 4JB0A 1JWLA 3OMWA 4KFCA 1EHCA 2E4UA 3B2NA 2NT3A 4QYMA 3QELA 3BBLA 4W5TA 2ZWMA 2FN9A 3HEBA 3FFWA 3HVRA 1NXVA 1ZHHA 4F3TA 3LFTA 3I5AA 3F7NA 3LUGA 4JAVC 3UKJA 4MS4A 2E4WA 4ZMSA 4NCAA 1ZDMA 1ZESA 1LBHA 1LJUA 5T7BA 1XWWA 1Z16A 2FLKA 3VNAA 4LDZA 1TMYA 4MR8A 4NCBA 4HNSA 1CHNA 3NBMA 4KVFA 2E4ZA 4D6XA 1GLGA 1BDHA 3H5VA 4KK3A 2FVYA 1JF8A 1T34A 2GBPA 3FDFA 3C3WA 3NNSA 4P1ZA 3A0RB 3C97A 1DBQA 4MGEA 5JNRA 4RY9A 4JA2A 3IDOA 1A2OA 3OLZA 4XLTA 4PICA 1A0OA 2FN8A 2NZUG 4WT7A 5KQMA 1OXBB 3GL9A 2E4XA 4KQCA 5TQ0B 2JRLA 3DLBA 3H75A 1Y1LA 3NHZA 4RK6A 1P2FA 4KMRA 2FW0A 2R4QA 2A9RA 2CWDA 2JK1A 3EULA 4EGSA 3QLTA 1I3CA 4QYWA 4RXUA 4XARA 3HSYA 4RY8A 5IULC 3MM4A 4IMJB 4MS1B 3KG2A 1DBPA 4RZSA 1DC8A 2AYZA 3F6CA 3KSMA 3TO5A 3LUKA 4QPJC 4YCSA 4LE1A 2HQOA 1QQAA 1DRJA 1JL3A 1YIOA 1QP4A 1FQWA 1NY5A 4UHJA 2NT4A 4Z4GA 3RVMA 1CEYA 4YO7A 3TD9A 1M2FA 1NXWA 5IEJA 1VPWA 5TPZA 5CHYA 4DQDA 3MF4A 4MS3B 1PEYA 5DCLA 3FFXA 4KK4A 4EYQA 1ZITA 1ZH4A 3LUAA 3RVKA 4CBVA 1GCAA 4ML3A 4Q6WA 2JVJA 1ZY2A 3O2QB 4N03A 3KLOA 1PEAA 3BILA 3JS5A 1L5ZA 1LK0A 4JOQA 2CHEA 2FXIA 2ID9A 4O5AA 5E3JA 1PNRA 3R0JA 3CNBA 3HJFA 4LDAA 4EYGA 3G85A 5I4CA 5IUKC 1ISSA 3H5TA 2E4YA 1CYEA 4ZPJA 3LMKA 5JNTA 1DG9A 3S99A 2GKGA 1KGSA 1JYFA 3HS3A 1F4VA 3UK0A 1APBA 3OQNA 3RVRA 1SD5A 2W42A 1Z2EA 4S05A 2QU7A 4KZKA 4N0PA 4EUKA 2N9UA 4G97A 4W5OA 4W5QA 2PUCA 1U2PA 3HDVA 2R48A 1ZGZA 3UUGA 2QSJA 2P9HA 3GT7A 4RK1A 1M2EA 1P8AA 2HSGA 3Q41A 3SG0A 3N0WA 3DZDA 2RDMA 2CHFA 2PE5A 3O1IC 3O2SB 4D6YA 4M88A 5PNTA 2HQRA 4L4UA 1EWTA 5T3YA 1YTUA 3GWGA 5FWXA 4RXTA 3L6UA 4NQRA 1YK1A 3QELB 3N75A 1EWVA 3M6MD 5TPZD 1U04A 3N8IA 3EODA 3QX8A 3M9XA 4IF4A 3OM0A 5B3JA 1JX6A 1JFTA 3SNKA 4LRQA 3C6QA 1B00A 3JPWA 4KQ9A 1MVOA 1F51E 1ZN2A 4MR8B 2IDMA 4HNRA 4P98A 4RK7A 4OBBA 3GV0A 2F8TA 2IYNA 4RU1A 2BGGA 4F11A 5KQLA 2J48A 3KJXA 3JVDA 3K4HA 2OQRA 3A0UA 3HV2A 1OXKB 3ILHA 3I42A 2P4UA 2PJUA 4MR7A 1J56A 3LKVA 4B09A 3LUFA 4MPTA 5IC5A 1QO0A 5EWMA 1MAVA 2FLWA 3DGFC 5KI6A 4XXHA 3Q7RA 1BA2A 4O1IA 5JNUA 3SQNA 1TLFA 4RDCA 4XAQA 3IPAA 1IIBA 4TMYA 4RXMA 5GOTA 3I45A 2Q5CA 1GUBA 3Q9SA 4OTZA 4RV5A 1DP4A 4ZMRA 3TB6A 4OG2A 6CHYA 1KRXA 3TMYA 1E6MA 1Z13A 4RSMA 4PYRA 3GRCA 4LE0A 3I09A 1BVHA 4Z0NA 2QVGA 1SXGA 3OLWA 5CNIA 1P6UA 1ZVVA 4KPYA 3MQ4A 4G0YA 4Z9BA 1DRKA 2LUOA 1Z12A 3SM9A 1PHRA 3O1HB 3CZCA 2H0AA 4GPAA 4Z99A 4YRZA 3EQ2A 3LOPA 1RXIA 1VLZA 1TJYA 3EJWA 4F12A 4WWHA 2B4AA 4Z4HA 1D2AA 2M1ZA 3M9WA 5HQJA 5IUJC 2HQBA 4YR7A 1JLKA 4MYRA 3H5IA 4KREA 3HUTA 4G0QA 5BRJA 1FSPA 1RXEA 5FBHA 3H6HA 3QX9A 3RVNA 4KNYA 1FFSA 6ABPA 5BRAA 4ETIA 2JCGA 2MYUA 3N6VA 1USIA 1QO0D 2IPLA 1S8NA 1DCKA 4TLMB 3Q7SA 5IBQA 1QP0A 3RVQA 3DLHA 3SAJA 2PUBA 5DLEA 3EDCA 1AB5A 1JH9A 4EVQA 2F8SA 1DBWA 3A3KA 3CKMA 3JTEA 3OLYA 2PUGA 2LBPA 4RY0A 2XDYA 3IP9A 2O20A 4H3KB 4Z4IA 1M5UA 1A04A 3E3MA 3KHTA 5EWJA 5F64A 3TX6A 5ED4A 5CNMA 4LZLA 2IPAB 1K68A 3MYYA 1NXXA 3KYIB 5FWXB 3RQIA 4KV7A 4EY3A 4PZ0A 4MQFA 1ABEA 3C3MA 3ROTA 1KRWA 1BDJA 1VKRA 2JBAA 3KCNA 1Z18A 3LUDA 5JNWA 2VUHB 2FMKA 5C5CA 2MYPA 4G0MA 3HCWA 5FBKA 4XASA 3LUCA 1WETA 1EWKA 1DJMA 2JVIA 4MLDA 4MR9A 5BQ3A 4HNQA 2PUAA 2PMCA 4JB2A 4YV7A 2PAFA 3DGEC 3H1FA 1JDNA 4G86A 4WZZA 4Z4FA 3GYBA 2PLNA 5TQ2A 1AB6A 3LUJA 1QPZA 1QQBA 3A10A 4UHKA 5JNVA 3N0RA 3CTPA 4MR7B 3T38A 1DCFA 4Y9TA 1NXOA 5BR1A 3OQMA 2KYRA 3RH0A 5DGCA 1DZ3A 5EWLA 3QLUA 4Q6BA 5EWMB 1D5WA 3QK7A
chains in the Genus database with same CATH superfamily
1Z8HA 2KX7A 2PUWA 3IQXA 4XB1A 4WKCA 2VJCA 3TRKA 3DQQA 3FNGA 4AJ1A 4PZ9A 4QJBA 2GRJA 3DE7X 1XZHA 3A7EA 3OM8A 2HRCA 2JLXA 1Y7PA 3LOQA 2JGAA 1J97A 2OV8A 2YNMC 1TADA 4BWGA 4DOMA 3MJSA 1OC4A 2E0IA 1P29A 4JGIA 4PZYA 3KKQA 1G6HA 3G7SA 4CN8A 5KREA 5F77A 3N5KA 3AXSA 3D8SA 4HQ6A 2ZRIA 1A9QA 4QOIA 3G89A 2MINA 2MYTA 8ABPA 2CGEA 3I8OA 2J45A 3CISA 1AURA 4RPIA 3ZXUB 4EW6A 4NZOA 2OSBA 1V1RB 4KJZA 1OPRA 2F64A 3AIOA 5KTRA 4UHCA 1YJ8A 4BWFB 4ZMBA 1WUYA 4Z1MD 4KITB 5H1YA 3CEMA 2IKSA 2A9PA 1DBRA 4X6YA 4CIDA 4Z7NB 1VGRA 3D6FA 3N58A 5DXFA 1NXSA 2D06A 4NP6A 5PGMA 5DN9A 2A1TR 2EV9A 3GBSA 3MWEB 3PHHA 4ZREA 1ZR4A 1UJNA 1Z68A 2YHIB 3DE5X 3F4KA 5AUPB 3D02A 3D8RA 3K9NA 1P75A 1W5SA 3GROA 4M8KA 3OLVA 3KKLA 2VI5A 4BE7B 4I4TA 3JQ8A 3EGEA 2HHHB 3PF8A 5EIBD 3GBPA 3C3XA 4I4CA 3WJ2A 1RTKA 1KI8A 1Z26A 3PUWA 2VWHA 3QPUA 4RHUA 1OFTA 2HM7A 4UXJA 5FL7A 2QMZA 1YVPA 1A1SA 1V26A 2CUKA 3O3CA 2J59A 1U1EA 4PIVA 3O31A 5ENDA 3HBAA 3PFBA 5JMTA 1QV9A 1W4LA 2IYWA 5FV7A 4NULA 5KQSA 1GCGA 1P6QA 2J67A 3TBHA 1UC8A 3IPCA 3REGA 3R77A 4PCVA 1PFYA 2H5EA 4NV3A 5B30A 2P9YA 3I2IA 4PQGA 4ROTA 1NMEA 3DFIA 3LKBA 3P52A 1XVUA 2JIQA 4I6JA 4KO1S 3WIBA 4A36A 1IHDA 2WHXA 4J6FA 2D7DA 3GR6A 5C81A 2FOXA 2FZWA 3QVTA 1NV8A 3VR5A 1VL8A 4P7GA 2P0YA 1UEJA 3S29A 1VLQA 1XRSB 2C5GA 2QAGA 2Z9DA 3R23A 2FQWA 1ZRNA 2EKQA 2QL6A 3OCCA 4NE9A 5TPWA 2W70A 4BX8A 2WIBA 1P45A 3R3UA 1WP9A 2D7CA 4P3NA 4UJ3A 2O0LA 3PDUA 3DEKA 2ZIAA 3MBIA 4RPKA 4WLVA 4X1YB 3L0DA 1XRQA 2ZIGA 2QBYB 2BV3A 3E2PA 2GM3A 2OO7A 2HTFA 1S8AA 3DW3X 5AKIA 5ALLA 1INLA 1IXSB 1NVEA 1RPAA 2RB4A 1HL7A 2XOKA 3UCFA 4LYAA 4RH0A 4PO1A 2E2WA 2R25B 1MG5A 4O25A 3PT5A 4HNUA 1CP3A 4X1KB 3FNIA 1SCDA 2FQYA 4BO7A 3BC1A 1NT2A 2BEJA 1WSDA 3LT4A 3G2PA 2QLMA 4DIKA 3V4LA 4U7DA 3CONA 3HGMA 4BLUA 2G4LA 4BL5A 3E9EA 2GPTA 3HYTA 4R2KA 3UOAB 1MT0A 1JIQA 1FZQA 3U9SA 1EJBA 3X1MA 1EESA 2J31A 3QEJA 1QLJA 1R66A 4ND8A 2ZBQA 2G1AA 1MAUA 2OHIA 2Y1DA 3DD5A 3FUCA 4XJVA 1KQPA 1PJAA 3MILA 1YS7A 4EGJA 1IZYA 3ESYA 4R8RA 1SWWA 3GA5A 4EEZA 2B1JA 3RVPA 5GZ3A 4FHGA 1VMAA 1NRXA 3UBTA 1H2XA 4PC7A 3KZCA 3SN6A 1WZNA 2H4YA 2IHZA 3WGIA 3R4VA 3HL0A 3I1JA 3CRW1 1XDBA 1Y8QA 2AKEA 1Z3IX 4KQWA 4E3ZA 4F4JA 2B7LA 3RRXA 3PGA1 4H7FA 3D7SA 1V5EA 2MINB 1VGVA 5C4IA 2NSDA 2HCTA 3VC7A 3ZWMA 1GY8A 3QHPA 5J5VA 3SPXA 5CW1A 1RFGE 5I4KA 1UPBA 1UBGA 2ZFUA 4XGNA 5BORA 4KRFA 4IRXA 3ZOZA 3TAHA 2AHOA 2VF4X 3P2JA 2A1UA 4F9FA 5J4KA 5LL6P 4MS3A 5A3QA 3G1WA 1YGPA 5AVSA 3FFTA 1KDOA 4X65B 3ZLJA 1NPDA 2SICE 4OHUA 3SF8A 2MSCB 3CEJA 2AOXA 4BC0A 3VKVA 4D02A 5IUNC 5K0TA 1EXDA 1Z15A 4OOEA 3H1EA 1EDBA 1CXZA 1VJ0A 2ZSKA 3G23A 3TX2A 1K6IA 4YRJA 1O6GA 2RI1A 1RAIA 4F8YA 4MDFA 5TMBA 1NZFA 3IE0A 4I4TB 3JQ8B 3UV7A 2J30A 4RAOA 4AG6A 5EJFA 3V4SA 3FROA 3UAOA 3ONNA 1W5FA 2FHSA 4BNZA 3W5UA 3QYJA 2DQKA 1QP7A 3TVDA 1MB2A 2ERXA 4K7JA 3KKOA 1L8LA 2YXBA 2RHGB 3LTNC 1Z9BA 4Z9AA 4FTWA 4S1WA 3VR1A 1YGYA 3DM5A 5G1OA 3RBAA 3WI7A 1LLFA 5GVSA 1IYZA 4MV6A 1XYVA 3SMQA 4M7WA 4ESVA 2QMQA 2OT3B 5FAKA 3ZHUA 2P3LA 2P8SA 3FFBA 4J0GA 3T15A 4JYAB 1RQLA 3WGMA 3F5FA 1FRZA 3NH6A 5ITZA 2G5PA 1PCXA 2FX3A 2H4WA 3PQ5A 4Y3UA 4O02B 2HSEA 4HVTA 1F5NA 2Y1FA 2I7DA 2P2DA 2PU5A 2QAGB 2O8VA 5TPWB 5LIPA 1GDHA 1WLSA 2J5KA 4R5MA 3LYAA 2EEZA 4QARA 1CJBA 2DC1A 5EA2A 2HDNB 1K75A 4YY3B 1K27A 5C7LO 4F04A 1TE2A 3F98A 1ZHHA 3BWEA 3W5BA 1YCGA 2SHKA 3I5XA 1F20A 3PEFA 2Z2XA 5FTMA 2WD9A 1Q7EA 4BTVA 4XVCA 1ZW1A 4HPJB 3M4NA 1JUDA 1PZHA 3PHIA 2XT6A 5D5PA 3RS5A 2HR1A 1EHIA 1LJUA 2PT7A 1Z16A 4GI3A 3X3HA 1FU8A 5JW6A 3QMWA 4MP8A 3WMFA 2VSNA 3H19A 5ALMA 2HBZA 4XH9B 2FCRA 1KFJB 3HCOA 1D2HA 2P5TB 3VU9A 5H0IA 3SF0A 2R7KA 3CUVA 2EIHA 2HQSA 1VJ1A 1EWRA 1U98A 1Y42X 3EBOA 1CR2A 3EQ9A 1VP9A 4ND8B 1OGYA 4UBJA 1K92A 2BRUC 2G7ZA 1QJ4A 1X0VA 2W6NA 4DY6A 1SVLA 5FLXA 1E9DA 3GQVA 4L76A 1GTVA 1U0EA 1X8LA 4INZA 1P17A 2XCUA 3ZN2A 4ZRMA 2IUYA 1EP3B 3VR2A 4P3PA 1ZMTA 3TEFA 1QRTA 3UZUA 2V6GA 1R9NA 3JZFA 3MMZA 1JSCA 3BWCA 3LZ6A 1N7JA 1F38A 1Y8QB 1UK9A 3SR4A 3A14A 3HFSA 4X6UA 1E4EA 2CNBA 2QW0X 3KSMA 4NYMQ 4PLFA 3NVKI 3UY4A 5K8UA 3FR8A 1T4MA 3CR8A 1UPAA 1OXSC 1JJ7A 1WMDA 2OXTA 3VOSA 3M6WA 1Z39A 1SPBS 1E89A 3AVUA 2BI7A 1YQ9A 3QM1A 4KIWA 2XUAA 4WADA 1J1IA 1ONOA 3A1VA 5IAGA 2QN9A 2A1UB 5TPZA 4AQYB 3JYPA 2BEKA 4MS3B 1I32A 5DCLA 1BHQ1 1E2HA 4BMCA 3FFXA 2X9QA 4AWXA 4KI0A 1ZRHA 1TYEB 3BRCA 4JQCA 2IHNA 4QQKA 1SXJE 1ZUNB 2PMWB 3EFOA 4HB3A 3W5SA 3T61A 3MQFA 5JAMA 4J8PA 2OB2A 4RZHA 4HS4A 2VPIA 3QJGA 2Q1SA 5AIAA 4RD1A 3PKZA 4JT2A 3DDNA 3O6VA 5K8JB 3I8SA 4QM7A 3D3QA 4G3XA 3L05A 1PEDA 4IXMA 4DC0A 2EW1A 2ODEA 3MRXA 4OM7A 2W22A 4WKBA 2WM3A 1T8PA 4DCSA 1K6XA 4NMXB 1AK9A 5JD4A 3I34X 3G5UA 4G0UA 2X22A 1M6EX 4ALNA 3W8RA 1IBCA 3EGWA 3MK31 2HU8A 4C06A 4N0PA 4MRPA 2AX4A 2C1XA 5J4YA 2ZJ4A 3UWKA 1TK9A 1IWOA 1UZAA 3DL7A 3GJXC 2ZBGA 3RLIA 1JB9A 2OFWA 3D81A 5REQA 5LP6C 4Q05A 5HIAA 3SC6A 5ITZB 1GNPA 1YNOA 4RK1A 3SZGA 4NAHA 3L4SO 3TQQA 2I33A 4C5BA 1X7ZA 1RYNA 2JKYA 3F67A 1G3RA 1YRYE 3PPYA 1ECGA 2OV4A 3AFMA 3P2EA 5THQA 3WRYC 2DBYA 1UDWA 1VHDA 4ARIA 1XLUA 4V0ME 4CV0A 3RF6A 1NG9A 5DLPA 4E51A 2VRNA 5H70A 2VDOB 1SU7A 2EBHX 3PQCA 2EG5A 2Q3CA 4ADSG 3DZIA 2KSQA 2D6FA 3B6JA 3W5IA 4FQ8A 2GKSA 1Y7HA 1MNQA 1T9KA 2E5FA 3EMBA 1FMTA 3I6IA 5A6VA 1US8A 3MJCA 2GAJA 1AA9A 3D0QA 5ALDA 5AVZA 4NX2A 2VHYA 2YC4C 3GJRA 4I9NA 3GRUA 4JI8B 2DLCX 1TM4E 4DUYB 2FQ1A 1FYVA 4HL6A 4P58A 4YP1A 3VU9B 4JNCA 4ZCQA 3TD6A 4RHCA 4LGVA 3U4IA 3ROKA 2OQRA 2PIDA 3HV2A 4JLAA 4PZAA 2HIHA 3D3KA 4D4MA 2PJUA 3TW0A 2PD4A 3ETDA 5K3CA 3X1KA 1SCIA 2B4TO 2XAAA 2K4MA 1U7ZA 1C7FA 4GC9A 2UXBB 3S55A 1LF5A 3N2YA 2AK3A 2C9MA 1VHWA 1VPTA 4Q7JB 4C0JA 4F4CA 3E7WA 3Q7RA 5J4LA 1ZZEA 4DCNA 5A9RA 5JNUA 2PGAA 1MJNA 4UMEA 1G8YA 2QP4A 4RDCA 3AY6A 2R6R1 3B6EA 3IPAA 1HWYA 1RCTE 1KMCA 4XFDA 1BJKA 4DG5A 5CDFE 4YUZA 2Y4OA 1E4EB 2PR7A 2VNAA 3AEZA 3IE1A 4NMLA 1F8XA 2ZJ2A 1LJ8A 3HJCA 4BX3A 4IMPA 5G41A 2ZRAA 4BO1A 1ODFA 3R44A 3NAGA 2UZ3A 2CXOA 2CFCA 4YALA 4HDKA 3KZKA 3MGAA 4XRGA 1NLZA 2GO7A 1H6BA 1TKRA 2YVKA 1GRRA 1N3YA 2JIBA 4YR9A 5BSRA 2B4RO 1EBFA 3AZPA 3DP7A 2H00A 1RBZA 2LUOA 4CG1A 2Z4SA 2RHOA 4LJAA 1ODKA 2QE7D 3EFOB 3G8YA 1PBTA 2AT1A 3IX7A 4TGLA 4YA6A 5TGZA 2C4VA 1XCGB 2H0AA 3JR7A 1DJNA 2PDAA 1QF7A 4K46A 1N9GA 3QV2A 4IJ5A 3UK1A 5EY5B 2ZWOA 4XIGS 2CNNA 1JQLB 3IQGX 1E1NA 1M66A 5JBNA 4B3SB 1W47A 1JLKA 4AY3A 1UBNA 2Q5HA 4BVLA 3EBPA 4A15A 1RABA 5FOUA 4FFSA 3PRHA 4MCJA 2D13A 3C1AA 3KJEA 5G40A 5L7TA 5EUBA 4EW1A 4HGNA 4PAWA 1DEXA 3QEBZ 2IPLA 5LU8A 3VTKA 4A0GA 4GFDA 2HPAA 5A7HA 3MCUA 4FK8A 4I1RA 2PBFA 3MCZA 4R31A 2ZKLA 4URYR 4YRCA 5FI1B 5REQB 4B4VA 1N77A 2HCRA 1DKQA 3LI2A 1PKXA 1R4NA 1S2DA 3NT2A 2C59A 4YP7A 4CWAA 4PN3A 1X7ZB 1FTWA 1USUA 2FY8A 3FLEA 4U6QA 4X45A 3AM3A 3R7SA 1BRMA 2R79A 3RHFA 5B1DA 2CFRA 5EJAA 2YVUA 5BNWA 1QQ7A 3CWZA 3JQAA 1M5UA 2R6GA 4FGWA 3OH8A 3L7LA 2XUZA 2HK6A 5K3FA 3X1JA 4HY3A 3TX6A 4AG5A 2QPAA 5JXWA 2V0CA 4LY0A 1FP6A 3KYIB 2HH9A 2H11A 1VE7A 2WWXA 4JXZA 3GARA 5TEWA 3LFHA 1KL7A 3IERA 5AM4A 4IJVA 2WHEA 3WGKA 4XD7D 1MH1A 1AHPA 1H1TA 3RVDA 4BNVA 4TWAA 4CUKA 1US8B 1O08A 3I0ZA 1HY3A 5I8ZA 3HY4A 4Q7QA 1JAHA 3IO5A 5FUBA 3NLLA 3VNUA 5JPIA 1WZIA 2UYGA 2NPFA 1CF2O 1FYDA 2ZYAA 1ODCA 1TEHA 2AB0A 2QIOA 5EUMA 1E5VA 3I8XA 1R0YA 1GILA 2IY9A 2PLNA 2YQ4A 1MGOA 2O23A 3S4YA 1XTSA 3LGSA 4J3JA 1I4OA 4CKYA 1A77A 2H16A 4C01A 2JFQA 4EPYA 3H1TA 2AC7A 3VPAA 4AJ9A 4U2CA 4AO8A 4CQLA 3TXAA 2PMBA 4WLOA 3WLOA 5CFMA 3QLUA 2PCLA 2YY5A 4WK2B 3RK0A 3BH6A 3TI9A 3KLPX 1IN1A 2HBRA 1M6HA 1QYWA 2X15A 4HDCA 4Z51A 2ID8A 5ISMA 5AJZA 1HDRA 2BR3A 1HYHA 2XIQA 3PXDA 1D7OA 2Z5FA 1Y8ZA 1HETA 4LSGA 1P0PA 4MS4B 5F9HA 2ZZNA 3L1VA 3I1YA 3ICWA 5DM1A 3EIQA 3UJ3X 4MCHA 4N6NA 1RQGA 2BW0A 1Y8RA 1SOUA 1CNFA 1NBOA 2COEA 3DOJA 3MTJA 3V34A 1ONPA 3M70A 4OFXA 3SS7X 2OHFA 4HDKB 1RKQA 5SY9A 4LJ7A 5CBPA 3DOOA 1J1UA 1UKCA 3AR3A 4W1SA 4PQEA 2WHPA 3G5LA 1V5WA 1E1RD 2J4DA 4XUDA 5T41A 1JP7A 1WO8A 1XF1A 2JHAA 2YBDA 3SS8A 3R8XA 1CVLA 5K20A 3LPAA 4GPIB 2XZLA 2H1CA 1WW2A 2CHUA 2G88A 3HZRA 4JVSB 1JDSA 4XM2A 3K0CA 2Q5QA 5CUQA 1CV2A 4B80A 1WQ1R 1KH1A 1N9GB 2OCYC 3EEOA 2HMAA 2ZI7A 1SBCA 2P2YA 2OV1A 2VDKB 4LQ4A 1ADCA 4MWDA 4E21A 3EIXA 4P3YA 1C4OA 4N0QA 4FYYA 4WZ6A 1PN3A 2P9TA 4BRWA 3S8EA 4JYBA 4BFXA 1NIJA 1M83A 3H5LA 1MORA 1IOZA 3OF5A 3RV3A 2DHCA 1DIBA 4FPXA 4MUBA 2NTNA 2AR0A 4J2TA 3U4AA 3UN1A 5JHGB 2H57A 3SEZA 3I5MA 4NMWA 1NJ6A 3N05A 4IMRA 3U39A 5FWNA 2W6CX 1UMBA 1GUDA 4QDTA 3ZW7A 3P19A 4TTTS 1M7BA 1KVRA 4XVUA 3EQ6A 1B74A 3GGGA 4F5WA 1IB0A 2Z8YM 1R4NB 3FYSA 3GLGA 2QUAA 4IJUA 3MJDA 2RSLA 3ER9A 3IUJA 4ISBA 5DBFA 2WWVD 5JYDA 2NLOA 3AERA 3FWKA 2QROA 3KQOA 4UEQA 5ARCA 3JQAB 2NPIA 5K3FB 2OBLA 1OH5A 1OX5A 3ZXXA 3P45A 1MAHA 3IAS6 4LX8A 5D1HA 1ZIYA 1NFRA 1A3CA 1O95C 3G9ZA 4H27A 2Q8PA 3KXDA 1NATA 2QQ5A 1BH2A 2VP4A 1WMFA 3KKEA 2YKGA 5EUQB 1LY1A 3GIDA 2E85A 5CNKA 2YXNA 3B52X 3N28A 3VR4A 3O1JC 5C2JB 5K3OA 3CH7A 2ECOA 2XH8A 4DSTA 4FFOA 1Q7BA 1XD8A 3CGGA 1QZTA 3ZWCA 4QECA 5F23A 4IDHA 1JE0A 1XMIA 4DDHA 2O7RA 4D8UA 2FPUA 4LJSA 3HVUA 3C4VA 1OFUX 1ZD3A 4Q1FA 2XGMA 1JA1A 2OM2A 3WL5A 1JHXA 2R47A 2R5FA 1JHVA 1K89A 1H9BA 1M2VA 1P91A 1PBNA 2PGLA 2XMDA 4G2NA 5FFFA 2QM7A 1GWNA 1BIFA 1M1ZA 1M74A 2NYUA 4NFYA 4CQLB 3U5TA 4MA5A 4FHDA 4MUXA 1JFVA 4C7KA 4ZK6A 1HE5A 5JS1A 4QUHA 2RBKA 3D7MA 5DEIA 2OO5C 3RB8A 3EC2A 4MJ7A 2HA2A 4ER7A 1GPWB 4N3NA 3WLSA 4URVR 1XQVA 3AINA 1CUUA 3C7DB 1A7JA 4ZQBA 1TQ8A 2EFGA 5FBQB 3TJMA 1PJ4A 5KOJA 4GKJB 2JAWA 3K0FA 1MX9A 4YT4A 4JOBA 2VT7A 4B6PA 1L5SA 4Y0VA 3RUPA 1A82A 1JMVA 1BU5A 1DKRA 4K6KA 3VSCA 1Y8RB 3AT1A 3OFNA 4NU6A 5ES3A 4PXSA 1WSAA 4J0KA 1JU3A 5AKLA 4ENPA 5HGXA 3UCXA 2V98A 2BH9A 1ZEJA 121PA 1LVUA 2JIDA 4KLAA 2WHPB 3O03A 1N2ZA 4GF5A 1Q7RA 2A9KA 3BXXA 2XEXA 3CZ4A 4EG6A 1T6ZA 4N6GA 2VDLB 3PYXA 1KOLA 3WYAA 4JV5B 1OD6A 2JGEA 2IEAA 4AUEA 3K70D 1YJAA 5ALFA 1XN1A 1B93A 4LW8A 3HO6A 1U2QA 1U3UA 3TH5A 5CK5A 1RPJA 5IKXA 4CLOA 1TLTA 2PX8A 5ES4B 1IOWA 3MG9A 2ZS9A 1GSAA 3EUEA 3W6NA 3T1QA 3LNTA 1Z4QA 3UV6A 4V0OA 2HT1A 4JVNA 2UUOA 3GCXA 3MGCA 1EDZA 3QWIA 2O7SA 1NF2A 1E3JA 2GPYA 3A58B 3GLHE 3FNHA 4HP8A 2WKSA 1KO8A 1Q92A 3HY3A 3NUQA 3BB1A 3OJLA 5LQUA 4FZJA 4P38A 3FOFC 2AGVA 5JANA 1UMBB 1XTUA 4N1AA 4WEQA 4AP5A 2BKUA 1ZWLA 3G8CA 3U7QA 3L43A 2V3WA 2YC2C 2ZJZA 5EJ5A 2G07A 3IT1A 1SKYB 1L8AA 3DDZX 1GR1A 1T1RA 2NXJA 3KB8A 2ZPAA 3NXKA 1WB4A 3W3AA 1T9DA 3SXJA 3DBLA 3UQZA 1C0PA 5M29A 5I7UA 2BHTA 4UVEA 2J9RA 2Z5LA 3CBGA 3Q85A 2Q3HA 4JL6A 5IMBA 4B6OA 1S5PA 5BV2P 5DHTA 1ISMA 4GZLA 1GLVA 3AERB 1N2IA 2C7VA 1NVMB 3EIWA 4IXNA 4P33A 3RRBA 3NS7A 1GVHA 1HZZA 3U9LA 2PUDA 2ZPTX 1TZMA 3N2IA 3QLVC 1YBVA 5J58A 5JADA 2CZGA 5EHIA 3SQMA 4WKGA 2QT1A 2QZ4A 3N6XA 4GXTA 4K9PA 4Q4LA 4UE3S 4UBOA 5LZ7A 4E08A 3FKJA 3LY7A 1CU1A 4H35A 4ITUA 2R7MA 4FW8A 1PVOA 3H4IA 3AR5A 1BMFA 1RE0A 3VOAA 2P67A 3LBAA 4G5SA 1RKXA 4W4TA 2JFGA 4W5TA 1W93A 3PCRB 2PT6A 4AMVA 4EPWA 5C4GB 4G0WA 4L6AA 1C7JA 1NRIA 1NXVA 1SIWA 1GSHA 4HBZA 3V1TC 2JRCA 3OZEA 3ZHXA 3USZA 4JMPA 3AM4A 3NC4A 3KYBA 4G41A 5AI9A 3UKJA 3H1PA 3FPKA 1WHTA 4F6LA 4K9LA 3OZGA 1IQPA 4B81A 2BRUA 1OJLA 3UANA 3SHVA 1KI7A 1UBJS 4UCFA 1I6WA 2FWIA 3ZS9A 2Y92A 4HNSA 1M2VB 2O3TA 4IUYA 1RRVA 1AZSC 3NC0C 2IQ5A 2BGJA 4IS2A 3CUSA 2YV2A 3C3WA 2WHQA 4PONA 3MZ0A 5BUQA 1TCAA 3WG9A 2QDKA 5FF9A 2Z98A 2FWAA 2A5YB 1D8TA 3IDOA 4KXLA 2QP3A 5LU9A 3AOEC 4UPDA 4M87A 3AU9A 3SIRA 3DBOB 4P35A 5AIBA 1FSSA 2C3PA 3G0DA 1E2MA 4UZSA 3IOYA 4DCVA 5KOJB 3D1JA 2W2PA 4MW5A 4RK6A 3FRHA 3II6X 3K0FB 2XX3A 4BVKA 4M0FA 1KYQA 1KKLA 3A1NA 3NBKA 4GECA 5IDXA 5C37A 5KNDH 1VXRA 3CF4A 4TQGA 1ESMA 4YIKA 3T3PB 2X6QA 1NSYA 5H83A 2BSQA 3ZOKA 2VHEA 3EA0A 3FNRA 1KIFA 4UCQA 4XJXA 2QUHA 1X13A 5LQAA 4LE1A 3G9TA 4OBEA 1SC1A 4LPSA 2OKGA 4UHJA 5FL3A 3VR4H 4X62B 3R3ZA 1ZJ5A 1GGMA 3EVTA 4WEOA 5HF9A 2Q7OE 1I13A 4NONA 4ND6A 5LDDC 4DCTA 3BQ9A 4CG0A 4DR5B 1AQ6A 2FWBA 2B8JA 2FZVA 2P6OA 2WJHA 4CBVA 4EGCB 2D2VA 3P71T 4JUIA 1L5GB 4N5NA 3MB8A 4CLOB 5AW7A 2P8JA 2FUCA 4N03A 1C29B 2F00A 1PZEA 5K8LA 2CE2X 4PXYA 3O5AA 1UJ5A 1XB2A 3MXTA 2HD4A 1DO2A 2J46A 4U00A 1JXAA 4YRMA 4X20A 3QI2A 4RFLA 2FXIA 3F8TA 4EH1A 3RIGA 4Z2YA 1KP2A 4CUJA 3AF1A 3OOEA 1OFGA 1Q17A 3LBFA 1GQOA 1S2MA 1XQ9A 3HU5A 5CIWA 3PP8A 1L7BA 4HXGA 3QLJA 2OXEA 1MEEA 1PJRA 1MD9A 1WZUA 1Y63A 2IBMA 1KXZA 1Y33E 1SBZA 2PUVA 2RB5A 3U7QB 3ZYCA 1RYMA 1TIPA 1JDBB 1APBA 1T0BA 4CMIA 5CA1F 4S05A 2YZ2A 5EZ6B 1U7XA 2IC5A 3DBLB 3MWKA 4FDMA 1KQ3A 1R0RE 2FSHA 3O73A 3HDVA 4XA8A 5JD5A 3IAHA 2C2BA 3T5GA 3SHTA 3SFZA 3FVQA 3WISA 1Z5NA 3DOIA 3SHWA 3L9WA 4CE6A 2EIXA 3QG5A 4YAUA 4GP7A 1NNLA 3DZDA 2FHPA 5MDHA 4Q3AA 3VOBA 4CNBA 2X4IA 4ZJZA 3D6TB 3S5UA 1E8MA 1XQWA 2AUNA 5AD1A 1VE6A 2O0KA 2VNIA 3LX4A 2OPHA 2HMUA 3WLIA 2Z1MA 3I9V1 5D87A 3KL4A 4UZFA 4BOYA 4WJLA 4F46A 3UMGA 3NGLA 2PQMA 2AMYA 2YQ5A 3IP1A 3C8ZA 2QSZA 2WP8J 1T5HX 2DBQA 5FQNA 1UM8A 1IL0A 3QX8A 4D9FA 5FJIA 2VQSA 1H4VB 4NE7A 1JX6A 2OYCA 4AZ0A 4B3BA 4FYMA 2D59A 2NVBA 3HDJA 4G07A 3PTAA 1E32A 2YOGA 1N6HA 4WL0A 3TBKA 4C5CA 1B00A 2VT6A 4EKEA 2R4TA 2XUPA 1T2DA 1SZDA 3DTYA 3HVIA 2QYTA 3JZIA 3I4LA 3NTVA 1RTTA 4M0PA 5BT9A 2VP0A 1BWQA 3T0FA 3ZWWA 3FPLA 3CF0A 4ID9A 4O2LA 4JLNA 1FU4A 1SHKA 4IKOA 4GLLA 2AFIA 2XA1A 4B6RA 3BJEA 2V6MA 1HDZA 4LMAA 3A0UA 4ENVA 2OFOA 2FPLA 2IUEA 3I42A 2WMNB 4E46A 4IVQA 1QHXA 3EFEA 3LKVA 5FBWB 4LG1A 3I05A 3GJ6A 3JZDA 3T54A 3I6QA 5GPBA 4GMFA 4JBXA 1CJMA 1N1MA 2NU6A 3LCUA 1IXKA 4RPLA 4AJIA 2QD5A 4CKWA 4HXYA 2HUPA 3BA6A 4L74A 2R8ZA 2E49A 1BG6A 3PNOA 3FYUC 1GZ5A 4TKMA 3SVZA 3KB6A 2IHBA 4QJ4A 1N0HA 4FYKA 1T9HA 1WCWA 1DX4A 1L5FA 4MUNA 4EAAA 2RHMA 2DECA 3FF4A 4RM2A 4G5RA 1YFZA 3JRWA 4GUAA 2OYRA 2KB0A 2DU8A 1VCMA 5IVHA 2GARA 2ZLBA 1BYIA 3G8BA 1DAIA 4RSRA 2C8KA 3FHJA 1E6MA 1A2QA 2WSSD 1SOWA 3JWEA 1Z13A 3PE6A 5EMMA 4ED9A 5K01A 2GHTA 1G21E 3B60A 4FQ7A 3DP9A 2YNMD 3L7NA 3S2IA 3TE6A 1WABA 1Q77A 2BMEA 2QS9A 3I2YX 1SBIA 1ZIPA 3ECSA 4B1FA 1VHQA 4N9WA 1H4TA 3H2JA 2POQX 1ZVVA 3N2LA 3PRKE 4ZVSA 3JQDA 1Z12A 4B8YA 4MW4A 4ILEA 3TSCA 2F43A 1GKIA 3ZDEA 3U1BA 2ACVA 3WYGA 1QCDA 1KS2A 2H1IA 2WU8A 2ZJ8A 3BUSA 4X20B 4IQGA 4NTZA 5CVUA 1MU0A 1D2AA 4IOKA 3FSGD 1R0CA 1ULSA 1ZUD1 4RPJA 1YKSA 4WK4B 3SHOA 3WP1B 2J3LA 1MJGM 4G0QA 4ZYUA 1QKJA 3H86A 3N07A 1CUGA 1X6VA 3H2IA 1XZPA 3BFVA 5BSMA 2FI1A 6ABPA 2X7HA 2VDUE 1KWKA 2YV1A 3QJ5A 5DOVA 5HPYB 5E8RA 3ZHVA 4TMKA 4CMIB 1SVKA 1GZUA 2AFRA 3S7ZA 5JU6A 2EKBA 4A6PA 2ZI6A 5EVCA 1TM3E 3TM5A 3WLAA 2ODBA 2I62A 4R1UA 8ADHA 1H85A 4X9XA 1HDOA 1EVIA 1GTG1 3ESDA 1KSFX 4E2FA 1G291 3OLYA 3HCEA 1VLMA 5F2NA 2WIAA 2XDYA 1W0KA 2J41A 5EG5A 1SVOA 2C99A 1DAKA 1A04A 3D2BA 3MUEA 1G7CA 3O8LA 3ORHA 1AIPA 3QNWA 3UFBA 1EINA 1ZOPA 1JXQA 2N42A 4L5IA 4I5GA 4R68A 3ZPXA 5JH7A 5ED4A 4OQXA 5LPNA 2W2MA 3HI4A 4QDKA 2OG2A 4MPPA 2DERA 2C20A 4G4GA 1LH0A 1SCAA 2QTGA 1XP8A 5F98A 4WY5A 4PYJA 1EUDA 1KIMA 2YZMA 2RBEA 1EVJA 1JR3E 1L5WA 3D54D 4J16A 3OQBA 1DJMA 3KETA 2A59A 3ZCTA 1D7AA 1GPNA 5T67A 4MGZR 5AVQA 4YV2A 3DGEC 4NCJA 2BCGY 2X8LA 4LJ6A 4R1PA 1LNQA 1R4ZA 2ORIA 1AB6A 2AFIB 4GWGA 1TF2A 2XVYA 1S89A 3MLEA 4K9NA 4HFNA 5KNDD 1G64A 2GTPA 4FMDF 4LQLA 3TFOA 4GOLD 1EJ6A 2B78A 4OIMA 5DGCA 2NU6B 1N1DA 2QYOA 4HDOB 1PJQA 3HADA 4R1MA 1RD4A 4CKWB 4D3ZA 3SJBA 1E6KA 3OO1A 4O5OA 3WK7A 2JD1A 1RJ9A 2B6NA 3RT1A 1XHLA 3LWZA 3QFTA 4IDDA 3UT6A 1GU0A 2PBRA 1UEXC 3IR6A 2QRLA 5C4MA 1MKYA 1YH3A 1UBSB 2YJ3A 3URMA 2PGXA 3GH3A 4J76A 3KUXA 4YHHB 4TL6A 3R74A 5TRTA 5DT2A 4YYZA 1XK7A 4M1EA 2WJWA 2NQ2C 1JECA 3GFQA 2GK6A 4W1PA 2ODPA 4DIBA 5I7FA 1Z2DA 1DE0A 3FMGA 3ME5A 1QOQB 4JC4A 2QY6A 3FZNA 4NU8X 2BM8A 2OVBA 1JKJA 5SV2A 2RJOA 3LHFA 3UH0A 4KDFA 4UUAA 1BXKA 3OU2A 1UCFA 2AJ8A 2F43B 3AUSA 3R0QA 1ORTA 4H6WA 3CFYA 4JT9A 4YO8A 1CUZA 2J9YB 2Z04A 1CZKA 3B78A 1KEWA 2OY0A 1B8VA 3DZGA 3LQ4A 1JPJA 3ZQKA 1AKWA 3OFND 2PD3A 4YJ2F 3PPVA 5KC8A 4Z4EA 3HB5X 1EK2A 4HEQA 5BURA 3WB1A 1H5NA 4OP2A 5E8JA 2P65A 2D1SA 5CYFA 2DHEA 3EIUA 2X0FA 3GEIA 5J3JA 4MV3A 4WXEA 3L7IA 4C2TA 1MDFA 4LXHA 1XZQA 2C5BA 1ADFA 4LRWA 4OJQA 3KJIA 2HA0A 2YFYA 1FX0A 1PAUA 2HB6A 3PJEA 4YCDA 1G5IA 5HEKA 4E31A 9LDBA 3TDMA 5B7QA 1D6JA 3ZTTA 3K0SA 4RTKA 3M2PA 3FMVA 2AVDA 3PX2A 2G8LA 3LC1O 3U3RA 3FRJA 3LO8A 4AJ2A 1YRAA 3MTEA 1JGTA 2Q4EA 4FYWA 2OA0A 1MVNA 1BW9A 5FA6A 2Q8NA 2YVQA 2DUJA 3VAZA 3ZDAA 3KYCA 1RPNA 4RFSA 5BWCA 4WK6A 5JH7B 3EZNA 1YJXA 1EX7A 3R3HA 4P80A 3WLTA 5FTLA 3HZHA 4HX5A 4AJHA 3B1WA 3SD7A 4NBRA 4AUMA 3PQ3A 2XZOA 1XDSA 3RAPR 4ZVKA 5CXXA 3JD2A 1N6OA 3BREA 1EUDB 1TZJA 1KQNA 2QG9A 5CT4A 2D2FA 5CEJA 3DS8A 5H9WA 2DQ4A 1XKQA 2ALJA 4NMMA 4I66A 4OMUA 5ALPA 1GV0A 1NMSA 5K0BA 3GO4A 5ESWA 4OXQA 4MK4A 1NYQA 4N49A 4HNTA 1Z35A 3BMNA 4HLDA 3T7IA 3WJAA 6PFKA 1JKFA 5CITA 2ID7A 4RCZA 3BE5A 2ZJBA 5CB6A 1GT6A 2HKIA 2YHAA 4HDQB 4PS1A 1T4BA 2G0AA 3MW8A 3WGYA 3DSRA 3PT9A 2DKFA 2NQTA 3KYDA 4N5DA 1JSXA 1B41A 2JLAA 5F9MA 1MJ5A 4U9HS 1RJ9B 3AONB 1QJCA 3ICCA 5JS7A 1OLXA 3EEIA 3RG8A 3T9DA 5IZCC 1YQEA 1H2HA 1M67A 1TZ2A 4YAIA 4RACA 3RK1A 1E2BA 2Z57A 3D8HA 5KQPA 1RPTA 3H1GA 3GPCA 4FWIB 2HEGA 4O8CA 1I7DA 3PYMA 3ZU5A 2Z0MA 1R1DA 3L6BA 3KWJA 4CM5A 2Y1WA 5ANRB 4DSUA 4JI1B 3V1UA 1WXWA 1G0NA 3QWHA 3E61A 2PXAA 1ZIOA 1E7YA 1NM5C 4ZP1A 4HAYA 1CUJA 1FBTA 4IFBA 3ENQA 1EFKA 1YXMA 5TT0A 3H05A 1L7QA 1ZIXA 4J3NA 4BLVA 5KTYA 3E5NA 3WKAA 1CDEA 2GI4A 5JCOC 3LQFA 4JP3A 1ZCJA 5D5QA 4JI0B 1U0LA 4BB9A 4RJTA 4MMZB 1ZN8A 1G60A 1Y9EA 3F5MA 4AXXA 1FQOA 3IIMA 4Q01A 2L19A 2ENWA 2EKPA 3CZ5A 2ZJYA 5G3ZA 3GLFA 2BGMA 5CCXA 1D1TA 1VSUA 1P18A 4AMBA 1T8WA 3BJRA 4HWRA 3TQCA 1QTQA 1HSOA 1LQTA 3PC2A 3IEMA 1Y0BA 3IAAA 2FMHA 4PGAA 1E94E 1O6BA 2WK1A 4WA8A 1ZXXA 4D45A 3KP1A 3UB4A 3FRIA 1B73A 1VC2A 1SB9A 1X42A 3L8DA 1Z7YA 1XTVA 2OEPA 1I1QB 3MWFA 5FO0A 4QXOA 2DY0A 1FX0B 5ALEA 2QNRA 3G0OA 2DUUA 5JAHA 3U40A 4MHTA 2JI6A 3MUOA 4EYKA 1R5BA 3H84A 4FNAA 4YMIA 1IN4A 1JHZA 2AOUB 2I6SA 3VU3A 4EHKA 1X1TA 2PD6A 3TE7A 3C7CB 3OO0A 3UAZA 5DTMA 3GNLA 1HPLA 3TR6A 4JCCA 4PW0A 1BW9B 4TKUA 1KP9A 4D98A 1H9CA 1I9GA 2BEWA 2RHCA 5BW8A 3KYCB 3CRMA 4RFSB 1K3UB 2YXEA 3AG5A 3ESXA 5AK4A 1RBMA 1L4YA 1UKAA 1MJGA 1GARA 4MEJA 3UOWA 4HAVA 1XO1A 3EZLA 2VPZA 4B3FX 2KQUA 3ZNQA 4W5RA 2Q5LA 2HNBA 1P2UA 4GE3A 4TSRA 1ZQ1A 3DAHA 5AHKA 5EHQA 1CUDA 3KOZA 3EAQA 1JWLA 3FJ1A 3ZG6A 4GQAA 1XZEA 1AQUA 4X7PA 4DR6B 5IASA 1JYSA 4K6GA 4QYMA 4ZT6A 2PS1A 3LCCA 1Y1KE 1RC1A 5DU2A 3T7AA 1DXQA 3DAPA 3L8FA 3UQYS 2XXAA 1CJKC 4K26A 3E7DA 3HRHA 1A8SA 3VTAA 1VJDA 5IKOA 3BMNB 3BOSA 1A9ZA 4L5AA 4QU8A 5B1IA 2J0QA 3L7JA 2GYYA 3C3AA 2FLKA 2LCIA 3HJUA 4ZWNA 1PK8A 2IP2A 3PDIA 5FTNA 4PHGA 4BUCA 2QYHA 4KK3A 4M1OA 2R0QC 4IJ6A 4ZDJA 2R00A 2WWFA 2OOKA 3K2IA 4AU1A 5KHOC 3BHNA 3KYDB 1ZOIA 3C1OA 3BGIA 1Q14A 4F4IA 4D80A 2I99A 3RHSA 1M1YE 3WXBA 1F8FA 3LBIA 3B5IA 5KQMA 1QAOA 3BD7A 5JG7A 4D9IA 1OLXB 2Z1DA 3NEYA 5EE0A 1IY8A 4FSHA 4CFSA 2QT9A 1VRWA 3C7TA 5A3RA 1U2TA 3QH4A 1QLHA 1QU2A 2A9RA 2H4ZA 4Q19A 3F1LA 3E2MA 4LWQA 2I1VB 1KZYC 4IGKA 5JQGA 4D46A 1KY3A 2Z2YA 1ITZA 2EW2A 3MM4A 2FH5B 1Z5GA 2DPHA 4IMJB 2HYDA 4PWZA 4AX8A 3VISA 1UXGA 4NOMA 4GXQA 5LLTA 4OJNA 3PEYA 1CEQA 1XTRA 1JL3A 3Q2IA 2Q5OA 3KM0A 1CZUA 1NULA 4OGWA 1SKUA 4YO7A 4GXRA 2XVZA 5F5LA 2VLIA 2I65A 1SKQA 3OZIA 4O1MA 1C50A 4YECA 5KSOA 5CHYA 3MF4A 1U7OA 3FM9A 4WXPA 1KVUA 4X91A 4FEYA 1EUQA 1TJ5A 5A7FA 3OHSX 1K4MA 1TYCA 1Y7TA 3HSKA 1GNSA 2F67A 4EZIA 1NDHA 3RS0A 4ML3A 4DJDC 4CVNA 3K4PA 5DOZA 2X5XA 4BFYA 5DK4A 3GLFB 2R8EA 4TT3D 1FQKA 1I33A 3ZQJA 1OTYA 4B71A 4C0KA 1RWKA 1I6MA 1S2NA 4GBGA 4KRGA 4NXNB 4DWWA 4HG2A 4JOQA 3FLBA 2BGIA 5ER6A 3ESZA 3P9SA 4OAPA 3B38A 4W7IA 5JT1A 1FL9A 1OQAA 2EZTA 2IEIA 5DVZA 1KU6A 1N7HA 3B51X 5A0FA 4C78A 1L5RA 2PH5A 2HF8A 4GKAA 3FWYA 3ZHCA 5G02A 1JI0A 1HZJA 1NOIA 4JHLA 4M1ZA 4UVDA 4YDQA 5KNLA 4M9XA 1EK6A 1HE8B 4HNGA 4UNSA 3DTVA 5CIQA 3H4TA 2I2BA 2QTZA 5FIUA 4P32A 4AF7A 4C7MA 1R50A 1W29A 2WJYA 2OGTA 4UD2A 5E6RA 1WDLA 1TUBA 3UGJA 4XVHA 1XAIA 4RV9A 4JJZA 3T35A 2QJRA 4CMEA 4W5QA 3NORA 2G7MC 4GEGA 3KQUA 1GUZA 3RC8A 3UUGA 1M33A 4TKUB 3ZV3A 1DMRA 1Y3DE 2BEWB 2WI8A 3OTQA 1I4EB 3AUXA 4BN4A 4QSHA 4CGYA 3EEFA 1K6EA 5LJIA 3ADCA 2RGRA 3IQIX 3ZHZA 2RDMA 3CF2A 2GPBA 3CRVA 4GT1A 1CZRA 3COPA 1X9HA 4I6EA 4O4IA 4YGYA 4PSAA 2DE0X 1B6GA 3BXZA 3OZFA 5ALYA 1AN0A 2VDRB 3WK9A 4YCCA 1F7VA 1X87A 4IVPA 3F3KA 4URZR 2OXRA 4I9GA 4DWOA 3L6UA 2G4CA 3MRSA 4HATA 5C1PA 1GEEA 3N75A 4C0SA 4D0RA 2GBLC 4D96A 1O2DA 3OPYA 2XXAB 1LX7A 1RZUA 1DUIA 1WUTA 2YXLA 3FZEA 4MPDA 2M9MA 5IW8A 4JROA 1U9IC 3IXMA 5U4XA 1ZD4A 1CY8A 3TZCA 3Q7QA 5KOHA 2PKRA 2V7BA 1N2GA 1OHHD 1YFKA 1Y9DA 2BUBA 4UNQA 5NULA 4D56A 1R0SA 1R0LA 2VDWA 3PDIB 2FZGA 4HNRA 4XYLA 5ARBA 3RRMA 2PYZA 4NAVA 4DIDA 5IDYA 2O0MA 4DNPA 4U8GA 5K2MA 2CDCA 2YX1A 3AJ8A 5KKCA 2EZUA 3N86A 4LNAA 2GJ8A 2PX2A 2HZ7A 2HWUA 1U3FA 2XYVA 1N32B 1QO0A 2VHJA 3S2SA 1WSWA 1PJSA 3A4TA 3DC7A 3DLIA 3PL1A 4L9WA 4FFLA 1G98A 2A0UA 2H54A 2Q6IA 1SO8A 3WK5A 1BA2A 3H5NA 1XD2A 3KJHA 1Z36A 3AR9A 5TIIA 1KYWA 1PYDA 4N7RA 4OGKA 1PD1A 1UJ2A 1NLFA 2AG0A 2C84A 5COAA 5DCWA 2W2QA 2XYRA 2YR0A 3R3YA 4LNHA 4EI9A 3IR7A 4P5DA 3JALA 3TB6A 4BLQA 3PHLA 1N1EA 1XTZA 4NATA 2Y6VA 3RUAA 1IWBB 2Q0XA 4A8HA 1E3IA 2I8LA 2W00A 3SE7A 1Z6GA 1MT3A 2RGNC 2W2NA 4BMSA 2VQEB 4PGHA 5LD2C 4LBZA 3MB5A 4CCAA 4MHOA 1RAEA 1P4HA 3A9WA 1RIFA 5ESXA 2BZ1A 3V8BA 1LQ2A 3C4JA 3NTOA 4QE3A 1S3FA 2ASVA 2XRMA 3EZ6A 3RJMA 3AB3A 2AXQA 3AO0B 1YB1A 2I2DA 2TMGA 2EBWA 4LK2A 1R5OA 5I8PA 3LOPA 4YAFA 3BRWD 2NWQA 3KTFA 4NC9A 5HQJA 1NX9A 4HPWA 2LWIA 3UEOA 2VJLA 2OTCA 1AKRA 1XLTA 3RFXA 2G40A 3A4IA 4FFDA 2W6MA 1O9HA 1RP7A 3D3NA 3E18A 5TX7A 4CL3A 4QULA 5JZBA 2YJ6A 4I9HA 1FFSA 3DTVB 4AWBA 5A5GA 3RSHA 4WZAE 4HSEA 5E6RB 3IELA 1TUBB 1OZAA 2V6BA 3R0VA 1GPKA 3VPFA 1T3TA 5BSWA 5I48A 3EPLA 3DVSX 1IOVA 2FUG6 1Z0AA 2WUGA 4C1NA 4PX3A 4KHZA 4RAQA 2DBVO 3N39C 4G4SP 3SJCA 1KGDA 1MFZA 2O5VA 3UA4A 3KFXA 2O9JA 4DR3B 1J2TA 3OEYA 4ECEA 4BKRA 2QTTA 4O4IB 4FCWA 3ZVMA 4YP0A 1SUEA 3IP9A 4HKTA 2VH2A 4MGYR 3LC0A 4BS9A 1TA9A 3E3MA 4UUOA 4Z4IA 4O2BF 5HR5A 4PY2A 2XXBA 3HVHA 5KSYA 3EDRA 3R5SA 4OQFA 4P54A 3ZBQA 1LDGA 4D4HA 1G2IA 4DUPA 3N8GA 1MQSA 1GZDA 2J0EA 3GAZA 2IYAA 1W73A 3OPYB 4ESEA 3RSSA 3V46A 1OWOA 1H6CA 1TMKA 2AKAB 1FDWA 1GFWA 3HR8A 1O95D 2AE2A 3X2FA 3CWQA 1E7MA 5C5CA 2Q2WA 2YTZA 4G0MA 5BQOA 5KOHB 1YQGA 1SJ9A 2R2AA 4WIAA 5EGNA 3UBMA 2JHPA 1QVZA 3B5JA 3I92A 4MPJA 2VDWB 3V4FA 3WRXC 5JJCA 1XVAA 1RLUA 1BDBA 1SUPA 2XODA 1SHZA 1SU8A 4WZZA 4L0MA 1XAJA 3I3SR 4ZEMA 4ASUD 1KI4A 4GGMX 1HYQA 1XRPA 1SKMA 3FJYA 4QODA 1DT3A 4Y9RA 5TVKA 3T38A 3LIPA 3T52A 4HH1A 2HEIA 5KJFA 1GGFA 3TTTA 3BBPA 2I2XB 1E7RA 2XOXA 1LS1A 2VJAA 5KVQA 5L9AA 1JSLA 2KLHA 1XD2B 3I01A 3S6JA 1U9JA 3V5NA 1QIIA 5LMUB 3QEMA 2Y1EA 1KS9A 1VKHA 3MJHA 3FVRA 4WZBE 1JHOA 3MTGA 3A6DA 5KQGA 1JMKC 2Q6VA 1JA0A 1U9CA 1RAGA 3JALB 4R8MA 2VVTA 3HJAA 2Q29A 1JEAA 3AFHA 5HHTA 2O59A 3K3PA 2N1MA 1CY0A 4Q3DA 4QFMA 4D9EA 1W5AA 1JHUA 3I6YA 3RG2A 3W4JA 1D2CA 1ZVKA 3C7KA 1C4WA 2WFAA 3FWPA 3QU4A 3ZJ4A 4V2UA 5B36A 1R9GA 2V4MA 3E05A 1RYHA 4RK0A 1OWLA 3K8ZA 4BEVA 2RKWA 3V6LA 2YRXA 1Q3KA 2ZANA 3D2CA 1QNFA 1GDDA 3OE7A 1L1FA 2PJRA 3CT6A 3BTUA 2WLSA 5H80A 1TRHA 1TU4A 1ZGGA 4S0ZA 4ZT2A 4M1TA 4WX2B 1YZGA 2PYIA 2J3QA 3MTDA 1CC1S 4QXPA 3O3MB 2IHJA 2HJ9A 2QPTA 1JNXX 1YCFA 2ZE6A 4L5BA 4PU0A 3TS1A 3HTXA 1EDDA 4YCNA 2DF8A 3A3YA 3HYLA 3O84A 2KJQA 1EFLA 1R6AA 2UUBB 2QK4A 4MAAA 2ATXA 1LPAB 2JJMA 4QG7A 4BEWA 1G55A 2X7XA 4ZEXA 1OZHA 2GFHA 4LHEA 2GVNA 4RTSA 2IKQA 4A8JC 5HSGA 3IOBA 1XZFA 2C57A 4NOJA 4ZQHA 3QUBA 2F1HA 1MTZA 2JKZA 1B4DA 2L18A 2IYPA 2XKBA 2XWPA 3H11A 4Y6PA 2VP3A 4Y2GA 1RMTA 2DQSA 4YWHA 1NN3A 1DMSA 1YDHA 4KP7A 3RRZA 2WDPA 1E99A 2Q0SA 3C39A 3BGDA 3KDSE 1ODLA 4Q24A 4TRNA 4UFNA 4B4UA 1GNLA 3F6BX 2FDXA 4KVZA 3B1FA 1XLVA 4RHXA 1TGVA 1Z6XA 3P0RA 4G8JA 2EJVA 4Q3NA 4AKSA 3FDZA 5FXMA 2NZXA 3OTWA 5AXCA 4LQDA 3Q3HA 1NPTO 4XD2A 4US2R 3ZU2A 3GU3A 4YXFA 2G28A 2WJZB 5IABA 3OKFA 3PU6A 1ZI6A 1TEVA 3AZQA 3HXTA 2XYGA 4BE9A 3FPGA 1ABFA 2W2VA 3M1IA 5J23A 3FWHA 4DDWA 3RAEC 4EATA 1MRNA 4YHBA 4ZZ2A 2WF6A 1YR2A 2MSDB 2YFKA 2YV3A 1K8YB 3O2JA 3PR1A 4GP6A 4IXWA 2XTNA 4JT4A 2QTVA 4NFHA 4NNJA 5EXEA 1LDYA 1G18A 2A9QA 1G7SA 4HD8A 4INJA 1VIDA 5AJYA 2WJ6A 3TZBA 1RPZA 2LNDA 1ZJZA 5DYYA 5A04A 3GW8A 4CGZA 3T1VA 4TXHA 4UM9D 4YB8A 3F5DA 2ES4A 1U8UA 5KEIA 5G0WA 3L0OA 1AGPA 2BDEA 3H83A 4MVJA 1N5MA 5IHXA 2ZR8A 5CGZA 4WK0B 4BAZA 1IHPA 3R9WA 3GJ0A 1G6OA 1AT1A 2CVQA 2YJNA 2PEZA 4BP8A 4O4JF 2ZVDA 4HC4A 5L6MB 3QEMB 3TRHA 5DHUA 3W7VA 4TWBA 5EZYF 1X9GA 3P27A 1W8DA 5ESDA 1IBRA 1NHWA 1ANKA 2FE1A 1XMPA 1O9BA 4P4SA 1MEOA 1L5NA 5KC9A 4MDEA 4G2TA 4V3BA 1W0CA 4G4IA 1FU7A 1MQ8B 3IAUA 4JLDA 1JILA 1W9MA 1GN9A 3T9CA 5C8VA 4EI2A 3J80A 3IQHX 3ITNA 3DMHA 4HLCA 3P20A 4NJOA 4C43A 3MIZA 3G6WA 5IN4A 3F7OA 3QYFA 1OPXA 3KALA 1D9ZA 1Y6QA 4IQFA 3AWIA 2H6EA 1KDZA 2ZBVA 4ZOBA 2WUFA 1JJIA 1V2GA 5B1SA 5L7WA 3P8ZA 3FGZA 2C77A 3OOYA 1TPZA 3DBIA 2NM0A 2XE6A 3P94A 3CTMA 4RMNA 2KE5A 3HGQA 2C96A 4JOSA 4JC8A 2IHKA 2FPRA 1MHTA 4Z3DA 4JKYA 1FNBA 2I6QA 1N8KA 2WMYA 4X92A 5CB4A 4TZ6A 2B3DA 2YJGA 1QB8A 3F5QA 4OXXA 1AKYA 1ISFA 1JN0A 2JB9A 3AUFA 2R6ZA 2ZJ7A 3GGSA 4J29A 3KAQA 5BWBA 1C9MA 2H65A 2Z43A 3DB2A 3HKDA 3R09A 4TMWA 2OFXA 3NG1A 1N0UA 2GESA 2NTVA 3JQBC 2VTBA 3HB1A 2ISCA 3ENWA 1U0FA 3OC6A 1ZI9A 4DLUA 4C4SA 3RTEA 4CYMA 4DLXA 5AUOB 1H9AA 2ZGVA 3H11B 4AULA 1N7GA 4TXNA 1SBHA 4J9VA 3LG2A 4KLRA 3UVEA 2Q4TA 4NKRA 5HOEA 2BE7A 3BTVA 1T0HB 3N3AC 2ZRNA 3UAYA 3ZYZA 3DBVO 1C3LA 3B7PA 1NU6A 3CKYA 3BIJA 1WQ3A 5FR2A 5I7OA 3F47A 5GM2A 3AJAA 3CUUA 5C8DA 5JPDA 2ZWAA 4CLHA 4NXMB 5F4ZA 5IYZF 3JSAA 3T1HB 3FDZB 1YL7A 1E8NA 1FF9A 3BRSA 3NWOA 4FC6A 4Q7MB 1V37A 4RKRA 1XK6A 4QVKA 3AFNA 3HUDA 2I2WA 2P2NA 2X2FA 1DHRA 3T6KA 1ECBA 3DTNA 3GNQA 2VS1A 2K2QB 3Q5DA 4YRLA 4AY5A 5CLHA 5IFKA 3AVVA 4MKIA 3DE3X 3HYCA 4XFKA 2BJVA 3L8ZA 4PPQA 5E1BA 3UB2A 3ZGZA 4HQOA 4JB0A 3FOBA 2ZAOA 4NRDA 3HB7A 3VYWA 2NIPA 2H2AA 1XTJA 2A67A 2NT3A 3B2NA 4KEAA 5IT4A 1MA3A 1YQTA 4KBYA 3L4KA 1MAWA 4R01A 2QTVB 3AI1A 2VNKA 2WAAA 1WPGA 2ZSFA 1NC3A 1NF3A 3ZLTA 1DC4A 1MO3A 4DR1B 1NI3A 2R5WA 2BFEA 5M2QA 2E4WA 1JQAA 1EZ4A 1P2TA 1V45E 3I32A 3MPOA 2PQ2A 5HDBB 4YI3A 5T7BA 1GG5A 4AJEA 1EBUA 1EPUA 4IQ8A 2ANBA 3PFIA 5DULA 5KBYA 1QB7A 2R85A 1D09A 2ECPA 1E3DA 2F8LA 2OORC 2WJGA 4JJIA 3RFCA 4K1LA 2GB4A 4QFCA 3RIYA 4P1ZA 2F1KA 3HP7A 2WYVA 5G4LA 4MAMA 2ZYVX 1CNMA 4MV5A 3TDKA 2YFHA 3QMPA 4B3RB 4FCCA 1U2DA 2EGUA 2HLDD 3OY2A 1PZGA 1VHLA 3DO5A 2XB8A 4KQCA 2CLFB 2QVZX 5K9ZA 2O3SA 1N5DA 4HLQB 3W79A 5IF3A 1S8FA 1UM9A 1FDRA 1II0A 2H8GA 1F0PA 1EEHA 4MXDA 2UYYA 3ORSA 5CYPA 3WB9A 1Q0QA 4P4SB 4S24A 4ZAGA 5K3BA 1ENOA 3ISTA 1HFEL 1N2XA 2VIIA 3GEMA 2OGUA 4CV2A 5CDSA 4HN2A 1MPXA 4YTEA 4LYGA 4OI0A 1PR6A 2R65A 1G9TA 3ODGA 4KOAA 4KRYA 2XMGA 4OBXA 7ADHA 4F72A 3COJA 4IDBA 3WL8A 1WXHA 4ZQIA 5DM4A 5E7MA 4UFPA 1T0IA 2AQ8A 4F93B 1FQWA 3RVMA 1NQAO 5CB4F 3GT0A 3GZ4A 2D1RA 1BA3A 3HMQA 5K3AA 2AFHE 1U0RA 3IDFA 3MNFA 4KFTA 4ABYA 1FPQA 1YDWA 1DOHA 2R96A 4RC9A 2V3CC 1PEYA 2B35A 5FEUA 2WIGA 3WLMA 4WN3A 2OGZA 1CZHA 4KK4A 3IBYA 1DAOA 1NQVA 2BFAA 4RJJA 1TAUA 5LQKA 2QSYA 2DZDA 3ANTA 2FNAA 3GRYA 3MT0A 1V6SA 2OCKA 2R6DA 5CB4B 2JFYA 2P6PA 1SC6A 3JS5A 3L1IA 4MVJH 3WAGA 4IIJA 2FPGA 4JP2A 1V95A 2DWQA 1WHSA 1G1AA 2X2PA 3FGOA 1W5EA 3CNBA 1WXFA 2XE7A 2FEAA 3HKDB 3HZOA 3HJFA 3F49S 2CUNA 3ZD9A 1X1EA 2JAOA 1ZJWA 4JUCA 5SY6A 2GEDA 3AL3A 3TINA 2VTBB 3B20A 4JDUA 5IC4A 4E5SA 3QBVA 2H07A 5H81A 4PXAA 5HKBA 3EXEA 1WZCA 3AVTA 2UUCB 3E9NA 2ZM6B 1DADA 1XDDA 4AKHA 3JQ6A 1Y4SA 2HJRA 2I9KA 1N5KA 1WSBA 4BQNA 1QRUA 2GZ3A 1NW6A 2Z2IA 1N34B 4GMHA 2BWJA 1Z08A 2O1SA 3WV5A 5CFLA 4WOKA 1P4GA 4J0IA 2PUCA 1CRZA 3ADKA 1IY1A 1U6KA 3AJ9A 4HYQA 4R9VA 3VJLA 1ZCAA 1I7NA 1QGYA 4HH4A 5FUYA 4OQEA 4EPVA 3U0BA 4EY4A 2ENUA 3MOSA 3N0WA 1UK6A 2PE5A 5B3KA 1I6KA 3B2EA 4KO8A 4MWBA 4E5MA 4EEKA 4NZNA 1A8PA 2PT9A 3HM2A 3CZAA 2AVNA 3O0TA 1WZ2A 4FP9A 3HEMA 3W9SA 3L46A 1ZP6A 3L06A 3JQRA 4XWKA 1T1GA 3QIAA 5IU6A 4HUJA 2BFEB 3G2KA 4KL8S 2C2YA 1AMUA 1J0DA 4G89A 4L8VA 4BN0A 1JRLA 2VZ9A 4KQ9A 3T4UA 2CXNA 1OXUA 3AIIA 2PMDA 3AUYA 1RM4A 5FYDA 4JD5A 3GRVA 1K4YA 2RHTA 2OZPA 1WDMA 2Q3EA 3KOWA 3ZTWA 4TROA 1W5TA 3LYLA 1CYDA 2GT1A 4I1IA 2A0WA 3FUVA 3DONA 4OB7A 1RZRA 2IIBA 1JDTA 1W1WA 1P3Y1 3UTDA 4D4KA 1OT3A 1JZSA 5LYYA 3UWPA 3WWOA 1OH7A 4GYJA 3IR5A 3OCXA 4UOZA 5FP0A 3HR7A 1PEKE 1UM9B 3RHTA 1O97C 2L69A 2OP1A 4OH1A 1KDYA 5JAUA 3HCNA 2Y0DA 5AHWA 2VP2A 3VSAA 2FRDC 4AZ0B 3NONA 1JEJA 2H85A 3WE7A 4ALMA 4AN1A 2Z08A 1FXWF 2YWDA 3GLUA 1ZD5A 3AF3A 1PDOA 3M8KA 1ZA2A 3KRTA 4GE0A 1PR4A 1WV1A 3GVIA 5J5AA 4RESA 3HH8A 1PFWA 3QU5A 5EFZA 4JWKA 1QIJA 3KOMA 1SWVA 3QVVA 4KR0A 3OQJA 4OTZA 2UDPA 3P9CA 4E2ZA 3SXPA 3CXRA 1ND6A 3VKWA 3R7LA 4AZWA 2IZ7A 4G5HA 3KU1A 4GQBA 3I39X 3HXPA 4RJLA 2AZDA 4MJLA 3SVLA 3MD9A 3NJRA 3F7TA 4KAFA 1E7SA 1AHIA 2HO4A 1AUPA 3DLAA 2BZ0A 4JH0A 3O4RA 1W76A 3F3SA 3LLCA 3FZYA 5FOSA 3A6EA 3OCWA 3V6MA 3VH4A 3GVPA 4IJQA 3P4UA 4OYYA 1N2CA 5AKYA 3D7KA 4LYHA 4DR7B 3T0IA 4FGJA 4YRZA 4A92A 2OECA 4IIJB 2FPGB 4FKBA 2JJYA 3HXLA 2J3JA 1WHSB 3A05A 2ZJ0A 4P08A 4WASA 2M1ZA 1OF1A 5IUJC 1HLPA 5D6NA 5AXDA 4KFRA 1E2GA 3ZWVA 1XCJA 1SEVA 3KVYA 4B4KA 3HFRA 4LIPD 5DSXA 3M6FA 5DB4A 2CVFA 5FBHA 1ZN9A 3RUFA 2ZTLA 3EXEB 1N78A 2LIPA 1QZUA 2VT2A 4HAXA 2ZSAA 5LMNB 3THXA 1KSGA 3AZOA 4PSKA 4D3XA 1QX3A 1HNNA 2WF5A 3NUGA 2G8NA 3AEQA 2B7BA 2D1QA 2YJ5A 4OHZA 4DMFA 5MGBA 1FLDA 4W82A 1Y1TA 2ANCA 2R62A 3PICA 1KIAA 4J1NA 4WE3A 3KSZO 3TRDA 4YV0A 5MN5A 1AB5A 621PA 4B3DA 4MUIA 2GEFA 4EVQA 2VBCA 3IHKA 3AYZB 2I34A 4Q18A 3GHYA 3M81A 3F6SA 3KR0A 4A2WA 2PCJA 2V8BA 3Q9LA 4UDOA 2O20A 3PRJA 2OYSA 4EBFA 5JD6A 3LD9A 1LDMA 1VOTA 2FX2A 2G04A 4NZYA 4BIMA 5JMWA 1J70A 5MGNA 4GI1A 4JJ7A 3W8EA 4GGPA 4EY3A 1J8QA 1UJCA 2OXCA 4MQFA 3C3MA 4N82A 4P9NA 4PZ0A 5FORA 3AB7A 3TWOA 4D9GA 1M9NA 5IM4A 4L16A 5GJWC 3O93A 2JBAA 3GA0A 2NTYC 1CBUA 1DI0A 4G5FA 2VUHB 5JNWA 3TECE 3L0PA 2MYPA 2P30A 3EYAA 1KAHA 2CEAA 2QD4A 3JATA 4II2A 4M9RA 3ILSA 1WETA 1DRVA 3QXXA 1ZD2P 4TM8A 3ZU6A 2JVIA 1EIWA 4W6QA 2H51A 1X7XA 4B3TB 1YS1X 4J03A 5ICCA 4JBNA 1UP4A 4L9RA 4P4TA 5K3SA 1L7VC 5CT6A 1I2BA 3WRVA 4HGQA 5BUCA 2XKKA 1VJ5A 3K8YA 1G3MA 3EF3A 3NHFA 4RADA 5C8ZA 1LLDA 1U3VA 1CDZA 4YI5A 4UUMA 3UT0A 3TSYA 3MFYA 3W8NA 2REXB 2ODNA 4FGKA 4O2BA 5KOYA 4TMXA 2C94A 2IWHA 4MP6A 4KXUA 4YRGA 2GBGA 2XUHA 3R7FA 1OI7A 3GOHA 1ILWA 1FDTA 3LPCA 2VHXA 4YASA 3NV9A 4QSMA 3EYWA 2O0HA 3OPYI 3BMCA 1XE3A 5AW6A 3NO4A 4RKWA 1OGJA 1D5WA 4KPUA 4O4HA 5DGTA 5DXAA 2J5QA 4BY9E 4DRXA 3LTEA 5KNBH 1KO5A 3CO0S 4TX1A 5JNLA 4Y2VA 1ZJ6A 1JR2A 1E6LA 2J9GA 5EJGA 3UF0A 3RUDA 1X92A 1O7JA 3UK6A 3STHA 4U9IS 2UXDB 2FDRA 1N57A 4DQXA 5EMNA 4BV2A 3HACA 1F8GA 4J0QA 5JQGB 5K5EA 2XTMA 4LV8B 4FB5A 3JYHA 4QUKA 1ZC4A 3ILYA 3FCXA 1XI2A 1ZAYA 1OUMA 1EE2A 4KXXA 1NW7A 3GAFA 1I4TD 1NNI1 1W25A 3GGPA 1E3EA 4DW8A 3DPIA 1CB0A 3AUJB 4IICA 1J23A 2XUFA 3MTQA 1DXHA 3ZXYA 2Y0CA 3PZRA 3RK4A 1RYDA 2W90A 2P1ZA 3P9YA 3FUUA 4OVKA 4LY6A 3C3KA 3KB2A 3ZV6A 4E7PA 1A7KA 4Y1RA 1K7EB 1CUEA 2IW1A 1N2CB 3KOUA 4FYHA 4IHKA 5DX1A 1DWPA 2R6CA 4OH7A 4Q3LA 4XWYA 1PQPA 2TMYA 4FZVA 3U6BA 3K09A 3LIIA 5E3HA 3O7MA 4LAFA 2IZ6A 2P9JA 4MRRA 2WWYA 1JG6A 3IUNA 3KPWA 1DEHA 4NG4A 5DEOA 2IOFK 3FBTA 1VDMA 3OCYA 1PGPA 2A7QA 1GTL1 1YZYA 2CBXA 4G37A 1TJNA 2RAFA 1JHMA 5J40A 3B9PA 1JQ3A 5FWYA 3TBFA 3KE8A 2BGRA 2QNBA 1DOZA 3LRTA 3THXB 2YW2A 2ZIXA 3QE0A 5JSUA 3MTAA 1MG0A 1Z34A 3IOMA 3AEQB 4JA0A 1F0YA 2VPQA 1ORRA 2JAXA 1MENA 3OZXA 5BOVA 3WK6A 2IS1A 2H0RA 1JDJA 2JPDA 2IXFA 4L8YA 1RI5A 2VL7A 4PPGA 1RJGA 4TYWA 5IM4F 1M54A 4HCJA 3EVDA 4GS5A 2UZ1A 1XBTA 2PFKA 2B5VA 4FE7A 2X0DA 4AK9A 2FEPA 3OOJA 5K51A 4B35A 3DFKA 1NYRA 2HMWA 1DV2A 3M1AA 4MCAA 4BUJA 4S04A 4GSKA 1VDZA 5JWHA 1WIWA 2C7BA 3NANA 4JBYA 1LLQA 2DKOA 1C2TA 1PSZA 2DULA 1A27A 3LDAA 3EZFA 4MQFB 5CT8A 4B2IA 1HF3A 3TOXA 3P2MA 4MZDA 3V7YA 2QUIA 1P44A 3FFAA 2JBAB 4QWWA 1XHFA 4PC1A 4ZKEA 1W59A 2DVMA 2HRRA 5M34A 4JODA 4BB0A 4AQ7A 3A1FA 3QY9A 4NK5A 1A9TA 3JATB 2E18A 4IWYA 5HQTA 2FF7A 3HN2A 4IDCA 3EVNA 1LRKA 5A2GA 1X7XB 4DM3A 3F3MA 3OIDA 2O06A 3U4MA 1N8SA 4HGOA 4K87A 4R98A 2OR3A 3FI0A 5B3JC 4RTNA 4C2AA 1XQYA 2AN1A 5L8VA 3QVUA 2O4CA 5AW4A 5K3EA 4LVUA 1DBSA 2QUZA 2AEMA 1Y98A 3EISA 3W06A 4G24A 4HMPA 5JD3A 5CBPB 1Z2AA 1ULAA 2ZWPA 3F6PA 3FYHA 5DRTA 5BN4B 3BMCB 3D4LA 3VPXA 2P4HX 1JFSA 2I54A 5SZHB 4KPUB 3AV3A 4JU8A 3IUBA 4MTCA 4O4HB 4PNHA 4ZALA 3VTFA 1J00A 1JHQA 3BF8A 4I5FA 3AKCA 3VZPA 4J1SA 1Q16A 2B2XA 4WKNA 4DRXB 4YQFA 3L4JA 4WFIA 4MMXB 5FPHA 3SDBA 2ABWA 4H6VA 5ULLA 1PYGA 2GXSA 2P40A 2JATA 2AN3A 3HJHA 4EQ6A 1FDVA 2NNLD 1G4AE 2E82A 1R0KA 2NX2A 3QF7A 1D5CA 3DMYA 1WD7A 4JASB 2QGNA 4QOEA 4EY8A 2G1UA 1T8TA 2QZZA 3OZCA 4MUMA 2QQGA 2NG1A 4PPFA 1LPMA 1T3SA 2WZDA 2IDKA 2G0NA 4K88A 5K3DA 2K6GA 3U3ZA 1JIXA 4EGAA 3ZVKA 2J6CA 1G3QA 3RU9A 3WNZA 4MCIA 2PX3A 2V59A 3SKVA 3PK0A 4ZICA 4CQMD 2ZRLA 1YJQA 3P9XA 1D4ZA 4Y1RB 2ZDGA 4RGVA 3VGPA 3IPLA 1AZLA 3RVLA 4QVIA 5CXUA 4KXWA 3THYA 4JN6B 1QLWA 5SZIA 3F2VA 1L7MA 2G3YA 4JX9A 4CU5A 5JDCC 2WF9A 2C3OA 3H9EO 5DI3A 5JAQA 4BNYA 1LPSA 3LLSA 4POAA 1KERA 5HA5A 1M2OA 3WYBA 4B4WA 4Z4QA 2K7ZA 4HNVA 2QN6A 3O2NA 3SMVA 3VPBA 4AWAA 4OJYA 3L6EA 4IOJA 2OCXA 3WS7A 2WZCA 1CP2A 4D6PA 3WHLA 1QAQA 1U1IA 2XAUA 4PC6A 5FWYB 3GEBA 4BZWA 1U6IA 4JJFA 4AJPA 1AV7A 2JH8A 2UYHA 3T4PA 2LE0A 3LO5A 1AQJA 1P77A 2J5XA 2ZIXB 3BEOA 4WD3A 1C3XA 2BUAA 1Q1ZA 3A6GA 4YVFA 8LDHA 1QK4A 5H4GA 3OTOB 1MOZA 3WGGA 4EB8A 2BONA 5JECA 5I9IA 3BZBA 4K0RA 5F52A 1H8HD 2MYNA 1T9GS 1DZIA 1KETA 1F0KA 3LL7A 3R6DA 2BF4A 3K5IA 1MIHA 4AJJA 2P41A 3GP3A 3EW7A 2VJDA 4MRNA 2UZ1B 2OHVA 1RWVA 4HVLA 2R68A 3MQ2A 2HSJA 4DF3A 1DFIA 1RU3A 1F3LA 2DSNA 1PV2A 2COUA 3TAUA 4R3NA 1DINA 5ENZA 3GP8A 1GL3A 2ZAYA 1M8GA 3U5ZB 3L7CA 1VCIA 4M60A 2E1RA 2JLCA 1F5SA 3X1ZA 4YGXB 2WSMA 3MRTA 2ZXFA 3FIUA 4E22A 1F9AA 2TYSB 1AVTA 4BLOA 1QYVA 1P9RA 4LKRA 3IGFA 3N3BC 4P4GA 4CHTA 3TTYA 4BATA 1IM5A 3W1WA 1CF9A 3TQHA 1D2RA 4EBBA 4TKZA 4FINA 2BVNA 4DV2B 3LFTA 2VTEA 3AR2A 1ZMBA 2IIQA 1DAPA 3CZMA 3M4ZA 4JAVC 4GBJA 5CX4A 2FFBA 4D9NA 1OXXK 2X77A 1U3DA 4YN3A 4B17A 5CLIA 3T06B 4E1BA 1AH2A 2CXUA 5KNBD 1VG8A 3PF9A 3I1IA 5K0NA 1G16A 3TIIA 4GLJA 1QGZA 2QTNA 4DJAA 1QP8A 1FX1A 3ZZNA 2E4ZA 2QVYX 3NETA 3OWOA 1SUIA 2PKCA 1XSEA 3A1SA 2HBQA 2QXTA 3JVVA 1DBQA 1SXJC 2ZB7A 3OLZA 4P83A 5A1TA 2MDTA 3UGKA 3O8NA 1YDMA 2E4XA 2EG9A 1B23P 3OQ6A 2IS6A 3H75A 4EQ6B 5HJEA 4ENUA 2EARA 5FTWA 3UMVA 3NHBA 2PRJA 2V7VA 2NSHA 3IAS1 2GPAA 4CI0B 4EGSA 5FH9A 4I5DA 1NKTA 1TIBA 2OCAA 4MMYB 4QYWA 4XRRA 3WV4A 1M76A 4GGOA 1RHKA 2GASA 4TV8A 2AMJA 4X8MA 2AYZA 2BISA 4PIPA 1K8XB 3MBOA 3TO5A 2HSZA 4MVJI 5HCUA 2JLSA 1VQ1A 3ZE7A 2J9FA 3BXHA 3L18A 3WJ1A 1H2AS 2DG2A 3C16C 2ZYDA 4Q00A 3O94A 4NH4A 1DLJA 1VFPA 3LWNA 3RRJA 3VDRA 5C35A 4Q16A 5IVKA 3DWFA 1YOVA 2Y66A 1FCJA 3L77A 1P3DA 1T36A 2GJ9A 2YWRA 3J7TA 3KPVA 1B8UA 3PC8A 5EKDA 4DJTA 3THYB 1LPNA 1N2EA 1SD1A 4KR6A 1XD9A 4I9FA 3DW1X 4BO8A 3Q88A 5BN1A 1UOPA 3BFKA 4LBVA 1MCZA 2VBGA 5DI3B 5A4MS 2EJBA 3QA3E 5KYYA 1LEHA