1RRFA

Non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, monomeric crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
175
Chain Sequence
b'GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAT ADP-RIBOSYLATION FACTOR-1
publication title The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 40
structure length 175
sequence length 177
ec nomenclature
pdb deposition date 1995-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrfA00
1W36D 3EZ2A 4GL2A 2GESA 2AK3A 4LV8B 2GEVA 2OAQ1 1YVDA 1EX6A 2MMGA 3LV8A 1P4SA 4TL9A 5H68A 1HURA 2J0SA 3NEYA 1YR7A 3H84A 3A37A 5AUNB 5LBIA 2FX3A 3W3AA 3W6PA 1NL3A 3QF4A 1KIMA 2QGNA 4OQNA 4DZZA 1R6BX 3AP1A 2AR7A 4Q1DA 2OLJA 2ZE6A 3OE7A 3B1XA 4WZBE 1ZIPA 3QBTA 4DRZA 1SKYE 1XBTA 3QVUA 2GZHA 2NPFA 2ZJYA 4A0HA 1F6BA 5JSZA 4MRSA 4E22A 1BOFA 1LV7A 5KSOA 4KU4A 1DG3A 3KXIA 4M1YA 1CR4A 2EW1A 4IDHA 4Q1BA 3TAUA 2OAP1 2EFEB 1ZJ6A 2XAUA 4Q9IA 3K9NA 4QGAA 1G8HA 3AM1A 2A5YB 4IFEA 4BUJA 5IF9A 3ZD6A 1GKYA 3MRSA 1UKZA 4N1AA 1M2OB 3RABA 4C0AC 1RZ3A 1R4AA 4QXAA 4C9BA 5D3MA 4RSGA 1UBFA 4DLRA 2IHYA 1IY1A 3ZVMA 3K70B 1G16A 3DKPA 3NHBA 3GP8A 4MUAA 4JLPA 4PQYA 4YONB 2G6BA 4KBGA 3SN6A 1EXMA 1N6HA 4HZUB 4OHYA 621PA 2IHBA 4KVAA 1AA9A 3AP2A 4BRUA 2JJ2A 4C3ZA 2GXSA 2PCLA 4MRRA 1ZM7A 2ZRCA 5FI0B 5KUTA 1XEXA 3GJ4A 1PJRA 3DOFA 4BLQA 4Q4HA 2ZPTX 3SFZA 4O2LA 4B76A 3GD7A 4YMVA 2XB2A 3I32A 3PEUA 1G8GA 1CKEA 4JIMA 2FSIA 2RGAA 1ZRHA 4B33A 4Q1AA 3GLHB 3V4RA 1EWRA 1AQYA 5TV2A 2FF7A 2QEQA 4HB2A 3UWOA 4F4CA 1EFRA 4XH9B 4B2LA 1CR0A 2O8EB 5J4YA 2BCGY 1RJ9B 4DLVA 1Z22A 1Q3TA 2YV5A 2CJWB 4O3MA 3T1TA 3OEHD 2FDCA 4NCHA 4Z8XA 3GQBA 4YQFA 4OJKA 3QUSA 4A0FA 4D26A 2AK2A 4ZDWA 2B92A 4LWZA 1KI8A 3SJCA 4A2QA 2RGCA 3TIFA 1FMJA 4LSGA 1QHIA 3ZYCA 4EKDA 1TU3A 4Q03A 1U90A 2IEYA 4LHXA 3RLFA 2IX3A 2J7KA 3HU2A 3TH5A 4M8NE 4QRHA 1N0VC 1US8A 4IDNA 5L3VA 5L3QA 4P4SB 1XTQA 5EZ5A 4XTCS 1NLZA 3NBZC 4TTPA 1LS6A 4XIGS 4B3BA 4POAA 1J70A 4M1KA 4RCZA 2EFCB 3DM9B 5A4JA 1IY0A 3FVQA 4C0QC 2RAPA 4GI7A 4TMXA 3IIKA 2ZSEA 3H1TA 4IFBA 2KI5A 1ZUHA 1SXJB 3CKLA 3R7WA 4ACBA 1E2DA 2OXRA 2ZI5A 3OAAA 3V9PA 2DHRA 5EE1A 2WJIA 4G5RA 1GM5A 1IOZA 2CL6X 3CF2A 2CNWD 4RZUA 1P6XA 1Z0AA 1KOFA 3I73A 1G5PA 4BLTA 4TYQA 3LLMA 5HKKA 4AWXA 3ICQB 1H8HD 1OLOA 4LJ9A 5FPKA 4C0HA 1JPNA 1XTKA 1KK1A 3EZ6A 4Q66C 5CYPA 5KU1A 4A2PA 3L8ZA 3QG1A 4TQ9A 2HCJB 1FTSA 1ZM9A 3AB3A 1XMIA 3A1WA 1FMLA 3UMSA 1RYFA 2MSCB 4DJTA 3FKSA 1II0A 2BOVA 5L3SA 3B8HA 4PC7A 2QAGA 1BYIA 2QENA 4YDHB 1KI6A 3GFPA 3K0FB 5J4VA 1RIFA 4E09A 2WOJA 3PV0A 1UBEA 5DNYB 3K8YA 4QKQA 1IM2A 1N0UA 2V7QA 2ZUDA 4DDWA 1KK3A 2ZAMA 1WA5A 4GSYA 2QMUA 3REFA 2PL3A 2OCBA 1II8B 2W6IA 2EVWX 2IXFA 5CM9C 2D74A 5FL3A 2ZRFA 1C4OA 2NO0A 1Z2AA 1P2SA 1U98A 2AHOA 3AF1A 4XSHA 4IXMA 4MGKR 4EQ6B 2JAQA 4PPQA 3IPXA 1X1SA 3EC2A 4LBVA 2P2LA 4M1SA 2ODWA 4NCJA 1JR3D 1DAFA 1QBKC 2IWHA 5BN5A 4W7SA 1NMXA 1T9HA 1X8JA 3KJGA 2IYVA 4NL4H 4P32A 1VECA 3FFAA 1OFTA 2LCFA 4B47A 1E1RD 2P0EA 1CR2A 5B30A 5TMPA 1KY2A 3CZPA 3KKOA 2XTNA 4HLCA 3GLGB 1TPZA 3BOSA 1WRBA 3TAHA 3RS5A 2FFAA 3K0AA 1TMKA 2R6DA 2V1XA 1Z6AA 4FMBB 1M34E 4LY6A 2UKDA 4ZIRB 2R8RA 5FR2A 4AC9A 2ZR9A 1JJVA 3DKVA 1H8ED 3MWYW 2IYZA 4NP6A 1B23P 1KJWA 1XRJA 2KB0A 2Q3FA 4W9MC 4RD3A 4JLDA 4B3CA 4I99A 3FMOB 2A30A 2JJ2D 1G64A 1HT2E 5CJPA 1CR1A 1QVAA 2JATA 1IHUA 4MRVA 3KKMA 4L4UA 1WQ1R 2VIIA 2G0NA 3VR1A 3ZH9B 4A92A 3I61A 4ASUA 4MITA 2ERYA 3TR0A 3G0HA 3SYNA 3I5XA 5F3WB 1ZIOA 4MA4A 3NWJA 4QGGA 2GJ9A 2NO6A 1E2EA 1IXRC 1WBDA 1NG9A 1YRBA 2C96A 3KL4A 4NYMQ 3CIOA 2W6JA 1G8YA 4DCTA 3TGPA 3ZD7A 5AK0A 1GITA 3CPJB 4OK3A 2Q9CA 2BKUA 2ZUCA 3HR8A 3U3OA 2DWQA 2ZR7A 4GMXA 4BECA 2HEIA 3LQRA 4NH0A 3DOEA 3LXRA 3OFND 1T0HB 3T12A 3BK7A 4QNRA 5E3HA 2OEPA 4Q7MB 1NVXQ 1KTVA 2CLSA 1XMVA 1S3GA 3LW8A 4KHZA 2J0UB 4BLPA 2PZFA 1KSFX 4EJSA 1ZNWA 1X8KA 4QOSA 1OIXA 1NN1A 4AK9A 1DO0A 4M4SA 4A4DA 4BASA 2ZS7A 2DFNA 1RRGA 2IYUA 2QG6A 3CRW1 3R9WA 1ZU4A 2NZJA 1EGAA 2WHXA 1W1WA 5FUXA 4AYTA 1KHTA 4X8OA 2ZE5A 2QMHA 4OK5A 4QGFA 4RY2A 2ZI9A 3KB1A 2OFWA 3NH9A 4QG7A 2X8AA 1NKSA 1W49A 5JHHB 1DAHA 4JBYA 1MO4A 4Q48A 3PEYA 1O3YA 2RGNC 5L8VA 2XOKA 2WJVA 4UJ5A 2FA9A 4DLSA 2IYRA 3PVSA 2ZAOA 1VCNA 2ORIA 1L2TA 3F5FA 2BJWA 3GLIB 2DR3A 1GDDA 3CR7A 1CJTC 4YMWA 1XPRA 2WWHA 5EQTA 2FSGA 3R9IA 4B75A 1EG7A 2GKSA 2LWIA 4QHTA 1NBMA 3FGNA 2N1BA 2OBMA 2ANBA 4HUTA 2PCJA 1OF1A 1NRJB 3C4JA 2ANCA 4FMCF 1TQDA 2I1QA 1F5NA 2EFDB 3LA6A 1VTKA 4P4SA 4PC2A 4Q00A 2GF0A 1GFIA 2O8FB 1G21E 1SVKA 2QQEA 4LJYA 3PJRA 2VA8A 4QBGB 3L0PA 5E7MA 3SR0A 1Q3HA 5CIQA 1W0JA 1E94E 4L5BA 3EWSA 1N6KA 1XTRA 3W3ZB 2JLZA 4JYCA 3BS4A 3NIBA 1E98A 1Z6GA 1Q12A 1N5KA 2NOAA 2XZPA 2YWFA 4KLZA 3M1IA 3IO3A 4LBZA 4NKRA 1G5TA 2V7QD 3CNNA 3WHLA 4OYHA 2V54A 3JZAA 3T5GA 2XJ4A 2JLYA 2RKOA 3AVWA 2IYYA 2IS2A 1UDXA 4XOIA 3LVQE 4RFVA 2W6ID 1K8RA 3FOZA 3MUFA 3ZVRA 2FPKA 3OIUA 1TF5A 2BBWA 4EFMA 2RGDA 2HT6A 2ZU0C 4G5OA 4D0LB 5K8LA 1LW7A 4GRAA 3GLHE 1ZUNB 3HU1A 5FUWA 3CR8A 1PLLA 2IEZA 4GT1A 4GPTA 2IYLD 1COWD 4D4LA 2NO9A 5FOVA 3E2IA 2G77B 1KMQA 2WKQA 4C4PA 3A1UA 5BN4A 2ATXA 1G7CA 2IF0A 3GJ7A 1E0JA 4PHTA 4TSFA 4AURA 4JL8A 4F38A 4Z54A 4PAMA 1XCGB 1TEXA 3HYTA 1R0YA 2I4IA 5FPHA 2F1JA 1UEJA 3NBXX 4TL8A 3QEJA 2WM9B 1Z3IX 2ZYWX 1ELOA 4V0ME 1ONBA 3ZJYA 2GCOB 3LWNA 4C0LA 2WMOB 3X1WA 2ONKA 5TXGA 1IN7A 1C9KA 2ORVA 3CRVA 4BFUA 4TLEA 2XXAA 2NG1A 1II8A 1DS6A 2YKGA 3ZDQA 1LY1A 2FSFA 2F1IA 4OK6A 4A8JB 2AN9A 4NCNA 5DI3B 1ZCBA 3TW8B 5JRJA 2DFKB 2G1KA 3M0EA 1SXJE 2RMKA 2MSDB 3AKCA 1OIVA 3A1TA 8OHMA 1UM8A 1FQKA 5FUYA 1RRPA 3EIQA 4B2IA 2Q3MA 4KAXA 4KLNA 1OE0A 4Q1FA 4AI6A 2GXAA 2CDNA 4PHHA 5LB4A 2FH5B 1DG1G 4C0KA 3C8UA 1E99A 4DKXA 4LYHA 2IUUA 2R62A 2GHIA 3WXMA 4LDJA 3C5CA 2OE2A 3HYRA 2QP3A 2YWHA 3CO5A 3KZ1E 3ZQJA 2V1UA 4L9SA 4ASUD 2WTUA 2H5EA 3DEFA 3IILA 4LJ5A 2A2ZA 4RVCA 3LH5A 2VP4A 3QSYA 1LNZA 4KFSA 4LV5B 3UWKA 1DAGA 3AF0A 2QA5A 2J0QA 2VRWA 1TU4A 5J40A 2RH5A 2YOFA 2ZS8A 3C16C 3UIEA 3WHKA 4M0LA 5TB5A 5JFGA 5CM8B 3UG6A 5F9FA 1GL7A 4W5JA 2WWGA 2HF8A 4A6XA 1XJQA 3LX8A 1MV5A 4D81A 4MDEA 3PCRB 1Q1QA 2VBCA 4PTLA 1IN8A 1CRQA 2QT1A 2R44A 4TMKA 1OV4A 4R7ZA 1J8MF 3NBFA 1R0XA 4A0GA 1E6CA 3THWB 2RGGA 2FE4A 4LC0A 1YZNA 4X8MA 5CYOA 1U94A 1UDWA 1M7HA 4PPFA 2D2FA 4DEYA 2PLRA 3THYA 1Q20A 2PMDA 4OHXA 1XEWX 2IS6A 4A9AA 3L82B 1QHHB 4WZAE 2WJJA 2IWRA 1D6JA 3B7GA 4MKFA 4FW9A 4XWKA 1KSHA 2HCBA 5JECA 3EAQA 1OB5A 1U8ZA 2EFHB 2XOKD 4DSNA 1E2HA 2GJSA 3BAFA 2JDID 3G5UA 2ZRPA 3T61A 4OQFA 1KO8A 1F48A 4RD6A 5FTLA 2B7CA 4ZV4A 1E9RA 2GAAA 1G7RA 3OIWA 2QAGC 4JJZA 3KXLA 1LTQA 4QNMA 2OG2A 3EPLA 4Y0VA 4V0KA 4F4IA 3QBVA 5FBQB 3FFBA 4DHEA 3IUYA 3W8NA 1GTVA 3Q72A 3IO5A 4AYWA 2X19A 1P9RA 2X2EA 3NTUA 3W90A 3NG1A 1VG9B 1NBMD 2BDTA 1A2BA 5GJCA 3THXB 1KY3A 4KFTA 5C4GB 3GLGE 3QY0A 3QKRB 2CL7X 5C1BA 1RE0A 4B3DA 2XZLA 5G3YA 2FZ4A 1D2EA 5ELXA 4F93B 1GZSA 1PVOA 2ZEJA 2PZEA 4OJQA 1JAHA 1CXZA 2YHSA 4URXR 2AKAB 3TMKA 1J7KA 1CULC 1XB2A 2LKDA 1XD2B 3MWJA 4HZIA 2ZI4A 1NVWQ 1H65A 2IYQA 2WIAA 2Q21A 4BFVA 4LPKA 5LDDC 4DLYA 4NHOA 4NZYA 5HTKA 4HUQB 3BGWA 2ZR0A 3LW7A 2VL7A 5JJLA 4XD7A 2OFXA 3O47A 2GZDA 4Q02A 1VCOA 2BHRA 1KAGA 1OXUA 1OYWA 5HE8A 3RS7A 3P27A 3CH4B 4BFWA 1PLJA 1OXXK 2I3BA 4LHVA 4URVR 5H1YA 1XEFA 4MH0R 3B60A 3K0SA 3EIEA 1JNYA 3QKSA 2B8TA 5H70A 4F4JA 2XZOA 4U00A 5JEEA 1QHGA 4DIEA 4EFNA 1G1MA 1KDRA 3TUIC 2ZRLA 1HH4A 4G01B 4P0TA 1W5TA 2JGNA 4Q1CA 4B6EA 4Q19A 3AQ4A 3MD0A 4ZPXA 5A0FA 2HJGA 2FMXA 4TSFD 3TRFA 1YZGA 2BMDA 4M2LA 3U3RA 3CX6A 3PITA 1GRNA 2ZRKA 2ZSBA 4BE7B 3M4YA 4LYJA 2OLKA 1DBSA 1RC8A 5JBQA 5GVSA 4DSOA 3ADCA 4CT5A 3CRMA 1G41A 3CH5A 4OI2A 4AG5A 2RCNA 4Q9JA 4RZXA 5KYKA 5FL7A 4A36A 3AKYA 3C5HA 1XEWY 2AWOA 4H1UA 3KQUA 3U2QA 4CEJA 4C7OB 4R98A 2ZROA 1XMJA 4L15A 3K9GA 2P65A 5CJ2A 4MKGA 3EWAA 3S1AB 3UATA 4ERNA 1UBCA 4OHWA 4RFSB 1MABB 1KO5A 3A4LA 3VR2A 4D4KA 4DCNA 2WAYA 2GEUA 4IOLA 3RSLA 1E96A 3V4FA 4Q9KA 4FCWA 3EW9A 3HPQA 1UKEA 2O5VA 2P5SA 3CF0A 2HJVA 1E2QA 2NO7A 5KDLA 4TMTA 4YMUA 1N5JA 5J4KA 3CWZA 5IDVA 1XP8A 5SZIA 3GLIE 1R8QA 4C0SA 2YINC 3G82C 2CHVA 4C0BA 3LDAA 2GNOA 4B43A 4BEJA 4IKEA 521PA 4TYNA 3CM0A 4IHQA 4GP7A 3Q5EA 2A5GA 4Q5IA 5DE3A 2GCOA 3AGPA 5KNCA 1TADA 4EJSC 4N3NA 2GJAA 2O8DA 3N5CA 3RRZA 2VSFA 3WNCA 2J1LA 3B9PA 3FMFA 2QBYB 3UMRA 1JEEA 1KKLA 5FUVA 2O8BB 3Q9LA 2ZXUA 5A5GA 3UPUA 1X1RA 1AZSC 3LBNA 4HDQB 3GJ8A 3AV0B 4A8JA 1M74A 4YMSA 2OBNA 2I1VB 1JECA 2ZSFA 1TX4B 1R2QA 1P9WA 3TSWA 1U8AA 3L0OA 4H9GA 5AUPB 2K5UA 2VF8A 5DLQC 4JLBA 4D4MA 1ZM2A 3MG9A 3SJBA 3A58B 4Q21A 1DAEA 2ZRHA 1EFCA 5FBVB 3BFVA 1F2TB 3CF6R 4FI3C 5JI3E 3U3KA 4DDVA 1CJVC 3T06B 1U0LA 1ZCAA 4PAOA 3CBQA 4MGZR 2WWFA 2ZVPX 4KI0A 1M6NA 2VSOA 3I3SR 2IW3A 1NIPA 4PC6A 1JXOA 4KJZA 2D4HA 4JS0A 3FHTA 3A36A 3H0KA 3CNOA 1II9A 5DISB 4WIAA 1YU9A 4KFUA 4LZZA 4Q47A 1XPUA 3W34A 4NYIQ 3U7GA 4BFTA 2JLQA 5TARA 1G7TA 1BMFD 1N6OA 3HP1A 3DM5A 3UK6A 1OH8A 2WOOA 4EPYA 2YZ2A 1EFUA 3ZZ0A 1DEKA 1G4AE 1W2HA 5FPSA 4IVQA 3NDBB 4PSAA 2ZI6A 5DYIA 1W5SA 4D25A 4A6PA 3N2EA 4RD2A 3VAAA 2GEDA 2QSYA 1E2JA 4DCVA 2PJRA 1YHNA 1CU1A 1ZMXA 2WKRA 3B1VA 5GVRA 2GCPA 3BD9A 3CRRA 3SJAA 2XITA 3U44A 1ZNZA 1P62B 4IDQA 5JJKA 3R20A 5BXQC 2IUTA 2QMEA 2VHTA 3TSOA 2ASEA 3ADDA 4JT2A 4LBWA 1YKSA 4WBSA 3U3MA 4NYJR 4O25A 1DADA 1WCV1 4US2R 1JR3E 2DWPA 1P60A 4XVRA 3R8CA 2ZRNA 4BWYA 1KI7A 1UJ2A 4LBYA 2AL7A 4S2EA 2ZM5A 1D9ZA 5JLJA 4XD7D 1L7VC 3OIVA 4IJMA 1CRPA 4FMCB 1KO7A 2BBTA 1FL9A 2UVQA 2FGKA 1RRFA 2HXSA 2JLSA 1U0HC 2WKPA 4RD4A 2FJUA 3REGA 3T1OA 3U5ZB 1XTIA 1NKTA 2F1RA 1I4LD 2B6HA 2QZ4A 3U7EB 3WNBA 4MGYR 3QENA 4I1OA 4WW0A 5BQ5A 1KI2A 4QGHA 1E0KA 2C9CA 2CVFA 3WYAA 1KSJA 1E9CA 1FOEB 3QKRA 5E95A 3SJZA 1XJCA 3L8YA 3QEOA 4CEHA 2VH5R 4PO8A 3QXJA 2QN6A 1IXZA 4JLMA 4PO1A 2QROA 4V0LA 1A1VA 2OZEA 4DLWA 3RNLA 3VMFA 2R6AA 4UNRA 1CBUA 3TKLA 5J5CA 1VYVA 4CEIB 4LK2A 4WXRA 4BPBA 1TF7A 4LC1A 3W6NA 2C03A 1W36C 1N0WA 3E1SA 4RD0A 5DGXA 2WWYA 4UNNA 3Q5DA 4IEIA 3B5JA 4HUQA 2XSZA 2VP2A 3AKEA 2GZAA 1JI0A 4HEJA 4IOJA 5FL7D 1RYHA 1E32A 1Z6YA 3ASZA 3Q85A 1UF9A 1TTTA 1KDTA 1T6NA 4D4JA 3NHAA 1TUIA 4JLJA 1CP2A 3NBYC 4TQAA 4PX9A 4DCUA 3U7HB 1W0KD 1F3OA 1BYUA 4N0DA 3I1FA 3WMEA 1GKUB 1D9XA 4NTZA 3UKDA 1WXQA 1D5CA 4UQOA 2IS4A 4QJ5A 2G0TA 4M9XA 4D0GA 4Q9HA 1X3SA 2QU8A 2HYIC 2ZSDA 1GRQA 1S3SA 4CF7A 2CCGA 4G0NA 4CW7A 2AXPA 4M22A 5CK5A 3U4QA 4MDFA 1Z47A 2O8CB 4HAZA 5KSYA 2D06A 1R0ZA 3MAAC 3O8CA 1GNRA 2RGXA 3OE7D 5E7IA 1MRNA 2YC4C 2GBLC 3HJNA 3MFYA 4PHGA 2R65A 2CHQA 1CJUC 3RC3A 3W9YA 2HLDA 2CVHA 1ZM3A 4TLDA 1G3IA 4L9WA 3W5IA 1KMHB 1E2MA 2WSMA 3K0CA 3QPVA 4IVPA 3BB3A 4OI4A 4G3XA 1W36B 1XJ0A 1Z06A 2MMCA 2VQSA 4QHYA 3WP0A 5BYKA 3VU9B 1NIJA 2RHMA 1VYUA 4FCTA 1ZD8A 1ZM4A 3O8BA 2GF9A 4TYYA 4Q4AB 4A0RA 2VEDA 2X77A 1XD8A 5FPYA 3S1AA 4YXWA 4NBSA 5GJWC 5EXPA 4RCYA 1G7SA 3FHOA 3TK1A 2H1LA 2C04A 2IT1A 4OQMA 1KAOA 2ZUBA 5CLLA 1E0SA 4HAXA 4DB2A 3NVAA 2H17A 1G19A 2ZJAA 3GEEA 4NMMA 1OH7A 5BW8A 4KV9A 1W7AA 3O8RA 1D2MA 2CL0X 2G3YA 4HAUA 4QFMA 4A2WA 1DPFA 3L0IB 2N42A 2H18A 3ZS9A 2ZSAA 1YE8A 5DSZA 4Q7LA 2XGJA 2FEOA 3QPWA 3SC3A 1FP7A 1G3QA 2NZ8A 4JL6A 2PX0A 2QPAA 5DN6A 2HYDA 3BH7A 4IVRA 1OXSC 1G3RA 3TQCA 2PX3A 2QUZA 4M1TA 3X1YA 6Q21A 2Q0HA 3CX8A 4C2UA 3IEVA 2VPPA 4G1UC 2IXEA 4KYIB 1W2GA 2ZS9A 2ZJ5A 1SULA 2BIFA 4WZ6A 1XD9A 1HV8A 1G6OA 1Z6TA 3CB4A 4US0R 2C95A 4BLOA 1EX7A 1P3JA 1RVDA 1U9IC 3CLVA 3WY9A 2WZQA 4PO9A 4MQBA 1XFAA 2QQ0A 3ZS8A 3FDIA 3C41J 3IHWA 1EFRD 3VX4A 2ZRMA 1CEEA 2BM0A 2ZJZA 3P4YA 5KOYA 4BZXA 1XXHE 4HLDA 2HF9A 4Y0AA 1Q57A 5B64A 3LBIA 5IK2A 4QL3A 4EAQA 4KBFA 1VG1A 4HZUA 1NNEA 1VHTA 1Y63A 3BWDD 1T3LA 3P26A 2D2EA 221PA 1CF4A 1ZC4A 1NF3A 1D8TA 2WPDA 3B13B 2IF2A 4FIDA 2GCNA 4I4LA 2J41A 3EZFA 1SVSA 2XB4A 4AY2A 3QOFA 4P31A 1SHKA 4GNKA 3TUJC 3CWQA 2F9LA 1JXMA 3W6OA 2BJVA 2NPIA 4ESHA 2BC9A 1UBGA 5F9HA 3TVTA 3FB4A 1YJ5A 3LRPA 3GLHA 3OAAD 4QJ4A 3QIAA 3QPUA 5LPNA 5EE9A 2OO7A 1QHNA 2SHKA 3RAPR 2O8EA 4QBHA 4JT4A 5TY0A 3SYLA 1RJ9A 3SS8A 3R8FA 1MT0A 1ZAKA 2CJWA 4YDSA 2IA5A 4KSCA 3UXMA 5FTMA 3B82A 3SFVA 5HKKD 2FG5A 4HB4A 5DYGA 2C5LA 1JALA 3ZQ6A 4TL6A 4TLAA 1GL6A 4P4UA 2PMKA 4IOKA 2OBLA 2ZYTX 5JCPA 1NVVQ 2H16A 3X2SA 2ZRDA 5C2JB 4V0MA 5FTKA 1S0UA 1ESMA 3D31A 3KJIA 2JEOA 1Q21A 1S2MA 3IQWA 4WAUA 3KDSE 1ZBDA 2NTYC 1DE0A 2B8WA 1HQCA 1Q44A 2E1RA 2X1VA 1QDEA 1P7CA 4R2HA 3FKSD 1VPLA 3TLXA 2QM8A 2OHFA 4FD2A 2JIZA 1DELA 2AWNA 3A6PC 2QPTA 1CS4C 3T1VA 1DTSA 2BCJQ 1AGRA 4B3GA 1SXJA 5JMTA 5KSZA 4R2IA 4Q7KA 1FTNA 1CTQA 3CZQA 5JWRA 1SHZA 1OFHA 1F2UB 1AKYA 1QRAA 4FINA 4DLZA 1BH2A 5GJBA 1ZINA 4GP6A 4URZR 3AVPA 3DVLA 2P3SA 1E9BA 4Q4JB 4TN1A 1T3HA 4EIWA 1G20E 4OQXA 5EZ6B 1Z0DA 1E2LA 3D6TB 4PQRA 4EPTA 4RJLA 5FR1A 1IJFA 1EFHA 1OT3A 5J4HA 4ABYA 4MGIR 4QM6A 5FTNA 2ZE7A 3FE2A 1ZUIA 2KBEA 3JVUA 5G41A 5AJWA 1R5BA 3B9QA 2CLDX 3GLFB 1L8QA 1YZUA 4H1VA 3BXZA 1DO2A 1HQYE 3GJ6A 2IUSA 2RB4A 4JSYA 1AZTA 5LB2A 4ZI2A 3CRQA 3ND8A 4KXFB 4N0EA 2IL1A 3K0FA 5UKDA 2DCUA 2DB3A 2YVUA 1ZNXA 3C7KA 4V0OA 1TAGA 4BFZA 2ZI3A 5EXSA 2CK3A 1T0JB 4OL0A 3UANA 3U61B 1VMAA 5JWHA 4QM7A 1HE8B 1AJEA 2OFOA 4K46A 1J99A 4ON9A 1RFLA 1KI4A 4YXWD 2F1HA 2PH1A 2ZRAA 3GEHA 5AWFC 3QF4B 2AKYA 4V03A 1AIPA 3A1VA 1NMYA 2H7VA 1S4QA 3IBGA 4D80A 1QF9A 1T5IA 4A82A 1XCPA 4CZ2A 2FSHA 1OYYA 2ZJ8A 4LI0A 5JZVA 2A5FA 3ONWA 4KSBA 5KNBA 4QC2A 1ESNA 1Q1BA 2PLFA 3IKJA 4EQ6A 4WA7A 2YYZA 4GZMA 5KDDA 2WWXA 1IJEA 3CW2A 1DAIA 4LGMA 5DN6D 4PQFA 3AGQA 3EPJA 3Q3JB 2QGZA 1VYTA 3BORA 2JA1A 5EXXA 1WB9A 4D2IA 1KZ7B 2IYTA 3QKUA 4HATA 1EK0A 2A7QA 4AKGA 1GP2A 4ZKDA 2BV3A 5D3MB 3F8TA 3BC1A 3NEJA 1KI9A 3VR3A 2J3EA 1YZTA 5K8TA 2FFBA 3B1ZA 2W6JD 3GLGA 4M53A 5JCZA 4HAWA 2VHQA 2VHJA 1FQJA 2BBOA 2Z4RA 3D3QA 4MUBA 1N2CE 3K70D 2BMFA 2KBFA 1RRCA 3MMPA 2ORWA 4II7A 4ZIRA 5IK2D 3BRWD 3GJ5A 2VTKA 4PFSA 2V55B 3RSOA 4TT3A 4DDUA 3KJEA 2VO1A 1XEXB 4US1R 4Q4HB 4PC3A 2A5DA 1TEVA 2A5JA 2CHGA 1M7GA 2OCYC 1W44A 2DFLA 3ADKA 2Z0MA 1U99A 4OBEA 1W48A 2WPDD 4LJ7A 4TYPA 1P2UA 3L2OB 1KI1A 2Z5FA 5FOXA 1T8UA 3WYGA 4DC9A 3LBHA 1U81A 4LHYA 1LF0A 3D7MA 4EPVA 2P6NA 2W2XA 4B2PA 5AUOB 4DUGA 2F43B 2R9VA 1TL7C 1FX0B 5EXTA 4PHFA 4F91B 2O0HA 1NN5A 1YR9A 4ACAA 3U60B 1FZQA 2DBYA 4TLBA 5EE5B 2UZIR 3AVUA 3DDCA 2HT1A 5KPDA 1TUEA 5HZKA 1G5RA 3ETLA 4NCIA 2ZTSA 2FV8A 4TTQA 1KNXA 3T34A 2R6FA 2ZU6A 2FFHA 1MKYA 5M04A 5G3ZA 1OW3B 4U02A 2GJKA 5SZKB 1W47A 1W4RA 5BWMA 1E9SA 5LD2C 3EZ7A 3IIMA 4M9ZA 1US8B 2QP4A 2R6GA 821PA 3OF5A 5L3QB 3SQXA 2DFTA 1GSIA 2J0UA 3IBYA 4KCGA 4R71A 2ZE8A 1EWQA 4XVUA 2OESA 3ZIAA 5CDFE 1XPOA 2P67A 1ANKA 1U8YA 5FOSA 2CLCX 3R7WB 2F7SA 3X1ZA 5JI2E 4JKYA 1C1YA 5L3RA 2BVNA 2JIZD 2CEAA 1XTSA 2O52A 2ONJA 2FN4A 2Z6VA 3QXSA 1E1QA 1LB1B 1W0JD 3EIHA 1N6LA 1SXJD 4DCSA 3SDZA 1Q1EA 3EPKA 1JAIA 1Z0FA 3WBJA 3UG7A 2XX3A 4BZPA 5FOTA 1KNQA 2E87A 4HLUA 4OKSA 4PC1A 3VKHA 2VYFA 4ESVA 1R7RA 4B35A 1V5WA 3GLIA 5HE9A 4DSUA 1YRAA 3WMFA 1Z5ZA 1VKJA 5JJIA 4NYMR 4LOAA 4M9SA 1W46A 5L3SB 5EP1A 2P5TB 3KXKA 1A2KC 5KPJA 5F98A 2QAGB 1NVUQ 2JLWA 4RZ3A 5LD2B 1G8FA 5J4LA 5TDHA 1S9HA 1Z29A 3LLUA 1CIPA 4Z1MA 3QI2A 1MO5A 4Q01A 1HEIA 2O8FA 2W58A 3LO5A 1E9EA 1ZVQA 1E79A 1PV4A 4GMDA 4B44A 3K9HA 5IT5A 3C15C 3KJHA 2CBZA 1XXHB 2CK3D 1DVRA 1GNPA 1GG2A 1F2UA 2MSEB 3LAWA 1F60A 1WP9A 3AVTA 3MGCA 2ZRBA 2DWOA 4X8LA 2PEZA 4FWTA 1NSFA 3MSXA 4Q4JA 3NC0C 5CIWA 2W83A 3AP3A 2WJHA 1OFIA 2X2FA 4IXNA 4BFYA 1AS0A 2GJ8A 1AGPA 1OFUX 2OV2A 2OCAA 2OXCA 3TSZA 1EESA 2ZYVX 3CPEA 3EG5A 1QVRA 2G1JA 4E5UA 2V3CC 4KO8A 1R8SA 3QNUA 1ZW6A 4JVSB 3LQQA 4M9QA 3QJYA 5CK4A 1TQ4A 1SVIA 5CITA 4LYFA 1T8TA 3FMIA 1KI3A 4PSVA 2EYQA 3Q7QA 2NGRA 4NDZA 5HCNA 3K70C 1NVVR 1RKBA 3X1XA 2AX4A 5GADl 1A7JA 3JZMA 1HA3A 2GWHA 4OHZA 2AD1A 3MJHA 1W4AA 3K0AB 4OI0A 3OEEA 1ODFA 3SBEA 1HYQA 1K6MA 3RRMA 1QG4A 1AN0A 4G5SA 3SBDA 4ZDJA 4IOMA 4MYHA 5KHOC 4LJ8A 4TL7A 1P5ZB 3DMDA 2REXB 5ANRB 2TMKA 2BMEA 1HUQA 2HV8A 4UKDA 4D6PA 1GVNB 1MR3F 1NG1A 3BERA 1T4GA 1Z0JA 3RDPA 4AKIA 5DI3A 1NSTA 2ZYUX 4TT3D 1MOZA 2R2AA 2JJ1A 5DO9A 3MJRA 2OCPA 5AUQA 1E4VA 3VNVA 1JR3A 1OJLA 1WDTA 3AUYA 3KFXA 4FMDF 1SVLA 1R5OA 4DVGA 3BH0A 3DZ8A 4U7DA 1JQJC 2V9PA 2GXQA 4HLQB 4NE2A 1UAAA 4AD8A 2PZGA 1E1RA 5JHGB 2OM2A 2W2VA 1KK0A 4DUGD 5HCIA 4TMWA 3LVRE 4B48A 1Z0KA 4LPSA 1XF9A 4AYXA 1QZXA 1DARA 2FZLA 4DT1B 4C30A 4L8GA 3NDPA 2IYWA 3ND9A 2J9RA 5SZHB 2O0KA 4LJ4A 4I1SA 2F55A 3GLFE 4AKHA 1H8EA 2CCKA 2FPLA 2D3WA 1TNDA 1A4RA 1O87A 4I81A 5K8UA 2W0MA 3U6BA 1T5LA 4HB3A 2ZITA 1BIFA 1BO6A 2V6IA 2PJZA 2WV9A 3TQFA 4UNQA 4EJSB 3P1JA 1NN0A 3RHFA 1SVOA 2QTFA 4BZQA 2C78A 2ZJOA 1N25A 1XU4A 2W00A 3B78A 1CJMA 1SXJC 3AH8A 1GRRA 2WSSA 2DYKA 4OQLA 4ARZB 5EP2A 1P73A 3THWA 3HR7A 3ZIAD 1XX6A 3RC8A 2GILA 4LJAA 1LF5A 3PEVA 4B73A 2GTPA 1UKYA 4DLUA 3AVYA 1PZNA 2LKCA 3U7FB 3RS3A 1Z08A 3EX7C 2QT0A 2NQ2C 2PT5A 4PPGA 4U5XA 5DH9A 4LCBA 1HTWA 2G88A 4W5WA 2GETA 5CLQA 1L4UA 1NP6A 5AR1A 5FOWA 2F43A 1Z07A 1FX0A 3A4MA 3H2YA 4MYUA 3RYTC 4MRNA 4TZ0A 1QG2A 3WBKA 1E1QD 4XWOA 1I2MA 2EQBA 1AS2A 4LV6A 1GOTA 1K5DA 2J87A 1M7BA 4JLNA 1QHHA 1UADA 2IYSA 5E4FA 4LX0A 4BGDA 5K8IA 4JLOA 1IN5A 2YJTD 4F92B 5JS8A 2NMVA 3U6KA 5SZJA 2EWVA 3OFNA 1NY6A 4JYBA 1S1CA 4YLGA 3RWOA 3RRYA 4BEBA 3SYKA 2QY9A 3TE6A 1N6PA 3B1WA 5CB8A 1LS1A 1OPXA 1U2RA 4E03A 1MH1A 1E2FA 3K09A 5IRCD 3GMTA 2C2HA 3KQNA 3B2EA 5KO2A 721PA 3ZVNA 3A4NA 3JVVA 2BMJA 3MLEA 4RZ2A 3ZLJA 1QHXA 1I2DA 3H4MA 3THXA 3SQWA 1IBRA 3WP1B 3L0SA 2RHDA 4Z1MD 2C77A 4LYAA 1G3MA 2J45A 3P4XA 1LVGA 2YWGA 1GILA 2REBA 3PQCA 3QG5A 3PG5A 3AF4A 3FMPB 2FNAA 1E79D 4PAQA 3FKQA 2HDNB 4M1WA 5JS7A 2J59A 3DPUA 5EUMA 1Z83A 1SVMA 1XD2A 5BYJA 3ASYA 3RVBA 5KTYA 2P6RA 3FTQA 5JEDA 4XJXA 3C14C 1XWIA 1Q0UA 3IIJA 3N70A 4GDFA 4KYUA 1OKKA 3HDTA 4Q1EA 1Z28A 3EZ9A 3IHLA 4TMZA 3N2IA 5FBRB 3VQTA 2IXGA 1JR6A 3BJIC 2F3TA 4D82A 3LNCA 3D8BA 1SKQA 1WE2A 1OXTA 1XTJA 3BFKA 3KFVA 1IY2A 1U0JA 4CRWB 3SI7A 1L4YA 2XNSA 4GOJA 4HYYA 4TZ6A 2C99A 3CONA 3VHXA 2WICA 1GUAA 3BBPA 2QTHA 3KX2A 4P3YA 1VCMA 3KB2A 1WMSA 1KO1A 1W4CA 2QRNA 4FXPA 3GFOA 1DAKA 1NLYA 4DDTA 2QP9X 1N5LA 2QMOA 1SQ5A 2OUKA 4DXAA 2IYXA 3OEED 5HPYB 1XXHA 4EPXA 1ZP6A 5P21A 4EPRA 2XXAB 5KDOA 2ODBA 1TQ6A 5B58C 4LRWA 5JWOA 5HZHA 3VTKA 2PBRA 1XDBA 1IAQA 1S9DA 4L16A 1FP6A 4Z8YA 2JLUA 3CNLA 3AKDA 1XZQA 3LXXA 2JCSA 2Q9AA 4LHZA 4C7OA 2XJ9A 4S35A 4AKEA 3ICEA 1E0AA 2FOLA 3HWSA 1Q1ZA 4HB0A 5DIFA 5EJEA 4BQSA 5BN3A 3BB4A 1IN4A 3SHWA 1HE1C 1CLUA 4RFSA 1COWA 1MABA 1W4BA 2XEXA 1PLKA 2JJ1D 3B1YA 1IQPA 3MWKA 3OHMA 1HY3A 4A1FA 3WRYC 2PEYA 4URUR 4Q18A 1PUJA 4UXJA 4XTRA 1FW6A 2UZ3A 1Z2CA 3OIYA 2YOGA 4M21A 1WBBA 2ZREA 1TQ2A 2CMKA 3L43A 2FGJA 2J5XA 4YMTA 5H8WA 1N5IA 5TVKA 1IXSB 3PXGA 1X86B 5EP3A 1YZLA 1ZNYA 5FOUA 1VG8A 3KTAB 2Y8EA 1NY5A 2C8VA 1KJZA 2ZRGA 2CE2X 4WOPA 3VNUA 4C2TA 3TR5A 1AS3A 2Z4SA 2B21A 3VKGA 2AFHE 3U3JA 1NJFA 3AF2A 3WYFA 5AJYA 3KQKA 1AQUA 1B0UA 4O0MA 3EC1A 4FN5A 3HPRA 4JJKA 4YC7A 2XNDA 4DLXA 2QBYA 2P6UA 4DWJA 2O8BA 1HT1E 1KYIA 5GJVC 3AF3A 1OHHA 4UJ3A 2QM7A 1P2TA 4HAVA 4TTRA 3T35A 2YWEA 3RS4A 5C46F 1G3UA 4QBFA 4M1OA 1M1YE 4URWR 3TJZA 2QL6A 1SZPA 3RS2A 4Z51A 3RWMB 2WSSD 2BKEA 3V00A 4P33A 3CUEF 3WMGA 1OIWA 3THYB 2BEKA 2BM1A 3DHWC 3RRNA 5FPTA 1R0WA 1XMSA 3FHCB 2WWIA 2VP0A 1KSGA 4HLUC 3SU8A 1ETUA 1A5TA 1JEDA 1F2TA 3EARA 2OT3B 3SHFA 3VHLB 1P75A 4GZLA 1KDOA 1OXVA 3VR5A 3WRXC 3PUZA 1G17A 2H92A 2R6CA 1J8YF 4GOKA 1NLFA 5DHAA 4ZI3A 3KUDA 4HI0E 4TMVA 4UNSA 1EFTA 4DT1A 4B3XA 4X8HA 4ZCLA 4CGZA 2VF7A 3NXSA 1E2NA 2YC2C 2O0JA 5KSPA 1JQLB 4M1MA 3UMFA 3GCGA 3AUXA 3R9XA 4IDOA 4Q7JB 1S96A 5EE0A 4FCVA 5AJVB 5E7JA 2NIPA 3AVOA 4QHSA 421PA 1N3BA 2GXUA 3I5YA 1AM4D 2PT7A 3KQHA 2JLVA 1QHYA 3ZVLA 4PR0A 4LHWA 3GJ3A 3E5HA 4J0QA 2JLRA 4ARZA 3ZGXA 1XNJA 4WVFA 2V8OA 4O2RA 2WBLC 4PPNA 1G18A 3OESA 1Y3AA 2ATVA 2E9SA 2GAOA 4CT4B 1ZD1A 2QRZA 2YOHA 3IQXA 4JBXA 4JSTA 2F3RA 4JLKA 3BB1A 2GVZC 3ZZUA 4KVGA 2D7DA 4DBLC 4B74A 1ZU5A 4EDHA 1Z63A 4XSGA 3W5JA 4CIDA 3DMNA 2ZJBA 2JDIA 4P4TA 4EUNA 2AFIE 4MYCA 5KNDA 1VIAA 3W8RA 3O8DA 4JBWA 1JB1A 3AVXA 3LX5A 3BE4A 1MO3A 3KKQA 2FEMA 2XSZD 1UKVY 3AVQA 1OKKD 3EXAA 1V43A 3GFTA 4EFLA 1SKYB 1P72A 5FH9A 3F3YA 4G5GA 5AJZA 1FUUA 1D2NA 3QKSB 2Q9BA 3DL0A 1BS1A 1VDZA 2AD5A 3NH6A 2WJYA 3PUYA 4DSTA 4HDCA 3VX3A 4JLVA 3RS0A 3PR1A 1GKIA 2WJGA 4UNPA 1DOAA 4K81B 2ERXA 2J46A 1X8LA 4NYIR 4JVLA 2Q6TA 2WMNB 4I1VA 2NO1A 3I8XA 4NPHA 4B3FX 1KK2A 2L0XA 4XVQA 2GK7A 4B6FA 2C9YA 2H8KA 2J0VA 2IBMA 3TW4A 1NJGA 4GOXA 1NN3A 1J90A 4PZLA 1E2IA 2C98A 4A8JC 2VHCA 2QI9C 3VFDA 2D62A 3B85A 4CEIA 4EPWA 5C18A 3MWLA 2JJ8A 4CEJB 5IHPA 4C0JA 4V0NA 4CYMA 2HLDD 3QF7A 4TLCA 1OB2A 1KO4A 1IN6A 3I8SA 4IW3B 2A78A 2VHUA 1E9DA 4TWZA 4OI1A 1JBKA 4I1UA 1R5NA 2WIBA 2IK8A 1CJKC 3I72A 4JMPA 4GFDA 1VHLA 1R10A 3LFUA 4PANA 4IEEA 1JPJA 1T3SA 2J7PA 2KE5A 1E2GA 3SZRA 1XZPA 2EU8A 1KJYA 5B57C 1M8PA 1E9FA 3PIRA 3J81k 1K5GA 1PUIA 1FNMA 4D0NA 2F9MA 2GDJA 4ITRC 1G6HA 1N6RA 1E2KA 3DZDA 1KKMA 1AK2A 2XTZA 3QQ5A 4R9UC 3B6EA 3CX7A 5JSZB 2V4ZA 3QXXA 1NBME 1P61B 1AKEA 1E4YA 2DPXA 2IC5A 4QJ3A 2O8CA 1FFHA 4ZDIA 2JASA 4RKEA 2O8DB 1E2PA 1ZC3A 4LUCA 3E70C 4B34A 3K53A 3T15A 3SEAA 4K8OA 3T1QA 2JLXA 4A15A 2QE7A 1NMZA 4V02A 4F7WA 1UEIA 3K9LA 2HUPA 3ECCA 1KMHA 2XNDD 1VCIA 5CB6A 3VU9A 2G83A 5JRZA 4HSEA 4FMDB 1OHHD 5FBWB 5CDFA 2ECKA 4RD1A 4DIDA 4Q4AA 2ODEA 1TF2A 2F6RA 1UPTA 4NYJQ 5D3QA 4PSKA 4URYR 3DO6A 4MKHA 4QBIA 3I62A 3IEUA 1P2VA 2BEJA 3QXHA 1MO6A 2ZVQX 3IDQA 1FUKA 3BIFA 2A3RA 2ODNA 4BLSA 3K1JA 4IRUB 4WXPA 1OH5A 3EA0A 3M6AA 5C4MA 3I4LA 2VP6A 3VKWA 3CPHA 2W2TA 4KITB 1YZQA 121PA 4UXIA 3QVVA 2N46A 3K09C 2RGBA 1GL9B 3KTAA 2QTVB 4MKIA 4G5QA 2ZRIA 2CCJA 5FTJA 3EA5A 4MYTA 4Q9LA 2EFGA 3ADBA 1ZD9A 4CDGA 1P9NA 4PZYA 1WF3A 2VP5A 2VSXA 2FWRA 1YR8A 2GBLA 3WNDA 2KJQA 3PUVA 2GA8A 2CE7A 3KUCA 3SOPA 1OH6A 2REOA 4HDOB 1XCMA 2QPOA 2QSZA 1SGWA 2VLIA 3AEZA 3LD9A 4JLAA 3PEWA 2Q3HA 2Z43A 1N6NA 4KFRA 3FPAA 2HXYA 3KQLA 1RW4A 4E07A 3U44B 4JKIA 3VR6A 3IGFA 4BRWA 1ZYUA 3QXCA 3NKVA 3GJXC 1A82A 3HU3A 3THOA 1RPZA 3P32A 2ZANA 2FU5C 1G291 2H57A 3SE0A 2QAJA 2ZIAA 5G40A 1YR6A 3TBKA 4B32A 4GBMA 4UXHA 1Z0IA 1S8FA 4BFXA 5EP4A 1BMFA 4TQUS 2GK6A 4RKFA 5HR5A 1JJ7A 5FFMA 3TNFA 1G9XA 4JVNA 4FWIB 4XWAA 5J47A 1GAJA 1UFQA 4NU0A 4DB4A 2D7CA 2WWWA 3OEHA 2W0SA 2GRJA 3H86A 4ILEA 1I4TD 1S1MA 4JL5A 2EYUA 3ZZTA 2ZETA 4DLTA 3FYHA 1YQTA 2WAXA 1U9IA 3PUXA 3A8TA 2EWWA 4CEHB 1X6VA 5EUQB 4AG6A 2ZRJA 4Q4LA 3I92A 4CVNA 2OSBA 3F0TA 1KZGB 5F2EA 3K0CC 3Q7PA 1J2JA 2FPMA 2YNMA 3FWYA 3X1DA 3AVVA 2GVDC 1YZKA 3RANA 3GJ0A 3SNHA 4AIIA 1KGDA 1KI6B 3IPYA 1Q22A 3QKTA 4W5HA 1E69A 1E9AA 2VP9A 2G9NA 2CXXA 1VG0B 3VR4A 2C9OA 3TUZC 5DHFA 1GWNA 3LY5A 4IDPA 5FBLB 1BKDR 2CNWA 1Z8FA 3BFXA 4TYWA 4B71A 2ZQ5A 4ZCIA 3T5DA 4BFSA 3A1SA 1KDPA 1VIYA 2ZJ2A 2WVJA 4DEXA 2V6JA 4ZDKA 2QORA 4LJ6A 4MRPA 2OILA 4ZCMA 3PFIA 2BBSA 5B2ZA 1H8HA 3K0EA 5G53C 1SVWA 1Z6XA 2J7PD 1N6IA 2ZI7A 4KODA 3OZXA 4JVMA 4HAYA 3U4QB 1LFDB 3GPLA 2KSQA 3KKNA 1G8PA 2RGNA 4PXAA 2IS1A 5DI9A 2QNRA 2BWJA 3EPHA 1FPMA 3P20A 1NI3A 4NONA 3KKPA 5EE3A 1GIAA 2A9KA 2AXNA 3QE0A 3MCAA 2Z83A 3NC1C 1E3MA 4BLRA 3Q8XB 1T91A 1DAMA 3GLFA 2B7BA 2RGEA 4OHVA 2FFQA 3TVDA 4PZZA 1FNNA 4ZO4A 1IONA 3BH6A 4JZKA 2DY1A 5FI1B 1GNQA 1MRSA 2QE7D 4NCKA 3PENA 3GEIA 2KWIA 4ZKEA 1QHSA 1G4UR 1I4DD 3EASA 1OSNA 5AJXA 2XTMA 1W0KA 3PUWA
chains in the Genus database with same CATH superfamily
3PGJA 4LWPA 3VC1A 3WWZA 4GL2A 4DA8A 4Y9DA 2GESA 3LL7A 2AK3A 4LV8B 2GEVA 4LZJA 1FS4A 1YVDA 4AG3A 4HVLA 4JI8B 4ZALA 1VRWA 4TL9A 7YASA 1CS0B 5F9MA 2ZVDA 3FUVA 3NEYA 1G6Q1 1YR7A 3H84A 3OIDA 5LBIA 3W6PA 3LCVB 1JSRA 4ANFA 1A4IA 3N58A 4OQNA 3KYJB 4CG1A 1NRXA 4UD6A 1A9ZA 2OLJA 4G0ZA 2ZE6A 3OE7A 4Q1DA 3MWEA 4YUWA 3A3KA 1ZIPA 1MX1A 3MTEA 3NOVA 3QUAA 2V7BA 4FQ5A 2QI9F 3KT3A 1JH9A 2OZVA 2A4KA 2WFMA 5JSZA 2VWQA 2NPFA 1F6BA 1O5IA 3WRVA 4E22A 1Z37A 3ZQUA 1RXWA 3CEAA 1O6ZA 3R0ZA 4CU5A 3MMZA 5KSOA 5JXJA 3KXIA 1XHFA 1CR4A 1NW4A 2EW1A 2H08A 2NTNA 3KOUA 3LI2A 4IRXA 4N8EA 5ED4A 3DMTA 1KBOA 3V1UA 1BHJA 3U4IA 4NVRA 3WAJA 3K9NA 4QGAA 3HKCB 1QBGA 5E38A 3FVRA 3ODPA 2WWVD 3ZD6A 3SLKA 3T3HA 1M2OB 4RIFA 5TGZA 2FEAA 2VJMA 2DKNA 2IHYA 1G21B 2HK7A 4P5DA 5IU6A 3K70B 2QN2A 3MGBA 3NHBA 3QK7A 2ODQA 2VDJA 4JLPA 4W4TA 1RLIA 4PQYA 5T5QA 4NECA 3TQTA 4BO0A 2PMEA 1P0PA 2JFBA 2QRKA 3GOHA 4FYYA 1N6HA 3HLTA 621PA 3ZJVA 1B6GA 4AS2A 4P84A 4B82A 2IHBA 1SBNE 4KVAA 1QQAA 1ZUD1 2QTRA 4TXHA 4C3ZA 3HXOA 3I76A 1W6RA 2WDZA 2WU0A 5E8JA 2ZRCA 4MQFB 5FI0B 1XEXA 5AOVA 2I2FA 4IUDS 3OOHA 1KOGA 1E59A 4UMDA 2RJOA 1V9LA 1CQJA 2C4TA 2JHFA 3I2JA 3BL8A 3UW1A 3WKCA 3GD7A 2C0PA 2ZKIA 4OX9Y 3I32A 4HL6A 2OXEA 4WNIA 3Q1LA 1GG9A 4HTAA 1JP7A 3KC2A 1NXQA 3QYJA 2IPLA 5F76A 4Q1AA 4PYJA 3GLHB 1L1QA 3T99A 1P0IA 3V4RA 3OTHA 4W6QA 3GY0A 3WMWA 5JPCA 1QIIA 5SY4A 4XH9B 1LK0A 4B2LA 5D6OA 1PSWA 4QDZA 1Z22A 2E0IA 4O3MA 3R3WA 1SOWA 2FDCA 1RWQA 1K98A 2Z3VA 4XKJA 1DIBA 3GQBA 3ENWA 3KOZA 4OJKA 1P1HA 2GD6A 3LLSA 3H1BA 4G84A 4D26A 2ZJ4A 3BQMB 1RBYA 1DQRA 3TQOA 1U2ZA 4BQNA 4OGGA 4A2QA 5CLHA 2MYPA 4RK5A 5K1ZA 1T5TA 2IITA 3ZYCA 2IX3A 1TU3A 1WKCA 1F17A 3KP1A 2NLOA 2PJUA 3HCOA 3PEEA 3RYHA 4ZXFA 4G81A 2VLBA 4CI9A 1K0FA 3LQ1A 1US8A 4YCDA 4D42A 1L5QA 1QGAA 5AKHA 3LPNA 5L3QA 3I9LA 4P4SB 4ZMRA 4XTCS 1NLZA 4XIGS 4X20A 3LUGA 1AURA 2PUJA 3ORSA 1J70A 4P3NA 4RCZA 1IY0A 4UUOA 3W7AA 2RAPA 4GI7A 1T2DA 4L76A 3H1TA 4IFBA 1SXJB 2XTJA 1HYHA 2ZZKA 3R7WA 3WSTA 5B4VA 2FWJA 2RHWA 1QXSA 4N7BA 5MHTA 2RH8A 4D9JA 4BKRA 3V9PA 1YB6A 2BMAA 2WJIA 3X1DA 3RU9A 4XIYA 4EY4A 2P77A 2H1FA 3QPAA 2X4GA 1X80B 1P6XA 1LJUA 2CFOA 5HGJA 5BP7A 2IUFA 3OA0A 2GZ1A 3DDUA 4RLSA 4GD3Q 1O94D 1AY0A 5F3RA 4AWXA 2I54A 2XI4A 3CLRC 2NVOA 3ABSB 4C0HA 1SUWA 4J7CA 1VBKA 3W5BA 3H1AA 3L8ZA 3A6ZA 3QG1A 5DEIA 4X1IA 1ZH6A 3QY9A 3UAGA 4HGOA 1LBQA 4MROA 3B6MA 4V39A 1GU1A 1GEEA 1O6FA 2P9QA 1CC1S 1PI3A 1W1IA 1CJSA 2Q99A 3AB3A 1YA6A 1K9VF 5B7QA 1AKVA 2XRMA 5HDQA 1I80A 1SA0B 1P0CA 1II0A 2BOVA 5B12A 1N2HA 5K51A 3O4FA 10MHA 1DDGA 2G8LA 4ZHSA 4EWLA 4WD3A 2FN8A 2V03A 4G09A 1T8RA 2WHPB 4PC7A 1BYIA 5E1DA 3O03A 5SV2A 2XCTB 3IUSA 1EB9A 4HFNA 1P0MA 4EHIA 3DF7A 2J0EA 4YDHB 3C3CA 1Z12A 3VR6H 5KHLB 4LMRA 2JI7A 1UT5A 5ARCA 4E09A 2E4YA 5ALFA 2QLNA 4ZREA 1PL6A 1FSFA 1JYFA 3K8YA 3PC3A 5ER9A 4BU0A 1GN8A 4OXKA 2A6PA 4DDWA 3ED5A 4GSYA 4CIYA 4AMYA 2AOTA 2PL3A 4S04A 1SPXA 1CSEE 2IXFA 3NASA 5JMPA 3NONA 3GDGA 3IP1A 1N5RA 1VBFA 1VBMA 3PGMA 5FA8A 5FL3A 3PLRA 3QWFA 4YJ2F 5FKJA 3GCZA 4J94A 5C1OA 5EIXA 2QW1A 3TZLA 1P2SA 4XX0A 4WZAB 3WYDA 2O7RA 1OAOA 3VZDA 3OTOB 4NU5A 2QG9A 5KTMA 3FLAA 4BO5A 3K5PA 3RTCA 3DV0A 2RKWA 4L73A 4YTEA 2FP3A 2YR0A 3PVZA 4KBYA 4I9UA 5A5EA 1WW3A 3UGJA 3WE7A 4IMJB 5E8RA 3WGKA 4IIXA 2IWHA 4C4RA 1GUFA 1WVMA 2ODAA 3TX6A 5HX7A 4JP1A 2JKVA 3ZYZA 3HBMA 1T9HA 1X8JA 3HJBA 1NV9A 4S24A 4UHFA 4P32A 4BQOA 3OZCA 3IV7A 3PFHA 5EMJA 1ZITA 3VH1A 1BCSA 1V37A 3W06A 5B30A 3CZPA 3TIIA 2XTNA 1ZD2P 1WF6A 3RARA 3TAHA 2C5AA 1ULSA 2X9NA 2ZWPA 4I1YA 1XIVA 3IFSA 4DUZB 4IO1A 1Y98A 4RJ2A 2JGLA 3RNOA 3QE2A 3SIXA 1JG1A 1WR8A 4LY6A 1L5YA 2UKDA 4XFJA 2NU9A 4YFVA 2IU3A 4AC9A 2OQRA 2P0YA 1YDFA 2PANA 4YRFA 5T41A 4XYLA 3DKVA 5EHZA 2BYTA 1MQ8B 3MWYW 1B23P 1QC5A 2A1TR 1KJWA 4F3RA 5B4TA 1XRJA 1XTTA 2CLLB 3GU3A 3NFRA 2ZIXB 4Y2YA 4I99A 4DIMA 2JJ2D 2JFUA 5CJPA 4LVOA 4R9NA 4MRVA 5L9AA 3JAWA 4BTLA 3GYGA 4MAMA 4CFZA 1J0XO 4L4UA 5E4YA 4A92A 4I46A 3NI2A 5CT6A 3LRXA 3N1UA 4MITA 2ERYA 4XD2A 3SYNA 2CLEB 2Z5VA 1EAYA 5BPHA 1QH8A 3E9MA 3QELA 2E18A 4QGGA 5K0GA 1CIJA 1WBDA 4H18A 4X97A 1NG9A 1JSLA 1JSCA 4O4HF 3QFRA 1YRBA 3QYAA 3BX1A 1E3IA 3BD6A 3PXCX 5LDHA 1AN9A 5KWIA 2BGWA 2VJLA 3PC8C 3CIOA 4KQJA 1G8YA 4NPAA 3LCCA 2P1RA 3EQ9A 3CPJB 1DHRA 2JHGA 1TO6A 5EWJA 3OQIA 4IVNA 4KXYA 3IJ5A 2OYCA 3LQRA 4HWPA 3HO6A 1RQLA 5FNVB 4MLZA 2XMDA 4ZVPA 3QUCA 3WMXA 4CKXA 4QNRA 5LBTA 2HTEA 4U5QA 2OEPA 4QUIA 2R3SA 4Q7MB 3VOAA 1KTVA 3IJEB 1XMVA 1S3GA 4KHZA 1A88A 2DT5A 4BB9A 1JEYA 4QOSA 1X8KA 3HCWA 5EESA 4IBOA 1NN1A 4DYVA 3D4BA 2A3NA 3CRNA 4QULA 5D1HA 4CQMD 1KYYA 1PD0A 3EAFA 4M4SA 1DBQA 4QTUB 4BASA 2DFNA 2WY2D 5KINB 5H4GA 1RZRA 1KOJA 2XWJI 3AEYA 3QMWA 1SBYA 2NZJA 2JJMA 4TKLA 3KAQA 1EBBA 5KTRA 1CUGA 3K15A 3REQA 5ICMA 2QMHA 4OK5A 4QGFA 4UMVA 2ZI9A 1KQGA 5LXTF 1KXZA 4QG7A 2OMKA 2XE7A 3VSCA 2VAPA 1LFAA 4YRSA 1SFRA 3QM1A 4JBYA 2BGUA 4Q48A 4MCJA 1S01A 3GAZA 1O3YA 2RGNC 3S0JA 3UICA 2IXBA 5KX5B 4WNCA 2C57A 3A2LA 4YAKA 3N74A 4LW8A 4UJ5A 3PVSA 2ORIA 4B3HA 3K4HA 5H83A 1HL3A 2BJWA 3PPIA 3HR4A 3K6JA 3GLIB 4LMBA 2XYGA 1TEHA 3GD5A 1N3YA 2DBVO 3CR7A 2WQ7A 4ESOA 4TUYA 4B75A 3T52A 1I1QB 3LC7O 3RK1A 2PMBA 4QHTA 3HWRA 2XXJA 3FGNA 2BKVA 2OBMA 2H11A 4HUTA 2W8ZA 3GELA 1K7YA 1FUIA 2W93A 2BUAA 3LT2A 1J56A 2D3TA 3WIDA 3GVPA 1VTKA 4J49A 4MQ4A 4C7MA 2CNNA 1GFIA 1QSGA 2CVQA 2W9XA 4L3WA 1SVKA 1OD6A 3OMLA 8AT1A 3BT7A 2JGDA 2VA8A 2LTAA 4UBLA 1W0CA 1TKCA 1P33A 3A9RA 3O4GA 4L5BA 4LCJA 2IEDA 3PI7A 5AVUA 3Q2IA 5HM6A 1TW2A 3BS4A 1E98A 1CB0A 2QG4A 4EB0A 2VXBA 2NOAA 3FOWA 4KLZA 3MWDA 5EMNA 3TSCA 2JS7A 3FUXA 1A8UA 4LBZA 1KBQA 2HOQA 2IDZA 5FYQA 1QB8A 3HHEA 2XUAA 1KU6A 3CCCA 1DKOA 4LDRA 4OYHA 3ODGA 3W2HA 3ZZNA 4PLFA 4AS3A 3OQOA 2IBTA 4JJ7A 3JD0A 2IYYA 2RI0A 4KHPB 2IOYA 2M6RA 2O20A 2IS2A 4RTRA 1EWKA 2XVXA 3HZHA 2MU1A 2YWBA 3OICA 4WXMA 2ZT8A 4GM1A 4IGKA 4ENWA 4NENB 3STHA 1CUHA 1Q0RA 3HJCA 4JFAA 3NBAA 4QDOA 1ZW1A 4QYTA 4HDRB 1OTYA 5H3CA 5H9WA 1WNFA 4GRAA 3TFQA 5K05A 2I6XA 2XQKA 3CR8A 1JLHA 4PR3A 4W1PA 4XIFA 3TOCA 1AD2A 1SUSA 5JANA 4LNAA 4DV5B 3SC2B 4D4LA 2Q6IA 4A8PA 3TZHA 1WV1A 1ZX1A 1W88B 2B25A 3A1UA 4ZAWA 1G7CA 1H5UA 3GJ7A 1WDMA 1E0JA 2VYVA 4PHTA 4TSFA 1JFFA 3QVWA 2XZDA 3PFBA 3K96A 4R9RA 4F38A 4Z54A 3G89A 4PAMA 3HYTA 1TEXA 1R0YA 4TL8A 3VYVA 2B8NA 3QEJA 4EG5A 1Z3IX 2AUMA 3GARA 1AMNA 3ZZ1A 3KEOA 3EIFA 4EHHA 3E1GA 4P9NA 5BV1A 5HNKA 1YDMA 1SCIA 3X1WA 4DWVA 5JXWA 2ONKA 5B53A 5TLSA 3M9WA 4KTVE 1C9KA 1BFDA 2EW8A 1M2FA 2COKA 2YCBA 3C2QA 2PKQP 5E2BA 3KFLA 3KU1A 1LY1A 3H8WA 3G9XA 5JISA 3N7TA 4WLOA 3GT7A 3DT6A 4IQ4A 4KPEC 2AN9A 4YP5A 2YL2A 4NCNA 5JRJA 4NBNA 4Q3DA 2DFKB 3M0EA 4Y1FA 2Q27A 2RMKA 4DV6B 1OIVA 8OHMA 1PWYE 4B2IA 2V7VA 2Q3MA 1GGNA 4CF6A 1KPIA 1VE7A 2MSKA 4KLNA 4AI6A 2QGFA 2XUIA 1LLUA 1C3EA 3C8UA 2IUUA 4HRYA 3H1EA 4JOQA 2H2AA 3DW3X 5C5EA 1NE2A 3FJOA 3QLVA 4YJFA 1I5RA 1L1FA 2QW0X 2V1UA 1N2ZA 1NQXA 1Z7WA 2WTUA 1ECGA 1UMCA 4DWWA 5LQJA 1V7PC 2AX3A 2R7KA 2DETA 4N0PA 3UWKA 2PA3A 3T5PA 2J0QA 4Q9DA 1TU4A 5EWLA 3WHKA 2CB0A 2ROQA 3ZPXA 4QPZA 4IRMA 3JRXA 3W5VA 4A6EA 1GL7A 1IDN1 3UV6A 3A6KA 5F9FA 4KAFA 2FAXA 3I0MA 2FUNB 2AUNA 3LC2O 4FKBA 1B0ZA 2J3LA 4H77A 2QN9A 4A6XA 2YRWA 1Y9JA 2RKBA 3WGLA 1PX0A 1E5QA 1QAMA 4L08A 5IM5A 3LJKA 4QXQA 1Q1QA 2IZZA 2Y1LA 4LQDA 4YJGA 1N8KA 1QRDA 2QT1A 2R44A 2EBFX 3NAGA 2WNHA 2HBRA 4N6NA 1EIZA 4X7BA 4JBNA 3BF7A 1RRKA 2O7NA 2RHJA 3KVNA 1R0XA 4EMUA 2D1TA 2PKQO 3R5JA 3UMBA 2X1LA 1PEAA 1G55A 1V1MA 1DIAA 2GSDA 2J3HA 2FZVA 2M6LA 1YZNA 3OF2A 3BCUA 1KS2A 4GZ3A 5DNEA 5A7FA 1U94A 2HUNA 4R6XA 1UDWA 1AHPA 1OWOA 1IOWA 1QONA 2D2FA 2DPMA 2PLRA 1JIUA 4RS4A 3THYA 2AN3A 1DLIA 5CBPB 3JQCA 4BC0A 2PMDA 4UNIA 4YR9A 5LQDA 2GERA 4PZUA 3RRFA 3KLOA 2G9UA 3EVCA 3T9DA 5EXEA 3L82B 2P35A 2WJJA 3D3WA 1SCAA 5FPPA 4LWOA 3B7GA 4K6OA 3VVLA 1IL0A 4DR6B 1KSHA 1PVDA 2P41A 3UK0A 3WGNA 2QZPA 1GLGA 3EAQA 2XOKD 1XPJA 3CVOA 3WQHA 3BAFA 1DKUA 1C30B 1TK3A 1FFXA 4N0QA 3G0OA 4G1EB 1F48A 4DANA 3H2JA 1HE3A 4NFSA 1IK6A 3E05A 3OEYA 3TFWA 2R68A 1Q15A 1G7RA 2JD1A 2HBZA 2Q62A 3CMCO 4JJZA 1E7QA 3VDQA 2OG2A 3WB9A 3EPLA 1N9GB 5DTRA 4F4IA 4WVLA 3FPEA 3RYFB 3FFBA 1XRPA 1RMTA 3K8QA 1QX4A 2PXAA 3Q72A 4JI3B 4CM8B 2X19A 3W90A 2CEKA 1MX9A 2VOEA 2Y9PB 1UL1X 2FVXA 4FBGA 3WQRA 4DWJA 4GPD1 4JA2A 4QUHA 1I2ZA 4KFTA 2Z3ZA 3LC1O 2ZM6B 4UZFA 1YHZA 4MIOA 2CL7X 2HZ7A 1DCMA 1V7ZA 2EX1A 1IYZA 4XGQA 1RE0A 3UVEA 1YBVA 2Z9DA 3AF5A 3ECAA 5IJWA 1C3OB 1D2EA 1GQOA 2X15A 2YJZA 1GZSA 2Y99A 1P1RA 1I3OA 2H2FA 5ALGA 5ES4B 1CXZA 4TS3A 1DIHA 1ZKDA 2I7CA 2QN3A 2PYZA 2W4MA 3PQ4A 3RQSA 3QLUC 5CDTA 1CULC 1XB2A 3BSYA 4BZZA 4ZEXA 2QR2A 1OAOC 2IYQA 2WIAA 4DMRA 3DXYA 2ORYA 5AI4A 3V1NA 4LPKA 4D8UA 4EARA 3NAQA 3PJDA 4HUQB 4BMVA 2ZR0A 2DG2A 3LW7A 3K05A 4LXTA 4EOGA 1YQ9A 2IY7A 2QX7A 1ZICA 2YXBA 3DD1A 2GBFA 2BHRA 1QHEA 1KAGA 4L7QA 3IVRA 5HE8A 1JHQA 1TUGA 3WRXA 3CH4B 4AJIA 4WZBA 3ASUA 4BFWA 3Q3CA 2FMFA 3ACBA 4LHVA 2YUIA 3VR5H 1E3QA 3DLPX 4YRKA 3RI3A 1VIVA 4RADA 3C3JA 3B60A 1I7SB 3K0SA 3ZEAA 3I5MA 1E66A 4FCCA 4QEKA 4X9XA 1QS0B 4F4JA 3ADPA 5ALVA 3TZ6A 1HDYA 4DIEA 2OD2A 1KDRA 4EFNA 1JIIA 1SUEA 3AHJA 4RPIA 4X7RA 4Q1CA 1W5TA 1NT2A 1C50A 1EM6A 4Q19A 4IF6A 5L40A 2QV7A 3HRHA 2NPOA 4KJXA 4MX8A 1DBWA 2HQSA 1NDUA 3LPCA 1T1JA 2GEKA 4O63O 1CWUA 1YZGA 3IH5A 3L06A 4JHXA 1AUQA 4M2LA 3E4DA 4IDGA 4LYJA 4YCBA 5IN5A 1EESA 4ZAZA 3DE1X 2HMUA 5GVSA 2Z1MA 4CT5A 1ECFA 2DECA 3CV3A 4TYMA 5BVHB 4IDAA 4OI2A 4AG5A 3SY8A 1V39A 3P0RA 3R5TA 4LDQA 2RCNA 5FL7A 4FHZA 2JD0A 3X43A 1RU3A 3PHBE 3ZV7A 3Q6MA 2BP7B 3P52A 4R98A 3PD1A 3ENKA 1YI1A 4L15A 3OI7A 4PYQA 4F04A 1LQTA 3EWAA 3GW8A 3RUHA 3NBQA 4ERNA 3FYDA 1MABB 4OVKA 3CLTC 5EA2A 4QDKA 4DZRA 3GT4A 3H3FA 3COVA 2WAYA 4F4UA 5E9QA 1WXDA 3T9FA 4L4RA 5HJ2A 1W76A 2AFVA 4K8RB 4FYKA 1UKEA 2C4NA 2HJVA 1OWPA 1R4NB 2NM0A 2OC4A 3L18A 4TMTA 2G9ZA 1YZ3A 3OIFA 1GZUA 2WHQA 5LNK6 1DUSA 2Y67A 5J4KA 1XSEA 1SUDA 3CWZA 5IDVA 3I3OA 5K45A 2CHEA 2HEGA 3T5AA 3QE4A 4PG6A 1XZFA 1R8QA 2VN8A 3NW9A 4F8JA 4MPTA 2D5AA 2PFKA 3QPBA 3OO0A 4FFSA 3HYSA 4C0BA 4BEJA 4HV4A 5AIBA 3IXLA 2B3TA 4O4JB 2FSUA 2H29A 4IHQA 4GPZA 4N01A 4AULA 2GCOA 2I6SA 4EW2A 2HREA 3VV2A 3LS2A 2CF5A 3BDVA 2V7GA 4N3NA 2C3PA 4K26A 3ZU6A 1GPLA 3PC7A 1JEEA 1GZ7A 4BKPA 2X4LA 3N8DA 1WM1A 4RK6A 3QV2A 3R76A 3O84A 1MOPA 1X77A 4GX0A 4YRPA 3LK6A 1OJ7A 4CWAA 2E5FA 2MDTA 3AV0B 3GJ8A 4HDQB 3UTCA 1PYGA 1H1DA 2OBNA 2XE4A 3AFMA 2HZBA 5F23A 5ALQA 1DTEA 2B6NA 1P6UA 1RQPA 3QFFA 4KX3A 1GSAA 1U8AA 5AUPB 5BV8A 1C29B 1J06A 2K5UA 2VF8A 2VTBA 3G2OA 3BWBA 3VBCA 4NOMA 4RZHA 3SVLA 5EVCA 4G4GA 1HR0B 4QEDA 4F3YA 3RYIB 3HP4A 2G1UA 1F2TB 3EJWA 4DDVA 2A67A 1P4HA 3AR7A 4WK2B 2B4AA 2ZUWA 2XUQA 3T06B 1U0LA 4PAOA 2WWFA 1JA1A 1QIMA 1ZQ9A 2PY6A 2ZVPX 3I3SR 5I5GA 2IW3A 1RTKA 4M1ZA 2CUKA 1J20A 1G20B 1NIPA 5IC5A 3VV3A 1VI6A 1BKYA 3HVJA 3JWGA 3A36A 4MW1A 3EFHA 1II9A 1KDZA 2P40A 2FW9A 4HDSA 4MW5A 4XZ3A 5EUBA 4BV8A 1XJ5A 3OP1A 1K6JA 3MC1A 4RQBA 1E1CA 4WJZA 1K1EA 2JLQA 4KE8A 3VJRA 3MFQA 1MJ5A 1IZ8A 1NMSA 4DDKA 5JYEA 3DM5A 2Q0QA 1YI0A 3OPYA 3AYZB 4N41A 1OH8A 2O3UA 3V55A 3JSXA 4OMDA 5HG0A 3VSDA 1KJNA 1REQB 4N3GA 1Q0ZA 1TIKA 2IH5A 2F2TA 1DEKA 1F1BA 1A2OA 4UVHA 3AB7A 5FPSA 3M49A 4C04A 4DJEC 4IUBS 1CV2A 3QIVA 4F2PA 1JG6A 1H2HA 1CP3A 4RV4A 4R8MA 4WASA 4AO6A 3HP7A 4DW8A 3S81A 1KHHA 2WD8A 1CYDA 1KR5A 1NVBA 2IZ0A 4FDVA 1F8XA 5IS2A 1THTA 3GIDA 3HC7A 3W05A 1EP9A 2J8ZA 4IIYA 1U2SA 4P81A 5GVRA 3CRRA 3C98A 3HCCA 1J8VA 1LLCA 4UM7A 2ZAGA 1P62B 1C5KA 3E6AA 4IDQA 5AICA 4POOA 1EG2A 4CJXA 4D3DA 2SECE 1GFZA 3OCWA 1H3NA 1YKSA 4WBSA 4NYJR 1WCV1 2ON6A 1O95A 3R8CA 4US2R 1CX9B 2E4XA 3OM1A 1J0BA 1EE2A 4L9AA 4XVRA 2PGLA 4BWYA 1Z4NA 1QM5A 2FDRA 1ZH0A 3GHYA 4S2EA 2AL7A 3UXYA 5JLJA 3RT1A 2QJFA 4NSNA 4DMCA 4FW8A 4UMEA 4W5OA 1EE9A 1W93A 1XAHA 3E7DA 3KEMA 2I1LA 2Y1DA 2YBEA 1WHTB 1L5GB 4S2UA 2DBQA 1G1AA 3WWOA 2ZBRA 5B6IA 3RB8A 1JQDA 2HXSA 2BLLA 1HORA 3EGWA 3RLIA 4DG5A 1U0HC 3K92A 3G7SA 2FJUA 4K86A 4RD4A 1MW8X 3M81A 3W5SA 3KSMA 2F1RA 1NPTO 3JQAB 1EDBA 2EFYA 3WNBA 1UK8A 3QENA 2PRKA 4I4IA 4KAAA 1RKVA 3JARA 3UCXA 3WYAA 1TYCA 1KSJA 3NTOA 5E95A 3IVAA 4QUGA 4M8SA 3LNTA 3QVOA 1B4DA 1IY9A 1BVYF 4B7CA 4HD8A 4A2CA 1EVYA 3ID6C 3T1NA 1T9AA 5FNZA 3F9CA 2QROA 3W78A 2PLAA 3H11A 3RNLA 2R6AA 4OQ4A 5ULLA 1UDRA 2PD4A 5AOAA 3WGTA 1VYVA 4EMBA 4AQ7A 4U2BA 1TF7A 4LC1A 3W6NA 2C03A 3ZE8A 3LYAA 3R5FA 4RD0A 3U39A 1M34A 5MFZA 4F2HA 3UFXA 4UBIA 4BNZA 4ABTA 2VDQB 2CSXA 2QNBA 3B2QA 3B5JA 3R3JA 5JTTA 3KVOA 1IDOA 3AKEA 3ZQ4A 3Q12A 3PHLA 4PYIA 1QZ3A 4MTLA 3RR2A 4B79A 4AS1A 1Z5NA 3QLVC 2ECQA 2PS3A 3SVTA 3Q85A 4IJKA 5B58T 3PLAE 3RBAA 1UH5A 1L3BA 4Q7QA 1KDTA 2RJNA 1VCHA 2C4WA 1CP2A 2ATEA 1ZLXA 3NBYC 3DEAA 4ML3A 4GWKA 4PX9A 4HFMA 1BYUA 3VR2D 1D9XA 5EJ4A 1TQHA 4R8KA 1Q1AA 3R6GA 4MINA 3JASB 4Q9HA 2EF1A 1X3SA 1ESEA 3EF1A 4D0GA 4OLBA 2D59A 3WK4A 3SJUA 2ZSDA 3GH1A 1GRQA 1Z2OX 1QK4A 3TOVA 4G0NA 4KQEA 5CK5A 4RJTA 2BGTA 2VDRB 1NJ8A 1N3LA 5DGIA 4BWFB 5DOVA 3E7FA 1GNRA 4IQ0A 4FT2A 5E7IA 4RMHA 2YC4C 1QU2A 1NXTA 2GN0A 3L7IA 4FP9A 2JK1A 2JGEA 3S2EA 2R65A 2R7AA 2H00A 4TTSA 4C4TA 2B4RO 3SBOA 1E3DA 4LXGA 1G0OA 2G8NA 1EDZA 4Q4CA 4MS4A 2CVHA 9LDTA 1JKXA 4TLDA 1JWLA 4L9WA 1NW5A 3BICA 4OI4A 3BB3A 4FJ2A 3FPSA 4G3XA 1W36B 1XJ0A 1AKWA 5AQEA 1JHDA 4LRXA 3VU9B 3NTQA 1HG1A 4GLFA 2BHLA 4YUXA 2RHMA 4YT4A 1ZD8A 3D6AA 3LE8A 3O8BA 3ZJ4A 1N77A 4OFXA 1GFSA 1XVIA 4R0MA 2X77A 1XD8A 5FPYA 2Z5LA 4R83A 1A3CA 5K01A 1EK1A 2JF0A 1NASA 2DBZA 1YTUA 3I23A 1K4YA 1X39A 1R27A 5J2TB 1OU0A 3EVAA 1DC5A 2A1UA 2H1LA 1Y4DE 2YHIA 1DIRA 4CUZA 4IY1A 1RWKA 1XGKA 1KAOA 2ZUBA 4GYJA 3VR4H 1SG0A 2Z98A 3UJPA 2JFFA 2Q5FA 3RTBA 2ZJAA 3GEEA 4MVJG 5EQFA 3AEUA 5BW8A 3NT2A 3V6MA 3O8RA 1V11B 4HAUA 4QFMA 3CCFA 3CGWA 2FVYA 3WO1A 1C8LA 3L0IB 4C4AA 2C20A 1DAOA 2N42A 2ZSAA 1YE8A 3JQ8B 1NBIA 4MJXA 4DQKA 3HXMA 2FEOA 3FPCA 2G40A 1V8PA 5DN6A 2B78A 3DKKA 5G4KB 2JCXA 3TQCA 1JVNA 3D7LA 4F5ZA 4FFWA 1DOZA 1QQ6A 1IPEA 1ZI8A 3KQWA 4PXSA 5ALSA 6Q21A 1ZK4A 5JSHA 2VPPA 2V7TA 4G1UC 4DMLA 2UXBB 1TM5E 1Q1GA 1W2GA 2ZS9A 2ZJ5A 3INGA 4NABA 1NTOA 3R5XA 3DWFA 3T0IA 5D6NA 4O02B 4US0R 1P3JA 1U9IC 2WR8A 4R8LA 1WVIA 2XTAA 4PO9A 4I4NA 3LKZA 5F64A 1M5RA 1EQAA 2YQ5A 1XFAA 4HYQA 5FLKA 4G0MA 4C05A 3C41J 1RYMA 3IDSA 5EJ6A 4EMTA 2ZJZA 3C6QA 3ETJA 4PQEA 2X7XA 1OGJA 1USWA 4X3OA 1E6EA 1JN0A 4RTMA 1W35A 2YNMC 4UVDA 3ELUA 5BNTA 1FP2A 2VJCA 3L8FA 1PDVA 4QL3A 4N3AA 3WX0A 3Q0EA 2WHYA 4UVGA 4P82A 4O4HA 4XDGA 1MTOA 3NYRA 1QRRA 1WW8A 3BWDD 3GCXA 4JP3A 1T3LA 1DXQA 4RJKA 1O77A 2VXOA 4AZ0A 1D8TA 1MFZA 2DQYA 4YAWA 3CJQA 3CN9A 1JW9B 2GCNA 3DZCA 1QPBA 2CY0A 3DR3A 1RXCA 3GUHA 5HF8A 5NULA 5C81A 3FOEC 3ZV4A 1ULHA 4B4DA 2W48A 2P78A 1JB9A 4FFPA 3PRKE 4V3CA 3CWQA 2CYBA 2G5CA 3RKRA 4D1YA 1NQTA 3VU8A 4G8DA 4YRIA 2QVGA 3W6OA 2H0AA 3PHJA 2NPIA 1FJHA 2LDXA 2RH9B 1HLFA 2HPVA 2AYZA 4UEWA 4ZCQA 5H81A 1BDHA 3OAAD 3D3JA 3R7SA 3BDAA 2PRZA 1T9GR 2NNWB 5LPNA 3JR3A 2XKAA 2OO7A 5DHRA 4C22A 3CISA 2F4VB 1S8OA 5TY0A 5G0UA 3I9OA 3SYLA 3SS8A 5HVNA 2CJWA 3ESCA 3A4VA 4GL4A 5FTMA 3B82A 2CZQA 2OA0A 5HKKD 1SKMA 4XFKA 2J07A 2YFKA 1YMVA 2WUEA 4JUCA 4MKRA 2C5LA 2GKOA 4QOHA 4J91A 2PSHA 4TL6A 4ZOCA 2AEMA 5ILQA 3ZQ6A 4YMLA 3FTCA 3KE8A 1GL6A 2DFDA 2PMKA 4IOKA 2OBLA 2VP3A 3H5AA 4LKRA 5DTIA 5JCPA 3ZHOA 3AUTA 3BCSA 4V0MA 1BU8A 4UDYX 5FTKA 1WAMA 1EM8B 4NBKA 1T2EA 1H0RA 2AYXA 1O8BA 2D54A 2P0AA 4WAUA 4YJ3A 5FB3A 1ZBDA 2DTEA 1DE0A 1RCUA 2B8WA 1HQCA 2IKQA 2NTYC 2W2OA 2W43A 2WUDA 5F2KA 5KWVA 3U4MA 1N75A 4RLQA 4YRDA 2C00A 2KPOA 4RVGA 4L7VA 4HQRA 1WUKS 2GN2A 1DELA 3AESB 4IAOA 1EHIA 5F1OA 3A6PC 4PG8A 5I4KA 3LUCA 5B7GA 5KYUB 1AQLA 4RJIA 1I14A 3T1VA 4BKOA 3ROQA 1Z7YA 2AJCA 5JMTA 2ZYAA 3R1IA 5KSZA 3U1BA 1I24A 3CZQA 2I78A 1SHZA 3BTSA 2HI0A 3O1LA 3ZD9A 1XZJA 1BH2A 2E5WA 3ZOZA 4GSLA 4MHOA 4D3SA 3E3AA 1J4AA 1YR3A 3OOEA 5IUJC 2G9QA 3BPSA 1Z15A 3ZR4B 4TN1A 4EIWA 4GKJB 3BHMA 4IJUA 3D0QA 2JIMA 3NP9A 2EHDA 5H02A 3QTLA 3EUWA 3R7LA 3CSDA 4EPTA 1DWPA 3OA2A 1NGSA 2CWWA 2FN7A 5CB0A 5JE8A 4AROA 1EFHA 3AR5A 4CMJA 1RM0A 4AVYA 2GM9A 1SM4A 3MCVA 4MGIR 3WJ7A 3FE2A 3R6LA 4KIJA 4YJDA 1MN6A 1GZ6A 4Z1OA 5G41A 1VGRA 3W04A 3WLIA 3O94A 4U2KA 2Q2WA 1R4MA 4G25A 3RVDA 1RQGA 1RBZA 2B0CA 5JNUA 1RXSA 1U2GC 5COQA 3DUFA 4TWAA 4KO2S 5AESA 1DO2A 1TW3A 3RC7A 1NUSA 2VH2A 1HEUA 3SF0A 1H0KA 2ZIGA 3V1MA 3QVLA 4O2AF 3W5AA 4ZI2A 4MUGA 4O6VA 5EWMA 2R87A 1DWOA 5JYDA 2YVUA 5CU7A 4HVCA 1TAGA 1KFBB 4DMFA 4YRRA 1ZCZA 1WULS 1BGWA 2ZK7A 3IDFA 4FBLA 5FJJA 5JVDF 3I04A 2EHJA 4C01A 3TLBA 5JWHA 4XVCA 1M6VB 1QOQB 4RESA 2YDXA 5EJGA 2FHSA 5ELMA 4EHJA 1J99A 1YMUA 4YXWD 1U0TA 4H7JA 4DGQA 1P5HA 1DXHA 2AJ8A 1WVGA 2GZMA 4TT8A 5AVYA 5J9FA 3EA4A 3IBGA 1P7VA 1QF9A 1QYRA 5HF5A 1TM1E 4CZ2A 3LT4A 3OZTA 3IC5A 1DEXA 1GV1A 3E1KA 4PFKA 2FPRA 3LUFA 4LI0A 5HQ3A 4QC2A 2E37A 1VL6A 2OCKA 4WA7A 3GJTA 4GZMA 4S3MA 1YIDA 1KPHA 2VJOA 3D5TA 3R3UA 5KDDA 4TMFA 1NDHA 3G68A 4LGMA 5IBPA 3K9CA 1T5HX 1JFTA 4ALKA 3O0TA 3FAKA 2UXDB 3RS8A 2JCGA 2FHPA 4IIBA 4NK5A 4D2IA 3CLHA 4REMA 3DS8A 5JD5A 4HATA 3KETA 3LXMA 1YAJA 3JAKB 4WKGA 3RFUA 3WR5A 4ZKDA 2BV3A 5BV7A 2VJMB 2OSVA 2W6ZA 3BC1A 3PGVA 2XNJA 3RU7A 4JYPA 1GL3A 4RM2A 2B1QA 2COUA 1BZYA 2XGMA 3O38A 4GBED 2PWZA 3GLGA 4BNHA 5E4TA 1Y4ZA 5JCZA 1TYDE 1TDJA 2NVUA 2OD7A 2I2BA 2VHQA 4FOSA 3UZUA 2C59A 4G0VA 1A2QA 3LQYA 1N2CE 5IAGA 3K70D 1MU0A 2KBFA 1RRCA 1PL8A 4TSRA 3MMPA 3KSAC 1O95C 2HK8A 4ZIRA 2NZ2A 2X8WA 4BNKA 5IK2D 4BX0A 4PFSA 2VTKA 1RPNA 3EBOA 3JYQA 2VO1A 1XEXB 3KJEA 2ET6A 4PC3A 2A5DA 1TEVA 2CHGA 3QU2A 4BVFA 4F1WA 2DFLA 1CQJB 1U99A 1TCUA 2CF6A 1UJMA 1UMBB 1W48A 4PY2A 2VUIB 3FI9A 3L2OB 2Z5FA 2HSDA 5FOXA 4DLKA 1H2YA 1T8UA 4UAGA 3RSCA 4RTLA 1Q6ZA 4JLUA 4LHYA 2B1IA 2GPBA 3D7MA 3JQ9A 4EPVA 2HF2A 2P6NA 1K27A 4MYRA 1U8CB 2RHRA 5AUOB 2F43B 5CDHA 4I1PA 1D7OA 3FB1A 4O5OA 3V4VB 4JELA 1YR9A 3U19A 5M5BA 1FZQA 5JD3A 1TCBA 3N39C 3AVUA 3I9V1 2HT1A 5DOZA 1JFLA 4CMKA 5KPDA 4WXYB 2H4HA 5HZKA 2XLCA 4MUJA 4IZIA 1MB2A 2P9ZA 3C24A 2PV0A 3OLQA 5INTA 5JUWA 1A9YA 3VUFA 2VKQA 1T3TA 2D1YA 3FDZB 5CX1A 2E2WA 2FW1A 3DBHA 3OSZA 1VLVA 5EKUA 3M6IA 5B37A 2GJKA 2DSNA 5A5FA 1W47A 3SZ3A 1ZHFA 3RYHB 2GGSA 5H59A 1O0SA 4P7FA 1E9SA 5J59A 1WW2A 2FP4B 2XWPA 3E81A