1RRFA

Non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, monomeric crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
175
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords RAT ADP-RIBOSYLATION FACTOR-1
publication title The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 40
structure length 175
sequence length 177
ec nomenclature
pdb deposition date 1995-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrfA00
1FL9A 1HA3A 4HAVA 1GWNA 3TQCA 2ZPTX 1AK2A 3R7WB 2ZUCA 4Q01A 3DMNA 5HTKA 1X8KA 4OQNA 2RH5A 3HP1A 2EFDB 5FUXA 1ESNA 4IOJA 2GCOA 3TW4A 3ZDQA 3D31A 1QF9A 1OE0A 5JCZA 2W58A 4RCYA 3I61A 5FOXA 1I4LD 2R2AA 3VR3A 3ZZUA 1M1YE 5FPHA 4EAQA 3PENA 4YMWA 1GOTA 4Q1BA 1N0WA 5DHAA 1PVOA 1BO6A 1K8RA 4DDTA 4BLSA 3OZXA 4ON9A 1NKSA 1KDPA 1TF5A 2A5GA 1QBKC 3AF3A 5FUYA 1GRRA 4JYBA 4BFWA 1TAGA 5DE3A 5JRZA 2BHRA 2ZANA 4GT1A 3M4YA 4B3BA 1L2TA 1NVUQ 4XVQA 5CM8B 1AZTA 4B48A 3NC0C 4BLPA 1IONA 4IDNA 4NBSA 2W2XA 1E79A 3AVWA 1KI7A 2E87A 2X19A 821PA 4QJ5A 3HPRA 1CR2A 1Z08A 1OKKD 5FTNA 4D4MA 2ZRCA 4P4SB 3GEEA 8OHMA 3U44A 4Q4HB 2BKUA 1G3MA 2GEVA 3R9IA 2VHCA 2D2FA 4AKEA 3FGNA 1E2DA 3S1AA 2WWIA 4O25A 4HLUC 4Q4AA 1AZSC 5L3QB 5H8WA 1G7SA 1UBFA 4M9SA 3AKCA 4B71A 2OXCA 2X77A 3T12A 5HR5A 4TYWA 2P6UA 4TTRA 1ZD1A 4EUNA 2WJYA 4B43A 1BIFA 3EWSA 3KJHA 4JLNA 4KHZA 3CZPA 1JR3A 1DAMA 1R5BA 3A1TA 3OAAD 4TQUS 5AJWA 1CJVC 2KI5A 3LBIA 2QAGA 1UFQA 3BFKA 1RC8A 3DEFA 2ZRDA 3SQXA 3U6KA 2ZVQX 2GNOA 5H1YA 2CXXA 1Z0FA 1DARA 2VP4A 3L8ZA 5HZHA 4LHWA 4R98A 2R6CA 2PCLA 4BLQA 4DLWA 1WDTA 2PX3A 3BK7A 3QKUA 1BH2A 3TKLA 5SZHB 4RZ3A 3SS8A 2V7QD 4Z8XA 3W6OA 4C0KA 4TZ6A 1OFUX 2YV5A 2V6JA 4ZKEA 1GNQA 3AKYA 3OEHD 3RS4A 3MG9A 3THXA 2ZRIA 2N42A 3JZMA 1WE2A 2BJWA 5SZIA 4TMTA 4C7OB 4ZDKA 4MRNA 1UEIA 1VG8A 1Z0KA 4DB4A 2FX3A 1S9HA 1HURA 2I1VB 4BEJA 2ORWA 5EXPA 4M1YA 2WMOB 4LV5B 1XEXB 1CULC 2YZ2A 5J47A 4KAXA 5JJKA 1W46A 1R7RA 2ZTSA 1E2EA 4GPTA 1JJ7A 1NVVQ 4HLDA 2KJQA 4TLAA 3GLGA 1VMAA 3AUYA 3LBNA 3MWJA 2QI9C 5HZKA 2FF7A 4RD0A 5DHFA 1KMQA 1R0YA 4UQOA 4TL9A 3AUXA 4LYJA 2HJVA 5JLJA 3I5YA 2QNRA 4KCGA 4AI6A 2FGJA 4JVMA 3DO6A 4CRWB 1GFIA 4DZZA 4CEHB 4HB4A 4PC1A 2G1KA 5EQTA 2PZFA 4A2WA 3CKLA 1ZNZA 3F0TA 1YZUA 4PPGA 3VTKA 4GRAA 4CVNA 2F55A 1TL7C 3H1TA 2DFLA 3E70C 4HAUA 1G4AE 5DLQC 2QP4A 1HT2E 4FCWA 3VKHA 3BERA 3FMPB 3EC2A 2ZRLA 3R9WA 3FDIA 4M1KA 1JPJA 1CJUC 1VTKA 2IYUA 3QG1A 3AVQA 2IT1A 4LC0A 1QHXA 4QL3A 4JLMA 4Q9JA 3H86A 1BKDR 1CJKC 4URUR 2Q9CA 4HI0E 4DT1A 4PSAA 1QVRA 4RD2A 1EXMA 2YINC 4NCJA 2BV3A 4S35A 3ONWA 2FN4A 5HE8A 4G3XA 4U02A 4EFMA 1MO3A 2WJHA 1I4DD 5J40A 3X2SA 3CRW1 3W8RA 1HE8B 2YJTD 2AKYA 3EARA 3EZ6A 4X8LA 3T06B 2IS2A 1CR4A 3OIUA 3PIRA 4ZI3A 3DZDA 3PJRA 1P7CA 2N1BA 4DSTA 1TMKA 1E99A 2CL7X 2MSCB 1H8HA 2XNDD 3IGFA 4V02A 3EPJA 4NYMQ 2VH5R 1IXZA 3T34A 2IYSA 2QROA 3U60B 1CXZA 2NOAA 2VLIA 2RGDA 4MA4A 1EFCA 4PFSA 1G8HA 1E1QA 1NY6A 1SGWA 4JMPA 4F4JA 3HYRA 1N6NA 4YXWA 5J4HA 3TR5A 4B2LA 4AKGA 5EJEA 1IM2A 2H17A 1B23P 4FWIB 2J0SA 5JWOA 5KU1A 3GJ8A 3CX6A 3A58B 4TQ9A 4RSGA 2NTYC 3IIJA 3VKGA 1Q21A 3B1VA 4ILEA 3IPYA 3E2IA 1EFUA 4QXAA 3EPHA 3U3KA 3FKQA 2XXAA 2OE2A 2O8DB 3VNUA 1G3UA 1XF9A 3B13B 1G8YA 4QRHA 2VP5A 5KDOA 3TAHA 5CK4A 5BYJA 3ZQJA 4JJZA 2AWNA 5EUQB 1R6BX 2ZI4A 1ZUIA 3VAAA 1CEEA 1Z0AA 1E79D 3BB3A 2PJRA 4JLPA 1XCGB 2GBLA 3NIBA 4P3YA 2IUUA 4ABYA 4XTCS 2VHTA 2RAPA 1HTWA 4OK3A 4JZKA 1R0WA 4CT4B 4NZYA 2CVHA 1E4VA 1T5IA 2XZPA 4P31A 4IXMA 3BFXA 4DCUA 2YKGA 4IVQA 4TLCA 4LHXA 3F3YA 4Q7KA 2FPLA 1Q3TA 2ZUBA 5F9FA 2GWHA 3KXKA 3CNOA 2QQEA 3QKSB 4IRUB 2ZI7A 3TE6A 4EJSA 5HKKD 4E5UA 5FL7D 2F1JA 3EIEA 4LHZA 1U0HC 4N1AA 5AJXA 3GQBA 1AS0A 2VO1A 1T91A 2OFWA 2IA5A 2PMDA 3O8CA 3V4RA 1A2BA 1RJ9A 1VHTA 1TPZA 3Q5DA 4QKQA 5DYIA 2AXNA 3T1OA 4DHEA 4LC1A 1HH4A 1W0KA 1N6RA 4Q1AA 4CW7A 1TADA 3JVVA 4JBWA 3PUYA 2VSOA 2ZI5A 1WXQA 4HAZA 2CE7A 1EX7A 4OQXA 4DCSA 3QXHA 4TYPA 4QJ3A 4AG5A 2O8CA 5AK0A 3ZS8A 4JKIA 3LAWA 3FE2A 1IN4A 1GTVA 1SKQA 4B44A 4HSEA 2XB4A 3KL4A 2WTUA 3OESA 1WBDA 2IF2A 4D80A 5CM9C 3GJXC 1ZC3A 1EX6A 1ZP6A 4B35A 5FPKA 2QBYB 1GL7A 1G21E 1DAEA 3LY5A 2ZJ2A 4GOXA 2YVUA 5AWFC 3K0SA 1KI6B 4P4TA 5JSZB 1XJCA 1G16A 1K5DA 2BKEA 2ZE6A 2ZJZA 1U9IC 5KPDA 3AH8A 2XZLA 3T35A 2YWGA 4M1SA 1OYWA 3TNFA 2GK6A 4EPRA 3QQ5A 4URXR 2O8FB 2CK3A 1UJ2A 3ND9A 5AJZA 4QM6A 1JR6A 3CWQA 1IOZA 1JAIA 4JLKA 1I4TD 4KYUA 4JLAA 3W6PA 1FQKA 1ZNYA 2QM8A 4NYJR 4LJ8A 2WWWA 3VFDA 3QSYA 1YR8A 2R6AA 3RRZA 4KITB 3G5UA 1SHKA 3ADDA 4WOPA 3O8RA 1U81A 4MYUA 3ZZTA 2JAQA 4D6PA 3W6NA 4PO1A 3GCGA 1W44A 1KMHA 1YZQA 4RVCA 2VYFA 3W3AA 2ODWA 4QNMA 3HR8A 3QIAA 4MRPA 4W7SA 5E7JA 1KSFX 3KJIA 2DFNA 2YHSA 4A8JC 1NKTA 1QHGA 1CRPA 2O8BB 2PEYA 4M2LA 1E9EA 4PC2A 2HT6A 3QEOA 2GXQA 4DT1B 3CPHA 3X1XA 1YZKA 1OV4A 3OFNA 1Z0JA 3QE0A 4LOAA 1W2GA 4RCZA 3AF4A 3TLXA 3C8UA 4AWXA 4KI0A 2H1LA 2W6IA 4PZYA 3TW8B 3WRYC 3THYA 2BM0A 5DN6D 4Z51A 4GDFA 3NBZC 3CPJB 1S2MA 1F60A 2YWEA 2DR3A 1DELA 3TR0A 4PC3A 5P21A 1XJQA 1NNEA 1P2TA 3DPUA 3GP8A 1UBEA 2V4ZA 4UNQA 5UKDA 1DAIA 2QAJA 5EZ6B 2ZAOA 1Z2AA 4Q4LA 3MMPA 3IIMA 4CDGA 4I99A 1S1CA 4B3DA 2GCPA 2J0UB 2DWOA 2WJVA 1XXHE 3ZZ0A 2FPMA 1E0AA 5CIWA 1E2QA 1E0SA 1WA5A 2QE7D 5C4MA 3RABA 3H84A 1Z6TA 3KQLA 1E1QD 3K0CA 2HUPA 1YU9A 3V9PA 3PVSA 3FMIA 2HYDA 5CLLA 4YXWD 1SULA 4NTZA 4ARZA 1E9BA 3VR4A 2GZAA 1D9XA 2YC4C 2A7QA 1SVWA 3FHOA 1UEJA 1KSJA 4D4LA 2IXFA 4JJKA 2NGRA 2ZRMA 4XIGS 4KXFB 2ODNA 2X1VA 5D3QA 4OHYA 1IJEA 4A9AA 1GL6A 2QORA 4YDHB 3SI7A 1HE1C 3RRNA 4GL2A 1F6BA 3BJIC 3DOEA 1X86B 4IVRA 2W00A 3H4MA 2J7KA 4BQSA 3U6BA 3RS3A 1WB9A 1SVOA 3B1YA 3HDTA 1ZM4A 4Q47A 4TL8A 3W8NA 1AA9A 4BFVA 3AP1A 2B7BA 2JLUA 2VP2A 3KDSE 1P9RA 3QKRA 2EFCB 4DUGA 2VP9A 2Z6VA 4KODA 4PC7A 1T4GA 5EP3A 3QVVA 3T1VA 4BFXA 4MGIR 5KOYA 2I3BA 3DHWC 4DJTA 3HU1A 5TARA 5IK2D 3AP3A 3EPLA 4FMDB 3KKOA 1E94E 5CB8A 1CR0A 5JS8A 2CJWA 2Q21A 5FH9A 1XP8A 3AKEA 3WHKA 1ZJ6A 5FBRB 4OQFA 1O3YA 3HJNA 1KI2A 3FPAA 4HUQA 3RC3A 2B21A 2JCSA 1D8TA 1R5OA 2EW1A 1II8A 1MOZA 1XEWY 3AV0B 4IOMA 1VG1A 4M4SA 1KDRA 1W0JA 3MGCA 3K09C 4BECA 3BH0A 4IFEA 3SN6A 2A2ZA 4DSUA 1EFRD 1XD2A 2AX4A 1FTSA 2QA5A 2R6GA 4F7WA 5JCPA 4AKIA 5JEDA 3T1QA 3QY0A 5IHPA 2QQ0A 1SKYB 4C0AC 2LCFA 5FOVA 3SFZA 4DLTA 3L43A 5FTKA 5KSZA 2HCBA 1KGDA 1AKEA 4GOJA 3LX5A 2VP0A 1VIYA 4IDPA 1JXMA 2PZEA 3CH4B 5FFMA 3KFXA 4GBMA 2JEOA 4OJKA 4UKDA 4Q19A 4B3CA 4MKIA 1G6OA 5L8VA 4Q7MB 3BXZA 3THOA 2YWHA 3BWDD 1RRFA 1Y63A 2BCJQ 1T3LA 2QL6A 3K0EA 4QC2A 4LHYA 3GJ7A 1ZU5A 3LNCA 3RVBA 2QY9A 3RC8A 5JS7A 1P72A 2PCJA 1KY3A 2VSXA 2WWFA 2J0QA 2OCPA 3NHBA 3EXAA 3I5XA 4LBWA 2WKRA 2CDNA 2ONKA 1E98A 2C78A 4R2HA 4NCNA 4GMDA 1AJEA 2W6JA 2CK3D 1R5NA 3A1SA 1XNJA 3FFBA 2XNSA 2DPXA 1P2SA 3GLIE 1IXSB 1GRQA 4TL6A 1NJGA 2IYQA 4EKDA 1SVSA 3N2EA 2EFHB 5K8TA 2YOHA 3DMDA 1VECA 3HPQA 1FUUA 2BBWA 3B60A 1QHHB 1UBCA 2MSEB 1US8B 2ZRJA 3KKQA 4R9UC 5DH9A 1P60A 1NVXQ 3GLFE 4Q9LA 1MO6A 1Q20A 4OQLA 3QI2A 3WP1B 3THYB 3IO5A 1FTNA 4L15A 1UKVY 2G9NA 1KO8A 2H92A 2NO7A 4DWJA 1E0JA 1OXSC 3BAFA 4EPYA 4CEJA 2CLCX 4IOKA 2AK2A 2FDCA 1KK3A 3A4LA 4RD1A 3VMFA 2QP3A 2H16A 3LH5A 3DKPA 3VQTA 3PCRB 4PQRA 2AK3A 2FSIA 4S2EA 2D4HA 3GJ0A 5EXTA 4BUJA 4Q9HA 2W6ID 4M9ZA 4MUBA 2C03A 4KVGA 4PX9A 2PL3A 4A2PA 4PXAA 2V1UA 1JECA 1Q3HA 1VPLA 1XXHA 2IL1A 4LV6A 2Z43A 3HU3A 3CRVA 3R8FA 1XPRA 1ZW6A 2KBFA 4C0LA 1RRCA 1Z6XA 4RD4A 3AVOA 3LXXA 2GJ8A 3K9HA 2NG1A 4V03A 4EIWA 5A4JA 3KTAA 3MUFA 1NSTA 3V00A 3HYTA 3ADCA 3GD7A 3UANA 1ANKA 4P0TA 3QUSA 3MCAA 2FH5B 2ODBA 4FCVA 3ZIAD 3GLHE 2HV8A 3CWZA 3RSLA 1IN8A 4X8HA 2AD1A 1OH5A 2GKSA 2ZRNA 1P75A 4US1R 2PLFA 4Z1MA 3VR1A 3AF1A 4ASUA 4A8JB 3LWNA 5L3RA 2KB0A 4OKSA 1CJMA 2OILA 1P9WA 1UBGA 4W9MC 2G1JA 5AUPB 4QGGA 3TUZC 4FD2A 2CEAA 4HDCA 2IYVA 3QKRB 4NP6A 1ZU4A 2VHUA 1S4QA 2QAGC 1SXJE 2V1XA 1XTJA 2ZJOA 5DI3B 1A7JA 2BMDA 3GJ3A 3IQXA 1Q22A 2WICA 4QBFA 3E1SA 5BN3A 2D74A 4K81B 1RKBA 2C95A 1LS1A 3ND8A 3Q7QA 5GJCA 4F92B 2HYIC 1NI3A 4HUQB 3R8CA 2ZROA 3KJEA 4G5SA 4Q1DA 1LW7A 2ZSDA 4TWZA 3DZ8A 1Z2CA 4LCBA 1OXVA 3OIYA 1TEXA 1KO5A 1TQDA 2GZDA 3U4QB 1LV7A 3QG5A 2CE2X 3Q3JB 3FHCB 3GPLA 3WMEA 2ZSEA 5L3SA 3KQHA 1XD2B 1BOFA 1M7BA 3BD9A 2IWRA 4WZBE 2BEKA 4PHGA 5C46F 4XOIA 4ZCLA 2FFBA 1Q1ZA 4IDOA 3NWJA 3ZVRA 3FYHA 5K8LA 1W0JD 1P5ZB 2GF9A 5FTJA 3KQUA 4FCTA 2XITA 4QBIA 4CYMA 4NKRA 3AVUA 1DE0A 4HB0A 2IYRA 1M34E 4QGAA 4Q4JB 3SDZA 2R6DA 4ITRC 1ZAKA 2OLJA 5FOTA 3PUXA 3G0HA 1LB1B 2WSMA 1G4UR 3CRQA 1LY1A 2HDNB 1HQCA 4JIMA 4TN1A 3NH6A 1KSGA 5EZ5A 3IIKA 4M1OA 3TUIC 4NL4H 2CHGA 4A36A 3TIFA 2LKCA 3G82C 1ZMXA 2D3WA 1Z83A 2RGXA 4UNNA 2OCYC 2JLYA 1U0JA 2ZIAA 2ZU6A 1GKUB 5ANRB 3GJ5A 4D82A 5CLQA 4JBYA 5AUQA 1U94A 2ZETA 2VHJA 4XWKA 1F2UA 1FP6A 3VR6A 3GLIA 2C98A 1T3SA 2Q3HA 3B82A 3IBYA 3LVQE 2ZJ8A 5JWRA 3PEYA 3I92A 4XH9B 4WXPA 2WZQA 4XWAA 4C3ZA 3B8HA 3OE7A 3VHXA 3O8DA 3W34A 3A4MA 2AL7A 3U3RA 3MWYW 4WW0A 2IEZA 1E2JA 1E69A 3KB2A 2C8VA 3GLFA 3L0IB 3JZAA 5FL3A 4LGMA 1OW3B 4LBVA 3SJBA 5JI2E 4TYQA 2ORVA 3IUYA 3T61A 4X8OA 5D3MB 3X1YA 2Q3FA 2AFIE 5FTMA 4CT5A 621PA 3SU8A 3UIEA 1MRSA 2P5SA 2G6BA 2ZQ5A 1UM8A 2QPAA 3X1ZA 2PZGA 5FI0B 3C15C 4IDHA 2O52A 3V4FA 1E4YA 3EZ2A 3OEEA 3QF7A 4BLTA 4K46A 1N6LA 2IUSA 1RIFA 2F43A 4OI1A 2XAUA 4HLCA 1XJ0A 3FVQA 4GNKA 2Y8EA 3NEJA 3LX8A 2IYLD 4NYIR 1Z07A 4PHHA 4O2RA 4XWOA 3THWA 1GAJA 1T8TA 3NBFA 2X8AA 2QT1A 2GRJA 4ACAA 2DCUA 3AVYA 2IHBA 3PG5A 2IC5A 4ZIRA 4HZUB 2PT5A 4A6XA 2IF0A 4FXPA 3GLHA 2CCGA 4FINA 3AF2A 2W0SA 1J8YF 2AKAB 2OBMA 2MMGA 3WMGA 3IEUA 4TSFA 2F9MA 4OI4A 2IYYA 1W4AA 3EZ7A 4RFSB 1N5LA 4DBLC 1WQ1R 4XJXA 4IOLA 5JRJA 3KKMA 2LKDA 4WAUA 3QENA 2A5FA 4IEEA 4HUTA 4M9XA 4C9BA 1KJZA 2WIBA 4M1MA 3WNDA 2GBLC 1FX0A 2GJAA 2IHYA 4DIEA 4C0QC 1D2MA 5K8UA 3A8TA 5G40A 4QBGB 4LZZA 1XB2A 1ZCAA 1SXJA 1U98A 2J87A 2WWHA 1XMJA 2EVWX 2PEZA 4HAWA 4TLDA 1KIMA 3GJ4A 2E1RA 6Q21A 4ASUD 4BWYA 1II9A 5CDFE 1W48A 2EYUA 2ZRFA 1E1RA 1CRQA 2GCOB 5FBQB 2X2EA 2VHQA 4EJSC 3I72A 1A5TA 4II7A 3UKDA 4DXAA 4D2IA 4EPVA 1Q1QA 3SBEA 1G19A 1ZM7A 3CO5A 1YZTA 5CB6A 3TQFA 1Z5ZA 2GVZC 3IBGA 4WIAA 3MAAC 1ZYUA 4UXJA 4L4UA 1G64A 1J8MF 1E2MA 5DI9A 2AXPA 2V9PA 1OH6A 1EWQA 2C99A 4LK2A 4R7ZA 521PA 1Z0DA 2PMKA 1Z63A 5AUOB 4CEIA 3KUDA 4MKGA 1GIAA 2H5EA 1OPXA 4LRWA 3TMKA 3U7EB 5CITA 1CBUA 5EXSA 4DC9A 1Q44A 4L9WA 4F91B 1QG4A 1OFHA 4OYHA 4XTRA 2ZR9A 4LDJA 1D6JA 2F6RA 4HDOB 4RKFA 1N5JA 2F1RA 3T5DA 1W5SA 4MRVA 2UZ3A 1M74A 4I1OA 3RS5A 3LD9A 3UWOA 5G3YA 1XRJA 4TMVA 2BMEA 5DISB 1KY2A 2IS4A 3U44B 3NDPA 1TF7A 2QRZA 4B32A 3S1AB 2FSGA 4Q4AB 4HLQB 1G7CA 4XSHA 1NG1A 1PJRA 3PR1A 4DVGA 5BQ5A 4HYYA 3VKWA 2NO0A 1EG7A 3CX8A 4US0R 1HYQA 3SYNA 5GJBA 1NSFA 4L16A 1M7HA 4BLOA 1FW6A 2QAGB 1R0ZA 1OB2A 2JJ8A 2QMHA 2QN6A 2KWIA 3K70D 1JI0A 1ZBDA 4K8OA 4PPQA 1KK1A 1I2MA 2ZYTX 5AJYA 3TK1A 3LRPA 2QM7A 3SR0A 4BE7B 3JVUA 1CLUA 4HB3A 1OH7A 3FB4A 3SE0A 3RRYA 4UXHA 4JVLA 1XTQA 2IX3A 2HJGA 1JR3D 2G77B 4YLGA 1QG2A 5EE3A 5DO9A 4LBYA 4BGDA 3MD0A 3MWKA 1FQJA 2GAOA 2XZOA 2WPDA 1DOAA 2QRNA 4AYWA 4EDHA 1IQPA 3NHAA 4TLEA 2DFTA 4DDVA 1G291 3THXB 3HWSA 4Z54A 3OE7D 1FFHA 2AWOA 5EP4A 1BMFA 4RZUA 5G41A 3RWOA 4KO8A 2EFGA 1UKZA 1T5LA 5LDDC 4IFBA 3FTQA 4KLZA 3ZYCA 2REBA 1DVRA 1NMZA 2WWXA 2BBTA 5FTLA 1DG3A 2P67A 4RKEA 1KZGB 1RE0A 3O47A 3TSOA 1V43A 1A1VA 2BJVA 1G5RA 3A6PC 1IN5A 2O8EA 2JA1A 2AFHE 3A4NA 4WBSA 4EQ6A 1U0LA 3EASA 4OHVA 2DWPA 3GLGB 3QF4A 4L9SA 3THWB 4A15A 2ATVA 4OHXA 1SVKA 3BH6A 1S1MA 1KNXA 3OEED 4PC6A 3X1DA 3QXXA 5FR2A 1E9DA 4ZIRB 2A5JA 3K0CC 4E09A 1NIJA 4DB2A 5E7IA 1ZUNB 1MT0A 4BFSA 1LTQA 2QEQA 3L8YA 3GEHA 2G0NA 4U00A 4YONB 1OIXA 4F38A 4PPFA 3LQQA 1KHTA 3QBVA 4PHFA 5KNCA 2Q6TA 1VCNA 3AVXA 2CHVA 2PH1A 4LSGA 4OJQA 1CU1A 1CF4A 1R8QA 4OI0A 3SEAA 3J81k 3TH5A 3SZRA 5KNDA 4JLDA 1RZ3A 3ADKA 3P4XA 4B76A 3KKPA 4TMWA 3KX2A 3D6TB 1N6KA 4TSFD 3SOPA 4PO9A 2F3TA 2WJIA 1VYUA 2Q0HA 4OBEA 1E2PA 1MO4A 2ZS9A 4A0HA 2OAP1 3A36A 3PEUA 1SQ5A 2BVNA 2WVJA 5LB2A 2XSZA 1OFIA 1KSHA 3LFUA 5CDFA 3EW9A 2F9LA 1XTKA 4TMXA 2HCJB 4V0ME 2BCGY 2K5UA 3KQKA 4L8GA 4ESVA 3KB1A 1E2NA 4U7DA 1F2TA 1SXJD 3E5HA 1FNNA 2FFAA 5SZJA 3WY9A 4QHYA 3CF6R 2QTHA 2G88A 5EE5B 4B3XA 4DDWA 3AVVA 1Q1EA 2FNAA 5EXXA 4URVR 3GFTA 5IT5A 4TYYA 2V6IA 4G5OA 2GZHA 5KDLA 2W0MA 1E1RD 1G3RA 3WP0A 5JJLA 3NTUA 1G20E 3BC1A 2OCAA 4TL7A 4B3FX 3Q5EA 4EFLA 4G1UC 3FMOB 1FNMA 1OFTA 4V0NA 1X8JA 1H8HD 5JEEA 1ELOA 4NCIA 1AQUA 5FBVB 2JATA 3KJGA 2P5TB 2ZE5A 5KSPA 1UAAA 2O0KA 5FOUA 2ZI6A 4BFUA 3Q85A 1G3IA 1UADA 2XXAB 1N0VC 1NLZA 1TUIA 2D2EA 2ZSBA 4FIDA 4TQAA 4G5RA 4MDFA 4OQMA 2IBMA 2ZJ5A 4GP7A 4NU0A 2FV8A 4E03A 1S3SA 3I4LA 4P4UA 3B78A 2FEMA 4C0BA 3UMRA 1QHSA 1X1RA 4PSVA 3K0FA 1MH1A 4FN5A 1LNZA 2JIZA 4LPKA 3TGPA 4I1VA 4RFVA 4A4DA 2BBSA 4LYAA 4EFNA 1G3QA 4Q21A 3CZQA 1ESMA 1JJVA 1XD8A 1JB1A 1NF3A 3MJRA 2HXYA 2ZE8A 1W49A 2AD5A 3TBKA 5B30A 2BMFA 2VPPA 2ZE7A 1TTTA 4DDUA 1HEIA 1PLJA 2CNWA 3VX4A 3CRRA 3TVTA 2B6HA 4QHSA 4MRRA 2NZ8A 5TVKA 2KSQA 2WSSA 1OHHA 4Q02A 2X2FA 4D0GA 4GMXA 4DLVA 2QMEA 1NRJB 4M21A 2BIFA 3WBJA 4N0DA 5J4VA 2VF7A 1IJFA 1VDZA 4EJSB 2J46A 1R10A 1VG9B 3LBHA 4GZMA 1DS6A 4OK6A 4ZV4A 1VYVA 5EE0A 1COWA 4BFZA 4WVFA 4DLZA 1D2EA 2FSHA 1ONBA 1NN3A 3I3SR 4A0RA 1KO7A 2W2TA 4C30A 1RJ9B 1TEVA 4Q1EA 1SVLA 3K0AA 2PBRA 1H65A 5F98A 3QPUA 4URYR 5LPNA 1YR6A 2XGJA 2EYQA 3RRMA 1SZPA 5GVRA 2WOOA 3TJZA 2ZI3A 3VU9A 4XSGA 1CS4C 1U8ZA 5CK5A 3R7WA 4D4JA 4PQYA 3OHMA 4NYJQ 3ZS9A 4A0GA 2O8CB 1P3JA 2NO1A 4O0MA 1F3OA 5FOSA 2PX0A 1E2GA 4KFUA 1FZQA 4Q66C 2YOFA 5CIQA 2RGCA 2WPDD 1ZVQA 1W0KD 4FI3C 3NG1A 2OG2A 1U90A 3CX7A 3HR7A 3NKVA 4V0OA 2GJ9A 3TRFA 4A0FA 4C4PA 4D4KA 1GM5A 3FHTA 1U8YA 1KO4A 1BMFD 4LJ4A 5E3HA 4YMSA 1XEWX 4NMMA 2O0JA 4LUCA 4QBHA 2N46A 3FWYA 2FMXA 2W2VA 3QKTA 3QF4B 2B7CA 1VHLA 1P61B 3LLUA 5KHOC 1L8QA 5B57C 4KFSA 1EESA 5AJVB 1ZM2A 3R9XA 4QGFA 4POAA 5TV2A 4JLOA 3CIOA 2VL7A 2RGNA 2OLKA 1FPMA 4O3MA 3TAUA 1ZUHA 1A4RA 4HAXA 1IHUA 5FR1A 2GEDA 4BFTA 3P26A 1P9NA 1VKJA 1XX6A 4M22A 4M53A 3TUJC 1Q57A 4OHWA 1ODFA 2QPTA 4P4SA 1KMHB 4MKHA 4LJAA 2H18A 3W5JA 2OUKA 5E95A 4LWZA 1DAFA 2CHQA 1HT1E 4Q5IA 5TB5A 2QZ4A 1Z8FA 2WJGA 4CZ2A 5JZVA 1U8AA 5L3QA 4CGZA 2I4IA 1ZIOA 2O0HA 2WBLC 2ZJBA 3IEVA 2IXEA 4RJLA 1E6CA 2GHIA 5FI1B 2FFQA 1KDTA 4BZQA 3BIFA 1RPZA 1UDXA 4MQBA 3SC3A 2J7PA 1G1MA 1KI8A 5EE9A 3UG6A 3ZD7A 2F7SA 4B6EA 3QEJA 3SBDA 3LVRE 4OL0A 4ZDIA 3ADBA 4Y0AA 5JI3E 1J70A 4Q48A 2IK8A 4V0MA 2Z83A 3QJYA 2REXB 3DOFA 4PAMA 5GVSA 3ZVLA 2ZYWX 4UXIA 4NH0A 3KXLA 4RZXA 3EX7C 1YZNA 1NIPA 1X1SA 3CF2A 3GMTA 3OFND 2HF8A 1E96A 4JVNA 4Q1FA 1CP2A 2A78A 2XSZD 2WIAA 3OEHA 3M1IA 1YJ5A 3IKJA 4DCTA 3UMSA 2BDTA 1IN7A 5HCNA 3QXSA 2QGZA 4JLJA 1ZD9A 4DEXA 1Q12A 2YWFA 2JGNA 2RKOA 3BORA 1Z28A 1L7VC 2QSZA 3MJHA 3B85A 3EIHA 3H2YA 4GP6A 2G3YA 3BOSA 3KZ1E 3QBTA 2WHXA 3N5CA 3EIQA 3NBXX 2JLXA 2NMVA 5HE9A 1TQ6A 2WKQA 5FBLB 1W4CA 1LF5A 2A30A 4I4LA 1XPOA 4AG6A 4DLRA 3I8XA 3BB4A 1YZLA 2ZS7A 3CR7A 4PAQA 2GXSA 5AR1A 1G41A 2REOA 4C7OA 1GVNB 3B1WA 4ARZB 4Q18A 1Q1BA 4IXNA 2CCKA 1YRAA 2VSFA 5E4FA 1AGPA 3K0FB 1KK0A 2NPIA 4CIDA 3AF0A 3D7MA 1I2DA 1XEXA 3IPXA 2V8OA 1R8SA 2EWVA 4PAOA 1G8GA 3K70C 3NBYC 1NN0A 1DPFA 1IN6A 4E22A 2GJSA 4JT4A 1MRNA 1NN5A 2ORIA 1G8FA 3AB3A 2KBEA 4QGHA 4DCNA 1NY5A 1XTRA 2JIZD 3PEVA 1ZCBA 4ZPXA 1XZQA 4OHZA 2RHDA 4RD6A 1OLOA 1ZC4A 5KPJA 1WRBA 1YKSA 1EGAA 5A0FA 1UDWA 3T15A 2H8KA 4OI2A 2VA8A 2R65A 3CF0A 3UWKA 4ZKDA 3WHLA 2CJWB 2CNWD 3RDPA 2DY1A 1LF0A 1QHIA 2C9OA 1E9RA 2HLDA 2IYWA 2Q3MA 4LV8B 1H8EA 1OIVA 2P3SA 3PUVA 3RAPR 4DLSA 2WSSD 3K0AB 1OHHD 2A3RA 3KQNA 4DUGD 2P65A 1NVWQ 2F1HA 1II8B 2Z4RA 2DWQA 1KTVA 1Z3IX 2XNDA 3LV8A 1NVVR 1ZRHA 2UVQA 2VQSA 4MGKR 4UJ3A 4F4IA 1COWD 4QM7A 5JMTA 1Z06A 1Z29A 1SHZA 2DYKA 3A37A 3CRMA 4LX0A 1CIPA 4JL8A 1ZNXA 4GOKA 3RHFA 3L0PA 1OXTA 2F1IA 4YMTA 3W3ZB 4XVRA 3NDBB 1DAHA 1E32A 2BOVA 3H0KA 4LI0A 4H9GA 4D81A 3SYKA 4KLNA 4LJ9A 5E7MA 2FJUA 4EPWA 2CLDX 1E9FA 4PHTA 1N5KA 3CB4A 2EU8A 2OCBA 1S96A 1XEFA 4IHQA 2QMOA 5SZKB 1NG9A 1JALA 2AHOA 2BMJA 5BYKA 2JLRA 1GNPA 2WMNB 3Q7PA 2V54A 4PO8A 1AQYA 2QMUA 2R6FA 5EE1A 3VX3A 1Q0UA 2VBCA 3A1UA 2XX3A 1DO2A 3U2QA 2QU8A 2G83A 3X1WA 4PPNA 4DSOA 2PLRA 5JBQA 4AY2A 4ZO4A 1KI3A 3VR2A 5DYGA 4JS0A 5A5GA 1OSNA 4RZ2A 1KAGA 5HCIA 2JLWA 4MITA 5LD2B 3P1JA 1X6VA 4KVAA 2FG5A 4JSYA 3EG5A 1HV8A 4DLYA 1IY2A 4R71A 2O8DA 4YMUA 2XTNA 4LYHA 5BWMA 3K9NA 3NH9A 2LWIA 4FW9A 2FE4A 2PJZA 5JHGB 4NYMR 2OSBA 4UNRA 1W7AA 1FOEB 2OBNA 5BN5A 3B1XA 2HEIA 2VIIA 4KYIB 4PZLA 2CL6X 1XBTA 5C2JB 1FMLA 2QTFA 2RGEA 3RS7A 3ZGXA 3LA6A 5HKKA 4NPHA 5FL7A 4ZDJA 2ZJYA 1SVMA 3FOZA 1SXJC 1NBME 2F3RA 2W6JD 2ZSFA 2Q9BA 2B8TA 3CONA 4Z8YA 3K9GA 4PZZA 3I8SA 1MABA 3FFAA 5EP2A 2VTKA 4HB2A 4TMKA 4F4CA 1D9ZA 1ZM3A 2GETA 3K8YA 4CEJB 3DM5A 4IJMA 3QKSA 2J0VA 2J7PD 3DKVA 1T8UA 3LQRA 5JJIA 3MLEA 2IXGA 3L2OB 2XB2A 2OO7A 2SHKA 3DVLA 2OHFA 3Q72A 1AM4D 1N0UA 4GFDA 2XJ4A 4A6PA 1NL3A 2GEUA 4MKFA 3FKSA 4Q1CA 3ECCA 2JLZA 2DB3A 1XMIA 3U61B 3P4YA 4A82A 4Q7LA 4AURA 1BYIA 2O5VA 1OXXK 2ONJA 3AVTA 2CLSA 1XXHB 4JYCA 2ZRPA 3PFIA 4BPBA 1C9KA 1OXUA 3B5JA 4B2PA 3IDQA 1DTSA 4C0JA 3CPEA 4QFMA 4QG7A 1JXOA 2EQBA 3KTAB 1XZPA 4LJYA 3C41J 5J4YA 1VCOA 1E2KA 4B74A 4BRWA 4R2IA 2ERYA 3AP2A 1JQLB 1SKYE 2AR7A 3B1ZA 4JLBA 1G7TA 1NJFA 3W90A 2ZUDA 2NO9A 3SNHA 3BGWA 3ZH9B 2QBYA 4AYXA 1Z6GA 1E9AA 4FMBB 4IDQA 3RLFA 2BWJA 2C9CA 1GZSA 5B58C 1TU3A 1KI6A 3RWMB 1IY1A 1HQYE 5JSZA 3IHLA 1KDOA 4ZDWA 2J5XA 2R8RA 4HLUA 2FFHA 2RHMA 1XFAA 5IDVA 3A1VA 3N2IA 2IYTA 5GJVC 2BC9A 4LJ6A 1K6MA 2O8FA 1UKEA 4XVUA 1W36B 5F9HA 1VG0B 2QT0A 3AQ4A 4ZI2A 2CVFA 2FOLA 1GKIA 1R2QA 4B47A 2ZR7A 2H7VA 2ZREA 3NC1C 4PR0A 4JLVA 4XD7A 4Z1MD 1E3MA 4WZ6A 1OYYA 2JDIA 3U3JA 2IWHA 4JKYA 4M1TA 2YC2C 1RFLA 1HUQA 4PTLA 3OF5A 1DADA 1AIPA 4B6FA 5JWHA 5B2ZA 2P6RA 1W36D 4KJZA 5GADl 3CR8A 1LFDB 1IY0A 2P6NA 4DRZA 5K8IA 1V5WA 2XTMA 4DCVA 2O8BA 1HY3A 5CJPA 5F2EA 1M8PA 5DN6A 1G7RA 2E9SA 3PUWA 4UJ5A 3B7GA 4AYTA 4EPXA 4A92A 1ZIPA 2Z5FA 1EFTA 5L3SB 1MO5A 3EAQA 4TZ0A 4JT2A 4MYCA 2P2LA 2L0XA 5H70A 2HLDD 1A2KC 4U5XA 1H8ED 3C7KA 1DEKA 1MR3F 1UKYA 2WM9B 2HF9A 3IHWA 1D5CA 1G17A 1N6HA 3A1WA 2WOJA 2J9RA 2ZEJA 3PITA 1W5TA 1CKEA 3KKNA 3LW8A 1G9XA 2H57A 2FU5C 4AK9A 3CM0A 3QPVA 2OESA 1QRAA 4NDZA 1NMXA 2QE7A 3GFOA 4BASA 3QVUA 1S9DA 2C77A 4PANA 1AKYA 2C96A 2ZXUA 4IVPA 1XTSA 4YMVA 2Z4SA 3RS0A 3VR5A 4B2IA 1YRBA 3M0EA 1UPTA 4TT3A 2A5YB 1WCV1 2GK7A 1G5PA 1WMSA 4ZCIA 3K70B 2J0UA 1JBKA 4MGZR 3TSWA 2GAAA 4E07A 4B75A 4D25A 2R9VA 1L4YA 2FGKA 4AD8A 5EP1A 1YR9A 4G01B 1KNQA 4FWTA 1QVAA 2V55B 1GRNA 3CH5A 5KSYA 1Z22A 3L82B 3SJAA 1Y3AA 3BB1A 4JSTA 3AVPA 3LW7A 3SHWA 4BZPA 4TTPA 1PV4A 3M6AA 3ZQ6A 1X3SA 3ASYA 1F2UB 2VEDA 1KKLA 4Q7JB 2YNMA 3GLIB 3WXMA 1KI1A 4P33A 4RY2A 5KYKA 4P32A 3SJCA 1FP7A 2MSDB 1GSIA 2CMKA 2QG6A 4GZLA 2D7DA 2NQ2C 4DKXA 1PLLA 3D3QA 1II0A 2ZRGA 1MKYA 2CCJA 1KI9A 4Q03A 4NYIQ 3UATA 4NONA 2J3EA 1NBMA 5IK2A 3AKDA 4MGYR 3GLFB 1J99A 2OFOA 4HAYA 1MABB 1QHYA 2FWRA 5J4KA 3BS4A 1KI4A 2J59A 4H1UA 3QNUA 3ZJYA 4ACBA 2JASA 4MYHA 4V0LA 2IS6A 1M7GA 5DGXA 3CW2A 3BE4A 5C4GB 4KU4A 4IW3B 3MRSA 1DAKA 1KJWA 3K53A 4C0HA 1FMJA 2D06A 3LDAA 4MYTA 3WYFA 1W1WA 2D7CA 3AM1A 2QTVB 4MDEA 1WP9A 2C04A 1EFRA 2GDJA 1NMYA 1VCMA 1XD9A 3WRXC 2QSYA 1N3BA 1TQ2A 2GCNA 2OV2A 4BEBA 4M1WA 2YYZA 5FUWA 1W4RA 4G5GA 2F43B 3F8TA 1A82A 2PT7A 2WV9A 1OJLA 3RNLA 2DFKB 3DL0A 3CBQA 3BBPA 1B0UA 1UF9A 1T3HA 1YE8A 4EPTA 4YDSA 1KKMA 5TXGA 5DSZA 3F5FA 4KSBA 4TYNA 3FKSD 1P2UA 3MFYA 3KFVA 2J41A 4F93B 2C2HA 5KUTA 5JHHB 1VYTA 2ANBA 2ZRAA 3K9LA 1QHNA 2IW3A 3GLHB 1NN1A 2UKDA 1AS3A 5GJWC 5TY0A 2FZLA 1TX4B 1T0HB 3UPUA 3CLVA 1XMVA 4ERNA 4DSNA 2OFXA 4LPSA 1K5GA 1KYIA 1OF1A 5BW8A 4O2LA 1YQTA 3EPKA 1FX0B 1R4AA 1W4BA 4G5QA 2IEYA 2OEPA 4TMZA 3Q8XB 2CL0X 1JPNA 4B3GA 3RYTC 2GJKA 1SXJB 4B34A 2GA8A 3EC1A 4NE2A 5H68A 4NCHA 1F5NA 221PA 4QJ4A 1Z47A 3NVAA 5G53C 4MUAA 4A1FA 2ZM5A 3UK6A 1NLFA 1X8LA 2B92A 1GL9B 1YZGA 4D0LB 1NP6A 2RGBA 4FMCF 2ZJAA 3B9PA 2RMKA 1NLYA 1GNRA 2JJ2A 2ZU0C 1J90A 5AUNB 1QDEA 4BLRA 2WWYA 2FSFA 4PSKA 2QPOA 3I62A 1RVDA 1XWIA 3REGA 2Z0MA 421PA 5L3VA 1G18A 3W5IA 4XD7D 1O87A 2JDID 3RSOA 2MMCA 2GESA 1G6HA 2QUZA 3OIVA 4KSCA 3TSZA 1XTIA 3IILA 4TLBA 2YOGA 3K1JA 1QHHA 2ATXA 3BFVA 4UNSA 4V0KA 5M04A 4MRSA 5C1BA 2ASEA 1OT3A 1KAOA 1US8A 4B33A 4PQFA 4Q9KA 1GILA 4CEIB 4N3NA 3MWLA 4ZCMA 3N70A 4OK5A 1JNYA 2NIPA 4H1VA 1TUEA 2XOKA 3GEIA 4FMCB 1BYUA 1U99A 1PUJA 2JJ1A 1U2RA 2RCNA 4RD3A 4W5WA 3WNBA 3EZ9A 4MH0R 3T5GA 4AIIA 1ZD8A 3OIWA 2AN9A 5KNBA 4URZR 2GILA 4A2QA 5FUVA 2FA9A 3CUEF 3PV0A 4GSYA 2VRWA 3P27A 1QZXA 3ICQB 2GXAA 2ZI9A 4YC7A 1GUAA 1M6NA 1YVDA 1ZNWA 2ECKA 4C2UA 3I1FA 1XPUA 1GITA 2VF8A 1U9IA 5J5CA 4TTQA 1JAHA 3ZIAA 5BXQC 3QOFA 2OXRA 2EWWA 4LJ7A 2A9KA 3RANA 1EFHA 2WAYA 3R20A 4HZIA 4LHVA 3WYGA 1TQ4A 3L0OA 2RGNC 1EWRA 1KOFA 3ICEA 3B9QA 4AKHA 3WNCA 1P62B 5TDHA 3QXJA 5KDDA 4TT3D 3U5ZB 1T0JB 4AC9A 3VHLB 1OB5A 4W5HA 4DLUA 5LD2C 3Q9LA 1YHNA 2KE5A 5CYOA 5LBIA 2ZRHA 4JL6A 1CR1A 3SQWA 4URWR 1S0UA 1P4SA 3PQCA 4BZXA 5KSOA 4KV9A 3EWAA 4FMDF 5FBWB 4WXRA 4C0SA 5CYPA 3AEZA 4M0LA 4A8JA 5TMPA 1E9CA 1LVGA 1Z6YA 3FMFA 1N2CE 3EA0A 121PA 3D8BA 2HXSA 3ZVNA 3NEYA 4G0NA 2RB4A 1BS1A 1N25A 2WKPA 4JBXA 1GDDA 1J2JA 1VIAA 1E2HA 3REFA 1PLKA 5KO2A 3WYAA 1R0XA 3WBKA 4C2TA 4QOSA 1E0KA 1PZNA 1C4OA 2ZRKA 4Q00A 3W9YA 4LBZA 1OH8A 2BEJA 1XDBA 5DI3A 2FZ4A 3U7GA 1NBMD 3T1TA 3DM9B 1DAGA 5FOWA 3P20A 2UZIR 3CNLA 1N6PA 3C5HA 1IAQA 2ZITA 2RGGA 4DLXA 2C9YA 2RGAA 4UNPA 5EUMA 1CTQA 2XEXA 2O8EB 1XMSA 3MSXA 2WJJA 2IS1A 2FEOA 1N6OA 3LLMA 3U4QA 2ZS8A 1W2HA 4EQ6B 5JECA 4Y0VA 3ASZA 3AGQA 5FPYA 1DBSA 1OKKA 2I1QA 3DDCA 3IO3A 1RYFA 1VCIA 1AN0A 2NZJA 4DEYA 4JVSB 3SHFA 2EFEB 4N0EA 3SJZA 5IRCD 3BRWD 1ZINA 5IF9A 3RS2A 1F48A 1PUIA 1T6NA 2OT3B 4KBGA 1E2IA 5DIFA 3CNNA 4LY6A 2GTPA 5BN4A 4Q9IA 4KFRA 3IQWA 5F3WB 3PUZA 3GFPA 4Q4JA 2ANCA 3EA5A 2ZAMA 2HT1A 4Q4HA 3OAAA 4QHTA 4D26A 3PXGA 2GF0A 2TMKA 2BBOA 2QP9X 2ZYVX 1DO0A 1S3GA 1P2VA 4KFTA 2A5DA 3QPWA 3C16C 4KBFA 1GKYA 2DBYA 4L5BA 1W36C 4X8MA 1GP2A 2JLQA 2XJ9A 2ZVPX 3KXIA 4DIDA 1YR7A 3GJ6A 1ZM9A 3HU2A 2OBLA 3PEWA 1JR3E 4HDQB 3C14C 2OM2A 4M9QA 5KTYA 1FUKA 2JLVA 2NO6A 4NCKA 5FPTA 2V7QA 2Q9AA 3C4JA 1AGRA 1Z0IA 1F2TB 1E2FA 2R44A 4JL5A 2IUTA 2J45A 4LYFA 4WZAE 2IYZA 4B73A 1M2OB 3I73A 2OZEA 5DNYB 1RRGA 4HATA 1CJTC 5G3ZA 4BRUA 2ZYUX 4NHOA 3U3MA 3AGPA 2JJ2D 1JEEA 1XCMA 1WBBA 1J7KA 2R62A 3K09A 2D62A 1JEDA 1TF2A 1E2LA 4WA7A 3U7FB 1TNDA 4I1SA 4QNRA 5D3MA 1W47A 2ZR0A 1G5TA 1RRPA 5JFGA 5C18A 5FPSA 2VP6A 1SVIA 2QGNA 2NPFA 4CF7A 4J0QA 2FPKA 1G8PA 4I81A 3ETLA 3SYLA 1XU4A 1C1YA 3O8BA 4W5JA 1TU4A 1P6XA 1JQJC 2JLSA 1IBRA 1DG1G 3EZFA 2QENA 1P73A 721PA 4LJ5A 3WMFA 2OAQ1 3L0SA 1N6IA 2XOKD 2JJ1D 1WF3A 3ZD6A 1RYHA 4HEJA 2CBZA 2ZSAA 3C5CA 1AS2A 5B64A 3GLGE 2IYXA 3UMFA 3NXSA 1S8FA 2XTZA 3I32A 4IKEA 2V3CC 3TVDA 2B8WA 1OIWA 1E9SA 1EK0A 4D0NA 5ELXA 4IEIA 4ESHA 3ZLJA 2ERXA 2WAXA 1ETUA 3QXCA 4HZUA 1KO1A 1MV5A 2BM1A 3UG7A 5LB4A 4I1UA 4CEHA 3B2EA 2C5LA 3U7HB 1T9HA 3P32A 2GVDC 4US2R 3B6EA 1RW4A 4RFSA 3LO5A 3BH7A 4M8NE 2GXUA 3U3OA 4BFYA 2G0TA 3SFVA 5HPYB 1XCPA 1L4UA 1Z6AA 1KK2A 5J4LA 5CJ2A 1KZ7B 3KUCA 2P0EA 1D2NA 2J1LA 3LXRA 2ODEA 3ZVMA 4YQFA 2W83A 2WWGA 1IXRC 1LS6A 4GI7A 1N5IA 1GG2A 2ZRBA 3VNVA 3UXMA 2DHRA 1KJYA 3VU9B
chains in the Genus database with same CATH superfamily
1JS1X 1FL9A 1HA3A 1GWNA 2O1SA 2Q27A 3TQCA 2WD9A 1E8MA 5KTKA 1ZD4A 4AWAA 3WHIA 4ZU6X 1OZAA 4PX3A 4OQNA 3OY2A 3R7FA 4Y2PA 1PFYA 3LPDA 4FFSA 3G59A 1N2HA 2WNHA 3N7TA 4JYMA 2IOFK 1YIOA 2GZRA 3PC6A 4RF2A 2SICE 5DHRA 1OE0A 1YR1A 1E8DA 2W58A 2J3IA 1J0AA 2IEGA 3DL4A 2HA6A 3GDOA 1C7RA 5FOXA 4EHLA 3G2PA 4C3UA 3EEOA 5FPHA 1TAUA 3QGMA 4JB3A 1GOTA 1AX9A 1K9VF 2EARA 1N0WA 1EM6A 1SBNE 1K8RA 2D0OB 1Z5VA 2JGDA 3BF8A 1R5JA 3HVRA 3UZUA 3F5SA 2H7CA 3U3ZA 3AJ8A 1JR2A 1KDPA 4Q3NA 2MJLA 2TS1A 2A5GA 1QBKC 3AF3A 1C8KA 4HMOA 4MUGA 1GRRA 4JYBA 4OXKA 5FUYA 5I7AA 3WGUA 1TAGA 1XHFA 1YDWA 5JRZA 3KZXA 2ZANA 1C0LA 2YXEA 5AKHA 1ZUD1 1GNLA 1OLUA 4GX0A 1NVUQ 2HO5A 4XVQA 1ZZEA 5CM8B 3V1YA 5BMVB 3OJWA 1MD9A 3VZPA 1IONA 4LFCB 3L7YA 3GPIA 2XF8A 4N7BA 5K7SA 3GLVA 2Q5EA 3AZQA 3CGWA 3PJFA 1N7JA 1CR2A 4J0KA 5BN4B 4MVJI 1QX3A 4XUCA 1Z08A 5BSKA 5FTNA 4FQ5A 3EEQA 2CXUA 3HEBA 4C87A 5DU2A 4Q4HB 2DOKA 4EKIA 1I51A 3R9IA 3ZGOA 4CFYA 2PWAA 3OBIA 1JHRA 1PX2A 3ZLTA 1Q1NA 1E2DA 3O0DA 4IIDA 1WPRA 4RV5A 4O25A 1AZSC 5AOCA 1T24A 2AQKA 4EI9A 3OE1A 2PUVA 5FI3A 3AR2A 4WINA 2CL5A 3O75A 5HR5A 4OGLA 4TYWA 3CW9A 2Z09A 1ZD1A 2WJYA 2R1ZA 2XZTA 1N9KA 3GRZA 4B43A 4JLNA 2PKQP 4OHBA 4DJEC 3UBMA 2OENG 1HTBA 2ODPA 4KHZA 2GPBA 4NG4A 2D5IA 1NC3A 1DAMA 1PZFA 1R5BA 2RGUA 2YH2A 3EY4A 4TQUS 5HFAA 1E89A 2QAGA 1BVRA 3S2GA 3N05A 2OGWA 5JO0A 1RC8A 4ITUA 3NHLA 4NULA 2ZVQX 2C9MA 1CP3A 3O4RA 3TW0A 3KYCA 3RUHA 4MJ3A 5IN5A 5REQB 1RWWA 2FUEA 3NT2A 4QXMA 2VP4A 3JV7A 1P7WA 3L8ZA 3T7SA 4O1HA 3FJ1A 3QHQA 1C0KA 1YE3A 3BMQA 3MWDB 3R4CA 1AH2A 4W1SA 1SRRA 1LZLA 3EGXB 3WZ2A 4RZSA 4MARA 1WDTA 4BIMA 2YCLA 5WRFA 1YBVA 1BH2A 3PEEA 5IYZF 3TKLA 3SS8A 4RZ3A 2X13A 2J6CA 4H4CA 1ZI9A 2DX7A 4O4LB 4ZAWA 2FMTA 3D7NA 2QUHA 5LQSA 4QZVA 4ABTA 4TZ6A 1DXHA 2NT3A 2QLJA 2V6JA 1SEVA 4ZKEA 1O6GA 3UXHA 2G36A 2V7TA 1T8PA 2N42A 3IAS1 3V6LA 3ANLA 3M6MD 1B26A 3Q6IA 3LJKA 4XX0B 4CQLB 2BJWA 6NULA 3OOHA 4TMTA 2P5YA 2HJ9A 4YLEA 3M3HA 1HORA 4HVLA 4C7OB 1QZ3A 1ENOA 1TK2A 3HJFA 1FDOA 3GN1A 3I9FA 3LYAA 5J2TA 1VG8A 1W94A 5TR9A 1S9HA 1HURA 2QN8A 1R12A 5D2CA 1P6UA 1L5GB 2FPGA 3MTGA 2WMOB 2RHGB 1X38A 1CULC 2YZ2A 4B17A 1V25A 1OOEA 5A06A 2JD1A 1R7RA 5AH0A 1AT1A 2ECPA 2WILA 4K1LA 1A8PA 3CF4G 4OXIA 3GLGA 5IEJA 4YDQA 1NZDA 4TUYF 5H3LA 2IDJA 2QI9C 4GX1A 1G6Q1 3TYXA 4C2AA 5HZKA 1EU1A 1KMQA 1TMOA 4JX9A 4QBTA 3ROGA 4YLYA 2P1RA 2C5FA 4TL9A 3NBUA 1V7QA 3IV7A 4C05A 1HNZB 3I5YA 1ZUNA 5KTNA 3DO6A 4BTVA 2UXDB 1I7SB 3WKBA 4M83A 1RWBA 4A2WA 2PZFA 2E37A 4AJOA 4HJRA 5C51B 1YZUA 2PZKA 3C6MA 4PPGA 4Q3EA 3SVLA 4FWBA 4J1TC 5DLQC 2F55A 1G4AE 5TPZD 4S2UA 3GCWA 4FCWA 1RQPA 2H52A 3BERA 3TFQA 2ASVA 1VJRA 2HWWA 2X0FA 5DNEA 3PP8A 4ETWA 2VAVA 4H1HA 4U1RA 5C5EA 1CJUC 2IYUA 1KERA 3PFFA 1QHXA 4OOFA 3DOOA 3V4OA 3CW8X 2J3KA 3H86A 3HP7A 3K15A 4WL0A 2G04A 5AVZA 1P8JA 1DCKA 1EXMA 1QVRA 2ZCJA 2BV3A 1XN1A 2WZCA 4V1CB 4F9GA 3D6HA 4EFMA 1R88A 3ABOB 5J40A 1N5RA 3TN7A 1UK9A 4G0OA 1JHQA 3DUFA 3I0MA 2A14A 2IHZA 5AVUA 2YJTD 5AM4A 4AROA 2IS2A 3OIUA 3A7EA 1B6RA 5CPFA 5B1DA 4FYWA 1UQTA 3PJRA 1FNSA 2N1BA 2VDOB 1E99A 3ETDA 4EMBA 2XNDD 3IGFA 4QXQA 4CMHA 3L6OO 2NU7A 3I1IA 1Y3BE 4D9IA 1HKUA 1TZJA 4P08A 1A8UA 2BP7A 5EQJB 3KVRA 2A1UA 2NOAA 3R8XA 4EVSA 2C7QA 2JGDB 1A9ZA 2FWNA 4MA4A 3Q3HA 1EFCA 1C1DA 4BNMA 1U28A 4ND5A 4Y2XA 4L73A 3TQRA 1GPNA 2UZ1A 4H4DA 4G9EA 4JDPA 4Q9DA 4UAUA 4GXTA 4CM1A 3IJEB 4IXWA 4YXWA 5J4HA 4MAAA 5TF0A 1B8UA 1MN6A 2RK3A 5EJEA 4YR7A 5CIYA 4AQYB 2H17A 4IZIA 2RH8A 1ZITA 2J0SA 3DOIA 4CG2A 4UCQA 5KOHB 1ZXBA 5GPBA 3ZCTA 4W5OA 3CX6A 4OU4A 5ECWA 4BGUA 3D7KA 3W78A 4C21A 1RYMA 3GLRA 4G1BA 1Q21A 3VKGA 1YBFA 4IEFB 4J2TA 3UWSA 3TECE 1TCVA 3G2MA 1ID1A 4B3SB 5K6AC 5EKDA 3FKQA 1YUMA 4QUIA 1YRQA 3I8OA 3AL2A 1C0EA 1XF9A 4N40A 4EITA 3G3EA 3LL7A 4QRHA 3IQGX 1MEOA 2GQ0A 4FIZA 5EYPB 4BO6A 1C4XA 2VP5A 3TAHA 5EGNA 1OC2A 1Y5IA 1EGQA 5KWJA 3ANNA 1R6BX 4S1VA 1ZUIA 4PG4A 4TLLB 4ZZIA 4YB8A 1Z0AA 4DCPA 5BV0A 2D1YA 2R6R1 1B15A 4JLPA 4PSUA 3ULKA 2XCIA 3O73A 3H0CA 3VDRA 2H1WA 3H2BA 2PVPA 2G8NA 2Q50A 4QDJA 4XTCS 4YIHA 2RAPA 4F2WA 5KYYA 4JXJA 3KHUA 5T6BA 4CT4B 3EVFA 4NZYA 2HK9A 3LXUX 2CVHA 2FZEA 4ZZ3A 1QVZA 3NM4A 1GN9A 2XZPA 3KSMA 4P31A 4XWYA 4IXMA 4DCUA 5JVDA 4IYRA 4LEIA 5BOSA 2B4KA 3PLRA 4TLCA 3AM5A 1J06A 4RHUA 2OCGA 4YDRA 4ZAGA 2HH9A 3VVBA 1NVGA 4DPKA 2QQEA 3QKSB 2GUWA 4IRUB 4EJSA 3TOCA 1X92A 2C88A 4EB0A 2HQSA 1KJNA 2HTEA 3H7AA 3GQBA 5AJXA 1AS0A 3GVCA 4MV1A 3RR2A 3S2SA 2OFWA 3O8CA 1NDUA 3HDJA 3FCSB 1A2BA 3S8EA 1NJSA 1HLPA 3GQVA 1VHTA 1L1FA 4E11A 2AXNA 3E5RA 4R8RA 2XGOA 1K1EA 4DHEA 1PNVA 1RWVA 2VWQA 3DXXA 3ERCA 1N6RA 1SURA 2PX8A 4YJHB 2A92A 4JBWA 2PV7A 2E55A 5EWLA 1WXQA 3A1FA 4V2UA 5ALWA 4GYKA 4M0PA 4QJ3A 1O9HA 2YZKA 1SKQA 2PH3A 5KAPA 4B44A 4QPDA 3KL4A 3TF5A 3ROXA 1WBDA 1FDSA 1W0CA 4FN4A 3DW1X 5KU7A 3E1GA 4X6YA 2X2OA 5CM9C 2HBRA 4FX5A 1Z33A 4O0LA 4KQJA 3U39A 2FPGB 1G21E 4RIEA 4RU1A 3P0RA 3SS9X 3RIGA 2FK7A 2P7HA 2YVUA 1Z4LA 3ANYB 4G0ZA 5AWFC 3SICE 4P4TA 4X95A 1XJCA 1K5DA 1X7YA 5KPDA 3FTFA 3M9LA 2EX1A 3AH8A 3PU6A 3KEOA 4Q0MA 3UMVA 2AFVA 1SHTX 2YWGA 4QUHA 4TV9B 2XZLA 4UU7A 4JJIA 4DDHA 3B2NA 4H16A 3TOVA 4OVKA 4NEGA 1KPHA 4DEVA 1JHOA 1UXJA 4RL6A 5DHSA 4DMCA 4UE6A 1OMOA 1UIRA 4UTRA 5CB4F 2IUFA 3CWQA 4HNSA 1JAIA 3T1HB 4BVJA 1EDEA 4JLKA 1QYXA 3DZBA 3KKEA 4I6JA 5AJTA 3W6PA 4E0BA 1MEEA 2XGMA 3AEUB 1JZTA 3GHHA 4H15A 3TBHA 3N6XA 5A2QA 1DMSA 1XAIA 5DGHA 1IXYA 3VFDA 1QB7A 4J0FA 1RWPA 3ADDA 1XNQB 3O8RA 3GB9A 4MYUA 4N39A 1PR3A 5DWVA 2JAQA 4ZC1A 4D96A 5AW0A 1Z0ZA 3T4EA 1W44A 1KMHA 4FX2A 4RVCA 1SN7A 2PUWA 3QIAA 3H3JA 3EUAA 4A8JC 1E6EA 2F1KA 4PZCA 1LQTA 3TCNA 2O8BB 2H54A 2PEYA 1GGHA 4L75A 4RHFA 1CZUA 2CBXA 5ALQA 2QRJA 4PC2A 3MJCA 3M2TA 4WNYA 2VBFA 3OOJA 3ZHZA 4PYJA 3CPHA 4R0VA 3X1XA 4IHAA 2C4WA 4D8WA 2BEVB 3QE0A 2OPHA 1H6BA 1Q2UA 5JD6A 1W2GA 4I5GA 4IRXA 4BKMA 2CLHB 4NZNA 1UQUA 1W1IA 3DBOB 2WLSA 2GSDA 3S4YA 3PGVA 1L4BA 4B4UA 5DNAA 2WJ4A 1JZSA 2W6IA 1EK1A 1CY4A 2C0QA 2NV2B 3ZD8A 1YAJA 2QYSA 3T7TA 1UXIA 1YZYA 4RA6B 3WRYC 1PQUA 3Q15C 3EUFA 4F8YA 3INRA 3CPJB 1F60A 2DR3A 3HKEA 3WQRA 5P21A 1REQA 2A67A 2Y93A 3AMVA 5KYUB 1JEJA 3C8MA 4HDNA 3SZGA 4ESOA 1EGMB 4QASA 3ZXXA 4E21A 3FAKA 5UKDA 1X7XA 2QAJA 2XVZA 3N0TA 3WO1A 2GRUA 1SUIA 3IIMA 4CKWA 2R0QC 1S1CA 2GYYA 5G0SA 2GCPA 2DWOA 1XXHE 1R9JA 3HH8A 4RIGA 3ZZ0A 5KNBH 2XUZA 5KUTA 1E0SA 3TEJA 2I78A 3RGGA 2QKYA 4REMA 1ODJA 3UJDA 3K0CA 4XGNA 2P78A 1HSZA 2HUPA 4NFSA 5E1DA 5NULA 5K0BA 3AJAA 3N0WA 1RKQA 3JQ8A 5CLLA 1ORTA 4FD3A 3JR7A 1E9BA 3D4OA 2X2PA 3M82A 4BB0A 2A7QA 1SVWA 1QS0A 2WHRA 4LNAA 1QIJA 2GPNA 4UDNA 3VKVA 2PGXA 1KSJA 3H9CA 1JQEA 3IBCA 2H1HA 1XVIA 2Z4TA 3HB7A 4G0UA 1N3LA 3QFHA 2ADOA 5FA8A 3KCNA 3NDIA 2A33A 1I6KA 2PL5A 2M98A 5GOZA 4KXFB 1FFGA 1K8ZB 1VRVA 3R6LA 2V0CA 3ELDA 4D5EA 2R47A 2ZAGA 4WKOA 4YDHB 2Q5LA 3SI7A 1MX5A 1UWCA 1I0IA 2ZIVB 3DBIA 1EDDA 1XZ8A 4KOAA 5LDHA 3OMLA 3VO1A 2EBUA 4EL5A 1QQ7A 3O4IA 3HDTA 3KUUA 3IT0A 1IZ7A 3I6ZA 4UPDA 2PRYA 2VRBA 3KDSE 3QKRA 4FYHA 4GGPA 4Q39A 3PFBA 5HGXA 1IH8A 3AUKA 4LJSA 2EFCB 4XB1A 3TLCA 3DT6A 3ESDA 1C2YA 3MGGA 4PC7A 2CXOA 4YCBA 1T4GA 3QA3E 2PRZA 2BSAA 1OI7A 3ZWNA 4YJ3F 3B1FA 3RFVA 1NONA 4E4RA 1TB4A 1MJ5A 2AG1A 3DHWC 4MMXB 4E4YA 1LK0A 1Z15A 2OZKA 3AP3A 3O8OB 4JR1A 5IK2D 3EPLA 1E94E 1FYXA 4X7MA 3LS2A 4C14A 4M89A 5BSUA 3QELB 1ZJ6A 1UMBA 4MR7A 2HY7A 1O3YA 3FPSA 1KI2A 1KU0A 3FPAA 3HJNA 4HUQA 3RC3A 3W8FA 2B21A 3IQEA 1R5OA 1CUUA 3JQFC 3O90A 3BDVA 4GF5A 3DFIA 2I7CA 4JGGA 1G4HA 4IOMA 5LQCA 1KEEB 1J8FA 2OQ2A 1JKXA 3HDHA 2CXSA 4M4SA 3MGCA 3PSHA 4CCYB 4BECA 4CJXA 3WK5A 5KQRA 4U2KA 2X6TA 3UJCA 5LQUA 4CF5A 4V0SA 2IGTA 5JCPA 2IOFA 4F7WA 3K8OE 1EP9A 3E4CA 3MPOA 3I28A 4W99A 4QFBA 4JV5B 2I03A 2QQ0A 5K3CA 1M5UA 1U5CA 2B30A 4DA8A 3PR2B 2B1RA 3BFPA 3EK2A 1ZSVA 1YB1A 2AB0A 2XUQA 3AK4A 2AV6A 4NEQA 4UOQA 4YJ2B 3B36A 1AKEA 3E05A 4JSRA 4GOJA 3V6MA 1IRXA 1OTHA 4IDPA 4BX9A 3E9MA 4GXNA 3R7DA 1BFKA 2YX1A 2O4UX 1H69A 4GBMA 4RVDA 1X7YB 2JEOA 4B0OA 1I6WA 5L8VA 3BWBA 4HCJA 4Q19A 1P7VA 3LCCA 2IPLA 5A9SB 1IPFA 1DZIA 3THOA 5C53B 4BJ5A 1RRFA 1Y63A 1A27A 4IHJA 3SZ3A 1K5PA 1W93A 2ZT8A 3AJEA 1D07A 3UYKA 2O5EA 4F71A 4BQOA 3MAGA 1FXWF 4M0UA 3G1UA 3LNCA 5DM2A 5HG0A 1JTFA 1N3YA 1YA4A 2PBZA 2VPTA 4QDZA 5HMMA 5AVKA 1TO2E 2QY9A 4Z86A 4PG8A 1K27A 3PWSA 1KY3A 1UBTS 3P5BA 4O08A 5CVUA 2VJYA 2IYFA 4EUEA 2J0QA 2F00A 1B76A 2JZNA 3LT5A 2VH1A 2ONKA 3USCS 5IFKA 4NCNA 3UTDA 3GCXA 1AJEA 3P9NA 3BBLA 4F3CA 1B00A 2FQQA 5HJEA 3JAWA 1R5NA 3A1SA 1XNJA 3B52X 1MA0A 3C3JA 3FFBA 1C41A 1YZVA 2EX0A 2DPXA 1P2SA 3KSDO 4NNPA 1XKTA 2Q6VA 3RT9A 4EKDA 3QMMA 4BL5A 2FR1A 2PUDA 3WDKA 4TRMA 3WAGA 4ZMSA 2EFHB 1BQ3A 1Y9ZA 1YIAA 2YOHA 2Z3VA 3DMDA 3QTBA 4PWZA 1VECA 3URMA 1XEAA 3L7IA 4ZT7A 4JC5A 2VC2B 5LLDA 2Q8NA 2MSEB 1GNTA 4G9BA 1B2RA 4R9UC 4XYLA 1Z8NA 3DOUA 3W3AD 1NVXQ 1RAEA 1BWRA 1MO6A 4PZPA 4UASA 1CW2B 4M86A 4PWYA 4E1BA 5HSGA 3QI2A 4JDUA 3WP1B 4NV1A 5AHRA 1TJ4A 2Z5LA 2C4NA 1FTNA 1DQZA 2H00A 2K6GA 1AXGA 2H92A 5TIIA 1E0JA 3HFSA 4EPYA 5DGIA 4G8DA 1CG6A 1PQWA 1UBHS 2AK2A 5DRTA 3P0HA 2O6HA 3WYNA 2GUGA 3IH5A 3EEBA 4MVYA 4RD1A 3F96A 3RO7A 3VMFA 2QP3A 3FTEA 2H16A 2M32A 4HDNB 3PGXA 3VJKA 5AESA 3FX2A 4IHKA 2YQZA 1J49A 1P2DA 2AK3A 4PQRA 2JAHA 3BM5A 4S2EA 1X7XB 4K1XA 3ZGZA 4MUBA 4IKPA 4RDXA 4KVGA 1N2OA 5IBRA 2IV7A 3FCAA 2PL3A 4RTQA 4IIYA 1EVQA 5F12A 4CM9D 3A9TA 2V1UA 1VPLA 3IUBA 4PTZA 4LV6A 2YXLA 4LCEA 3S2EA 2ATEA 3WVNA 1Q19A 3I3OA 3HU3A 1KYZA 2Y71A 4RIFA 4Y2UA 5G4KA 3KZOA 3ZGYA 3CE9A 1K7EB 4XVHA 5CYFA 3LP8A 3PEFA 3LXXA 3QLJA 4V03A 4GOLD 4NE7A 5A4JA 4UBNA 3K30A 5B1SA 3MUFA 3TOSA 3V00A 3ZE6A 5DWQA 5CCDA 1H05A 2FFJA 4Z9BA 1J5XA 4OXNA 4JCCA 2R5WA 3HCBA 5A7FA 3U40A 4FCVA 5AW8A 3ZDXB 1MAUA 2BL4A 3JRWA 3N7AA 3DXFA 1SFRA 4QWMA 3ZVKA 5LQDA 3DE7X 3BVPA 1VI6A 2C5GA 5KX5A 2BR4A 3UAXA 4BGIA 3NI2A 3L7MA 1Y89A 3BCRA 3K6SB 2PLFA 3AFMA 3F7MA 4O2AA 4Z1MA 3QBDA 2QV0A 3SHOA 2AMLA 3C3DA 4YT2A 1J9GA 2R7AA 4ASUA 4BJ1A 4Z4GA 1XRLA 2QTLA 5L3RA 1P81A 2KB0A 4L5YA 3QMVA 4DRYA 4JFRA 2HIGA 4BLUA 3RVDA 1P9WA 5DHPA 1KL7A 3NWPA 3WGYA 4HDCA 1C9DB 2IYVA 3QKRB 5HJ7A 3C39A 2ATIA 1XDWA 1S4QA 2FZGA 1I0LA 1EBFA 2QAGC 2W4IA 3E3MA 5BQFA 3ESZA 4CQMA 4BTLA 4DJ5X 2C5AA 4G0WA 3KJFA 4DR6B 1Q16A 5DZSA 2I2AA 3PHJA 5I7VA 4GYJA 1A7JA 2XYHA 3DAGA 4Y2QA 3MWEB 3VSAA 3ZQUA 2ZUFA 1RQ2A 3B3GA 4H7FA 3E1SA 4DJFC 5BN3A 1RKBA 5CH5A 1LS1A 5H3HA 4U3JA 1T3GA 4YCMA 2HYIC 4HUQB 1C30B 1Y48E 3HYCA 3BIXA 4G5SA 5IBQA 2ZSDA 3DOJA 3OX2A 1K4KA 5E2IA 4FT4A 3RBZA 2Q2OA 4A10A 5IKPA 1OXVA 5LQAA 4U39A 4MLDA 1KO5A 1TQDA 2GZDA 2O07A 3QG5A 4J76A 4JI5B 3ZY6A 4DZTA 5LLTA 8AT1A 2R6JA 3MOIA 3Q3JB 3FHCB 3TKYA 2P9HA 2YVLA 4HBZA 3R76A 3OOSA 4OHCA 4X63A 1JKIA 2VDPB 3KQHA 5LQNA 1M7BA 1WXXA 4ZVPA 3HVJA 1DKOA 1WIWA 3HJTA 3PTZA 1N75A 3M6VA 2Y9MB 4KXNA 4QU8A 2YZGA 4ZO9A 5C46F 4XOIA 5AHKA 4I5FA 1JIUA 4AB1A 2FFBA 1JIQA 1ZJ5A 4IDOA 2G9RA 5FEUA 2BGKA 4JJFA 3OWOA 3T7KA 1PZXA 5IT9A 3ZVRA 1YB7A 5ERXA 3HCCA 4JB0A 4FCTA 3SR3A 3NUGA 1S2LA 4J1QA 5CUQA 4NKRA 4CYMA 3AVUA 2EKQA 3DE4X 1RHRA 5AMXA 1T9GS 3IP7A 2C3MA 4QGAA 1CIVA 1M34E 3AIIA 2R6DA 4WACA 4JELA 5KTSA 1RAAA 1V1JA 2II6A 2P9EA 3LDGA 1LB1B 3L1KA 4C4XA 2Z58A 1JWBB 3CRQA 4ZI7B 3HCPA 3UJBA 1FLNA 4L5CA 3HBNA 3UOAB 1U3TA 2UYHA 1FNCA 1KBQA 1V11A 3NH6A 1ACMA 1GYQA 2RB5A 4KQ2A 3TB4A 5B4UA 1MVOA 1E7SA 1W9MA 2X86A 4M1OA 4ZOCA 3LY7A 5HGJA 7REQB 3L8CA 4FONA 3TIFA 10MHA 3G82C 2CVQA 4IXDA 2AZTA 1XRQA 1V6SA 3KS9A 4WOJA 3GRVA 3ZXYA 1O6CA 2JLYA 1WULS 3OFKA 2DRIA 4N01A 2XMSA 1MU0A 1Q17A 2ZU6A 3HJAA 3Q9UA 4U7FA 5ANRB 1ADBA 3RS9A 4JBYA 5CGQB 5ALVA 1SM4A 2ZETA 2BPOA 4B81A 1O0BA 3VR6A 1GD1O 3BRQA 5ALIA 1PK9A 4HH1A 3S2ZA 2HQBA 2ZUVA 5KVSA 3GLIA 5JMOA 1T3SA 5HIJA 2Q3HA 4JNCA 1I7PA 1M8JA 4FI3F 4RW0A 3PEYA 1SD2A 4C3ZA 3VHXA 4MS3A 3OWXA 1TXGA 4CU5A 3R0JA 4O4IA 3MWYW 1NJ1A 1E2JA 1UOEA 2KM1A 2G17A 1AQLA 3MTDA 2CNBA 5BWOA 3O21A 1GQQA 3E3LA 1M8GA 5FL3A 3SJBA 4LBVA 5JI2E 3FYDA 2QSUA 2V5AA 4AO6A 3D8TA 1YJXA 4I46A 2AMYA 1RYBA 2JIMA 3IUYA 3RS8A 4MUXA 4YPVA 1P7PA 1CUAA 1JEQA 1QIGA 2JL1A 4DR5B 2Q3FA 2AFIE 4IUCS 621PA 4OO3A 1MF7A 1Q6ZA 1AV7A 1T6ZA 1TEHA 1Z16A 1YKGA 2VEOA 3CWCA 4XUDA 1H0KA 2QPAA 4DIMA 5ERGB 2PFKA 2PZGA 4IDHA 4LVOA 5C3UA 3NYQA 1G38A 3R74A 3WLAA 3I9OA 5G1NA 3UMMA 4EP1A 2PIAA 2HMYB 1U28C 3C3CA 3NGLA 2KPOA 3HM2A 2IUSA 4N8SA 2JCXA 1EIZA 1TU0A 2XAUA 2ZSIA 3IX7A 1KS9A 1XTVA 4H3KB 4FGJA 4GNKA 1W5FA 2Y8EA 3NEJA 3ZV6A 4BJHB 2IYLD 3H1EA 5G4KB 3SSMA 4PHHA 3ZKWB 2GKGA 5FWYA 2I9KA 3I5MA 3NBFA 2X8AA 4PBSA 4IG4A 3I76A 1Y5NA 4D42A 1VA4A 2DCUA 1JFFB 2IHBA 3JD0A 3HCAA 4M1EA 3MWFA 4HZUB 2C2GA 2PT5A 4I55A 4ZIRA 4JUFA 2YHIA 2H2DA 3DV9A 2VZ8A 1JLRA 3GLHA 4OP1A 3RG8A 3STTA 1L5VA 4XE5A 2AKAB 2JFZA 4LXQA 4S1NA 5KX5B 4YP5A 3TNJA 2WKWA 1J97A 1DC5A 5TX7A 2JCVA 3KT3A 3OO1A 2YNMC 3GLSA 4RFSB 1GGFA 3U13A 3INNA 4O2AB 1DTWA 4XJXA 4YAOA 1O94A 2PYIA 3QENA 4BKRA 1O58A 1T8RA 4AICA 1N2CB 1QTIA 2WUWE 5B3KA 3N58A 3L40A 2XMZA 2V45A 1I36A 2HRRA 1KA9H 2I4LA 3PTLA 3JARB 5FBZA 3CV3A 4C0QC 1FS4A 3T7IA 4BVLA 2XDQA 1KWKA 4LZZA 4RY0A 1U98A 3ND7A 1CUHA 1XO1A 4N0MA 4ARAA 4JOBA 4CQMB 3DE1X 1FDRA 1JLKA 1DRKA 4HN2A 3ACBA 2W90A 3NYWA 3FAZA 3Q6NA 4BWYA 4RABA 1NBEA 4RGBA 4X1IA 3IQFA 5CDFE 1L4NA 5BNIA 3PB3A 1CRQA 1QFZA 2GCOB 3CUWA 4EYGA 1NVMB 5HRCA 4EZBA 5D51S 2IP1A 4EJSC 1A5TA 3OZVA 2EXXA 4MVJE 4LGYA 3V55A 5H9WA 1S01A 1G19A 3HXTA 3CO5A 4E4TA 4NQZA 4YS6A 1N33B 1NUTA 2PXHA 4WIAA 4CKCA 3COZA 3ZDAA 1ZYUA 1JEYA 1D2AA 2AQIA 3G8CA 4L4UA 4NFHA 3OY7A 2H51A 4MKXA 1NW8A 4MQUA 4RV4A 2PUBA 3SLKA 2GCEA 2O8NA 2V9PA 5HQJA 1EWQA 1QRRA 4J7UA 1W96A 1ZS9A 1LBHA 1XYGA 2EV9A 5F1KA 3QX3A 2PKEA 1JHXA 1Z0DA 5JCJA 2BFAA 4WZBA 2BI8A 4PX2A 1GIAA 3U7EB 3UUWA 1VE7A 3AR7A 4LJKA 2HADA 1JF8A 3BGVA 1OFHA 4OYHA 1FBTA 1SCUB 4F2PA 2ZR9A 3LBAA 3RUIA 1WD5A 5AM5A 1JAYA 1BW9A 4QUGA 1N5JA 2PT6A 4UTXA 3T5DA 4MYSA 2IV3A 2UZ3A 3UWOA 1J8DA 1D4OA 4BYMA 4YCSA 2VJMA 5DV9A 5G3YA 4INZA 2JNWA 4TMVA 2BMEA 3FTDA 2A9PA 3NBQA 3U44B 1UFRA 1ZN2A 3E8XA 2C9BA 1TF7A 1YL6A 4M9RA 1H2FA 2Q4BA 2WFZA 5ADVA 1CY0A 1YK1A 2XDAA 1F0KA 4N7MA 3S1AB 3EDQA 3VNAA 2LNDA 2XGSA 4WT7A 1SXHA 2IVZA 4RHYA 4OYYA 1F8YA 4L51A 2XA9A 3CJQA 2NO0A 3B3JA 4US0R 2JJQA 3RVMA 1JU3A 4RELA 3GP5A 2ISCA 3SYNA 3V1KA 4AZ0A 3D64A 4YRDA 5IWAB 4KAFA 4UMFA 5GJBA 4AJHA 3X2FA 3IAFA 4JP8A 4EI2A 4KVZA 4R1TA 1E1CB 1KZ9A 1R8XA 3WGJA 3FWNA 3GH3A 4G56A 4QATA 5D7BA 1OB2A 1WXEA 4H08A 2ZRQA 2JJ8A 3LHKA 3FNIA 2DKNA 4Q16A 2RARA 3NS7A 1ZXXA 1YGPA 5IVPA 3T9CA 4PPQA 5AJYA 2PR2A 1BKSB 4I3HA 3U4CA 4DCJA 1CS0A 1K86A 1L7OA 2WJAA 3FA2A 4HB3A 3RRYA 2FRDA 4UXHA 4JVLA 3JD2A 3ZZ1A 3M3PA 3SS7X 3KSZO 3PE4A 1UC5B 1X1TA 3I09A 3EDYA 3F90A 5CTAA 3A0RB 3F6PA 3RVKA 2PS1A 3IUSA 4HN4B 3HP4A 1G5IA 5J59A 2VJPA 1D1SA 5MN6A 1IL0A 1JSRA 4LBYA 1JDVA 4BC0A 1RWMA 1UXOA 5A4AA 2AI1A 4GE0A 5ERYA 4UCFA 2NZWA 2GAOA 1YKFA 5MF6A 2VHEA 1XHEA 1DOAA 2QX4A 2WTAA 2CY0A 5CT4A 4YQZA 2BN4A 2P77A 3EGIA 1R64A 4N3BA 4EDHA 4LNUB 1VMDA 2AXQA 4DDVA 1BCSB 1BX1A 1T6YA 3HVKA 3HWSA 3JQQA 4MIYA 4WXMA 3TNYA 1M0SA 1BMFA 4I8IA 5G41A 3FVVA 7GPBA 5CA0A 4ETNA 3EOAI 3VC2A 4FXOA 1GGEA 4WEOA 4KLZA 4XFKA 1ZY2A 1FFXA 3PCTA 4JQZA 3T7JA 2BBTA 2BFEB 3BICA 4INPA 5I01A 5JYBA 2J33A 1GDHA 3O4VA 4IMPA 5CVCA 1DG3A 3T5BA 2Z2ZA 5FTLA 1RE0A 2RK4A 3O47A 4ZQHA 3Q7TA 3LQ2A 3TSOA 3HB1A 3MC1A 4KQCA 3HKCA 1DGQA 1LPMA 3RT1A 2GYWA 4FYYA 2QPLA 3P8ZA 5JOQA 1M2GA 4OQPA 4X62B 2JA1A 5EFOA 4D0RA 4EQ6A 1ZEMA 1IFXA 1ZGCA 2Q1TA 1LC3A 3A6GA 3EASA 3B38A 3HMKA 2VJQA 3BGDA 4QFCA 1I3MA 3ILXA 3QF4A 2IXAA 4N65A 3S27A 1CUIA 1P0CA 1XZDA 5DM4A 1K0FA 1SVKA 3BH6A 4OTZA 2ZYSA 1VKOA 2O7SA 3FWPA 2FG6C 3IODA 3OEED 4J4HA 3U56A 1E9DA 1BWPA 4I55B 2A5JA 3K0CC 1NV8A 4E09A 4RGQA 4ZIRB 3LCVB 4FKBA 2EGUA 4V1CI 1P74A 1OROA 3IAUA 4F6RB 2QEQA 1XKXA 1WSWA 3PRJA 1OIXA 4PPFA 2FJ0A 3LQQA 4PHFA 2C2OA 1YJQA 1IAVA 1PO7A 5IG2A 4V39A 2PWBA 1ST2A 3PGLA 2AOXA 3FLAA 2PH1A 1SA0B 4CM4B 1J21A 4IGIA 4K9KA 2CVOA 4MR8B 1M76A 2YR0A 3IDOA 4M54A 3HTXA 1UZNA 5DWDA 1OZ0A 2HAEA 2OC9A 3SZRA 4BMPB 2EAUA 5INTA 1RZ3A 3NP9A 1A5AB 3P4XA 3FETA 3U9SA 2I55A 5B6IA 1S89A 3CT4A 1TW3A 3GMSA 3KX2A 3LLCA 5DEIA 3PC3A 4Q3DA 1ZGJA 4RJIA 5BNZA 1GPMA 4MNTA 2F3TA 2OFFA 3SXUB 4OBEA 2JBAA 1E2PA 1MO4A 2ZS9A 3F71A 3JCZA 3A36A 2YFQA 3PEUA 1SQ5A 2BVNA 4MW2A 4UFNA 5CGZA 1BS9A 2G5GX 1GQFA 4U8GA 2HCJB 3JXEA 4V0ME 4YRBA 1RYYA 3ABQB 5JQWA 1KQ3A 2CVPA 4QOHA 4YX9A 2OBBA 4EEKA 1WB6A 4Y1RA 4JI2B 3U48A 5IXSA 3BWCA 4MI6A 5L4NA 1H0HA 3D3WA 1N34B 3E5HA 1FNNA 3DKRA 4CKCB 2WP0A 3NONA 3WY9A 4B3XA 3NOQA 5K0GA 2J9GA 2G88A 1NMEA 3V7UA 3AQIA 1Q1EA 3DCNA 3AVVA 3ICWA 3LG2A 4TYYA 4OXXA 1NP7A 1E1RD 1Z37A 2EJCA 4NMHA 1WMFA 2CLFB 1G3RA 2CXTA 1JG6A 1EH5A 2HHCA 2NO4A 3F9IA 4TL7A 3B6JA 4B3FX 2IFTA 4UUAA 4E1AA 5ALXA 4EFLA 4G1UC 5F21A 1E7MA 1Z4KA 2CFIA 2FW0A 3IVCA 2CB9A 1TJ5A 4REOA 4DQKA 5F51A 4DVJA 1XDSA 1AQUA 1JHPA 1T5OA 3RSZA 1FYDA 4ZAZA 1UAAA 2V0GA 2NSDA 2O0KA 5FOUA 2DBZA 1BW9B 1FFBA 5IVDA 2I22A 3AEQB 1QK3A 4WCFA 4XWWA 1N0VC 1NLZA 2RKWA 3DR5A 3M6UA 1XWWA 2D2EA 3GL9A 4FIDA 2ZB3A 2A58A 1NYRA 1GG9A 2PLWA 4NZZA 4GP7A 1ECLA 4GR5A 1IXKA 2I3GA 4E03A 2H1SA 3B78A 2FEMA 3TFWA 5DN9A 3WDSA 3UV6A 1X1RA 4P98A 5LWHA 4QAJA 5AVTA 3LPLA 4L4XA 3MINA 4LPKA 3S55A 1ZN8A 2CLKB 4KN8A 4I1VA 1C14A 3HHEA 5AOBA 3SX4A 2BBSA 3R40A 4FHEA 4A4DA 3MGKA 4Z2AA 1ESMA 4AZ0B 1JB1A 3NHSA 4BTEA 4OMUA 2AD5A 1OXMA 4F04A 3TBKA 2BMFA 3O3CA 1TTTA 5KSWB 2BFBA 5I3CA 2CNWA 3AHCA 3UHOA 4MRRA 1S7CA 4CUKA 1OHHA 1ISIA 2JFHA 1J2YA 1SVUA 3LDUA 3ZCSA 3FR7A 2FUKA 1BMDA 4KQ6A 1BNCA 4M21A 1EM8B 1N8NA 2EL7A 2OTCA 2AOUA 2ID9A 4XDZA 2J46A 3U9TA 5HXAA 5HIMA 4ZV4A 3FBTA 1DS6A 1ZK3A 4OK6A 5JSHA 1VYVA 1B8PA 1T8SA 3VPXA 4CM8A 1Z4JA 4LOIA 5KWVA 5DYTA 3S7TA 3NMUF 1RJ9B 2NM0A 2PRJA 2PR7A 3NWOA 3QJGA 3IV9A 3P9QA 2PBRA 1FPQA 3Q7IA 3SM3A 4URYR 5LPNA 2XGJA 1YR6A 1BD3A 3RRMA 1SZPA 3OPYA 1IRIA 3DC2A 2CLIB 3BD7A 3IUPA 2QTWB 5AQEA 1IG3A 4E7OA 4XPIA 5CA0B 4H6PA 3ZI0A 4HGNA 2DHQA 4FFMA 3MQ2A 4GLLA 3GAMA 2HU8A 4CG3A 3K96A 3IR5A 3S2FA 5CIQA 3QX9A 4RACA 4Y30A 3ONEA 3PHGA 3SZOA 5ALLA 3HKCB 1X14A 3UJ9A 4D4KA 4C4PA 3FSRA 3HR7A 2GJ9A 2P30A 3H5TA 4A0FA 4BXOA 5ILGA 3BA1A 3G0DA 1KO4A 2Q1XA 4G23A 3FMGA 2PJUA