3BJRA

Crystal structure of a putative carboxylesterase (lp_1002) from lactobacillus plantarum wcfs1 at 2.09 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
267
structure length
244
Chain Sequence
b'FQGMQVIKQKLTATCAQLTGYLHTNLPAIIIVPGGSYTHIPVAQAESLAMAFAGHGYQAFYLEYTLLTDQQPLGLAPVLDLGRAVNLLRQHAAEWHIDPQQITPAGFSVGGHIVALYNDYWATRVATELNVTPAMLKPNNVVLGYPVISPLLGFTWTPTPNELAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATALATAKIPYELHVFKHGPHGLALANAQTAWKVAHWLTLALEWLADNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative carboxylesterase
molecule tags Hydrolase
source organism Lactobacillus plantarum wcfs1
publication title Crystal structure of putative carboxylesterase (NP_784706.1) from Lactobacillus plantarum at 2.09 A resolution
rcsb
total genus 73
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bjrA00
2Y6VA 4D9JA 5JALA 1WM1A 1CV2A 5CXUA 3JW8A 3IUQA 3WL6A 4C87A 3AJAA 1EINA 4BZZA 4Y7DA 1QTIA 5CW2A 5LP1A 3LS2A 4ZI5A 1LGYA 4L0CA 1S8OA 2FUKA 4YK7A 1VE6A 1VJ5A 1ETHA 4X91A 2H7YA 2XQJA 2I3ZA 3NOXA 4ZWNA 3W9UA 4B0OA 1QJ4A 3O0DA 3A6ZA 4BAZA 1IMJA 2XMRA 3DS8A 1SCQA 4Y2QA 3D5EA 1T2NA 3G8YA 3R3ZA 1QIMA 1DT5A 1MTZA 4M0FA 1PFQA 1QOZA 2DR0A 1XZDA 4BRSA 3MGAA 1Z68A 4X85A 2OCKA 1CLEA 1MJ5A 3QPCA 4QDZA 4Y2JA 1AUOA 2C4HA 4LXIA 5T4HA 2BCEA 1Q0ZA 1BEEA 3GELA 4H7FA 4BC1A 2WIFA 4RGYA 5K3CA 5DWDA 1WB4A 3WKBA 1XZBA 2ONCA 2I03A 4OPMA 3LIPA 1JU4A 4CIBA 3A70A 2WJ3A 2XMZA 4HS9A 5D7BA 2QVBA 2G63A 1CUAA 5FPQA 2ZJ6A 4BYMA 4J0KA 1UK9A 1LNSA 4DMCA 1JU3A 5ALWA 2XUOA 4NVRA 5DTJA 2QRUA 2PSDA 5AI6A 1LPSA 1BRTA 5SYNA 3EQ9A 5LZ7A 1CUHA 5AJHA 5C8ZA 1R4ZA 5LZ8A 2GYVA 3I2FA 4BATA 1WHTA 3OTQA 4MWTA 1QFMA 4X00A 1BU8A 1H23A 1IZ7A 5C81A 2DCMA 1XZMA 5HQ3B 3STYA 1LPNA 4Y2TA 4P9NA 1CUVA 4DYHA 1THGA 2XUKA 3AZQA 3H1BA 3ZLTA 4Y2UA 3IURA 3D0KA 2JGLA 5LZ2A 3FNBA 2GZRA 2JGJA 3WQHA 5ALOA 3AZOA 4UBJA 2GBCA 3ESCA 3WKEA 2HFJA 3DNMA 1X2BA 5SYMA 2VT7A 5K3AA 4E14A 5DYWA 2V97A 1CUBA 3DL7A 2EEPA 2HU7A 4X97A 3DKRA 5CT5A 2WIDA 1BCRA 1QIDA 4CCWA 5HKAA 2D0DA 4E15A 2HA4A 2PX6A 1ZJ5A 2Z5GA 3TGLA 4FFWA 2XMSA 3N2ZB 2JGMA 1J07A 1H2YA 3H2KA 4UBKA 1F8UA 3R41A 3WA7A 1K5PA 1DX6A 4GWLA 4DNOA 3FSGD 3WL5A 3QITA 3F96A 1CQZA 4AO8A 4IHAA 2BGRA 3OG9A 1N1MA 1IUNA 4GHWA 4UBMA 4KE7A 4H77A 2R8BA 2FJPA 3KDAA 3PFBA 1D07A 4UBLA 1EXWA 1Q83A 4BCDA 2QOEA 4MQLA 3K2IA 5ALTA 2C58A 2D5LA 2IX9A 2RGUA 1XKLA 3S2ZA 1DT3A 3BIXA 2BGNA 3V1LA 1QIGA 1EHYA 3WKDA 4KACA 1ORVA 2ZYIA 3R3XA 1IVYA 4IH1A 3KSRA 3ICWA 4NS4A 1CUJA 2HRRA 2YH2A 3H17A 1TKRA 4O08A 1CUUA 1C4XA 4G5XA 4J0HA 2G5TA 1F0PA 5E2IA 1XQWA 3VKFA 4Q34A 1H2WA 3C87A 1XRNA 1Y37A 1QLWA 4H18A 4ITVA 4J0DA 1FFBA 4B80A 1A8UA 4UFPA 5ALXA 3C5WP 3CN7A 4Y9SA 1L7AA 7YASA 4AZ3A 3KWFA 2B20A 2QUAA 4AO6A 1XROA 2XUFA 1AC5A 4ZRDA 2ZSHA 1Q0RA 4XWGA 5IVKA 1IZ8A 4U2BA 4B83A 2J4CA 3L1JA 3IVMA 5CH5A 4GI1A 4YPVA 3HRHA 2GZSA 1UKAA 1JJIA 4KRYA 1VA5A 4I3FA 1UOQA 5LYYA 4NMWA 2BJHA 4I4CA 5HQ3A 5AOAA 1NU6A 3K9BA 3HEAA 2W6CX 1E8NA 3LCRA 3V48A 1O6FA 4H35A 5AKYA 1O6GA 1GQSA 2DHEA 1AMNA 2XLCA 4W1RA 4OYYA 2V98A 1XRMA 3PDCA 4FLMA 4IH4A 4MXDA 3RK4A 1QIHA 5KWIA 1QIFA 2XE4A 3F8SA 4TVKA 4FWBA 5AM2A 1AURA 1NX9A 3AIKA 5AI0A 3CCBA 3BDVA 5BV7A 3BF8A 5JZSA 4KE6A 4DMHA 4X95A 4UBNA 3WWOA 1WPXA 3H0CA 1YSCA 1YAJA 4W63A 3DJYA 3OC0A 3QYJA 4K6HA 3D4LA 3U0VA 1N8SA 1JI3A 3KXPA 3DLTA 1H22A 5KREA 4OSEA 1LBSA 3H19A 5HF5A 1JT2A 2IIVA 5CTAA 5ALLA 4BAUA 3WZMA 4LYEA 2GYUA 2HDWA 1CUYA 3FAKA 2XQFA 1XRRA 1XZCA 3D7RA 1RYYA 3WK4A 4WFKA 4C6HA 1LPMA 4GXNA 4KE9A 3DDUA 1MX1A 1ISPA 4OB6A 1CUGA 4X71A 3NGMA 5CBKA 5A71A 2VSQA 4EBBA 1G4HA 3PUHA 3KD2A 4HTAA 3HZOA 3PICA 4KJXA 3KOOA 3M3DA 3DQZA 1H2XA 1HQDA 1T4MA 4KAJA 1UFOA 5HCUA 1JJBA 2WHPB 5AM3A 3BJRA 1LPOA 4GECA 4C4YA 1HL7A 4Y2PA 2VT6A 3HYSA 2Z3ZA 1MAHA 3DYVA 2QM0A 2EDCA 4XVCA 2WKWA 1CUXA 1W52X 4GDMA 3H1AA 1QIIA 1UK6A 1DWQA 3H2JA 2X76A 3I2HA 4QE3A 4UPDA 1CIJA 1XQXA 5K3FA 1AGYA 1R50A 4MEBA 4EY6A 1DINA 4X6XA 3PFCA 3ZI7A 5CMLA 3D2BA 2PUHA 4TGLA 3IA2A 4EA6A 4FNGA 1YCDA 1XZFA 3FYUB 1YR2A 4EY8A 3E3AA 2LIPA 1SC9A 3HC7A 3V9AA 1JKMA 4DM7A 2JEYA 5HFNA 2HHAA 5AH0A 4FLFA 5JZBA 3VJMA 3AIOA 4H7DA 2J3QA 5D6OA 2FJ0A 3HXKA 3C8HA 3D2AA 4EHBA 1ODSA 4ZREA 4DIUA 2QZPA 3C5VA 1GQRA 1BE0A 4FKBA 2HL6A 2C0QA 5AK4A 5T4FA 5K3DA 1Q84A 5HF8A 2HA7A 3BXPA 1AKNA 2WU3A 5AKKA 1U8EA 2CZQA 1F6WA 3ZLUA 3Q8WA 1FFCA 4A5SA 4X7BA 2XMBA 5ALKA 5EIHA 3HI4A 3DKKA 3WK6A 1XZJA 5HF9A 3QZUA 1ORWA 1G66A 4DNPA 3PI6A 2YXPX 1QO9A 5A7GA 5C8XA 1OCEA 1CR6A 4KAFA 4E11A 4J0CA 3FCYA 1TIBA 4AMZA 3QM1A 3QPDA 1CUSA 4WFJA 2VA9A 4CCYA 1K8QA 2CB9A 1BCSA 1WB6A 4C89A 1QFSA 3OPMA 2XQGA 1VLQA 3WKCA 1HLGA 4S0XA 5EHZA 4BC0A 4QWMA 2JGKA 4P08A 2HA6A 4UHHA 3G0BA 1CPYA 3SK0A 3VXKA 2XUHA 5ALVA 1MX5A 5C7YA 4Y2VA 3A2NA 3I6ZA 5FV4A 2WG0A 4CI9A 2XUAA 4WY5A 5C8VA 4G4GA 1YASA 2JIDA 3O4IA 2QXUA 4FBLA 4RE6A 2VAXA 3CCCA 4B84A 5IVDA 4K6GA 1YB7A 4FNMA 5ALPA 1P0IA 1R3DA 5DNWA 4C88A 1TAHA 4HRXA 1E66A 2C7BA 5DYTA 3I6YA 2CEKA 2AJ8A 5I7UA 5KBYA 1LZKA 3ANTA 2ECFA 5AKJA 4G8CA 2OCIA 4YASA 3G02A 3EBLA 2ZYRA 1Y7HA 4H0CA 3AFIA 4U2FA 5AHXA 2WFMA 3DL4A 5A62A 3FLBA 4JYPA 2WIKA 4FTWA 4QDTA 3B3QA 1USWA 5JD5A 3WWPA 1XLVA 4W1QA 2Q0XA 4C4XA 2PM8A 5AK6A 2H1IA 5A7HA 3X3HA 1R1DA 1CUEA 5AM4A 1LPAB 4LXHA 1B41A 1CUIA 3FLEA 4FLEA 4QLOA 1XZKA 1U65A 2WIJA 4JEIA 5ALGA 1A8SA 3L1HA 2XUIA 1QIEA 2XQIA 4B9AA 2O2GA 4BVKA 2H7XA 4X94A 2PU5A 3RKSA 4AX4A 4M0EA 4W1SA 5IKXA 3QBJA 3QMMA 4UFOA 2RAUA 4LKOA 4PSCA 2PKYX 2RHWA 4BE9A 2HM7A 2XI4A 2DHCA 2O2HA 3G9XA 1LPPA 4QDUA 3BL8A 5BWCA 3W06A 1Y7IA 3WL8A 3UUFA 3R3UA 5EIEA 2EDAA 2WG2A 3E4DA 3O4JA 3MVEA 4IO0A 4EUSA 5K3EA 3M83A 2O2IA 1MNAA 1UZAA 5AOBA 4G8BA 2ACKA 5CT4A 2IITA 3AINA 2VQ6A 4KAAA 3C6BA 3GA7A 4PSDA 4ZV9A 2OXEA 4L9AA 1KEZA 2HA3A 4DSZA 4QDXA 5AKGA 1E8MA 3TJMA 2PPLA 3B5EA 3VISA 3BIWA 4HXEB 4MWSA 2Y1KA 5AKIA 3DYIA 3IUNA 5DNVA 2DHDA 1ZD3A 2WILA 2OLEA 4B85A 4F60A 2K2QB 3G9TA 3K6KA 2JEZA 1P0PA 2XMGA 1GPLA 1ODCA 4ZGBA 4J03A 2PSFA 1AX9A 1QZ3A 4OU5A 5JZ9A 5IVHA 3EF3A 5KWJA 2BKLA 4F21A 4U2GA 3IDAA 4Q3KA 5LKRA 3FLAA 5AKXA 2VEOA 4Y2RA 1WOMA 3R3VA 1ZIXA 5H3HA 1UOPA 2OGZA 1DX4A 4TPKA 2HA2A 4WY8A 3G0IA 5AM5A 3H18A 3HACA 1B6GA 1U4NA 4MEAA 2WUEA 2P8SA 4NZZA 1GGVA 2PSHA 1WHSA 4X3CA 4B6GA 2QXTA 2B4KA 5ALJA 3G0CA 2H9YA 4K2AA 2VF2A 3SWWA 2QT9A 4ARBA 3AIMA 4BCCA 4JUIA 1XZIA 5JADA 4BVLA 1DQZA 4L72A 3CN9A 1XLWA 2XQKA 3GUUA 1VE7A 1DWOA 2HA5A 5A6VA 1IUPA 1U2EA 4EB0A 1I6WA 4YX9A 3WIOA 2CBGA 3W9BA 4WJLA 4U2EA 3HABA 3EIOA 5J3JA 1XQYA 4FMPA 2XMDA 2BUAA 2V9ZA 1ZIYA 1LLFA 3LLCA 1UKBA 4CFSA 4G1FA 5T4BA 3LIIA 2QR5A 3D3NA 1WCYA 2RIPA 3BE8A 4UHEA 3ZPXA 3HLKA 5ALDA 1ZI6A 2GYWA 4UBIA 1HPLA 2W22A 5HFAA 4MJ3A 2NW6A 4QDOA 3QMVA 1CUDA 4XIIA 4E46A 3MUOA 5FLKA 1YA8A 3DOHA 3TRDA 1WB5A 3WYNA 5FXMA 1XLUA 4GBGA 4BTLA 1ZI9A 3C6YA 4BTVA 4DLNA 5I8PA 1TK3A 5AP9A 5D3ZA 2DQZA 1UKCA 3G0GA 3G0DA 1CRLA 4Y2YA 5ALZA 4N8EA 2RHTA 3W04A 2I78A 4PO3X 1E3QA 3YASA 4N5IX 1RP1A 4M0MA 1EA5A 5FDFA 1MU0A 4BAGA 2AJBA 4Q3OA 4Y2XA 2PSJA 3RARA 5I9IA 2HU5A 1EDDA 1JMYA 1MN6A 4B82A 1W76A 4RNCA 2VJBA 3EQ8A 4BDTA 1RWQA 4KEAA 1UK8A 3AILA 5ALNA 5ALYA 5LZ4A 3VVLA 5ALHA 2ACEA 5JARA 1GKLA 4JH0A 3MUNA 1ZGBA 1DTEA 3FVTA 4ARAA 2YYSA 2VJDA 3H2GA 4CG3A 4EY5A 3IUJA 2XMCA 2B61A 4KR0A 2QS9A 3VDXA 1OXMA 1DQYA 3O9VA 4U2DA 2OGSA 1SCKA 1TCCA 4J0GA 5FOQA 3Q0TA 3R40A 2YASA 5AICA 4AO7A 2XLBA 1VZ3A 2OPHA 4QWWA 5CRIA 5EIAA 2C5GA 4J7AA 1KU6A 4Q1VA 1GXSA 4HVTA 3W05A 1MAAA 5AI4A 4IH9A 1P0MA 5A2GA 3P2MA 4ROTA 4XJVA 1BN6A 3M82A 2JGFA 3QVMA 3RM3A 1X2EA 4EY7A 4FFVA 4H7KA 1L7QA 3FSGA 4X6UA 2WTMA 5ALFA 2Z8ZA 2UZ0A 1ZD4A 5FPPA 2HIHA 4ETWA 5K5EA 4G4JA 5AK3A 3WZLA 4KRXA 1R88A 1EX9A 1J2EA 1EDBA 2C0PA 1K4YA 5HK9A 3C8DA 3E0XA 4AQDA 3STWA 1THTA 4XX1A 2PVSA 4F5ZA 1K63A 5LLSA 3I2GA 3G7NA 3C6ZA 4LXGA 3U1TA 3NWOA 4BB0A 3ESDA 1R9MA 1HBJA 5K3FB 4PNZA 1W1IA 1BEZA 4QA9A 5DTIA 3SC2A 1YB6A 5CT9A 2PBLA 3O9MA 3N0TA 1VOTA 4P93A 2J3DA 2H7CA 2WUFA 5DJ5A 1MT3A 1ZD2P 1ZGCA 5JYCA 4BP9A 2WU4A 3ESAA 2WJ6A 2WTNA 4Q82A 3D2CA 1EVEA 3A2MA 3JWEA 3T52A 1K6EA 2OGTA 3O95A 3ED1A 4UHFA 5AOCA 4PW0A 3SX4A 2OAGA 1QTRA 5BWBA 1DWPA 1TCBA 2JF0A 5JAOA 1XZAA 3C6XA 2RI6A 1M33A 4AN0A 5AIBA 5CXXA 2HU8A 1L7RA 1C7IA 1FSSA 4DSAA 4V2IA 4INZA 2XB6A 2WUDA 3I2KA 4KYVA 4IQ4A 3FYUA 1TRHA 1KU0A 4PQEA 3F67A 5EGNA 2JBWA 3ZLVA 3DEAA 1E89A 4C01A 4X6YA 5YASA 4PF1A 3WKAA 5EHQA 1MX9A 2XUPA 2AJLI 3HSSA 1MPXA 4N8DA 2WFLB 3IULA 2VJAA 4AN1A 4OU4A 3DOIA 4OCZA 1MO2A 4MYSA 2X8BA 3I2JA 4FOLA 1A88A 3ESBA 3OURA 2XUQA 3STUA 4GW3A 2BUBA 1WPRA 3VVMA 1XZEA 3WL7A 1CQWA 5AI9A 2WQZA 3FBWA 5E4JA 2WFZA 5ALUA 1UXOA 2ORYA 1EB8A 2AXEA 4L3WA 1VXRA 1E8DA 2VATA 4I19A 3TEJA 5HK8A 5EFZA 1XZLA 3R3YA 2XMQA 1GPKA 5A7FA 5JD6A 2ZJ7A 5LKAA 3JYHA 3STTA 1UOOA 1JFRA 1UK7A 1N5MA 2HADA 2VJCA 1QE3A 1BS9A 3WYDA 2HFKA 1GT6A 5IH7A 1LZLA 4A16A 5HF6A 4U2CA 5E4TA 4FHZA 3BJMA 1XRLA 1CUZA 2Z3WA 3FWHA 4ZXFA 5CH8A 2XDWA 2QUBA 5DYYA 5E4YA 3G9ZA 4Q05A 3WWDA 3ANSA 1GZ7A 4Z49A 5CT6A 3FVRA 3ZV7A 4AZ0A 1XRQA 3IUMA 1OILA 4K6KA 3CXUA 5ALMA 3V1KA 1EI9A 1UT6A 3BDIA 3WIBA 5ESRA 3L1IA 2Y6UA 4HAIA 4RE5A 1J1IA 4EY4A 3I6MA 2QTBA 4HXGA 1EB9A 2XUDA 5JAHA 1ACJA 1J06A 4DNFA 3RLIA 3FYUC 5JD4A 2WG1A 3WK9A 2G4LA 4JYMA 1VZ2A 4HXFB 3DD5A 5FUMA 2BAGA 1QIJA 4LYDA 2OQIA 1QO7A 3PE6A 3W2TA 5AM1A 4RPCA 3T4UA 3I28A 2XUJA 4A23A 1N5RA 2ZSIA 1EK1A 5ALEA 4F0JA 4MQMA 2AJCA 2O7RA 4H7EA 1ZI8A 3PF8A 3O4GA 5HZGA 1G5FA 3WI7A 3PF9A 4H7IA 2JGIA 4AB1A 5CURA 1UWCA 1QONA 2BFNA 2CUTA 3H2HA 1EDEA 4CG1A 3QPAA 4N8SA 5LZ5A 5AKLA 3WWCA 3S8YA 5CT8A 5AI5A 4G9GA 2PSEA 5FKJA 5JASA 4UHBA 4B9EA 3H2IA 4BDSA 3PUIA 3AZPA 2WUGA 3FYTA 4UHDA 4PV7A 1VKHA 5F4ZA 3O4HA 2WIGA 5JIBA 4OB7A 3OM8A 4UFNA 4H7HA 1SFRA 1CEXA 3ICVA 2C5FA 4HRYA 4K5QA 1VA4A 1GKKA 1BN7A 1TQHA 4ZV7A 2WHQA 4G4IA 4WFIA 1E5TA 3F98A 1YA4A 4BE4A 3ZWQA 4G8DA 4FDMA 5AKZA 5DNUA 1HKHA 2XT0A 4H7JA 5K3BA 3E1GA 5LIPA 2GBGA 4UHCA 1TCAA 4QLAA 4W9RA 4J3JA 5EHXA 1GPNA 5T4EA 5AK5A 1ZOIA 1PV1A 3ILSA 1ZD5A 1DU4A 2WFLA 5JAPA 1W75A 1R9NA 1ODTC 1HDEA 4UBOA 1W6RA 3BF7A 5IVIA 5FRDA 2Y2UA 2ZYSA 2PL5A 2ZYHA 4GEGA 1C7JA 1YAHA 2E3JA 5AIAA 1EH5A 3GROA 3A2LA 1FJ2A 5ALSA 2PU7A 1FFDA 3EQ7A 4BCBA 5AM0A 2R11A 4CIAA 1ACLA 3WJ1A 2WHPA 4C4ZA 1JMKC 3WMRA 4WDRA 4QNNA 2OG1A 2XUGA 4DMKA 1LPBB 2CMFA 5ALRA 5JATA 1FFAA 2QMQA 4DNQA 4DTCA 1EVQA 2QJWA 3C43A 2PUJA 4Q3LA 2CKMA 2BUCA 3WK8A 4B0PA 1ZJ4A 1AZWA 1X70A 2CJPA 3NUZA 3WA6A 3D59A 2RONA 3IIIA 3QH4A 2GBFA 2X5XA 4BRZA 5EI5A 2WSLA 3G9UA 3C70A 3GZJA 3IB3A 3FOBA 1XZHA 4J0JA 3KWJA 3H04A 4PSUA 2WLSA 2WHRA 2ZVDA 1A7UA 2ES4A 2GBIA 3IBTA 5BOVA 4EZIA 2Z8XA 2ROQA 3WK5A 5LZ9A 5AI8A 5D3KA 1XKTA 1LBTA 1SOMA 1CVLA 4GLBA 1IUOA 3B12A 4X92A 5JAUA 1EK2A 3HJUA 3I1IA 3STVA 2DSNA 4BVJA 3BWXA 4OD0A 2J4FA 4W1PA 3QMWA 2B9VA 3M81A 1CUFA 1FFEA 2OCGA 2JGEA 2OQVA 4CCYB 2AJDA 5ISMA 4J0IA 1W4LA 4Y2SA 3GFFA 2OAEA 1XFDA 1A8QA 2G5PA 3I1YA 3V1MA 3F97A 1YS2X 5CH3A 2O7VA 2VAVA 4CG2A 4MYDA 4KE8A 1AQLA 4B81A 1P0QA 4DGQA 4G9EA 4B7ZA 5AO9A 4BBZA 1CFJA 3DCNA 3LP5A 2HA0A 3VJLA 4QZVA 4FBMA 5AKHA 1F0NA 3OOSA 5AKEA 1XZGA 2HRQA 4OUKX 3R3WA 3WLAA 1XQVA 3R0VA 4JNCA 2FX5A 1VXOA 2ZJFA 2Y2VA 4P92A 4AMYA 2OCLA 3WWEA 4N5HX 1PJAA 4OYLA 1NU8A 5JANA 3WJ2A 5ALIA 3STXA 1QGED 2VTVA 3F9CA 2WM2A 6YASA 2V96A 1CUWA 4UUQA 5DLPA 1YS1X 3UUEA 3UMJA 1H2ZA 4X90A 4BZWA 5HKBA 1G42A 5FP0A 1ZICA 4HZGA 2QKYA 2DQYA 2QJRA 1JJFA 4QEKA 4LHEA 1QIKA 3AUKA 4LIPD 2DFPA 1XRPA 4WDQA 5ALQA 3VJKA 3I2IA 3C45A 1CUCA 1SCIA 5EHNA 2WJ4A 4AXBA 4WCVA 4OB8A 4DMFA 3FCXA 3GBSA 2I3DA 3V1NA 4X93A 3WK7A 1MNQA 1BROA 4BP8A
chains in the Genus database with same CATH superfamily
2A9QA 3CURA 4CM4B 3GN1A 1GILA 4BL5A 4DL9A 1OKKA 4XJTA 5JALA 4RM2A 1ZIOA 3KHTA 4LE0A 2Q4DA 3T5DA 2AVDA 2KQUA 5CXUA 4V0NA 3Q5DA 3QQ5A 4IV5A 4AZ3B 1J8YF 1O5TA 3FPHA 3DLPX 1II8B 3HZHA 4CCAA 4KQIA 5K3OA 1ZGGA 1YU6A 1R5BA 4LZOA 4IX1A 3T06B 1DL5A 4Z7NB 5IKPA 1Y8ZA 4LJ7A 5FNVF 4IICA 1QOQB 2GK4A 2DBVO 4Z1MD 5F78A 2QX9A 1EZ4A 3NANA 1SKUA 1G3QA 4CKZA 5JI2E 5IM4F 2DETA 5DEOA 5HBGA 1ZHOA 2IBSA 2PRIA 1IU9A 1ENPA 4MYUA 4YRLA 1F2TA 3A14A 1USKA 1CE8B 4L0CA 1S8OA 1V5WA 4G4SO 4NU0A 3TQRA 3UICA 1E92A 4CM5A 3WGVA 4YK7A 1ZH0A 1BYUA 2B4AA 2ZYDA 2WB4A 3Q3IA 2GQ0A 5D85A 4RENA 1VJ5A 2ZUBA 5IAAA 1TX4B 3USZA 1ZOLA 3B2EA 4YDHB 3LUCA 1CJCA 1JF8A 3AI2A 1GADO 4W9NA 5KPDA 1IN6A 3ROFA 1JJVA 2PRSA 4QECA 1U63A 2WMNB 4IJ5A 1EFDN 3RV3A 4I46A 5EAIA 2IYOA 3VZQA 3ZYZA 2WF6A 3ESRA 1DXOA 2R48A 3GA5A 3KB6A 1EVYA 3VR5D 1ZHHA 4Q16A 3F2VA 1IBRA 4LOLA 1EP9A 3NATA 5L9AA 2HT1A 3G8YA 1QCCA 3R3ZA 4N4AA 5D7NA 4CQLA 4ZXFA 1C8BA 2FH5B 2W37A 1OZHA 1PFQA 3L6OO 1HYQA 1Q7BA 2ZRNA 2DR0A 3FRIA 4JIMA 1GL7A 3KUXA 4JU8A 1XZDA 2C5BA 3BQ9A 4D57A 3KJQA 4HQKA 1ZMOA 3LBIA 3MGAA 4DBLE 3D0QA 3DR5A 4JY7A 3E2PA 2AXNA 3OFSA 3QOYA 1S2DA 3U4CA 1AVTA 2EATA 2X9LA 4X85A 4Y6SA 2VHEA 3EGDB 4RVGA 5K05A 4N48A 4M1WA 4NHOA 1L4HA 4YRBA 2VYCA 4OXRA 4MNTA 5C5IA 1RE1A 1K0FA 2C4HA 4LXIA 1AK9A 2BCEA 2QP4A 1YBFA 2Q4OA 4YROA 3A4IA 4JP8A 3SG0A 1Y6FA 4J94A 1OWMA 3LWNA 4DADA 3KVNA 3NBZC 1L4UA 3OE7A 4H7FA 4NEQA 3WAKA 5HBRA 1QYIA 1L3BA 2PCJA 1RPZA 4Q7QA 4EHAA 2WIFA 2YCBA 5CVCA 2PA3A 3MMXA 4RGYA 5DWDA 3VDNB 3TNLA 2CWDA 4PAGA 4U7JA 3HBMA 1GL3A 1ZC4A 1KO7A 1VC2A 5EMJA 3A6LA 1T5SA 4JVMA 3UXYA 1P8AA 1XQ1A 4OPMA 1Y1RA 3OF3A 1YUMA 2J5XA 1EJ2A 3FY4A 4LFAB 2QX6A 1J8QA 2BEJA 2GK7A 1AS3A 5AJVB 1U28A 2A1UA 2QW0X 4OEHA 3RUIA 3C2QA 4DWJA 5FH9A 3D81A 1CUAA 5FADA 2OZVA 5E6RA 2VP4A 1MOSA 3FPLA 3PUJA 2CVQA 4GPD1 1VLLA 1I4TD 3FX2A 2C3OA 3FB1A 4DMCA 3GLGE 1E94E 2FX3A 4AZSA 1GV0A 1IAVA 2J6IA 3FDZB 3R2JA 2OCDA 3GLIB 1T91A 1UMCA 2BRUC 3TD9A 5ALWA 5WRFA 3D1LA 2AQHA 3KB2A 4ZCQA 4NVRA 3WOHA 2JLCA 3A9SA 1I5OA 1G55A 4QOIA 4XWAA 3BA1A 4JIGA 5AHRA 4U6QA 4W5RA 4DUGD 2GEFA 3MTIA 4I3HA 5AJTA 1JG4A 5AI6A 1JEAA 2HNBA 1LPSA 5K0LA 3E7DA 4H6VA 3KJFA 1GPUA 1U2GC 4PQFA 3RWOA 5CCEA 5IJZA 4MPRA 4KVZA 3DFZA 4DW8A 3T4PA 1G8YA 1GAWA 4AJ4A 1XIVA 3FNGA 3NRJA 5BURA 5ADWA 5HM8A 5LNK1 5KB3A 2VOJA 1E1QA 1DDIA 2P9ZA 4D0NA 4BV9A 3F3MA 4Q9HA 1R4ZA 2WM9B 2OFFA 3E22B 4PBTA 5ANRB 3UF0A 4M0DA 3LX6A 3ROMA 3OTQA 4Q7EA 1P6QA 1FX1A 3KFVA 4FKMA 1Z4MA 4HGOA 4XR4A 2JK1A 4YRFA 4B1FA 4H6WA 5JH7A 3IAM1 1Z5OA 2DWUA 3OHPA 4OK3A 3B82A 2WJWA 4Q4AB 1JEDA 3D6UA 4EP1A 3GLFA 1OTHA 2NNWB 5IMBA 4HDMB 1MV5A 4M8KA 4TSFA 1GJRA 3QVSA 2NZYA 3CLSD 1SUCA 5JDCC 3KKMA 5BSFA 5HQ3B 5FWYB 2J5QA 1DRJA 1OA1A 4XGRA 3M8KA 4OX9B 3OFNA 2ECOA 3UN1A 4DYHA 2YCLA 4ZARA 2W4QA 4G0ZA 1GWNA 5LQJA 2Q0QA 4RV5A 2BHRA 2X8JB 2VKTA 1T9GR 2I9PA 2JGLA 2GPSA 1NONA 3D0KA 3NJ4A 3D7KA 2Q9UA 4N0DA 3FNBA 3TD2A 1ZGJA 3OM0A 4BV8A 4NP6A 2AXQA 3KVYA 4WLUA 3VNAA 4JROA 3NIFB 4MVYA 5ALOA 3ERCA 4TQGA 4UBJA 2IHVA 3NAMA 3TH5A 2OC9A 8ABPA 3BWEA 1GCUA 1HKUA 4B7UA 2VHVA 1JHMA 2HFJA 3KPYA 3JS5A 2WKRA 4TVBA 3GGCA 1K86A 1CNMA 1JKFA 1OE0A 2VT7A 4OREX 4HATA 4HSGA 1KHHA 3N6RA 1D0SA 2BGTA 2QRHA 3AF3A 2QRVB 4JR0A 1DKNA 1TMGE 3K94A 3VI3B 1U9CA 2ZYGA 2V97A 1TVMA 3L4JA 1TK9A 4IFBA 4G0UA 4MI6A 3F2IA 5JLJA 5J1SB 1K3UB 3JR7A 4RA6A 4E51A 2D59A 5EIXA 2BFCA 1OZ0A 1TJNA 2IL1A 2PWPA 2WIDA 2G7MC 5JAZA 4Q00A 4GZ5A 1WXEA 1DC5A 4D97A 2QTMA 4HADA 5FA5A 1BJRE 1ZJ5A 3AVVA 4ND8A 4BBPA 2ONKA 4CM9A 3L3BA 3TGLA 1LVUA 2ZBUA 2FN4A 5TVKA 4CQNA 2HCRA 3BICA 1ZH4A 2BMAA 4NYMQ 4KR2A 1JYSA 3T7RA 4TLEA 2JGMA 1VL1A 3G5UA 4Z54A 3W8RA 2B25A 3WSTA 4RO0A 3S70A 4H17A 4L8LA 4DNOA 2IXFA 3R0XA 4KMOA 1L5QA 3WG9A 4JXZA 3ITNA 3DEYX 4WMLA 4I9FA 1XPOA 4RTLA 5I7WA 2C5AA 1IUNA 2G06A 1EFPA 2H2FA 3FI0A 4NCBA 1B7GO 4RMGA 2PL3A 3RR2A 4IGKA 4H77A 3PFBA 3RAJA 1AA6A 3PGXA 2VZEA 4MAFA 4WN9A 2O14A 1YJCA 4U00A 3GLHA 3RUHA 1L5KA 3A6HA 4OHUA 1I2ZA 3UJCA 3V5NA 5F9FA 3G2JA 4OKIA 1JKIA 2FPIB 1JQLB 1L5HB 2GJ9A 1XDWA 2B69A 4G1VA 2COKA 1T4GA 1E2IA 1UANA 4PIPA 4F5DA 3GLGA 2GHTA 3CF4G 1AUVA 2NQ8A 1S2GA 5BUZA 1PWHA 1VLZA 2RGUA 3TJZA 4A8JC 2HPVA 4MQEB 1T26A 2AFHA 2I1LA 1LLUA 1G6OA 5IJAA 1EHYA 2H07A 4R41A 1O9HA 3WKDA 2FN7A 2ODTX 5A4KA 3R3XA 2EIHA 3FGOA 5REQB 3SQNA 1YJAA 3TR0A 2XCLA 2XOKD 4E4RA 3N6XA 3GIWA 4MPDA 5KJFA 3W7AA 2BFAA 3KSAC 1GV1A 1Z22A 2P79A 3GUYA 2YH2A 1W46A 1YZUA 4FYKA 2B1JA 3AO0B 5JDCA 2BFBA 5IJWA 3HCDA 1FJXA 4YYZA 2JKYA 2V65A 2EVWX 1WR8A 3AM5A 1Y6ZA 5JMTA 1OWOA 4DMGA 3PL1A 1BA2A 2NZXA 3OLCX 5CHYA 5E9JA 6CHYA 4ENRA 3K4PA 4PYOA 1E0SA 5DV9A 2O2XA 3TB6A 1O6BA 2EAUA 3GK3A 4AG3A 2C2WA 2C95A 3EZ7A 4XYMA 1L1QA 4TV9B 3E6AA 4XASA 3Q7RA 4J0DA 3VR0A 1HFKA 5BUCA 1RPTA 4RCVA 2CLEB 5EWJA 4UFPA 4MYHA 4TMFA 3DSRA 3KQMA 2O8VA 1W88B 3T9BA 3G3EA 5U4XA 1SQFA 1ZMXA 1JZTA 3CN7A 3PD7A 4UUPA 1F8FA 2QN1A 1WKVA 3OEHD 1L7VC 1KJZA 2VL7A 3H4VA 3HWRA 3DBVO 1YC2A 3ORFA 4YO7A 5HMLA 3DE4X 4PO9A 4CQLB 4QHYA 3AESA 3HA2A 2Y93A 1XROA 2SCUB 2XUFA 5J2UB 5AW2A 4FWIB 4W7HA 1UP7A 1F6BA 3OZDA 2VWPA 4BGVA 4F45A 1YONA 5JEDA 3EDQA 4HQRA 1S9DA 4XWGA 5K8CA 4QHSA 3U7GA 5F7XA 4ECAA 1QQBA 4CMIB 3L1JA 2O57A 4KRGA 4QM7A 4OKNA 4I8DA 1JH9A 2EKPA 1XVUA 2IYXA 4LVUA 2XZLA 1UPXA 4O2BF 4GI3A 4GI7A 4LA4A 5EMNA 5A3VA 3K9FC 3MJCA 1JJIA 4MTLA 4PTLA 4R31A 1ZX1A 1IDOA 4I3FA 1K6JA 4AAYA 1PJ2A 1OX5A 3C3MA 4B48A 4EJFA 1P4AA 2BJHA 3CISA 4I4CA 4U1RA 3BWYA 4Y1EA 3TRKA 3U49A 2PGAA 3K9BA 4EJ6A 1E8NA 2GAIA 3LCRA 4GXQA 2ZIZA 1WF6A 2I3BA 1BRMA 4I4TA 1O6FA 2WF5A 3CVOA 3Q1KA 5FOWA 1M1UA 4NDAA 4II3A 4HB2A 4I1VA 2OV2A 4L7VA 4RKYA 2FPKA 1KHTA 1SVIA 2V6FA 1IN1A 3VTAA 1JAZA 1XTQA 2UV8A 3D4PA 4IDNA 4I6JA 3UMSA 1AUQA 1AMNA 2XLCA 1SK9A 4RH3A 1WZIA 2AK2A 4NECA 1BD4A 2O2DA 1EGAA 2QMOA 2RAPA 3KKQA 2A9JA 2VNSA 5JWHA 3T9EA 3TSYA 2Y71A 1JDSA 1J25A 3PDCA 4DPLA 3EGDA 1Z0KA 3M4NA 1FZQA 4IFEA 1C4OA 4Z8XA 2EFEB 5KNCA 1XK7A 4ND4A 4C0AC 4M4SA 2UXCB 1N2JA 3LGAA 2WVJA 3SYNA 3ZVKA 3KT3A 2R8OA 3RADC 4TVKA 3RVDA 1M7GA 3FW1A 4UUOA 1H4SA 2PZEA 2PBZA 1NX9A 3AIKA 5AI0A 2CZGA 3CCBA 4XTCS 2BF7A 3BF8A 4RV4A 5K3SA 3S99A 5IK2D 5JZSA 5ED4A 2FY8A 2HQOA 4H1UA 4BIIA 2CN1A 4AKHA 1Z8DA 2UYOA 1XN1A 1DBWA 5CX1A 4YB8A 2CXNA 1UP6A 5ICGA 4E6EA 1H4TA 5CGQB 3UNXA 5EE9A 3BSYA 5BMVB 1DO8A 1RNLA 3S7TA 1JLHA 3WWOA 1YSCA 3V8BA 1YAJA 2JHAA 4E6PA 5ITZB 1PCXA 3JZMA 5JW6A 1IY0A 1P7WA 2ZP1A 4W63A 3VGPA 4B4DA 4FR2A 4E4TA 4QHTA 3FWPA 5C34B 4K1XA 3FZEA 1TKCA 4RSHA 1Q5PA 2A1UB 1WZNA 3U0VA 4AJ9A 5K0BA 1N8SA 1UMDB 1YMQA 1TU3A 5LOVA 2IEBA 1JQAA 4S2EA 2EERA 1OT3A 3FCCA 5E0OA 3QU4A 1DTWB 3RD5A 4MPPA 2A6PA 1ODIA 3MERA 1H22A 3BX1A 4FILA 4WBXC 5KREA 2EFHB 5J58A 2VF7A 1WP4A 3SHWA 2G0AA 3OESA 2VCYA 3H19A 1EFRD 1T0JB 3NAZA 1BJKA 2C83A 5EJGA 4EB3A 1L9XA 3ZXIA 1CT9A 2IIVA 4DUPA 4BNHA 2PAFA 3WZMA 2GYUA 4QELA 5BN3A 4V03A 5M29A 1R74A 3MMPA 2AW3A 2AFIE 3GNSA 5JQGF 1COWD 1XRRA 2WF8A 1E20A 4PLPA 5ES4B 2JCXA 4FB4A 1OYWA 1TF7A 4EARA 5JJLA 4C6HA 4XVUA 2GPAA 4YWHA 1G8PA 1SKYE 4GXNA 3KQQA 1DJNA 2VWGA 1ITZA 3FSEA 4CM3A 4Y9RA 3U3ZA 5CBKA 5FPYA 2BZ0A 1UBLS 4OHBA 4L57A 3PS9A 2H29A 4YRKA 5C1PA 5LLTA 3BRSA 3RHSA 1JJ7A 2DFVA 2AG5A 1QO0A 3L6BA 2VUHB 1G4HA 4K9KA 3FUUA 4DQDA 3Q10A 1XT6A 2YWCA 3JQAB 2WB2A 3ENNA 3ML1A 4HTAA 2A9RA 4RTRA 5F9HA 1MZVA 1RRGA 1SZDA 2FETA 1ZMBA 2C4UA 4QUJA 3QVOA 1D1PA 3VPXA 1H2XA 4FS3A 2ZULA 2EQAA 4BO0A 1Q17A 1HQDA 2B7LA 4EVQA 2NYVA 5TT1A 4RD1A 1UFOA 1W29A 2BPOA 5HCUA 5KAMA 1JJBA 1Q3KA 2B4YA 4L5IA 2IXGA 3W3AD 3BJRA 2ZE6A 4DV1B 2VNIA 1T8WA 4DXHA 3P97A 3M2TA 4DLZA 1J0EA 1JHVA 2H1LA 1RHRA 3E7XA 2CMKA 3Q3VA 4IG9A 3KQKA 1R8QA 2WTAA 1HL7A 4Y2PA 3W79A 3I83A 4S12A 2V0GA 2VKQA 2ZWAA 2Z3ZA 2HZBA 5EP4A 1N9GB 4BX8A 2NIPA 1S96A 2BGWA 1DC7A 2DF8A 5JNUA 2VEDA 3AR3A 4LJAA 1NF2A 1OGJA 4L78A 3AU9A 4XVCA 2WKWA 1ECGA 1CUXA 1I9CA 1VJGA 4MA0A 5MF6A 2UYQA 3L0BA 3C16C 1L1FA 3GFOA 4IIXA 4MARA 4CL2A 5AW7A 5BSEA 1E2DA 1TZKA 1U7TA 2Z43A 4P3OA 1NVWQ 3GAMA 4HSEA 4QE3A 1ECFA 1S2LA 3NM4A 4G1CA 4R1UA 1LDBA 3OJFA 5KQRA 1KO8A 2I8AA 5JEEA 3W3AH 4ADSG 1M1YE 1KGSA 1UBSB 2ZJYA 3PQ2A 4RL4A 1R50A 1P7YA 2XYPA 3C97A 4L8YA 3OO0A 4DIMA 4JT4A 5EG5A 4BNXA 3L07A 4ZAVA 4XW2A 1AKRA 4MEBA 1JU9A 1ZVQA 2OBYA 2X15A 4MYCA 4EY6A 3UCXA 3EWAA 1OFUX 5K8JB 4NAUA 3VO8A 1YQGA 3C3CA 4YJ3F 1JQBA 1KI8A 1PR1A 2C9BA 2PUHA 2P4EA 2RGNC 3EEBA 3L7DA 4FNGA 4N3GA 1YCDA 2GPYA 4XLZA 4F06A 4TZ0A 1TEVA 2O3QA 1C9JA 1YR2A 4UEQA 5LU9A 2E49A 1U3CA 1F7UA 5DW3A 4QO8A 4F9EA 4IV0A 1M8FA 2AC4A 3NTUA 4MICA 3HUTA 4OATA 4DM7A 5CA0F 1ABFA 3BGWA 3N87A 4JJGA 5DZSA 5HFNA 4EYOA 3KWLA 2B36A 3DCIA 5AH0A 1OGYA 5DNCA 4FXOA 2NP7A 3TMYA 5B5SA 3VJMA 1E9DA 1PR5A 3MBOA 4LHYA 5I4IA 1E99A 3SP1A 3THRA 5ITVA 2FJ0A 4L07A 4W5QA 3C8HA 4PPQA 4D79A 4ERXA 2XF8A 1RC1A 3W78A 5JHGB 3WSWA 3BSSA 1ODSA 3AQIA 2YWEA 1DV2A 1T3HA 4YS6A 4HDRB 3D0RA 1J2JA 4LTNA 3C5VA 4ZTBA 3L0SA 3S2FA 4DIUA 2V4MA 3JASB 3L02A 4KZPA 3L1KA 3MC1A 1QB7A 3CLKA 4OJTA 5T4FA 3MWDA 5TQ0A 3OIWA 1NKTA 1Y4AE 3N9IA 1OWNA 1XXHA 5EJAA 5K3DA 3X1DA 4BJ3A 3DL2A 1A9XA 2C8LA 5HF8A 1NPYA 2ZW9A 4UJ5A 1DEXA 2WU3A 3EVTA 4YJFA 5AMXA 2ZIEA 4JVLA 2QB5A 3QX7A 1YRHA 1PT5A 3KYDB 2WQ7A 3V1YA 1WY5A 1E3EA 1AF4A 3R7WA 1O8CA 2WWYA 1KNQA 1JHDA 3O2NA 3MWEB 1J39A 2GS9A 2JJ1A 1X1SA 2XMBA 5J4HA 4ZAZA 2XEXA 5BW4A 4PR3A 2QL6A 3PDIA 3TVTA 3ZHRA 4B7CA 1KYYA 3GUCA 4YI5A 3M4YA 3MS7A 3T7EA 4MV9A 1IATA 3GFRA 3I45A 4DBLC 1MORA 1VKZA 3CWZA 3E8XA 5FR1A 5A9SA 1HEYA 3JSAA 3SM9A 3WISA 1XZJA 5J5VA 3QZUA 3UWDA 1G66A 2I7CA 1UIRA 1CDDA 4BQEA 3UH0A 5JZOA 4DIOA 1I1QB 1BWSA 4WKPA 1GN9A 1C7RA 5A7GA 5IT0A 3AJEA 5E8JA 1A77A 2J0VA 4QUKA 5DF1A 1G21E 3H2ZA 4QFDA 3WWYA 2P91A 1R0LA 5I9BA 1CR6A 2HO4A 4WLOA 3VR6A 4KIJA 4B3GA 2FEKA 3H3FA 4AMZA 1R6BX 3RVKA 5C7OO 1G6HA 3MBKA 4INAA 5CJJA 3WBFA 4EB6B 1R8JA 1IYZA 3NYRA 4NWIA 3P8ZA 1N34B 1NG9A 2A2ZA 4NPAA 5KTSA 3ZVMA 1PGPA 2VA9A 1QH8B 1IPEA 1QHNA 3TXXA 3VDQA 3DL0A 3GT7A 4DCSA 2X4IA 3F6EX 1BH2A 3VZRA 3DM5A 4TWRA 1K8QA 1B76A 3BXGA 1WSWA 1VIVA 2ZG6A 3GD5A 4RFLA 1IHUA 2CB9A 1BCSA 3ZWKA 3U62A 1PFKA 1QFSA 5ABPA 3OPMA 1PVVA 2XQGA 4MS4B 1YVEI 5LMNB 3T1HB 2YOHA 3OSUA 4OHYA 2YN0A 3IPLA 2HBYA 1KJNA 1NLMA 2CFTA 3WKCA 3RIEA 5AD1A 4CL3A 5SZIA 1V0JA 1FUIA 1TVCA 2FG5A 3PHIA 4XSVA 1Y5LA 3CZRA 1UDWA 1FXUA 3PNKA 2JGKA 1N5IA 4P08A 4UHHA 1NXSA 4GP7A 4AZ0B 1L8AA 2ZFUA 2QN9A 3TZLA 1CR4A 3IP8A 1Y3AA 2RHHA 1WJGA 1MX5A 4IUYA 2SICE 5I45A 1D2MA 1ZGZA 2FFRA 3S44A 3TNFA 1XMXA 2B92A 4RHEA 5AHKA 4BKUA 4POOA 1O77A 3G68A 4Q37A 4YGXB 1JAXA 1Z63A 2VDPB 4F4CA 2UYGA 2ZTMA 3MMSA 4LWQA 4MS3B 5K0FA 3UC9A 1DJQA 1X42A 4B45A 3KAJA 5H81A 4D41A 3IEIA 5C8VA 3LRTA 3D3QA 5F76A 2IYQA 1GUFA 1KAQA 4IR7A 1JZQA 5KSYA 1OAOC 2RHLA 5HQTA 3OC6A 3LCJA 1WDKA 2HMUA 5CYPA 4JBNA 3VRHA 1SUSA 3PGLA 2JIDA 1IBKB 2FW9A 4J7CA 4Z53A 2JGDB 2YWJA 3TLGA 2ZIXB 4W5JA 2GCGA 2Q2VA 2EBUA 2Z9CA 3DDHA 3ELBA 4RE6A 4RYDA 1OUMA 3SD7A 4B84A 2GNAA 1M8JA 4HN9A 4IDGA 3TKYA 3KOXA 4E5DA 3GHHA 4BGEA 1Q91A 1GO2A 2J3LA 2V4UA 4US1R 2PZGA 1YB7A 1KO5A 2P4SA 1I6MA 3L8ZA 2UUAB 1U5AA 5B3LA 1G3IA 3NRBA 5DNWA 5ITZA 2XWQA 4PYIA 4O4HA 1XCBA 2B8WA 4RZ3A 4H4CA 5DYTA 4QJ3A 4CKEB 3OWXA 1Q95A 1FVHA 3LDAA 2IHUA 2CLOB 2C77A 3MSCA 4RETA 3THYB 2AJ8A 2FRDC 1PD1A 2NXJA 4W8HA 4OAOA 5TNXA 3GAZA 2OB2A 3P32A 3GBPA 1PYOA 1Q16A 2XNJA 3HBFA 2QTWB 5SZHB 2Q0SA 1T9GS 2WJVA 4YDRA 4OM7A 3GMSA 4ZVQA 1D5CA 3VOAA 4LJ6A 4URYR 2F8MA 1PSWA 1ULHA 3O74A 4YASA 4F3TA 1P1JA 2NT4A 2X13A 4UAJA 4U7HA 5F77A 4GUDA 1NYLA 2AMVA 2FTKE 3ENWA 4LXQA 2EZTA 4EYQA 2FSPA 2X8AA 1PT7A 1Z2EA 2ZYRA 2UZ3A 3KUCA 4GO1A 4BNKA 1LY1A 3WXBA 5AHXA 2JIMA 3B9PA 3DL4A 5FA6A 4H60A 3CEAA 3WJ7A 3PP8A 4F8YA 1ZOPA 3KZVA 2HW8A 4IIJA 3KXKA 4JYPA 1PJCA 5KU7A 2OBFA 1A72A 3GUVA 3E9QA 2WIKA 1DKUA 2ZUVA 5E7IA 1F2VA 1USWA 1SA0B 3F4BA 1RQGA 4LBVA 5CFMA 2HCJB 1ISHA 1BW9B 2YN2A 3JQDA 4OLFA 3U80A 1XDBA 2G9QA 2Q0XA 4C4XA 4JUCA 3PFGA 3KJGA 3EE6A 2QTVA 3OZWA 4K9LA 3KTDA 1QSGA 1F2UA 3ISVA 3GD7A 4GOND 1TK2A 2BBSA 2H1IA 4GMXA 4ZO7A 1CUEA 4W5NA 4EW1A 4FEAA 4Q6BA 1PK8A 2RSLA 2NYAA 5DDIP 3EOBI 3LKDA 2FEWB 2ZVPX 1UWKA 5HG0A 1NMQA 3PR1A 1GGFA 4MVXA 2QTRA 1SUEA 3ZWWA 1QDLB 1NR5A 4LEIA 4MKFA 1X8LA 2RB5A 3OCVA 4K26A 4Q7MB 4TLAA 1V25A 5EMHA 3WLMA 4E22A 2XX3A 3N2NA 3QV1A 2J5BA 2FV8A 3KR2A 1XZKA 5D87A 4F6CA 1U65A 1GOTA 1HE5A 4HAUA 2C8KA 5EZYF 1YIDA 4RZHA 4KXWA 3CSDA 2YV2A 4R7ZA 5AXBA 3SSNA 3WYFA 2QRQA 4D4LA 3C3BA 5F2NA 2XUIA 4LZAA 2ZPUA 2QROA 1FUUA 1CEEA 3B9QA 4PLGA 2W6JD 3M33A 4B9AA 1P17A 3NNSA 2C61A 2GXSA 2AYYA 5A4FS 1ZCBA 2PD6A 1W93A 3P52A 4LNUA 4OH7A 4OXNA 3GWGA 3DR3A 4EQ6A 1GD1O 1R6XA 5CEJA 2VYNA 1B8UA 3EVFA 4OJKA 4ZANA 2CCKA 3LLSA 3RKSA 5K0SA 1DRUA 4TYQA 4IF6A 4RA9B 5TQ2A 4W1SA 1KP3A 5FPSA 4XIJA 1E9FA 4RPGA 3QBJA 3GJSA 1A2QA 2RAUA 5JS1A 3OT1A 5FOSA 4PLHA 2R87A 3JWJA 3KM0A 1YOVA 2C2GA 2O06A 1H69A 1EVLA 1KAEA 1G16A 2XD9A 4PSCA 2FDCA 1QWOA 1I2CA 3RS8A 5DNYB 2MR5A 2HM7A 1IOLA 4Q9AA 2XTMA 4UE3S 3HS3A 1HYBA 3G9XA 4EJMA 3VSBA 4R71A 4N40A 1REQA 4P31A 2YQZA 2IHJA 2HX1A 2B83A 1OPRA 3RT7A 4EYGA 3GLFE 1H66A 4JI1B 3N59A 3W06A 1Y7IA 4IAOA 1N2BA 1OQAA 4IY1A 4OY3A 4UDXX 1VMDA 5C51B 3IE1A 3NALA 1Z2PX 1V2GA 2Q4EA 2WSBA 3BWDD 2X2OA 4NATA 4F2HA 3NKFA 5A4MS 3B5IA 1AY0A 1R6DA 2HXYA 3TW6A 5EIEA 1XNQB 3GLSA 5ADHA 3MVEA 6ABPA 4IO0A 2HF7A 3OF2A 3EUEA 3LTEA 3RAPR 4JI5B 4FYJA 4ZEWA 2VK4A 2XGSA 3GZNA 4CM8A 5K3EA 4F2WA 4R1PA 1UZAA 1XD2A 3UV6A 5KTTA 2EW2A 3MJSA 1ECLA 4G8BA 4HH3C 1W4BA 2ACKA 2XCUA 4TSFD 3KKLA 2XHEA 3AINA 3TR5A 2VQ6A 4DIBA 1FUKA 3C6BA 3BSFA 4PR0A 4PSDA 1LSUA 3GJXC 1GPBA 5IN5A 5LP6B 1Z82A 4CQJA 2I7DA 2C3PA 1CQPA 4AJEA 4B35A 1BDHA 4RJLA 5DGXA 5FI5A 2HA3A 3QXXA 4US2R 3VH3A 2YFHA 1O4WA 4MR8B 2PJRA 3M1YA 2B1QA 4A15A 1G8KA 5KVQA 3ROKA 3DHNA 1WU7A 1IJEA 1C9KA 4B31A 1VMEA 3K2QA 1TAQA 2PPLA 1H8ED 4MPJA 2IK8A 1E9VA 4EGAA 3B5EA 3RJ5A 3UEOA 4ZYLA 4MB0A 3WDMA 1MB9A 3WFIA 3QX3A 2OD7A 3OCXA 3P0EA 3GNQA 1L6IA 1UBKS 4Z4QA 1SWVA 1NZJA 1ZD3A 3JATB 1IBMB 2XCOA 1TM1E 1EJ6A 1TYAE 2IUYA 3RYCB 1EE9A 3QOXA 2ZCVA 4LSZA 5AYVA 4GOLD 1GPLA 5B58T 5LQNA 2PRYA 4I50B 5DNDA 4LAFA 4WHMA 1W4AA 3BQNB 4HAXA 3R74A 3SYMA 4DA4A 3HFRA 3VKGA 3JRNA 4LVOA 3ZY5A 4EH1A 5IVHA 1PL6A 1SXJC 2DYKA 2DPMA 3TW8B 1YT5A 2YIJA 3ITDA 5CDFE 2GAAA 4Q3KA 1NF9A 2XTNA 4D99A 4B6OA 4NY1A 2P27A 1BXKA 1SQ6A 4N0MA 3ABIA 1CZKA 4L5CA 4M1OA 3BIJA 2FGKA 3RSLA 1JILA 1ZGAA 4ECEA 4JJ7A 5LKRA 1N33B 4K03A 4AKSA 3TRJA 2ZXUA 1KZYC 1F51E 2VEOA 3KNZA 5AKXA 3SYKA 4ALJA 1CQIA 3LAWA 1WOMA 3R3VA 4HCJA 2XQVA 3MW8A 1GZ4A 1YUNA 1ZIXA 3KG2A 3EVAA 4U7TB 3VZBA 4BJ1A 1SD1A 4P4SA 3U4QB 2C4WA 4M98A 1H65A 3PTLA 4O4HF 3H16A 5KDLA 5CITA 1V3TA 1DX4A 1N25A 2HA2A 3R6LA 3REOA 1RHKA 1UC8A 3ADPA 4WNIA 2H2HA 2EZUA 2GZ2A 2ZWPA 3H18A 3HACA 3OEYA 2B6NA 3FMOB 3MRVA 1D1TA 2CBZA 2PQMA 3OCJA 2QQFA 4TL7A 1CEQA 4QJ5A 2GTPA 5FHRA 3TL2A 1ZIDA 3FKSD 2Y66A 1R2QA 3MSXA 5SY4A 5C7IO 3TQOA 5FTKA 3FHOA 4A6DA 1MX3A 1C50A 1Q19A 2GOYA 1TYZA 4XVQA 2E1RA 1WHSA 4X3CA 1JIKA 2KMLA 1EMDA 1S0UA 5F98A 1G1AA 1PLLA 2X9NA 2YHBA 4RBNA 2EU8A 2D1RA 2WK1A 1QTNA 5CJPA 3G0CA 5SY9A 1DFHA 1XD8A 1IQUA 2VF2A 1CY7A 3UJBA 1U2TA 4EF5A 2H2WA 1OXKB 1UIMA 1KXZA 2QD4A 3Q41A 4ARBA 4BCCA 4O4JA 4JUIA 1YIAA 3OX2A 3P9YA 2QI9C 3L0OA 4NBUA 1JX6A 4W7IA 2GGSA 4QGGA 3HVKA 5JTTA 1J9GA 1KVRA 1Y9AA 1UF9A 4MB6A 1CY2A 1T3LA 1VFNA 1XYVA 4QXAA 4B17A 1T13A 1UDBA 1Z2OX 4JYBA 4L72A 4C5BA 1I0IA 2ZSJA 4M1QA 2B0CA 1GGHA 3K9HA 3L01A 3HJTA 3ZBUA 1SY7A 3V46A 1RD4A 1VE7A 1SVSA 4XR9A 1QYXA 1AG9A 1DQPA 1TA9A 1VLMA 1XJCA 4TL6A 5NLLA 4D43A 5KMGA 4PWZA 3RABA 3TQSA 1I6WA 5BNIA 2P69A 3R5FA 1J56A 3N74A 3WIOA 1DUIA 1V3VA 4OGWA 4QUDA 4NMMA 4R1LA 5NULA 4J7XA 3VR2A 4CIWA 1UBMS 1PZGA 3HKBA 2CLSA 2EX1A 3M6MD 4Q1FA 1RHUA 3UAWA 5LD2C 1I36A 1SBQA 5JS7A 5CB4B 1I9GA 3ZW9A 2F3RA 2XMDA 2HBQA 1E1KA 2M6SA 2Q1SA 4WJKB 2BUAA 1H2HA 4OBXA 5E4FA 2WF9A 3IAEA 3F46A 2V9ZA 2BTEA 1RIIA 2VRNA 2IPAB 4NC9A 1ZIYA 1EWQA 4LJLA 1UKBA 1WX1A 1T10A 3VMFA 2V4ZA 1FXWA 4IMRA 3LV8A 1NRIA 3ZV6A 4PM4A 3HGTA 1KKLA 2ATXA 3O1JC 5T4BA 3UWMA 4ZZIA 2EWVA 3I04A 1XTPA 3EXFA 2HMVA 3VR5A 1IZYA 5KNLA 3LIIA 1Z75A 1T1IA 1YK0A 4IMPA 3D3NA 1IY9A 3P5SA 1XELA 1YD7A 1U1IA 4UPVA 1WCYA 3SEQA 1IHYA 2W2LD 4AUMA 4MUEA 2NADA 2W8BB 4RD3A 4AKGA 2OESA 1AGPA 2RIPA 3ZPXA 3ZVLA 3LBAA 4QU9A 4AJKA 1RDFA 3HKEA 3OEWA 4HAZA 1U94A 3ZNQA 1XTBA 5IKOA 2BGUA 1W36C 2P4HX 5CNIA 1HPLA 4Q21A 3H75A 1IHOA 4WOJA 1JHQA 4Q02A 5IUJC 4YT8A 1NURA 4C3ZA 4YUZA 3KQYA 3U2QA 5H4HA 3GGGA 1OROA 3G9QA 2JATA 2G72A 4TMWA 3GJ5A 4UOZA 3IJRA 3LO5A 3IDZA 5ADVA 3OZVA 4F04A 5EXDA 1CBUA 3D3WA 4PZCA 2VPPA 5BOSB 1AGXA 2O2ZA 1FP7A 4IYRA 2J9XB 2REQB 4BKMA 1IFXA 2NO9A 4I36A 1KWKA 1O0SA 3U7FB 5EWLA 1WZ2A 4D2IA 1O97D 4FFBB 1RBMA 2JARA 3ZX4A 4KQWA 4DJDC 1ZI9A 4Y6RA 2A3NA 2VK8A 3CZMA 2IHBA 2A9PA 5I8PA 3B1VA 4HNSA 1Y5MA 3P0FA 1HYEA 5IBPA 3UMBA 4U7WA 2BHSA 5AVTA 3DT6A 1J2YA 1TVEA 1ZOOA 3FJYA 4R1TA 4D7AA 4B2IA 3CEHA 4UD6A 3TMAA 2BYTA 4U0KA 1A7AA 3REFA 4G0OA 1LCIA 2J31A 1E62A 2EGGA 3FF4A 3G0DA 1CRLA 3G0GA 4ZJUA 1RLUA 4GDFA 2P4UA 1HSOA 3WLEA 2FPXA 2I78A 5KVSA 1E3QA 3T35A 2ECKA 5C5EA 3HL4A 2FZGA 5KTPA 4N5IX 2DLNA 3HKCB 1W7AA 4OL0A 1B0ZA 4CF4A 5BV0A 1TDJA 1BDJA 3LVFO 1EA5A 1PJ3A 3PIIA 4HNGA 4HNAA 1E3DA 3HWWA 5JJBA 2PG3A 1MU0A 4M9QA 2PT6A 2X7HA 4Q3OA 4MUAA 3AL0C 4C6SA 1LWOA 4IEEA 3D64A 5I9IA 3DWIA 4RVOA 4RKWA 3T7SA 2HU5A 4ZEVA 2O8CB 1EDDA 4C6RA 3OCCA 4U9IS 1JMYA 4DN6A 4O33A 1UQRA 1YACA 4DA9A 4DUZB 4MW4A 4B2PA 1XP8A 3KLOA 5H3CA 3EQ8A 3ENQA 1XTVA 2F1KA 1RWQA 1HR0B 3IMKA 3PGKA 4WOBA 2AC2A 2REOA 4OI0A 3F74A 4ZKEA 1CK4A 1PJ4A 3RG2A 1KL7A 2OBLA 1Z34A 2JHCA 2IZ1A 1NUPA 1P6UA 3ZV3A 2PUDA 2QVZX 5EMKA 5T67A 3IV7A 1YE5A 3IAFA 4BO4A 1DHTA 2R68A 3FPCA 4E21A 5KX5A 2I91A 3Q9NA 4ZN6A 1TA0A 1TFUA 1U2PA 1N0VC 5ECDA 3MUNA 4GOOD 5T57A 3I61A 4YCDA 5IHPA 5EC8A 3Q8MA 5I9NA 2XNHA 1DTEA 1W0JD 1WXHA 4BNYA 3PX2A 2XNSA 4B33A 2ACWA 5TPZD 3IOYA 5K0GA 1J70A 3QHPA 3H2GA 4KYUA 1CG6A 4HB4A 4OQNA 4EY5A 3UPTA 2XMCA 2IY9A 2QTNA 5M7EA 4KR0A 3DWFA 4G0YA 1MRNA 2H59A 3WFJA 1C0LA 1GGNA 1TQ6A 4IWXA 2GEKA 4RVCA 4F96A 2FP4B 4U2DA 4DE5A 2HMAA 3ED5A 2MINA 4AYXA 3Q0TA 2C8JA 3R40A 3F6SA 2E9SA 4HPWA 1WKCA 4PYNA 2FP3A 1P75A 2BISA 1PS0A 1XBTA 3IP1A 4KO3S 2EARA 3UXEA 1YJXA 1LH0A 1PAUA 1UPTA 2ZIWB 2G0TA 3S68A 2OGWA 5CRIA 1LU9A 1PWXA 3CX6A 2XDAA 2XD4A 3OU2A 3P9KA 4NH4A 2R751 3IPXA 2YXNA 4M6WB 5FJIA 1Z0IA 2BGJA 4Z9AA 4RX1A 4OHZA 3TWOA 4Y0VA 3ZCSA 1R37A 3GRFA 4BFXA 2G76A 3BA6A 3H11B 1UKZA 1JVBA 5EQJB 5GONF 1E79D 1ZO8A 3R7BA 3W8FA 1W96A 3V9PA 3W05A 2VJMB 2BKUA 1MAAA 2QRZA 5T3UA 4BQOA 2XTZA 1BGXT 1P0MA 3K15A 3H42B 4IH9A 4PG6A 1T9AA 2EFYA 2QE7D 4ZTUB 4NOLA 3DP9A 3N2EA 1U4SA 2GCOB 1NUHA 1WV1A 3R1IA 4L8VA 4QPCA 1VPVA 1M2WA 1OBHA 2HLNA 3JV7A 3Q98A 4IJVA 3S3TA 2R6ZA 3OLVA 3TEFA 3M82A 2QUJA 4RZSA 3AUFA 3BCRA 4ZDJA 3IPRA 4WOPA 4P4SB 2HSWA 2JL1A 4ZP1A 3MK31 2FEAA 1NQVA 3OMWA 2YZKA 1RKBA 3EH1A 1G5RA 2P9BA 2V7GA 2WTMA 4YGYA 1BVYF 1XMVA 4EEKA 3X1MA 2XNKA 4JJAA 1X80A 3EMKA 2PT5A 3LWZA 3NGLA 4JOBA 4OHOA 4YJHA 5DCWA 3GG9A 3ZKWA 2FPGB 4ETWA 4YV0A 5K5EA 1AMUA 5CAEB 3BFXA 2UVPB 2YWHA 1I7SB 3RYCA 4DV4B 1UPBA 4TYYA 4IDOA 4G4JA 5HS4A 2ZM6B 1WDTA 3KDPA 3PXDA 3WMWA 3K30A 4G4SP 2Q27A 3W2HA 3WICA 1EX9A 4C20A 2G8LA 1T5BA 1YHZA 2HC9A 3N7AA 2AUMA 3OECA 1Q0HA 1RXUA 3EGCA 4P54A 3N7TA 4ZHQA 4R9NA 4ZOAA 3QFSA 4EPTA 1ZUHA 4H3KB 2GO1A 2HLPA 3QKWA 2AN3A 1VCOA 3UWSA 8ADHA 1E9CA 4OVKA 4HMQA 2P0AA 2H18A 1PFYA 3I2GA 4Y6GB 3OJCA 4AD8A 1BWQA 1TJYA 5L3SB 3REGA 3IPAA 4LXUA 5DM2A 3DFMA 3NWOA 3ESDA 1QYVA 3HDHA 2X6QA 3IT1A 3CGWA 5K3FB 4PNZA 3VSAA 4B43A 4YR9A 1WXGA 2ACVA 3PA8A 1EQAA 5K09A 3SC2A 2ZE7A 2XAUA 1EGMB 2QX7A 5IXYA 4KWEA 5HJEA 3AXTA 2BZ1A 3AVPA 2YTZA 4IRMA 3RNLA 1DPGA 3TPFA 2BGIA 1NPTO 1T15A 2A84A 4J29A 3N0TA 3CTPA 3R7LA 2CNDA 1RCUA 2OZEA 3DZHA 3EDCA 4WI1A 4ITUA 5K4HA 1MEOA 3U48A 1NA5A 2O54A 4UTPA 3FOAA 3WQQA 1NTOA 2I33A 2CNKA 4I2NA 3UA4A 5DJ5A 5A4JA 3OAAD 3SFVA 1S2IA 4DAEA 4LFBB 4DCNA 1I7PA 2CL5A 3TQQA 2P9GA 2RAFA 1MT3A 4HLDA 1GZSA 2J0SA 5JYCA 3WRYA 1TU4A 1WVIA 3I12A 4QUEA 1V7ZA 4BQSA 1QS0B 3ESAA 2OV4A 3MD0A 4EJSC 3A1DA 2WTNA 1KI9A 2BRUA 2YJ3A 3A8TA 3D2CA 1E64A 3HZZA 2CJWB 4PLCA 2A0FA 3H7IA 3A2MA 4NFLA 3JQCA 4DOMA 2AN1A 1K6EA 4HWRA 3O3MB 3OKFA 3HP1A 4O6VA 3LYLA 4RKRA 4HEQA 1FNMA 4LX8A 5JNRA 5AOCA 3NASA 1UJ2A 1ISFA 1BNCA 4OHPA 4Q47A 5KINB 1KOGA 1DMSA 2R7KA 3SX4A 3T7DA 2BGLA 3NFRA 3SEZA 4RF3A 3GIDA 2CY0A 3LBYA 5BWBA 1PU2A 1DWPA 4IIBA 2I4MA 1CY4A 4FD2A 4KDFA 3TBKA 3VYSB 2JF0A 2BL4A 2DY0A 2P6NA 2VP9A 3MQ2A 1A9ZA 5H59A 2FR8C 2QAGA 3ORHA 3SCZA 2AG6A 2CSXA 3JYOA 4CV1A 4PEVA 1ZH2A 2BGKA 2H65A 4NESA 4YRRA 4LWOA 3CW8X 2QD2A 2RI6A 4Y9TA 3GVIA 5D5PA 5GOTA 4EB6A 4GBED 5CDFA 3PHHA 2LUOA 3FMPB 3TJRA 1UDXA 3D4IA 4PZLA 1HZZC 2YL2A 4RAOA 3IDOA 4RVNA 1RQXA 5F21A 1Z7GA 2CNWA 5FBQB 1PG2A 5K45A 4QIHA 2A88A 1WV0A 3GCWA 1FSSA 4RQAA 4X8LA 1OX4A 4HL6A 4V2IA 1AKUA 2JVJA 4INZA 4NXMB 1USVA 3KKKA 2IOHA 5L4LA 1AUPA 4PRLA 3I2KA 4AG5A 1Z36A 4DQLA 4LOJA 1U8FO 4IQ4A 4BNNA 2LKCA 2PBFA 2XNDA 3DE1X 3IAXA 1EGHA 1AHNA 1N8NA 1TRHA 4X0EA 3CR8A 4Y6OA 5UKDA 1P7ZA 4G89A 2VXCA 4RIEA 3RS0A 4CF3A 5K6AA 1MD9A 1I13A 1EVJA 1KI6A 1E1CA 2B1GA 3IXMA 3G2OA 4LGVA 2JI7A 5EPEA 3VX4A 4D9NA 1E89A 3DONA 5LDHA 4HEHA 1AJEA 4PF1A 2QIPA 4A27A 4BZQA 1NJ5A 3FA2A 1DEOA 4MP3A 5CEEA 1S4MA 3U4DA 2HWKA 4V02A 4D44A 3KU1A 2YVAA 4ZPXA 5G02A 1B8PA 2QJTA 4N8DA 4J1TC 3F7OA 1MO3A 2H16A 5JD3A 4MS3A 3LX4A 3MMNA 3PJGA 3IULA 2AZTA 4FEGA 4ZI3A 4RLHA 5JVDF 1QX4A 2VDUE 5BOSA 1E2MA 1Y4ZA 4AWBA 1E32A 1WLSA 4MYSA 1N2ZA 5CFQA 1VL0A 1YNSA 1Z73A 3QEMA 1A88A 4F4HA 4A0HA 1A5AB 3SIXA 2JLBA 3DXXA 2AMLA 2XUQA 1EDZA 2Q3CA 1ZN7A 2B5OA 3PDUA 1P9WA 2NXEA 3QUCA 4IUCS 5DTQA 2CVFA 3QQPA 1CLUA 1I1OA 1Q21A 2JD0A 4UTOA 4YV2A 2BUBA 4DR5B 3F47A 4I4TF 4Z4FA 4QVIA 1XTIA 1M83A 4V0QA 3AFNA 3ZJ5A 3WX0A 1AZSC 1CQWA 3WGGA 1CZOA 4LMAA 1KDVA 4E7PA 3DVQX 4BEVA 1KSHA 3CSUA 5JR3A 1ZA2A 1S2OA 5E4JA 3AFHA 2X0JA 5LNK6 1LRKA 4JQSA 1PR3A 2CL7X 4L73A 5CDGA 2C4VA 1J0DA 3K1TA 4L3WA 1KS9A 2YZMA 3W2EA 5BV2P 2Z57A 3QLEA 2VATA 1P39A 1YZVA 3FCEA 2OO5A 3M1IA 1GRCA 1U4OA 3P2IA 4I19A 2VNJA 5DXAA 3TEJA 2IY8A 3PPVA 3MIZA 3CRVA 4JITA 1C9EA 2AHOA 5DH9A 1LRLA 5GMOA 2W90A 2PYZA 3DDNA 3O3OB 1VP9A 4ND6A 5CLIA 1YJ5A 3P4UA 1EFPB 5A7FA 4OBEA 4HDMA 5JD6A 4OYHA 5DXFA 3T5TA 3MHTA 4WH0A 1VLJA 3TS1A 3JYHA 5B2FA 1X1CA 3OJWA 3B20A 4MZXA 5MGNA 1Z5VA 1V16A 4HWGA 3FJ1A 3NEJA 1HDOA 4LRSB 1QE3A 3U60B 3WYDA 2F2TA 2HFKA 3AVXA 4FP9A 2C2OA 4X5OA 2AFIB 4HWKA 2WBLC 4KTTE 2YX1A 2QORA 3ND5A 1Y7TA 4GX5A 3TUJC 1NY5A 1P9NA 3MMZA 5HF6A 4BX2A 2FZEA 2VNAA 3ETNA 1BSVA 4DLVA 1FDOA 5JNSA 2O1WA 4JLAA 1PWEA 3PDHA 2O50A 3UO8B 3F73A 1EUYA 2QTTA 5H82A 1RLMA 1MEEA 1WF3A 4XI9A 2J46A 4UDNA 3I92A 1YKGA 1NLYA 2VJMA 1MO6A 1T6YA 2HI0A 1Q7EA 2H1WA 4J43A 2R5NA 3HVIA 2Q07A 1GPWB 1PZFA 5CB6A 1E7QA 1C3OB 1IN8A 2PGLA 2XDWA 4QUAA 4R3WA 3U17A 2QUBA 4C2TA 2MWMA 1YVPA 3TOVA 1PFGA 3DO6A 4HTFA 2B3TA 4MUMA 2H0RA 3LQKA 5BSHA 3EPLA 3T3EA 1FFYA 5DYYA 4ZDWA 2W0MA 4COOA 3CF0A 3IC5A 2PV0A 4CT5A 2CMHA 1DBRA 2GK3A 2NPOA 3CWQA 4LJSA 5BWOA 1QE5A 2OO5C 3FKSA 4CJXA 3WWDA 2XB8A 4BRWA 4DV3B 2BP7B 4WEOA 4Z49A 3ZE9A 3LUJA 2VUIB 3HN6A 4M36A 4OXIA 3TNYA 5DYIA 2OBXA 2NU7B 2WWXA 4ND8B 3VH2A 1ATZA 3GH3A 4G26A 4RK7A 1N2SA 3ZDCA 2C3UA 2PMCA 2P77A 2R5FA 1UT6A 3V1KA 5HVNA 1NFRA 3QF4A 2FOXA 3BDIA 4A8HA 4CF7A 2XUZA 5FLEX 1DBIA 5KKCA 1KY2A 3AHHA 3GARA 3I04M 3NXSA 2YOGA 4P35A 2GASA 3RYHA 4ENTA 2WD7A 2Y6UA 1CP3A 3VV2A 3KB8A 4U5QA 4FFRA 3NIWA 3GEDA 1VE1A 4DF3A 1RAGA 1SUDA 5AXCA 3R0QA 4YP9A 1J1IA 3B6JA 1VMKA 1VB3A 1D7AA 3QI7A 3SIPA 3UT5B 1YGYA 4ER5A 1AXGA 3LRPA 2BY4A 4ZV4A 2E7ZA 3IB6A 3ZHSA 4JD5A 4DLWA 4V0SA 4OLAA 3HV0A 5EE3A 1ACJA 2JK0A 2PZFA 1LFDB 1U9ZA 4ZQIA 3ETDA 3V4FA 3D1JA 3ROTA 2WG1A 3WK9A 1QV6A 4JYMA 1D2RA 5JCZA 3PCRB 3A6GA 3O84A 4TTIA 1XDSA 4G01B 3TTYA 5LQAA 4OX9Y 2R7MA 2VRCD 1P73A 3E81A 3HU5A 3OJEA 1Z6QA 2ZAGA 2ZSDA 4CUJA 5E3HA 5FUMA 5BN5B 3HDVA 5HGXA 1XO1A 3GUZA 2C9DA 3MS2A 3AMVA 3RIMA 4ACAA 1JHPA 3RRMA 3MJ4A 5IDQA 1GAQA 2DKOA 2FPGA 3G49A 4N5LA 1MG0A 4KO2S 2XWPA 2PX0A 3GJTA 4WY2A 3QKTA 4GVXA 5A4IS 2NU9A 4B34A 4EHHA 5EMMA 5GADl 1ZNXA 1T2FA 3O8OB 4CI0B 4LBYA 3PE6A 1D2GA 1WCXA 5AM1A 3T15A 2HQBA 1NC1A 4IDEA 4Q9KA 4RPCA 5KTMA 3FVVA 4KQ9A 4CDGA 4TTRA 4XX0A 4L4UA 4PCLA 2V7VA 4CMKA 3EUFA 4R2LA 4G2NA 4MRMB 2GXUA 3D6VA 2ZSIA 3R23A 1R00A 2PGNA 3EY4A 3LJKA 4R0NA 1YQTA 3OE1A 1NM5C 1LRJA 5TJHA 4DQ0A 3WHPA 4IDAA 2W2LA 1BU5A 3UIEA 3PC3A 3ETLA 3L7IA 3FVQA 3N8IA 3MYRA 4GF5A 2ZJZA 4I9UA 4RXTA 1SHZA 4P6VF 1Y6JA 3JVIA 3VV3A 1B2LA 1ZI8A 3MWFA 3LZDA 2ZGVA 2XZTA 4HWSA 1O94D 4TWAA 1DDGA 2A4MA 3DMDA 3O4GA 4E2WA 3WV4A 5HZGA 3BQMB 4YACA 3WI7A 2PUCA 2X6RA 1N8KA 4TS4A 4GLLA 3LE8A 4JL8A 3U3XA 1P81A 1B14A 4H7IA 3AKCA 4PXSA 3S2SA 1R18A 1EUZA 4D26A 4ZZ0A 3WC4A 4AB1A 1XHEA 2IZ0A 2J9RA 3BD8A 3ZZTA 5BO5A 2XTAA 2AI1A 1JIQA 3G0OA 3MCTA 3ZGXA 2BFNA 3GCXA 4HT3B 1VL2A 1HTTA 3ECAA 4IIHA 1QRUA 3H2HA 3H5NA 2JRCA 5TX7A 1FXSA 3M2PA 2NO7A 2PZAA 4GKBA 3QPAA 3BMNB 2PKXA 2FFJA 2M1ZA 3ENZA 3ZBPA 3B1WA 2YXBA 3SHFA 4HYQA 1N2EA 3F6YA 2IELA 1FFXA 1IEVA 1OX4B 4BO1A 1FNSA 2VHZA 2Q99A 3FIUA 1RJ9B 3LVQE 5LOVB 3W6NA 2VP0A 3HDGA 4QX6A 3QK7A 4YP6A 4W5HA 1PW5A 4XJSA 2YJGA 2OM6A 4BX3A 4DV6B 2IU3A 2W6IA 2PSEA 2QD5A 4G9GA 1I3NA 1NR1A 4KQXA 3SE7A 3DMNA 4Z9BA 2NVWA 1V95A 3S81A 4FGZA 1V96A 5DEIA 4UHBA 3Q6MA 4PY2A 2QZ4A 4KIGA 3PUIA 3HKDB 1ORHA 5EKXA 3BHMA 3FYTA 3KOYA 1P2UA 4LYGA 4QBIA 3BC1A 4UOQA 3H1TA 4U02A 1S3IA 1E0KA 3MUFA 1E6CA 2SNIE 1KF0A 2UU9B 2J9GA 4AMBA 3PNBA 5HIAA 2PRKA 3E5HA 4MW0A 4IVPA 1PFVA 1B0AA 1U3TA 3ZDBA 4H7HA 1SFRA 5JQGB 2Y1GA 3QE4A 1DCMA 1J2TA 1OXTA 3GJ7A 3HDQA 4GKVA 4MRPA 3S2GA 3SZOA 1ZINA 4DQUA 3FHJA 4A7PA 1N2CA 3A36A 3HJAA 3WBBA 4JI3B 1HK7A 2NZUG 5DX0A 4ZV7A 5HMMA 2D0OB 2L42A 4NOJA 1V48A 2WHQA 4Y1GA 3PFKA 1DCFA 1NJ1A 4P38A 5ENVA 5ARBA 1Z0UA 4F9TA 2O5VA 1GNSA 3DZIA 4D9MA 1YA4A 4HG2A 1C9YA 1XMSA 2P9FA 5CXSA 3B1FA 3UKOA 5A5EA 2F1OA 1HLFA 1QHHA 1YFKA 2H4FA 1SC3A 1ZJZA 1NBME 2XT0A 4H7JA 4I14A 4TL8A 1ZNZA 3RBAA 4ZYVA 2QZZA 3G85A 4BYGA 4AQYB 1OB2A 2R7AA 4R0MA 3QVKA 2RCNA 5GIOE 4UHCA 3VX3A 2GWRA 1MIOA 5DCLA 2CUNA 2IYWA 4CHTA 3EGXA 4Q9IA 1Z3IX 5SY6A 4B3BA 1TJ5A 2MYTA 3PLNA 1GPNA 1YCHA 1IPFA 5EGSA 5K0ZA 4Q39A 3F9IA 4FK8A 2ONYA 2I1QA 2OILA 3ILSA 2BONA 3NJRA 1ZD5A 4PLVA 5I3CA 2I2WA 4LRQA 1N1EA 3LBFA 3PUWA 2AT1A 1LDNA 3TW4A 5JAPA 4MRVA 3W5AA 2CV0A 2Z1MA 2ZRDA 5MFPA 2DH6A 1LDYA 5FRDA 8ATCA 4YT4A 4D3DA 1FBTA 1YMUA 3CR3C 1Z7YA 4F3YA 4PZ9A 5KNBH 3BILA 3TQHA 3UATA 1HE8B 2F43A 1P3DA 3VGJA 4BMPB 1FQKA 4QODA 1M5TA 3DNPA 4HYTA 5JXGA 2VBIA 1H6AA 2YWFA 1L7EA 3E2MA 221PA 5KDOA 1FJ2A 5ALSA 2AN4A 3U44B 2EBHX 1FFDA 5TQVA 5E7MA 1GNRA 3EQ7A 3FOEC 3KP1A 4ZKDA 3OQIA 5B4UA 2I99A 4ZEXA 1PL8A 1U90A 4ZVVA 3IQDB 2BFMA 4FYIA 4AZVA 3WJ1A 5DNEA 3F5QA 4WACA 1KY3A 1Z0AA 2PLWA 3AI1A 3DULA 3ZTWA 1FW8A 1XJQA 2XBMA 2C7RA 4E5MA 1BQ3A 1C30B 1A9TA 5CLFA 1OFTA 5CLQA 1DG9A 4RH0A 1E6WA 4RDXA 3WRYC 5I48A 3WAJA 1SCDA 3G5MA 2GD0A 1YQ9A 3DE0X 4DMKA 1FSPA 4KTVE 2FMHA 3FFTA 3MZ0A 3QW4B 1RQPA 2O6HA 1WNTA 5ALRA 3W6PA 5IVPA 2FLKA 4WUVA 5FNVB 3DLHA 3TUZC 4FPXA 4IOLA 3E9EA 5C1DA 1U0BB 2E55A 4XDHA 3CMMA 2ORWA 1C5KA 1T2CA 4ABYA 2UDPA 4I1YA 2A1TR 1TGYA 1PG5A 3C43A 3ZJYA 1EVZA 4ZALA 1GM5A 1QZUA 1AQNA 4Q3LA 4YMSA 3BB1A 2X58A 3HJGA 4HJRA 2BUCA 3PD1A 4KXYA 4UEJA 4QGHA 4AJNA 3BJEA 3VR3A 3WGUA 4EK9A 2QYSA 2YNMC 1E2JA 2QRLA 5I01A 1MXHA 1R0CA 3NPAA 4KOAA 4HLNA 5DOZA 1GZHB 3HE3A 1AZWA 2OV8A 3RW9A 2EEZA 3KD3A 3R44A 2FF7A 3AB8A 1HNNA 2FPSA 1VJDA 3JQAD 2X1LA 4O8CA 1RXEA 4RF5A 2CJPA 4QSMA 5DGTA 1UC5B 3NUZA 5L7TA 3ZU5A 1OT5A 3OFJA 1TECE 3NOOA 3D59A 3H97A 5ELXA 1O6ZA 3QUSA 1Z38A 3UV3A 3DMPA 5JSKA 2XCIA 3R6WA 1K68A 3AV3A 4LE2A 4CVNA 2O8DA 4CMGA 2W98A 2GBFA 4GM4A 1W5BA 2R5WA 4HAVA 3ZE8A 1CRPA 2QMHA 4N3NA 2I76A 4NE7A 4WCFC 3CLUD 1HNWB 3C70A 1YO6A 4G9BA 2J7KA 4JA0A 3U19A 4FW9A 2FFQA 4FQ7A 2NTYC 1S3FA 3UENA 4RULA 2NYRA 721PA 4PSUA 3HO6A 3MT8A 2EJUA 2QRJA 3RANA 5B6JA 3K8YA 1KK1A 5LZ9A 5EEHA 5KNBA 3UZUA 2ZVDA 3S1SA 1TEZA 4Y0AA 2H11A 3HVJA 3TM5A 4BVHA 5BOVA 1VHLA 1TE2A 1IULA 2WYOA 2PH1A 1MB3A 2AWOA 2PXHA 4KXQA 4MRNA 3FE2A 3PG5A 4BLWA 2ALJA 4XQCA 4ID9A 1DB3A 2Z8XA 2WYUA 1WWKA 4OFXA 3ZZNA 1XPUA 2P3SA 4HAWA 5D3KA 1SOMA 3BTSA 4D98A 4EWLA 3BWVA 1D2NA 5H83A 4ZDKA 1NVGA 3B12A 3BKXA 3ETJA 2GDZA 2ZRBA 3CNBA 4RY2A 1IXKA 1YJQA 2Y99A 3BH7A 4RJ2A 3VFDA 4DTIA 3ZVNA 1GDTA 3HJUA 2DLDA 5JAIA 2CXPA 2WLTA 3BTVA 2GHQA 3HXLA 3L8YA 4ND2A 3CUSA 3BWXA 5AJWA 4D4HA 4ND5A 4DLYA 5JC1A 1N78A 3HRKA 4JEHA 1W44A 4RH1A 4W1PA 2WYHA 5INTA 4LRWA 3H4IA 4CIDA 1WUIS 4V24A 5FFFA 4J4HA 5FV7A 1H1DA 3BH0A 4DFDA 3CVVA 2EX0A 1MDFA 2FXIA 1FQJA 4MV1A 1CUFA 4AJ1A 1ZOSA 1FFEA 2CVOA 4L51A 2JGEA 2Z2JA 5GV8A 3WLTA 2OQVA 3EIXA 4TVSA 4ZYYA 3JWIA 4YP7A 2OP1A 4R7GA 4QDJA 2VCHA 4PX2A 5B6PA 1ZD1A 5ISMA 4J0IA 1FYFA 4PNHA 1GFWA 4GPAA 1W4LA 4BFVA 3VKVA 2L17A 5CBPA 4DB4A 2QG9A 2C1XA 4MUJA 3C1AA 2P6PA 1XFDA 1LF0A 3I1YA 2HQ1A 2Q3DA 3PQCA 4LK2A 3V1MA 2Q9BA 1SC6A 2HWWA 4JT2A 4N6NA 2XITA 1P4HA 1U9IA 2JAWA 4CG2A 1GNPA 4G36A 3CA8A 3HCAA 4Z4IA 2GBPA 2JB9A 1GGJA 1OLXB 2KPOA 4B81A 3LO8A 4DGQA 2OHHA 1KIFA 2V7TA 4EUNA 2J85A 3H6GA 4G9EA 4B7ZA 4LXXA 1WE2A 5AO9A 4BBZA 4E3ZA 1DIRA 1RJGA 2XSZA 3H4MA 2G8NA 4HDSB 5AVZA 3CE6A 2QU8A 4A82A 2GM5A 4F6LA 5A06A 3DOUA 3SQMA 2WKQA 3D7SA 1QUFA 5HCNA 5JROA 2ZJ5A 5FI0B 2FKAA 3NCHA 1DC6A 1E6MA 3I52A 3VR5H 3GCDA 2HRDA 1TIPA 3V97A 4EMUA 4NE2A 1BFKA 3VJLA 4LYHA 1JFFA 1UZMA 2F7SA 3ANXA 1OFVA 5J4YA 3FDZA 4P7KA 2XWSA 1U28C 1YR9A 3HUDA 3NZEA 1XJ5A 3OOSA 1T2VA 4MMYB 4WXHA 1YE3A 1ZMRA 3IHTA 3MNFA 1DOHA 3N58A 4Q24A 4X1KA 4XGKA 3VBCA 4DHWA 2R0QC 2I71A 4F6RB 2ECQA 1IY8A 3HB7A 1T8YA 3LM8A 3AFMA 3RIGA 3EEIA 3AWIA 4AICA 5HA5A 3WLAA 4FT2A 4UXJA 4DLTA 4NPCA 1E96A 1NBOA 2B8NA 1N6NA 2FWAA 5GOZA 3RYIA 3SC4A 3VR4D 4JYZA 2X23A 2I67A 2FX5A 2I22A 2QTCA 1FLAA 3ON5A 1T5IA 4P92A 5B30A 5BXYA 1GTG1 3BHIA 1I2AA 1VCHA 3UMYA 2OHGA 2PKWA 4N0QA 1JYEA 3B48A 3WWEA 1V8BA 4OYLA 4DSUA 2ZZMA 3NAQA 3MINB 3CSSA 4Y1FA 4C1BA 4PO1A 5TS3A 1TIKA 4YRMA 3TM4A 3ILXA 3MG9A 2GTHA 4C5CA 1ULUA 1J1ZA 3BHNA 3KQNA 2QZJA 3WDLA 1Q22A 2QZSA