3BJRA

Crystal structure of a putative carboxylesterase (lp_1002) from lactobacillus plantarum wcfs1 at 2.09 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
267
structure length
244
Chain Sequence
FQGMQVIKQKLTATCAQLTGYLHTNLPAIIIVPGGSYTHIPVAQAESLAMAFAGHGYQAFYLEYTLLTDQQPLGLAPVLDLGRAVNLLRQHAAEWHIDPQQITPAGFSVGGHIVALYNDYWATRVATELNVTPAMLKPNNVVLGYPVISPLLGFTWTPTPNELAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATALATAKIPYELHVFKHGPHGLALANAQTAWKVAHWLTLALEWLADNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative carboxylesterase
publication title Crystal structure of putative carboxylesterase (NP_784706.1) from Lactobacillus plantarum at 2.09 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
total genus 73
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bjrA00
3DEAA 4ITVA 1GPNA 4Q34A 5ALRA 1QIDA 2HU7A 3FWHA 2GYWA 1RWQA 4FHZA 4KAFA 4AO8A 2C58A 1J06A 4QWMA 2ZSIA 1GKLA 3DLTA 4XX1A 3WKDA 1QJ4A 5EFZA 4X97A 1TK3A 3FYUB 5AI6A 2B9VA 2WLSA 4KAJA 1VA4A 5JD5A 1EB9A 2WTMA 5CW2A 1PJAA 2HU5A 1XZGA 1QIJA 1LPSA 4UUQA 3DKKA 4EY6A 2WIKA 2PUJA 5AK6A 2WSLA 4H7FA 4OU4A 3WWPA 3W05A 3MVEA 4PSDA 1YR2A 5HFNA 4BCDA 4LYDA 3O9MA 1MN6A 4BAGA 3ICWA 5AKZA 3CN7A 1CVLA 2XE4A 2QXUA 2Y2UA 3G9XA 4JYPA 4H7JA 3DL7A 3QPCA 2XB6A 1CLEA 4M0FA 4GLBA 2WUGA 4FNGA 4Y2VA 5LP1A 2OXEA 1E8MA 3E1GA 4ROTA 3ICVA 4S0XA 3WIBA 3QITA 2HA6A 5EIHA 3QPDA 2AJ8A 3I6ZA 4HRXA 1DT5A 2PM8A 1GPKA 1ZJ4A 2GBCA 3EQ8A 1X70A 3H18A 3G0BA 4HTAA 4LKOA 3ZLUA 5JZSA 4KYVA 1H22A 4GI1A 1XQXA 4LXGA 4JYMA 5E4YA 1CUHA 5AKLA 2XUOA 1B6GA 1UOPA 2RHWA 4U2DA 4RGYA 1QIFA 4G4IA 4GW3A 5JATA 3TJMA 4WY8A 1UOQA 5AK4A 4KE9A 3WYNA 4HZGA 2I3ZA 1TAHA 4KRYA 5ALQA 2Z5GA 4UHBA 3HI4A 1R50A 5F4ZA 4FBMA 2J4CA 3FVRA 3PICA 4HXFB 4GECA 4X91A 3STVA 3I28A 3M81A 1CUDA 5I9IA 4Z49A 4J0CA 1CPYA 3A6ZA 4BAUA 3C5VA 3WIOA 1R9MA 3BF7A 3S2ZA 3W9UA 2C5FA 2WUEA 3QPAA 1Y37A 4MQMA 1TRHA 2O2HA 4OPMA 3SC2A 2OGTA 4Q3KA 1XRMA 5K3AA 5FRDA 1CUJA 2DQZA 1AMNA 4B83A 3D0KA 1XFDA 5AM4A 4PO3X 4B0OA 5KREA 1QZ3A 2XMRA 4AB1A 5AOBA 3ESBA 2XLBA 5DYYA 2I78A 4G4GA 4E11A 1OXMA 4X00A 4BAZA 3N0TA 4EY7A 5CT9A 3WK6A 1JT2A 2PPLA 3G02A 3HLKA 3AILA 3QYJA 2OQVA 1CEXA 1YAHA 2VTVA 2D5LA 4TVKA 4B82A 4JNCA 2Y6UA 3IB3A 2ECFA 1UKAA 1ZD2P 3G0GA 1BN6A 2EDAA 2GYVA 4L0CA 1ODSA 2VEOA 5BWBA 1XZIA 5JD6A 1IVYA 7YASA 4HS9A 1VJ5A 4UBIA 3HABA 1LZLA 2HRRA 4FFWA 2AXEA 2O2IA 1CUXA 1FFEA 2WFZA 5FKJA 4BCCA 4JH0A 5I8PA 4F60A 2XMDA 4OU5A 4P08A 4QDUA 3G9TA 1H2XA 3HXKA 5C8VA 1SFRA 5A62A 1MJ5A 3BL8A 4QDOA 2XQJA 1FJ2A 2JGIA 2CB9A 4Y7DA 2BGNA 2ZVDA 1YA8A 2GBIA 1SOMA 1CV2A 2VSQA 2ACKA 5LYYA 4K2AA 4YX9A 3L1JA 1ZI9A 2BJHA 2OLEA 3FLBA 4TPKA 4TGLA 5ALKA 4UBKA 1BEEA 1T2NA 3I1IA 3D4LA 3MGAA 1AURA 3C87A 4H7DA 2PSFA 5EHXA 2HA5A 2XUHA 2ZYHA 2GZRA 5AJHA 3FOBA 3IUJA 2QT9A 4UFNA 3H19A 2VJDA 1HLGA 4L9AA 4X85A 4LHEA 5BOVA 5ALVA 6YASA 4KAAA 3D2CA 4BC0A 4QDXA 4QWWA 5AKJA 2V96A 3F96A 1K8QA 3OG9A 2JGLA 1BCSA 4BVJA 3A2NA 3IIIA 3W2TA 3DQZA 1E8DA 3HACA 4RNCA 5JASA 1UT6A 3WWEA 3VKFA 4FMPA 3WK9A 3N2ZB 1Z68A 5EIEA 5CH3A 1LPOA 3FSGA 5HZGA 3I6MA 1UXOA 1EVQA 1AC5A 1BROA 4FLEA 3FBWA 4O08A 3WL6A 4Y2SA 5K3DA 1XZEA 3ESDA 4YK7A 4Y2QA 3MUOA 4M0MA 2B61A 4N5HX 1VA5A 1USWA 3UUFA 4BZZA 1ORWA 3C6ZA 1EDBA 2G4LA 5HKBA 1XRRA 4P92A 2H7YA 2XQFA 3AIOA 3DOHA 4QDTA 1EH5A 5FPQA 4CIAA 1CFJA 1H2ZA 1LZKA 1EK2A 3NOXA 5AKEA 3WA6A 5ALLA 4AXBA 4XJVA 3H2HA 4YPVA 2QRUA 4BE9A 1JU4A 3H2JA 5JAOA 4G5XA 3A2MA 1WB5A 2WFMA 4KE7A 2RIPA 2Y6VA 3STTA 5FLKA 4ZREA 1YS2X 1JMKC 2O7VA 2YXPX 5D3ZA 2HADA 4K6HA 3C43A 3DCNA 1ZD4A 1HBJA 3VJKA 3I2HA 4KE6A 1WCYA 4DMHA 3STYA 4QNNA 4KJXA 5AHXA 5A2GA 3WA7A 1GZ7A 3VVLA 2X5XA 4MWSA 1JU3A 4BDSA 3WKBA 5AIAA 3R3WA 4BC1A 5DYTA 4EY4A 3BF8A 5AO9A 1XZLA 5CH5A 3AZPA 5HF6A 4F5ZA 3I2IA 4OYYA 1ZD3A 2XI4A 3I2FA 5ALPA 1XZFA 2R11A 5J3JA 5HF9A 4WFIA 4DNOA 1LNSA 2WJ3A 4BTLA 1C7JA 4CFSA 1SCIA 2ZSHA 3PUIA 4H77A 1QIIA 1TCAA 1N1MA 2WG0A 3LIIA 5AK3A 5LZ7A 1JJIA 1BU8A 2WUDA 5AKKA 5EHQA 4IH1A 5C81A 4B9AA 4U2CA 2XQIA 1DX6A 2PL5A 4G9GA 5JAHA 1QFSA 5T4EA 3FLAA 1P0QA 3STWA 5EHZA 3V1NA 5ALJA 4UHDA 4U2BA 3NUZA 1F6WA 5KBYA 1CIJA 1DINA 1WOMA 4EY8A 3F67A 1N5MA 3OM8A 4X6XA 1R1DA 3R0VA 1R9NA 2QUAA 1LPBB 2AJBA 4N8SA 5HCUA 1KU0A 4OB7A 1L7RA 1CQWA 3BJMA 2QJRA 1GQSA 3YASA 5FUMA 1A8SA 5LZ5A 1BS9A 3G0DA 2VATA 1F0NA 5DWDA 5ALMA 1HL7A 3WJ2A 5AI9A 3O4GA 4WJLA 1UK8A 1QIMA 2ZYRA 2BCEA 3KDAA 4J03A 3R3ZA 4ARAA 2DCMA 3E0XA 5DNWA 3R3XA 4MEBA 3VJMA 4DMCA 1XZHA 4X95A 3V1KA 3NWOA 5SYMA 2WIDA 3VJLA 1LPPA 2QJWA 1EK1A 3OURA 1YASA 3LLCA 4X3CA 2HA7A 3HZOA 4P93A 2ACEA 5T4BA 1BEZA 1NX9A 1BE0A 2YASA 5YASA 2VAVA 5DYWA 3UMJA 5ALTA 1MO2A 1TCCA 1Q0RA 3E3AA 3V9AA 2BUAA 4KACA 1XRNA 2DFPA 4K6KA 5AM1A 3I2JA 4B85A 4J0DA 3VDXA 3PUHA 2WU3A 4CIBA 1A7UA 3EF3A 3FLEA 4EB0A 1QFMA 4UHEA 3PFBA 4D9JA 3RKSA 3SX4A 1WM1A 4CG1A 4DTCA 1EHYA 2OCKA 3FVTA 1C7IA 4B0PA 2XMCA 2C7BA 2WQZA 4ZGBA 3Q8WA 4Y2XA 4QE3A 2QVBA 3IULA 2WIFA 5E4JA 2E3JA 1VOTA 4UHCA 3D5EA 5DNVA 2H7CA 1NU8A 1P0MA 3QMVA 2Y2VA 4H35A 5K3BA 2BKLA 2ZYIA 2PUHA 1DQZA 4MXDA 1E89A 4Q3LA 1N8SA 1VKHA 5D3KA 5T4FA 4N5IX 1W76A 2ORYA 1XLUA 3DOIA 4H18A 2AJDA 1CUSA 4L3WA 4UFOA 3ZLTA 3DL4A 4X93A 1JMYA 4C01A 2JGJA 1CUWA 2PX6A 3KWJA 3JWEA 2VA9A 1GGVA 5HF5A 4DGQA 4DSZA 5CT4A 2AJCA 4MYSA 2EDCA 3I2GA 2HHAA 1G42A 1FFAA 3H2IA 2K2QB 5JZ9A 2QMQA 4BZWA 2OCLA 1ZD5A 1GQRA 4X6UA 2V97A 4G4JA 4J0JA 4WFKA 5AK5A 1SCQA 2OQIA 5IH7A 1R88A 5E2IA 3B12A 4NVRA 3ZPXA 3W06A 2VJAA 3DDUA 3ILSA 2YH2A 2G63A 4M0EA 4KE8A 5HF8A 4K6GA 1FFCA 1AQLA 1K6EA 1LLFA 3WI7A 1YCDA 1P0IA 1CUFA 3DYVA 4NZZA 2RHTA 1TKRA 2Z3ZA 3AZOA 3LS2A 1PFQA 2JF0A 4LIPD 3K2IA 2XUQA 3STUA 5H3HA 3Q0TA 4W1RA 1XZMA 3QM1A 1CUAA 4NMWA 4DNQA 1DWOA 5JAUA 4U2EA 5AI0A 2CUTA 4I4CA 4W1SA 1DT3A 3T4UA 3WWCA 4H7IA 3DKRA 3M3DA 1LPAB 2JBWA 3NGMA 2ZJ6A 4XIIA 3ED1A 3WYDA 1CUCA 4AMYA 5DLPA 2B20A 5K3FA 4Y2PA 1R3DA 1Y7IA 4B7ZA 2V98A 4GWLA 3V1MA 1TIBA 2JGKA 4J0KA 3ANSA 5HKAA 3PI6A 4JEIA 2CKMA 1VXRA 2QR5A 4DMKA 3PDCA 1U65A 4X7BA 4OSEA 4C88A 1XLWA 5ALSA 2XUAA 2JGEA 4H7KA 4B81A 2XUJA 3WWOA 3VXKA 1YS1X 4OYLA 1A8UA 3CCCA 5K5EA 3RLIA 1H23A 3LCRA 3X3HA 1F0PA 1MU0A 3QZUA 3HEAA 1THTA 1MX5A 5CBKA 4J0HA 2XUFA 2OAEA 3WZLA 3IUQA 3SWWA 5AP9A 3LP5A 4PQEA 5EIAA 1VZ2A 4IO0A 3R40A 2PVSA 3RM3A 4PW0A 1QO9A 1TCBA 1ETHA 1B41A 1AX9A 1EINA 4MWTA 1WB6A 5LZ2A 4Q05A 3SK0A 3R3YA 1CUVA 4RE5A 1MNQA 4OB8A 3G9UA 2PSHA 1THGA 3D59A 3H1AA 1S8OA 4BBZA 5EHNA 1JI3A 1XZDA 2B4KA 3GUUA 1VE7A 1XKLA 3WJ1A 5AKYA 1EI9A 4BB0A 1DU4A 3KWFA 2HM7A 2WTNA 2WILA 1XZCA 3EQ7A 4OD0A 1Q0ZA 1CUGA 1QONA 5C8ZA 1YB7A 4W9RA 1M33A 3AZQA 3QBJA 3FYUC 4Q3OA 1QLWA 5HK9A 1SCKA 2FUKA 1K4YA 1IUOA 5HK8A 1DX4A 5FDFA 5K3FB 1YSCA 5K3CA 5ISMA 1ZI6A 2VJBA 4BYMA 3I1YA 1XRQA 1Q83A 4UPDA 1HDEA 2WJ6A 2IX9A 3C8DA 1U2EA 4X92A 4AZ3A 3C5WP 4J3JA 4FWBA 4INZA 2JEYA 2JGMA 1WHTA 3L1HA 5ALFA 4L72A 1XQVA 3F97A 3WK5A 1LBSA 4UBLA 2EEPA 5KWJA 2G5PA 4GBGA 4P9NA 3VVMA 4CCYA 3WZMA 4K5QA 3I2KA 4N8DA 3R41A 2I03A 1W4LA 1MAAA 5K3EA 3BE8A 1QIKA 4UBMA 4FDMA 4OCZA 5BV7A 4G8CA 3U1TA 2WM2A 3ESAA 3C70A 3FSGD 4DYHA 4EY5A 4G8DA 5LZ8A 4BP9A 3WKAA 4EA6A 4QDZA 3H17A 5IVKA 3O4HA 4FLMA 1U8EA 2GBFA 2QM0A 4KR0A 4JUIA 4J0IA 3EBLA 3DJYA 3AINA 3O0DA 4AX4A 4C4YA 1NU6A 4ZI5A 2ONCA 3C6XA 1IMJA 4EUSA 3HRHA 3DD5A 5JYCA 3BIWA 2ZYSA 1QIGA 1WPRA 3OPMA 1IUNA 1K5PA 2ES4A 4DSAA 2OPHA 5ALNA 1ZJ5A 4HXEB 5T4HA 4ZWNA 2J3QA 4F0JA 3F9CA 4UHHA 2XMGA 5CXUA 4WDRA 2XT0A 5AI8A 2GZSA 4QLAA 1ODTC 1DWPA 4BCBA 5IVHA 1MX1A 4E46A 2ROQA 3QVMA 1HKHA 4G8BA 2WFLA 3JYHA 4EZIA 1UK7A 1ZGCA 4QEKA 1XRPA 1CQZA 5EI5A 1GXSA 4BDTA 3GBSA 5JAPA 2WUFA 3WL8A 3L1IA 3G0CA 5JIBA 1G66A 5DJ5A 3M83A 2XUKA 3PFCA 1IUPA 4BATA 1MAHA 3IVMA 5A7GA 2Y1KA 4CCYB 1ACJA 5A7FA 1F8UA 1WHSA 5A6VA 3O4JA 1AZWA 1PV1A 3WK7A 4KEAA 4F21A 3HYSA 1E5TA 2C4HA 4Q82A 2XUPA 4UFPA 4MJ3A 5FV4A 2QXTA 5JZBA 3IBTA 4HAIA 1W6RA 2C0QA 5CURA 1CUUA 2HRQA 3PF8A 2XMBA 2XQKA 2H9YA 2XDWA 2HA3A 1MNAA 2VQ6A 5AKXA 3A70A 5IVIA 4Y2YA 1UKCA 5AKGA 4Y9SA 1T4MA 3ESCA 2QTBA 1W75A 2OCGA 3BIXA 4RPCA 4MQLA 5HQ3A 2HA4A 3DS8A 5A7HA 4W1PA 5ALWA 4AZ0A 2XUDA 5LKAA 3CN9A 1HPLA 3UUEA 2R8BA 3E4DA 3KD2A 3OOSA 1SC9A 1QTRA 1RP1A 3BWXA 1QGED 4LXHA 1MX9A 1TQHA 1CUIA 1WPXA 2X76A 5AIBA 5FP0A 2AJLI 1O6FA 4IH9A 4A16A 1QOZA 1JJFA 2BUBA 1KEZA 5D7BA 2Z3WA 3AIMA 3FCYA 2WJ4A 4FFVA 5ALHA 4Y2UA 1FSSA 3MUNA 2WFLB 1VLQA 4N8EA 5C8XA 5A71A 2CJPA 2J3DA 3C6YA 5CRIA 3W04A 4PF1A 1C4XA 3V48A 2XMZA 2D0DA 1AKNA 1ORVA 2RGUA 4DMFA 5JANA 3P2MA 4C4ZA 3S8YA 2DQYA 2QZPA 1ZGBA 5AKIA 4IHAA 3KSRA 4WDQA 1LPMA 1UK6A 5FOQA 5AM3A 4DLNA 1VE6A 1L7QA 4U2FA 1QTIA 5AOAA 2HFKA 1D07A 2FJ0A 2WIJA 5ALZA 5ALXA 4H7EA 4MEAA 3WMRA 2WU4A 4PSCA 2W22A 5AM2A 2IIVA 4BVLA 4WFJA 3GROA 3WL5A 3AUKA 4RE6A 1MTZA 1A8QA 4AQDA 3C8HA 4Y2RA 2QS9A 4UBJA 3W9BA 4OB6A 3G7NA 2PU7A 5JADA 4X6YA 5EGNA 5CH8A 1ZIXA 1W1IA 5AM5A 1H2YA 2QKYA 1LBTA 1GT6A 2ZJ7A 3H2KA 1E3QA 5AI5A 4ZV9A 2PSJA 4PNZA 4Y2TA 4W1QA 3U0VA 2QOEA 4CG3A 2X8BA 3K6KA 4AN1A 3GFFA 2XLCA 4C6HA 5HQ3B 1UWCA 4C4XA 3AFIA 4LYEA 3OTQA 4IQ4A 4AO7A 1XZJA 5ALDA 1DTEA 5CTAA 3OC0A 4UHFA 2O2GA 3FYTA 4ZRDA 5ALUA 4BTVA 4FBLA 1CR6A 1E8NA 3TGLA 1XLVA 3B3QA 3H1BA 2RAUA 5LLSA 3G9ZA 2OAGA 3EIOA 2XQGA 1ZOIA 3D3NA 1EVEA 3B5EA 4CCWA 1GKKA 3ZWQA 3WK8A 4ZV7A 1J2EA 3H2GA 4H0CA 3F8SA 1AUOA 2VAXA 2J4FA 4U2GA 4Y2JA 4V2IA 2VT7A 4X94A 4AMZA 2PBLA 5LZ9A 3T52A 2XUGA 5CXXA 2C5GA 2IITA 1IZ7A 2HA2A 4LXIA 5AOCA 5LZ4A 3BJRA 3IUNA 4G9EA 3EQ9A 3H0CA 1BN7A 2CZQA 4B6GA 2HU8A 1J07A 1OILA 2CEKA 2UZ0A 4CI9A 1U4NA 1BRTA 1MPXA 2HDWA 1XQWA 4NS4A 3C6BA 4DIUA 3PF9A 1EDDA 3ZI7A 4FOLA 3STXA 4E14A 5DNUA 1IZ8A 1XROA 2VJCA 1A88A 3ZLVA 3D7RA 2YYSA 2LIPA 1DWQA 3O95A 1X2EA 3ANTA 3WQHA 2V9ZA 5I7UA 3QH4A 4GDMA 2DHEA 1ODCA 2G5TA 3KOOA 4DNPA 3RK4A 2PSDA 1JJBA 1CUEA 1EA5A 1G4HA 4DM7A 3IA2A 3QMWA 3V1LA 5IVDA 2WHPA 2DHDA 1XZKA 4W63A 1ACLA 2XMQA 3WL7A 5FXMA 3CXUA 3WKCA 1OCEA 1CUBA 3RARA 5JALA 2Z8ZA 2Q0XA 3KXPA 3G8YA 1CUZA 3D2AA 1J1IA 2CBGA 2DR0A 1RYYA 3HSSA 2BAGA 4BVKA 1UZAA 5ALGA 4ARBA 1E66A 4AO6A 4GHWA 2VF2A 4B80A 4FNMA 3TRDA 1ISPA 1EB8A 4EHBA 4ETWA 1GPLA 1CRLA 3GA7A 5FPPA 5CMLA 4A5SA 1YB6A 3WKEA 1QIEA 2BUCA 3BXPA 3WLAA 4BRSA 1XZAA 2O7RA 3JW8A 4G1FA 4KRXA 2QUBA 4A23A 2RI6A 1P0PA 1QE3A 1QO7A 2GBGA 1UKBA 2ZJFA 4X71A 5ESRA 1WB4A 2WHRA 1XQYA 4FLFA 1XZBA 4ZXFA 3VISA 1L7AA 2GYUA 3PE6A 2WIGA 1AGYA 3GZJA 4B84A 1DQYA 4C89A 4QZVA 4HRYA 3FAKA 2DHCA 1ZIYA 3BDIA 1X2BA 2XUIA 1R4ZA 2W6CX 2H7XA 4HVTA 5AI4A 3FNBA 3AIKA 3K9BA 1ZI8A 2CMFA 4PSUA 3BDVA 4BP8A 5AH0A 5HFAA 4X90A 5SYNA 5JARA 2WG2A 1H2WA 1LPNA 1YA4A 3GELA 3F98A 1N5RA 1UFOA 4E15A 2HIHA 1EDEA 1KU6A 1ZICA 2DSNA 1QIHA 3AJAA 2WHPB 1MT3A 5JD4A 4WY5A 3A2LA 3HC7A 4XVCA 3R3VA 5KWIA 3TEJA 2NW6A 5ALOA 5BWCA 4GXNA 4B9EA 5C7YA 4IH4A 4J0GA 1FFBA 5CT6A 3QMMA 1UK9A 2WG1A 1BCRA 5AICA 1UOOA 4GEGA 5ALIA 2P8SA 1I6WA 4Q1VA 2HA0A 3LIPA 4C87A 3WK4A 5DTJA 2JIDA 5ALYA 4QA9A 4WCVA 2PSEA 1FFDA 1EXWA 4XWGA 5ALEA 4AN0A 2OGZA 5CT8A 3O9VA 2JGFA 1XKTA 5AM0A 1Q84A 1G5FA 2VT6A 3FYUA 1O6GA 1CUYA 4MYDA 1YAJA 3IDAA 3DNMA 2WKWA 2XMSA 1VXOA 1JFRA 2BGRA 2I3DA 5LIPA 2H1IA 4QLOA 4UBOA 3I6YA 3O4IA 1K63A 4UBNA 4I19A 4CG2A 4FKBA 1W52X 4FTWA 2HFJA 5LKRA 3FCXA 1XRLA 4YASA 2OG1A 3CCBA 4BRZA 1Y7HA 4I3FA 3WWDA 1EX9A 2BFNA 3G0IA 2WHQA 2RONA 2Z8XA 1LGYA 4PV7A 2JEZA 3H04A 5AKHA 2HL6A 4J7AA 2FX5A 3DYIA 1VZ3A 5D6OA 2OGSA 2C0PA 5CT5A 3M82A 3IURA 3ZV7A 4OUKX 3D2BA 1JKMA 2PU5A 4HXGA 2FJPA 2OCIA 4EBBA 3C45A 3IUMA 4DNFA 5DTIA 1HQDA 4H7HA 2PKYX 4BE4A 3HJUA 5E4TA 5IKXA 3R3UA
chains in the Genus database with same CATH superfamily
4ECEA 3BH0A 3TNYA 1QRUA 4G5QA 3LKBA 3QVVA 2PRKA 4JFAA 3ORHA 2G0NA 5KVQA 1GPNA 1WW2A 1ZWKA 4CMEC 4HLUA 1MH1A 1AA9A 2VHJA 3BD6A 3R2JA 4QPZA 5ALRA 1T13A 2CNBA 5GOTA 4MPRA 3AI7A 2UUBB 2FEPA 3V2UA 5KYXB 4YACA 1JFVA 4JA0A 4AJHA 4E21A 2GPAA 1EWTA 3I92A 4JOBA 4OJMX 2Z6VA 3TL3A 4JJ4A 1VFNA 4UDNA 1K7SN 4XIJA 1J99A 3OWXA 4AO8A 1RSZA 1MTOA 2G4CA 3KVNA 3DOFA 4K9PA 5GONB 3TJRA 1UKVY 3TPFA 4HAZA 5C53B 3CONA 1C0EA 4QWMA 2BC9A 2ZIXB 1RI2A 4YAJA 4EO7A 1GKLA 2BMFA 4C20A 1ATIA 3O8OB 3AW8A 2RAVA 1TK3A 2NACA 2PLRA 5AI6A 1AK2A 4K1XA 1I1QB 4KO1S 3O8CA 1RCUA 1PVVA 5FA5A 4V0OA 1KWGA 3CWCA 1X7GA 3H8SA 1U80A 3LW7A 1ZUHA 3A0RB 4GMXA 4KAJA 4Q3BA 1V1RB 1TTTA 5JD5A 3LY7A 1G41A 2BTOA 2WTMA 4JOQA 5C8YF 1OQAA 1XD2B 4HH1A 4DS3A 4BFYA 1CC1S 1EUDB 1WIWA 1F5SA 4MQBA 1Y3BE 1FB5A 1QIJA 2P6OA 4GXQA 3D3JA 4EB0A 1IWPB 2HXSA 3Q11A 3DKKA 3LPCA 4JX8A 2GK6A 3TLZA 3L0CA 4EFKA 2E4YA 1GFWA 1G0OA 1DXYA 2Q49A 2WSLA 4UVDA 1KDVA 4CT4B 5ICEA 1HNWB 4KXUA 2DBZA 5G0UA 4K8RB 1BH6A 3MVEA 3QSGA 4FYHA 2H8KA 3RK0A 3RYHB 5C35A 5HIMA 2XBUA 1YDFA 3PRKE 5GOZA 1ZSNA 2O57A 1UQTA 3C16C 1QH8B 4LYDA 4KV9A 4NEGA 1MN6A 4Z86A 5FQOA 4B8WA 4QT4A 1PVOA 3ICWA 5AKZA 2IP1A 3CIFA 1ZMTA 4B4DA 3PL5A 4UU0A 1IZYA 1TXGA 1M1UA 4RGQA 5MHTA 2GF2A 3WGKA 2XDQA 5CYGA 3OTOB 3RK1A 4GI2A 1RKQA 2ZUWA 4A8HA 2AC4A 4KR7A 2X5JO 3MJVA 1MH9A 1P6XA 1VG0B 2JARA 3EAQA 5I01A 3C6KA 1RWBA 4MZDA 1QDLB 3G79A 5KSWB 4TKLA 3LPAA 4RWEA 3EPLA 4ZT3A 1FMTA 1NOKA 3B5JA 3FY4A 3UK1A 3SBXA 2PWAA 2QUKA 4GLBA 2WUGA 4M9XA 4TTJA 5DRYA 3UJHA 3A3NA 2Q6IA 4NU0A 3GFBA 3ENKA 4EKGA 1FZQA 2BR4A 4R6WA 2YFHA 3ZU5A 4ROTA 2N1MA 4PFSA 3ICVA 1F60A 2P0YA 3MT9A 4EARA 3LDFA 3T1TA 5BSFA 1O9GA 4U7JA 1P5ZB 4R54A 5E8RA 3RV4A 4GP6A 3DDNA 4JLWA 2OLJA 3GGSA 2P2DA 3T38A 2VSYA 3QPDA 5ILOA 4A4DA 1VDMA 2AX3A 1WWKA 3G7UA 4OKNA 2DUWA 4RHTA 2XCLA 4EENA 4QUEA 4HRXA 3DTNA 4K9QA 1GPKA 1UDAA 3HY4A 1V11B 3QX3A 2DWUA 1NLFA 2F3SA 2GBCA 4OUDB 4Z51A 3U7FB 3SKVA 4MYUA 4YI5A 4HQ0A 1JIJA 2ZQ5A 3QLVA 5HKKD 3CZPA 3ILYA 5JZSA 1KK1A 4WT7A 3FIUA 3KJQA 3LPNA 5A3RA 2D0IA 1UMCA 3U16A 3CLRC 2ZIZA 5KTMA 2IZOA 1JEYA 3EFOB 4GI1A 1KEKA 1XDUA 2VIIA 3HLTA 4K88A 1QZUA 1YFKA 2XYHA 3KIPA 4LXGA 3QEBZ 3RRZA 1N0UA 2FE1A 3X44A 1IBMB 1P44A 2WVHA 3GCGA 5EZ5A 2V5UA 1FYVA 4EJMA 4WESB 1Q57A 4KQHA 4IICA 3WIEA 3RS4A 5IMSA 5ILQA 5TPZD 1Y48E 4WY8A 1Z12A 3KUUA 2E5WA 1S9DA 4TZ0A 3DLPX 1N5JA 3MLEA 4ED9A 3DW3X 5JSYA 2GK3A 1YJCA 3HLYA 3HDHA 5E6UA 5EXSA 1EIZA 2UUPA 2I3ZA 4WLUA 2QVCA 1WMBA 1PT9A 1TFRA 1B8NA 4IGEA 4DHEA 3LOPA 4KIJA 1REQB 1OX4A 1Z25A 3AUTA 1A2OA 3GB9A 4CMCA 4JOCA 3AVVA 2GD6A 1SBHA 5CVCA 1W7AA 2H1HA 4UHBA 4C6SA 1KMIY 2A9PA 2AFRA 4DARA 4AT1A 3EXHA 3AESB 3FVRA 4FS3A 4LZOA 5KJEA 4HTFB 4X91A 4G0MA 4M1QA 5TT0A 4F9TA 4XDGA 1LVGA 2Y68A 1P7WA 2IZ1A 4D6YA 3ORQA 1XWIA 3WTCA 2RCNA 4QDJA 3CO0S 1YWGO 1ZESA 2QTWB 3OCWA 1RHJA 1TYZA 2ACWA 1TAQA 3PJGA 4ZO9A 2Z1MA 4ZQFA 5I9IA 2A3RA 4D9GA 4IJWA 3EFHA 4LK2A 5KSOA 4J0CA 5DBIA 4EJSB 1ZA1A 1NN1A 3MTDA 3EW9A 2CKDA 5J4LA 3A6ZA 2X6QA 4AXXA 1H1LB 1M2HA 2WJIA 1XNHA 3VPBA 5LBTA 4J6EA 3SDSA 5BNFA 1VLHA 3L8ZA 4BRWA 4R8SA 2C5FA 1NATA 2BMEA 4NENB 1W4CA 2GA8A 4LXUA 4P1ZA 5CVVA 2XR1A 1KYWA 2O23A 3TLGB 4DOMA 1JHXA 1TJ3A 1XDDA 1DRUA 3IDQA 4XD2A 5DX8A 4GLOA 4HGZA 2O2HA 4RZXA 2XB9A 4RQAA 1JEDA 4EPWA 3B3FA 4MV1A 3UQYS 4J16A 2D3WA 2AI1A 2OGTA 4PZAA 5DTMA 4Q3KA 4EI9A 1ID8A 2GZDA 5ECWA 5K3AA 5M34A 1F2UA 4MW7A 3RSZA 3ZLBA 3ZCUA 1K2VN 4L7QA 1M83A 3CKMA 4CVNA 2BGGA 1G20B 3ROEA 3NCHA 1XFDA 5DGCA 1GTJ1 3ZQJA 1AMOA 5KSZA 5JAMA 4NOKA 1Y4AE 4O59O 5KREA 4AB1A 4E3WA 3K70B 1Y5RA 2VJLA 5DGTA 3N70A 2UKDA 1FE8A 4OQLA 2ET6A 2XLBA 3E9YA 4EEXA 1NW7A 5H59A 3FXAA 3HA3A 2E82A 4V39A 4FYXA 1GNLA 2VQ3A 2GEBA 2RHGB 2VYND 3VR0A 5B1EA 5B4UA 2RD2A 2WD9A 3D6AA 3JQCA 2EZ4A 3ZHZA 4MEJA 3WNVA 2P9JA 1ZLYA 1OXMA 4EY7A 1UBNA 3M1AA 3AUSA 2PEYA 3HWX1 3WK6A 5JUWA 3GEBA 5CNIA 5LDGA 2QRHA 1XWWA 2PPLA 3Q3EA 2I3GA 4JIMA 5IKPA 2FDRA 2AZ4A 2OQVA 5SICE 4DJ5X 3PFIA 1YAHA 3W8DA 1TK9A 2IHKA 1SU4A 3IQWA 1NLYA 1SIBE 3FOWA 3EARA 1RQNA 3ETJA 2P9QA 4JNCA 3I9FA 3MYYA 4QELA 4GM4A 2J59A 3R5SA 4TLAA 3GJ3A 3BD9A 2BTQB 5CXSA 3WFZA 1SM4A 1PDWA 3IB3A 1FX1A 2ECFA 2GHTA 1R16A 1C81A 1SY7A 2C3UA 4GGMX 1X7DA 3ML1A 4V2UA 1IY1A 3L07A 1UKAA 3WQBA 4BO2A 3HJFA 4CLXA 2VF5X 3OQNA 2QUHA 3FPAA 3CH7A 4TXHA 4B7CA 3UAYA 3BWYA 2OESA 4C7MA 3TOCA 2JCYA 3G2PA 4X62B 1AS3A 1ODSA 1X77A 1XX6A 1Z8HA 2HQSA 5EJ4A 2AR0A 3RYTC 4BO1A 5JS7A 4QREA 2AXPA 5BMVB 3WFJA 1ATZA 3F47A 4GOJA 2OHIA 1VJ5A 1ZKDA 5C1IA 1YTLA 2H8GA 1I94B 1NBHA 4F7DA 4HAVA 3DLHA 4ZDJA 2WWRA 5FBRB 3NDJA 4FGLA 2AXEA 3W6UA 4IUDS 1CUXA 2E87A 1LTQA 4L0QA 4BVBA 4BCCA 4JH0A 4OI4A 1AKQA 3CUKA 3R7WB 4OU5A 3BFPA 3GGCA 4QDUA 4ESHA 4JI2B 3G9TA 1H2XA 3CJQA 1C29B 1Y9DA 5C8VA 4JJ6A 4WD3A 1SFRA 3NHLA 2F59A 3L0ZA 2DMRA 4HO1X 3OLXA 1BU5A 1YZLA 1WQ3A 2VTDA 3USES 4F11A 1UQRA 1ZU5A 1FJ2A 1II0A 1O96A 3RPEA 1S3IA 2JGIA 1PCXA 1FUYB 3CRZA 1K5DA 6NULA 1XMJA 5F3DA 3DEZA 5HS4A 4AF8A 3E70C 3QTTA 3BPSA 1I5EA 1Z33A 4V0LA 1CV2A 1TB4A 1VCHA 3BTOA 4JKOA 4QX6A 3L6UA 2AF3C 3O8DA 4GRAA 3UUGA 1HG1A 2J9FB 1JFFA 4CUZA 3UAXA 1ZK2A 3PCXA 4X41A 3L1JA 821PA 3HVKA 3S1AB 3MT8A 2GR9A 5LQAA 1GG2A 3AB8A 3CA8A 3CLRD 1Y6FA 4N7RA 3PSAA 2IV7A 1RVDA 3EBOA 3H9BA 4TGLA 2UZ1A 4HNAB 2OBBA 4UBKA 5B4VA 1LJLA 3K9CA 3I1IA 1DLIA 1E77A 1MVOA 3QFCA 4IILA 4EB6B 1NPYA 1UZNA 2XGSA 3HO8A 4KN6A 2ZPUA 2X14A 1GCUA 2ZBDA 3UT5A 3HBNA 1SJ9A 3LBNA 2NZWA 1S1CA 3AUFA 1XTZA 2XODA 2B7CA 3Q2KA 3V7UA 3N59A 3ZW8A 3RCBA 1U2QA 3UB4A 3OLVA 1ZUWA 4BFWA 5DEOA 1FX0A 2MIIA 4I5DA 4WUTA 4Z6KA 1Z2EA 4RMNA 1OSNA 4YCBA 1P7VA 1K08A 1M1YE 4L9AA 4BHTA 2J30A 3U5TA 1JWAB 1I4EB 2V4ZA 1FNDA 3HYLA 2P4HX 5E6RA 4D8UA 1Y8AA 5BN5B 1B3BA 1DC4A 4HWRA 2ZG6A 5CCEA 3ABIA 4KAAA 3D2CA 2GVZC 1A50B 1W5FA 5AM2A 2CLKB 3SVTA 2WWGA 4QWWA 4QYSA 1CBUA 1G19A 1O9BA 2V96A 4RPKA 1ULUA 2QY9A 5K45A 3FPCA 2XNJA 3II6X 4M3NA 1K8QA 4GC5A 3SS7X 4DLBA 3HXQA 2GRUA 4ER3A 1P1JA 4WWHA 2I8LA 4PIPA 5IMBA 4B6QA 4JEUA 4AZSA 3IS3A 4HLQB 3DWIA 4LQCA 2C97A 1ZISA 3A6EA 1IN8A 1FNSA 2YJ3A 3K1TA 4FMDB 1L5HB 1FNMA 2AN3A 3PHGA 4DIKA 3VPDA 1VE9A 2QV0A 3LQQA 1HE2A 1L3IA 4H0NA 4DUGA 3IXMA 4A8JC 4KGXA 5CIQA 1SIUA 3I6MA 5C32A 5HZGA 1WCIB 1BDIA 2ZIFA 2L18A 4QIHA 1KRHA 4R1PA 5B3JA 2ETXA 1EVQA 3SLRA 5IHXA 1EK0A 1JGTA 3A28A 1ZH0A 2IEGA 1C0KA 3C3YA 1D8TA 1G17A 4MPTA 2YC2C 3DSRA 2IYPA 4QXPA 2VHZA 3RABA 5BV1A 4C76A 3QKSA 3G85A 3L6DA 2FVYA 3E7FA 4JITA 1IEQA 4OKSA 3RD5A 5B3KA 5KNBA 1A9PA 4CQMD 3T3EA 3Q3VA 3HKEB 5K0LA 4BQRA 2XV1A 4KWCA 1TLFA 1Z08A 1QHHA 1QGUA 1U02A 3HGMA 2BHLA 2HC9A 4MLDA 1EXNA 3E9RA 4O1MA 4XOUA 1SBZA 4M8KA 4QOIA 1XXHA 1DRKA 3ZWXA 4E32A 4O63O 3LZ6A 3G2NA 3UUFA 5TMEA 3M2TA 1A4UA 3BWMA 3PK0A 1ORWA 4G0NA 1NJ2A 4HSEA 1EDBA 2CGEA 4TSFD 4BZZA 4MKIA 4DR2B 1PS0A 3QOYA 4BX9A 4X65B 2G4LA 4E2FA 2XT6A 1OYWA 2KLBA 4RSRA 4QBTA 1PZHA 4NECA 4QVIA 2XQFA 3ADBA 3WISA 1BMFD 3AIOA 1G6HA 1QF7A 2IYTA 4G23A 3DOHA 4I1UA 4TMYA 1CQIB 5K0EA 4RQBA 3GWGA 2QM7A 4HAOA 1B8OA 4IIHA 4EDFA 1U04A 2SBTA 2B30A 2HI0A 2N1BA 3FFBA 3NIFB 3O03A 2KW5A 4D3DA 3PNYA 4QXMA 4LF7B 2GCNA 3GVCA 4L51A 4DM4A 1RMYA 1XTBA 2FCAA 1FPQA 5IDQA 3GDGA 2DUUA 1IWOA 2FZEA 4MB2A 4RD4A 1KNXA 1UJ4A 2BELA 3FMVA 1I3OA 4DVJA 5AKEA 2WRZA 3LFUA 1J1ZA 1Z2NX 3QFRA 5L3RA 1PFGA 4MUIA 3SHOA 4ITUA 3GJ5A 2I2XB 1HZZA 1JU4A 1U0SY 2B83A 2FFAA 3H2JA 3GEDA 1SWVA 2ZRBA 4PGHA 8LDHA 3KT0A 4BQIA 1CZHA 5LMNB 1ECGA 1TO6A 2DQSA 3OE7A 4KGZA 3Q1LA 4ND6A 4YH1A 3GFSA 3KJGA 4HDAA 3TCNA 4DZTA 5JFTA 1N8NA 5KAPA 2V7QD 2WFMA 4Q37A 1QHNA 1FDUA 3MFQA 1ONSA 3UMMA 2HHHB 5K6AA 3STTA 1NPTO 1YXMA 1YS2X 3IUEA 2PZLA 2QN8A 3FUXA 2HADA 2Y1DA 1MLDA 1J8MF 2F6RA 2OMEA 1QG4A 3D7MA 4HMPA 5M3BA 5LU9A 3DCNA 1BHJA 3GMSA 1FUEA 4D9NA 4BWYA 4XQCA 2V4MA 5FFNA 1D4ZA 3Q6IA 1BD3A 3FH0A 3G5AA 3VR6D 1NVBA 4CMIB 5FWYB 1OXSC 2EGGA 4HN2A 1M2OB 1T6YA 2ADOA 2AHRA 5IWCA 3S0JA 1M67A 1OFVA 1UANA 2ZS9A 4UCWA 3QPWA 5FHQA 3QG5A 3WA7A 4EGSA 5EKTA 1DPGA 3J7TA 3H8JA 4HNHA 4KQCA 2J9XB 4YJ2A 3AFMA 2PR7A 4MWSA 2DTEA 5D3MB 2YN4A 4URFA 3WKBA 4C7KA 2OFWA 5JT1A 3BB3A 3GRPA 1PR5A 3LA6A 3R3WA 5ENDA 3RRXA 1XMVA 2PGNA 3A9UA 2PQ2A 3I1FA 4KLNA 4PVCA 3A31A 2PZMA 3DDWA 2O5RA 3HB5X 2W58A 3NIWA 4IDQA 3OZDA 4B3MB 1XZLA 2V6GA 3VI3B 1DHTA 5JAIA 4QGGA 4QRDA 4CTJA 5FBWB 3OOHA 3NZEA 3PKIA 2R8ZA 1VJDA 4KQGA 3I2IA 3MMSA 4L4ZA 3BMQA 3P0EA 3VX4A 5TPWB 1ZMRA 1Z5UA 2XI4A 1UJ5A 3F2IA 1XWFA 4X60A 4BNHA 4LZWA 1XZFA 1M74A 3ASYA 1IVNA 5J3JA 2GZ1A 2E4AA 4PQFA 4RIGA 4WFIA 5EJ6A 3DLCA 5DNYB 5EQFA 4JI6B 4C08A 1X87A 1X1DA 3FTNA 1EWKA 3QU2A 4JUAA 4NI5A 4BL5A 2W37A 3IP9A 2P5YA 2WJ3A 1BX3A 3MWDA 5DE3A 4BMNA 1C7JA 3AEXA 4GLFA 3LAWA 3T5CA 3TPZA 1SCIA 3R77A 1CDDA 3PUIA 5DNAA 5A4MS 2JGAA 2Y9PB 1L7EA 3HB7A 4IXMA 4LOJA 4U0KA 4ZVRA 1WP4A 4DSOA 2IC5A 5BW5A 4JU9A 1OT5A 1CG6A 3DKIA 1JHQA 1J70A 3KKZA 2E7ZA 1JSLA 4KH1A 1EVLA 3OFJA 4BGDA 4CEIA 1Y1RA 2O0JA 2A5YB 2HLNA 5AK3A 1LJ8A 3JWHA 1VHWA 1AS2A 3MSXA 4X8OA 5LZ7A 3KAQA 1JJIA 2H1SA 3UMBA 1BU8A 4ARIA 4B1FA 2WUDA 2R8EA 4DCPA 5KWEA 5EHQA 1SCUA 1UXHA 1ZLXA 3TGWA 2CF6A 1TMOA 2XF2A 5CG2A 3PGJA 3EXIB 4NCIA 3HVHA 1MA3A 5SYAA 5FNVB 4M0KA 1N2EA 1DX6A 3D7KA 1DQPA 2I6TA 3E9ZA 3ICPA 2Y92A 4WPGA 1CCWA 2PL5A 2W6IA 4GYKA 1GQOA 2M6KA 4HR7A 1QFSA 3GLFE 1FNCA 3DE1X 1S4QA 3CG0A 3PUVA 4RY9A 5GVSA 4L4XA 3MRSA 2AOWA 1NUQA 3KUXA 3PQ2A 4KQEA 3D4IA 2W2KB 2OC4A 3SE7A 2JIPA 3LYUA 2DVMA 2BEKA 3ZV4A 2BT4A 5KBYA 3RQIA 3BL5A 4L28A 1EGAA 2WSBA 1IOVA 1LV8A 1N5MA 4MUBA 1B2LA 4UXHA 4DF3A 5EERA 3UHAA 1WUIS 4H3SA 4U0JA 3CRW1 2JFVA 5KJFA 2F9FA 2I2FA 1ACMA 1LPBB 1G8SA 1Y3FE 2J9GA 4ID3A 3P0FA 4N8SA 1LD3A 3B9BA 5HCUA 3E5NA 3MEQA 3IVCA 3VHQA 2AIRA 4I4TB 3VU8A 1GTSA 3HDGA 4L5YA 2JLXA 1PTJC 4TXMA 3FCCA 4XI9A 5B3AA 3T06B 2NVUB 3SF8A 3YASA 3PE4A 3TM5A 5ICCA 3HO1A 2FNAA 4V0ME 3KWLA 5LA6B 1SR8A 1SD2A 2R86A 2VATA 2BI8A 1EP3B 5EE0A 2AB0A 2VSFA 3X1JA 5DWVA 1B76A 2ZT5A 2ZRDA 1HL7A 3BH7A 2PWPA 2YS7A 2PYZA 4E5DA 3KJEA 1ZK4A 4MRPA 1NW4A 5KVCA 4W5RA 4WJLA 2BM8A 2HMVA 1A9SA 4F4IA 5KOHA 3C3CA 1CRQA 1HYHA 1O54A 3EMDA 1Z07A 1E7MA 3KDAA 3KOZA 4J03A 4BVEA 1B6TA 1E9VA 5C5IA 1FTYA 1HFKA 2C42A 5JV5A 2JEOA 4OM7A 4YAEA 1EJ0A 2O1SA 2NWQA 2WM9B 5J63A 4AF6A 2YDXA 3AOEC 4DEYA 3DWFA 3R3XA 2ZCJA 1MFPA 4PYIA 2P9EA 4XFKA 1XZHA 2V6MA 2VPWA 1XEXB 1NW6A 3OCCA 4L16A 5CDSA 3O7MA 1Q11A 2KYRA 3PPXA 3V1KA 4QPDA 1IHYA 4B44A 3M49A 3NJ4A 3CSUA 1MOZA 2V9CA 3FCSB 2WIDA 4RD3A 1AO0A 1XEWY 1CDEA 4Y6PA 3K0BA 1GT91 3QVUA 4NZ9A 3VJLA 1GQFA 2A0WA 1M8KA 2ZIEA 3WXBA 3A32A 2IHYA 3ANLA 1YASA 1ZH4A 3L82B 3HTXA 3LV8A 4AS3A 2A5FA 2F1OA 2ZDGA 2QE7A 3W7VA 4DKXA 3N2KA 1CJUC 1HMPA 2ACEA 5T4BA 2MWMA 4E2XA 5FR1A 2HJGA 2ID8A 5K7SA 2EJTA 3AKYA 2JFGA 3ZGOA 4CNBA 3QJYA 1Z2DA 3ZVNA 3OZCA 4IXTA 4Q4HB 4GNRA 3IMKA 4LDRA 2JGRA 1E7YA 3DC2A 1F12A 4JP3A 1Z38A 1DIGA 4A15A 1QOQB 2C57A 4KPUA 2KS6A 4IMPA 3ZOKA 1P3JA 1Q0RA 1T9KA 4RJTA 2Q5IA 3K94A 1TRKA 3V9AA 5IASA 1XZNA 4EJ0A 1UBSB 5BW4A 1UPFA 3L7NA 3OOJA 2B6NA 3N0VA 4MK4A 2JAQA 4HGPA 4PS1A 4HLCA 4LV8B 3O38A 2G9ZA 2F1HA 4GYJA 3VDXA 3DH0A 1VYTA 3C24A 4KMOA 1B0PA 3DLIA 1EFDN 1HDIA 3S99A 1JHOA 2HTEA 1Q21A 3PITA 3MPUA 3PUHA 2J4DA 4UC0A 4I55A 1L9KA 3R74A 2WU3A 4ENSA 1DBSA 3JSXA 2V1XA 3P45A 1N9KA 1A7UA 3QEMB 4CIBA 1ZPDA 3ONEA 1XSEA 1T5BA 2C4UA 2KJQA 3NTOA 3PC2A 4O0MA 4XIFA 3AR7A 3ZY3A 2JFQA 4D9JA 2QN7A 3SX4A 5BWLA 5IHPA 1QG0A 2B6HA 3VR3A 2O9JA 2OCKA 3FVTA 1C7IA 3QA9A 3FUTA 1LW6E 2YQ5A 1V5IA 1NJFA 3B1VA 4F5DA 4MV7A 4JFRA 1KYXA 3G2JA 1IHDA 3ZHVA 1SRRA 3VOAA 1GN9A 2IY8A 3LRTA 1GOTA 1I0IA 1WSDA 4UE6A 2JJ8A 1N2OA 3FGOA 3D8TA 1TC1A 3IULA 3TJZA 1PAUA 2C5AA 4PC1A 3IAFA 3RFTA 3LMKA 3D5EA 4NG4A 1RCFA 1SG9A 4L5BA 5HEKA 1OZGA 1LK5A 2ORIA 4X1OA 5EHGA 1SH7A 2O7NA 1AQ6A 3QMVA 2ZXUA 2BBWA 2EJCA 3AL2A 3AR4A 4H35A 4RD1A 5K3BA 2VPPA 2B69A 2PUHA 3GCZA 2EWVA 4AECA 3F74A 1F7UA 2X3FA 1XL1A 2VOEA 3HWSA 1ST3A 1N8SA 2QUIA 3JQDA 4NG5A 1GGFA 5EZSA 3VSEA 5JAZA 3UFXB 2VDQB 3D54D 3SZUA 2ORYA 5TNXA 2D2EA 1QX3A 1YMUA 3DOIA 3GT0A 4XLLA 3VUFA 1CEEA 1SHKA 2AJDA 1E98A 2HWUA 3NO4A 2GN9A 3CEJA 4Q48A 5LMCA 2XRFA 4OH7A 2QDKA 2IEBA 3GA0A 5F5LA 1QV9A 1YZYA 2R7MA 2P2NA 2PT9A 3DL4A 4IHJA 4LS3A 5E3IA 1TO2E 5LXTA 2CV0A 1KY3A 3RJ5A 2KMLA 3K4HA 4X93A 3O83A 3L9XA 1DJLA 4DG8A 2FMKA 4DLKA 4CIVA 5FUWA 5MN5A 4YCJA 4R0NA 4JD5A 3M33A 2JGJA 1DZ3A 3KS9A 3INYA 1BW9B 5JXIA 1XYGA 3QVLA 1JA1A 2C5BA 3JWEA 2JFXA 1JKFA 1TW3A 3BWBA 4GH5A 5CD9A 2PUEA 4RSGA 3EMVA 5HF5A 3SEZA 3UWDA 3FNRA 1UBFA 4H6PA 3H65A 5CT4A 4II7A 5DH9A 4MYSA 4DQXA 3GLFA 3GT4A 4D9HA 4BECA 2EDCA 3K0AA 3DB2A 1HLPA 1OX5A 4X9XA 1CULC 1G6KA 2JCVA 1PZNA 5JFOA 4WRRA 4FJ0A 1SUDA 4LYJA 1ZW6A 5EG5A 3H2IA 2V1UA 2K2QB 1P9RA 2R8YA 5JZ9A 1J22A 3NONA 3PEWA 3KQNA 1KAOA 3KPJA 5HILA 4WLOA 5DM1A 2FH5B 2HMAA 5K09A 2DPLA 3DZDA 2JIMA 1ZRNA 2CLLB 3DCJA 1GM5A 4J0JA 1XYYA 1EP1B 1NQWA 2D3TA 3W2FA 5D3QA 3PC6A 3WL3A 2ZRKA 4WLVA 4GMDA 4F2PA 4IFTA 5IAGA 4XARA 3ZWCA 1DQNA 3KTAB 1GSHA 1SKYE 3B12A 3BTUA 1DWUA 4FYMA 4NVRA 5E2IA 5EIWA 2VJAA 4P3NA 4RWZA 3DV0A 4BU1A 4IR7A 4AJIA 1II9A 5F1OA 4RH0A 1DAGA 3UHFA 4DIMA 4HHEA 3WLFA 2RHJA 3NEJA 3GFOA 4K6GA 3UH0A 3HVJA 1JX6A 2P6MA 4F9EA 1Z8NA 2UVPB 2ZBGA 2C2GA 4BQSA 3OCJA 1LLFA 1DADA 1MDBA 1FYFA 2QM8A 2FVXA 3IHTA 3IOEA 3LXXA 3O1HB 5CM8B 3AETB 2IE8A 4I9UA 3W8EA 621PA 5IAAA 1V0JA 4UEJA 3RVMA 1TM5E 4AF7A 1T34A 1W581 1C14A 4ZZIA 1D1QA 5CB8A 1LC0A 1Z4JA 2DTXA 2J46A 2BF4A 4B3JA 5AUOB 2C4KA 3GZNB 1T24A 3O3CA 4P32A 4F4DA 2PK3A 3ZBPA 3MT7A 4ARZA 5IKEA 3SFVA 1PUIA 1GZSA 4ZIRB 3DD1A 3PC7A 1LS1A 5C80A 1M1NB 3Q4GA 3L9WA 3ZYCA 4BJ1A 5BR4A 2NT4A 2VKQA 4S04A 1H4QA 1V5FA 3I9V6 3ZDCA 1YC5A 2G7ZA 3BWEA 3GP5A 2IEAA 3EYWA 3DGEC 1KMHB 1PFQA 2AMFA 4LIPD 1DTWB 1X80B 2CD9A 2CNWD 3NM6B 5F76A 3DO8A 3LQRA 4IIJF 1P1RA 2JLSA 1POWA 3SLGA 5H3HA 5IF3A 3W3ZB 2RHHA 1V2HE 4CV0A 5BSHA 1CUAA 2CWWA 4O02B 1W4BA 4PLGA 2X1LA 2DKOA 4NMWA 5JMTA 3BCSA 5JAUA 3B7PA 2QNIA 1QRSA 1K06A 3AK4A 2GO7A 4EPVA 1P0FA 2Y67A 1FDWA 1FFWA 3N58A 3O2JA 5AI0A 5TJ9A 3K2EA 2I55A 2H07A 2VH2A 4N7BA 1YQQA 3SEQA 2JAPA 5JJ5A 2XECA 3EOZA 1NP3A 4H7IA 1JR2A 1JDBC 3DKRA 3RADC 1LPAB 2J09A 1VPTA 3F4BA 2GPBA 2ZJ6A 1KK0A 3OO1A 4D46A 4HH4A 4L15A 4XIIA 3BN3A 5KDOA 2L19A 3OO0A 5TB5A 3WYDA 3EXEB 2FP4B 1IG0A 3GARA 4FN4A 4ESVA 3PUZA 2B20A 4ZHSA 3LP8A 1Q14A 2VNKA 4GL4A 4LTMA 1KFBB 5ARBA 5IM4A 1F1BA 1WBJB 1OLXA 2ORED 2VAWA 5K3FA 4JLAA 1N77A 4Y2PA 1ARZA 5E2BA 3S2UA 1LWNA 3W6OA 5L9AA 1XVAA 4TS4A 4B7ZA 4ZO4A 1W96A 3ANMA 3IOCA 4ZXPA 4DPMA 2JG3A 2V98A 4H1VA 4GWLA 3V1MA 4JQCA 4IHJF 1TIBA 2IIPA 5JPIA 5JSZA 1X8KA 1ZUD1 2PX0A 2QLBA 1L5SA 4AJ4A 2O4CA 2MR6A 4BO3A 1VXRA 4PX9A 4LZNA 1IEVA 2OM6A 1G3MA 3P9QA 4R4JA 1NT2A 2YTZA 1XR3A 3CUSA 4OSEA 2I29A 3AU8A 1U7WA 4G81A 3S2SA 4BV9A 2C88A 1E9BA 2E0IA 3GJ8A 2JGEA 2ZUEA 4EOGA 2HN9A 2XXJA 3OP1A 4G09A 3HN7A 4Y8VA 2RC5A 1PWXA 2QYTA 5IXJA 2FW8A 2B8JA 2ZE8A 1JTVA 3HWRA 3MWYW 4B81A 3H2SA 2W6OA 4O4JA 5K0NA 3RREA 4J7UA 4Y2GA 5BNWA 3WDMA 5J2TA 1A8UA 2PN1A 2WVAA 2GAIA 4GPD1 3IMFA 4Z9XA 1Y7LA 3FNFA 4Z99A 3VKVA 4EA8A 2Q3EA 3EDRA 5BQ5A 1Z7YA 2HHCA 2ZK7A 3PDWA 5GM1A 1KY5A 2WV9A 3DE6X 3L8FA 3OPYB 3X3HA 1E1QA 2ZE5A 4UVIA 1I4DD 4KJZA 5AW4A 4Z4IA 1NVGA 3KXLA 1GRNA 1SG0A 4GBED 1WCXA 3DC7A 2GI4A 3F8WA 3T7DA 4MW9A 4D1YA 1QF6A 3U31A 3EA0A 1AH2A 2YCLA 2OAEA 3C3XA 4JEHA 4MUFA 4WZ6A 5AXAA 2G9NA 2LVBA 1DJNA 3W6PA 3K6SB 2Z1NA 3LP5A 3LUAA 3N7TA 5EIAA 3PT5A 2P0EA 2KB0A 3R3UA 2PUAA 4IO0A 1RIFA 3A1UA 2OBMA 3D6JA 1YO6A 4QQRA 1C7RA 3Q5DA 5IZ4A 2GJSA 3GVHA 2DFKB 1MT0A 2ZI6A 3WHLA 1CNFA 1W4RA 4ZYLA 1JKXA 3CJRA 4JL8A 5E1MA 4CMBA 4F8EA 3CPJB 5I3CA 1LFAA 4M1KA 3E84A 4TZTA 4B6OA 4YV2A 4WXEA 1Z4PX 4JOSA 3QFTA 1SU8A 4NP6A 1NBWB 3SR0A 2BFPA 4FYJA 3TWOA 3A6DA 3DE3X 1U99A 3PQ4A 4ZGGA 1LI4A 1MRNA 1PT8A 3W2IA 1V6CA 1WB6A 1KFEB 3SK0A 2J9YB 3R3YA 4LRWA 1PR1A 4P53A 3O47A 4J1TA 1VCOA 2UYOA 2I4OA 1DXOA 5DHQA 2G1AA 2BJWA 1CS0A 1HT3A 3M6MD 4NQRA 1UJ2A 5KYYB 4R2IA 4OB8A 1B74A 1QK4A 3D8BA 4QJ3A 4TMWA 5KYWA 2Q6OA 2C03A 5CLFA 1SUFA 4N40A 4S2UA 3ZE0B 3DPIA 1QVVA 2PSHA 3PC8C 3SM9A 4TWZA 3JSAA 4F4FA 1U2GA 3KKOA 4X1YB 4F38A 2PX8A 2W2XA 2BKXA 3LHFA 3JAWB 3PXBA 1G5IA 4KGDA 4YWJA 1M2FA 3ZWOA 5G02A 1SC1A 4QKQA 2BWJA 2E1PA 3LT2A 4ZQGA 3B48A 2QTHA 3CT6A 1PJ2A 2J5RA 4B4UA 5JEDA 3CF0A 1E64A 1SBYA 1U3UA 4YRLA 1XKLA 1NAIA 1FA9A 1EI9A 2VLBA 4GZMA 3VKUA 5ER9A 4B6JA 3C2QA 2NGRA 3KWFA 4MSUA 3B89A 4Q7EA 1N7JA 3U4AA 3ZJUA 2CHVA 1U8CB 4OD0A 2RIRA 3MGKA 3VX3A 4DMRA 2I54A 1Q0ZA 3MWJA 2OR3A 1YH3A 3L7YA 1QONA 5C8ZA 1CD5A 1YB7A 2GSDA 3QKIA 4LNUB 4AICA 1Y80A 1JIQA 3QBJA 4Q3OA 3GFQA 5B55A 1DAEA 3M5PA 3MB5A 2ZI7A 1QLWA 1D6JA 2I22A 1EJBA 1WXIA 2IW3A 2WSIA 4QUBA 5AUQA 1P9WA 3CLHA 2P9HA 3B1ZA 1IUOA 1UEIA 5HK8A 4GBJA 4RA9A 5FDFA 2FUNB 1E6UA 3FNHA 1FDRA 3T4EA 3D4PA 4RGBA 1DIRA 3I6BA 1KI2A 1QPBA 4N5DA 1JV2B 2V3WA 2VJBA 4DUYB 1XRQA 4M8IA 3K15A 2QN9A 5E4FA 1RKBA 1T2FA 2Q9CA 3LDUA 3PPWA 2ISCA 2NAFA 1XCOA 2WJ6A 2YXDA 1N2CA 4FYWA 1JAXA 1QQ6A 2OBLA 5EPUA 4F1JA 3MCWA 3HRIA 3U1BA 5EE5B 2WV7A 16PKA 3AYXB 4X92A 1BQ4A 1H5QA 3BCRA 2OENG 1FDTA 3C5WP 2GCOB 4ZQEA 4HNRA 3AF1A 1E99A 3ZHYA 4ZZ3A 5LU8A 1OIVA 3P2IA 3UTDA 2J08A 1IAQA 1KDTA 4JYCA 4RIFA 5H82A 5IDVA 4EQ6B 3HU1A 1XQVA 3KHTA 2BY4A 4DA0A 1HSZA 2DT8A 2ID4A 5E8JA 5J2UF 3OJXA 4M99A 3GRVA 2XCUA 1NVDA 1GCAA 4ZVVA 4INJA 5DGHA 5KYUA 3FDFA 5C1OA 4CUJA 4D44A 4OX9B 1TMYA 4MCHA 4B2YA 4WCFA 3JASA 3CEAA 4MR8B 1VL1A 3A3YA 5GQSA 1FQWA 1AXRA 2O0LA 4P9NA 4TV9B 5J2TF 1RXCA 2OSBA 2R1VA 4XA8A 2V7VA 4UW9A 3WZMA 4BFXA 4BNJA 3ZWPA 3GLHE 4RUKA 2YXEA 2H17A 1FL9A 3FLMA 4I6EA 4CLHA 1EGQA 2TMGA 3SHVA 5J5AA 2OP0A 3EVTA 1DELA 5FAKA 2O7SA 5KX5A 1W4LA 4EK9A 1OH8A 4KO3S 4I8IA 2V6JA 4XKJA 1HFWA 1CR1A 2H1CA 4EFLA 1BNCA 4DQKA 4LCBA 4WOPA 3VO8A 3WIDA 1HYEA 3L04A 2VUHB 2DWOA 3ZG6A 4PSKA 2YWRA 5DN9A 5LYJA 3S2GA 2VR1A 1E4VA 3FSGD 2XOKD 3CSDA 1T10A 4MS3A 5DI3B 5SZHB 4ZGWA 2IU6A 1YRHA 2JFYA 3H84A 1RYZA 4K9KA 4V38A 3ESXA 2P90A 3WKAA 2B4QA 4MUGA 3N2IA 1W85A 1Z5VA 4QDZA 2F8MA 2F8LA 4ZAVA 2CNNA 4NYIQ 4NDAA 4FJ1A 3UJCA 4KG7A 2WZQA 4QJ4A 5IVKA 4FI3F 4PPQA 4LXQA 3UXYA 1GU1A 1FVHA 1HDYA 1U8EA 3PX3A 4WEQA 5D86A 2HYDA 2IU0A 3GLIE 1V35A 2Y1EA 1QVAA 4KR0A 4ZVUA 3OD1A 1HETA 3AM1A 1JG1A 4AKTA 4RDIA 1PLLA 1A7KA 4G25A 3T94A 5CDTA 2VNAA 4DR6B 4XD7A 5DSXA 1CF2O 4I5GA 4F4CA 3AINA 3O0DA 5C46F 3LHKA 4POOA 5ADHA 3ZU2A 3LECA 3W5BA 4EABA 3WLNA 2JI9A 1LSOA 2P41A 1L2TA 5F3RA 2ONCA 1IMJA 1PRYA 2GN2A 4TWBA 1Q12A 2DSTA 4FDVA 3DD5A 1NSTA 3BXHA 3I37X 2G3YA 2F9MA 4HLUC 4PFJA 2C9CA 3C3WA 3VHLB 4BB5A 4E30A 5GINE 4QQNA 1HO3A 1NAHA 2HYIC 3MLAA 1SXJB 2AD5A 4RX1A 3WLSA 2L82A 2VNIA 2LD4A 3LOQA 4ARUA 3WRVA 2XAAA 4YT8A 3PWTA 3UJPA 4JJZA 4OKIA 1BH2A 4Q18A 4CKEA 1ZJ5A 2G40A 3K20A 2VF7A 4HXEB 1I6MA 1P74A 4U63A 4BMOB 2CV1A 4ISCA 5T4HA 4GMGA 2W6MA 2ARKA 4J1QA 4F0JA 3IAAA 1H65A 4UHHA 4OI1A 5BN1A 1AJEA 1W88B 3EH1A 2IZ7A 3D8NA 3QE4A 1A69A 5F7JA 4WDRA 4UAVA 2ZR8A 3I58A 3AI3A 5AI8A 3PXGA 5KCMA 2LTAA 4CM3A 3FKSD 4GUDA 3A14A 1NV9A 1XRJA 1LBHA 1YGYA 3Q85A 4FOTA 3W1VA 1XMQB 2HT1A 2LRHA 1QKIA 3TNLA 1OFTA 2JZCA 2FWPA 2HQBA 4X1IB 4R6XA 2OOKA 4KXWA 3RG2A 2WSSD 1XXLA 2OUIA 3NG1A 3PI7A 4OLFA 5EJEA 1ADFA 4D8YA 1TI7A 3GWZA 1VIVA 1RR6A 4H1WA 3ZDRA 1FTNA 1TM7E 2O2XA 2Q46A 3U60B 2O3TA 2XX3A 2OMKA 2D1TA 5I9MA 4NYJR 3RC3A 3O0TA 1JRLA 3JZAA 1GXSA 5BQOA 4IJQA 5KSPA 2PKEA 4L8GA 3TFOA 4MI9A 1J5EB 5CGQB 5JHHB 4G26A 4F4HA 4OBBA 2Q3DA 1QFZA 4JWTA 3RC7A 4GS5A 4MULA 4RTOA 1F9EA 4MYRA 2VHVA 3EAFA 3G0CA 5DLQC 2AG5A 2QUZA 4NPCA 4HX5A 4ZN6A 4Y0AA 4PNHA 2MJLA 2F67A 3A1CA 1RWOA 4NONA 3Q72A 4K8OA 1YL5A 1D09A 4D82A 1Z8DA 4F5YA 3UHOA 1P19A 5JDIA 5FORA 5E9WA 2ZUUA 3PFCA 1VSTA 4GD3Q 2D6FA 2ZTVA 3W2EA 2FWNA 1IK6A 1WOYA 1CRZA 3BZUA 4KBGA 1MAHA 4RW0A 2HOQA 3ABOB 2P9TA 4HDRA 4MS4A 3QFHA 4JROA 1C9JA 1PS8A 2MYTA 2YZKA 4OHKA 3SJUA 4CCYB 4QAJA 1ORHA 5K51A 4NNPA 4BFSA 1H4TA 5I8ZA 1BX1A 4OL9A 5G1NA 1WHSA 4C4PA 2Y27A 1ISHA 3O4JA 5MGBA 4O3MA 4Z1OA 2VJMA 1E6LA 4JUDX 3W5DA 2IXFA 2NSDA 5B37A 2DWPA 3FX2A 2QMUA 3EDOA 4EW2A 2W0SA 1BRMA 4B4KA 3NMUF 4MJ3A 5CA0A 1NHGA 4UVEA 1Y81A 4PTLA 1IQ0A 1G1MA 1Q17A 3OZTA 1SRQA 2B4RO 5JWOA 1Y33E 3ZE7A 2IHBA 3AR3A 1MAUA 3R23A 3WC4A 1MZPA 5J1TB 1YHZA 2Z09A 3GEGA 1X92A 3VU9B 3OFSA 2HXYA 4S1PA 1RAGA 3SCZA 1B43A 1WDTA 3H1EA 3HKDB 1UDXA 4RVSA 1W6RA 2GJKA 5IWAB 4QTUB 4P4TA 1CUUA 2CYCA 1ZY2A 4ONEA 3T1VA 1K98A 3M6VA 3QLVC 4UREA 3K35A 3MC1A 2XQKA 2X4DA 2YW2A 5AXCA 3H5LA 2YIVX 3PNSA 2H9YA 2VQDA 2XDWA 4ROSA 3NRBA 2HA3A 1MNAA 5AKXA 1TD1A 3V8BA 2BZSA 3WVNA 4R2XA 4RA6A 3F6SA 3UOAB 1NI5A 3G6KA 3A9RA 2O2JA 1UT8A 2VZ9A 1BZYA 2AYZA 5DMHA 2WYIA 5C1DA 3WI7A 1UADA 1TU3A 5LP1A 1HC7A 1DBRA 1KEPA 1T4MA 1ULSA 2HBZA 2PA0A 3EGCA 2UZ3A 3ESCA 4H3VA 1P2VA 2A14A 2OCGA 1O4VA 3QLEA 4KO8A 1MABA 1T1RA 4LF6B 1AU9A 1CIPA 1NJ1A 1DCKA 3B3JA 2X1MA 5DT9A 4CTOA 5HQ3A 4ARCA 1JA0A 3AFHA 5JLAA 2I1QA 5A7HA 5HRAA 2AMYA 3JARA 1MVLA 2XTMA 3PA8A 1M34E 5H5JA 3V7FA 1DRWA 1KR5A 1Z6PA 4AZ0A 1KAMA 2XUDA 3OZUA 4OHPA 2FDCA 2O8EB 4IEFB 4KQ1A 5G0WA 3UMGA 1FZTA 1RC1A 3VAYA 3MCZA 4YJGB 2X0DA 3G0HA 4AI6A 4KXFB 3CEMA 3FTQA 4M36A 2JFWA 5EPEA 1PHPA 2VPTA 2ZYDA 1H9BA 4ZU1X 3T3MB 3KD2A 3U3OA 4RTQA 4RIHA 3D43A 3IH5A 1PEDA 3EBPA 4JODA 3BWXA 1J24A 2CXUA 2E5FA 2WWTA 3EXHC 2VJYA 4Q3AA 3ZXSA 3ZHUA 2HJHA 2O3RA 3UGJA 4JDPA 2H51A 1EBFA 3A1DA 1Q16A 4WKOA 3K31A 2DGDA 2Z98A 3FR7A 5D6NA 2FRDA 4BVAA 5FP0A 1NM5A 1K6XA 2Z3VA 3F6BX 3H8VA 4M83A 1Y7TA 3TLYA 4DXDA 1Q50A 3QW2A 3ZDQA 1JJFA 2ZRPA 4IF6A 2QYOA 1ZCZA 2OUKA 4NV0A 5LPNA 3GCXA 4YCSA 4KIGA 4C4SA 3RI3A 3KXDA 4E13A 2JVIA 3FR8A 2PA3A 3PA6A 3KM0A 2WFLB 1ODIA 4DRXB 4N8EA 1XA3A 2XPCA 4L3VA 4MWEA 1OXXK 2IRWA 2UU9B 1P3DA 2GESA 4J4BA 4FEAA 3W04A 4HN4B 4D25A 1J25A 2A0FA 2AOUA 1UT5A 1C4XA 1TQ8A 2YHSA 3V48A 2XMZA 1H42A 4DQLA 3ZKWA 1WXHA 1E7QA 2RARA 1O8CA 1KIAA 2VJKA 3E23A 3F5DA 3EIXA 4JR1A 2IIBA 5THQA 5KSYA 1AQUA 1ORVA 2IWRA 4AJLA 1WMDA 3P2MA 4Q03A 3IRVA 3S8YA 5HYVA 4B4WA 4J16C 2Y05A 1W47A 2RCYA 1ZGBA 3K9FC 3LHDA 4IHAA 1UWVA 1XRSB 1ZUNB 3GDOA 1CJSA 4UTXA 4WDQA 1LPMA 4DVGA 3FOFC 1P9LA 1KJJA 5HBRA 2VHUA 3ZHCA 1U3TA 4AVYA 4U3JA 5C3MA 3ICQB 2AI2A 2VSNA 3GRFA 5DHTA 2G1JA 1L7QA 3ROFA 1ZQ1A 4RS4A 1TL7C 1E6CA 3KT3A 1BDHA 1ZR4A 2AEMA 4FINA 2JRCA 5HUHA 4PSAA 2CXOA 3WGUA 3PSHA 4YJHA 2FJ0A 5IBPA 1IN1A 1EX1A 1ICEA 3QV1A 5G0SA 4R3NA 5ALZA 1FJHA 2ZRQA 3H11A 3CMMA 4GICA 3A58B 5ALXA 5CITA 2BI7A 2X0FA 1VLLA 2VHWA 2XE8A 4PSCA 3TIXB 5CA0F 1NNEA 1Y4ZA 3C3KA 2J3EA 1L5GB 1SBTA 3EXAA 1M5RA 3GROA 1JDNA 1R9GA 3DHYA 4G24A 2PAAA 3AUKA 4PLHA 5E9QA 1MTZA 4AQDA 3RTEA 1O57A 4JUCA 3RVSA 3GEMA 4QM6A 4LE1A 3C8HA 1UC8A 1UMDB 1NC3A 4D81A 1QPGA 2IPNA 2WJAA 5K3SA 4X8HA 5JXWA 4MPJA 3ZV6A 3L8HA 3G7NA 5FQNA 3WAJA 1RZRA 1YIAA 3L43A 3OPNA 4TROA 4C4OA 1X7YB 4GAEA 2KE5A 4EVRA 2DBVO 2PS3A 5A3QA 5EGNA 3HBAA 4UVGA 3A37A 1BFUA 1W1IA 1MIOA 5GADl 4DDTA 1ZL0A 3BL6A 2PWBA 1Q1NA 3PZBA 4MQEB 1DP4A 1LBTA 2AXNA 1IG3A 2FSHA 2GKOA 4JBWA 4U6SA 3OX2A 4Y1GA 3IO5A 3H2KA 1JYFA 1SB8A 3DUWA 4MW6A 3V6LA 1RJ9A 5AI5A 1I0ZA 3WLEA 1XTPA 1C3LA 4BMYA 3NWEA 1F2TB 3BXGA 1CVIA 2V54A 1CRWG 1G8PA 4DQUA 4ZDWA 5KUTA 3COJA 2OZPA 1XVUA 1UM9B 4CG3A 1ZAYA 1D03A 3R6GA 1EIWA 1J9ZA 4NBWA 1JHRA 3TIGA 3RUFA 4DG9A 3GFFA 1FU7A 2PLAA 1Y5IA 2RAPA 2XLCA 4AROA 2Q4BA 4Z2YA 4J4TA 1KYTA 1UWCA 2DY0A 4C4XA 4MWCA 1HT1E 3AFIA 1TVMA 1TZBA 4JV5B 4JL6A 1PK9A 1GPMA 3GVXA 4JLNA 3FB1A 3FJYA 5LQCA 1IHUA 1J4AA 1TAGA 3V34A 4AM8A 4Z5XA 1J5PA 2RGDA 4LY9A 3VPFA 4M9SA 3EPJA 4F2HA 1M8PA 2VT2A 5CTAA 1LTKA 5KTSA 1J8QA 3K0FB 2PUWA 3KELA 2NP7A 3OC0A 3OZSA 5EKSA 2XOEA 4CW7A 5F2NA 3F6YA 3AGQA 3JRXA 1PP4A 2Y66A 1V26A 2BBOA 3SDBA 2G83A 1IY9A 2BGJA 4QQ8A 5JS6A 1TGVA 4C0AC 2GCEA 3E3MA 6AT1A 3GF4A 2OXCA 3EXG1 4B3SB 1S0UA 3B3QA 3H1BA 4DGSA 1L4MA 3OSZA 3RGWS 3RT1A 3SC3A 4KR9A 2CLIB 5LLSA 4E5NA 5IZCA 1EUCB 3SBEA 1U0GA 1E5LA 3HKCA 3OQOA 2RI1A 1M2GA 4PQRA 1GKKA 2BZ1A 1LB1B 1HE8B 3LQFA 4JQOA 4TRRA 4CCWA 2E37A 4I4IA 5JROA 1IZZA 2LZ0A 5B53A 1Y3IA 2JHFA 3CZ9A 1AUOA 4X54A 2WABA 5CA1A 4PXYA 1LBIA 4R1SA 3B13B 4EG3A 3U56A 3HNOA 4EAAA 5ADVA 2G1PA 2D1SA 2ZPAA 1W46A 1GTZA 4Y2JA 1ZZGA 5TMPA 2NXWA 3C1OA 4AMZA 3DNFA 1Y3HA 3X1WA 5LZ9A 1PT5A 3T52A 4XJXA 4LVOA 1S01A 2FGKA 3WO0A 1P31A 2IITA 1IZ7A 4QO8A 3ZGNA 2F55A 4LXIA 2EFYA 2QTAA 2UYGA 2EJWA 1G21E 3AR2A 5AOCA 3PDUA 4BV8A 3C3EA 1DHRA 1ONOA 2FZVA 3LNTA 2QLTA 2WYOA 3HZHA 2GS9A 1K1EA 3P4UA 1RAAA 3R3SA 4YRSA 3EQ9A 4BVGA 2J5KA 5CYPA 5DM60 2PMDA 2QPTA 4XQ0A 3K1ZA 4YMTA 4DBVO 4EVQA 1YCGA 2G04A 4MQUA 1WNFA 2R85A 4PZPA 4EMSA 5KNCH 4ACBA 4MUHA 1KJYA 4GOKA 4V1CI 5JNVA 1VKOA 2NTEA 2IXTA 3RH0A 3QKRB 3UN1A 1J07A 1YS4A 2Q6KA 1U9CA 2EQ5A 5IXYA 5L6LB 1NVVR 2W2LA 4Y9DA 1KMQA 4OHWA 1HXHA 3IEXA 1GUFA 2XXBA 5B3JC 2IODA 3RYCA 5HE9A 3GNSA 4U8HA 1LLUA 1OXVA 1MPXA 5CLJA 2BFEB 4GXTA 3IBGA 2OORA 1EFPA 3C6BA 3IAS1 1SAYA 2QRJA 4FOLA 3BYZA 4QAQA 5AW7A 1A88A 2LXNA 1GYPA 3WXMA 1IONA 2B78A 4H3KB 3RFFA 4GPBA 1OWLA 3T3HA 4AN4A 2FFQA 2C9OA 2V7GA 2H2WA 2WE8A 4C05A 5J4VA 2WYWA 4L57A 3I9NA 1YZFA 4ZOLB 4MO2A 2FN7A 4LC0A 2WPDA 2LIPA 3O95A 3CR8A 1X2EA 2PHZA 4HYQA 1K5HA 5DN6A 1QGZA 4WBNB 2YCBA 2HRDA 1AZLA 1CQJA 2IEYA 2N47A 3SEAA 9GPBA 4K9DA 5JO9A 3ZY4A 1WQ1R 1WV1A 4R7ZA 3ITNA 1M1ZA 2BL4A 3H6GA 4FFMA 4R1UA 3U3JA 4ZI7B 3OZIA 4WL0A 3SYTA 1RHKA 4WZBE 2QRMA 4GDMA 4F8JA 3C3JA 4PNEA 2A35A 5IEJA 2G5TA 2Q3HA 5U4QA 1NRIA 4MV8A 3ZQUA 5KQPA 2D7JA 1XF1A 5ITZA 4HVLA 3TVYA 1W2HA 3CS3A 3TOSA 2ABWA 3IGFA 2XB8A 1L4UA 3UYKA 1X8LA 2G82A 2YWCA 3JQ8A 2PBFA 1R5BA 3UV6A 3UXEA 1NRWA 3SXUA 3AP1A 4XTRA 1F8XA 2XMQA 1BA3A 1DIHA 1ESCA 3ZDEA 3ZHBA 3R7BA 4YRGA 1SKMA 2O2EA 1SC4A 2RGEA 1NJSA 2LKDA 3G17A 3DAGA 4RCYA 1M72A 2QI9C 3UATA 2LGJA 3R6WA 4ND8A 5FPYA 3V42A 1F1JA 3CXUA 3VPXA 5FI3A 6PFKA 3ETHA 4BO4A 3UA4A 3UKOA 1CUBA 4HWPA 1UBLS 2Q0XA 3GIWA 2TMYA 1CEQA 1C7ZA 3BAZA 3EWNA 2CYBA 2I6XA 1HZZC 2XRZA 3DZFA 1CUZA 4MHTA 1J8VA 1NJ6A 4TUYA 1J1IA 4N0EA 5GY7A 4N76A 3ROXA 4C0QC 1U0NA 2NTYC 4N1AA 3HSSA 3DBVO 1GKUB 2E6KA 3UJAA 3U4QB 5GJBA 4G0PA 3VYRB 1HQYE 2ZTMA 3R6LA 1A9YA 2VWGA 3LBFA 2NQ2C 5K6AC 1OF1A 4IKEA 2R6AA 4ARBA 1MRZA 2G5GX 3FD8A 4UCQA 4AO6A 4H16A 3E53A 1P0CA 1V7ZA 4B80A 2NYUA 5CCDA 1ISPA 5DK6A 3TRDA 4N0PA 5I8WA 2VZ0A 4ETWA 3ZD7A 4MCAA 1FBNA 4JT2A 4BNDA 2G8NA 2KLHA 9LDTA 5CMLA 3GJXC 3V7YA 3QF7A 1YB6A 4A26A 1N2SA 3CVUA 5FWNA 1U3FA 1X9HA 2EKLA 3QWFA 1T4BA 1MO3A 4BRSA 5CA1F 1P45A 2PMWB 4D4GA 2O7RA 4RTJA 1PL6A 3EHEA 3VZCA 1KBOA 4EELA 1T5IA 2QTZA 4F84A 1FW8A 4C0BA 2ATEA 4MKZA 5K8UA 4HB4A 1G8MA 1XV5A 3Q88A 3RUAA 3QHQA 5EE1A 2ZU0C 5EKDA 2JIQA 4TQAA 3KK0A 2PJDA 3AF2A 4FFPA 3OQPA 4LGVA 3ETCA 3KQWA 4Q1BA 2X0JA 5KDDA 4IGFA 1W48A 1QE3A 1J23A 1P2UA 1UKBA 1QO7A 1U7HA 2GBGA 2JJMA 3AHCA 3CZMA 3ELUA 3ESQA 3JQPA 4QU9A 3MBKA 2D2FA 1V39A 3CZQA 4R01A 5ESRA 5FNZA 4R81A 1NVMB 5BYJA 4LJRA 4J3FA 1KI1A 3AW9A 1V1MB 3EUWA 3AV0B 1E1YA 4O5OA 4P4LA 1ZKMA 1XZ8A 1RZ3A 3VZSA 3GZJA 1E4EA 1I32A 3E7WA 2IYZA 3PLRA 4YJFA 1UCFA 2OYRA 1DQYA 5HBGA 1KSHA 4QU5A 4KW7A 4ZCSA 2BGTA 3RYFA 4YXFA 4YJKA 1E1NA 3L92A 4NC9A 4WBXC 1QYIA 4EYSA 3I0MA 1DC3A 2HSDA 5ABPA 2DHCA 2NVWA 2Q99A 4C7OA 3BDIA 4PZLA 4QTYA 3CC8A 3TLBA 1R4NA 1SULA 3L1KA 2JH9A 4IDHA 3TTWA 2W6CX 3C14C 2BFOA 2H7XA 3FMOB 3QU5A 5CK4A 1QP0A 1V5EA 3GXOA 2G5CA 1FRZA 2VHTA 2ZYWX 3FNBA 3AIKA 1CNMA 2GN4A 3GJ6A 3O3MB 5FFFA 4C3OB 3GEPA 4MP8A 5DW0A 3LYHA 4PGFA 3UGKA 4YCMA 1D4FA 1WDKA 2CMFA 2GQ0A 1TUIA 1EBBA 5LWQA 4E22A 5JS1A 4B6SA 3LW8A 4BP8A 2FFRA 3PCTA 4RVDA 1Z0UA 4RHUA 5FWAA 1N3YA 5SYNA 1U1DA 5K05A 4I5EA 3IT1A 3IT3A 4OHCA 1BJTA 1KH3A 1H2WA 2FSPA 4YJ3F 4B6RA 1LPNA 1JW9B 4TTQA 3THXB 1DV1A 3AHEA 2AYYA 2K6GA 4Q9JA 3T5PA 4WZAA 1EE2A 1UBJS 1F3LA 3OLQA 3G8DA 1OA1A 4YRFA 3ON5A 2J5XA 4RKWA 2QN2A 3HB9A 4D56A 4RK1A 4D2IA 1Q0LA 5EVJA 1D2GA 2NV0A 1T6ZA 2ODAA 3N7AA 3EDCA 4M1MA 3LSTA 4C6TA 1T6BY 1JG7A 3A3KA 1SUIA 2BSAA 2PZFA 3C3MA 3K0KA 5G2OA 2NXCA 3VU3A 1SBQA 1YMQA 3OJCA 3TNFA 2PEZA 1X7ZA 2YZNA 3AMVA 5IPFA 1QU2A 1D2AA 2D1YA 4MR9A 1QIHA 5DDIP 1E0JA 1J09A 1NR7A 4HRVA 2WHPB 3SYLA 3D3QA 3UCFA 3B9QA 4DUGD 4DLPA 4OI0A 4BXOA 3VKHA 1MC4A 1JVSA 3A4YA 5HIJA 2PLFA 4QUGA 1Z74A 4XQEA 4CUKA 1RPNA 1EXMA 3O94A 4MCJA 3X2EA 1MMFB 5BWCA 5COQA 2VEDA 4Y9UA 4B9EA 1MR3F 3W79A 1UBTS 4UAGA 4J0GA 5EP4A 4MIEA 4CQMB 1FFBA 5KHLB 4JJFA 1GQYA 2HNAA 5TQ2A 5KNBD 2V8BA 4QUHA 4EO9A 1Z62A 4CMAA 4GX5A 3CVXA 3U61B 4ENPA 1UK9A 1XMIA 1IHOA 3KOYA 1O08A 3HEBA 2Q1TA 3GMIA 4JP1A 4YONB 4A7PA 1MB0A 1RJEA 3DT9A 3PWZA 1JN0A 2UYQA 3CU5A 2WP8J 3DV2A 5HJ5A 2RB4A 3EZGA 4F2GA 2CUZA 4PG6A 5DM0A 3EB9A 2D5AA 1GZ4A 3B2EA 5BV8A 3RTBA 2QTVB 1E9CA 1H0SA 3CSSA 3ND6A 2VXOA 2CJFA 3NC0C 4LCJA 4WNCA 1BWSA 4NCJA 3B6MA 3OZBA 2NM0A 5H7XA 5KYXA 3ZGXA 1R4MB 1VC2A 1SQ0A 4KSBA 4RF2A 1Z4OA 1R0XA 3GJ7A 1I3NA 1PR4A 1UBMS 4PZ9A 4QA9A 1H3FA 4B31A 4GKJB 2C5SA 2PSEA 1FFDA 4NBKA 3L01A 4PGGA 4RPJA 3SHTA 4KR2A 2OD7A 3IVAA 5GONA 1VKNA 3MFYA 3PYXA 5CB6A 5EXXA 1MGPA 1HDGO 2W8BB 3T5GA 4XR4A 1WUKS 2EGUA 1XKTA 1PWEA 2ZIXA 3A9TA 3HJTA 3IKJA 4LJAA 1Y5MA 5EMLA 3WDSA 4XRGA 3O8OA 1KJ9A 1YI1A 2IBSA 1U0EA 1SURA 3E5RA 1O6GA 1YR7A 1A5ZA 3DOUA 1CUYA 1SA0B 4BO7A 2EKPA 3PU6A 1YAJA 2DYKA 5FTWA 4PWZA 1ZD9A 3IDAA 3U13A 4ES6A 3ASUA 1THZA 3EIHA 5HXAA 1V1RA 3GP8A 3QWAA 1FSFA 2WKWA 1OLSB 3GRCA 3WBJA 4HMQA 1C9MA 1VXOA 1XPOA 2D1RA 9ABPA 2I3DA 2WKRA 3CNLA 2CFCA 4YMLA 1C7QA 3DCYA 2CD7A 3NU1A 5F98A 2D06A 3OE7D 1XVVA 2HK6A 2NT3A 3I6YA 3O4IA 3OEHA 2GEJA 4P5DA 2LUOA 3VR4H 4FHDA 3DQQA 4PHHA 4Q1EA 3UJ3X 4ZHQB 3KL2A 3QA3E 4LOHA 2CMDA 2XIQA 3RYHA 3FCXA 2LBPA 1CJMA 1VMDA 4BKUA 4KO2S 1JBKA 3OMWA 1YB4A 5H9WA 1R6XA 1RXUA 3L7IA 2NPIA 1LSJA 3UK2A 4AZ3B 3O1LA 4B4OA 3TTSA 1MF7A 2WVJA 4RPIA 1C4KA 1CTQA 3LLSA 1VHJA 1M6EX 2NSYA 3R0XA 2KI5A 3RS0A 2IH5A 3UJ9A 5LP6B 4YUWA 4TKUB 1O97C 3D6NB 1YE3A 4PCLA 2BFNA 5DBGA 2YFQA 4EI2A 1RW4A 1R0YA 3A6FA 4LC1A 1JVNA 2YFKA 3OT5A 4G5RA 1A27A 4Y1FA 2BMWA 3Q9UA 3CLSC 3ZIAD 2NAPA 1B93A 4FMCB 4L7VA 2GEUA 5HIAA 1U0BB 1E2PA 1TFUA 3H04A 4N3BA 5K6RA 3CTMA 3Q87B 1MEOA 1DDGA 5DRTA 1GKYA 3KPYA 2AWOA 2FX5A 3DYIA 1WXFA 4DV7B 5KC8A 4NBLA 1T15A 5D6OA 4HH3C 3KFVA 1QYVA 4A8PA 5JNUA 4HUTA 4WADA 3B38A 4YRAA 1IM2A 5CB4F 4BGIA 3W3AH 3EE6A 5FX2A 5TEVA 1PNTA 3ZGZA 4Q7MB 3UMRA 4MA5A 4O2AB 4OUKX 3D2BA 3CNOA