3BJRA

Crystal structure of a putative carboxylesterase (lp_1002) from lactobacillus plantarum wcfs1 at 2.09 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
267
structure length
244
Chain Sequence
FQGMQVIKQKLTATCAQLTGYLHTNLPAIIIVPGGSYTHIPVAQAESLAMAFAGHGYQAFYLEYTLLTDQQPLGLAPVLDLGRAVNLLRQHAAEWHIDPQQITPAGFSVGGHIVALYNDYWATRVATELNVTPAMLKPNNVVLGYPVISPLLGFTWTPTPNELAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATALATAKIPYELHVFKHGPHGLALANAQTAWKVAHWLTLALEWLADNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative carboxylesterase
publication title Crystal structure of putative carboxylesterase (NP_784706.1) from Lactobacillus plantarum at 2.09 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Hydrolase
total genus 73
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bjrA00
5J3JA 3D4LA 1KU6A 2XT0A 4GW3A 3W04A 3WYNA 1LPMA 4P08A 2GYWA 3ZV7A 4FBLA 3AJAA 4EA6A 4P93A 1UK7A 3HACA 3G9TA 1XRRA 1W75A 2Y1KA 5AI0A 3I28A 4BVKA 2DCMA 2OXEA 2HFJA 3C45A 3DKRA 4K6HA 4OPMA 3DNMA 2JEZA 3JYHA 3BF7A 5T4BA 3VVLA 1ORWA 4ZI5A 3TRDA 2O2IA 4HS9A 2HRRA 2QR5A 3RKSA 1F0PA 4BAUA 5JYCA 4UUQA 4UBNA 2PSHA 2W6CX 4NMWA 4LHEA 5JAOA 5AKXA 3HRHA 2WG1A 2WTNA 2RHWA 3WMRA 4WFIA 1GZ7A 1E66A 3WZMA 5EIEA 5D3KA 2Y6UA 3FAKA 5HKAA 3WKAA 3G02A 3NUZA 4X93A 4N8DA 3H2HA 1F8UA 3ESBA 5HF9A 5CH8A 5ALDA 1QIGA 3C8DA 2UZ0A 2BJHA 3ILSA 1XRQA 4KJXA 3WK8A 3NGMA 4JH0A 4C89A 1K4YA 4F60A 1E8MA 4EY6A 1TCCA 3T4UA 4X90A 1XLVA 4MJ3A 1XRPA 1O6GA 3YASA 3JW8A 5HKBA 2WHPB 3DL4A 1JU3A 2AJBA 2NW6A 5FOQA 3ED1A 4PSUA 1UKCA 5LKAA 3AZOA 1K8QA 3A2LA 4DYHA 4B9EA 2C4HA 4K6KA 3F97A 2HU5A 5JADA 3A2NA 4GECA 1JKMA 3DLTA 4OU4A 1BEEA 4EY4A 4AB1A 3CXUA 5KBYA 2QS9A 3C43A 4B80A 1VKHA 1MNAA 4BZZA 3DQZA 3PFBA 5EIAA 4BE9A 5ALTA 4K5QA 2WJ6A 3GA7A 2XMGA 1SCIA 5CBKA 4X6XA 3I6ZA 3FSGD 3VKFA 1EHYA 2H9YA 1JFRA 1QIDA 4TPKA 5DYWA 1LPNA 5DYTA 4JYPA 2XMDA 2XMQA 1QO7A 2QOEA 2CMFA 3IUQA 1XZKA 1CV2A 5IH7A 3WIBA 1UK9A 1A7UA 3AZPA 1G5FA 5FKJA 2HFKA 1UOOA 1XROA 4X6YA 4DGQA 4B7ZA 5AI6A 1EI9A 4M0MA 3MVEA 4RPCA 2QUAA 3V1KA 1IUNA 5I7UA 3BDVA 4PF1A 3C6BA 4LKOA 2IITA 1BS9A 3C6ZA 3GFFA 3TGLA 3K9BA 1GGVA 3ESAA 3F67A 5DTIA 1ZIXA 2QZPA 1FSSA 3R3UA 4QDOA 2I3DA 4E46A 3CCCA 2K2QB 4G8DA 3CN9A 2BKLA 2OGZA 4Y2QA 4KE8A 4EUSA 2WJ3A 1CQZA 4JEIA 5E4TA 3E4DA 2VT6A 1C4XA 4BTVA 1GKKA 5HQ3B 4RNCA 1JU4A 1WCYA 5CT6A 3O0DA 1DQYA 5LLSA 1XRLA 2XI4A 1R3DA 7YASA 1G42A 1DX4A 4FOLA 6YASA 2GYVA 3TEJA 2RI6A 2QTBA 2XUPA 4B6GA 4UBKA 4L72A 4CCWA 4AX4A 3WJ2A 4AZ3A 4WCVA 1CUWA 4MYSA 2PX6A 4UHBA 2HA5A 1TRHA 2EEPA 3O4JA 3RM3A 1VE7A 1XLUA 4UBLA 3GZJA 1DWQA 3O4HA 4EZIA 3RK4A 4MQMA 5CRIA 3I2HA 2XUDA 1T4MA 2XUHA 1Y7HA 2B61A 1XQWA 3M83A 3WL6A 4BCDA 3BWXA 3C5WP 5ALNA 4GHWA 3S2ZA 4BRSA 4NS4A 3WK6A 3LP5A 4C4ZA 4X71A 5HF8A 5ISMA 2QVBA 2ZYSA 1EXWA 4BYMA 1C7JA 4PW0A 2WFLA 5ALXA 4FNGA 5DNUA 3NOXA 5A2GA 5LZ7A 4FTWA 1THGA 1E8NA 4G4JA 5K3AA 3VJKA 1YS1X 3U1TA 4Y9SA 2B9VA 5ALVA 3WK7A 2HL6A 4H7JA 2WIFA 2XUIA 3QPAA 4GEGA 2HM7A 5AI5A 1ZI8A 3IURA 2VJDA 3JWEA 3STXA 2WFZA 3H19A 5CXXA 3N0TA 3C5VA 3WKBA 1CIJA 4DIUA 4AN1A 2B4KA 4DNFA 4F5ZA 3EQ7A 1CUCA 5EI5A 1GPLA 1H2ZA 1M33A 2QXTA 5A71A 2BAGA 3E1GA 1IZ7A 2JGIA 5JZBA 1L7RA 4WDRA 2XMRA 4ZREA 1LZKA 3WA6A 1W1IA 3G9ZA 2OCGA 2Y2VA 1XZGA 3LIIA 3QMMA 1MX5A 2VJBA 4FNMA 4IH1A 2R8BA 5E2IA 3HC7A 5AI9A 4B85A 3O9VA 4MXDA 3O4GA 4U2DA 2RHTA 4FLMA 3I2GA 4H7IA 3NWOA 3RLIA 4UFOA 1YCDA 2XUAA 5ALOA 2HHAA 4Y2VA 3WI7A 1FJ2A 4GXNA 4UHFA 2CZQA 4BCBA 4C4XA 2ZYHA 1WPXA 3D7RA 2D5LA 2H7XA 2WTMA 2WG2A 1TKRA 1X2EA 3BIXA 2WIGA 2PKYX 2XLCA 4H7DA 4AN0A 1QIMA 2QM0A 3WL7A 4KACA 3WWPA 4DSZA 2HADA 3BXPA 1WB4A 2QXUA 5ALFA 3STYA 3WWCA 3AILA 1UKAA 4ZRDA 4OYLA 3K2IA 3W2TA 4LXGA 4FBMA 5H3HA 1UWCA 1RWQA 5YASA 4S0XA 3D3NA 3PF8A 3IUNA 4WDQA 2WLSA 5AM4A 1R1DA 3QH4A 1BEZA 4DLNA 2WFLB 4PO3X 2Z8XA 4A16A 4ROTA 2J4CA 2QT9A 3ESDA 1H2YA 3IULA 2C58A 5IVHA 1CUFA 2WUEA 2BGRA 4HZGA 3ZI7A 1CUSA 2O2GA 1DINA 1XZDA 3D2BA 2AXEA 1CUJA 5C81A 4KEAA 2JGEA 5JATA 2OCIA 2C0QA 1AX9A 2HA2A 3SWWA 4UFPA 3ZWQA 4X85A 5KWIA 2HA4A 4C6HA 2OCLA 3QZUA 3PDCA 3BL8A 3E3AA 1VZ2A 4DMFA 1FFCA 1TAHA 3H1BA 2WUGA 3IUJA 2WHRA 1GPKA 1ZIYA 1BCSA 1EA5A 4HAIA 5BV7A 4IO0A 4XX1A 4C4YA 2B20A 4CIBA 3DL7A 1ZGBA 5DNWA 2WHPA 1G4HA 1ACJA 2J3DA 3EF3A 4DMKA 2RGUA 1R9NA 5ALLA 5AICA 2LIPA 5LZ9A 1JJFA 2QMQA 4QDXA 2DQYA 3KWFA 2O2HA 5AK3A 1OXMA 4W1PA 4UBJA 5JD4A 3HSSA 2ZYRA 2GBIA 5LYYA 1UFOA 4FLFA 1Z68A 4OB7A 4KRYA 4QDUA 5CT4A 2WUFA 1MT3A 3W9UA 4U2EA 4CCYB 1XKLA 5I9IA 5ALIA 1P0QA 1OILA 1ZD2P 4J0CA 2VTVA 3ZLTA 4HXFB 1EK2A 4Y2JA 4EB0A 1HKHA 3BJMA 3L1IA 5HFNA 4CG2A 5AM3A 1XZEA 2VAVA 4H7FA 2G63A 3WA7A 4KE9A 1XQXA 1JMKC 5AM0A 5AKJA 3IDAA 2HA3A 3OURA 4AO8A 5AIBA 3FYUC 2OQVA 1ZJ4A 3W05A 3I2KA 3PFCA 4OD0A 5DJ5A 3HJUA 2PSEA 3X3HA 1QONA 5EFZA 1SOMA 1WM1A 1Q0ZA 3E0XA 3M3DA 5JARA 1VA4A 1CQWA 1E3QA 4H35A 4X6UA 2QKYA 2ONCA 4AXBA 4Q82A 5HQ3A 2HA7A 4H7HA 4AMZA 5CTAA 3O4IA 4EY5A 1EK1A 2YH2A 4Q3OA 5AH0A 1PJAA 3BIWA 1CUVA 3D0KA 3WWOA 3IUMA 4FHZA 4KAJA 3LIPA 1CFJA 4X91A 3H0CA 3W06A 5C8VA 4HXEB 3I2FA 3F98A 4BCCA 3C8HA 1Q84A 3D5EA 4AO6A 1VZ3A 1GPNA 2PBLA 4B81A 5AKIA 1XRNA 2D0DA 1U8EA 2ES4A 2R11A 3PI6A 5LKRA 4WY5A 1MU0A 5FLKA 4KYVA 3H2GA 4KAFA 1GQSA 4CIAA 3ANTA 5LZ2A 4M0EA 3DCNA 1P0PA 5FP0A 3FWHA 4TGLA 4BC1A 1WHTA 4J3JA 3M81A 2G5PA 3ANSA 1B6GA 1MTZA 3AIKA 1ODTC 4QWWA 3WYDA 3HXKA 3HLKA 4FFVA 1L7QA 2OGSA 3HEAA 1CUGA 1JT2A 3G0CA 3QITA 5ALQA 2OCKA 1A8QA 5A7GA 5DLPA 3HYSA 4EHBA 4QZVA 1T2NA 1BRTA 2CKMA 1EB8A 2AJCA 4KR0A 4N8SA 1QTRA 4BDSA 4CI9A 5LP1A 1LZLA 2WILA 3V48A 1CUUA 4A23A 4W1RA 3OPMA 4H0CA 3GUUA 4J0IA 4ZGBA 1ETHA 2VEOA 1TQHA 2ZSHA 1CLEA 4IHAA 1JMYA 4RE5A 5AKHA 4W1QA 1XZLA 1IZ8A 2PM8A 3SK0A 2ORYA 4DNQA 1P0IA 4BZWA 4BVLA 3R3VA 3DS8A 5K3BA 2XMBA 2J4FA 1TK3A 4HRXA 4HVTA 1XZIA 1I6WA 3U0VA 5K3DA 4CG3A 4TVKA 2G5TA 4PV7A 4J0GA 3VISA 3H1AA 4BDTA 2BUBA 5E4YA 4JUIA 1TCAA 2HA0A 5KREA 1NU8A 1HQDA 2JGMA 4W9RA 5AM5A 3EBLA 2PSDA 2WUDA 1XKTA 1IUPA 2C5GA 1FFAA 3AINA 1LPAB 1MAAA 1QIKA 2WU3A 1J1IA 5K5EA 3C6YA 5AI8A 4J0DA 3LCRA 1QFSA 2QUBA 1YA4A 3S8YA 2JGLA 5EIHA 2XMSA 1E8DA 5ALUA 2OAGA 5ESRA 1XRMA 2DR0A 5JALA 1Q0RA 1MX9A 5BWBA 2WIJA 3D2AA 4BE4A 1R9MA 4UPDA 3GROA 4LXIA 1NU6A 2JIDA 4G1FA 4Y2YA 4KE6A 3D59A 1O6FA 4OCZA 2RAUA 5AP9A 3G0IA 4YASA 4YPVA 3H18A 2Y2UA 5C7YA 5SYMA 1ZJ5A 2H7YA 2XMCA 5BWCA 5C8XA 2EDCA 3PE6A 5AIAA 4GBGA 4H77A 3HZOA 5JANA 2HDWA 1QIIA 5HK9A 3B12A 1J06A 5EHXA 2GBGA 5CH3A 2H1IA 3DOHA 2XUQA 3O95A 1X70A 3OM8A 5CT9A 3PUHA 1CVLA 1CUYA 5JD5A 4H7KA 4Q3LA 4M0FA 2O7VA 3VVMA 3F96A 2JGJA 5T4HA 5LIPA 5K3EA 3CN7A 5AKLA 3FSGA 4E15A 2PVSA 5IVIA 1YSCA 4MYDA 1QIFA 2ZYIA 4H7EA 4BBZA 2DHDA 5AKKA 1XQVA 5CT8A 3KWJA 1UOPA 5EHZA 4C87A 1X2BA 2DQZA 3DJYA 1GQRA 1W52X 1SCKA 3LLCA 1PFQA 3ICVA 5JAHA 3PF9A 4L9AA 2DSNA 4BP8A 3IVMA 2JGFA 2HA6A 4XVCA 1IUOA 1N5MA 1YB6A 1XZFA 4X92A 3DEAA 1AZWA 4U2BA 4CG1A 4HRYA 3FOBA 3WKCA 4FDMA 5FPPA 2JF0A 2PUHA 4OUKX 5A6VA 1ZOIA 4CCYA 2QRUA 3VJMA 4QDTA 4ARBA 1DU4A 2DHCA 4WFJA 4JYMA 3FYUA 4ITVA 5JASA 2HU7A 4XJVA 3WJ1A 4K2AA 1HBJA 1UK6A 2BCEA 1N5RA 1EDDA 1UT6A 1JI3A 4IQ4A 2ACKA 3R3ZA 4N5IX 5ALZA 1LBSA 1UXOA 2Q0XA 5JIBA 4BATA 3GELA 4PSDA 4KAAA 1CUBA 4L0CA 4I3FA 3V9AA 4Q1VA 3VXKA 3WIOA 4FKBA 2WFMA 4QA9A 4BVJA 1RP1A 2PSJA 3LS2A 1KU0A 1CR6A 5K3FA 4GLBA 2AJ8A 3F8SA 3FYTA 3L1JA 4ZV7A 2VAXA 5E4JA 3EIOA 1EDBA 1LPPA 4G5XA 3Q8WA 4C01A 1YASA 2XUKA 3QVMA 4GWLA 4X94A 3V1LA 3FCXA 2OQIA 5D3ZA 1GT6A 3D2CA 5LZ4A 3IBTA 3BF8A 1BN7A 2JGKA 4DNOA 5A62A 3B5EA 2W22A 3R40A 3DYVA 5AHXA 3R0VA 4GDMA 5D7BA 1U2EA 4K6GA 1QIJA 1OCEA 1BCRA 1ORVA 3OOSA 3UMJA 2FUKA 1ZI9A 3V1NA 4F0JA 5HZGA 3DOIA 1H2XA 2PU7A 4W63A 3WKDA 1AUOA 5CXUA 1VA5A 3QMVA 1LPSA 4DTCA 2YXPX 3R3XA 3BJRA 1THTA 2C0PA 2XUFA 5ALGA 4J0HA 1CUIA 3FLAA 1LPOA 2E3JA 5EHNA 3P2MA 5FUMA 1QIEA 2VF2A 4QE3A 5JAPA 5FPQA 5LZ8A 5ALRA 2I03A 1TCBA 4EY8A 5FXMA 4XWGA 5ALPA 5A7HA 4X3CA 1XFDA 2ZVDA 1YS2X 3QPCA 1MPXA 3SX4A 1QJ4A 3VJLA 5HK8A 4UHCA 1LNSA 3FYUB 1SCQA 4CFSA 1UKBA 1W76A 1YB7A 1WOMA 3DDUA 1AC5A 4Y2TA 1YAHA 4B0PA 4Y7DA 1MO2A 4P92A 2XB6A 4LYEA 1J2EA 4I4CA 2P8SA 1S8OA 4FFWA 3I2JA 2HRQA 3F9CA 4MWSA 4N5HX 2WM2A 5HFAA 5T4EA 4BC0A 3WQHA 3ZPXA 1XQYA 2WIDA 2WG0A 3STVA 3T52A 4KRXA 2V96A 3H2JA 1CUEA 5K3FB 4RE6A 4GI1A 1QE3A 2GBCA 3DD5A 5HCUA 4JNCA 4U2CA 5AM2A 2PL5A 1XZJA 2J3QA 1DX6A 2CEKA 2C7BA 3FVTA 3QYJA 3IA2A 1E89A 3EQ9A 5DTJA 4J03A 5C8ZA 5IKXA 4UHEA 3UUFA 4PQEA 5HF5A 4G9GA 5CT5A 1UZAA 1BE0A 1QGED 2CJPA 3G8YA 1ZD3A 2BUAA 4E14A 4ZXFA 2AJDA 2Z8ZA 2GYUA 1RYYA 3L1HA 5K3CA 5HF6A 3IB3A 4INZA 2V9ZA 1QTIA 1CUXA 5ALWA 2WIKA 3R3YA 1EH5A 1H23A 1K5PA 4KE7A 1EX9A 1BU8A 2VT7A 1K6EA 1CEXA 1LGYA 1QLWA 2XLBA 1C7IA 4G4IA 2ZJFA 1EVQA 5JD6A 4X7BA 3EQ8A 2FJPA 4BRZA 1CPYA 5FDFA 3BE8A 5T4FA 3O9MA 3AIMA 4LXHA 1DT3A 3FCYA 1QIHA 1WPRA 3R41A 3A70A 1EINA 1YA8A 4HXGA 3ICWA 3Q0TA 1Y37A 1QOZA 5AKZA 3UUEA 4ZV9A 3FVRA 2GZSA 4U2GA 4YK7A 2FX5A 3DKKA 1UOQA 2PPLA 4QLAA 1L7AA 3RARA 4Y2RA 1MJ5A 5FV4A 2XQFA 3I6YA 1HPLA 4G8CA 1W6RA 1AMNA 3K6KA 1MNQA 4YX9A 4UBIA 2CBGA 1FFBA 1R4ZA 4UBOA 4O08A 2IIVA 2QJRA 5CH5A 4PSCA 1XLWA 1IMJA 4OYYA 3H2IA 1XZCA 3AFIA 5AOAA 2Y6VA 3QBJA 2WQZA 1CUAA 3HI4A 5BOVA 1NX9A 1QO9A 3WK9A 4LIPD 5FRDA 3SC2A 4G9EA 3PICA 3QMWA 5AOBA 4MWTA 4BTLA 5AK6A 1JJBA 5JZ9A 3G7NA 4Y2SA 3GBSA 4U2FA 1LLFA 2G4LA 2Z3WA 1PV1A 4B82A 2RONA 4H18A 1CUZA 1Y7IA 1CRLA 1DWPA 3HABA 1SFRA 2RIPA 3AUKA 1H22A 4Q05A 2ZJ6A 3KXPA 4UFNA 3WZLA 4IH4A 1F6WA 1J07A 2XUGA 3A2MA 1B41A 4LYDA 5IVKA 1ISPA 4BB0A 1XZBA 4P9NA 1N1MA 5I8PA 4QDZA 2AJLI 3KDAA 3OC0A 3G9XA 4UBMA 1TIBA 3OG9A 4WFKA 3FLBA 5IVDA 2I78A 1ODCA 1Q83A 4XIIA 1GKLA 3I1IA 4N8EA 1E5TA 1SC9A 2JBWA 2BUCA 3DYIA 3KSRA 1ACLA 1IVYA 4X97A 3B3QA 3IIIA 4FWBA 1QZ3A 4FLEA 4NVRA 3FLEA 5ALSA 1VJ5A 2YYSA 4W1SA 4UHHA 4A5SA 3I2IA 2XQGA 4B83A 1CUHA 3MGAA 2X5XA 4AO7A 1WB5A 3MUOA 5AKEA 4G4GA 4ZWNA 3I6MA 5DYYA 3WL5A 3WWDA 1CUDA 1DT5A 1XZHA 4I19A 3BDIA 5CMLA 2BFNA 1FFEA 3AZQA 4MQLA 2XUOA 1DQZA 4QNNA 1R88A 2WSLA 4OU5A 3I1YA 4E11A 3PUIA 2I3ZA 5ALYA 2PU5A 1HL7A 4Y2XA 4B84A 5CURA 2VA9A 1H2WA 3W9BA 4QWMA 3STTA 1VLQA 1ZGCA 5LZ5A 2ACEA 1EDEA 4Z49A 3STWA 1WHSA 3WL8A 2OG1A 1WB6A 3CCBA 2GBFA 3C87A 1LBTA 1A8UA 4OB6A 2VQ6A 3WK5A 1K63A 5ALEA 1YAJA 4EY7A 5DWDA 2XE4A 3G0GA 1D07A 5D6OA 1U65A 3A6ZA 2VJCA 1JJIA 5AO9A 5KWJA 2EDAA 5SYNA 4J7AA 4DNPA 2DHEA 1VOTA 3KD2A 1ZICA 2OPHA 4X95A 1EB9A 4C88A 5JAUA 3M82A 4BAGA 1KEZA 2V97A 1USWA 4DMCA 5JZSA 4ARAA 2VSQA 1XZMA 2XQIA 2XQKA 2X8BA 4DMHA 2H7CA 4MEBA 3MUNA 5A7FA 4G8BA 3H04A 3H2KA 2VJAA 5F4ZA 1FFDA 3N2ZB 4AQDA 4RGYA 1N8SA 1MAHA 2PSFA 2HU8A 1P0MA 5ALHA 2O7RA 4J0KA 4QLOA 1W4LA 1ZI6A 1BN6A 5CW2A 5AI4A 4UHDA 2WKWA 4B9AA 4WJLA 1VE6A 2ROQA 5AM1A 3ZLVA 5EHQA 4B0OA 2ZSIA 1VXRA 3TJMA 2JEYA 2PUJA 1BROA 2WHQA 2ECFA 4Q34A 5AJHA 2Z3ZA 1QFMA 3G0DA 4ETWA 2YASA 3ZLUA 2IX9A 2OLEA 3STUA 2WJ4A 1DTEA 4PNZA 5ALKA 2DFPA 1LPBB 2ZJ7A 4QEKA 2OAEA 4DSAA 4NZZA 2Z5GA 2C5FA 3VDXA 3V1MA 3AIOA 5ALMA 4V2IA 1ZD5A 3WK4A 5AKGA 1U4NA 2OGTA 1YR2A 3KOOA 2X76A 4EBBA 2V98A 3G9UA 5EGNA 4IH9A 4Y2UA 4OB8A 2XDWA 4MEAA 2XQJA 3C70A 2XMZA 1VXOA 2GZRA 2WU4A 2FJ0A 3C6XA 1DWOA 1F0NA 4J0JA 5AK5A 3ESCA 3FNBA 4X00A 2QJWA 4BAZA 1AKNA 4AZ0A 3G0BA 1AGYA 4HTAA 1AQLA 4F21A 1EVEA 4Q3KA 2CUTA 3H17A 3R3WA 5AOCA 4L3WA 4DM7A 2BGNA 2VATA 3WKEA 5AKYA 2XUJA 5ALJA 1HDEA 4WY8A 1A88A 3WLAA 1HLGA 3OTQA 1MN6A 1XZAA 3WWEA 4D9JA 1AURA 4BP9A 1R50A 1GXSA 1MX1A 2CB9A 1G66A 5AK4A 1ZD4A 4AMYA 3QPDA 1ODSA 4Y2PA 1UK8A 3QM1A 4FMPA 5DNVA 2HIHA 1A8SA 4OSEA 3FBWA
chains in the Genus database with same CATH superfamily
3P0IA 3OE5A 3W2GA 2X0IA 4GR4A 1ZH8A 2MSCB 2GHIA 5BSFA 2HMWA 4GW3A 4E51A 1ZG3A 3DO6A 4OHCA 1I4WA 1CHNA 4IQFA 3LHIA 3IAHA 1WSAA 2IQIA 3W04A 3WYNA 1DCKA 2HRBA 2GYWA 4PPGA 4HMQA 4OQLA 1YS6A 5D1HA 2QG9A 1DXHA 2PRJA 2EIHA 2ZATA 4KUGA 2I4NA 4KOEC 4ZMBA 1VL5A 2GLTA 4NC9A 1HK7A 2DP4E 3U19A 1UK7A 4JP8A 5GGXA 3T12A 1ZEJA 2ZXEA 5C1BA 3G9TA 1XRRA 3UXEA 1XHEA 2Y1KA 4BVKA 4OQXA 2VF5X 4P98A 5ICMA 1XNGA 4ZT2A 2ZIFA 1I9CA 3DGEC 3PRYA 5DSXA 4J29A 4CIDA 1QKKA 2HFJA 2P4EA 2QQGA 4BEBA 5LJLA 4WLUA 1GQOA 4RENA 3ZDRA 4EABA 1E7RA 1FMJA 3S5UA 4PR3A 4BL5A 2JEZA 1BVRA 3PA8A 5AXDA 1GGKA 3W3AH 5EJFA 4NV1A 4WE3A 4IOKA 5EJ4A 1RNLA 4OREX 3VVLA 3UWMA 1K7CA 1TZKA 3IMCA 3KUUA 1Z16A 4GZ3A 1APBA 5I9TA 3KBOA 2XWPA 1QQTA 2WWFA 4JI1B 2QR5A 4DXDA 1G3RA 2FWBA 1W6UA 4WCFB 5LD2B 4WZZA 5CB6A 3QKTA 3T5GA 2J4DA 1UT8A 3U13A 3DDOA 3EJWA 4MS1A 4XIYA 5B6JA 3TIGA 1ATIA 3GAMA 4MAAA 4F1JA 3DTTA 2YC4C 4RYDA 4WFIA 1I2BA 1NASA 1AMOA 1E66A 4CQMA 2IX3A 4OLAA 2NSDA 2I3AA 2QQEA 1RMQA 1W8DA 1DG3A 3P2OA 3TZKA 5HKAA 1FNSA 1SZDA 2CSUA 3HYRA 2IEBA 2IC5A 4PM4A 1FFXA 1RWBA 3Q4GA 4U9UA 5JBQA 4KTVE 1XE3A 5KINB 4BNMA 4P7JA 2QX4A 3WKAA 3G02A 3NUZA 2SCUA 3NHRA 4CIWA 4N8DA 2PKQO 5JXIA 3H2HA 2E21A 4J7UA 5CB8A 4G6ZA 3K5IA 3O82A 2HQOA 3CINA 4AJ1A 5AOVA 3ZE7A 2Z6UA 2BSXA 2INGX 3JX9A 1XGKA 1KDRA 5C52B 3SDZA 2VHJA 3D3QA 1A9XB 2H8GA 1T3SA 3A6KA 4UATA 2LIVA 5FOXA 2UZ0A 5JS8A 1OU0A 2IUTA 1ZCJA 2JD2A 1YR6A 2N1MA 2VHYA 3DBRA 3LUHA 1G6OA 3KDSE 3NGMA 4ISCA 1ZJWA 2MR6A 2HQRA 2R1TB 1E8MA 1I4DD 4RHFA 4LHXA 1O9BA 4P4SA 5K20A 5KQSA 1VQ1A 3T4UA 3VU9B 5CCXA 4LXXA 3KB2A 1P5FA 3DTYA 3HFSA 3BKXA 1T8TA 1XLVA 3PRHA 5JVDB 3S1SA 2ABWA 1WSWA 1NVXQ 2BHRA 2GEUA 4W8OA 4ZA2A 4XDYA 1MT0A 4O29A 3UMMA 2PT7A 3YASA 5DGCA 4PS0A 1E9RA 1R0ZA 2PUDA 2PRKA 5CNJA 4JUAA 2PV7A 1KJIA 1W9MA 4FQ5A 2RH9B 3ADKA 3LC1O 3ONEA 3Q7EA 4JBWA 4R1OA 3ZTTA 1ZMBA 2WHPB 4HDQB 2NW6A 1OWLA 3DEIA 3F1KA 3ED1A 1WD5A 1DJQA 5FOQA 1TTTA 4PSUA 2GHRA 3TN7A 1A82A 4RESA 1XDZA 3F97A 1BHO1 2HU5A 5LXTF 1IY9A 1SRQA 2DT8A 4GECA 4OU4A 4G24A 4AB1A 4GPIB 1M1YA 4YIKA 2ZR0A 1U94A 4DB4A 3FVVA 5G0UA 1CIVA 2VJLA 4YT4A 1POXA 2A0KA 5T67A 1KZGB 3DMTC 4N4AA 4BZZA 5CFNA 4YQFA 2AZMA 2ZRCA 1IQRA 2BM8A 3GQBB 5EIWA 1EWVA 2CDBA 3PHCA 5GONA 1E2QA 2RMKA 1AM4D 4JAVC 3PYXA 3DB2A 5EL0A 1EX1A 4JT9A 2ZJ0A 3GA7A 3QVVA 1O8CA 4I81A 1GNQA 1D8AA 1T8YA 4RJJA 5FBWB 1QHSA 3CUVA 4GIBA 2VP5A 2XMGA 1Y1SA 3N59A 1FTGA 1SXGA 4JVLA 2D0PB 3LBFA 4V24A 2CYAA 2RIRA 2VJQA 4DB2A 1NBIA 2UVQA 1PAUA 1O87A 4QD3A 4P3KA 1YZVA 3UMCA 3LP8A 3VKWA 3ZDFA 3OJWA 1K5GA 1QIDA 2B4RO 2C3YA 1TQDA 1KK2A 5DYWA 1HR0B 3ZJUA 1VPEA 1LPNA 1XCGB 3HNRA 2AG5A 5KWSA 1VHJA 3F9RA 5AT1A 1QE0A 3ABIA 4J7XA 3DR3A 1GFSA 2CMFA 3IUQA 3KSMA 5GJVC 4C0BA 2VDQB 3BHIA 4F72A 1GTJ1 3DXZA 2R79A 3RTAA 4LG1A 1RQ7A 4FONA 4OH7A 2JLYA 2QY6A 4XA8A 1OLXA 4TXHA 1UOOA 5FV7A 1YRLA 3IAS6 3ENWA 3B9BA 1YKFA 2FPRA 3OX3A 2VBFA 3OZVA 4RAQA 3JVDA 1EU1A 2YXNA 5AI6A 2JLWA 2OHOA 4YH1A 5LP6A 4G85A 1EI9A 3R9WA 4QPZA 4QL3A 2VT2A 3ZZ0A 2EZ4A 3MOSA 1JVBA 1W2HA 1YDMA 4FSDA 4KN9S 1VIDA 3AR8A 1P60A 2O52A 5L4NA 1W36C 4UUPA 3KQVA 4K9PA 2BKUA 4C3ZA 3OCUA 1VSVA 4W6ZA 1K2WA 3TAHA 4EWLA 4Q4DA 1BE1A 1YL6A 1KDTA 1WW2A 2FRVA 4LJ4A 2CEAA 3ENZA 2OV2A 3JATA 1KY5A 1B26A 1TEXA 4UZSA 5DYNA 3VTZA 2NLOA 2VKTA 4UD6A 1N5OX 4CQMB 2H11A 3Q7SA 4HQLA 5JNUA 2VI5A 3HUTA 5LXTB 3NTVA 1DC6A 4ZO7A 3W5JA 1DSSG 2PIDA 4WN9A 1GGVA 4DY6A 2VP9A 1FFXB 1G7CA 2ZRFA 1S4MA 3EUAA 1U2TA 3U1VA 5HXAA 4A82A 3LDAA 3VSAA 4HPJB 4JL8A 4ENWA 1FPQA 5EOVA 4ACAA 1NVWQ 3LX4A 2A1UB 3TTSA 4QDOA 2I3DA 4EO7A 4AYTA 5P8WA 4OEHA 4GPD1 4X0EA 3E1SA 4NG5A 2Z57A 4G1EB 1GR1A 3IESA 2J32A 4KLRA 4AKHA 4QSMA 3RAEC 2O7SA 3DBRB 3KELA 4JQOA 2QQ0A 3TXAA 4DQLA 2ZPTX 3RNLA 2AQKA 4DJJA 5E4TA 3E4DA 2DBRA 2B98A 3AEQB 4OMUA 1KE2A 4DZRA 4ENTA 2C04A 1R6AA 2FPOA 1NJ8A 2GEFA 1N4AA 1TZCA 2JD1A 1JXAA 2VZ8A 4P33A 4MP3A 2W7TA 221PA 4NU6A 2PKXA 4MH0R 3KUKA 5CT6A 1CS0B 5ILGA 4P1ZA 3UV7A 3A1NA 4GAEA 1HV8A 2B7LA 4GI2A 5HS4A 5K7SA 1GDTA 1ZRHA 1HNZB 4WNYA 3NV9A 1LI7A 1XRLA 4DR5B 2QJTA 5HGXA 4JX9A 3LWBA 1YQEA 5JXWA 1BXZA 2NU6A 1P1HA 2AKYA 3SNKA 1H8HA 1UOEA 3EGEA 1STOA 1P74A 3HJBA 1GFIA 2XWSA 3HB9A 2FZLA 4GYWA 2F9LA 5PNTA 3T4XA 1XVLA 2VC2B 1IZ0A 5BSMA 1GQQA 1LLCA 1KJJA 2MYUA 4KL8S 4CIVA 4CETA 3U60B 5IM4F 2CT8A 2DLDA 1COWA 1QC5B 4V3CA 5D2CA 4EMTA 4LWZA 4Z54A 2E5WA 4G4SO 4LOAA 3K92A 4DDWA 2B8NA 2EJUA 3FF1A 4B6GA 3H2BA 4G63A 3AR9A 2W6MA 4B2LA 4U8GA 1UJ4A 3QVWA 4UBKA 3GNLA 4TKVA 4L72A 3VFDA 2ZKIA 3ZE6A 2VQFB 3THYA 3ECSA 5CNIA 4YR9A 1Y6QA 4CLRB 3G89A 2PZ8A 4WPGA 1NVEA 4BO6A 2H17A 2NTJA 4BZXA 1N6HA 1GL3A 2G40A 2K4MA 2MSNA 3GJYA 1CYDA 4MYSA 2GRAA 2M1ZA 4S1PA 3NHAA 2PX6A 2WT9A 4UHBA 1L0BA 1R0BA 2HA5A 1TRHA 4MAFA 4U7TB 2GEDA 1E69A 1VE7A 1XLUA 4UBLA 2H9AA 1KSGA 4KN8A 3TQSA 4UDYX 1CY1A 1C9KA 1DWQA 3EF1A 3VR2A 3JPWA 3MQ2A 4LQLA 1Q1BA 3X1KA 4BNUA 3ZD9A 4AWAA 4CJXA 1PVVA 2M32A 4YAOA 2H2HA 3LDUA 2IEZA 3B53X 1IN1A 3BIOA 5DKFA 1RVDA 1Y7HA 3GLSA 1G21A 3HLYA 3UCEA 4QOFA 4NNPA 4PTZA 3NDPA 2E6KA 5ALNA 5FPHA 3WADA 1UBUS 4KHPB 2HUPA 2PUAA 1C7ZA 3PXXA 3EAFA 4NZMA 1H0KA 1I1QB 4RSMA 3RJMA 3TLKA 5M7EA 2GZ3A 4P3NA 4PZ9A 4MS3B 4E1VA 5B5SA 3PQCA 1TJ3A 5K8IA 4XUCA 1QK3A 4XYGA 3VDQA 1K6XA 5FWYB 1T1SA 4I1VA 3GMDA 1CJVC 1CY4A 1ML4A 1RQGA 2JDIA 1I2MA 5JZMA 1K3UB 3PUXA 2VNAA 2X77A 4P6VF 1OLXB 4D9IA 4LF9B 2FWMX 2FSGA 2R6AA 2ZJ3A 3GHYA 4LYJA 1L8XA 2Q4OA 2V7BA 3PEUA 4I3HA 4JIMA 4FIZA 2GCNA 3T5BA 5FAXA 3TSYA 4KQFA 2HK9A 3VPDA 4CM3A 4C06A 5LP6B 1SKMA 1YTLA 4B6RA 4MV6A 2X41A 1PGOA 2X0RA 5IEBA 1H4TA 1Q2XA 3IXMA 3AJ8A 4XKJA 4BMVA 1IOVA 3CLKA 1MQSA 2QJFA 3DZCA 4TMZA 3OKCA 3CH7A 2A92A 3FD8A 2VQ3A 4EM6A 2WFLA 4WACA 3W7VA 1FLVA 4MR7B 4U0JA 1NBHA 3EG9A 1ZJYA 5DFAA 1ZOSA 3NOXA 1Z0ZA 3JATB 5A2GA 2X0KA 4F12A 2BI8A 4FTWA 1BQ4A 1KFKB 4KQEA 5LZ7A 1E8NA 3BGIA 4AJ4A 1BYIA 4X3PA 2AD5A 5C80A 2ZBUA 4O8ZA 1HE5A 4WN9B 3FFTA 4WZBE 1O6CA 1KC1A 2P79A 2GLXA 1HRDA 3CRQA 1TL7C 1ABEA 4HWKA 4E31A 2X0EA 3LLSA 4KO1S 4LA4A 1NVFA 3WK7A 1HFKA 4L4UA 2HL6A 3OOYA 3RUDA 3NVKI 3VZCA 3D3WA 3DNPA 1NY6A 3HU2A 3OE1A 4HLUA 4IJ6A 4XVRA 5LA6A 1JN0A 3O3OB 3QPAA 4GMXA 1RQPA 5DM2A 1OF1A 2X5OA 2ZB2A 4LE0A 3H19A 3ROGA 1CJCA 3N0TA 5BQOA 4FHCA 1Z47A 1PDOA 2QXYA 2UV8A 3KSZO 2JLZA 3BWYA 3VV2A 3UPTA 4NJEA 1KI6B 2QAGA 4UMFA 4ALIA 2GCGA 4DIUA 4TTPA 2IDZA 2NX2A 4RSRA 5FFFA 4ZMRA 1SIWA 3F73A 2Q9CA 4W7IA 5C7IO 1DAEA 3QUBA 4AZSA 1D0VA 4A6EA 4PPFA 1F14A 1GPLA 3NRJA 1H2ZA 1TM4E 4PANA 2BKVA 2GT1A 1J0AA 1NXWA 4EYKA 2BAGA 2LTAA 4WCDA 1IZ7A 1I8TA 4RULA 2SNIE 2EFDB 1M2HA 3O8NA 1EFAA 1LZKA 3G9ZA 5B4VA 1RHRA 2WR8A 3UBTA 3EGWA 1OXKB 4P8RA 3B3GA 3PIRA 3LUBA 4RXTA 4UTXA 1ARZA 1ZJJA 3LHDA 1T6BY 2BE7A 3OLYA 3PIDA 4G5QA 2XNSA 4LJ9A 4BX3A 1M75A 1ZMTA 2DFVA 2Y4OA 2QF7A 4M1EA 7AT1A 3E9NA 2YINC 1VPDA 1P0CA 3ELWA 3FJ1A 1ZQ9A 1LCIA 1XYGA 2O0MA 2COKA 1PP4A 2HC9A 4YP9A 5KNLA 1MX5A 4H15A 1QLJA 3UXHA 2FMIA 2E82A 2R8BA 4GZLA 4B85A 1WIWA 3O9VA 1CY6A 1L1RA 4JP2A 1E98A 3QFTA 2RGWA 4JJEA 3L6RA 2MSDB 4KB5A 2C2YA 4LK2A 4LZLA 4PYRA 5CM9C 3RBZA 4BMSA 2ZUWA 4LDRA 5C5CA 3HWWA 3IMFA 1IQUA 4YUWA 2G25A 3E7PA 3VZQA 3ZWCA 3RLIA 3UXYA 3TOSA 2XXAA 4F8YA 3EWNA 4UFOA 2R85A 4YRQA 4DWWA 1YCDA 2FEWB 2XUAA 4MGZR 5LA6F 4EAQA 2R00C 5CGZA 1P2UA 2HHAA 3D1VA 3KOWA 4H7PA 4O4JA 3DDHA 4Y2VA 1VYUA 5A06A 3ETCA 1MC8A 1YHNA 2I6FA 3QF7A 3QHAA 5F5LA 1MOSA 4EG4A 4UM5A 2WYUA 1FJ2A 3CX3A 5DCYA 3IQXA 4QYIA 3E53A 4IZ6A 4KDEA 1MO3A 2JA2A 1ZMRA 4XRGA 4K81B 2WAOA 4ZCIA 5BPHA 2BZ0A 4MW1A 5DGIA 4WD3A 1C0KA 4HS4A 1H1TA 4QYMA 2WTMA 4GS5A 2G80A 1PJTA 2C2HA 1JE1A 1X2EA 2W37A 2PNJA 3OQOA 2QIOA 3WRWA 1YK0A 1J2YA 3BIXA 4Z7NB 4XARA 3R0ZA 3MILA 4IOLA 5AXAA 3BMNA 5FPSA 2AXNA 3WNDA 2EG9A 1LQTA 1EGAA 3KR2A 2H52A 5JSFA 2DG2A 1QIMA 3UC5A 3ZJ4A 5GZ3A 2QM0A 2X2FA 4RHCA 2BFBA 1T6NA 3FMGA 4NDAA 2G6BA 2Y1WA 3TLGB 2ECOA 2FMTA 3ZVLA 2XR1A 3BXPA 1OYOA 5ALFA 3R7NA 3O38A 3EH1A 2J6BA 4DDMA 1JDBB 1N32B 2QN2A 1GQ2A 1I4LD 1TO1E 2FWRA 4II3A 4PRKA 1DKRA 1U99A 5CVUA 3H9QA 5KNDD 3K2IA 4NHOA 3ZCXA 4RVCA 5C3MA 5J4VA 5BUSA 5JSZB 5I7AA 4PGMA 3ONWA 5H3HA 1ZRMA 2BGTA 1PR2A 2O3UA 5CAEB 5YASA 2OESA 3D3NA 3NUQA 4P0TA 3PF8A 3QGMA 3A3KA 4S0XA 5B36A 1G16A 1XHFA 2Q7DA 3RAGA 1IUKA 1J0EA 4D9BA 1FUEA 2ZUTA 2WLSA 2F4NA 3LQRA 5AM4A 2NUTA 1F1BA 1R1DA 1D6SA 3AR2A 4URWR 1E2IA 1RJ9B 1G291 4CODB 2XEDA 3PC8C 4D8TA 2WFLB 2ZU6A 3KAKA 4PO3X 1OHHA 4P36A 2VDOB 2HLPA 3EG9B 1V7CA 2HJSA 1AKQA 1M6HA 4Z3DA 3VYTB 1H2AS 1MQ9A 1J70A 5HJEA 3OCJA 2AWNA 3UJ6A 3HVRA 2VL7A 1H2YA 3K5PA 1E3EA 1TC1A 3ZHVA 5IVHA 2GI4A 4HY3A 4DR1B 1I01A 4GR5A 4LI0A 3ZKAA 3ZI7A 4ZJZA 2B0JA 3TLJA 5CDTA 2ZTSA 1W46A 1CUSA 3PJDA 3WQSB 4WERA 2Z1MA 4KPFC 1M72A 3D2BA 1UZUA 2AKAB 4YUVA 1CUJA 3NIBA 4OHOA 2XBLA 3D3WB 3JQ6A 3M6AA 4KEAA 2CNDA 4IHJA 5EN4A 2OCIA 3DCJA 1I6KA 1HT3A 1JTVA 5I4BA 1SUIA 2CE7A 4YI3A 4FFPA 3LY8A 3MELA 4OFBA 2ZE7A 4RPHA 1DAIA 1XD9A 1LFDB 4WLNA 1A3CA 1Y8ZA 3Q9UA 1DI0A 5KWIA 1ZVJA 5TE9A 4WQMA 2IYRA 4NJEB 2QAGB 1SU4A 4EPWA 2J7KA 2Z8YM 4C6HA 3PKZA 1E1MA 1F4VA 3PDCA 2VQSA 1QNLA 5KQGA 1VZ2A 4DMFA 2WJWA 2QRQA 1FFCA 1M34E 1RWKA 2P75A 1E7YA 2EP5A 3AP1A 3T1VA 5B55A 2WKQA 4RYLA 1KERA 4PYIA 1MIOA 3K0EA 2ZPUA 3BSWA 3DMTA 2NU7B 1J8YF 4DS3A 1IBRA 2YQ4A 3EVEA 1TQ8A 2QR3A 4IZIA 4U8HA 1V5FA 2JKYA 3EQ6A 1I1NA 4OXIA 5H83A 1RE1A 1R2QA 4XX1A 3TQOA 3IRUA 2BMEA 2OQ2A 4HN2A 2ZBEA 4HX9A 1HFEL 2P6PA 3H2ZA 4MVWA 1QVZA 2H1HA 2GJ4A 1CEQA 1X9GA 1ZGBA 3DEHA 2GLUA 3H0EA 4ME6A 3LPAA 4PAWA 2H57A 4RF4A 4F5WA 1BU5A 1L7OA 3O4VA 2DFLA 1ACJA 4BKRA 2NTEA 2J3DA 1OROA 2W4IA 2OP1A 4QBHA 5BN1A 2M6RA 4CTJA 3F49S 3GEGA 2COUA 2E6UX 4IIBA 4UASA 3EARA 2CLFB 4OFZA 4JUBA 1XJCA 1Q95A 1R9GA 2CL6X 1TE2A 4NK4A 1W0KD 1QGYA 2IVZA 1T8UA 3JWHA 4J94A 1KBOA 1CWUA 2CYCA 3A06A 4LJ8A 1ZN2A 2EW2A 4KXNA 4MUBA 5AICA 4D3SA 3CQ9A 1X7XA 3OCWA 4TRRA 4RHXA 3MBKA 3W9YA 4WN3A 5IDXA 4QDXA 4EA7A 2HGZA 3WLPA 5CFLA 3NM5A 4RA9A 2QPTA 4MCAA 5D00A 1N7JA 2A7QA 3C6KA 3KFLA 3OLWA 4C3VA 5BV0A 4QYIB 3MOGA 3CPSA 3HKBA 2CFSA 2CUKA 3HSSA 4LV8B 4OXXA 1I1OA 5JT1A 4NMLA 3DE2X 2BM1A 4QOIA 4R81A 3VYVA 4MYHA 1JDUA 1UBHS 1ZONA 2C4NA 3QIAA 4FLFA 4D97A 1Z68A 2LP4Y 4E2FA 4IIJF 5K09A 4KR3A 3B5IA 2O05A 1KOGA 4F4IA 1P4AA 3OZRA 3EFOA 1Z0JA 2HK8A 3V7UA 4ENSA 1F0YA 4KRYA 4P7BA 3TSZA 4TM8A 5J2UA 4WH0A 1TT5A 3T3IA 4CM1A 5CT4A 4RCVA 1MT3A 2BFBB 4KP7A 4ITRC 5BRJA 2IOQA 4QJ5A 4K40A 3E58A 1K8ZB 4LF7B 4CCYB 1L5KA 3UMRA 3J80A 4UCWA 1TUBB 1W0JA 1WBJB 2GCIA 4QUGA 1P2BA 1XUOA 5ALIA 4TXNA 1W581 1QV9A 4F2DA 1T36A 3OTGA 2BDEA 2Q41A 4J0CA 5FBQB 4C6RA 2VTVA 1FDSA 3I9KA 4RU1A 3HVJA 4H3KB 1SC6A 3TPFA 1TIPA 4CPDA 3QI2A 2PPVA 3BXFA 3M6FA 4IG9A 5CYFA 1GGNA 5FLYA 1EK2A 2Q3CA 1HKHA 1HH4A 3R0JA 4R69A 3E48A 1KVQA 3BJMA 5FUVA 5EUQB 3TVTA 1GIAA 2GEVA 4IDHA 4X84A 4EHDA 3FHTA 1EFDN 4R1NA 4JDPA 2RJOA 1ZVMA 3EGXA 1H3EA 4MITA 2GN9A 2NUTB 1JIQA 2G09A 2VG8A 1T2EA 4IVQA 1A97A 3ORSA 4KFTA 1YZFA 5K8JB 1M1XB 1XZEA 3MIIA 3ZJVA 2ZWOA 3OQHA 4QQKA 1P4GA 4F2GA 3H13A 3ZZUA 5D1NA 1O95C 4EMSA 1FP6A 2XD9A 2EATA 4A2WA 4Q37A 4LXUA 4M0CA 5EMNA 1AF4A 3DEJA 2M1XA 3VQTA 1V1RA 3U9TA 3AKZA 3Q0EA 3UH1A 5H81A 3X1YA 1T9GR 2OBMA 4J49A 3UJCA 4FZJA 1GYQA 3II6X 3EUEA 5E38A 2KW5A 3KNZA 3CE6A 2NO7A 1P5JA 3LK7A 3FYUC 3PDHA 4IF4A 3KEGA 3WAGA 3FNGA 4QUEA 1N9KA 4Z0HO 3TINA 2X5KO 2H3EA 4YMSA 3AR3A 1F2TA 1Z34A 2HNKA 2YY5A 4WK2B 1VBKA 4S1WA 4NNOA 4ZO6A 5DTRA 4OD0A 4DW8A 2HJGA 2D1RA 4ND8A 1U8AA 3AI3A 2O0KA 3LUAA 2X7XA 4FIDA 2MCFA 1J5EB 3X3HA 1QONA 2JIQA 2XYRA 3PGLA 4XSHA 1B14A 1MABA 1VL6A 1QZUA 3JZDA 4NCHA 2JFWA 4OQZA 3TMYA 5ICGA 5IJAA 5EXDA 2ZAOA 1WM1A 2WJGA 1KAGA 3F3SA 3I72A 4IIUA 1MXFA 3O8CA 1ELOA 2DWCA 1PNQA 1OGIA 2IYFA 4LAFA 2VF4X 2AYXA 4C1NA 2HA7A 1DKPA 4HDAA 4IL5A 1L4MA 2Q49A 4AMZA 1NNEA 1L8LA 3PWKA 4CQJA 1RJFA 2H07A 2DPYA 1YB5A 2YH2A 1XX6A 4MUMA 4PWZA 4XLTA 3NAQA 1F7VA 3I73A 3OQBA 1R18A 3QELA 1PJAA 5C53B 5FFNA 4Q4HB 1BCRB 3QKWA 3BHMA 1CUVA 3D0KA 1FYFA 3DP7A 3K73O 4DV3B 4DSUA 2IZ1A 5KDDA 2D6FA 2VUTA 4G4SP 2JLXA 2YWJA 3PWTA 1ZUIA 1JKXA 4FYXA 2VHCA 4G1MB 4ND3A 3WWOA 3DJFA 3UJBA 1LFAA 4N3GA 3IUMA 5DM4A 4NAUA 1ND6A 2V9PA 2JI9A 4M89A 4MRRA 3W3ZB 4Z4IA 4S2EA 5JY1A 3L3BA 1FNNA 2HW8A 3WIUA 1TI7A 5CPFA 4V0ME 4HJRA 3E3NA 3OKFA 3I2FA 3PHJA 1A98A 3F3YA 1CG6A 4WAUA 4IFBA 3PGXA 1P91A 4AICA 4JC8A 3PJRA 1QAMA 1ZLYA 1Q84A 2OECA 5DULA 4A2CA 3TFOA 2PBLA 4D9MA 3ZDZB 3BA6A 4BFWA 4HVAA 4BU1A 4BGIA 5C35A 4P80A 3UXMA 1QX4A 3TNYA 1RXCA 3TJZA 4ASUD 1ZAYA 1PD0A 3GFVA 2OVFA 1XRNA 2WMYA 2YVQA 1C1YA 1V45E 2Q8NA 1VJCA 3CSSA 3AVQA 3BGOS 4I4TA 2QTVA 2G7ZA 2B2CA 3U17A 4WGGA 1NQAO 3ANXA 3UK2A 3PI6A 4KMOA 2WQ6A 2PGDA 3B20A 3EFOB 4YT8A 4BGVA 2YX1A 4WY5A 5J2UB 1TT5B 1IZYA 1OH8A 1W36B 1PJ3A 2WNHA 1EJ6A 2WF6A 1GAWA 3EDRA 3F4KA 4JOCA 1ZBQA 1E1NA 3AXTA 2A9VA 4H60A 3T9DA 3BCSA 2PWYA 1GTL1 3ESQA 4IYRA 5FWXB 3HWRA 3GDOA 4M0EA 2V4UA 4YY3B 3VPFA 3DCNA 3EVGA 3B51X 3CSDA 1PVOA 1TUGA 1UC9A 1T36B 1UP7A 3QE2A 4FINA 1LS1A 3DT8A 2L42A 4GP6A 1U1EA 2D5IA 2G5PA 1XWWA 2OWDA 1EBUA 3ELYA 5CA1F 2RBEA 1T6YA 3I5XA 2OXTA 1Y8RA 1T2FA 4KBGA 3QE0A 2WV7A 2QMYA 3P9SA 4OYRA 2JCGA 1O7JA 4MJ7A 4FEAA 2ISSD 2ZCUA 2BI7A 3QEOA 3EGXB 4QTXA 2CNWA 2XV1A 3MZ0A 2FWPA 2NSHA 4Z5XA 5GIOE 2FW7A 1L7QA 3AB8A 2OGSA 3JQPA 3QJYA 3GCGA 2Y1EA 5DE3A 1JT2A 3V4OA 4DJFC 3LVRE 3TOCA 4C0QC 4JLMA 4NAHA 3H3XA 1PQUA 4KQ1A 1KWKA 3KOYA 4Q6BA 1WR8A 4KQKA 5BRNA 3WNVA 2I2CA 3M4JA 4KGDA 4ZFNA 6Q21A 1IOLA 1ZXBA 5DLPA 5JAZA 2BRUC 3DAPA 1DC5A 4L8WB 1GARA 5JNRA 4TOIA 1EB8A 3VI4B 3EZ6A 2P1DA 4UU1A 1QTRA 4BDSA 3RYTC 4CI9A 2WILA 3QV2A 1CUUA 5AVKA 1QZXA 5HX7A 1L8OA 5EEGA 3OU6A 4PVCA 4OLBA 2ZEJA 4OI0A 1RLJA 4LHVA 3FTNA 2QNIA 3AB3A 4ND8B 4H0CA 2N46A 2VJPA 1H1DA 2PXAA 4R41A 4F9FA 2GJKA 1N2EA 3E7FA 1EUQA 2IS2A 2OHHA 4J4BA 4J6EA 4PU0A 4ZGBA 2VZ0A 2Z58A 4HH3C 1MABB 3FDIA 3GWZA 1ZC4A 1JMYA 2Q6TA 4UVHA 1K1EA 5EESA 4EW6A 5AFSA 4W1QA 1XZLA 3LUFA 2PM8A 4FT2A 2NV6A 1QRUA 2ZBRA 2XGGA 3A6DA 1YCFA 4G5RA 4K9NA 5CLHA 2QN3A 3LWDA 3L77A 3Q41A 5HG0A 2C3MA 2YHUA 5L95A 2XKKA 4Q47A 1V37A 4BVLA 1WCIA 3D0OA 1HZJA 2FRDC 3PCRB 4LYAA 4Y6GB 2R00A 2HBQA 3HKCB 4KO4S 4U02A 2PUVA 4I6GA 1ZO8A 2LKCA 2XMBA 4BQQA 4GX0A 1XF9A 4DFDA 3QELB 1C8LA 4EHKA 3EIHA 4OQMA 1YZUA 1UR5A 2CW5A 5DBHX 3IEXA 3HBAA 1ZJZA 4HRXA 5L3QB 2WF7A 3DL0A 2NO9A 3HLTA 1VHWA 3I39X 3T9CA 5K4GA 3VBEA 5AESA 2WDZA 4D9NA 1JHZA 3GCWA 2H1OA 1I6WA 3A36A 3CKKA 4G65A 4R98A 1I3OA 4HR7A 2J87A 2PQ2A 3IP9A 3HS3A 4RF3A 5F1PA 1XNQB 5DLDA 4M9RA 3ZCTA 8GPBA 4CG3A 1P4JA 2Y92A 1VL1A 1K75A 4TVKA 4Y2GA 5SZKB 4JI6B 1QZTA 4OXYA 1DKOA 3EVFA 3VHXB 3RG2A 1TYEB 4RV9A 2YIDA 1T8SA 4JEUA 4YXWA 3H1AA 1CIPA 2FVYA 4EQZA 3FNRA 5E4YA 5TNXA 1D7AA 2O3RA 4JUIA 4S1OA 3ZGXA 4HUTA 4URVR 1FU7A 3N70A 5LDDC 1NU8A 7ADHA 3BWEA 1JQKA 2YKGA 2BEWA 3SJAA 1HT1E 4GX1A 4ZJUA 2JGMA 3QYAA 3GT0A 4H17A 3JD2A 2XH8A 1XKTA 3ER8A 4EFKA 1Y89A 2VSNA 4NDNE 4XOIA 2RHOA 2YCBA 1ZAKA 1IJEA 4PN7A 1C9EA 2X4DA 3AINA 5G1OA 1JJ7A 1LPAB 2P62A 4TXJA 4B3JA 1VP3A 4F38A 1P8AA 3VR5A 2V6JA 1R0XA 1RAGA 1O0CA 2C4MA 4J0DA 3I4LA 4C9BA 3RIGA 2QUBA 2GKOA 4XUDA 1POWA 1XELA 3QF4A 3PC8A 4IJVA 2XMSA 4KRGA 3OJ0A 1T3TA 1E8DA 3QYFA 1IEVA 1PX2A 1C3JA 1TYCA 4N47A 2PZKA 4LBVA 3SYNA 5DTQA 3H8JA 3P71T 1FYEA 4URUR 3Q3JB 3EGVA 1NJ1A 3OJLA 2RDMA 1N1DA 4X60A 1M10A 2F3TA 3OQPA 2QSZA 3CNBA 1NMXA 3WB1A 3GL9A 4DQXA 3VJRA 1NC3A 1S7CA 2QRPA 3M9XA 3QPBA 1NN1A 4GC5A 3Q3CA 1U3WA 4LCJA 3NFRA 4LCEA 5BWBA 7REQB 4ARUA 1MQ8B 3ZWAA 2ENUA 3T5CA 4AJOA 4CLOA 2Q8QA 4IOMA 4KQXA 4R7GA 2AYZA 3F9IA 4WNCA 5G1PA 4WLEA 3OEHA 3RG8A 1JSZA 3PXGA 3F0TA 4NU8X 4UPDA 1XDGA 2ZYDA 3UCXA 3BH7A 3WGZA 1IXRC 3RTGA 3EWAA 2JIDA 1N2CE 2AQIA 1F12A 4ZGGA 2QROA 1CULC 4INAA 1E3MA 1DEOA 4NENA 2GDZA 2P2LA 2AEFA 4C0HA 2OM2A 4KE6A 2Z83A 4ZC1A 4OCZA 4U6QA 3CNLA 4IEIA 2P30A 4N5LA 2GOYA 4RMJA 1S8AA 5U4QA 1FDWA 1Y98A 4NH0A 1GN9A 4HNQA 1WW3A 5EKXA 5KYTA 4YPVA 3H18A 4JSTA 5L4SA 1DRUA 1T24A 1XF1A 4OSOA 5GVRA 3SM9A 1CSEE 1P7YA 3EXIB 5I8WA 5H70A 5EQDA 1QLHA 3JYPA 5DBFA 3REOA 1U7ZA 3GG2A 2O7NA 4BUJA 3LQFA 4D2IA 5BWCA 3CEAA 3PE6A 1GRCA 2FWJA 1JA0A 2D2XA 1GGEA 2GH1A 2ZRAA 3L0PA 1F3OA 4PG4A 1ISSA 4C03A 1DIOB 3PSAA 1CY2A 3HZOA 5JANA 3OPYA 4H31A 1YMQA 2BC9A 4P7GA 5JDCC 1BRMA 1R8YA 2XKAA 4H27A 3WXBA 1MXHA 5HK9A 3B12A 3HA7A 4MRNA 1D7OA 4K6MA 3RRXA 1F2VA 2V6IA 1YBVA 1J06A 4QGSA 1LVGA 2PUTA 3WNCA 4W9MC 3IODA 3HA5A 4DUGD 1IE3A 1GCGA 5EHXA 3O2NA 4YRNA 1ORHA 5JRDS 4WOJA 1PG5A 2OB1A 2XCOA 4WXEA 1NUSA 1ABFA 2P77A 3PKJA 5KPJA 4AMGA 1QH1A 1KVSA 3PE4A 4DN6A 5J43A 3GJXC 2GZMA 3QVGA 3O95A 2RI1A 5PGMA 4Z1MD 1Y3AA 3DV0B 1IHXA 5GM1A 4EARA 1CVLA 3K71B 2ZWMA 1IJFA 3LUCA 4J2HA 2BN4A 4PGFA 5GWXA 1Q92A 4LBZA 3U3MA 3UAYA 5JD5A 5FBRB 1EFHA 4PXYA 2WB4A 3R5XA 1M66A 4ZI7A 3U4QB 4P4LA 5LDGA 1FSFA 5KOIA 1A7KA 2VK8A 4M0FA 3Q6NA 3I8SA 3FFAA 3E9CA 4LYYA 3UGKA 3GFRA 3VVMA 5IU6A 1IY8A 4Y6SA 4B7UA 5JEEA 1Z6AA 2G9VA 3BFJA 3IHLA 1OREA 3M9LA 3W1EA 3AP2A 1UJ2A 4NBUA 5AVXA 1UBOS 1E0SA 4N54A 2X0FA 4UHKA 5T4HA 5K3EA 5F23A 5DP2A 2MT9A 1WXGA 3FSGA 5JD3A 3R7DA 2XPCA 4ID9A 3CYFA 4CQMD 3A6JA 4EW2A 4WXHA 5IVIA 1DOAA 2HXSA 2A86A 5J9FA 1SHKA 4JASB 4D96A 3L40A 2ZYIA 5HYVA 1Q7BA 3S2IA 5IANA 1A7AA 3GRCA 3NATA 5CFRA 5AKKA 4TKUA 1P81A 2ZI6A 3NXSA 3VDNB 3AETA 1O97C 3CWZA 2BEWB 4GRAA 5EP1A 3JARA 4NULA 3FPCA 3HCAA 2XNJA 3B1YA 1E7WA 3L8CA 2AHRA 5BNZA 2YS7A 3HCPA 1W52X 2AR7A 3D6AA 4XI9A 4GH5A 5K8TA 1EUDA 1FNDA 1YJ5A 1EUCB 1FNBA 3PKIA 3ZDAA 4MDFA 1C0IA 4EW1A 1QK4A 2Z1NA 1X80A 1Q5PA 1GEGA 4CKWB 3ELUA 4RD0A 1DEAA 3AHCA 1A9RA 2PL3A 2ZG6A 4LN1A 2AVDA 2GK7A 3WJAA 4L4SA 4M1QA 3FOZA 3ONDA 3R4VA 5D5HA 3IELA 2Y27A 4GGOA 3OEYA 4U9IS 4B3TB 2DH5A 7MHTA 4DR6B 1AZWA 2VJNA 1O95A 4O2BF 2AD1A 4AG3A 4LOJA 2OEPA 2BE9A 1UWKA 2CFTA 3SBEA 2VXYA 4FDMA 2JVKA 4AW9A 1YH3A 2AUTA 2QRKA 3H83A 3UMVA 2P68A 2QRUA 4LXTA 2DE0X 2FY8A 2PD3A 3VJMA 1ZX1A 2B5OA 3WMGA 4DZTA 3NORA 4CG0A 2PMWB 4MUYA 1M1YE 2RHRA 3IO3A 4WFJA 4DEVA 3MK31 2YFQA 1SG9A 3FYUA 2P7HA 5I8ZA 1EIZA 2JRCA 4XJVA 4FQ7A 5GJCA 1I7LA 3WJ1A 4CLOB 2NPFA 3ZS8A 1VYVA 3IKVA 1Q6YA 4YHHB 1EDDA 4HYEA 1E2BA 5HUQA 1P1RA 2OFXA 2PG3A 5DM1A 2JH8A 3JQDA 4BNNA 4RL6A 3H6HA 3R7WA 5HQTA 2J08A 3H7AA 2OE2A 5ALZA 4L8FA 1NNSA 3MM4A 2IXBA 3H9GA 3V46A 4A5OA 4B45A 4NENB 5TQJA 1TUEA 2RGNC 3GELA 4BEVA 1AGRA 5I7WA 4EG6A 1V1MA 3C1AA 2I2FA 2NYUA 4JR2A 3NTQA 3LM8A 3AUUA 3GUCA 4L2IA 5ENVA 5IS2A 1R6BX 5I3CA 4L0CA 3T15A 3V9AA 2P3LA 4PAMA 5EIFA 2HCFA 2H2GA 3OE7A 5FHRA 3P20A 3WIOA 3ED5A 3OZTA 3ADBA 3C5EA 4IQ8A 3RYIB 3CB2A 1KDPA 1JHVA 1BS2A 4CUZA 2HIAA 4M9XA 1GRRA 1RP1A 2RGBA 4PYJA 1V96A 3Q6IA 1AQ6A 4XQGA 5BYJA 3ROFA 2GSWA 4R83A 2MSKA 1JG6A 2OKGA 2P3QA 2W2QA 2HWYA 3FYTA 4ZOEA 1GHTA 2VAXA 3ENNA 4FGKA 3OPYB 4GBED 4Y1RA 4XPIA 5JLJA 2DAPA 1LTQA 1SRRA 4EFDA 5ELXA 4UUOA 1MIHA 3BTSA 3Q8WA 2I7CA 4C01A 1YASA 5F2NA 1OXBB 1TJ5A 2PWBA 4L28A 5HTOA 3FKQA 3L82B 1UBJS 4MV1A 4DSTA 4LZPA 3FCXA 2EC5A 2IHJA 1RSZA 3LT1A 4QOSA 2AMJA 3NAGA 4MCJA 1ZU4A 4B3FX 3RSZA 1NYRA 1CZUA 1GP2A 4OA5A 4H1HA 3ZG6A 2FX2A 5AJXA 3LKBA 4JSRA 3EPKA 1X8KA 4B8ZA 1F48A 1LDNA 5F1YA 1QYWA 3W5VA 3D1JA 3PGKA 2BGGA 1C81A 3QVGB 4MULA 3GPCA 1BN7A 2Q2VA 1E3SA 1ESDA 2NQ2C 3H9UA 3LHSA 3N7TA 2Y67A 1YZKA 3NXKA 2PAFA 1M54A 1RU3A 1Y1KE 4IDPA 2APJA 4P2BA 3UW3A 4FMCF 2WWXA 3B5EA 5EVCA 2IHVA 2IYWA 3DYVA 4M60A 1ZD9A 3RSQA 3R0VA 3UJAA 1XCPA 1HDZA 3DMFA 4HAOA 2C42A 4K6GA 1QIJA 3GK3A 2C83A 4PAOA 5LM3A 1WHSB 2CC2A 1SBZA 2AR9A 3K3PA 1ORVA 5C1DA 2HREA 1FTQA 2PH1A 3EIUA 2ZVPX 1DUSA 1EDZA 3GEIA 3ROTA 3TPZA 3V42A 3ZNPA 3HV2A 4XCQA 2VBGA 4YJ3A 3SJCA 2JVIA 3P32A 1H2XA 3L6CA 5BMVF 4OL0A 2DERA 4Q24A 2JI7A 2B1GA 1VA5A 4Z3KA 2BCJQ 3MERA 1SEVA 5HNKA 4FT4A 3UT6A 5JPCA 2R62A 2XNHA 1SU6A 3GJTA 2C3UA 3CF4G 3VC2A 2XUFA 5FO1A 5K4AA 3AETB 4BPBA 3HUFA 2FWAA 1DKLA 2X6QA 3T0GA 9LDTA 4CTKA 4RJKA 1GA6A 5MN4A 4RFLA 1QCDA 1MC5A 3OMLA 4O0MA 5HEKA 1EUDB 5KX5F 5IF9A 1JEYB 1GTG1 5KJ1A 2YJ5A 2ZAIA 2OD2A 4FE4A 5EHNA 3EPPA 2Q3JA 4DA7A 3U39A 1KBZA 1Y8QA 2Q5LA 1F8XA 4OL9A 3GLFA 2PV0A 1G3QA 2H85A 4J3NA 5TQVA 1OXTA 1Y6ZA 3GOQA 2BEKA 5E6RA 4YWJA 4XOUA 5LZ8A 5ALRA 1Y9JA 1PGJA 4ZDJA 1KQ3A 1JLSA 3TEFA 4YMHA 1XJ5A 1V3TA 2HRCA 4OQQA 2IW3A 3AP3A 4V0KA 5ALPA 4RSHA 5BN5A 2ZE6A 4OKIA 4BQOA 1C4OA 1MB3A 3CEPB 3G68A 2QM3A 3JWIA 3FHCB 3EZ2A 5L6LB 1WW8A 1JE0A 5B2FA 1M2NA 1I32A 1TB4A 2HSWA 2QTAA 2BRUA 3L93A 1QJ4A 3BG5A 2FCRA 4CWAA 2X9NA 3G2JA 5HK8A 3M5CA 4XLZA 1RZVA 2WM3A 2PCLA 4UHCA 5CDFE 1U7OA 3AFHA 3FYUB 2A9QA 1EXVA 1W76A 4GYYA 1U5CA 3WMFA 4CW7A 5K6TA 1TPZA 2QRMA 1COWD 1XOIA 5EEHA 5AUNB 4DWJA 1UAYA 4E5YA 3OY2A 1G8JA 2V54A 4MPRA 3HB1A 1G8HA 1NAHA 1ZPDA 2ZI4A 1AC5A 1S7GA 1YMVA 2I7XA 1YAHA 2AF3C 3I04M 4FMCB 3A05A 2QR2A 1BA2A 4XFJA 1J8DA 2H2WA 5K0CA 4BNXA 3OF5A 1U5BA 3PT9A 1VMDA 4QATA 1UZMA 4PNPA 3IVXA 5CIWA 3DNFA 2V1UA 5DH9A 3TW8A 3ZCQA 1V1MB 1X7ZA 3JVUA 2I5PO 1K4KA 1C8VB 3RUPA 4BKQA 2HRQA 2Q3MA 2XNDA 4LWPA 4N5HX 1JQAA 2WM2A 5B1SA 5HFAA 3DV2A 1CU1A 1YZGA 3ZU2A 4TYNA 1G21E 1BVHA 3IVRA 5BMVB 1SA0A 4POAA 4HO1X 2FRDA 3WQHA 3ZPXA 1G20E 1D2NA 4RNDB 3VR2D 2B83A 1N4DA 3MWYW 1UPTA 1N92A 5ESDA 2V96A 2YBEA 3GGPA 1KAMA 1CUEA 1Z13A 3S2FA 4QUKA 3ZHCA 4X1IA 3E18A 1GJRA 4DF3A 1SPBS 2CV1A 1O6ZA 5FULA 4Y1RB 4XPIB 4QFCA 4QPDA 2NXCA 4GKVA 5H82A 5K0EA 2EKQA 3VPBA 2G08A 4D4MA 4ZV7A 4WMLA 1X1AA 2EKPA 2MWMA 4ZYYA 1PQWA 1E2KA 2X5JO 2X40A 3CRW1 4NSNA 3KXDA 4IFIA 2DOKA 4C05A 5AM2A 1QRSA 1X42A 1DX6A 1Y5LA 3MQFA 2C7BA 4GF5A 4D3DA 3QLVC 4Z4QA 1RAEA 5BW6B 4YEDA 4F91B 3C3AA 1W8IA 5JO0A 3Q8KA 2QB5A 4QOGA 1X3SA 4O02B 1N2SA 1AHNA 1IFXA 2BEVB 1J22A 4PLZA 1GNTA 2CJWB 1PX0A 3DSRA 3W5CA 2OCYC 3VU3A 3KLMX 2M6LA 4AJLA 4LRSB 5HF5A 3IQIX 5I9SA 2ZQ5A 5CT5A 2G4VA 1TUIA 2XZPA 4QTZA 5THXA 3FOWA 4FDAA 3R3JA 1QGED 4F93B 2CJPA 2Q6VA 1IC6A 1G3IA 3G8YA 1DZ3A 5JS7A 3EVTA 1NW6A 4P54A 5LL6P 2B1RA 4BNIA 2JGNA 4ZXFA 2Z8ZA 5AW5A 1SQ0A 3Q1LA 2B4QA 4E2WA 1W5AA 4MQFB 2FDXA 1P9RA 4YJ3B 2ECQA 3PFFA 3ZWWA 2GYUA 3QE4A 4ZOLA 4EHNA 4RH1A 3LWZA 2CK3A 4ZQGA 5DM0A 4BO9A 3IP7A 5HF6A 3COYA 3UG6A 5HR5A 3BZUA 5A4IS 1OGYA 1P1BA 1U7TA 1WXQA 3IB3A 5I51A 3DKPA 5H3LA 4INZA 2OM6A 1ZLXA 1PNVA 2P5YA 4IKOA 2WNIA 4OJMX 5ALWA 2XBMA 4HSGA 2EHDA 2H5LA 5DHQA 4FB4A 1CVIA 3FDXA 4EYSA 3T7KA 1JTEA 3TNLA 4AFNA 3DAGA 2YR0A 4FHGA 1DXQA 3DKVA 5K1ZA 2P8JA 2AN4A 1EX9A 1FJHA 1V25A 4HFJA 3A58B 3LXRA 2B1QA 4TQAA 1PJ4A 2WVJA 3K9CA 1M8JA 2VT7A 2NSJA 1MJFA 4FZRA 1NFFA 3H2YA 4GVPA 4HHEA 5JQGF 3PVZA 4HNTA 2PZMA 1EG7A 5E3IA 3UAGA 1V4VA 2YZ2A 2XLBA 1YI1A 2I22A 1PZFA 4JQSA 2ZJFA 1PT9A 2IELA 5E6RB 1Y4AE 1E2UA 1FYDA 1UF9A 3EASA 4DLUA 2CUZA 2ZTUA 3D43A 4QQRA 4IDEA 4QXAA 1FZTA 3VAAA 3ZWDA 1BOOA 2Y71A 3SF0A 4FMDB 5HM8A 4JN6B 5BN5B 5SICE 3OLCX 3V32A 4BUZA 2QE7A 4BNYA 1NNLA 3PUVA 4M8IA 2P9JA 4B31A 1V3VA 1JNYA 4M87A 3RTBA 2NWQA 5T4FA 1N3BA 1XMPA 3HUDA 3L04A 5C1OA 4EB3A 4MUFA 1LDGA 3FUVA 1R6XA 5I4CA 2JI8A 4XZ3A 3C16C 3ZJYA 2V7XA 3WP0A 3FCYA 2J7PD 4O59O 3WRYC 1EEHA 1M5UA 4E5SA 4RIIA 1EINA 1YA8A 3DHNA 4KFCA 4DEYA 3KB6A 3NJ4A 5SY4A 3HJAA 4EEZA 2B35A 4L08A 3UGQA 4HDKA 4ZV9A 2GZSA 3HCOA 5BW8A 4IV0A 5IMSA 1M5RA 1KP2A 1XDDA 2YVKA 5JDCA 5JYDA 3DKKA 1UOQA 1GA1A 2PPLA 1U5BB 3D8HA 2Y0PA 4Q9NA 3N3AC 1XAJA 5BWLA 3RKUA 2WF8A 1IB0A 4MKGA 3RC2A 2XQFA 3I6YA 1HPLA 3GX1A 3QVJA 4DTIA 4NOLA 1W6RA 2YOHA 1BJRE 3CLSC 2AT1A 1E2GA 5FBLB 5JFOA 5KTPA 4F92B 4CCYA 3HXTA 3VRHA 5L8VA 1QHIA 3ZD6A 4YX9A 4F04A 3MRSA 4LDAA 4Z51A 1EIWA 1BHQ1 1PU2A 1N2JA 3FOAA 2NNWB 5IZ4A 1NUTA 1YVEI 1BXRB 4FDVA 2FVXA 4TZ0A 4Q1EA 2ATXA 5DOVA 4S0ZA 4KYTA 4YCJA 3HA3A 3SHTA 1U9IC 2IIVA 3K0FA 4XRRA 2QJRA 1XKQA 5CB4F 1JG7A 4RD4A 3AF2A 4IGIA 1PLKA 4RHUA 2KLHA 4PSCA 3RVQA 5B3JC 2NXWA 1IMJA 2GPJA 2ZT6A 3T41A 3WC4A 5AOAA 3WB2A 3HUUA 4AY3A 4M4SA 1Y6GA 1T5TA 3MPOA 2C4KA 2AI1A 1CUAA 3HI4A 4F5YA 5ICFA 4B40A 3ZQKA 2CHVA 3WK9A 3PL5A 1OTXA 1SVWA 1IH8A 5A6SA 2V3VA 4ESHA 2O50A 3QSYA 1PI3A 4E1BA 2VH1A 3H5LA 2W2VA 3D4OA 4KDRA 4MLZA 3G2PA 2CNBA 2BJWA 4HSEA 4LYHA 5CA0A 4G9EA 2OCPA 3PICA 1J49A 3CNNA 1RYHA 2EYUA 3DAYA 3QMWA 5AOBA 3Q12A 2WTXA 3G85A 2JCXA 2Z4TA 3KJFA 4MWTA 5FUBA 3EPLA 2XRZA 1USKA 1JXQA 2O3QA 2VTDA 3C2QA 1JJBA 3EUFA 4D46A 4UJ3A 3G7NA 5KC9A 4Y2SA 4N0DA 3B6MA 1TMOA 4UKDA 3ZXUB 2GXQA 2ZYWX 4OOFA 4U2FA 4PX2A 1Z0KA 5CK4A 2FUCA 1JIVA 3MT8A 2G4LA 1OHHD 2XXJA 2J07A 3I8XA 2EFCB 3PLNA 5EIBC 3EF0A 4JELA 5IPFA 1TC2A 5DHUA 1TXGA 4BGEA 2Y3IA 4TSKA 4EH1A 3LVQE 1DWPA 2XW6A 4ISBA 2OKCA 2H1VA 3VSEA 2HWUA 1SFRA 2Z2ZA 4TLEA 3RDPA 4L3VA 1C3EA 1R74A 5IT0A 2V45A 2RIPA 3M2TA 1H22A 2L18A 3FPKA 4M8SA 4BE7B 4K2HA 4Q05A 3RIXA 4AKTA 4DMMA 1IDN1 1K3TA 4MV3A 1IU9A 2FN9A 3KXPA 2X6RA 4XEHA 2PBZA 4OHBA 3IP6A 1RBMA 4FOTA 4IH4A 1SEPA 3WMWA 3CZMA 1F6WA 2FDRA 1N2OA 3ZWKA 1J07A 1X1RA 5FTWA 3AGPA 3JV7A 3DULA 1RZUA 1D1QA 1P9OA 2PXXA 4ABTA 2YIVX 3MCVA 2D5BA 1V6AA 2EXXA 2P5UA 3E9DA 4KITB 5IVKA 3KD3A 1Q2UA 2X86A 3EN0A 1E4VA 4MWEA 3RYFA 2E9SA 4A0FA 2PKRA 1LRLA 4IIHA 3IT1A 1U81A 5I8PA 2Q1XA 1RCFA 4LE1A 1I7QB 4XYLA 2GASA 4HJXA 2GJAA 4QVKA 1A95A 3V8NA 2YWHA 1L7NA 1KP3A 4BX8A 1ADYA 4O4IF 1RJWA 2YIJA 3AHIA 4JEHA 4G0YA 3W1VA 5H59A 5I7SA 3IE0A 3FCCA 3DV9A 3MAGA 3SQMA 1V35A 4K0RA 1SO8A 3CX6A 4FB5A 4RWEA 4LGYA 4N8EA 2EIXA 3ZN2A 2BUCA 2RGNA 2ILVA 5CB4B 4GOND 4RZ2A 2IPMA 1WZUA 2VDRB 1KNXA 1N2HA 2AGVA 5CNMA 5JBIA 4TMWA 3SS7X 3I04A 1WB9A 1V47A 3VKVA 3CVUA 4CMEC 1JZSA 4AJHA 1IEWA 5LBUA 5COBA 4YRFA 2XYHA 4AJ9A 5A04A 5JY6A 2VZEA 1LDEA 1TW3A 4Y9TA 4EQ6B 2H92A 2DPHA 3CRNA 3SEFA 3WWYA 4UUNA 1ZNWA 2GWHA 1W48A 2ZCVA 4ZYZA 3QFSA 4ADSG 2A33A 2XWQA 2ISCA 2J8ZA 2BZGA 2QRVA 2YYSA 3NWBA 2C1ZA 4NRDA 3SP1A 4AY2A 1EXMA 3U81A 1QFXA 3WIEA 4RIEA 4JKYA 1T1GA 2UZIR 3GRRA 1CKEA 3KVVA 4A5SA 2XQGA 1VI6A 1KK3A 1NRWA 1RI5A 2VPIA 1Z39A 5EMJA 3JAMA 2TECE 4XB6B 2JHAA 4EJSC 1YA6A 1KWGA 1C9DB 1XKXA 2BFOA 2FOIA 1RCTE 4LFBB 4YAUA 1XV5A 1GLNA 1Q15A 1HFWA 1M2OA 1ZUNA 2KM1A 2R47A 2HOQA 3G23A 5DYGA 4JITA 1A77A 1CX9B 1NW9B 1NKTA 4YAWA 4QDJA 1P75A 4AS2A 1GN8A 2ZAGA 3T8YA 4KC0A 3VX3A 3FX2A 1S0UA 5JI3E 3MG9A 4HGQA 2JIPA 1JI0A 4ARIA 4QXQA 1FLDA 3TNFA 3W8DA 4P38A 4GRDA 4TTVA 2AQHA 1XZHA 4L15A 1PT6A 1V3QE 1BFKA 1NMQA 2D1SA 1OSNA 5K2MA 2F17A 2BZ1A 1E2FA 2LCFA 4I19A 2BFWA 4M88A 4MS4B 4O63O 4PFQA 1QAQA 2HMUA 2ZROA 2HCJB 1VKZA 5CMLA 4WXRA 4YIHA 2IYQA 1QHEA 3LE8A 2BGLA 5EWJA 2BFNA 2VDMB 3RAPR 3ZY4A 1FIUA 2CV0A 3K0FB 1K89A 3KQPA 5BQXA 1W36D 4D25A 4LF5B 5HKKA 2PH3A 4HYTA 2SECE 5SZJA 2VSYA 3GUHA 1QVRA 3KFVA 3MWDA 1L5YA 2GUWA 4L0QA 4ZVVA 1B15A 2ID4A 3MTJA 1TEVA 5B53A 3K6SA 4IMPA 2XUOA 1DBSA 4LE2A 2PZFA 4MLPA 3FE2A 3VYSB 2C7GA 4D3XA 3OWOA 2OOKA 4DUYB 4DMRA 2PGIA 1V4NA 3KB8A 2AG6A 2P41A 3FYHA 1TF7A 3DAFA 1YOVA 1B42A 1YHZA 3LQ2A 5ALYA 1CDDA 1XU9A 4UZFA 4FYMA 2WTUA 1JR4A 3KT8A 2EGUA 4E5UA 1ECGA 1ZVVA 3CJRA 3LX6A 1Z2EA 4O4IB 2A9FA 2VA9A 3M1YA 3EQ2A 1Z2OX 3OUZA 3E82A 4RVFA 5CA0B 1VLLA 5LQMA 1R9JA 2O1SA 2A59A 4G1BA 3EXG2 4MYRA 3UAZA 3U09A 3KR0A 4QWMA 3STTA 4CEIB 1ZGGA 2ZB3A 1KVUA 4D9FA 1XXHA 3ITNA 4JA2A 5EP2A 5K05A 5DN6D 3Q7IA 3V4RA 5TGZA 3WR5A 2Y9PB 2PQ6A 2QVYX 3CF4A 3IYLW 1PBNA 4OBWA 3STWA 3BMCB 2N47A 3QTBA 3O3NB 2OG1A 3NGXA 2Z3VA 1WB6A 3L8ZA 4JLUA 4KQHA 3UQZA 4KGZA 1XFAA 3KUXA 1OI2A 2AUNA 1CVRA 2IPAB 2IY9A 3ABRB 1TYDE 4E7PA 1FSGA 2ZU0C 4FFBB 1KJZA 2MSLA 3P9PA 1ZZGA 1L8QA 1KARA 3LWNA 3U7QA 4ZVTA 4WKCA 1JEQB 1KS2A 4LPSA 1DBIA 3RRMA 3WLKX 5LYJF 1N6LA 2LE0A 1ZK1A 4KVZA 5ALEA 1SKYE 5KMGA 2GPSA 2BDTA 1NOKA 2IPOA 3PJGA 4BXOA 3PQ2A 4AAYA 3QFHA 4TYYA 1N2IA 2WM8A 5FA8A 4DC9A 2C95A 3HB4X 1RT9A 3A6ZA 1J20A 4FYJA 4IZOA 1ZIPA 4PFKA 1FS5A 1O9HA 1JJIA 2WJIA 4Z8XA 1KIMA 4IOJA 5KWJA 3E0QA 4C7OA 1LWNA 3AFNA 4I7EA 2POCA 1V7PC 3GMTA 4QBFA 3F5FA 3RYFB 4J7AA 3TX2A 1WETA 3ITKA 1QG6A 2VJMA 4FNAA 3RV3A 3SEQA 1U7PA 4XQEA 1YONA 5DX0A 3CRRA 3W78A 1BNCA 3WHIA 1IN6A 3TQQA 4G1CA 3FWZA 5H68A 3PNKA 4Z9XA 3VO8A 4A92A 2BGIA 1AGXA 2E48A 1E7MA 4H1VA 4C88A 1O4WA 3NHKA 4YRZA 5BNIA 1L3CA 1YB4A 3ORYA 3QEMB 2IBTA 1WX1A 2BJVA 2OCDA 2XQKA 3I9OA 1JSLA 4J1QA 3S70A 4AZ3B 4N76A 3RS8A 1TA9A 4M76B 2QD3A 2RAFA 1T1JA 3LC7O 4BRUA 2GCEA 2NGRA 2IW1A 3LY9A 4HQRA 5LLTA 3VH3A 3T06B 3A31A 1I7NA 2IYNA 2PVPA 3K05A 2IU4A 3PGMA 4DANA 4YAGA 4KBYA 3L6OO 4IDOA 2NUAB 2A5FA 3QTTA 2FWNA 1EFUA 4PYQA 4QGFA 3CU5A 4LFAB 2HRZA 1UBFA 1MAHA 2A5GA 1GZ4A 2ZXUA 1QYIA 4GMGA 4ECEA 1UJNA 5EWLA 2AFHA 1ODIA 4Y30A 1DKUA 3H6KA 3NPAA 4QLOA 1KFCB 2P9HA 1B43A 1EFPA 4CQNA 2F1KA 1ULTA 2IYUA 4MDEA 3D6FA 5CW2A 2X19A 3MIZA 5FQNA 3LGSA 2VNHA 3Q10A 3E81A 4XLLA 2WKWA 5FBVB 2NSYA 3SVTA 4NCAA 1CD5A 4FSHA 1QS0A 3VNQA 1PHRA 4NBKA 4FD2A 4KLNA 1DFGA 2C0CA 4TV8A 3HJFA 4MVJE 4KYIB 1AQYA 3UWOA 3P8ZA 1RKXA 3C5CA 3DMYA 3QLVA 5AM1A 5EAIA 5BN4B 2DT5A 1PDWA 4B0OA 5J40A 4MEJA 2OAQ1 1SUSA 1CQIA 2ZFUA 2JEYA 2XECA 2VDNB 4KIJA 5I45A 5LYJB 2HYIC 2BR4A 4MVJD 1OZFA 2TMGA 1JR3E 2IYLD 3OZWA 4Q34A 4UMDA 4KR2A 2IKSA 2DQ4A 3EISA 2AA3A 2ODQA 4Q7MB 5JH7A 3GJ7A 3NYQA 4ETWA 2CXQA 1S9HA 2WJ4A 2CL5A 4PQEA 4G8JA 5EXXA 1HYGA 1VJTA 4PNZA 4EA9A 3MWDB 3B2QA 1T9HA 3KEFA 2DFPA 3D02A 3RC3A 3K6SB 621PA 3AHJA 4AJ2A 3FPGA 5HUHA 1AA6A 1N2ZA 1QF6A 2FUNB 3G8AA 2P6OA 4GKAA 1E4EA 3CMCO 2GKGA 2HK6A 5JLAA 4DG8A 4EGFA 2A5JA 3M1IA 1YOVB 1VKOA 1PWEA 3DXYA 1C1DA 3AWDA 3FVQA 1EHCA 1ACMA 2YN0A 2IF0A 2QLFA 3AIOA 1HKUA 3IPAA 1J8FA 1NURA 2FU5C 4FEEA 3WGKA 8ADHA 3RYCA 3T5PA 5G40A 1CC1S 3FZYA 1K0UA 3COWA 1TFRA 1GZ3A 1U4NA 1LS6A 1GSHA 1RTKA 2A7XA 1YR2A 4J91A 1U0OC 4N03A 4TL7A 3KJQA 4W7HA 3RBXA 3FZGA 4L4YA 3GPDG 5HSGA 4PC1A 1E60A 1QRAA 2C2WA 2H1RA 2O07A 3G9UA 4IWYA 1RM0A 4NBSA 3RVBA 4IH9A 3BHJA 4B8YA 4BBPA 1BDIA 4Y2UA 3FTFA 2R9VA 5E9JA 5H16A 3Q2KA 1XCLA 3PDWA 4OGGA 3WZ2A 2XQJA 3KRTA 4GFDA 3C70A 1NZJA 5TB5A 1GUYA 3OZIA 4MUGA 3K15A 2GZRA 4UXJA 1ZOLA 5I5GA 3QKSA 3C6XA 2WF9A 1UZNA 3B8HA 5EKDA 4U0KA 3GRKA 4FCWA 4J0JA 1PD1A 4MP8A 5AK5A 1DBWA 3TVDA 2ZYUX 3U7FB 3GGGA 1PVDA 3ZXSA 1DIAA 4X00A 3U7QB 2PANA 1PK7A 3HWX1 3L7JA 2IUEA 1WDTA 2OL4A 3LNTA 3BILA 1IN7A 4PHCA 3RIEA 2VAMA 1F1JA 3PXUA 3ENQA 4HL6A 2F90A 1UADA 1XVIA 1D3AA 3J7AC 2YJGA 4K28A 4LY0A 1C14A 4ZARA 4BXOB 4DILA 4S1VA 2MSEB 2BFMA 2Z6AA 1JGTA 2IY7A 4FE3A 3V8QA 2JC3A 3HCCA 5DHFA 3U3KA 1EVEA 5ULLA 1G2QA 1NHGA 1SHJA 4QM7A 2IGTA 2YN2A 4C7OB 3PNLA 1FVHA 1MH1A 3FDFA 4TT3A 4DM7A 1ZH2A 4L3WA 4E5NA 3G2NA 1A7JA 5AKYA <