4XWAA

Tmk from s.aureus in complex with the piperidinyl thymine class inhibitor with a c5 ethyl-amine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
204
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate kinase
publication title A highly potent antibacterial inhibitor of Gram-positive bacterial thymidylate kinase (TMK): SAR of piperidinyl thymines at position C5 and L1
rcsb
source organism Staphylococcus aureus (strain mu3 / atcc 700698)
total genus 86
structure length 200
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwaA00
3EA0A 4ZO4A 2RHDA 4URWR 2C03A 2I1QA 4D81A 1N6HA 4K46A 4HAVA 1IJEA 3IHWA 5EP3A 3K70D 1AJEA 4I1UA 3L8YA 3F0TA 2H92A 2OM2A 4OQNA 1EWRA 1YJ5A 2ZJZA 1R0YA 2FFHA 5G40A 1FP7A 1IXRC 1RRFA 1P3JA 2XNDA 1XWIA 1MO3A 3G5UA 4OBEA 4Q1AA 5BYKA 3IIJA 1G3MA 2VF7A 1BYIA 2QU8A 4LV8B 4NL4H 1OSNA 3RANA 1EGAA 2OBNA 2PLRA 4ON9A 1OPXA 1RFLA 3HYRA 1SVKA 4EIWA 1Z8FA 4LSGA 4Q00A 2GEDA 2C95A 4PC1A 421PA 1S96A 1SXJD 1US8B 2QA5A 4PHHA 3KQKA 3M1IA 5HPYB 3RS2A 4BFUA 3W90A 5GJWC 3ZDQA 4C0SA 4OQLA 4RD2A 3GPLA 4A0RA 1GKIA 3EXAA 2CVHA 5K8LA 2NQ2C 5HCIA 3LNCA 2OLJA 3F3YA 3U4QA 3AKEA 3IDQA 3TRFA 4BASA 4LYAA 2V8OA 4Q9KA 4DHEA 2EQBA 3CX8A 3U5ZB 2D2FA 3KJHA 4ACBA 4BLSA 3Q7QA 1HY3A 4NMMA 4CW7A 2JA1A 5G3YA 2ZRPA 2QUZA 1T8TA 2OCBA 4ZCLA 1AZSC 4LBZA 2H7VA 1E9CA 2J1LA 1P4SA 4QHYA 2V6IA 2ZR7A 3MUFA 1KJWA 4CRWB 1GUAA 4MKHA 2ZPTX 4HI0E 1HA3A 3F5FA 1W2GA 4V03A 1XD2B 2W2VA 3I8XA 5FPYA 3DOEA 1SZPA 3CLVA 1DO0A 5FBRB 3SQXA 2ECKA 4WZAE 3B78A 5DN6A 2JJ1D 5JMTA 4NDZA 5JHGB 4AYXA 2GTPA 1DOAA 4LI0A 3VNVA 3PUYA 4XWKA 2WJIA 1E79D 2CK3A 2IW3A 4OHWA 4QJ4A 4B47A 1CULC 1FX0A 1NLYA 2XAUA 3QENA 3RWMB 3NVAA 4DLVA 1XDBA 4MYCA 4C7OB 3MJHA 3OIUA 3LBHA 4LK2A 1K5DA 3DMNA 1NMXA 2RAPA 2REOA 1W46A 2OSBA 3BH0A 4NONA 3BWDD 2XSZA 1SVWA 3F8TA 4HLUC 2QM7A 4NCNA 4JSYA 4ARZA 2OHFA 1W36B 4B2IA 2HJVA 4MITA 3NTUA 3O8RA 1KNQA 3HU1A 3AVOA 2G3YA 1T6NA 5ANRB 1E69A 1CRPA 1FTNA 2O0JA 4FMDF 1JI0A 3SQWA 1BH2A 1KSHA 3CF0A 4HB3A 4Q1EA 4EFLA 1NLZA 5FL3A 3KJIA 3MLEA 5JLJA 2X2EA 2IXEA 5FFMA 3Q8XB 4URUR 2FE4A 4M53A 2OV2A 1XB2A 3DPUA 4HAWA 1E9RA 2QPOA 5CYPA 2VHCA 3L0IB 4LC0A 1KK0A 3FMPB 3DMDA 2OZEA 3LQRA 4R2HA 2QP4A 3FMIA 1VIAA 2QE7A 3T06B 4EFNA 1KTVA 3EWSA 2V3CC 3AVUA 1A1VA 3LX8A 1P2SA 3L8ZA 3VR4A 4P3YA 1HE1C 2WJGA 3HR8A 2F55A 5L3QA 2WWFA 2ORWA 4NHOA 2BMJA 3FFAA 2OUKA 4LV5B 2ZE5A 3GCGA 3EZ9A 4K8OA 4CZ2A 2V54A 5G3ZA 3AQ4A 3IO5A 1M8PA 4C0JA 1YZTA 4A8JC 3EPHA 1XTIA 2WVJA 1E2QA 2DFKB 4KBFA 2BMDA 4RZXA 4DSNA 4ZDKA 2J0VA 1T3SA 2Z43A 3PQCA 5SZKB 2PMDA 2W2XA 3D8BA 2WSMA 2D7CA 3NIBA 5CM9C 3U6KA 2GRJA 1LNZA 4Q7MB 4R2IA 5A4JA 1S3GA 3A4NA 2YOFA 3B13B 8OHMA 2FH5B 4GRAA 1F6BA 2QP9X 3P20A 4TL8A 4CEHB 2F43B 3KFXA 1BYUA 4P4SB 4JZKA 2CXXA 3ZYCA 4R71A 4IDPA 2AKAB 4NYJQ 1PVOA 1XU4A 1R0WA 2BOVA 1RYHA 1Z6TA 4ZIRB 2BCGY 1VMAA 5KPDA 4GZMA 1U9IC 4C0AC 2BEKA 3I5YA 2DFTA 1GM5A 4A6PA 4TN1A 3REFA 2QAGB 3FMOB 2VHJA 5KYKA 1KSJA 5KUTA 4LRWA 4MUBA 4TQAA 3QBVA 4DUGD 2IS4A 1YZUA 1ZINA 2A5DA 5KSOA 4MGZR 4UXJA 2PEZA 1J8YF 3W34A 4DDTA 4JBXA 1GIAA 1X8JA 1GL9B 2XGJA 3GJ6A 1HT1E 4RD1A 2WBLC 4UKDA 3SJZA 3ZZTA 4IDHA 3UXMA 1Z06A 2AHOA 1NBMA 2HLDA 3AF2A 2NO1A 3RSLA 1UADA 3RS0A 1X1RA 3KKOA 1XTQA 3NBZC 4Q03A 2QPAA 2NGRA 4JYBA 4NCJA 5JS8A 3B8HA 3QF4A 1ZM7A 1NVVQ 1KGDA 2IWHA 1ESMA 2PCLA 1JR6A 2JGNA 1ZRHA 3IBGA 3ZS9A 1TMKA 2AXPA 2BMFA 1W44A 2WJYA 2ZRAA 3VR5A 3ZIAA 2WMOB 4DCVA 5B57C 3MG9A 3QEJA 1YZLA 2BV3A 3QG5A 4FCVA 4O2RA 4BLRA 4AKGA 4LJ5A 2ZE6A 1EG7A 2IK8A 3LY5A 5EE3A 2NZJA 2R8RA 3B9QA 4Q7LA 1T0JB 5J4KA 3QPWA 3W3AA 3U6BA 1IN6A 1PLKA 3OIVA 1JXOA 1Q22A 4OHYA 3NHBA 3HJNA 1GL7A 3I72A 2ZSEA 4AURA 1DAIA 4UJ5A 1Z6XA 5DHFA 5JWHA 4Q1CA 3EPKA 3GEEA 1HQCA 4GOJA 2D06A 1FFHA 3ICEA 3BC1A 2ZE8A 3FYHA 2FEMA 1FPMA 3R20A 4PC2A 1T8UA 3A1TA 2ZVPX 2QT0A 1PLLA 4LOAA 3B1VA 2QGNA 3T15A 1E1RA 1GNQA 3FWYA 3IHLA 4Q9LA 1KK3A 3AGPA 3PUVA 2JLSA 1MRSA 4HZUA 4JYCA 2QM8A 3KQHA 2W6JA 4DXAA 2XTZA 2MSDB 2G6BA 1UDWA 1F2UB 3E5HA 4CGZA 1XP8A 3THWB 4A0FA 1ZNYA 2CNWD 2O8EB 2ZR9A 2IYYA 3FKSD 5JJKA 2EYUA 2IYUA 5JEDA 4FCTA 4KO8A 1A2KC 4NYMQ 2P6UA 3EC1A 2O52A 2EFEB 1FZQA 4NKRA 4OI4A 2J7PA 4KLNA 2WWGA 3VR1A 4BQSA 4U5XA 4C0BA 3CNLA 3G0HA 2WSSA 2DB3A 1NN5A 3KZ1E 4F38A 1ZMXA 2O8FB 3I8SA 4RFSB 3RSOA 1QHNA 1Z0DA 4TL7A 5C4GB 3UWKA 4EQ6A 4QHTA 3ZH9B 2H18A 3CX6A 5F9HA 3H0KA 3KX2A 1M7HA 3P1JA 4LBWA 2KBEA 2ZETA 2FFBA 3AP2A 3FVQA 3CRQA 4DDVA 2OBLA 1P60A 5AR1A 1G1MA 3NBYC 2ZJ2A 2QRZA 3AVXA 3HWSA 1KZGB 2R9VA 2JJ2D 2BKEA 2H5EA 4Q18A 4XSHA 5FUYA 1G8GA 3I92A 3GLHA 2JIZD 1ZUHA 1KI6A 2REXB 3M4YA 3BBPA 4TZ0A 2WAXA 4DLYA 3THXA 3K9HA 3NXSA 3VU9B 2QN6A 1Z29A 2LWIA 3OEEA 1OKKD 3PXGA 4P31A 5FOWA 5FTMA 4WVFA 1TF5A 5TXGA 4BEJA 3NDBB 2BEJA 2GBLA 2YVUA 3A1UA 5FTJA 1UDXA 4OJQA 4PAOA 3H1TA 3PENA 3BFXA 4GT1A 2J5XA 3MAAC 1C9KA 2IYTA 4FINA 4OKSA 5LBIA 1YVDA 2I3BA 1EFHA 3AVWA 4IOMA 4GOXA 1IY0A 2NZ8A 1BO6A 2BC9A 1MABA 1GDDA 1NKTA 1KNXA 1E4VA 5CB8A 3AKDA 4MQBA 3KQNA 2R62A 2W0MA 3U60B 4Q4HA 1Z63A 4KLZA 5EZ6B 2IYWA 1XEXA 3E70C 1G6OA 3EARA 5JSZB 4NBSA 1QHIA 3LLMA 5G41A 1KK1A 1N6OA 3MRSA 2DFLA 3PG5A 3CH4B 1M2OB 3JVUA 3U3RA 4HAYA 4IHQA 3AKCA 1A5TA 2OILA 4G5GA 1GAJA 2O8BB 2PBRA 3LXXA 1F3OA 4KI0A 2P6NA 5H8WA 1S2MA 2FX3A 4M1KA 5JWOA 1PJRA 1U81A 2J46A 2ZSBA 4JJKA 1VG1A 3CNOA 1K8RA 3ETLA 3DKPA 2ZRCA 2NPFA 4AD8A 2CVFA 3U3KA 3SI7A 1G7CA 4BFWA 5FH9A 1NY5A 1Z6YA 1R7RA 2GESA 4JVNA 3C5CA 4KV9A 4O2LA 5DSZA 5GJCA 3HYTA 1JEEA 3TW4A 4AWXA 4AKIA 4RD6A 1QHHB 2P5TB 4TTRA 4GDFA 2IBMA 4KCGA 4QC2A 2IYZA 2W6IA 3CWQA 4BGDA 4QBHA 3THOA 1ZC4A 3LXRA 4D4LA 4MDFA 1ZM9A 4YMSA 3J81k 4LZZA 4JLJA 5FOVA 2CJWA 1P61B 2P0EA 1FUKA 2OEPA 2ZI6A 1CTQA 1QBKC 2BDTA 2C2HA 3I62A 5HTKA 3TR5A 1GWNA 4NCIA 3K0FB 3WYFA 1Q3HA 2XZOA 3WBKA 4DB4A 1W4CA 4QG7A 4Q1DA 4NU0A 2H16A 3H4MA 2ZXUA 2ODNA 2OCAA 4WW0A 1U0HC 4DSUA 2Q3HA 5AJZA 1K5GA 2BWJA 1XZQA 3CUEF 2V7QD 4PZLA 4AG5A 1L4UA 2XXAA 1E96A 2ZE7A 4ZV4A 4G01B 3ADBA 1T4GA 4TLEA 3U7EB 3OF5A 2OE2A 3QXSA 1YR6A 1E2NA 4M22A 5TY0A 1G4UR 2VIIA 2Q9AA 1ETUA 1CS4C 5GJBA 1QF9A 2IL1A 4QJ5A 1UBEA 1MV5A 3A1SA 1N5KA 2VP9A 4DSOA 1KO8A 3RAPR 1IJFA 4XD7D 4CEJB 2XB2A 3HP1A 4O3MA 1M7BA 1AM4D 2QL6A 1VHLA 1Z6AA 2E87A 2J0UB 3RS5A 3WY9A 2D2EA 1ZVQA 3IPXA 1G3UA 4YDHB 3KDSE 1ZNXA 3EWAA 3QKSA 2VO1A 3L0OA 3UWOA 1T5LA 4AY2A 4XVQA 1L4YA 3CB4A 4IVQA 4Q4LA 2REBA 1A7JA 3S1AA 5E3HA 2VEDA 1KHTA 3MWJA 1NP6A 5C46F 4V0ME 1DVRA 3A4LA 1D2EA 3KB2A 4W5WA 1GRQA 2G0TA 4L8GA 4OYHA 3O8BA 2FN4A 1ZD8A 2GA8A 2HCBA 3K70C 3ZLJA 4HZIA 2GZAA 2YV5A 2QE7D 5KSYA 3KKQA 1CLUA 3GJ4A 1FMJA 1E4YA 2QMEA 4JVLA 3SYNA 4DEYA 2VP4A 4JLMA 4RD3A 1JB1A 2ZM5A 4HB2A 1FQJA 1FNMA 4PR0A 3LD9A 3IUYA 1G19A 2RCNA 3T35A 1E98A 1KMQA 4WOPA 4JS0A 2BHRA 3OAAD 5EP4A 4WIAA 4JL6A 4RJLA 1TUEA 3C15C 1NVUQ 1LS6A 2O8CB 1G17A 2GCPA 4JVMA 3BB1A 1UF9A 3DO6A 4PFSA 2YJTD 4LHWA 1E3MA 4HSEA 2AD1A 1NKSA 3SC3A 3QBTA 5FOUA 2AN9A 3K9GA 2IYRA 1KDRA 5D3MA 2QBYB 1YRBA 5SZIA 4JIMA 4B35A 1KSGA 3GJ8A 3TUJC 3BJIC 4V02A 4HB4A 2O8DB 121PA 1ZUNB 1XNJA 3QKUA 3R9XA 4DIDA 2OESA 3MCAA 1XTRA 1NJFA 1AZTA 2GBLC 1Z0IA 1JJ7A 1ESNA 4IW3B 4C0HA 2FG5A 2IA5A 1UKZA 3B1XA 2WKRA 4HLUA 2TMKA 1YR9A 4PC6A 5CK4A 5H70A 4G0NA 4YLGA 4BUJA 2C8VA 2NG1A 2XJ9A 1WDTA 1L7VC 3B9PA 4B48A 1W4RA 1UKVY 3VR2A 3GLGB 3E2IA 1XCGB 2BBWA 1E2MA 3WXMA 5IK2A 2GEVA 4XOIA 4DCNA 1HTWA 2QTFA 1DO2A 2DHRA 5LD2C 4RD0A 3QY0A 3K0AB 4US0R 4D25A 5TARA 1ZUIA 4LBYA 2IUUA 3NHAA 3W8NA 1GP2A 1VPLA 3SBEA 2EFGA 3PEYA 1IHUA 1LV7A 3FMFA 4IVRA 3EIQA 1ZD1A 4PXAA 4RD4A 3NEYA 4Q02A 2WICA 4TSFA 4WXPA 1TAGA 3QOFA 5CDFA 2YKGA 4JMPA 3GLFB 5E4FA 3DL0A 1X1SA 3TE6A 1UBFA 2LKDA 1KI4A 1RE0A 1JQJC 5CLLA 2CE2X 1P9RA 2HYDA 1DAFA 1Z22A 2GILA 3MWYW 1KSFX 2CHQA 2JEOA 2ZYUX 3I73A 5L3SA 2IF0A 5SZHB 4Q4AA 1H65A 1E0SA 1X86B 2XEXA 1M1YE 5TVKA 4A8JA 1YRAA 3B60A 4PSAA 1FQKA 1U2RA 3W6NA 4ASUD 1Z28A 3HU3A 3CRMA 4M9SA 1XMJA 2YWHA 3BRWD 3GJ0A 2D62A 3U7FB 3N70A 4AYWA 3TW8B 4JLPA 1NVWQ 1P6XA 3FFBA 4RKFA 4EJSA 2PX0A 3WBJA 3AGQA 1J8MF 2F9LA 1CKEA 2KE5A 4DKXA 2ZRLA 3EZFA 2H8KA 3TH5A 5UKDA 2F3RA 2MMGA 5FOSA 3LBNA 5FPSA 1W36C 2F7SA 5J47A 3MJRA 2QAJA 2ZJYA 3BERA 4B6FA 3KL4A 3ZGXA 1II8A 4F92B 2FA9A 1EXMA 4D4JA 4Q4JB 3LDAA 5J4LA 3THYB 3IEVA 4KJZA 1G7RA 2WWXA 4OI2A 5EUQB 4BLOA 1DAEA 1XMIA 4DB2A 3QNUA 2YC2C 5DE3A 1RVDA 4AI6A 4LHVA 1KIMA 2ORVA 4LPKA 4MGIR 2WHXA 5JRJA 2CLDX 1E9BA 1FW6A 3T12A 1SXJB 2HXSA 2PT7A 4JL8A 3TBKA 4HDOB 3EIHA 5KDLA 3AF0A 5CITA 3B1WA 4TMZA 4MH0R 4PSKA 1N5IA 5BN3A 1KKLA 2GXQA 3RS3A 4XVUA 2C9YA 1T91A 5EE5B 1KMHA 5TDHA 1JEDA 2Q0HA 4M1WA 5J4VA 2V1UA 2RGXA 4YXWA 5ELXA 4B3BA 3TSWA 4HB0A 4EPVA 2ATVA 1RRCA 4BZPA 2C9CA 5GJVC 4WAUA 1DS6A 1HV8A 2PLFA 2WAYA 3UMFA 4US2R 4PO9A 2WV9A 1TU3A 3EIEA 3P26A 4LJ7A 2IF2A 1JR3A 2B7BA 2NTYC 4FCWA 1MT0A 4I99A 4B3CA 3ND9A 1OB5A 1ZNWA 1OF1A 5JEEA 1YR7A 4A2QA 2ONJA 4PZZA 5L3VA 2VQSA 4FMDB 1AIPA 3Q9LA 4TYPA 1H8EA 1W0KA 2ORIA 3IEUA 4V0LA 3RRYA 5EJEA 2FSFA 1A4RA 4B2PA 4F4JA 2JLUA 4GI7A 4C3ZA 4HAXA 1HURA 5IRCD 4HYYA 4UNRA 1UKYA 2HEIA 4LJ6A 1JNYA 4DLXA 1GTVA 4B71A 4KYIB 1QZXA 2PZEA 4E03A 4BPBA 1QVRA 3FTQA 1U0JA 2F3TA 4MRSA 4X8LA 3U2QA 1H8HA 2GKSA 4XH9B 3U7GA 4LX0A 3I5XA 4Z1MA 4AIIA 2WJVA 1XJ0A 4IDOA 3U44A 4KHZA 3R8FA 4TLBA 5FPTA 4ESVA 3C8UA 2P3SA 4JVSB 3CX7A 2WWWA 2Z0MA 1ZIOA 3OE7A 4BFZA 3AVVA 3CRVA 3R7WA 4LYHA 3SOPA 1OLOA 1W0JA 3CPEA 1XX6A 1OXVA 2ERXA 3PEVA 3SNHA 3GP8A 3GJ5A 1N6NA 1Q1BA 2N42A 2JLQA 2RGDA 1AQYA 2DR3A 4BFYA 4KSCA 5H1YA 2F6RA 4A36A 3B2EA 1E6CA 3RNLA 2EWVA 2F1RA 3SEAA 2BCJQ 1PUJA 2RB4A 4V0KA 1XTSA 2Z5FA 4M9QA 4Z51A 3VR6A 2D7DA 2QZ4A 4M0LA 4FMCB 2VP2A 2C5LA 3GLGE 4W5HA 3K09A 4OI1A 4B3GA 1ZAKA 3QKRB 1Q12A 3BOSA 3MFYA 4BE7B 2ZRHA 2GF0A 1N0UA 5KHOC 2V55B 4FN5A 2DYKA 1W1WA 1ONBA 2HYIC 1IN5A 4MGKR 3QXCA 1W5TA 2KB0A 1BS1A 2ZRBA 2EU8A 3A1VA 5HKKA 1EFRA 4HEJA 4BFSA 4GNKA 4FI3C 2IYSA 1LFDB 2HCJB 2FMXA 3SE0A 1F2TA 3AP1A 3LO5A 5E7MA 2XITA 1ZU4A 1QHSA 1E2EA 2W6ID 5BN5A 5HZKA 1VCOA 1W5SA 4Q01A 2JASA 3K0SA 4DC9A 2ZU6A 1E1QA 1LTQA 4JLKA 2IWRA 2ZROA 4KAXA 4TYQA 4G5RA 3U61B 3U7HB 1E2IA 4PTLA 2VHUA 1KKMA 1CR2A 2G77B 4EJSC 1VECA 4GSYA 4KSBA 5E7JA 4PQYA 4MKIA 1E94E 3N2IA 4URYR 1D9ZA 2WPDA 1XCMA 4A15A 3NC0C 1FOEB 3CH5A 5BN4A 3L43A 3KXKA 4L5BA 2C99A 3ZZUA 4FMCF 2GXUA 2ZYVX 2HJGA 4NCKA 2ZI7A 1Y63A 1E99A 4RVCA 3HDTA 1IY1A 1TQ6A 1AGPA 3QVUA 4Q7KA 4V0OA 1XXHB 2RGAA 4QBIA 3P32A 4D2IA 4OJKA 3UG6A 2YOHA 1SXJE 3VX3A 3WMEA 3GFTA 5DI3B 5JRZA 2AKYA 1SVSA 5FOTA 3CPHA 1FL9A 2Z4RA 2R6AA 4B6EA 4B3DA 1P9WA 2A5YB 1BMFA 4M21A 1WRBA 1M7GA 1ZJ6A 3NG1A 4B3XA 2GCOB 4NP6A 3TK1A 1P5ZB 1RKBA 4PC7A 1U0LA 3R9WA 1Q57A 4LCBA 1VG9B 1WA5A 4LYFA 5BYJA 4GPTA 1OFHA 4TLDA 3KFVA 3CO5A 2ZR0A 1RJ9A 1X3SA 1XFAA 4L9SA 1OFTA 2WJHA 4TL9A 1IN4A 3NH9A 4AG6A 4R98A 1SQ5A 1Z08A 2B7CA 4NPHA 4I1OA 2C98A 3VKHA 1JPNA 4QJ3A 4CEIA 3KJEA 4N3NA 3B7GA 4UNNA 5FL7D 3PEUA 2R6CA 821PA 4TMWA 2D4HA 1OXXK 2GAAA 2QSYA 4B75A 3VTKA 4UNQA 1OFUX 1XMSA 2ZREA 3D6TB 4B33A 4EKDA 1XZPA 2IHBA 3FKQA 3T5GA 4DWJA 1COWA 1XJCA 2IYXA 4KFSA 4NYIR 3LH5A 1JECA 2ODBA 1CP2A 3OFND 1Z6GA 2X77A 1ZM4A 3GJXC 1ZM2A 2OLKA 4HDQB 2WOJA 4JL5A 2IXFA 1P9NA 4BFVA 1GVNB 1OHHA 1VDZA 2DWOA 4AKEA 2CEAA 5K8TA 2VLIA 3O8DA 2AFHE 4RY2A 2KI5A 2VSXA 1Q1ZA 1JJVA 3HU2A 3CPJB 4LJAA 2JDIA 1LF5A 1OXSC 4PPQA 3IGFA 3QXXA 1U99A 3A37A 3DZ8A 3TQCA 5JZVA 1KI1A 5KSZA 4II7A 2Z83A 2WIAA 1W7AA 2AXNA 2ODEA 4A2PA 2CMKA 4CT5A 3GLIB 4Q47A 2IYVA 2V6JA 4TWZA 3L82B 3QEOA 4LV6A 3LA6A 3BD9A 1KI9A 4QGAA 2BKUA 1NMZA 3PITA 4A8JB 3RC8A 2XOKD 1Z07A 2IUSA 3VAAA 1SGWA 3IILA 3KTAA 4P4UA 1SKQA 4A6XA 4D82A 4LHZA 3K09C 3P27A 5IF9A 4DDWA 2Z4SA 1P62B 1P7CA 3PFIA 521PA 4DIEA 3DM9B 1OYYA 3CF2A 3QF7A 2HV8A 2QSZA 4LDJA 3DVLA 5FUVA 3W5IA 4BRWA 4CT4B 1V5WA 1CJMA 4PPFA 2X2FA 4W9MC 5EXPA 2ZVQX 3CZPA 4UNPA 1IXZA 3VKWA 4NE2A 2CLCX 1TF7A 1QG2A 4ZI3A 4M8NE 2GJSA 1Y3AA 3MGCA 1LW7A 4BZXA 1R0ZA 2J9RA 3EA5A 1DBSA 5BWMA 3I61A 1TADA 2ZJBA 2K5UA 1CJKC 2ZAMA 4CIDA 1Z0FA 4ESHA 3ND8A 1U8AA 1CJTC 3GFOA 3GMTA 5J40A 4KYUA 3Q72A 5FBQB 5BQ5A 2P5SA 1GFIA 3PV0A 4JLVA 4P4TA 4E5UA 2RH5A 4TTQA 2GJAA 2YWFA 3OEHD 2ZUBA 1QRAA 5FUXA 3K53A 5JFGA 3AP3A 4FXPA 1S0UA 1AKYA 2Q21A 1ODFA 2XTNA 4MGYR 4WBSA 1TQ4A 4FW9A 3U3JA 1YZGA 5B64A 3WRYC 2BVNA 1YZQA 4RCYA 5DI9A 1US8A 3RC3A 4D0GA 3IQWA 2R65A 3D3QA 4UQOA 4JKIA 1NG9A 2EFDB 1UBGA 2A5GA 3QIAA 3HPRA 2XTMA 4C4PA 2B6HA 2GJ9A 2JJ1A 4DJTA 5FOXA 1IY2A 1TNDA 5HZHA 5A0FA 2FGJA 3ASZA 3FGNA 3WHKA 4S2EA 3NBXX 3L2OB 2OO7A 2C9OA 1E79A 2XNDD 3U4QB 3A8TA 2FZ4A 4URZR 2R6FA 2G88A 2QQEA 2VSOA 5K8IA 5JBQA 2Y8EA 1PUIA 3B1ZA 2GWHA 4IEEA 3ADCA 1I4DD 2PZGA 2HF9A 1N6IA 4LUCA 4PO1A 3AKYA 3DDCA 4M9XA 4X8MA 5C2JB 2NIPA 2DCUA 2EW1A 1UBCA 3T1OA 2CL7X 1AS3A 1OIWA 4GMDA 4KFRA 2O0HA 2ZUDA 5EE0A 1XD2A 4WZ6A 2G83A 1SVLA 2IT1A 2VP6A 3MMPA 4IOJA 1NSFA 3SJBA 3L0PA 4XIGS 4RCZA 3BB4A 2GVDC 5GVSA 4TYWA 4PHGA 3RYTC 3IQXA 1H8ED 5GVRA 4BEBA 5AK0A 4Z8YA 2CL0X 1TF2A 1NN0A 3ZVLA 1IN7A 1Z0JA 1V43A 2I1VB 3T61A 4DLWA 1C4OA 1FX0B 1DARA 1GOTA 2JLZA 4C7OA 3RRMA 3RWOA 4PO8A 3LW8A 2G1KA 4U7DA 4E22A 2FU5C 4Q21A 4QGHA 1EWQA 2IEZA 1TL7C 4IFEA 1CF4A 3QVVA 3ZS8A 3UKDA 4ITRC 1I2DA 4URXR 4A82A 4ARZB 4XTCS 3FDIA 3FPAA 4P0TA 2O5VA 5DN6D 2J41A 5AWFC 3K0EA 1G291 3LLUA 1SVMA 3SBDA 4PSVA 2RMKA 2YNMA 2FDCA 3FE2A 4Q9IA 3D7MA 1T9HA 3SHWA 3JZMA 3PR1A 2CK3D 4LWZA 2P65A 2O0KA 2X1VA 2NPIA 1JAHA 2VRWA 4Z8XA 3CR8A 3OIYA 1N6KA 2FFQA 4RSGA 4URVR 1W0JD 4A4DA 1B0UA 2ZRJA 2P67A 4CYMA 4D80A 4YC7A 4DCSA 2EYQA 4C2UA 2OFXA 2JAQA 5AJVB 4JT2A 1XCPA 3AVPA 4HAZA 1XPOA 4YMWA 2XSZD 2N1BA 3GJ3A 4GZLA 3A1WA 5FPKA 1GKYA 2CLSA 1OB2A 2QI9C 2MSEB 4LJ8A 4HLCA 4NH0A 1KI7A 1G7TA 4TTPA 4R7ZA 5L3QB 1L2TA 2YZ2A 3B6EA 5FTLA 4Y0VA 5KNCA 2KJQA 4DLZA 4IDNA 3WNCA 3AUXA 1G18A 2HF8A 4J0QA 2L0XA 3QXJA 5JI3E 1MKYA 4P32A 3AVTA 1MO5A 2AX4A 1NRJB 2GAOA 2OCPA 3TUIC 4UXIA 1M74A 4L9WA 1LB1B 2ZS9A 3MD0A 4JLDA 4W7SA 1AK2A 2PJZA 4G1UC 2XNSA 4NCHA 3HR7A 5KO2A 3OESA 4DUGA 1F48A 2HXYA 3WMFA 2ANCA 3QXHA 4F4IA 3TGPA 3T5DA 3UG7A 2J59A 2RGNA 1KO7A 2PEYA 2BJVA 3BFKA 5JJIA 2WWIA 3CRRA 3CR7A 4IFBA 4DLRA 3EX7C 4CEHA 1EFUA 1E2LA 2F43A 4P4SA 5AJWA 2YHSA 3IIMA 3TR0A 1E1QD 4ZIRA 4QFMA 5CB6A 3TQFA 5JCZA 2XZPA 1DTSA 2QAGA 1KZ7B 1OH7A 1N6LA 5TB5A 2YYZA 3NKVA 1SXJC 3IO3A 4OQMA 2IS6A 3GFPA 2VP5A 4B2LA 4C0KA 1WB9A 3CBQA 3K8YA 4OHZA 5CM8B 3DEFA 4ILEA 3B82A 2F1JA 2QROA 3A58B 3WRXC 2WOOA 1E0AA 5K8UA 2HDNB 4HATA 1E0KA 3BK7A 2IEYA 4ABYA 2EFCB 3SN6A 2AR7A 1RC8A 4AKHA 4N1AA 1W4BA 1OIXA 4QKQA 1Z3IX 1VCIA 4QNMA 1VCNA 4Q1BA 1P2TA 4Q66C 2RGEA 3A6PC 4LJ4A 3QF4B 2DWQA 5EZ5A 4BLQA 2G9NA 3SYKA 4F93B 2FFAA 5F9FA 3BB3A 2VYFA 4IKEA 4JLAA 1TPZA 2JJ8A 4QXAA 5CJ2A 1SHZA 4GL2A 2JLRA 3CF6R 2BM0A 3N2EA 3OHMA 5EP1A 3T1VA 4B76A 1G6HA 2ZSFA 1UAAA 1IOZA 2BM1A 4DBLC 4S35A 3TIFA 3Q7PA 1UPTA 4C0QC 4LC1A 4JLNA 1NBMD 1RZ3A 2HLDD 2GETA 3KQUA 4E07A 5EUMA 3PJRA 4G3XA 5F98A 5LB4A 5E7IA 1WF3A 1FUUA 3AEZA 3IBYA 4A2WA 2P2LA 4U02A 1TEVA 2QTHA 1UJ2A 1ZBDA 2UZ3A 2YWGA 2YINC 2IX3A 5LB2A 3SU8A 1XJQA 4TZ6A 1SKYB 2V1XA 2CNWA 5J4HA 4EPXA 3C5HA 3FKSA 3CIOA 2ZRGA 3ZIAD 4YMVA 3C4JA 3RS7A 3PCRB 4DLSA 4EAQA 1R5NA 4BFTA 3MWKA 1D2NA 1KI8A 3ZVNA 2VL7A 4OL0A 1JBKA 1G8HA 4JJZA 5KOYA 1CXZA 1J7KA 1ZW6A 2QGZA 5IHPA 4BFXA 1G7SA 4BLTA 3SFZA 1X8KA 4PAMA 4YDSA 4Q7JB 2CCGA 5LDDC 4V0MA 1P2VA 4MRPA 4NTZA 4PQFA 4HZUB 1F2UA 1G4AE 1HQYE 1Q1EA 3RS4A 3THWA 1VCMA 3Q85A 1G3RA 2IYLD 2O8EA 3WNDA 3OIWA 5KNDA 3LW7A 2CHVA 3QJYA 1FNNA 1MRNA 2UKDA 4TYYA 2AL7A 3BH7A 2JJ2A 4LYJA 4EPTA 3QPVA 5JCPA 4JBYA 1N5JA 3FOZA 1E9DA 4IVPA 2IHYA 5D3QA 2JIZA 2VPPA 2WWHA 3EW9A 3ZQJA 2WJJA 4L16A 3QG1A 3H84A 1E1RD 2ZJAA 1OIVA 2IUTA 3EAQA 2O8FA 2G0NA 4RFSA 2XX3A 3VNUA 1OKKA 3SFVA 1OH6A 4MUAA 4MYUA 2J0QA 2W6JD 4EQ6B 1GRRA 1K6MA 4D0LB 2NO0A 4N0EA 2PL3A 1QVAA 3ICQB 1DELA 2JLWA 1VYUA 4H1UA 2XB4A 3WNBA 3EPLA 1Z2CA 3X1ZA 1ANKA 5FUWA 5SZJA 2OAQ1 3ONWA 1KDPA 2CL6X 4IDQA 3LX5A 4M2LA 1TU4A 2J7PD 3GLHB 4QRHA 3T34A 2PT5A 3VU9A 1KI6B 2BBOA 2QG6A 2B8WA 2ASEA 2VP0A 2WSSD 3ZQ6A 3THXB 1RW4A 4IXNA 3SZRA 1R8SA 5AJXA 2GK6A 4A92A 3C14C 2FOLA 4B43A 2ZU0C 2QEQA 4B44A 2RGNC 1JAIA 1G20E 3EPJA 4TMXA 1EX6A 1KO4A 5IT5A 3NH6A 3QSYA 1I4TD 1G21E 1G5TA 2FPKA 2LCFA 3QI2A 2ZITA 2A9KA 5E95A 1ZC3A 1MABB 4KXFB 3KQLA 4Q4HB 1N0VC 3B1YA 3NC1C 2VSFA 5JSZA 2NO9A 3RABA 2QAGC 1I2MA 4XWOA 4B34A 1XEXB 2IYQA 4Q19A 2IXGA 4JSTA 2QT1A 1ZD9A 3Q5DA 1D5CA 5FBWB 5FR1A 3OEED 4YMUA 5LD2B 4W5JA 3Q3JB 4I1SA 2VF8A 4WA7A 2ZJOA 5JWRA 3V4RA 2O8BA 2GJKA 4KVAA 2BIFA 1MR3F 4M4SA 1EFTA 2GXAA 3CW2A 5FI0B 1HYQA 2RKOA 2I4IA 1MOZA 2ZYWX 3GJ7A 4EDHA 1OJLA 4DRZA 4TQ9A 1KAOA 1XPUA 4X8OA 5KNBA 4CF7A 4I1VA 1GITA 5JHHB 2C04A 1E2HA 2SHKA 1WP9A 2OFWA 3T1QA 1TX4B 2Q3MA 1ZCAA 3VR3A 4KBGA 1QHHA 4MKGA 1MH1A 1NBME 1R8QA 1ZM3A 3FHCB 4FD2A 4H9GA 1T3LA 1OE0A 4OK5A 2H17A 1YE8A 2V7QA 3LBIA 4C2TA 4R9UC 2C96A 2FF7A 3D31A 1R5OA 1XRJA 1DG1G 5DLQC 2BMEA 2GNOA 3M6AA 4B74A 1CRQA 4PAQA 4ACAA 2YC4C 3R9IA 3DZDA 2A5FA 4JLOA 3W8RA 5JS7A 1S9HA 1KAGA 3KXLA 4QM6A 3GD7A 1NJGA 1RIFA 3EC2A 3TKLA 2CJWB 3UATA 1XEFA 3EG5A 3RLFA 4XD7A 2MSCB 4UJ3A 1VIYA 4P33A 4OQFA 3K0FA 4GMXA 1NN3A 3GEHA 2FWRA 3KKNA 3RRZA 3AM1A 2CDNA 1U94A 3QPUA 4NYIQ 3RHFA 3CRW1 3WHLA 1I4LD 4MYTA 1ELOA 1A82A 2ZIAA 4TLCA 2WM9B 1GNPA 5B30A 3CONA 3GLFE 4Q5IA 1NSTA 3SR0A 1CBUA 1NG1A 2D3WA 2XXAB 1GRNA 4XSGA 4FWTA 2RGCA 4HUTA 2HT6A 1VG0B 1SKYE 3W9YA 1JQLB 1HUQA 3K0CA 1P73A 2ZRFA 1YKSA 5CJPA 2ZSDA 1W49A 4CEJA 3K9LA 3TNFA 721PA 1W36D 1UFQA 2PMKA 1QHGA 2J0UA 2OCYC 1VG8A 3DM5A 4N0DA 1KI2A 4BZQA 1OYWA 2QY9A 5HCNA 4PPNA 3AB3A 4TMTA 3QKSB 2V9PA 1S9DA 3FHOA 3OAAA 3S1AB 3I4LA 4LJYA 2Q6TA 2B8TA 3ZZ0A 5DHAA 4GBMA 1WCV1 1GILA 1W4AA 1YZKA 2V4ZA 4OHXA 3VHLB 1B23P 5FR2A 5CIQA 1AQUA 2GDJA 2W0SA 1NIJA 4TLAA 1CIPA 1G8YA 5KDDA 4UNSA 3MSXA 5L3RA 1E2KA 4IOKA 1DAHA 1G9XA 2J0SA 3AVYA 2C77A 4MRRA 3PEWA 1QG4A 2YOGA 4UXHA 1DE0A 3BS4A 4MA4A 4O0MA 4KFUA 1S4QA 5AUQA 1OW3B 1TTTA 3LVRE 3P4XA 1S8FA 2W58A 1T0HB 1Z5ZA 2BJWA 4D0NA 5HR5A 2O8CA 2HT1A 3W6OA 1IM2A 1NL3A 4QNRA 4I4LA 4H1VA 3UK6A 1UEIA 3TAUA 1TQDA 5JECA 4ZPXA 4QBFA 3V4FA 3W3ZB 4TMVA 4EPYA 4ZKEA 2QBYA 2ZQ5A 5D3MB 3I1FA 4DDUA 4XJXA 1U8YA 1DPFA 4XWAA 2O8DA 2JLXA 1YZNA 3GLHE 2ZI3A 2IS2A 2DPXA 2R6GA 4JKYA 5KSPA 1YU9A 4HUQA 1E9AA 4GOKA 1GSIA 5FBLB 1J70A 3VKGA 4HDCA 1XD8A 4M9ZA 3PUWA 2ZAOA 1E2JA 2WKQA 1KK2A 2ZJ8A 5A5GA 1ZCBA 4LJ9A 2CCJA 2ZS8A 2Q9CA 3UIEA 1HT2E 4A9AA 2ODWA 4OQXA 2DY1A 1XMVA 4M1TA 2UVQA 4DT1A 4ZKDA 5C1BA 3GLGA 4LGMA 2GK7A 3SJAA 3FHTA 4PX9A 1LY1A 3ZD7A 2GZDA 3GEIA 3TLXA 3C16C 3C41J 1R6BX 3HPQA 5FTNA 4DEXA 1GG2A 4B3FX 3EZ2A 1N5LA 3K0AA 1AS2A 2FSHA 3UMSA 1WMSA 1M34E 3Q5EA 2JLVA 2ZRMA 5P21A 4ASUA 1L8QA 4L15A 621PA 1R10A 1KO1A 3NBFA 5DYGA 4TT3A 3LV8A 5EQTA 2WWYA 1DAMA 2FJUA 2QORA 3LAWA 5M04A 5KDOA 4LBVA 1YHNA 3LFUA 1D2MA 4F4CA 1Z83A 3ZVMA 3GLFA 4TL6A 3X1XA 1OH5A 5JJLA 1ZIPA 1GZSA 3DKVA 2N46A 4YMTA 1J2JA 4Z54A 1DAKA 2ZRDA 2ZJ5A 5IK2D 1LF0A 1AS0A 1D9XA 5L3SB 1NN1A 1YQTA 4Q4AB 3X1YA 1OXUA 3IIKA 1XTJA 4AYTA 1ZU5A 3AF1A 1C1YA 4DLUA 4OK3A 3ADKA 3EZ6A 4EJSB 4LHYA 3O8CA 2GXSA 4TSFD 1XEWY 1XEWX 3WP1B 2OFOA 1R4AA 2KBFA 3MWLA 3CM0A 1VYVA 4AC9A 3TVTA 1NIPA 5DO9A 3I32A 1ZNZA 4KFTA 1G64A 2NOAA 3NEJA 2PH1A 2AK3A 4Q9HA 4Q4JA 5EXTA 4HLQB 2D74A 1II8B 4PC3A 4TYNA 3KKPA 3THYA 1N0WA 2ATXA 3SJCA 1SULA 3ZD6A 2F1IA 1A2BA 2R2AA 3VQTA 3QKTA 5LPNA 1DG3A 3G82C 2J3EA 3NDPA 4L4UA 4OHVA 4B32A 4NYJR 1NY6A 4OI0A 5F3WB 2Z6VA 3RDPA 3U3MA 5BXQC 2VTKA 4IEIA 2PCJA 1SHKA 3AUYA 1SXJA 2W00A 3SHFA 4EFMA 2PJRA 2OBMA 2VA8A 2FNAA 2R44A 1G8FA 1Q20A 4C0LA 4A0GA 4FWIB 2CCKA 3CZQA 3K0CC 3GQBA 3KB1A 2ANBA 4EPWA 2A30A 1OFIA 3K1JA 1NNEA 4TQUS 1N6PA 1KMHB 2P6RA 1AN0A 4BWYA 2UZIR 5JI2E 1WXQA 4IXMA 4KU4A 4PPGA 3SS8A 2VHQA 3W6PA 4Q1FA 4D26A 4O25A 4BLPA 2WMNB 6Q21A 4GFDA 5AUOB 1VHTA 1E32A 3BIFA 2FSIA 3BFVA 5CYOA 4DCUA 2CBZA 221PA 1WE2A 4E09A 3KUCA 5GADl 3LWNA 3E1SA 3TUZC 4Q48A 4V0NA 1NVVR 3RRNA 4QHSA 1O3YA 1YR8A 1CU1A 2NO7A 4YXWD 3ADDA 1WQ1R 1G5RA 4LHXA 1XPRA 4ZDWA 1XXHE 2BBTA 2ZI9A 3SYLA 1TUIA 5J5CA 3AVQA 2GJ8A 1D6JA 3CKLA 2F9MA 2ZI5A 4HLDA 1JXMA 1N3BA 1JR3D 2KWIA 4M1MA 1TQ2A 1E2FA 1HH4A 2FSGA 3JZAA 4OK6A 5G53C 4IJMA 1ZYUA 4B73A 1W47A 4I81A 1KY2A 3R8CA 1Q1QA 1SVIA 1VTKA 3B5JA 3ECCA 1U98A 3U3OA 5KTYA 2PZFA 3UANA 2VBCA 1CR0A 4DCTA 1Z0AA 2MMCA 2ZANA 4YONB 1P72A 1Z2AA 2ZRKA 4ERNA 1W0KD 2RHMA 3U44B 1NMYA 3TMKA 3LRPA 3DHWC 1WBDA 2ZRIA 1G41A 2WIBA 4IOLA 2X19A 4K81B 1OXTA 3R7WB 1CEEA 1VYTA 2AK2A 1GL6A 2J7KA 2W2TA 2ZEJA 1TEXA 2JCSA 1J90A 1UEJA 2A5JA 2FZLA 1R0XA 5BW8A 2BBSA 1RRPA 1H8HD 2OT3B 2ZYTX 2A2ZA 3PIRA 4Z1MD 4MRVA 4DLTA 5B58C 2XZLA 2RGGA 4ZDIA 5AJYA 4WXRA 4NZYA 4CDGA 3QKRA 1EX7A 1E2GA 1FP6A 3I3SR 1U90A 2ERYA 5C4MA 3REGA 1NI3A 1Q0UA 1IQPA 1ZP6A 3VFDA 4AK9A 1G3QA 3OE7D 4NYMR 1IAQA 4RFVA 3AF4A 4U00A 2DWPA 4JBWA 1KDTA 1DEKA 1R2QA 1XD9A 1GNRA 1O87A 2CE7A 5EXSA 4DZZA 4FIDA 5TMPA 4MDEA 2J87A 4DSTA 1T5IA 2C78A 5EP2A 1JPJA 3H2YA 1AA9A 1P75A 2HUPA 2FPMA 1N2CE 1OT3A 1F2TB 2PX3A 4YQFA 5CDFE 3NWJA 4BECA 3A36A 3AF3A 1S1MA 2DFNA 1RYFA 3BE4A 5EE9A 2B92A 3X2SA 1W48A 3WMGA 3GLIE 3TAHA 3VHXA 4LPSA 1QHYA 5AUPB 2JATA 2QMHA 4D6PA 3T1TA 2GHIA 3WYGA 5B2ZA 3KKMA 1WBBA 4QGGA 2VH5R 1XBTA 4D4KA 4C30A 2AFIE 3X1WA 2QRNA 1RPZA 2NO6A 1Q44A 4XVRA 3A4MA 4ZCIA 1II0A 1EFRD 5HKKD 1AGRA 2GCNA 3LQQA 1IN8A 4EUNA 1N25A 3ASYA 1BKDR 1S1CA 4GP6A 1Q21A 3BAFA 1KY3A 1QHXA 1KDOA 2H57A 1FTSA 1UM8A 4PQRA 5DYIA 2FV8A 2ZS7A 2AWOA 3LVQE 4EPRA 1D8TA 1Q3TA 2R6DA 2Q9BA 1CR1A 2ZRNA 2ZUCA 1OH8A 2DBYA 4PANA 3BORA 3IKJA 1PV4A 2H1LA 1IXSB 1M6NA 5DGXA 5L8VA 1XXHA 4QM7A 1KOFA 1X8LA 4MKFA 2E1RA 3FB4A 3KUDA 4ZDJA 4GP7A 1BOFA 1QDEA 4MYHA 5CIWA 5C18A 5DI3A 3RVBA 4US1R 1T3HA 3K9NA 1KYIA 4WZBE 2B21A 2WPDD 3O47A 3VX4A 1OV4A 1XTKA 2FGKA 2GCOA 5TV2A 5FL7A 4TMKA 2J45A 3BGWA 1J99A 4LY6A 2GEUA 5J4YA 5DISB 2ZTSA 1MO4A 1II9A 1MO6A 2X8AA 4M1SA 3WP0A 5CLQA 2IS1A 1U8ZA 2QMOA 3BH6A 2JLYA 3B85A 2A3RA 1CJVC 3PUXA 2QENA 4Y0AA 5FI1B 4PHTA 1N6RA 3VMFA 3P4YA 5KU1A 1W2HA 3CNNA 2QQ0A 3OFNA 1JR3E 1XF9A 3QQ5A 5DIFA 4RKEA 3UMRA 4DVGA 1KI3A 3OZXA 1P2UA 3KJGA 4Q9JA 4PHFA 1HEIA 1RJ9B 4G5SA 1LS1A 2ZI4A 3AH8A 5HE8A 4QBGB 4ZI2A 1DADA 3BXZA 3SDZA 2ZSAA 2EWWA 4FMBB 4HUQB 1DAGA 4C9BA 1GKUB 4QOSA 2GVZC 1BMFD 1EK0A 4M1OA 1KJZA 1E2PA 3AV0B 2A7QA 1X6VA 4CEIB 5FPHA 5H68A 3EZ7A 4QGFA 3V00A 2YWEA 2RGBA 1BIFA 4BRUA 4F7WA 2QP3A 2OXCA 4JT4A 5EXXA 4KITB 5DH9A 4DT1B 3DOFA 1KJYA 1R5BA 3TSOA 2OXRA 4A1FA 3V9PA 2FEOA 1CR4A 1HE8B 1NF3A 4ZCMA 1E9FA 3QUSA 3QE0A 4HAUA 2GZHA 1F5NA 3IPYA 2XOKA 1E0JA 1CJUC 4G5OA 2F1HA 3WYAA 4CVNA 4XTRA 1RRGA 3C7KA 1KO5A 1IBRA 4X8HA 2EFHB 3PUZA 2WZQA 1Z0KA 4KVGA 5AUNB 3W5JA 4POAA 1EESA 1UKEA 5IDVA 4JLBA 2Q3FA 1E9SA 3CWZA 1NVXQ 1G5PA 3GLIA 1COWD 1NLFA 5KPJA 2QPTA 2OG2A 4RZUA 5DNYB 1PLJA 3JVVA 2KSQA 3TVDA 3X1DA 2NMVA 4QL3A 1S3SA 4RZ2A 2LKCA 3PVSA 1OHHD 1FMLA 4RZ3A 1G16A 2IC5A 3ZVRA 3TSZA 2OAP1 2XJ4A 4F91B 1G8PA 4D4MA 4IRUB 2ONKA 2QNRA 4TT3D 2AWNA 3KTAB 1G3IA 2A78A 1JALA 2QTVB 5CK5A 2JDID 2EVWX 5EE1A 2AD5A 3N5CA 3K70B 1F60A 4KODA 2W83A 1E2DA 4PZYA 2WTUA 4M1YA 1SVOA 1AKEA 5FBVB 4A0HA 2CHGA 2GF9A 2QMUA 1IONA 2WKPA 3L0SA 4MRNA 5FTKA 3H86A 1EFCA 1Z47A 5F2EA 1VKJA 2VHTA 3KXIA 2E9SA 5HE9A 3M0EA 3ZJYA 3UPUA 2G1JA 3OEHA 1PZNA 1E9EA 3EASA 3TJZA 4G5QA 2FPLA 1U9IA 1LVGA
chains in the Genus database with same CATH superfamily
1A8PA 4E33A 2C03A 4OB7A 1N36B 1N6HA 1NFRA 1Z2EA 1SVUA 2PL5A 4HMOA 4KXVA 3LPCA 1Z45A 1AMNA 2MINA 1YDFA 3F0TA 3TNJA 1I2CA 2OENG 1T3ZA 5IDQA 3VVCA 1YJ5A 2HU8A 3O7MA 1RXWA 3GROA 2FFHA 4F5ZA 2JK1A 5DXAA 3V7WA 3SY8A 2DT8A 4GWKA 3CEJA 1ZEJA 1XWIA 2G0AA 1MO3A 3G5UA 4OA8A 3VU0A 4HCJA 1KQPA 4FPXA 2WUWE 4BVKA 4EI2A 2UXBB 4OUDA 2BGRA 2IJGX 4L2IA 3K73O 5KJEA 1LH0A 1P1JA 2HJRA 1UJMA 3HYRA 1SVKA 3B9RA 1ILEA 2FEPA 4LSGA 5FADA 3C45A 2DHCA 5EJ8A 2P4QA 1UXOA 1WHTB 4P6VF 5IHXA 2QA5A 2GDZA 2XUPA 2YZMA 3RS2A 4BFUA 5IVIA 1SY7A 1AKVA 3TDNA 4KACA 2I4LA 1TUBB 1M8KA 1REQB 2WF5A 1GKIA 4B40A 2WZDA 4HQRA 1L5NA 1F5SA 4EP1A 1IXKA 1QWSA 3DV9A 3ND7A 3HNPA 3LDGA 2CFOA 5IARA 5LNK6 4DHEA 4YREA 1NLMA 1S2NA 4PSDA 3WLNA 1NJ8A 2PRIA 3KJHA 1TZCA 4ACBA 4BLSA 2FPGB 2WA1A 3HCNA 3HFRA 5KQRA 3IKLA 3U48A 1XQ6A 4D26A 2LGJA 2ZRPA 1T8TA 2OCBA 3KCNA 3C6MA 2MSLA 3VVLA 4LBZA 2YXDA 5HBGA 3WKAA 1E9CA 3PDWA 1BDBA 4J2OA 5JAQA 1EHYA 4MKHA 4CIXA 2ZPTX 4FDTA 3LL7A 3STHA 4MI9A 1Q0ZA 1LPNA 1LPOA 1XZJA 2JEYA 3PGKA 5C8XA 5FBRB 5CU7A 1FLAA 3B78A 5DN6A 2JJ1D 2DHEA 2FK8A 4FGZA 1N1DA 3MJSA 1UDBA 2GFQA 5AK5A 1DOAA 5JC8A 2GPYA 2QL7A 4ENTA 4B85A 4KR6A 1E79D 2XVMA 2CK3A 1OCEA 2IW3A 4OHWA 1FX0A 1USUA 4CXMA 5AXCA 1H0KA 4MVXA 1XDBA 1ZESA 4GC5A 1HGXA 1EE9A 4C7OB 1K8XB 3DLHA 1Q77A 1CY7A 1K5DA 5BR7A 2QW0X 3DMNA 4X62B 4A16A 1NMXA 4J4BA 1PJAA 2REOA 1YB7A 3BH0A 3R77A 3D1VA 1VJ0A 3BWDD 2R5FA 4MHOA 3O90A 3LECA 2CYBA 1KNQA 3BCHA 3NI2A 3BXHA 1GR1A 2ODQA 2DR2A 4JFRA 3JR3A 3P9QA 1LNSA 3ZHQA 1T6NA 5ANRB 2CUTA 4Z4EA 1E69A 4MW4A 1CRPA 1RVV1 2O6LA 3HR4A 3QPCA 2XA2A 4FMDF 5G2OA 3SQWA 3H2SA 3CF0A 4MLPA 4ZICA 1VHQA 3N2GB 3QYAA 5IBQA 4OKNA 5CGQB 2IXEA 3C8DA 3N86A 2FE4A 4IO0A 2OV2A 3SXUA 4HAWA 4LC0A 1MQ8B 3HGMA 5DP2A 4N76A 1XC7A 3KZVA 5JQWA 3DMDA 2OZEA 3GRVA 6REQB 2CN1A 1KS2A 2I29A 1UPUA 1BWSA 2VOEA 3EY4A 3R5SA 1DIGA 3L8ZA 5IABA 5JSHA 1HE1C 1PFUA 3WL5A 2PUJA 3E35A 2F55A 2PU7A 2WWFA 3MGAA 3H9JA 3IAM1 1ZGZA 3MUNA 3BCUA 5BWBA 4X7MA 5A4MS 3C3CA 2Y9MB 3FUCA 3DZCA 4CZ2A 2YTZA 5B5SA 2VRCD 4KN9S 1BOOA 1USIA 1JLRA 3NKLA 1WR8A 4BMDA 4R2MA 4M0EA 1UKBA 1AN9A 5FLYA 1RSZA 4DS3A 1GZ5A 4RZXA 1T3SA 5I7SA 4F04A 5CLIA 2GLTA 4AJNA 2HWUA 3HY3A 3K2QA 1EUDB 4WXHA 2W4MA 2M6RA 4XLLA 5HQ3A 1ULBA 1KEKA 4KXYA 1NW3A 3OKPA 3EBOA 3A4NA 2YOFA 3HRHA 4GRAA 4RE5A 2FI1A 4F3YA 2X8LA 2HZ7A 4RZQA 3VPXA 4BV8A 3KFXA 4X6XA 4N54A 4JZKA 1Q1NA 3WO0A 4R71A 2D2XA 1MPXA 2FR1A 3OBIA 4GVLA 4IDPA 4OV6B 5DHSA 4QG3A 2WQ6A 1SN7A 3C3WA 1Z6TA 3K4QA 4ZIRB 5KU1A 5ILQA 5DASA 4ENPA 1U9IC 2BEKA 3HE3A 3WLFA 3ZNQA 1YGPA 4LISA 4TN1A 2O5CA 3NAGA 5KYGA 1TKAA 2PX4A 2RONA 5ALEA 5JAIA 1YASA 1KSJA 4G07A 4LRWA 3TXXA 3K20A 3D0QA 3GGCA 4XGQA 3INTA 3VKVA 3IQEA 1YZUA 1L8XA 4LVCA 4DF3A 4DIFA 1QRUA 4KAJA 5AVYA 3FHLA 1GIAA 1NQUA 3CA8A 1H2RS 1X8JA 2XGJA 4I9GA 5F4BA 1P0QA 2Z5GA 2ZPAA 1EWVA 3DL4A 2X86A 4FFLA 4K28A 1YS2X 2FWIA 3G5LA 2WBLC 1AB6A 3QLEA 2OHGA 4PXYA 2B6NA 3L1VA 4B7ZA 5K03A 4N0QA 1T8WA 2XD4A 3F7TA 4OQ4A 4K6OA 2AHOA 5ADVA 3NOOA 4L5IA 4ZYLA 3D5EA 5GTDA 2XBMA 1JUDA 2NO1A 4ZHQB 3P2JA 1BU5A 1L7PA 1BHO1 3M5PA 1P5FA 1GSAA 2VHXA 2JH3A 4RHXA 4HNUA 4PNHA 5EHXA 4JYBA 3KLPX 1VSQA 4MLDA 1N5OX 3HZHA 1I3NA 3QF4A 4NCJA 2CB0A 1G98A 2IRWA 2HK8A 3CTPA 4GSLA 1A72A 1KGDA 1VJRA 4YJHA 3PKIA 5FCDA 4EJFA 4GBJA 1LSUA 4FZVA 1EVQA 3M1AA 2PCLA 3U1VA 3H5TA 5KTTA 1TZBA 2PUVA 5KOIA 2O2JA 4WJKB 5JNWA 5A4AA 1HX7A 2WJYA 1WW8A 3JQAB 4NS1A 4WUTA 4DE5A 4LFCB 4EA9A 1GDTA 4JEIA 3B6IA 3KTOA 1YZLA 3QEJA 3QG5A 1XE3A 3FHJA 1GL3A 5TJ9A 3UOGA 1K2VN 3OJCA 4DQLA 2JGMA 2OCGA 3FPFA 3HYSA 5ARBA 2PXAA 1P77A 2IK8A 3B6JA 2HPZA 2QZPA 2YVQA 1XTTA 2WF6A 4KMOA 4U2GA 3MK31 4RIFA 3V8NA 1G4HA 1U7DA 4TT8A 4C89A 1Z0ZA 4BNHA 4C1BA 4TRMA 2R8OA 5F7JA 2B1JA 1GL7A 1V48A 1VIDA 2CW5A 4KMRA 4LQDA 3L1IA 1DAIA 1PFWA 4UJ5A 4AURA 5JNVA 2XRZA 3RVLA 2JBAB 1ORTA 3WFZA 2I2XB 1NQXA 3JQAD 3SIRA 4ATNA 7MDHA 3ZHCA 4Q12A 3ICEA 2WABA 3FYHA 4YACA 2FEMA 2VYNA 1W1IA 1Z4OA 1FPMA 2C2GA 1AUXA 1SU8A 2ET6A 2X7HA 4ZQFA 1DC7A 3R20A 1MB9A 2GZSA 2PUTA 4PC2A 3ZXYA 1EAMA 1XRSB 2UV8A 3VNBA 1PLLA 4LOAA 3B1VA 4ZVUA 2QGNA 3RYHB 2GPNA 4QXRA 1JYSA 1HOTA 5FUMA 3J7AC 1X92A 5JDIA 3IT0A 1K0FA 1VLJA 4LXHA 3AGPA 4W5RA 2AX3A 3G3EA 5BN1A 1Y4SA 1KQFA 3INYA 4NHEA 4HZUA 4AMGA 2EF1A 2GA9A 4KIGA 5FIUA 4D56A 2XTZA 3KZCA 2PZKA 2WK1A 5A9TA 5F23A 4HP8A 1G5HA 1KMMA 1RWKA 2AG8A 2ZR9A 1K4KA 2IYYA 1NONA 3BWCA 2EYUA 4JUFA 3DMFA 1SXPA 4KO8A 3RKUA 5FO1A 3C8MA 1E5TA 2RJ3A 2HKIA 3H4TA 1WZ2A 4X1KA 2EFEB 3MBOA 4BC1A 1PT7A 2VK8A 4FD3A 4Y2SA 3C5VA 4KLNA 1RJWA 3RR2A 5CHEA 4C5CA 4EGQA 2A0FA 1HDZA 3LQFA 3HJAA 3CNLA 5FA6A 2O7QA 4B7UA 1O03A 1EJBA 5HRUA 1NN5A 1KY4A 4CKBB 3H3FA 2E21A 4ZK6A 4UUNA 3UWKA 1Z0DA 3SF0A 3T1HB 3ZH9B 2AT1A 2H18A 3H0KA 2YV2A 1J8VA 2B0JA 3E6AA 1AKMA 3M6IA 5DWQA 3KC2A 4LBWA 5TMEA 4S04A 3R40A 2KBEA 3TI7A 4PRKA 3Q9UA 5IXSA 1LU9A 1WO8A 4RHUA 1FF9A 2OBLA 2O5EA 2QKYA 3I42A 3PTZA 1G1MA 1U2EA 1Z5PA 2OVBA 2ZJ2A 3NBYC 3HWSA 4LY3A 5ULLA 1T9GS 3RC1A 3VMMA 2BKEA 4QFBA 2H5EA 4MV0A 3R74A 3DMHA 5DEIA 4XSHA 4F3RA 1VCHA 2EIHA 1DQRA 2OC9A 2WT4A 2JIZD 2AOTB 3T7AA 3O91A 4N3CA 2NACA 2W6NA 1YB5A 2WAXA 3BBPA 2HY7A 2QGFA 3C3XA 3HBNA 4K1LA 1Y5MA 1Y37A 4M8IA 3VPHA 4DLYA 1NU6A 2ENWA 4LZAA 4BIIA 5ABPA 3ZE1B 4DILA 4DG9A 1ECCA 5FOWA 4DC1A 1Y5NA 4WVFA 3QK7A 3IDOA 3NDBB 4PINA 1P19A 3HS3A 5FTJA 4RSHA 4DABA 3FRJA 4M1QA 3H1TA 1I1QB 1N2BA 4KWTA 3EIOA 1YBVA 1H23A 2D1RA 3MAAC 1SM4A 3T95A 2IYTA 3IAFA 3SWWA 3ULKA 1OV6A 1CZNA 4XASA 2ST1A 1PRYA 2P9ZA 3CQ9A 5HK8A 4IOMA 4GOXA 3RVDA 1NWHA 4TN5A 1MABA 4FONA 3DAFA 1NKTA 1ZCZA 3AKDA 4MQBA 4PYRA 4FMPA 5DYWA 4IXWA 4Q4HA 1Y81A 3D8HA 1HKHA 2ID7A 3AI3A 4IRXA 5H83A 4RTNA 1ZN9A 2NTNA 4KLZA 1Z8HA 4BTEA 1M34A 2IYWA 1XEXA 2VDRB 3HJBA 3G9TA 1Z2DA 5CIYA 4PY2A 3VPGA 5IPFA 2ZB4A 2PTGA 3BUSA 1U7PA 4QTUB 3L7IA 4YPVA 2YW2A 1DDIA 3MRSA 2AC7A 2M1ZA 2B2CA 2AW5A 2GT1A 1M2JA 2VBFA 3BVPA 3PRJA 3K2IA 3CX4A 4CM6A 4IGEA 2ZBFA 4OH1A 1RXYA 4P83A 1M2OB 3JVUA 3ZHXA 4AJJA 1IWBB 1H22A 3AKCA 5LMZA 1TCCA 4MKZA 1OUMA 2PBRA 3NW9A 3R0XA 2GF2A 1MN6A 1UFRA 4BVJA 3KE8A 1JT2A 1HO3A 3LXXA 2NVBA 4KI0A 2P6NA 4D98A 5BVGA 1IATA 2HK9A 5JQGF 1S2MA 4M1KA 2QHXA 4LYGA 1PJ4A 2VWHA 4YRRA 4J3FA 3BN3A 1PJRA 4JJKA 2ZSBA 3GAFA 2W8BA 3CNOA 1K8RA 3IAM6 4JR1A 3UMVA 2QQFA 3Q9SA 3U3KA 4AD8A 3EMDA 2CLMB 5G1NA 5FH9A 1L4FA 5HFAA 1Z6YA 2VBGA 1R7RA 3Q0TA 4FYKA 4WADA 3ONFA 1SQGA 4KV9A 4WFQA 5GJCA 1JEEA 4AWXA 1U9ZA 2YASA 1HL7A 3CXRA 4C7MA 2P5TB 4TTRA 2UUOA 3KQQA 1K7EB 2IBMA 1GPH1 4QC2A 1RKQA 2HZBA 5AKEA 2BEUB 4GI5A 2J9XB 3ZHBA 2DQKA 4BGDA 1XVTA 3THOA 1ZC4A 3A9TA 1H2HA 1CUWA 3LXRA 4XX1A 1CUHA 5GAJA 1ZNQO 4KE7A 5I01A 3JQ8B 1ZISA 1LBHA 3O4RA 4LZZA 3AC0A 3OPXA 4JLJA 3KOXA 4ZXFA 4EECA 4GP9A 1AB5A 1A3CA 1JEAA 1ENYA 1P61B 1FUKA 4PSUA 5FOVA 4EF4A 4ISCA 2VSNA 4I08A 2Q2OA 1N92A 2BDTA 4G5FA 4I46A 3I62A 4UVDA 5K8CA 5ALFA 2WAOA 4G8JA 2GBGA 3JQPA 3MHPA 4TKVA 3ZCRA 1C1XA 1UFVA 3R5TA 1B74A 2CEKA 3NAZA 4P3XA 3GYGA 3H5RA 4RH1A 5K20A 1UJ5A 3O73A 4QG7A 2XZOA 3CO0S 4Q1DA 3TZBA 3OSUA 3DDUA 3VR3D 2ODNA 3E7PA 2Q3HA 2EP7A 2ZJ1A 3MT0A 2XYVA 1XG5A 4F84A 1K5GA 1WXIA 4HN2A 3VO2A 2B78A 2H1SA 1CETA 2JIRA 1T4GA 2P6OA 4HH3C 3OF5A 4PEVA 2EP5A 2OE2A 4KPUA 4L0CA 4YJ2F 2FPUA 1E2NA 2G9QA 4EK9A 1L5OA 2C84A 1ETUA 1CS4C 1RTKA 3RJZA 5GJBA 5K0NA 4EZIA 1QF9A 4ETWA 2IL1A 4FBLA 2P4SA 4GR9A 4QJ5A 4R8VA 5IC5A 3LYHA 1N5KA 2VP9A 3VJLA 3RSSA 4D9EA 5KCMA 4RTJA 1QTQA 4XD7D 1NJ6A 3IVCA 5K3EA 1ZW1A 2Q1TA 2J0UB 3EEOA 3OQ6A 4KSYA 5JDIC 2YW9A 3G0OA 3IPXA 1H05A 3KDSE 2ZT8A 3V33A 2HU5A 4Y98A 4N3GA 3QKSA 2VO1A 5GONF 2YJ4A 1T5LA 5ESDA 3LCJA 1A7JA 5F1PA 1XTZA 3I76A 3LCMA 4OHOA 1V3QE 5I48A 4NENB 3BMOB 3MWJA 4KRYA 2PX6A 4M7RA 2I66A 1WJGA 4YT8A 2II6A 5B2EA 1DVRA 4ZVMA 4W5WA 1D2EA 4FILA 4GVPA 4TWJA 2G0TA 5E0KB 4E3ZA 3UWDA 4J3NA 2FN4A 1E4OA 5JYCA 2HCBA 4F8JA 2J32A 1EK1A 4BBAA 4F86A 4WSOA 1GTRA 3I0ZA 1KQOA 3EVEA 2WQ7A 1HK7A 3GJ4A 1K66A 3H05A 3FF1A 1I3MA 1OGIA 2VP4A 4I3HA 2VA9A 1Y89A 2W6OA 3VU8A 3WSWA 1QH9A 1FQJA 1FNMA 1QO0D 4HXEB 3FH0A 3LD9A 3W4IA 1F7UA 4CG3A 4JAVC 3T35A 5EP4A 2PX8A 4WK0B 5DU2A 3W5VA 4WQMA 1AHIA 3PSAA 1EHIA 1WU7A 3ZQUA 1NVUQ 3AR2A 3BB1A 3DO6A 3DWFA 3UGJA 2RGYA 2YJTD 3W06A 5DZSA 1FRNA 5HILA 4MEAA 1U1FA 3VZRA 3NV7A 3QBTA 3PNYA 1JU4A 5FOUA 1ABEA 1Q3KA 2IYRA 2QLBA 5CFMA 1JZSA 1SO8A 1OXBB 1Z33A 4MQMA 2XA1A 2QBYB 2H9AA 1Y7TA 3DZGA 5I7AA 2QRPA 4B35A 3GJ8A 4C08A 2VF5X 3TUJC 3UBTA 4V02A 1UZUA 1ZUNB 1XZFA 2B8JA 2JNWA 1T2CA 4FC7A 2RJNA 1ZN8A 4BJ6A 1S6YA 3ZY6A 3FZNA 4EG5A 1TIPA 2R5WA 3OSZA 1U02A 4RF5A 4A73A 1AKUA 1XTRA 4WNAB 1Z0IA 3ZJ5A 2DWUA 4IIJA 4KH0A 4KQWA 2WF8A 3UJNA 2WNIA 2J4CA 1T1JA 3OQBA 2FY8A 2WYUA 1QWOA 2IA5A 2PGAA 2V4MA 4I19A 4KO1S 2WKRA 3JQ7B 4HLUA 1LA2A 5CK4A 3DE3X 5H70A 4NFHA 4N9WA 4YLGA 1PGOA 4NABA 5SV2A 2XJ9A 2BR3A 1PK9A 1Y3CE 1ZXXA 4KG7A 4RTRA 2J3LA 1ORWA 2K4MA 2QV0A 1IHXA 1PQ4A 4B48A 4ZTUB 3VR2A 4J0FA 1JHAA 2AI2A 4BNDB 3L8GA 3LKZA 4YAFA 2GEVA 1V11A 4XOIA 4BMZA 5CDUA 1HTWA 3QYFA 2QTFA 1DO2A 2IPAB 3MWGA 4FXOA 4WXMA 2G7ZA 1WIWA 3D4BA 5TARA 3QMVA 5TPWB 3S28A 2C3UA 3GA5A 1O9GA 1GP2A 6GPBA 5FX2A 4ZCPA 4KB5A 2VUIB 1IH8A 3UCEA 5C8YB 4CMEA 1LV7A 4IQ0A 1M5TA 4IVRA 1N2CA 4PXAA 4J49A 4RCVA 2GPJA 4TSFA 4RM3A 4A23A 4JMPA 2XVAA 3GLQA 1WCIA 1HXHA 1M6EX 2LRHA 2QTLA 3GLFB 1CQJA 4UTOA 5E4FA 3T3EA 2Q8NA 3TE6A 5HW0A 4DN6A 4U2KA 3EVBA 2CE2X 1J2EA 1DAFA 1QGYA 2GILA 1UWLA 2CZCA 2Q7XA 2XRMA 1KSFX 3IV7A 4DMRA 5FNVA 2IF0A 3JWHA 5SZHB 1Y80A 2XOXA 1E0SA 1JSXA 3MQ2A 1U0FA 2VQ6A 3SSOA 1LK0A 2CT8A 1R12A 4MP3A 1YRAA 2ZVJA 4PSAA 1U2RA 1OAKA 5K2OA 1AHHA 4O2BF 3HU3A 4D74A 5BSEA 1GSOA 2ZXEA 2V6MA 4PZCA 5BSVA 3PE3A 1OWLA 2D62A 1E5XA 3GJ0A 3N70A 1JV2B 1SEPA 4RKFA 4PLPA 2QYSA 1VJDA 1J0AA 1KE1A 2W2MA 1L7OA 2F9LA 2NU6B 1CKEA 1SMKA 4BY9E 3Q9NA 1GJRA 3IVGA 2H8KA 3A9WA 3VVBA 1JE1A 2IP4A 3PR3A 4JC4A 5ERGB 3OCVA 5FPSA 4JXZA 2W2NA 1JDUA 4ZO8A 2GHTA 2BGJA 1X7ZA 1II8A 2FA9A 1H4QA 3AJ9A 5HHTA 4MV5A 4Q4JB 4WCFB 3LDAA 1HT3A 1TE2A 3RASA 4BE4A 1G7RA 3G9QA 2GBCA 2WWXA 1SQ6A 1X42A 2NPOA 3KAKA 4DREA 3L7KA 1U3FA 2I4OA 3QNUA 4YJFA 3LUFA 4IZHA 2W70A 4LHVA 5E1MA 3PXDA 4LPKA 1H2EA 4F11A 1N7JA 4IP0A 4HC4A 3TCNA 4R9NA 1A4XA 1YAJA 5DSXA 3AHIA 3JAWB 5CITA 2HAEA 3B1WA 3UAGA 2CLFB 2PKQP 5HRCA 2RHBA 4PSKA 2GXQA 3GQBB 1D4AA 1NF2A 2C9YA 2GUWA 3EUWA 4QU9A 4EGAA 4OPMA 2WMDA 1JEDA 3OZCA 3WDMA 4M1WA 2UZAA 4EL0A 2V1UA 3LC0A 4KR9A 3DXYA 5CVCA 4DNFA 4EPVA 4IJ6A 4M1ZA 1RRCA 2AMFA 5LBUA 2C9CA 2D3TA 1MG0A 5GJVC 2I33A 2F17A 2JIDA 3ORQA 4BO9A 3UMFA 1C30A 4BNYA 3R3UA 1Q50A 1X2BA 2WV9A 1L5RA 5A5EA 2L69A 4X1YB 2BMAA 2VUSA 2J9FB 4LJ7A 2IF2A 2B7BA 3AFOA 4JASB 4I99A 1Z68A 2QRVA 3RFCA 1OB5A 4Y6GB 4S1NA 4E5PA 4PPYA 2O14A 5B1IA 4D8TA 4Z4IA 2FSSA 1BW9A 2GZ2A 1Z7GA 3BIWA 5EMHA 4BX2A 2QU7A 2XXJA 3C70A 1CIJA 5L3VA 1AIPA 4FQ7A 3ERCA 1H8EA 2Z9DA 4QOHA 1ZH0A 2SBTA 3IEUA 3RRYA 1ABBA 2F1OA 2FSFA 1A4RA 2CHEA 2A4KA 2OGUA 4F4JA 1GCIA 3I34X 4I6EA 5JVDA 3ROTA 1KZ4A 3O74A 4LRTB 1RQLA 1KAEA 4HDKA 5T57A 3P4UA 1B2RA 1UKYA 1NW4A 3N8GA 1T25A 3TGLA 1TC1A 3BE6A 1ADCA 4DLXA 3M7IA 3FNFA 2JHFA 3QQPA 1MJGA 4O2AB 1O77A 4U6QA 4KYIB 3GDHA 1QZXA 2UZ4A 4E03A 3IC5A 4QYIB 2GRAA 4JSRA 4BPBA 4B45A 3HJGA 4MRSA 2WF7A 4X8LA 2X5NA 2X8JB 4K6FA 3FGPA 3PDIA 2POQX 2XMZA 3LIPA 2QG4A 2IXAA 4Y1RB 4QT4A 4HWSA 3CEHA 3TNLA 4JOSA 1EFVA 4CM5A 3CNEA 3WYBA 4EG0A 1F1BA 4CR8A 3R8FA 3FTEA 4FOSA 4TLBA 5FPTA 1N8NA 1O94D 3STVA 4C29A 1C9YA 1LPBB 1SUFA 1H2YA 3C7CB 3RIHA 3VTFA 4CF3A 5BNZA 3CX7A 4ZJPA 3OE7A 4BFZA 1NI4A 4ZMSA 4ITUA 3R7FA 3SOPA 3CPEA 5TE9A 4JJ6A 3ZEIA 4R2KA 4D4HA 2YFKA 3MFQA 5T64A 1KZHA 2QJFA 1N6NA 3VZBA 2N42A 2JLQA 1IRIA 4V3BA 5A7FA 2RGDA 2P3LA 4MW5A 1UEXC 4KQ1A 3VJKA 4ZI7F 1JTEA 4KSCA 4YUVA 3VYUB 5IMBA 3SEAA 1E6CA 1Q0QA 3IR5A 3P7MA 2BCJQ 1JKJB 1O9BA 2RB4A 2C7PA 5DLDA 2GKOA 4M9QA 5CURA 2AFVA 1DKNA 2ETVA 1QC5A 3BEOA 3FUWA 4W5NA 5I9NA 2CLIB 1SBIA 4NX2A 2I2WA 2GO1A 4UREA 4XYGA 4P93A 4U63A 5K0ZA 4B3GA 3QKRB 4B3IA 3BOSA 4FFNA 1FSPA 2ZRHA 2GF0A 3N5KA 1N0UA 4PG6A 4ZMBA 4WWHA 3HXOA 3HBLA 1TO1E 1GPUA 4F1WA 3AEQB 3BDAA 2X13A 1D2AA 2A67A 5HIJA 1F8YA 3KB8A 5CPBA 3ZZMA 1XNHA 2DPMA 1PJ2A 1G60A 5IH7A 3L02A 4CMEC 3QLVA 4GR4A 1PWEA 2ZJ7A 2R47A 2FQYA 3DEAA 4BB9A 1QH1B 4EUEA 2VOJA 1DMSA 4TXMA 2A0KA 3MELA 3WLEA 1XK7A 3TB4A 1Y1TA 3GUYA 2HHLA 3PNPA 2HCJB 4MV8A 4E94A 2O2HA 1VBFA 3S55A 3UGQA 4I4CA 3F78A 1RQGA 1N2JA 5CDSA 1E2EA 3WDSA 5BN5A 3DOOA 4EELA 2X0FA 1AXRA 3LP8A 3ZE2B 1P2GA 5HZKA 1W5SA 4Q01A 2JASA 3Q6IA 2EBWA 4IUBS 1DBQA 1LC3A 1QQ6A 5JCJA 2Q46A 1E1QA 4CKCA 3GT3A 1HDEA 2NSJA 2IWRA 3PD1A 4ZCIA 3INRA 2CWWA 3D6FA 4KAXA 4YTEA 3U61B 1RAIA 3GARA 5EZYB 3VSDA 4UUOA 4RK4A 1MBZA 2O19A 1SHJA 3HM2A 3PTAA 1RLMA 5KQMA 3DDHA 2FOIA 1OU4A 4GSYA 4XIYA 1M9NA 1Q7BA 4KSBA 2ZWMA 5E7JA 1TU0A 4MWBA 4PQYA 1BRMA 2V98A 4MKIA 1DPGA 2CNNA 4URYR 3H1EA 3MIZA 5HF9A 1NQTA 1XCMA 2JA2A 3LUPA 2JAXA 4A15A 3WIOA 3GWGA 4JJ8A 1FUIA 3K5PA 3L43A 1S02A 4L5BA 4P3PA 1KTIA 1B4DA 4C6TB 3OPMA 2GM4A 4IJQA 2ZWOA 4KYTA 2V7BA 4RLFA 4FEYA 4ID3A 3ZZUA 5IAGA 4GPEA 2ZYRA 4DLKA 4FMCF 2GXUA 2ZYVX 4UDOA 2RSLA 4JQYA 3VC7A 2EXXA 3R3WA 1WWKA 2VEOA 2ZJ4A 3O3NB 5DOZA 2WC1A 2QLNA 4ZCTA 2JGLA 2QRHA 2J3IA 2UAGA 3EN0A 3DMRA 3KT6A 3KKZA 1UDAA 2P7IA 2O2DA 5A4IS 3NTRA 4X90A 1SXJE 5AW7A 4GG1A 5T7BA 2AKYA 3MINA 1SVSA 5F77A 5C1DA 3RUPA 5JADA 3EWIA 3AM4A 1N32B 2R6AA 2BM8A 3QE2A 1XZEA 3HJTA 1MG5A 1S8NA 2COEA 1XSEA 1Y1LA 2A5YB 4M21A 4PGFA 2UYYA 1WRBA 1I30A 4D8VA 5FLKA 2OV1A 3NNSA 3E9YA 2I2DA 2GCOB 4ENSA 3TK1A 3MCTA 1HR0B 4A27A 1RKBA 1JU3A 4CL2A 2YFHA 3R9WA 4JNKA 4JP8A 3ZR4B 4D79A 3HVRA 1VG9B 2EP8A 2PR2A 4G0MA 4NZNA 4C04A 4UTVA 2CV1A 2IQ5A 3E3AA 3M33A 3B20A 5ALPA 2OHIA 3F90A 4OFXA 3TQIA 1UPCA 2HBRA 1JE0A 2P0YA 1OFTA 2WJHA 3MJFA 4MQ4A 1X7YA 3NH9A 5DM4A 3CZAA 3OLQA 4MUEA 4YP7A 3SSNA 4AG6A 4H6PA 1G66A 2Q4OA 1WKBA 4I1OA 2P2GA 1JPNA 1VE9A 5BSRA 4NAUA 5EIBC 1NYRA 3P45A 3ZU4A 2GO7A 4PGAA 2ILTA 2PWZA 3PCXA 2D4HA 1QGAA 1ORIA 2GZ3A 1E7QA 3HGTA 3IHTA 3H8VA 4TMWA 4L4XA 3VTKA 4B75A 1E8NA 3VOTA 4DBLE 3D6TB 4HQ6A 3UHPA 4B33A 4YV0A 3SXJA 3FKQA 3T5GA 4RYLA 2IZZA 5MN6A 4J16C 4XE5A 5DM70 3MM4A 1XJCA 4FOPA 3VKFA 5KQGA 2DLNA 2ZQYA 1F4PA 4LDRA 1JECA 4EUKA 5CUQA 1CP2A 3OFND 1YI1A 5AHOA 5IKEA 1Z5UA 4HDQB 1NW6A 3LFTA 4CFZA 4L02A 1GQ2A 3ILVA 1GVNB 1VDZA 2E37A 2AEMA 2IPOA 2CEAA 3MTJA 3RFVA 1YSCA 2VLIA 4LJLA 3LUDA 5FBHA 5C7LO 1E20A 1R8JA 2K2QB 3P71T 5BSWA 3HU2A 4KWEA 4W5OA 3CPJB 4ZOCA 5F3DA 1KA9H 3IUMA 1SXGA 4AP5A 1OXSC 1IXYA 2AOXA 4CF5A 1UBMS 1U99A 1N3LA 3A37A 1HTTA 3QXXA 3TQCA 4DSAA 5H4GA 4YJGB 4II7A 4Y2PA 4DV2B 1BN6A 1UXJA 2Y1KA 4MI1A 3K1AB 4MR7B 1CEXA 5E9QA 2JFYA 2ODEA 1E62A 1VJ1A 2BD0A 2Q5LA 3PUIA 1C0EA 3GLIB 1LDBA 2P4EA 3PNMA 5MN5A 1QGUA 3BRSA 3LA6A 1HDRA 3OPYB 3GMSA 3ACCA 2EGHA 2ZDHA 3QTLA 3B36A 2JGDB 5KAPA 5KTKA 1OWPA 3KTAA 4L1KA 4YRPA 4A6XA 1CY6A 2QX9A 4KWCA 2O7RA 5CDGA 3EVCA 3O1IC 5JRDS 5IF9A 4FGWA 4XI9A 2NXJA 2ZT5A 521PA 5KNBH 1P7CA 4R1OA 1IEWA 1UBOS 4GXTA 4AG3A 1ZK3A 4DIEA 9ABPA 2HV8A 2QSZA 2ZTMA 3K30A 3G79A 4RA9A 5DNAA 4DM4A 4ZHQA 4KIJA 3EG9B 1QE5A 1XWWA 4AZ0B 1E3TA 2QZ9A 5ESWA 3Q40A 3K1YA 4W9MC 4F4FA 3GP5A 3K6SA 3LSTA 1GG9A 3CEMA 4LSZA 5REQB 2JFUA 1R4MA 4JP2A 3GT7A 4NE2A 1LTHR 1QG2A 3NVKI 3GAZA 1ETHA 1QJCA 2LBPA 4M8NE 4R1TA 1S2LA 1Y3AA 2GJSA 2YS6A 4BBJA 2WNHA 3I61A 1R0ZA 3EA5A 5IX8A 4MROA 2IEIA 2ZJBA 2K5UA 2NNWB 1CJKC 2ZAMA 3L4KA 3E53A 3ND8A 1UDRA 3RYCA 3RSFA 1GPLA 5CA0A 3VSAA 5ALQA 3AUAA 3GFOA 3QX7A 3MUEA 2MINB 4A8HA 5KYXA 3FUUA 5LLSA 4R01A 1NJ1A 1ZJ4A 1C80A 3TFQA 5KYUB 2GM5A 5J40A 4CWAA 3D7RA 4KTTE 3FBWA 1CJSA 4HJRA 4LTMA 5FBQB 2C9ZA 5BQ5A 4TTIA 4ZD6A 1UMCA 3ZTTA 3HDHA 3MYYA 1E59A 1XXLA 3HB5X 5JXGA 5KINB 2A88A 3TPCA 1BWRA 4YVFA 1QRAA 1K8YB 4OUDB 4DMLA 3K53A 4J0DA 4L2IB 2C1XA 3MGKA 3TZEA 2Q21A 2AUNA 1AKYA 1ODFA 3DAPA 3EF0A 4I9FA 2H08A 4KH1A 4MUKA 4AS3A 4P3KA 5B64A 4HADA 2BVNA 3HL0A 2A9RA 1LDNA 4DMGA 3IQWA 1K7FB 2R65A 3D3QA 1BQ4A 3OZVA 5T8KA 4UQOA 3USES 4E7PA 1NG9A 3WAJA 3AEYA 1HSOA 3DG9A 2A5GA 2IHTA 1DT3A 3H04A 4H7PA 4AUNA 4C4PA 3HJFA 1H2BA 1UT6A 3NQ41 3Q87B 5HF6A 1MA0A 1GQFA 1TNDA 1BA3A 5A0FA 2FGJA 3I2FA 3JR7A 4JBIA 3L2OB 5EPUA 4ZT7A 1J06A 1ZH6A 4JBHA 1K4YA 4KP7A 1BFDA 4LNAA 1R6VA 2R6FA 3TLKA 2QQEA 5K8IA 2RI1A 4IEEA 4JQOA 1WPRA 4D9GA 1AXEA 4NNPA 2PZGA 4F0JA 1N6IA 1NNI1 4OHRA 2R2GA 3S4YA 6CHYA 1IN1A 4M9XA 4X8MA 5K2MA 1DBRA 4KDFA 4XOUA 1PBNA 2CL7X 3L6RA 4YRJA 1XV5A 4EKIA 2O0HA 3WYCA 2AR0A 2A84A 2GSDA 1YI8A 3T7CA 1CQXA 1MH9A 1RI5A 1Z4LA 2VP6A 4G41A 2QWXA 3FYUA 4U7PB 1KQ3A 1D1TA 3CLSC 4JUAA 3SJBA 3L0PA 3QU2A 4TUYF 3LK7A 4X63A 2GVDC 4UBKA 4C4RA 5CXXA 2JFHA 2P69A 1C81A 2X8BA 4PYIA 5EG5A 3I1YA 2JI8A 2BISA 4BEBA 4KN5A 5LQDA 2CL0X 2DJIA 4NWIA 1TF2A 4P3OA 4RY8A 4TZKA 1V43A 1WPQA 3TDMA 1A8IA 1GOTA 1FX0B 3GNTA 5C0OE 4YCMA 4V1CI 1I3KA 4B0PA 4O4JA 3RWOA 3A1CA 4FT4A 5EHZA 1FVFA 4K0RA 3LYAA 4E22A 4U7DA 1L9XA 1YDWA 2QLMA 5DW3A 2QN8A 4ZFNA 3C8HA 3O3MB 5BMVA 4FDLA 4MB6A 3HKEA 1KEVA 1NKVA 3L1JA 3P9SA 4X97A 3M6FA 4MWSA 3QWBA 4XTCS 1JFLA 1Z4KA 4UM8B 1U7OA 1VL1A 4N01A 2B7LA 3C0KA 2XMRA 5DN6D 3FYSA 1RXSA 1VHDA 3HV0A 3LLUA 1SVMA 3MF4A 1IQ0A 1OFUA 2C0PA 4QU5A 3SBDA 5B55A 3RVNA 3FE2A 4QQRA 4J1TA 3I58A 1BEUB 1QIDA 2H3HA 2WTXA 2CK3D 3G2QA 4CM8A 5F64A 2F3QA 5A1JA 2C7QA 4QJBA 1B2LA 4JUBA 1IYZA 1PAUA 2CZQA 3D8NA 4ZZIA 1Q0PA 1N6KA 1R15A 1W0JD 1XHLA 3DZKA 3FLAA 3SXUB 3U3DA 2P67A 4A4DA 4BCDA 5I7HA 2FW9A 3WAGA 1L5HA 1FRZA 3LT5A 2EYQA 4C2UA 2JAQA 4MTCA 3JWIA 1V8DA 5JS6A 2O2GA 2JFBA 4WKCA 4NXNB 4P36A 1YCDA 1M1ZA 4YMWA 1WS6A 5C53B 1KKUA 1M73E 4DSZA 4RANA 1GKYA 3V1MA 5FPKA 1JHMA 1X77A 3QHPA 2O5RA 4KQ2A 2C3OA 4LJ8A 4NH0A 4X1IA 4GNRA 3ZVKA 4TTPA 1L2TA 3E15A 2DG2A 3OG9A 1CDEA 1W5AA 4URHA 5JSYA 4IDNA 3AUXA 4L7QA 1G18A 4LXXA 1WL8A 2L0XA 3CG4A 1XZNA 3A6EA 4RNDB 3O84A 3HCFA 1TI7A 4WL0A 3AV3A 3TUIC 2ZW9A 2HR1A 1I32A 4JGGA 3MD0A 3SYMA 4DDKA 3OICA 4BQFA 1AK2A 4NCHA 1WDKA 3HR7A 3ITKA 4RY0A 5LDHA 3W2HA 1VYHA 1F48A 4WERA 4AZVA 2ANCA 4BX0A 3JAKA 5KYVA 3UG7A 2ISCA 1E3WA 1QUFA 1TQHA 3MPOA 4NE7A 1Y3BE 2PEYA 1VI2A 1T5HX 5WRFA 3FSRA 5KQSA 5JJIA 5EZQA 4UFOA 1BVUA 4WY5A 5HQ3B 1N34B 3GJSA 1P9LA 3CR7A 3WO1A 4DLRA