4XWAA

Tmk from s.aureus in complex with the piperidinyl thymine class inhibitor with a c5 ethyl-amine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
204
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title A highly potent antibacterial inhibitor of Gram-positive bacterial thymidylate kinase (TMK): SAR of piperidinyl thymines at position C5 and L1
rcsb
source organism Staphylococcus aureus (strain mu3 / atcc 700698)
molecule tags Transferase
total genus 86
structure length 200
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwaA00
1FPMA 4D4LA 3ZLJA 2IWRA 5DO9A 1W4CA 1G19A 5DYGA 2F9LA 3FHOA 1HQCA 3KKMA 3PEYA 2GJKA 1QBKC 4Y0AA 2AR7A 1D5CA 5EZ6B 3Q8XB 4ZDKA 4R7ZA 4TMKA 3Q7QA 3O8DA 3ZVLA 3K0SA 1ZP6A 1SVSA 3B1VA 3K0CC 5AWFC 2HLDA 1JR3D 1KJYA 3G82C 3GFPA 4R2IA 5E7MA 2GJSA 3Q85A 4HATA 5JS8A 1SGWA 3PEWA 1XD2A 3N2IA 2R6AA 1SXJA 3T5DA 2A5DA 2BBOA 1J99A 2B6HA 3SU8A 1BYIA 3DM5A 3LH5A 4GDFA 4MRVA 2G88A 4NP6A 4PAMA 3VR4A 3W34A 1NKSA 2VSXA 2OCBA 2ZRDA 4MRSA 3QXCA 1S9DA 2IEZA 2R9VA 3FWYA 4YDSA 1AS2A 2OLKA 3FKSD 2IHBA 4N3NA 2IYVA 2JIZA 1G3IA 1D2EA 2ZRLA 2CVHA 2I1QA 3TBKA 3ZVMA 2JLVA 2I4IA 3WNCA 4KSCA 1XMJA 1KTVA 2ZRCA 3FMIA 4TZ0A 3ZH9B 4HB4A 4M1SA 1COWD 3B1YA 1AS3A 2ECKA 4Q18A 2ZYWX 4O25A 1CEEA 2A30A 2HCJB 4BLQA 4CIDA 5FBQB 1XXHB 4EUNA 4DCTA 4JLMA 1XF9A 1E94E 5KNBA 3BBPA 4KBFA 1LNZA 3WMEA 4QXAA 1PJRA 1YU9A 1KSFX 5L3RA 3RS0A 4EKDA 1VIYA 5JI2E 1SVOA 2OFWA 3FE2A 4L8GA 3J81k 4V03A 1XZQA 2ZE5A 1NI3A 5JEDA 4Q5IA 2YC4C 4TYQA 121PA 2IYYA 3L43A 2E9SA 4KBGA 5DHAA 1KY3A 2HF8A 4DLRA 5JEEA 2O8EB 2QAGB 4PC3A 4NCKA 1NMYA 2G77B 1QHXA 5CK5A 3RHFA 3WYFA 1NRJB 1Z3IX 1LF0A 3MWKA 2XJ4A 4IXMA 2ZSEA 1N6NA 5L8VA 2EWWA 3RWOA 3I4LA 4BEBA 1S1MA 1GFIA 3HYRA 5JFGA 4JSTA 1PUJA 3Q5EA 4ACAA 3ND9A 4PPFA 3IO3A 1E79A 3WHLA 3IDQA 1UKVY 2B8WA 2BCGY 2WVJA 1ZD9A 5FPTA 1NG1A 3EARA 2GAOA 1JALA 2CDNA 1WXQA 1IN5A 1AQYA 4TLDA 1VKJA 3E1SA 5KU1A 2FDCA 721PA 5B2ZA 1MABB 5HE8A 1CBUA 4TT3A 3PUZA 3GJ3A 4X8MA 5BN5A 1SHKA 2NZ8A 3KX2A 1J7KA 4PANA 4RFVA 4AKIA 1OB2A 1NBME 4Q01A 4LJ4A 2P2LA 3HDTA 4BGDA 3EIHA 2XOKD 1JXMA 3ZJYA 3EXAA 4M1OA 1GITA 4P4TA 2F7SA 1OXXK 3GLGE 3VNVA 3IQWA 4OI1A 1RRPA 4GZMA 2W6JA 2B21A 1E9FA 4I4LA 1SVKA 3D6TB 4CDGA 3I5YA 4ZI3A 3LX8A 5EP4A 1R10A 1VCMA 3KQUA 3PCRB 2PCJA 2J0SA 4HLCA 3OAAD 1FOEB 4OQXA 4QOSA 2OFXA 5CM8B 3QEOA 1LS6A 3QVVA 2VHUA 3QBVA 1P75A 2R2AA 2GTPA 3VU9A 4MH0R 4MYHA 1NLYA 2J0UA 2P5SA 2ZVPX 4Q4AB 2ZSBA 4URXR 1Z5ZA 4PPNA 2BM0A 2V55B 3H86A 5HCNA 4PSKA 4TYNA 2BWJA 2ZREA 3MWLA 2VHJA 2WHXA 2F1JA 1K5GA 2ATXA 4XOIA 3E70C 2HUPA 3W6NA 1IXZA 4Q47A 3EPKA 4JLJA 3EIEA 4Q03A 3KQHA 4Z8XA 5JJLA 2Q3FA 1IN6A 1R5BA 2WOOA 1ZMXA 1WCV1 3SC3A 2IC5A 3QG1A 4JLKA 1S9HA 1KI3A 4XSGA 3H4MA 2Q3HA 1FUUA 3MGCA 4XWKA 1FP6A 3H1TA 5FFMA 4QJ3A 3OEED 2PMKA 3A37A 3F3YA 1KK1A 1BH2A 4URWR 1Z0FA 2CE2X 1FQJA 3ZQ6A 1FNMA 4PZLA 1G8PA 5FUVA 1IONA 1YZUA 4MRRA 4Q9JA 3R9IA 3EX7C 4YMVA 3BE4A 3SR0A 2WSMA 2X2EA 3RSOA 1NBMA 4OHZA 4Z54A 2OESA 3AQ4A 2ZU0C 4LBWA 2LCFA 3C41J 3I5XA 4JLAA 1VHLA 5JRJA 2QP9X 4Q7KA 3CNLA 1NVWQ 3CRVA 1LFDB 5JCPA 3KKPA 3U3MA 4M9XA 4MA4A 4HZUA 2WV9A 2ZI6A 1E2NA 3BGWA 2FOLA 2QP3A 1UDXA 4S2EA 2OBMA 3IEVA 2C96A 3CRQA 3AF3A 2V6IA 3G0HA 1II9A 1R2QA 3PFIA 4V0ME 2G0TA 3HR8A 4TMXA 3DPUA 4F91B 1BMFD 1VPLA 2FFHA 2RCNA 3K0FA 4B33A 4B43A 2KJQA 1W36D 1R6BX 2JLSA 2GCPA 2KE5A 1SHZA 2ZJAA 5CM9C 1ZM4A 1G291 1HE1C 5CLLA 1Q57A 1G1MA 1JQJC 3QXXA 4DVGA 4F4CA 4PSAA 2R44A 1ONBA 2JDID 1U81A 3REGA 4WZAE 2C98A 2YKGA 3MFYA 3Q9LA 1ZU5A 1W36B 2VLIA 1Q20A 4A82A 3BOSA 2VEDA 3FFBA 4N0EA 3SJBA 2YVUA 4NDZA 1ESMA 2VYFA 4D80A 4TMZA 5JBQA 2CE7A 3RRNA 3GLIE 5K8UA 4EQ6A 1E2GA 2ZI4A 2WBLC 1E2JA 1E1QA 3I92A 1OXSC 3MJHA 5FTMA 3T1OA 1DG1G 1G7TA 4Q02A 1WB9A 1T8UA 2ZANA 3GJ7A 5D3MA 2WMNB 2DWPA 3R7WA 4P4SB 1CJUC 2O8DB 1R7RA 2AX4A 4XD7A 5K8IA 2RGDA 4WAUA 1AZTA 2QN6A 3ZVRA 2RHDA 4G1UC 3PUWA 5DHFA 3AVVA 3CPJB 1KAOA 4KLNA 4LK2A 1JJ7A 1ZM7A 2IXGA 2F6RA 3KJIA 1CULC 1HURA 2O0HA 2P3SA 1HYQA 3OIUA 4HLDA 5L3QA 3P32A 2A5FA 2GBLC 2JCSA 1KI8A 4TLAA 3I73A 5EXTA 2GCNA 1MT0A 2VSFA 4P3YA 1KKLA 1VHTA 2IEYA 1KMHB 1NP6A 2IXEA 3QKRB 4V0MA 3WYGA 1AA9A 3ONWA 5AUOB 4ARZA 3EC1A 2HV8A 5J4LA 5TMPA 1OIXA 2OV2A 5L3SB 2ASEA 2Z0MA 4FN5A 4UXJA 2PJZA 2VHQA 3DZ8A 3K1JA 2GJAA 3B9PA 4QHYA 4NYIR 1SKYB 3LVQE 5JS7A 3K70B 2G83A 1ZAKA 3W6PA 1U0HC 3T15A 3A1WA 1G20E 2F43A 2C9CA 1S0UA 2OO7A 1OFHA 4HAZA 2KBFA 3OIWA 2D3WA 5FPSA 2PEZA 4NHOA 3X2SA 4LWZA 2WJIA 4B73A 4ON9A 1P2SA 1II0A 1N6IA 3LBIA 3CR8A 2ORVA 3IHLA 2WAYA 3N2EA 2RKOA 2ZPTX 1ZUIA 4RJLA 3S1AB 4B74A 4CEIB 1NN5A 1RW4A 5BYKA 2BEJA 4NKRA 2XB2A 1UPTA 2ZSDA 3GJXC 1EFTA 1QHSA 2HYDA 4A6PA 2HJVA 5F9HA 2RGAA 4OHXA 3FMPB 4QHSA 1XB2A 3G5UA 2B92A 4ZCMA 3KDSE 2PLRA 5B30A 4A36A 3QKSB 4BRWA 3AVPA 4NTZA 3ASYA 4RKFA 2OM2A 1HUQA 4HYYA 3B6EA 3EZ6A 2EFEB 4JBWA 4WZBE 1D9XA 3WMGA 3GJ4A 3K0CA 2R6GA 2HLDD 4AYWA 3PUVA 3NWJA 1GRRA 5AK0A 3U3OA 3LVRE 1A2KC 3VX3A 1MH1A 2BMEA 4R9UC 3LY5A 3PJRA 3U44B 1G18A 5KPJA 3UWOA 1V5WA 3KQNA 5JMTA 4C0LA 4JJZA 1XD2B 2FA9A 4LJ6A 1T6NA 2QPTA 2JGNA 4DCNA 4DSTA 1NVVQ 1B0UA 4CF7A 2VIIA 4LC1A 3PITA 4Q1DA 3A1VA 2JIZD 3V00A 4AKEA 1E9CA 1YR7A 3MCAA 2QMEA 3BAFA 3TSZA 1KIMA 2FSFA 4EFMA 3MD0A 3C15C 4ZI2A 2RGCA 2G3YA 2VP4A 4QL3A 4HB3A 1GWNA 3VFDA 1IQPA 1NLFA 4E07A 3AVWA 4URZR 1NNEA 4HLUC 2JEOA 1AS0A 1JNYA 4DSUA 2J59A 1Q1EA 1KHTA 1Z6GA 2RH5A 3CX7A 5FBLB 1GRQA 4Q7MB 1RRCA 1E9RA 1P73A 1UBFA 1NKTA 2ZRPA 3AUYA 3BB3A 1GL6A 3WBKA 3L82B 2WSSD 1A2BA 4NONA 1J90A 3ZGXA 5TB5A 1TQ2A 4PZYA 2GESA 3FHCB 3WP1B 4NMMA 1GUAA 4JJKA 2DCUA 4D4JA 1KI6A 4RSGA 4U7DA 1KMQA 5EP2A 3QXSA 3BH7A 5DI9A 2JLQA 3WY9A 2ZR7A 4LHWA 1XZPA 5J40A 1P2TA 2BEKA 2CL0X 2OCYC 4RZXA 1FMLA 2QNRA 4QBHA 5AJVB 3H0KA 4RD6A 2JLUA 1E32A 3GPLA 1IJFA 1YZQA 1XTIA 4QG7A 3QIAA 5CDFE 2ZRKA 3THYA 4IFEA 4EPYA 3AGPA 4MGIR 2B8TA 4JBYA 3LAWA 4M1TA 2FE4A 1AJEA 4UXHA 1E9BA 2ERXA 3GLFE 3QKTA 2W83A 5DIFA 1E79D 3CRMA 1X8LA 3B78A 4W5WA 4B3CA 2QG6A 3DMNA 4CRWB 1DAKA 4FWTA 2FGKA 2WPDA 1XFAA 4HUQA 4C3ZA 3ZVNA 1ODFA 1NN3A 2XZPA 2MSEB 4OI4A 1FQKA 3FMOB 5JWRA 3QBTA 4BASA 3HU3A 3CNOA 1YVDA 4DEXA 4C2UA 1CXZA 1F2UA 5G3YA 1G7RA 3BERA 4LZZA 2VQSA 2ZSFA 1UDWA 2YINC 1QHGA 3EASA 5TXGA 1II8A 4MRPA 2NZJA 1KZGB 1BYUA 421PA 4PAOA 2Z5FA 1Z63A 1EXMA 4LPSA 5FPKA 2ZITA 3CWQA 1Z6XA 2C99A 4DC9A 1E2PA 4YXWA 3AVUA 2DPXA 4W5HA 4C0QC 3W90A 1ZCAA 3KFXA 3TMKA 1G17A 4ZDIA 5KOYA 2QORA 4OHWA 5FOXA 4PC6A 1ZNXA 2R65A 4XIGS 2BDTA 2YHSA 3IUYA 3R8FA 4IVQA 1W46A 1ZD1A 4Z1MA 2QAJA 4Q4LA 4RY2A 5LD2C 3VKGA 4HI0E 4Q9KA 3TQCA 1RZ3A 1OYWA 4D25A 2F9MA 4PQYA 1LTQA 4MYUA 2V54A 3CR7A 4XJXA 4ZPXA 3TQFA 3R20A 2XTZA 3U2QA 1F6BA 1XBTA 3B1XA 3VU9B 2OCPA 5CDFA 1FTNA 3PVSA 2EFHB 2VSOA 4Q1FA 2P5TB 5JWOA 3QF7A 2PCLA 1DPFA 2WKPA 4PO8A 2JJ1A 2ZRAA 3GLFA 1F60A 4WW0A 4KITB 1MO3A 4X8LA 4HZIA 4G01B 1K8RA 3FOZA 4ZCLA 1LB1B 4BZQA 3UXMA 2ZSAA 1HY3A 1A5TA 3GLHE 3U4QA 2FGJA 2J0VA 2WKRA 2CHQA 3ZZ0A 3PR1A 1YR8A 3AEZA 3MUFA 4BFWA 4IEEA 2GJ8A 2H18A 4ZV4A 3TRFA 4HLQB 5EUMA 3DDCA 1ELOA 4P4UA 1UBEA 2ZJ8A 3QSYA 1OLOA 1Z07A 3RRMA 1CS4C 2F3RA 4OHVA 4KODA 5LBIA 1N5KA 1S3SA 1GNRA 4LX0A 1N25A 4JL6A 1KI7A 2TMKA 1BOFA 3NDPA 2QRZA 1P6XA 4D0GA 4HUTA 4AKHA 4IHQA 1MKYA 5FUWA 1X3SA 1ZM9A 1M74A 2RGGA 3RS5A 3T06B 1JAHA 1QHHA 3FFAA 2EWVA 3AVQA 4W7SA 2C04A 1Z0IA 2VP0A 3NC0C 4LBZA 2PT7A 2YWEA 4TLBA 2CLCX 3C7KA 2WZQA 4JSYA 4W5JA 1RJ9A 1EFUA 3OIYA 4BFYA 2X2FA 2YOGA 1QG2A 2IF0A 3D3QA 4E5UA 2HYIC 5H70A 1ZUHA 3MSXA 3NEYA 1E1QD 1MO6A 4QJ5A 4RCZA 5J5CA 3U7FB 2OAQ1 3SBDA 4UJ5A 2D2FA 1RFLA 3UMRA 3UPUA 3KZ1E 4Q7LA 4TL8A 2NO0A 4AWXA 1Z0KA 1LV7A 3GLHA 4LBYA 4CT5A 1WDTA 2ZIAA 3WHKA 3DM9B 4EQ6B 3C5HA 4BECA 3CX6A 1KDOA 3ADCA 3SYKA 4EAQA 1NG9A 1L8QA 5CK4A 4WXPA 1IAQA 3EAQA 4KVAA 2FEMA 3R7WB 4JT4A 3EG5A 2WJVA 2QY9A 2IYZA 4IOMA 1OT3A 5KDDA 3EC2A 2DBYA 4PZZA 2GBLA 3IQXA 3TK1A 1E9DA 2H7VA 2A5GA 3GFTA 4TWZA 3RNLA 4MQBA 4C9BA 3QNUA 4US0R 2EFGA 2D7DA 3N5CA 4LC0A 5FTJA 1OF1A 4BFTA 4KLZA 2DFNA 5GVSA 2ZYUX 1XPRA 1RPZA 3W3AA 3A6PC 1XTKA 1GZSA 4FW9A 2SHKA 3BXZA 2ZRJA 3AKDA 2RMKA 1C1YA 4NL4H 1OH6A 1OFIA 1Z83A 2BC9A 1G7CA 3KUCA 1OKKA 1PLLA 4XVUA 4ARZB 2ZM5A 5KTYA 3TW8B 1TQ4A 3RRZA 2ZJ2A 4IEIA 3KJGA 3UANA 3TSWA 3B60A 2WJYA 1F2TA 3QVUA 2AWOA 1KO1A 3T1QA 5L3VA 1YKSA 2IBMA 1KJZA 2GDJA 4DIEA 2JJ2A 2ODNA 2DHRA 2OE2A 3BD9A 5EE9A 4DSOA 2NPIA 1HQYE 3X1WA 4A0FA 2O8CA 2O8BA 3TUJC 3LFUA 1M6NA 2ZJ5A 3AF1A 1EFHA 4A15A 3A4LA 2N42A 3BRWD 3I3SR 2WWHA 4US2R 3DVLA 4IDQA 2PZEA 1CJVC 4A4DA 4UJ3A 1E69A 3GEEA 5KSZA 2IYXA 3SYLA 5JSZA 1VG0B 2CJWB 2O8FA 3NHAA 1I2DA 1M7GA 4TQUS 1R5OA 4Q00A 4DLWA 4M0LA 4MYTA 4EPWA 1L2TA 1TU4A 4LGMA 5KYKA 1M2OB 2OILA 2Q0HA 3CRW1 4UNRA 2ZRGA 4DHEA 5BN4A 3KQLA 1N2CE 2IUSA 2HT1A 1Z0AA 2QAGC 1CJTC 3PEVA 4JVSB 2Q6TA 1E6CA 2EU8A 2ZUDA 4FCTA 1A4RA 4JVLA 2V8OA 2C78A 1Z0DA 1JI0A 3CF6R 3NIBA 4DDVA 5BN3A 2J1LA 3CH5A 1E0JA 2ZE6A 4ASUA 5KSOA 2R6FA 1E0SA 3L0PA 2V7QA 1G3QA 3O47A 3ZDQA 1GILA 4GOJA 3MWJA 2P67A 4LY6A 1VECA 4A2WA 1W47A 3BJIC 4QNRA 1XDBA 3ZIAA 3I62A 4ABYA 2DFLA 4M1WA 2VP9A 5HR5A 4TTQA 4QFMA 1U98A 4UQOA 5IK2A 4RD3A 1UM8A 3C4JA 1TX4B 2IXFA 1YZNA 4JLDA 5G40A 5SZIA 4GNKA 4HLUA 4A9AA 3REFA 5C18A 1U0LA 1VG9B 3AF4A 4TMVA 2FPKA 4DIDA 4AURA 1VYUA 1T3LA 4KAXA 3RLFA 4Y0VA 5M04A 3NH9A 3WP0A 2ANBA 4IXNA 4Q66C 4WIAA 5G3ZA 2W58A 1OE0A 4I1UA 5EJEA 4DCSA 4J0QA 2XZLA 3DEFA 5FUYA 4EDHA 1RYHA 4A8JB 3NBFA 2IS6A 2IS2A 821PA 3OFNA 3AP1A 4LJ9A 1JB1A 3VR6A 4MRNA 1Z08A 4RFSA 4X8OA 1FW6A 4JL8A 2PT5A 1CKEA 4FMBB 1T91A 1FX0B 2QQEA 3CONA 5LB2A 1GNPA 5FPHA 1WBBA 4LV8B 1W0KD 5KNDA 1KI6B 3SFVA 3SYNA 2XITA 5JWHA 5FUXA 3ECCA 3K9NA 1H8HA 4Q4HA 2WWXA 2XXAA 4QHTA 4LPKA 1ZM3A 3RRYA 3X1YA 1P9RA 1U90A 3DZDA 4LYAA 4DDTA 4NYIQ 1FP7A 3C5CA 4TL9A 4ZIRB 1K6MA 4ERNA 2J3EA 3V9PA 2XNSA 3LBNA 5EE1A 3THYB 1VG1A 3QXHA 1OPXA 1H65A 1DTSA 3ZZUA 4KFTA 1R4AA 2IW3A 1UFQA 2WPDD 1NVXQ 5GJWC 2VBCA 2Z6VA 3I8SA 4XWOA 4OI2A 1CJMA 4XSHA 1N0VC 3O8BA 3AKYA 4OQFA 1N5LA 1PUIA 3VNUA 2O52A 3TVDA 5IT5A 3FPAA 1CF4A 1ZRHA 5J47A 2QSYA 5KSPA 4LRWA 1JECA 5EP3A 2YOHA 4LOAA 4O3MA 2IUTA 3LA6A 1CRPA 2R62A 3UG7A 2GWHA 2ORIA 3K0AA 1E98A 1X86B 4H9GA 1F2UB 4JBXA 2ANCA 2J7PA 2Q21A 4AYXA 3BFXA 4A0GA 2JLZA 2IK8A 2GVDC 3T35A 3PG5A 4YXWD 4B3FX 3A4MA 2R6CA 1YQTA 1YHNA 3GQBA 4CEHA 1U8ZA 1Z06A 4BLPA 4WZ6A 2HXSA 4UKDA 4Z1MD 3TKLA 4M1YA 1G8FA 1D2NA 1Q1BA 5EE5B 1US8A 4OHYA 4JKYA 2GEUA 1P2VA 1GKIA 4IW3B 2YC2C 1UKZA 1E0KA 1UJ2A 1VCIA 3SHWA 3X1XA 3ZS8A 4F38A 2BMDA 4EPRA 1QHIA 4DZZA 4AY2A 1E2IA 2IYQA 1B23P 1E1RA 1QHYA 2GJ9A 3GLGA 3QOFA 3EZFA 4EJSB 1E2HA 3K0EA 3PQCA 3K9LA 2V1UA 4HEJA 1ZBDA 3A36A 4QNMA 4EPVA 1W4BA 1XEFA 1PV4A 1KDRA 4KFRA 3WBJA 3NBXX 2WTUA 4QBGB 2GRJA 1TMKA 1EWQA 2JJ1D 4QKQA 3UATA 2YJTD 3NKVA 2JLRA 4G5SA 3TIFA 1LS1A 2GZDA 4Q7JB 1KK3A 1XNJA 4NCIA 5FOUA 4PSVA 2VHTA 1GSIA 5HKKA 3HWSA 3SFZA 2O0JA 1R0WA 3TR0A 1E2MA 3CKLA 1XEXA 3DHWC 2V3CC 3KTAB 4LJYA 1G6OA 4XVQA 1R8SA 4IDHA 3UG6A 5BXQC 4OI0A 3FGNA 4YMWA 1Z6YA 2D06A 2RB4A 221PA 3MLEA 4GFDA 4GP6A 3AVTA 4F4IA 3AF2A 2C9YA 1VYTA 3U4QB 1ZC3A 3KJHA 1VCOA 1NSFA 2W0MA 5J4YA 1GKYA 2QGZA 4B6EA 3DO6A 1E2QA 4DCUA 3KQKA 2ZRNA 3B8HA 5DN6A 4ZO4A 4CYMA 1G3UA 1W0JA 3IBYA 4U02A 1MR3F 4YMUA 2CEAA 1EFRA 4I1SA 1W7AA 4RZ3A 1R0YA 3CZPA 2ZETA 1VDZA 4OYHA 2QMUA 1P4SA 2IWHA 3GEIA 2JA1A 5B64A 1KGDA 3RABA 4P0TA 3TW4A 3THWB 3UMSA 1JR3E 4FD2A 4MKGA 2YWHA 3EIQA 5EUQB 3R8CA 2W6IA 4MGZR 1VCNA 1UADA 1HTWA 4Q9HA 3K70C 2ZRFA 5ELXA 2ZROA 4P33A 1XCMA 2PZFA 521PA 4H1VA 4D4KA 3O8RA 1QHHB 2UKDA 1QRAA 1UKYA 5F2EA 1N6HA 3C8UA 3DOFA 4PX9A 4JKIA 3KFVA 3P1JA 2VPPA 1VMAA 1G8YA 1HEIA 5GVRA 5GADl 4BLRA 3U7HB 5AJZA 1EK0A 4NCHA 4RD2A 1DAIA 1XXHE 2ZR9A 3A4NA 1D8TA 3PXGA 4URYR 2D7CA 1RJ9B 4R98A 1YRAA 3GEHA 2VL7A 3LW8A 2F55A 5CITA 4JLBA 2QBYA 4OL0A 1FTSA 2J5XA 1IXRC 1EG7A 1K5DA 3MMPA 3IBGA 4C0AC 4CT4B 1KSGA 1E0AA 1KI9A 1N0UA 4BE7B 1GNQA 1N6KA 4LJ7A 3AGQA 3FYHA 2B7BA 3HPQA 4LHYA 3VMFA 1VIAA 3LD9A 4IVPA 2HJGA 2GZAA 4GOXA 1IY1A 5SZJA 4MDFA 1O3YA 3LWNA 1XTRA 3GLIA 4PC2A 4DT1B 5EP1A 5D3QA 2AKAB 2BOVA 4GOKA 2PLFA 2D74A 2ODWA 4M9QA 2YWFA 2QTFA 2EYUA 3TGPA 1XU4A 4PO1A 2WAXA 4FMDB 2AD1A 4C4PA 1DELA 2I3BA 3L2OB 1WMSA 2EVWX 4HB0A 3THXB 3MRSA 3AVXA 2AXPA 5CB8A 4HAXA 5DNYB 1OKKD 2GXUA 2H16A 5AUPB 3H2YA 1EGAA 1WBDA 4C0JA 5KSYA 5JHGB 2C03A 2ZYVX 4C0HA 1XMVA 2QI9C 1J70A 1J2JA 1E9EA 2VA8A 2WIBA 2YYZA 1W4AA 4XWAA 5FI1B 4F93B 1XP8A 4TLEA 2ONKA 2IYWA 5FTKA 1SXJD 1X8KA 2Z4SA 3ND8A 2MMCA 2PH1A 1ZCBA 4DRZA 3R9WA 3GJ5A 4B2PA 2H1LA 4ILEA 1U9IC 2L0XA 3SN6A 2H5EA 1G41A 4AYTA 3KB1A 1SXJB 1COWA 4NPHA 2JATA 1DAGA 1CR1A 2ZE8A 3D31A 3K09C 1JEEA 4GPTA 1IN4A 1RVDA 4YMSA 2O8BB 1IJEA 4O2LA 2OXRA 5IRCD 1QF9A 2AHOA 4V0NA 5DISB 1F5NA 2PBRA 1Q21A 1XD9A 2A9KA 2QENA 3IILA 4MUAA 1NSTA 2NG1A 3TVTA 2QAGA 3FMFA 2AFHE 1TPZA 1WF3A 4Z8YA 4QRHA 3VTKA 1R5NA 4NYJR 1OH5A 1NLZA 4P31A 2QM8A 2XEXA 3A1SA 1YRBA 2BM1A 2QZ4A 4B3XA 4G5GA 2HXYA 4UXIA 4BLSA 2QA5A 3U6KA 4D81A 1HT2E 3ADKA 2WJGA 5FOWA 4ASUD 3TLXA 4OBEA 4UNQA 2NTYC 2V7QD 5FBVB 1H8EA 2IYSA 4OJQA 3BH0A 5CJ2A 4RD0A 5GJBA 1KSJA 4JLOA 1T0JB 2H57A 2ZS8A 2FFAA 3I1FA 4MGYR 3ZIAD 1DARA 2AXNA 2V9PA 4DLVA 2NO7A 2IYTA 3I72A 1ZVQA 2CK3A 1E2KA 4M2LA 2WM9B 5GJCA 2NPFA 1NN0A 2QT1A 4JVNA 2GF0A 1GAJA 1N5JA 2ZYTX 2J41A 1KDTA 2QMHA 4OQLA 4CEJA 2QM7A 4DCVA 4Q1BA 1KO7A 1U99A 5KO2A 2VRWA 1D6JA 1MRNA 4NU0A 4CGZA 1A82A 1ETUA 2GILA 1JXOA 4EPTA 3NBZC 3ZQJA 2XX3A 4WA7A 1TADA 1W5TA 3NHBA 2IYRA 1CU1A 3KXLA 3LDAA 2ZUBA 5KPDA 4LHZA 5FL7A 3GP8A 2QUZA 1M7BA 3JZMA 3PUXA 3SS8A 3SQXA 3OFND 1R0XA 1CRQA 3B1ZA 3V4FA 2Q9BA 4B34A 2CL6X 1ZYUA 4TT3D 1OSNA 1JPNA 1OYYA 4DB2A 2WWYA 4HDOB 5C2JB 4F7WA 3EPJA 1PLKA 4Q4AA 5E95A 5E3HA 2X8AA 2ZTSA 3OZXA 2GXSA 4JIMA 1C4OA 4RD1A 1G3MA 2OBNA 2ZI3A 2WOJA 4RFSB 1CR4A 1OIWA 1KJWA 4JLVA 4E09A 2BIFA 1TUEA 1ZNYA 1H8HD 1XTJA 2W6JD 2IYUA 2OUKA 6Q21A 3QPUA 4GT1A 3W3ZB 2PJRA 5UKDA 5TDHA 3VR3A 2OBLA 5G41A 4Q4HB 1F3OA 2XXAB 4IOJA 1DAFA 3CPEA 2FN4A 2VF8A 3SNHA 5TY0A 3BWDD 1G4UR 3TAHA 1KY2A 2C2HA 4TZ6A 1P60A 1S4QA 4TTRA 2UZIR 4FINA 3LQRA 1P7CA 3BFVA 1XCGB 2J0QA 2N1BA 1AGPA 1G5TA 2IHYA 2J0UB 4Q9LA 4AG6A 1ZD8A 3IO5A 3V4RA 3CM0A 2OCAA 4TTPA 4JMPA 2CCKA 4PFSA 1HH4A 3KXKA 2QROA 1AN0A 4N0DA 2EFCB 2J7PD 1AIPA 2GETA 2BMFA 2J9RA 3A1UA 3U3KA 5JLJA 1YJ5A 4OQMA 2X77A 3PEUA 4DLTA 5E7IA 1XMSA 4LYFA 2PZGA 4B3DA 3K0AB 3QXJA 5K8TA 1I4TD 5JCZA 3KXIA 5JZVA 4A0RA 1OH8A 1U8AA 3LNCA 3DL0A 1DG3A 1YZKA 3X1DA 3CNNA 4ACBA 1SULA 2OLJA 4IOKA 4LHVA 4B44A 1NBMD 1KNQA 3UKDA 1QG4A 1PLJA 3IPXA 3M6AA 3VAAA 1Q44A 2GZHA 3IKJA 4O0MA 1Z29A 1SKYE 2A2ZA 2FSGA 4CEHB 1CJKC 1E1RD 2OAP1 1NN1A 1RIFA 2BVNA 4NH0A 3TUIC 1KK2A 2R8RA 3SBEA 5LD2B 4K8OA 2CVFA 4PTLA 5BWMA 2AK3A 4PPQA 5CYPA 4A6XA 1DAMA 5TARA 4L4UA 1AKYA 1HA3A 4I99A 2CBZA 3GLGB 5EXXA 4ITRC 3OEHA 5F3WB 4HZUB 1NVVR 4PHGA 2CLDX 4PHFA 1KOFA 3UWKA 2CXXA 5HKKD 2OEPA 4PQFA 4G5OA 3QUSA 4B2IA 1LVGA 4FMCB 1X6VA 2BMJA 1E4VA 1S8FA 1L7VC 1UBGA 2OFOA 1X1SA 4P4SA 4RKEA 3EZ9A 4NYMR 1W5SA 2UVQA 1TF7A 3K0FB 1A1VA 1AGRA 2FPMA 3CW2A 2XZOA 2FU5C 1Q22A 1XEWY 2A7QA 1PZNA 3L8YA 4BEJA 1OFUX 4C30A 3C16C 4DDWA 3BK7A 2BHRA 3CF0A 2GEDA 4PO9A 3VQTA 4EFLA 1J8YF 4GZLA 3AKCA 1W0JD 4UNNA 3LLMA 4XTCS 2H17A 4E22A 1EFRD 1D2MA 3C14C 4Q1AA 1TNDA 2WIAA 4B6FA 2ZEJA 1DO0A 2ZI5A 5FBWB 2ZS7A 5EZ5A 1A7JA 2N46A 4UNSA 1KMHA 1NIJA 3RC3A 3FTQA 4XD7D 3QKRA 2QU8A 1WA5A 3I32A 3P26A 4GBMA 3VR5A 2JLWA 4LDJA 4NE2A 2DB3A 2GK6A 2NMVA 5L3SA 1G64A 4Q1EA 3TE6A 2QPOA 3HJNA 3IPYA 1P9NA 2W6ID 4BZPA 4D4MA 2X19A 5D3MB 5HZKA 5JI3E 2ZRHA 3RS4A 4BFXA 2OXCA 2NO1A 4IVRA 3X1ZA 4B75A 3D8BA 2QT0A 1ESNA 5AUQA 4CW7A 1G9XA 5DH9A 4QM7A 3CLVA 4A2PA 4BLTA 2VP5A 1GTVA 4B32A 4M1MA 1OFTA 2NQ2C 4KXFB 3GFOA 3CWZA 4QM6A 2ZUCA 4MDEA 5JJKA 5HZHA 1E2FA 3WXMA 2ZJOA 5H68A 3FDIA 5L3QB 5DI3A 1KDPA 1GIAA 3BIFA 1GL7A 3HU1A 3HU2A 4OK3A 3B9QA 4RZUA 3UK6A 4CEIA 3EWAA 4GP7A 1XPUA 5J4VA 2VTKA 2REBA 1G7SA 5F98A 4MYCA 4FMDF 2MSDB 2J46A 3GJ0A 3L0OA 5FOVA 1VYVA 2ZI7A 1SVMA 2K5UA 4M9ZA 5TVKA 3TH5A 2EQBA 3I61A 2WWWA 5FOTA 3KL4A 2ZXUA 3QKSA 4MGKR 4KFUA 2JLXA 3AVOA 2QBYB 1CLUA 1C9KA 2BKUA 4AIIA 1U0JA 2XTMA 4POAA 3OIVA 3NEJA 2F43B 4M8NE 1T3HA 1N3BA 1DE0A 2EFDB 4QC2A 2OHFA 5KDLA 3IGFA 3U60B 1ZNWA 2Z4RA 3RVBA 1TQ6A 1JBKA 1I4DD 5A0FA 2FWRA 4OKSA 4H1UA 3LX5A 3B82A 4HAYA 1TU3A 3U44A 3GLIB 1OB5A 4V0OA 5TV2A 1P61B 1OHHA 3CIOA 1V43A 5IF9A 2ZI9A 4G5RA 1OV4A 3ZS9A 1IHUA 3ZYCA 1NVUQ 3QF4A 2BV3A 2J45A 2E87A 2C95A 4TYYA 1NY6A 4AC9A 3SHFA 2I1VB 2B7CA 2C8VA 2Z83A 4O2RA 4URVR 1MV5A 3AV0B 4DLSA 4B3BA 1E2EA 5HPYB 1KK0A 4I81A 4GI7A 2OSBA 1Y63A 3CRRA 1FUKA 4PC7A 1IBRA 1NJFA 1P3JA 2REOA 1ZJ6A 1U9IA 4IDNA 2NO9A 4I1OA 1IY0A 3RDPA 2KBEA 2OT3B 2WMOB 1ANKA 1IM2A 2BKEA 1RC8A 3K09A 4FCVA 2IUUA 5B57C 4FIDA 4B2LA 4TN1A 4DDUA 1Q0UA 3K8YA 4V0LA 4A8JC 2WSSA 2IF2A 3RWMB 3O8CA 4Q21A 3B13B 3IIJA 2P6UA 3TUZC 1G8GA 1BS1A 1JPJA 4L9WA 4E03A 2Q9CA 3IIKA 4TLCA 2CNWA 1RKBA 3HYTA 1NMZA 3QPVA 2D4HA 3HR7A 3BC1A 4LI0A 1J8MF 3GMTA 1ZW6A 2BJVA 3UMFA 3B2EA 3KKQA 3AM1A 1S3GA 4C7OA 3F8TA 1XMIA 5HCIA 2G1KA 4LYHA 3QEJA 1GL9B 3FHTA 4GL2A 3FKQA 2DWOA 2RGNC 3ZD6A 4BFZA 4C2TA 1H8ED 3T1VA 2P6NA 4LYJA 3TSOA 2CHGA 2D2EA 1Z22A 2CCJA 1WQ1R 4GMDA 3SZRA 3U3RA 4I1VA 4WBSA 4DUGA 4X8HA 2QE7A 4QGGA 3KB2A 4QGAA 5LPNA 5C46F 3A1TA 3M4YA 1M1YE 4K46A 2CK3D 2IA5A 1TUIA 1E3MA 1Z47A 1P72A 2BBTA 3P27A 3DOEA 1SZPA 2GNOA 2KSQA 4II7A 4D0NA 2V6JA 4M22A 2FV8A 2LWIA 621PA 4BWYA 1L4YA 4PAQA 2AD5A 4PC1A 4XH9B 4HAWA 3E5HA 2GK7A 3Q3JB 2Q3MA 4C0KA 5JJIA 2C5LA 4KHZA 2LKDA 3AP3A 4CEJB 4LV6A 1KZ7B 3Q72A 5FL7D 2VP2A 3SJZA 4KO8A 2CMKA 1WE2A 3VR2A 1DAHA 3U3JA 1AZSC 4RD4A 5FOSA 1W44A 2PX3A 1FMJA 2VF7A 4HUQB 1DOAA 3TR5A 4YQFA 4G3XA 4YMTA 1AK2A 1N6RA 2MMGA 3CF2A 4AKGA 1DS6A 1XEWX 1Q3HA 2J7KA 4K81B 2ZVQX 1M7HA 2J87A 5EE3A 3QJYA 4L9SA 4EJSC 1GM5A 4LSGA 2DY1A 3CBQA 2FPLA 3OESA 5KDOA 1QDEA 1L4UA 5BQ5A 1II8B 1LW7A 5BYJA 3SEAA 4Q9IA 1ZC4A 1N5IA 3ICQB 1T5IA 2V4ZA 3K9GA 1XJ0A 1NL3A 3LV8A 4KJZA 4ZKDA 1NF3A 2FEOA 2RGXA 3DMDA 2W0SA 4M1KA 1TL7C 2E1RA 2O5VA 1NY5A 4TL7A 4LJ8A 3ASZA 2P0EA 3DKVA 3NC1C 1UF9A 2W2TA 2HCBA 2XSZA 2KB0A 4DLXA 4L15A 5EQTA 3SI7A 4QJ4A 1G6HA 2OZEA 4U5XA 2G9NA 2REXB 4A92A 1W36C 1Z2CA 1T5LA 4Q4JA 1OJLA 4NBSA 2RGEA 2CHVA 2IX3A 5AR1A 2FX3A 3MWYW 1E4YA 2JJ8A 1IY2A 2WJJA 2A3RA 2DR3A 2ZU6A 3JZAA 4KSBA 1G4AE 4D2IA 4LV5B 3WMFA 4HAVA 1QZXA 4KI0A 5ANRB 4A1FA 4B76A 1HT1E 4HSEA 4Q1CA 5DE3A 4KVGA 4PR0A 1I2MA 1ZNZA 2GCOA 1JJVA 1G16A 4OJKA 1WP9A 3GLFB 3LBHA 2F1HA 2ODBA 2GAAA 2HDNB 4DWJA 1RYFA 2XNDA 4NZYA 1W4RA 1GG2A 1S96A 1OXVA 4TSFA 1W49A 4NYJQ 2QP4A 1QVRA 1BKDR 3BORA 3BS4A 4FMCF 5JHHB 2YNMA 2NO6A 4A0HA 3GJ6A 3IIMA 4AK9A 1LF5A 3L8ZA 3OE7A 3WYAA 4TMTA 3U6BA 1TEXA 4BZXA 4RVCA 5DGXA 3B5JA 1S1CA 2F1RA 1AM4D 5CIWA 3FB4A 3ADDA 1TEVA 2BBSA 2ATVA 3NG1A 4DSNA 3OEHD 5AUNB 5FR2A 5IDVA 3R9XA 3W9YA 2JAQA 1EX7A 4HDQB 3T5GA 2RHMA 3VKWA 4QGHA 4L5BA 1T8TA 5DYIA 1GP2A 5HE9A 3M1IA 3W6OA 4DB4A 3W8NA 4IOLA 1P2UA 3CB4A 3WRXC 1U8YA 1G8HA 1KI2A 1X1RA 4LHXA 5FTNA 4GSYA 4IDPA 3SDZA 3QY0A 3RC8A 5FPYA 1P5ZB 1N6OA 5CJPA 3PENA 4CZ2A 1XJCA 3AF0A 1KI4A 1SVLA 2G1JA 5EXPA 1Q1QA 1IN7A 1OW3B 3T12A 4TYPA 3SJAA 3T1TA 4PHHA 1YZTA 1VTKA 2ZRMA 3BB4A 5CB6A 3CO5A 4QBIA 1ZUNB 2DFTA 3K9HA 4IKEA 3P4XA 1U94A 5KUTA 1FFHA 4D82A 1ZM2A 2IYLD 3N70A 5AJXA 1HV8A 5FBRB 4TYWA 3RS7A 1S2MA 4RCYA 2LKCA 1G21E 3THOA 1YR9A 3GLHB 1YZGA 3K70D 2BJWA 4KU4A 2ORWA 4NCJA 1KAGA 2XAUA 5JRZA 1UKEA 4D0LB 2QPAA 3GCGA 1KI1A 1JEDA 2DWQA 2GKSA 2DFKB 5K8LA 4LJ5A 1EWRA 4JZKA 4JS0A 2RAPA 4BLOA 3ZD7A 1W1WA 3KKOA 1TAGA 2GA8A 2CCGA 1MRSA 4TMWA 4OK6A 1CR0A 1JR3A 2VH5R 5EXSA 5LDDC 4M53A 4IRUB 3D7MA 1SXJC 2HEIA 2QTVB 2O0KA 2ONJA 4MKFA 2EYQA 1MO5A 4S35A 5FR1A 4KCGA 2KWIA 1DBSA 4XTRA 3Q7PA 5DI3B 2FJUA 2CJWA 1WRBA 1D9ZA 3IHWA 3QE0A 4YLGA 4LJAA 4D6PA 4XVRA 2H92A 3EPHA 1AQUA 2FG5A 2IT1A 3FKSA 5AJYA 3U7EB 1E9AA 2ZJZA 3P4YA 2YWGA 2JJ2D 3SE0A 1XXHA 3LQQA 3Q5DA 3NXSA 4TQAA 1DVRA 1KKMA 3NVAA 4C0BA 1QHNA 1F2TB 1BO6A 4M9SA 4FCWA 2QRNA 1CTQA 2AK2A 4JVMA 3K53A 2O8CB 2DYKA 4KV9A 5F9FA 4AD8A 5AJWA 1OHHD 5HTKA 1DADA 2F1IA 2FZLA 2ZRIA 4ESHA 2VP6A 1XWIA 4Q48A 1SVWA 3AH8A 1GRNA 4DLYA 5JSZB 3W5JA 2O8EA 2O8FB 4JL5A 2GXAA 3B85A 4CVNA 4W9MC 1O87A 3LLUA 1KYIA 3EW9A 2GEVA 4IFBA 3RSLA 3PIRA 1TF2A 3F0TA 4FXPA 3QQ5A 4PQRA 5G53C 2BCJQ 2GHIA 3QF4B 4BQSA 4ZCIA 4ZKEA 4JT2A 1UBCA 3T61A 3QENA 4D26A 4HDCA 1XJQA 2MSCB 3L0IB 4KYUA 1Y3AA 1KO4A 4NYMQ 1Q3TA 3AUXA 3EA0A 1N6LA 4TQ9A 2A5YB 4JYBA 4OK5A 3MAAC 1E96A 2AFIE 3AP2A 3LXRA 3CUEF 4GRAA 1JR6A 4B3GA 2JASA 4A8JA 2NOAA 3M0EA 2NGRA 4BRUA 2BBWA 1EX6A 1MABA 4JYCA 1CP2A 5IK2D 2EW1A 4YDHB 3E2IA 4P32A 1XCPA 2CNWD 2ERYA 3QG5A 4EFNA 2V1XA 1ZIPA 4MKIA 1FX0A 4LCBA 3ADBA 3T34A 1NMXA 5A4JA 4DJTA 2PMDA 4M21A 2FH5B 4R2HA 4Z51A 1YR6A 3MJRA 3PV0A 2KI5A 3RS3A 5J4KA 1X8JA 1W2HA 1E9SA 2XOKA 5EE0A 5KHOC 1W0KA 1EESA 2RGNA 4ZDJA 5C4MA 1Z0JA 3VKHA 4QBFA 1P62B 4JLNA 2FSHA 3NTUA 1XPOA 4ZIRA 1M8PA 1E2DA 1Z2AA 3U5ZB 4C7OB 2F3TA 4F4JA 4DUGD 1ZU4A 2QE7D 2YOFA 4UNPA 3P20A 4AG5A 3JVUA 4NCNA 5A5GA 1DAEA 1KO8A 5E4FA 3OAAA 3QKUA 1R0ZA 4FI3C 1YZLA 2ODEA 1CIPA 5H1YA 4B35A 3LW7A 1XD8A 3F5FA 2FFBA 3TJZA 1IN8A 1E2LA 3WNDA 2WWFA 2XB4A 1Q12A 4URUR 3W5IA 4KFSA 1XRJA 1KO5A 5CLQA 3EZ2A 1E99A 3H84A 3VX4A 3JVVA 1XX6A 4EIWA 4LUCA 2A78A 5P21A 2C9OA 3IEUA 3A58B 4L16A 2AWNA 1N0WA 2ZE7A 4US1R 3SQWA 4HB2A 1TQDA 4DXAA 3RAPR 2ZAOA 1Z28A 1BIFA 3BFKA 1Z6AA 1Q1ZA 4M4SA 4WOPA 1NIPA 3PUYA 3OEEA 2PEYA 4N1AA 1EFCA 2Z43A 3NDBB 4KYIB 5CIQA 1GVNB 2FNAA 4V02A 1G5PA 2W00A 1PVOA 2QEQA 4DLZA 5FH9A 3OHMA 4YONB 3A8TA 1UEIA 4BFSA 5GJVC 1XTQA 3ETLA 4OQNA 4EJSA 4PHTA 4TL6A 1SQ5A 4WVFA 4A2QA 4ZDWA 1XTSA 2QTHA 2QQ0A 1NJGA 2X1VA 5CYOA 3WRYC 1OXUA 1UAAA 4HAUA 5SZKB 1CR2A 2AN9A 3WNBA 4DLUA 3B7GA 1W48A 1OXTA 2ZAMA 1FNNA 1VG8A 3NH6A 5J4HA 2JLYA 2W2VA 5BW8A 2GXQA 3OF5A 5KNCA 2QMOA 4AI6A 2IS4A 3I8XA 2C77A 4JLPA 2ZQ5A 3TAUA 2YZ2A 2AKYA 3CZQA 4G5QA 5C4GB 2PX0A 2QL6A 4IJMA 2AL7A 3ZZTA 2XSZD 4Q19A 1GOTA 3NBYC 1MO4A 1OIVA 3KTAA 1BMFA 2HF9A 2NIPA 3MG9A 3QI2A 2ZS9A 4U00A 5B58C 1Z6TA 2Y8EA 1US8B 1TTTA 2P65A 3KUDA 3LRPA 1G3RA 2WKQA 1GKUB 5FTLA 2ZR0A 3SJCA 3KJEA 2JDIA 2IL1A 2HT6A 4G0NA 3UIEA 1DEKA 2FZ4A 5JECA 3GD7A 1TF5A 1KNXA 1MOZA 2FFQA 2YV5A 2G0NA 4Q4JB 4BPBA 3AVYA 3CPHA 1RE0A 2RGBA 3KKNA 1N6PA 4MITA 2VO1A 3BH6A 3AB3A 3EA5A 1T3SA 3RYTC 4DKXA 2FF7A 1YE8A 2OG2A 3RS2A 2O8DA 4B48A 1DO2A 4IDOA 3AKEA 2XNDD 3VR1A 4BFUA 3THWA 3RANA 4TSFD 2WICA 2GCOB 2IS1A 3W8RA 2H8KA 3TNFA 1ZIOA 3LXXA 1XEXB 1RRFA 3GJ8A 3OE7D 3VHXA 2QSZA 2XGJA 3SOPA 2D62A 4C0SA 8OHMA 1AKEA 5DN6D 1GDDA 4V0KA 5DLQC 1T9HA 2UZ3A 4BUJA 3ICEA 2PL3A 3CH4B 3HP1A 3HPRA 4PXAA 3BB1A 4YC7A 5SZHB 3U61B 2A5JA 1R8QA 3VHLB 1JAIA 2R6DA 4WXRA 5LB4A 2W2XA 1SKQA 3L0SA 5DSZA 4B47A 2ZJYA 1HE8B 1SXJE 2CL7X 2ZJBA 1IOZA 3LO5A 2P6RA 1Z8FA 4R71A 4DEYA 1IXSB 2CLSA 1FZQA 1F48A 5IHPA 1KSHA 2XJ9A 3EPLA 4QGFA 4GMXA 5E7JA 4B71A 2Q9AA 4MUBA 3B1WA 3EZ7A 3DKPA 4FWIB 1FL9A 1SVIA 1ZINA 5H8WA 4DT1A 4F92B 1G5RA 2G6BA 1P9WA 4RZ2A 1T0HB 3CX8A 5FL3A 4ESVA 1M34E 1LY1A 2ZRBA 1T4GA 3S1AA 4LBVA 2FSIA 2WJHA 2FMXA 1W2GA 1JQLB 1QVAA 2WWGA 4BFVA 4DBLC 3EWSA 4EPXA 4MKHA 3FVQA 1UEJA 2GF9A 2GVZC 1OH7A 1U2RA 4PPGA 5C1BA 2VHCA 5FI0B 1RRGA 2QGNA 2XTNA 3THXA 3U7GA 2WWIA 1I4LD 3QPWA
chains in the Genus database with same CATH superfamily
2X0RA 2UUBB 2FLVA 1OC4A 3DOUA 3FCUB 3HZOA 1FPMA 2JI4A 3UMJA 4EOGA 1W4CA 3LPCA 1G19A 3B70A 2F9LA 1EHYA 5CCDA 3TQOA 1SVNA 2W2MA 3KKMA 1O6FA 3LUFA 3PEYA 1RHKA 1T36B 2GJKA 1QBKC 2PKYX 4L27A 2DPYA 3FCSB 4Q9NA 5ERYA 1D5CA 1SUWA 1JFVA 1RLIA 2OYSA 4H7FA 4ZDKA 1Z5PA 4KN8A 4R7ZA 3FYUB 4TMKA 2AA3A 2XYHA 4F2DA 1AY0A 4EYGA 2PXAA 3E05A 2IRWA 4EGQA 1RWPA 5AWFC 5C8YA 4BNGA 1KJYA 1VBKA 1YA4A 3BHNA 4R81A 4BVKA 2QRJA 2GJSA 2LDXA 3Q85A 4ZT4A 5IH3A 3UMVA 1JX6A 4CM1A 3PEWA 4FM9A 4EG0A 2R6AA 1VLJA 3IVXA 3T5DA 2A5DA 2OVBA 5JZOA 3OTIA 4WBNA 2VRBA 3INTA 2G88A 1Q11A 3OLVA 1KOLA 3U7QA 4ZIRB 4I50F 1Y4UA 2DQKA 1WXWA 2A88A 3Q12A 4YAOA 5AKYA 4DGQA 1RZVA 5AVVA 4OJTA 2XQJA 1P7PA 3WLJA 3CE9A 2XH8A 3FWYA 4YDSA 5G4KB 1NOIA 2W8ZA 3DEAA 3H19A 2JFYA 3HRIA 4I0WB 3U1TA 1RMTA 1XSEA 2D1TA 4N3NA 2IYVA 4WX2B 3K6KA 2KW5A 4F8EA 3I2GA 1G3IA 5K01A 1ZJWA 5J43A 5CCXA 4HC4A 2BM9A 2ZRLA 2MSNA 4P36A 4UQPA 4BMZA 2I1QA 4KVFA 5BNIA 2CSUA 4QECA 2B94A 2JLVA 4MIKA 5ULLA 2PUGA 4L0DA 1KETA 3T4XA 3Q98A 2WIJA 3R3JA 2HWWA 4E94A 3HJGA 3WDMA 4HB4A 4JBLA 4OLHA 3AK4A 1I1NA 3WHIA 4Q18A 2QI9F 2ZYWX 5IJZA 2HCJB 1T2EA 3RH0A 3EZGA 5KQGA 4R6WA 1H2WA 1C4XA 4N6GA 5DBHX 3EPPA 4JQZA 4BP8A 1XF9A 4DCTA 4EUNA 1SKMA 1E94E 5KNBA 3HUTA 1JEQA 1V35A 1XK6A 5M2QA 3RVMA 3TECE 1YU9A 1KSFX 3SYMA 5EMHA 2W11A 2VQEB 5CD9A 4JWTA 1X42A 1NI4A 4MI1A 4C2AA 2OFWA 2AW5A 2ZCJA 4PLGA 3P2IA 2VSNA 2FRDA 4ER7A 4Q5IA 3HA2A 4YJDA 3RK4A 2VHYA 1DFHA 4UEQA 3L43A 3V2IA 4HO1X 5A5FA 4KBGA 1JKIA 5DHAA 3T3OA 1YNOA 4H6PA 2VWPA 3H1GA 1YOVA 3DGEC 1X7YA 1AZWA 3KR9A 3NAZA 4YWJA 1PJBA 3ZZ1A 1Y6GA 1K5HA 3UA3A 4PC3A 4NCKA 4E30A 1QO7A 3TXYA 2OQIA 4JI1B 4GW3A 1SO8A 5LFAA 3OJEA 3R24A 4N0QA 1B6SA 3RHFA 5IS2A 4ATNA 2WP8J 4MV5A 3VYRB 1ZY2A 5LM3A 3RYCA 1JFRA 4FT2A 4H1HA 1Z3IX 3GDHA 4AS2A 2FPGA 1QGOA 2HRCA 5AW2A 2XJ4A 4D8XA 4UU8A 4E7PA 2R84A 3BD8A 4XE5A 5JFGA 3CKMA 4HDMB 4GLFA 4C3OB 4JSTA 3OM1A 1T9BA 2CUZA 1OTYA 3DZGA 2W2QA 4ETWA 2B8WA 2BCGY 2Y0PA 1TC2A 4CCYA 3EARA 4K6MA 1JALA 2CDNA 1IN5A 5FV7A 4UTZA 1GQFA 2AZMA 3ORHA 3EW7A 4HH3C 3VPFA 4Z49A 4HR7A 4RJKA 3PPYA 5C81A 1CBUA 2CNBA 4TT3A 3LHSA 2BHNA 4M88A 4JYZA 1SHKA 1V3TA 2NZ8A 3K72B 4EHJA 5M29A 1OB2A 3H5NA 4LJ4A 3QMPA 2J3KA 4J9UE 2P2LA 5CPFA 4JB2A 3NQ41 3EIHA 2NV0A 3ZJYA 1P6QA 4X90A 4I08A 4P4TA 2CNDA 2F7SA 3AY6A 4RVHA 4CMKA 3BBLA 2Q8NA 1K7YA 1ONPA 3QRWA 4OI1A 3CGWA 2G9VA 3D6TB 5A4IS 1DJQA 1RM5A 1L7OA 4OLJA 1RNLA 1C0IA 3PCRB 2I7TA 3L6BA 2PCJA 3U19A 2J0SA 1GGHA 4PX2A 4YFVA 2JAWA 4QE3A 4ZYTA 4MUJA 5FX2A 4EAAA 2QRVB 3IRUA 2BP7B 3QEOA 2O14A 2NSYA 4HS4A 3QBVA 4E14A 2ST1A 4MH0R 2J0UA 3OWHA 2AC4A 3DAOA 3VDRA 4B3BA 1Y3BE 4CQLA 2IPLA 4AQYB 2ZSBA 3VNQA 2V55B 2EJTA 3H86A 3CEMA 2JHGA 1XHLA 2B34A 2BWJA 1E7YA 3VR3D 1QAOA 1EYZA 5T4FA 2ADMA 2YQ5A 3EIEA 4JLJA 4DMCA 4HAIA 3LBFA 4GKAA 2FWAA 4Z8XA 5KX5B 2Q3FA 5JJLA 1OAOA 1ZMXA 1WCV1 3K3PA 3I04A 5FCDA 3SC3A 3SLGA 1DJOA 1LFAA 4LXUA 4MCJA 2HLHA 1M1YA 1QK3A 3EIWA 3QOXA 4XSGA 2Q3HA 1FUUA 3L4BA 2B35A 4JX9A 1FP6A 1P17A 1STOA 1XLUA 2O0LA 1BEZA 1OBOA 2PXCA 1WG8A 4K2AA 3PLAE 1IZ9A 9ATCA 1TYCA 4G0QA 3ZQ6A 3STYA 4KIWA 1GVHA 4PYIA 1SC6A 1P80A 3TIGA 5FUVA 1DQPA 1CS0B 1J25A 3U13A 1IONA 3A9UA 3JRXA 3MB8A 4FE7A 4UASA 4PGGA 4MRRA 3R9IA 4FGZA 4E5KA 3BE4A 3SR0A 3N2KB 2WSMA 3AR6A 2HHHB 3RSOA 4ER3A 5IF3A 4Z54A 1H2AS 5ALRA 3AQ4A 3F3MA 3IOYA 4Q3EA 3C3AA 1C1DA 2HMSA 2NU7B 1NW8A 3ROFA 3V7YA 4CIBA 4KQHA 5JRJA 4RHCA 1GLGA 3T3IA 4BWFB 2OHOA 3GLTA 4LVCA 5IKXA 2XDQA 3KPWA 4XIFA 1Z73A 3DFZA 1P4GA 4MA4A 1N32B 3BGWA 1QORA 4ZICA 1OLXB 1UQTA 3L0ZA 1F1JA 3ZR4B 1FBTA 1Z4IA 2F1KA 3TN7A 1P44A 3AF3A 1KPIA 3VAZA 3EY9A 1XVUA 3HR8A 3ZYZA 4F91B 1O97D 3AM1A 2RCNA 1YOBA 3K0FA 4PTZA 4B43A 1EEHA 1J2YA 2GDZA 3MAJA 4I1PA 4NSNA 2NU6A 2EZ8A 3OFSA 3VU3A 2KE5A 3B38A 1ESDA 3LT2A 4XIJA 5HK8A 2RGWA 4RGQA 2A1TS 1G1MA 3EZXA 4Z0NA 4M55A 2R44A 2I9KA 3EG9A 1UWCA 4MRMB 1U81A 2P9HA 3GP5A 4PYQA 4WZAE 4PPYA 3W5CA 1ZU5A 1CF9A 3PC6A 4Z9BA 5KTKA 1X3LA 3RSGA 2RG7A 1N5MA 1P2BA 4OP2A 1Z17A 4L28A 2R6ZA 2HA6A 4TWAA 4A82A 3NJRA 1YQEA 1NP3A 1SUEA 4OHBA 3ORRA 4N0EA 2RBGA 2W8BB 4LYYA 4WCDA 3R3UA 1V3QE 1ESMA 1Z6PA 5B12A 4XPIA 1ISMA 1T0PA 2PQMA 3BCRA 2DHCA 1M73E 4U0JA 4D80A 1WZEA 3RRNA 3GLIE 5K8UA 3P97A 4EY3A 4EQ6A 1E2GA 4BHTA 1T2FA 2WBLC 1RAAA 3HUFA 1DG1G 5EHGA 4A8HA 5REQA 5CH8A 2ZANA 3W78A 1JKJA 2BRUC 5IM5A 1V9SA 1R7RA 3VHRA 1BN6A 1M6WA 1I13A 2V97A 3Q8WA 5HW0A 2XY4A 1KEKA 1TZBA 3F4LA 4X6UA 1REQA 1BD4A 2YQZA 2Q1UA 3WYBA 4CKBA 4B3SB 3ZVRA 2RHDA 4O08A 4G1UC 1LV8A 3PUWA 4I4CA 3LGAA 3D0OA 3MGBA 2PGJA 4LK2A 1JJ7A 1ZM7A 3VHXB 5I7HA 1YSCA 1P7WA 2F6RA 1D07A 2FX5A 3KJIA 4J0CA 3R7SA 2YMLA 1HURA 2XUPA 3BVPA 2O0HA 1JLHA 3K8OE 4R01A 4RIIA 1ZZGA 4BNDB 4MP8A 2H1CA 3OIUA 1O94A 2P8SA 4N0PA 4RIFA 3RG2A 3P32A 4YCSA 4YRBA 3QE9Y 4Q24A 1UM9A 2ACVA 2C82A 2HGZA 1KI8A 3F49S 4TLAA 3I73A 2RAVA 4TWBA 2X0FA 3S1LA 3X44A 2G7ZA 4OXQA 4E33A 1KKLA 4F4UA 1YMVA 2P2SA 5C8VA 3WJAA 1C7JA 1KMHB 3MOSA 1NP6A 4CIAA 2X8LA 3DBLA 4IIVA 3ONWA 2GPWA 5AUOB 4XLZA 1D1PA 1GPYA 3R3SA 1EZ4A 5TMPA 1LW6E 2K2WA 1KQPA 5LJIA 3N2YA 1JI3A 1KEZA 4MHOA 4BJ5A 2ASEA 2ID7A 4M7RA 1UK8A 2VHQA 4QG3A 3EVGA 4GR9A 4OU4A 3NHPA 1SKYB 1DKQA 3LVQE 4J7XA 4NYIR 5JS7A 5HRUA 1NXPA 1Y5NA 1DUSA 1XRMA 3COSA 1ML3A 1USGA 2GLTA 2F43A 2C9CA 3CSDA 3EAGA 3O2JA 1CUDA 3W5SA 3ZIUA 5BOSA 4OU5A 3EQ8A 4CMJA 5K0GA 1OFHA 4HAZA 3L6CA 2XUHA 1D7OA 3OQIB 1XRQA 1SUSA 1H0HA 3DQPA 1U1EA 4QQ8A 1I7PA 3SIXA 3X2SA 2WJIA 4GKJB 5FNZA 4KDCA 3TX6A 4YBRA 2VYVD 3VSCA 1C30B 1P2SA 1II0A 4BVJA 1QVWA 4JH0A 2H0AA 3CR8A 3ANTA 3LBIA 3N2EA 4GGMX 3LX4A 5FLKA 4B74A 3TTYA 2GTIA 5K3OA 1WXIA 3BRWA 2QQGA 2Z95A 3NIDB 2YFKA 4NKRA 4M1EA 4QYIB 2MYTA 1QM5A 4YCDA 3S4YA 1JFTA 4JAVC 3QW4B 2AOUB 5TQ2B 1FXUA 3R5SA 2XT9A 2VPZA 2HJVA 4JUDX 4A6PA 3KE9A 4BNFA 2E4WA 2QMZA 2JFNA 2ZB4A 3G5UA 3TLJA 2LXNA 2YXNA 5AOAA 4ZN6A 5K20A 1ZRMA 2FPRA 2PLRA 4KUEA 2SKCA 2HH9A 1GPNA 3TEFA 4BRWA 1Q50A 3A25A 4CKZA 1O4WA 1T4CB 3PICA 5EYPB 4O8ZA 3KE8A 4RAQA 1V1RB 3B6EA 3EZ6A 2AH5A 4WZBE 1DIRA 4NAUA 1D9XA 2RAFA 5G0VA 3WLMA 1U9ZA 3AX6A 1O0CA 3B5EA 3GWZA 4G4SO 2HLDD 1FTWA 4GLBA 1USIA 5AK0A 3TOXA 4OLAA 3OCUA 1U63A 3RQSA 3IT1A 3D7KA 5NULA 5D5HA 3LY5A 5IDWA 1E7RA 4LZLA 2NZVG 4N9WA 4OXIA 1CX9B 2Y68A 4KR2A 1Z5UA 3PF9A 3JYLA 1G18A 3LP6A 1UAGA 1I0LA 1ULZA 1TVEA 1IXYA 2Z6QA 1AK9A 2REQA 1U8UA 5AM4A 5EPUA 5JMTA 1B26A 1XD2B 4LF4B 2OWEA 3MWEA 2QPTA 2YJNA 3LWBA 1SHJA 2ARKA 1NVVQ 4CF7A 2Q6VA 3PITA 4LDNA 3A1VA 4B6OA 2FP4A 5AQEA 5FPPA 1YR7A 4MWSA 3CLUC 3MCAA 4HGPA 5J2TB 3T8YA 3UMYA 3ZXUB 4AUNA 2FSFA 5BVHA 3MD0A 3IEKA 3AILA 2G3YA 3E1GA 4F8JA 1H3NA 3UQZA 1X1AA 2C42A 4HB3A 1GWNA 1IQPA 3AVWA 4URZR 4UVDA 5BPHA 5LLTA 1QCDA 1TT5A 3JAWA 4DR4B 3KLNA 3MXTA 4P53A 2RH5A 3NKFA 1GRQA 4Q7MB 4MWTA 2QDXA 2B0JA 3E7WA 4GOOD 3C6YA 3L7NA 4MYDA 2VDWB 4JNCA 4LDAA 2H1IA 3BGVA 1ZVKA 3G6WA 1PO7A 2J3DA 4IV8A 3UHJA 3ZGXA 4AJKA 4D4HA 4GXNA 2GESA 3AI2A 5D86A 9LDBA 2HMVA 2GM9A 4R3WA 2LGJA 1UXHA 1KERA 4NV1A 2ACKA 2JGLA 4EB0A 1DQSA 1CRWG 2PNFA 4D4JA 3GCDA 1LLQA 1GG9A 2LZ0A 2V96A 3H2IA 3MERA 1RVV1 3PSAA 1KMQA 4HF7A 4K6CA 3SD7A 4BQEA 3AFIA 4TPKA 3PGJA 1EUDA 3KKEA 4S1PA 3V8EA 3L0DA 3DE5X 2DKNA 2OV8A 3VUEA 3HVHA 4BB9A 3ZWCA 2O2JA 3BH7A 4J91A 4P22A 5DI9A 3WY9A 3DEIA 1HL3A 3ND5A 1FMLA 1NZDA 5AJVB 3H0KA 5E1MA 5A03A 4B31A 1IJFA 1M6VA 1YZQA 1SFRA 3G5AA 1CUZA 3ONNA 5CDFE 4LF5B 3THYA 4O4JF 4GBED 2OK7A 3AGPA 5DRTA 4DM3A 2CB0A 1UFVA 1XQYA 5CUQA 3FPEA 3ZHXA 1NE7A 3M81A 3OBIA 3R3VA 1P3DA 4G23A 4M1TA 4N7JA 1AJEA 4G1MB 1LTKA 4GE3A 3AHFA 4HDSA 3ZCXA 4RANA 2VDRB 3CRMA 3OKFA 2PKQO 3JWHA 3AU8A 5FIUA 2OPHA 4MAAA 1K0UA 3UXYA 2QIPA 3EDRA 2FGKA 4OXNA 3FWZA 3OQHA 1U7UA 4NFYA 1RI5A 2A1UA 2FFJA 3FFWA 4L8WB 2XZPA 2G36A 3FMOB 4MKRA 3QBTA 4XQCA 1KY5A 3SFTA 4BASA 3A9WA 1RTKA 2RHGB 1G7RA 2EX1A 3BERA 3D6HA 2YWBA 3QX9A 3QX8A 4LZZA 4B87A 1ISJA 1X1CA 4QARA 5KHAA 1QHGA 3EASA 2AFIA 3COWA 1F5SA 3SGLA 1ADYA 1TEHA 2OFFA 1HZZA 4A26A 2O1SA 4AQ7A 2AJCA 2E3JA 4HPJB 1GTL1 2HOQA 5C0OE 1EXMA 2QTCA 4D46A 1DC5A 2ZITA 1QGYA 5ALOA 3URMA 3WGKA 4DC9A 4R9VA 2X4LA 1JE0A 4YXWA 3GCXA 3NI2A 2MHCA 4CN9A 2P2NA 2LPMA 3HKBB 4IDAA 1D4FA 2QORA 1ZNXA 1R0LA 1ZQ1A 2X3UA 3UJDA 2QX6A 4R1LA 3KHTA 1JU4A 2HWKA 5EWMA 3JS5A 4HI0E 4KNVA 3TQCA 4D25A 1RZ3A 3PWTA 1GAWA 2F9MA 4PQYA 3RVRA 1FLNA 4ZPXA 3TQFA 3V46A 3R20A 2XTZA 5J59A 4PBTA 2FTKE 2QZPA 5NLLA 2R97A 5KMGA 1N75A 5ARCA 3ZU6A 1C7ZA 3OKAA 3U37A 5JYCA 2R7AA 5HS6A 1KQFA 3PVSA 2C4NA 5HF6A 2H4FA 4P86A 4MUIA 1XAJA 2YFYA 2WKPA 3IQFA 1MB0A 1HOTA 3OT1A 2OV6A 4OXXA 1TB4A 4MS1A 1J2TA 3OX3A 4IICA 3TS1A 1C9YA 3VH4A 4HZIA 3KQQA 4V2IA 3AUTA 4G01B 4PINA 4JEUA 4PG5A 2CLKB 3FOZA 1VJDA 2VZ9A 3HFRA 3Q2OA 4KH1A 1YJCA 3PJEA 3HA3A 1RU3A 1PDVA 4HN2A 1K7CA 4JA2A 1QQ5A 3F7TA 4QXOA 3ZZ0A 2PD3A 3U4QA 5MGBA 4YI3A 1YR2A 4ITUA 3ROKA 3GYBA 2GK3A 3MUFA 3RBZA 4DA6A 3Q2KA 1R4NA 1W5FA 1G59A 5BT8A 3TRFA 4HLQB 5ALSA 3DDCA 1NWHA 4RIHA 1F0NA 1UJNA 4TUYF 1C9MA 2FVXA 1OLOA 1Z07A 3HVIA 2GN8A 5KYNA 3P0EA 4XDZA 1PF7E 1DWUA 2CLMB 3AHHA 2WWTA 2DUMA 4LX0A 4MV7A 5LBIA 4CUJA 5HOQA 3ECSA 3HKCA 5CDYA 3M82A 4JL6A 4WBXC 2HNBA 4QU0A 1WUJS 1W4LA 5AVUA 4U6NA 1TAQA 1R50A 4QXMA 2JHPA 5A6SB 5IEBA 1P18A 1BFDA 1E7QA 1UJ5A 4LYEA 1NJ1A 2CMGA 4RPIA 5HG0A 1YDGA 1CETA 4IHQA 1QHFA 3HY4A 1RQGA 3MYYA 4KO3S 3T06B 1QHHA 1WOMA 1BCSB 4TKMA 5L7YA 3FN4A 1OREA 2VZ8A 4BCCA 2C04A 5JSKA 4EGJA 4HRVA 2VP0A 1J9EA 3WWPA 2EKBA 3U0BA 3HSYA 2ZWOA 4TLBA 4CKCA 2ZB3A 2YWXA 5TSDA 4P7JA 2XZDA 3K8ZA 4OYLA 4JSYA 1EUYA 4W5JA 3V3KA 4F5WA 4PY2A 2YVLA 4H7IA 2A0FA 2PUFA 1G5FA 4REQA 1U7DA 1DFIA 3HCBA 2F8SA 2HYIC 2IX9A 1A2OA 3ICCA 1BJKA 1CUHA 4C6RA 1TJPB 4QA9A 1AUVA 5F76A 1AMUA 5J5CA 5E0KB 3SBDA 4O59O 5A4DA 3UMRA 3TNLA 4CV3A 3IUJA 3MT7A 4Q7LA 3N2ZB 3R7LA 2NO0A 3MOIA 4R9RA 4F5YA 3HC7A 2GEKA 4C03A 1LV7A 1O03A 3AF5A 1HWYA 1X0VA 1ZH4A 2QW0X 4AWAA 3AMVA 4XFKA 3H2ZA 5DCWA 4BECA 4JCCA 3VO1A 1CNMA 2PQ0A 3JYHA 4G0OA 5SV2A 1ESCA 4OP1A 4P34A 4WXPA 5CK4A 4MLZA 4YHBA 2V9ZA 2FEMA 3IB6A 2ISSD 3JQAD 4I66A 3MEQA 4NECA 4PVDA 3EG5A 3HQ4O 4GZ5A 3W5VA 4IOMA 2VKTA 4MB0A 3UAVA 3EC2A 2D0IA 3T5TA 5KDDA 3O4JA 4YFYA 4XGRA 2AOTA 3ENNA 3A2NA 3EJWA 4KO2S 3HDHA 2P77A 1VSUA 3MB5A 4PZDA 2JBAA 3GFTA 2R7NA 3KKKA 3QKIA 3JAMA 3QNUA 2AI2A 3GGSA 3EUWA 3TOSA 3VRHA 3KYCB 4ZQFA 2C94A 2D7DA 2FXIA 4ZGWA 1G8MA 1KEVA 2HKIA 4MVJA 2DH6A 2HO4A 5B3AA 4AVYA 3WISA 1KIFA 3W3AA 4EG8A 3A6PC 5L45A 4QPZA 4D0SA 3PQ5A 5HEKA 4FW9A 1Q0QA 4DPKA 3NAGA 2BGKA 2ZRJA 2RMKA 1C1YA 5I9BA 2O9JA 1SC4A 1SD2A 3NGMA 4X1YA 1Z83A 2BC9A 5GPBA 4YAWA 5CX1A 1A8QA 4XDYA 5D5QA 1RM4A 2BFBA 3R7AA 4XVUA 1GUFA 2I4TA 3NYQA 3WWZA 2DECA 1BZYA 3L1UA 2ZJ2A 3RRZA 2V7PA 1CZUA 4ALKA 3R8XA 4ID9A 4OOFA 1Z25A 4KJXA 1NONA 7GPBA 2XUDA 1CE8B 2C9MA 3U7IA 3ONVA 5T4EA 2R6R1 2IBMA 1QAMA 2GDJA 1CP3A 3QPAA 3RTAA 1CUBA 2ODNA 2IW1A 4B09A 1MDBA 2DWUA 2MDTA 2NPIA 3O84A 4U7GA 4M83A 1LPNA 3X1WA 3PUKA 4KO4S 3TUJC 4BEVA 2IODA 1ZGJA 3AF1A 4R7GA 2XLCA 4FR2A 3EJ6A 1EFHA 1V39A 4JP2A 4KWHA 1PYDA 5DYTA 1W9MA 2VAMA 1NZFA 1ONOA 1AUPA 1YDMA 1KIAA 2IQ5A 5JTTA 2WWHA 1WUIS 4IDQA 4A4DA 5JXJA 3HBMA 3K1YA 5C8YF 4AZ3B 2IYXA 3OZWA 1VG0B 4RDCA 1AOXA 2P27A 3NHAA 4YRMA 2Z6UA 1CUXA 1QF7A 2FWMX 3QY9A 4MYTA 4WBNF 1M2OB 3BD7A 3L7OA 3ROZA 1UJBA 4GLLA 5HMLA 1AK1A 1KAEA 3OMLA 4KRYA 2ZJ6A 5BN4A 2QAGC 5A62A 4F04A 2UYQA 3PEVA 1WULS 4DJDC 1ZR2A 2O5EA 2OD7A 4PX5A 3O4IA 4DWWA 2ZUDA 5H82A 3D6AA 3NOQA 4EP1A 3IOEA 1DUIA 4INAA 2C78A 1CJCA 4V1CA 3CF6R 5BN3A 1MJ5A 3CH5A 3JSXA 1JLKA 1VL0A 4INPA 4FEAA 1VPTA 2QTWB 2R6FA 1YS1X 5FV4A 1E0SA 5K8VA 1G3QA 3KYBA 3K5HA 2FVYA 3EQ2A 3ZDQA 1EA5A 3MWJA 1LQUA 2EKLA 3L06A 1ZLXA 4GUAA 3KM0A 3OY7A 5KTOA 2HBRA 2XF8A 1W47A 5K4GA 5C52B 4ND4A 2G8NA 5BQOA 5T6MA 5IJ9A 2C7VA 4EHHA 4G56A 1APBA 4Z6KA 4HWTA 1CQJA 1FNSA 4QPNA 1XLVA 4L4SA 1OROA 4UOZA 4TTQA 1MIOA 1R9GA 3F97A 3IP8A 3SYNA 1UM8A 4KRXA 2IXFA 4YV7A 1KR2A 4OP3A 1QBGA 1JDPA 4RLQA 4UAGA 3T9EA 4XRGA 5BR8B 4KDFA 1M72A 1IB0A 1JYEA 1WV1A 3L7JA 4OGKA 2C7RA 3AF4A 5EL0A 1YHYA 1GL3A 1Q5PA 2JCBA 3ZDBA 1A9OA 2Q1SA 4YJHA 1VYUA 4U2EA 3C7TA 4BE4A 5LSAA 2XKJE 3SR4A 2Y0DA 1XAHA 1TGYA 3B7WA 3WP0A 1MHTA 4JB8A 2H3HA 5DBOA 2J4CA 3PDWA 2DC1A 3RRBA 1AA6A 4AO8A 4FEYA 2EC5A 1NLMA 1SBQA 1U02A 2YUIA 3AWDA 3P0JA 3PZRA 2IU3A 5EJEA 4NY1A 1EXDA 2PZLA 3FBGA 4JR0A 5AW9A 2Q7OE 4C7VA 1TIKA 3TGLA 3KJQA 3AP1A 4N82A 3SKXA 5GWXA 1W88B 3T5BA 4MRNA 1Z08A 4ER5A 4X8OA 2UZ4A 4JL8A 2ZIGA 1CKEA 2ZSJA 2DQSA 3HDQA 1IEQA 3ETNA 3UICA 2LD4A 1MEOA 1T91A 1NBAA 2GS9A 5BNZA 1ZGCA 4K5QA 5LB2A 1SUIA 2NUBA 1DWQA 1PG5A 4JZYA 1KI6B 5KNDA 2OPBA 2YXBA 5I4IA 3SFVA 1VQ1A 1JFLA 2NADA 2YHIA 3ICWA 5AKZA 3IH5A 4HP8A 4MQEA 2XITA 3A32A 2FN3A 4PO3X 1DC8A 1EH5A 3ECCA 3RVKA 1H8HA 3VGPA 5LMCA 2WWXA 2XXAA 1NC3A 3U3DA 1H5NA 1ZM3A 4G5YA 1CYDA 1VMIA 2EGHA 3B89A 3ZE1B 3WAJA 4JU8A 4K1XA 4W9RA 1P9RA 4TV8B 1CUAA 4EYSA 3E3OA 4NIMA 5HUJA 2FI1A 3COJA 4JFRA 4NYIQ 2O6HA 1KU6A 2H4HA 3CS3A 1EGVB 4ZVPA 2GHQA 1DIOB 1PT8A 1CUWA 2UYYA 2ZBDA 3LBNA 3MJSA 4PBRA 5EE1A 3SS7X 4DDHA 2DH5A 3IDOA 1DTSA 4FK8A 4FLFA 1UFQA 2G9RA 1NVXQ 2WPDD 4CLRA 5LKAA 2NP6A 1Y37A 1E8MA 4XWOA 5LDHA 1KF0A 2Q5QA 3U7RA 2W2KA 5A4MS 4G85A 2I3ZA 1QC5A 4DVJA 2DT5A 4FDVA 3MTGA 1PS8A 4GG1A 2WF8A 3SF8B 3RE1A 5KSPA 1JECA 5EP3A 4RTMA 4L22A 2XYVA 2A4MA 1Z45A 4LOAA 4HNTA 1E1CB 3LA6A 4CM5A 5F7XA 4G1CA 1SHTX 1JV2B 1QVZA 5BWNA 1H4SA 1CRPA 3K0AA 1E98A 4H9GA 3DQZA 1MX3A 1NOJA 3QE3A 4A0GA 3DZBA 4MR7A 2IK8A 3CJQA 2G5PA 3DMPA 4F8YA 3FUTA 5JXGA 2OC9A 2PS9A 2Z8ZA 3GQBA 4JV5B 3TPCA 1VPDA 4I55B 5JU6A 3ZWDA 1U8ZA 3M6XA 4PFJA 1EFVA 4BQOA 1E61A 2ISCA 3CNHA 4NMXB 3KSMA 2JZOA 3G89A 4OHYA 3EWNA 4DXDA 4CLEA 3A6LA 1P2VA 3ILYA 1UKZA 2PQ6A 2BMDA 4JWKA 5DM1A 5F77A 2ZSKA 5A5DA 2EAUA 5KNBH 1EGQA 2GJ9A 1YS9A 3IVGA 4BV9A 2HO5A 5A9RA 4NF2A 4RY8A 4EJSB 3IVMA 2HK6A 3PQCA 3CC8A 4RYLA 1BQ4A 4UULA 4LDRA 1XEFA 1PV4A 2V3VA 2BI4A 3FNIA 2D4AA 2ZR8A 1RAFA 2DP4E 3RHTA 3TIXB 2C54A 4MV8A 4QKQA 4Z4EA 2ECFA 1C0EA 1INLA 3NKVA 2A0UA 4KAAA 1QH8B 4NICA 5ARDA 3MTAA 5DM2A 3RAJA 1XNJA 3RT9A 5BQ3A 4KR6A 4ODIA 1HO3A 4EG3A 2QZJA 3AUJB 3HB4X 3HWSA 2XNKA 3SFZA 5HX7A 1CG6A 4FOTA 4X6YA 3KB8A 4WFQA 1WSDA 2JGMA 4QYTA 1XEXA 4B7UA 4K26A 4BB0A 4DQLA 3T4UA 4IDHA 3UG6A 4YV2A 1JL3A 1ZESA 1Z6YA 2R7LA 2YJGA 1O1YA 2RB4A 1NP7A 4GFDA 4LKRA 1CQIA 1H1DA 1RRVA 3NRCA 4P2GA 2AC7A 4IHAA 4AW9A 4F4IA 4ZVOA 1PKEA 1VYTA 1I6LA 2JAPA 5E9WA 5K05A 4BX3A 1KQ3A 1ZC3A 4KMRA 1XA3A 2JEYA 1GKYA 1XALA 1E2QA 3SNKA 4FFWA 1KXJA 1MW9X 3B8HA 3OE1A 5DN6A 2VUUA 1K8QA 4WINA 4BTLA 4CYMA 3SF0A 4OIMA 3WQBA 4RZ3A 1UWVA 3A10A 1KEEB 1F4LA 3FM9A 1VJCA 2YW2A 4BIMA 2LCQA 4OYHA 3M33A 2IWHA 5B64A 5JD3A 1KGDA 4JUAA 4Y3UA 4RU1A 4ALIA 2WHRA 3H17A 5KQMA 3TF5A 1JR3E 1JT2A 2C9DA 4EYEA 4KAFA 4JJ4A 2D6FA 1S3IA 4UE6A 2DCMA 1IBKB 1EZ1A 1XHEA 1L7QA 1H42A 3ML1A 3DLIA 1HTWA 5LMUB 3K70C 3FRHA 5A6VA 5ELXA 2IEIA 1RJGA 4AJLA 4FYIA 4ZJZA 3V3TA 5BSKA 3BL6A 1DKUA 1Z4KA 4PF1A 4BS9A 3ABIA 5J63A 2BONA 3R6TA 1F1BA 3C8UA 1RBMA 3DOFA 3D8UA 5EY5B 2NX2A 2WLTA 1G8YA 1TZ2A 1XTZA 3K9CA 4MA5A 1KTIA 5K0SA 3I2FA 2J9FA 4FNGA 1EK0A 4RD2A 4BRSA 1AV7A 5I7FA 1Y3HA 1JEAA 2N9UA 2ZR9A 4R40A 4XGQA 5I7AA 3K31A 4LRXA 3EIOA 4URYR 1RJ9B 4R98A 4ZVUA 1QB7A 3B48A 3GEHA 2HF7A 1FDRA 2C4MA 2RGUA 4FYKA 3N3AC 3S3TA 5LQRA 3S2GA 4NX2A 4IWYA 1TAUA 5JFTA 5JNVA 1EG7A 1K5DA 3ZTTA 2G4VA 1YZFA 3P5SA 1M2FA 1KSGA 4F6LA 5EG5A 2G1PA 1KI9A 1N0UA 4U2DA 5ILQA 3L79A 1J0CA 4IZHA 1EHIA 2ET6A 3ZCSA 3RIXA 3HPQA 5F1KA 2XUZA 3ZWNA 5IVDA 1AGNA 1WXFA 4UVHA 4JP8A 1L5HB 1TMOA 5SZJA 3WB0A 5U9CA 1O3YA 2R4TA 1DXOA 4DV4B 1GPMA 2JFHA 5EP1A 1XYYA 4JLWA 2YIMA 1W581 1ODCA 3AEYA 3FUWA 3ORYA 3PC8A 2DBVO 2PLFA 4FFDA 2HY7A 4EZEA 2WF9A 4MZXA 1YH3A 1XZCA 2IUYA 4MDHA 3M6VA 2HIAA 5IYZF 2YWFA 2DKOA 5MN5A 2EYUA 3GOQA 4PO1A 2A5LA 3IAFA 3MJTA 6ADHA 3SSMA 3PEFA 1IQRA 3T7DA 3D4IA 3C8DA 2Y1LA 4KRGA 1DELA 2I3BA 3L2OB 4JEHA 4CPDA 3H11B 3PQEA 2JGKA 1WMSA 4HB0A 5HQJA 2WA2A 5THXA 2KMLA 3MRSA 1W5EA 3EVTA 2AXPA 1DC7A 2WTXA 4QDKA 5HDQA 3RCBA 4QJIA 5DNYB 1TRHA 2VHEA 4IJUA 4C76A 1HDZA 2H16A 5AI9A 5LCXA 2AE2A 4KV7A 3Q0TA 1TLFA 1FEZA 2PV7A 4Z0PA 3RBXA 3UK2A 3JCZA 1M5TA 2HA3A 1EBUA 5KWEA 1J2JA 1N5OX 4U7PB 2C61A 2Y76A 4ZVNA 5FI1B 3DEJA 3V6LA 4TLEA 3TLCA 2HI0A 1FRNA 1SR8A 2IYWA 2OMKA 2CL5A 4X54A 2JKYA 1Z35A 2C59A 3SVTA 4GF5A 4QATA 4W1QA 3C4QA 3ISVA 1GU1A 3M8KA 2CEKA 3OUTA 1VYHA 1I4OA 4DRZA 1VLZA 3UB4A 1VA5A 3F67A 4UUBA 5C8YB 5I9NA 1U9IC 5T8KA 1PJZA 3SIPA 1QFZA 5EZYA 3STTA 2ZAGA 4NPHA 1DAGA 1S7GA 2JATA 1CR1A 4DR2B 1CIJA 2I5PO 3FPFA 4YMSA 4W5NA 5F35A 5THQA 2IHVA 3UWDA 3W5HA 5EWLA 5C8DA 3D2CA 4ED9A 3G1UA 3TZQA 8AT1A 3ENVA 4DY6A 2VHWA 3FPLA 2A9KA 2VR1A 3IILA 4MUAA 1NSTA 3NBQA 5EIBC 2C2BA 3ZE7A 3O6VA 2FUEA 3GEMA 3NWEA 1I33A 4QRHA 1KARA 1TZKA 2PBLA 1W19A 4H4DA 5LA6B 1YE5A 3EBLA 3PNPA 3KELA 1V16B 2VNKA 1NLZA 4NYJR 3QYFA 1C7IA 2XEXA 5F1PA 2C4KA 2QZ4A 1PEAA 4C43A 1LBHA 4Q16A 1N2JA 2QA5A 3U6KA 2NV2B 1DIGA 3K1TA 5FOWA 2R25B 3IEMA 3ZIDA 3E9ZA 4OBEA 4ASUD 1RP7A 1Z36A 3ZU5A 5FBVB 4C4YA 3HXKA 3B51X 1K7EB 5C32A 1MXFA 1JEQB 4OB8A 3R0XA 1KSJA 1MPTA 5DXFA 3WJ7A 5JAUA 2XMBA 4JXZA 2ZS8A 3QV2A 2FFAA 1ILWA 4MGYR 1NI4B 3GLKA 3ZEAA 2OGSA 1W96A 5B1HA 2V9PA 1CERA 2YS6A 3I72A 1YUBA 1ZVQA 2JKVA 4M2LA 1JBEA 1V8PA 2PUJA 5EN4A 4Y7DA 3NCHA 3N2GB 5ALGA 2C3UA 4HWRA 1W34A 2IU4A 2GF0A 3TLZA 1HC7A 4GPIB 5C1OA 2ZYTX 1PBTA 1YOVB 3JTMA 1SH7A 1KDTA 3VR0A 4CEJA 4KIGA 4Q1BA 4XLTA 4TS3A 2VRWA 3E7DA 1MRNA 4NU0A 3A9VA 4HGZA 2ES4A 1OXMA 2VF5X 3CZRA 5ALJA 3ZKWA 1HDOA 1JXOA 1YBFA 1ZL2A 2W2OA 2Y2UA 3NBZC 1TADA 5T3YA 3BWYA 2O4CA 2BR4A 2QW8A 1XYVA 2EW8A 3GP8A 2A1IA 2F4VB 1ACJA 1AHIA 1M7BA 2BH9A 2QXUA 3PUXA 4L76A 1RACA 4LGVA 1PSZA 3F6YA 3PD7A 4UM9D 3W04A 1BOOA 1CRQA 3B1ZA 1TYEB 1TKBA 4GM0A 3V4FA 2G9UA 4B34A 3AHCA 1ZYUA 3H99A 4IJWA 1Z2EA 1OU0A 1A4UA 2MR5A 1N7JA 2QXYA 3EPJA 4F7WA 4OJMX 1SG9A 4Q4AA 3OU6A 4LI3X 3NW9A 2P9TA 1Q92A 4H7DA 4UM8B 1N4AA 4RFSB 2WFMA 2ZI3A 2WOJA 4B4UA 3D2AA 5EJFA 2JEZA 1MG5A 1OIWA 1U5BA 4MUNA 5DIZA 2BIFA 1P19A 1ZNYA 3PDIA 3AFHA 3UT0A 2OUKA 4Z4GA 1YRQA 2VHXA 3NYWA 5JVDA 3I2IA 3V1MA 4BKUA 4YP6A 2Y0BA 3HS3A 4BVBA 4B3TB 5UKDA 3EHDA 5BMOA 2OBLA 4I6GA