4XWAA

Tmk from s.aureus in complex with the piperidinyl thymine class inhibitor with a c5 ethyl-amine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
204
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A highly potent antibacterial inhibitor of Gram-positive bacterial thymidylate kinase (TMK): SAR of piperidinyl thymines at position C5 and L1
rcsb
source organism Staphylococcus aureus (strain mu3 / atcc 700698)
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 86
structure length 200
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwaA00
4H9GA 1W4AA 1G8PA 4PSKA 3VU9A 3VX3A 1BH2A 4F4CA 3OEED 4B3GA 1I4TD 3T35A 5JHGB 2ZEJA 2IF2A 2MMGA 1AS0A 2CCKA 4RZUA 4C3ZA 3GLIB 1F2TA 5HKKA 4LHWA 1XDBA 2QY9A 5KO2A 3SJCA 4LYHA 4DB2A 2ATVA 1E2DA 4HATA 2ODWA 2ZUCA 2IYRA 2GF0A 5FR2A 2XTMA 3H1TA 1QF9A 2CLCX 1JQJC 1R2QA 2C03A 2Z83A 4ZI3A 1XJQA 2OCAA 4Y0VA 2AK2A 2ODEA 1WDTA 2VSOA 3MAAC 3QQ5A 4LBVA 1F48A 1OV4A 4QFMA 1NJGA 4NKRA 1ELOA 1VPLA 2FH5B 4R2IA 1TADA 4DCNA 1AJEA 4JVSB 4XD7A 1U9IA 1ZNYA 4PR0A 4QL3A 1RRGA 1JAIA 4B3CA 3L43A 1E96A 5D3MB 5GADl 2ZM5A 2BIFA 3Q8XB 5C2JB 5AUQA 4US2R 2ZRFA 2JLZA 2RGEA 1NMYA 4QXAA 2FA9A 1XCGB 1PLLA 5LB2A 1KMHA 2R8RA 4AG6A 4LJYA 4V0MA 2R6DA 4UXHA 1P9WA 4C0BA 1L7VC 1W49A 3VMFA 1NN3A 1VCIA 3H2YA 2WIBA 3DZDA 3GFOA 5LPNA 3AVXA 3F5FA 1W2HA 3UWKA 1OW3B 3SU8A 3PFIA 4OHVA 2F1HA 2FMXA 2RGXA 2PZEA 1RRPA 3HU3A 2OV2A 1YHNA 1OPXA 2KE5A 3QXJA 1BKDR 5BXQC 1N3BA 1IXSB 3ASYA 3ICQB 2FGJA 1SXJD 3FHCB 2PCJA 1A7JA 2E87A 4QBIA 2F9MA 1CKEA 2AWOA 1MABB 4PZLA 4YMVA 4Y0AA 2AHOA 2CCJA 3MWKA 1IXZA 2RB4A 4LWZA 4ESVA 1ANKA 2YWFA 1N0UA 4GI7A 4WZBE 2ZRJA 1G7RA 5JWHA 1WCV1 3W6OA 4NYJR 4C0KA 2BM0A 4URWR 3L0OA 5JRJA 2OHFA 3KXIA 4YXWA 4KFTA 5FR1A 2ZJ5A 4R2HA 4UJ3A 2DPXA 1CS4C 3H4MA 4IDPA 3K9GA 1X1RA 4D82A 5C46F 3V00A 3R9XA 2XJ4A 3CRRA 1M7BA 1ZNWA 4M9QA 4A0HA 3ZH9B 5DISB 1ZM4A 1DAKA 4KCGA 4CF7A 3WRYC 4YONB 3THXB 1ZUHA 3TR0A 5J4VA 1S0UA 4GOKA 4FI3C 3T06B 2W2TA 2ORIA 2W2VA 4CT5A 3ZVNA 3CRVA 5EJEA 3EPLA 3HU2A 4ZCLA 1OFHA 4N3NA 5M04A 2R6AA 2HCJB 1OIVA 1W0JA 1IN8A 3F3YA 2Q3MA 3GPLA 3ZQ6A 2CHVA 2XAUA 3QKRB 1OKKD 1UBFA 1G17A 3RS7A 1XTSA 1DAMA 2FPMA 3V9PA 3OHMA 2XXAB 2HXYA 5JJIA 4JT2A 2D7DA 3ZD7A 2YWHA 1E0AA 4TYPA 4EPVA 3GMTA 2J41A 5J40A 4RCZA 4A0RA 2REOA 4KYIB 3T34A 1WXQA 2JEOA 1HURA 2DWPA 1R5NA 3A4LA 421PA 3AM1A 4OHZA 4PAOA 3UMFA 4LSGA 2H18A 5AUNB 1HT1E 4HAZA 1RYHA 2OM2A 1T5IA 5C18A 1T3HA 3C5HA 4TL9A 4XVUA 3B1ZA 2SHKA 3U61B 1MO5A 1NVVQ 1ZM9A 2NOAA 4PZYA 5AJVB 1CR1A 5B58C 1VG8A 1JR3A 3PUWA 3IKJA 4HB0A 1YZNA 3RANA 5IRCD 3MFYA 4HLCA 1EXMA 3WHKA 1OFTA 1XP8A 2WJVA 3DOFA 4JKYA 4XH9B 2F9LA 3DOEA 1KI7A 1FNNA 4BZQA 2ZSDA 4QJ3A 2VP0A 1ZCAA 3R8FA 2OEPA 1M7GA 1KI2A 1GKUB 2X2EA 1KSGA 2QROA 3GJ7A 1R7RA 1ZD1A 2OFOA 4YMUA 1E0KA 5DN6D 4QHSA 3BRWD 3DHWC 3SJBA 2H16A 1NG9A 1SVOA 4HZUB 4NONA 3CX8A 4V0LA 8OHMA 3SYKA 1DO0A 1KK1A 3JZAA 3LRPA 4HLDA 4D4MA 1E98A 2C2HA 3T1TA 4Q7LA 2ORWA 4Z1MA 1MRSA 1KIMA 4CZ2A 3K0AA 3QEJA 4RCYA 1CRPA 4BZXA 5FPKA 4QGGA 3TMKA 2IWRA 1F2TB 1BO6A 1E2KA 4B48A 1GP2A 4LGMA 3PITA 1UKVY 1IJEA 1NN5A 2OFWA 1VYTA 1YZUA 2P5TB 5BYKA 5JI3E 3PEYA 4KFUA 4JBWA 3LLMA 4R9UC 2HLDD 2OILA 2B21A 3B6EA 3DMNA 3VR2A 3GLIE 1TQ4A 1HUQA 4EDHA 2QPOA 5FUYA 4MRPA 4E03A 1B0UA 2JAQA 3KKQA 3LO5A 2CHQA 3ASZA 2HT6A 5B64A 1IM2A 3AH8A 4ASUD 5CIWA 2EYUA 5J4HA 3FPAA 4AY2A 3BS4A 4TMZA 4H1UA 1JJVA 1KTVA 4TTQA 3O8BA 3ZZ0A 3ZS8A 2QQEA 5EP4A 4DEYA 2IEYA 4RVCA 1J90A 2NO9A 1N5IA 2ZRCA 2R6GA 4E07A 5LDDC 3BJIC 2GJKA 3KFXA 1OH6A 1BYUA 3KKOA 2CE2X 1YKSA 4PO9A 4BZPA 1Q0UA 4LJ5A 4EPWA 3LX8A 1J70A 2J7KA 4WXRA 2HYDA 3UK6A 3ND9A 1SHKA 2Z43A 4OKSA 2F55A 1XJCA 2QUZA 4UNQA 4CEHB 4E22A 3Q5DA 2Q3FA 2GBLA 3TSWA 3A58B 2ZYVX 4A8JA 1A5TA 3O8RA 2I1QA 5IDVA 1KO8A 1SVWA 1Y63A 1SULA 3O8DA 4TQ9A 1VDZA 1F60A 4LHZA 4D4LA 3AVTA 2W2XA 4KHZA 1HTWA 2DWQA 1ZIOA 2IYWA 2NQ2C 1H8HD 4EPXA 1FQJA 1Z6GA 2DFNA 2I1VB 4HDOB 5DGXA 3BD9A 3F0TA 5FTJA 2QL6A 5FTKA 2IYSA 2QMUA 3RHFA 4ZI2A 1LS6A 1D8TA 1D9ZA 2ZITA 4GPTA 2OLJA 3IQWA 2FFAA 1ZD8A 3ZIAD 5CIQA 2KSQA 1S8FA 5KDLA 3BWDD 4M9SA 4TQAA 1OKKA 1X8KA 1EG7A 1XPUA 3B82A 3KJGA 1DAIA 2CLSA 3BOSA 3FMPB 4XJXA 3R8CA 2UZIR 2JDID 3MWLA 3RLFA 4HUQB 1NMXA 1ZU5A 1KI6A 3SS8A 3P27A 3N2EA 1EWRA 4Q1FA 5FPYA 3MCAA 2VYFA 3SEAA 3IO5A 4HAUA 1JR3D 2O0HA 4ERNA 3WNBA 4KBGA 3W5IA 3KL4A 4F7WA 2ZJBA 1KI6B 2OBNA 3B7GA 2BMFA 2ANCA 4C2UA 4PC2A 3KTAA 4JVLA 1Q12A 2GWHA 2JCSA 3K0FB 4II7A 2W0SA 4K81B 4Q7MB 3NDPA 1G5PA 4PHTA 1R0WA 2JLQA 2P5SA 5FPHA 4OHYA 1GDDA 1GZSA 1MH1A 1NKTA 3U60B 1T4GA 4TYWA 1WMSA 1E2JA 1KDOA 3CZQA 3KB2A 121PA 3K09A 1UKYA 2C04A 3G5UA 4IDHA 4QNMA 1DVRA 1TL7C 2BC9A 2GCOA 3CH4B 4P4UA 1RRCA 4JSYA 1TQDA 3MJHA 3OZXA 3RS3A 1JPJA 1OHHD 1JR6A 4DUGA 1V43A 2BKEA 3KTAB 4PSVA 2CVHA 3PUXA 1G20E 1M8PA 1XTJA 2V7QD 4NL4H 5FBLB 2KWIA 4IVRA 3IPXA 4GRAA 2IL1A 3BFXA 1XEWY 3FMOB 1OLOA 2V9PA 3PEUA 1NF3A 1Z0DA 1PVOA 5JWOA 4AKGA 1AGRA 3AVPA 1P73A 5CLQA 1COWD 2RHDA 4LJAA 1RFLA 2ZJ8A 4Q7JB 4TTPA 4WA7A 3B78A 1OE0A 2OBMA 1FPMA 3U3KA 4KLZA 4GSYA 5KPJA 3HR7A 3EASA 4BRUA 3GJ0A 5EP3A 1C4OA 2OXCA 3FKQA 1ZW6A 2ZYUX 3MWYW 4A6XA 3A8TA 5F9HA 2ZRDA 3KFVA 4ZCIA 3U7GA 2XB2A 5JRZA 1MRNA 5KSOA 2QENA 5BN4A 3LFUA 1NLFA 1H8ED 1IN6A 3N70A 2P65A 3LQRA 4A92A 2ZSEA 2JLYA 4PAMA 2QI9C 1F3OA 1FQKA 1NLYA 3TJZA 2ZRNA 1CBUA 3BH0A 3X1YA 5HZKA 1G3UA 2H7VA 4WAUA 1GNRA 5E7MA 3BB3A 3K9LA 3ADKA 3GD7A 3D31A 3K0AB 5CJPA 3CX7A 3LVQE 3FTQA 2QAGB 1NN0A 3QPUA 1IHUA 2CJWB 2NZ8A 2ZE7A 2WWHA 2ZRAA 3M0EA 3ZYCA 1QHHA 1W36D 5JECA 4NCKA 2HJGA 3CR8A 4JL5A 4BLQA 2ZI3A 2IXGA 3FFBA 4XVQA 1G64A 3QBVA 4KO8A 1S4QA 2WSMA 4KVAA 4FWIB 1G3RA 4V0KA 2J0SA 4C0QC 2OXRA 2ZS8A 4G1UC 1Z29A 2JASA 1E0JA 1FP6A 4JLVA 1HY3A 4DSNA 4JVMA 2FZ4A 2WHXA 3L0IB 4OL0A 3MSXA 2V4ZA 4OK5A 1W5TA 2QMHA 2QMOA 3A4MA 1KSFX 1T3LA 1WF3A 5FOSA 3L82B 2MSEB 4FMBB 2RGDA 1AA9A 1KJWA 3JZMA 2CNWD 4NZYA 2QA5A 3EZ2A 1UFQA 3LD9A 5J4LA 2DYKA 3O47A 4Q1DA 3SOPA 4BFSA 1XXHE 2IHBA 2OCPA 2TMKA 3I5YA 3SDZA 4I1VA 4RKFA 5E95A 1CU1A 3CB4A 3CUEF 4A15A 3GLGE 2WMOB 1J99A 2NPFA 4B44A 4UNNA 1OXUA 1KI1A 2YOHA 2YYZA 3PEWA 1G41A 1KAGA 1Z2AA 4FMCF 3UWOA 3MRSA 4A8JC 2GEVA 3NHBA 2EYQA 4BFZA 3D8BA 3UIEA 4DLRA 5TY0A 1XEFA 3RRZA 3WRXC 2P67A 4PC3A 3CR7A 3NTUA 1I2MA 4RD0A 3KQUA 2WSSD 1FTSA 2IA5A 3P32A 5DHAA 2BVNA 1Z5ZA 4ZO4A 1MR3F 3NH6A 2OCYC 1XCMA 5EXPA 2O8BB 3Q5EA 3RS5A 4PC1A 4NTZA 3KUCA 1US8B 1OYYA 2Z4SA 1E0SA 1C9KA 1FZQA 2BJVA 2YC2C 3TE6A 2ZANA 3QKTA 4JLKA 2VTKA 4WBSA 1E1RD 3GJ3A 4M9XA 1DAGA 4TYYA 5CJ2A 4LRWA 2RGNC 1W47A 2ZJOA 3ZVMA 1W0KA 1LF5A 2R6CA 4V02A 5IK2D 3BIFA 3MD0A 1S96A 1US8A 3THWB 3T1QA 3LBIA 4ZDWA 1EK0A 1JQLB 2REXB 2QRNA 2F7SA 2J0UB 1CJTC 1G3QA 1OH8A 4LCBA 5AJZA 1EFUA 3EA5A 1SVKA 1VG9B 3CW2A 4NCJA 2ANBA 3BERA 3BGWA 1XRJA 5TDHA 3I1FA 3ZDQA 2F3RA 3QG5A 4CYMA 2D06A 1E1RA 2IX3A 1Z6XA 2YC4C 3DVLA 4KSBA 3U3OA 3NG1A 4TYQA 1EGAA 4NYMQ 5BW8A 1NJFA 2RH5A 4NP6A 1A1VA 3C7KA 1OT3A 3SFVA 3AF1A 1MV5A 4K46A 1E9SA 4KV9A 3W5JA 2J46A 4FD2A 3AV0B 1AN0A 5J4KA 4C0JA 3UMRA 3B1YA 1ZU4A 1NY6A 2A5GA 3CRMA 4XVRA 2X2FA 5TB5A 1F2UA 3WP0A 1QHYA 3FMFA 1E2GA 1LB1B 2BDTA 3EAQA 4RJLA 4TMVA 4DLWA 4IHQA 3QIAA 1XZPA 2R65A 2WSSA 4Q4JB 1YJ5A 4LHYA 2O8CA 1SXJA 2BMJA 3NXSA 3U44A 3HU1A 2V8OA 4QC2A 5TVKA 2BMEA 4DC9A 2NTYC 1Z08A 1LFDB 4BQSA 4U00A 1G1MA 2DCUA 3FE2A 3QVUA 3EWSA 1U2RA 4DXAA 4IW3B 3KUDA 4DDUA 4Q4JA 1AQYA 1DOAA 2YZ2A 521PA 3EPKA 3QXCA 1L4YA 5HKKD 2H17A 4LBYA 2E1RA 1TEXA 2XTNA 3IILA 3EG5A 4Q4LA 3KZ1E 2FPLA 1OH7A 4B33A 4DCUA 5HE8A 1G5TA 3LV8A 1E94E 5LD2B 2G77B 2WWFA 1TTTA 2GTPA 2JJ8A 2CNWA 1FMLA 1TQ2A 4D26A 4XWAA 4B2LA 2Z6VA 2F6RA 1Q57A 4IOLA 2RHMA 3AKYA 3OE7A 1XJ0A 3QKUA 3B1VA 4LUCA 4LBWA 3A1UA 4OQFA 3M1IA 1FP7A 1TF5A 5TMPA 2IYLD 1ZMXA 3B2EA 3CF2A 3IIJA 4JLAA 4BFWA 2QRZA 1D5CA 1FMJA 3WBKA 1Z22A 4EFLA 1I4DD 2ONJA 2BOVA 2HDNB 1YZTA 4V0OA 3HP1A 5FBWB 3LNCA 3AVUA 1IY2A 3GFPA 3K53A 2VHUA 2P6UA 1P2TA 1U8ZA 2A9KA 2CK3D 4PQRA 2UVQA 3P4YA 4BPBA 5EP1A 2J1LA 1IQPA 2Q3HA 4BRWA 1OB2A 1DBSA 2WV9A 3AVQA 1KI8A 5FOTA 4NE2A 2RAPA 4FXPA 4OK6A 1S1MA 3RS2A 2GVDC 1W4CA 3BC1A 1X8JA 3TAHA 2WJYA 4CEIB 1LVGA 2ZREA 1II9A 4I99A 3R7WA 1CRQA 4HLUA 2W58A 2ZI9A 1HE1C 1P2UA 2FE4A 3AVVA 3FDIA 4ZPXA 1KNQA 4IXNA 3K09C 2QE7D 2PX3A 4D4JA 1S2MA 1ZYUA 2F1IA 2BV3A 2W6JD 4L9WA 1G6OA 1XD9A 2XX3A 1NIJA 4FIDA 2AR7A 2IYZA 4NBSA 3VHLB 1GKYA 1P7CA 3KXKA 4JS0A 2DY1A 4GZMA 4CEIA 3E5HA 1AKYA 4EAQA 4LPKA 4MUBA 1R8SA 4ARZB 1EX7A 4PC6A 2P2LA 3RC3A 3TNFA 1OFIA 2XJ9A 2NO6A 1ZM3A 1BYIA 2ZJAA 3SHFA 3AF0A 2DBYA 1DEKA 3MWJA 4Z8XA 4KLNA 2FEOA 5KYKA 3EIQA 3OIUA 4EUNA 4POAA 1PLJA 2P3SA 3QXHA 4TWZA 2KB0A 1J8YF 2VHJA 1KJZA 4KJZA 4ARZA 2UZ3A 4LOAA 4M0LA 2O8DB 5SZIA 1NIPA 2NZJA 2DFTA 4G5RA 1H8HA 4IVQA 4Q4HA 2F3TA 5ELXA 1YU9A 2WWGA 2IWHA 1R8QA 3K70C 1D9XA 1F5NA 2K5UA 1X3SA 3AF2A 3A1SA 3UKDA 5H1YA 5JBQA 3QKSA 2V54A 5L8VA 2EWWA 2RKOA 2FX3A 2XTZA 4IFBA 4B71A 2W83A 4DWJA 3CNNA 3EZ7A 5AWFC 1GNPA 2RCNA 4D0GA 4S2EA 3C5CA 1QBKC 2EFDB 1PUIA 1UDWA 4PO1A 1KO1A 2B7CA 3DMDA 1G7SA 2C96A 4DLZA 1XMIA 4K8OA 5KSYA 2OE2A 5JHHB 1P2VA 4V03A 4BLRA 1RW4A 5EXXA 2PL3A 3NEYA 4CDGA 2Q6TA 4RD6A 2ZR0A 2GVZC 1CR4A 2QN6A 3K0SA 3B9QA 2Z4RA 3T61A 3IHWA 1SKYB 1N6OA 1UBEA 4F4JA 4P31A 2WZQA 1KYIA 3AVWA 3GJ4A 3GCGA 4OHXA 3SC3A 5KTYA 2KBFA 4YMSA 1IY1A 3LXXA 2ZSAA 1KKLA 4IOMA 5DO9A 3TSZA 4XSHA 1XZQA 4MRNA 3UXMA 2XZLA 2OO7A 2QT0A 4RY2A 1UKZA 1A4RA 3BE4A 3S1AB 2AFHE 5H70A 2ZJ2A 4D2IA 2PEYA 4KSCA 1U0LA 2PZGA 5DI9A 3TQFA 4EJSA 2JLXA 3LBHA 1OF1A 4PQFA 1Z47A 3HDTA 5SZHB 4EJSC 1NSTA 5HTKA 1G8FA 2Q9AA 3VAAA 4YDHB 3DDCA 2ZE5A 4L9SA 4B75A 1FOEB 2O8CB 2C99A 2J87A 1RVDA 4P4SB 4MH0R 4DEXA 2QZ4A 4S35A 2WWWA 2WIAA 4O0MA 5F3WB 5CDFA 1UAAA 2GCPA 3VHXA 1AM4D 1KSHA 3RAPR 2ATXA 1WB9A 5IF9A 3D6TB 4IFEA 3CPJB 2ZPTX 4TZ0A 3HR8A 3H86A 1QG4A 1P61B 1QHNA 2PZFA 3L0SA 5J4YA 1PV4A 1W5SA 4O3MA 2VLIA 2YHSA 4LI0A 1P60A 3G0HA 2QP3A 4P4SA 5JZVA 4G0NA 2G1JA 2MSCB 4PPQA 1ETUA 1XMVA 2G0TA 5JCZA 2WWYA 1S3GA 4BECA 3AP1A 1N5KA 1ODFA 4QGAA 2IYUA 4HB2A 2JJ1D 3AGPA 5H68A 1XTKA 4LX0A 3AP2A 4I1SA 4B6FA 5DE3A 1OXTA 2FFHA 4AI6A 3HJNA 1OFUX 3EC2A 4D80A 1BMFD 4M1OA 3X1DA 3U6KA 1TF2A 3AKCA 2PLRA 3I61A 3CM0A 1ZNXA 1EFCA 1GWNA 2VP4A 4GP6A 2P6RA 5GVRA 4IKEA 5EE5B 4DCSA 4XWKA 4Q19A 2OBLA 2XNSA 3NIBA 2IS1A 1AGPA 2V7QA 2W6ID 2ZRMA 4PX9A 4LJ8A 4M1TA 3T12A 2OUKA 1II8A 3CLVA 2EFHB 2HEIA 2W6IA 2O0JA 1KMHB 2QU8A 1XTIA 2JLWA 3SE0A 1ZVQA 3EA0A 1S9HA 5KNDA 1W36B 1FFHA 1N6HA 1NVUQ 2ZYTX 4HAYA 4MITA 4NDZA 5EUQB 5K8TA 3I62A 2NO1A 3IEVA 5JSZA 4UNPA 3R7WB 3TBKA 5A4JA 2WBLC 1KK3A 2NPIA 2JGNA 3VR3A 5B2ZA 4URUR 4YXWD 1N6LA 1P9NA 4GP7A 1E79A 4DLUA 3QXSA 5HCNA 4OQNA 5JCPA 4PXAA 1GRNA 3LY5A 5DIFA 721PA 5JJKA 1J2JA 3B1XA 1NY5A 2IK8A 3FYHA 5CITA 4N0DA 2IF0A 3I3SR 4HAXA 1O3YA 1N25A 4RFSA 1DTSA 2ZRLA 3PR1A 5AJXA 4EFNA 4QBFA 1JB1A 1WE2A 4JZKA 1MT0A 3MUFA 3I32A 4EFMA 1FW6A 4HLQB 4R71A 3DKPA 2FSGA 4OJKA 3WY9A 2GZHA 4DLXA 2WJIA 1BS1A 3F8TA 4MYCA 5FUWA 4URYR 4W5JA 4X8HA 3U4QA 4DKXA 2G9NA 3RDPA 3I92A 1VECA 5KHOC 4BLOA 4RZ3A 1QRAA 2C5LA 2HXSA 1AQUA 2QQ0A 5DI3A 4KI0A 3GFTA 2G1KA 4IEIA 1Q21A 1R10A 1XXHA 4I4LA 2HV8A 5JFGA 4QOSA 1DG1G 1CR0A 1H65A 5CM9C 3SI7A 1RIFA 3K70B 4CEJB 4DCVA 4DRZA 2P6NA 2GK6A 3H84A 6Q21A 3TW4A 2AL7A 1FX0A 2CL0X 1G6HA 2RGNA 4TLBA 3K9NA 1N0VC 3TVTA 3PV0A 2N46A 2P0EA 1WP9A 5HE9A 1E9DA 2J59A 1XEXA 1NKSA 1I2DA 4LJ6A 4MDFA 3VR1A 2ZI4A 2W6JA 4B2IA 3FOZA 4CT4B 3FKSA 5FOUA 1T91A 2JLRA 2VRWA 1L4UA 1GTVA 4HYYA 3KKPA 2IYTA 1GIAA 5FI0B 1K6MA 5JEEA 2QNRA 2IUTA 4NU0A 4KFRA 1SXJE 5FTNA 1ONBA 4JLMA 4DDVA 2CMKA 3HYTA 3HWSA 1N6PA 1YZQA 3LX5A 2VA8A 1GILA 1YRBA 2ZJZA 4HAVA 4MRSA 5DYIA 3S1AA 4B74A 3SFZA 1SKQA 2CCGA 2I3BA 1AKEA 4QHTA 4C30A 2WJGA 4Q9KA 3WP1B 5H8WA 4P3YA 3QVVA 4R7ZA 4JJKA 4JLJA 1CULC 4W7SA 1Z07A 2PBRA 2J7PA 4MKFA 5LD2C 4X8MA 2VF8A 4KXFB 3GJ5A 3VU9B 3IUYA 4DIDA 3Q7PA 1DE0A 2RGBA 1UBCA 1TQ6A 2F43B 4FCTA 2JDIA 4Q01A 2H1LA 2IYXA 2VP9A 2QP4A 2LCFA 1WA5A 3KKMA 2VP5A 3GLIA 2WPDD 1Q1QA 3RWMB 3KQLA 5JI2E 1VCOA 1YZGA 3C41J 1DADA 1NBMD 1W0KD 2WOOA 2ZAMA 4TSFD 3SR0A 3VKGA 5L3RA 4MGKR 2OT3B 1KHTA 4HZIA 1HQYE 3ZZUA 2VHCA 4I1OA 5FOVA 1KI4A 3B1WA 4UXIA 1P3JA 1G16A 3M6AA 1E69A 1U0HC 4BEJA 1Q1EA 4D81A 1LF0A 3NBXX 1DARA 1CTQA 1JNYA 1HYQA 5B57C 4DJTA 4LC1A 1ZD9A 2IHYA 3P1JA 3Q3JB 4OK3A 3C15C 1T5LA 5CK5A 1QHGA 2VHTA 5EXSA 3T15A 3O8CA 3TK1A 4F92B 3EPJA 4XIGS 2AWNA 2WM9B 3V4FA 3W6NA 2EFGA 1E9AA 2ZSBA 2R44A 2BEKA 1N6IA 1P62B 1HEIA 2D74A 1XX6A 1R0YA 2B6HA 4KODA 4CW7A 4P32A 1F6BA 4C7OB 2CL6X 1JALA 4MGZR 4B2PA 3IIKA 1NRJB 3UANA 4KITB 1EFRA 3CX6A 4QG7A 5FTLA 1UBGA 1XMJA 3T5GA 1Z06A 4Z54A 1GOTA 1G8YA 2C78A 2EW1A 1OB5A 2PJRA 2OESA 2KBEA 4JYCA 3LH5A 4R98A 3TIFA 1E2IA 3TKLA 2ASEA 4C9BA 1E2MA 4M4SA 1QG2A 1S3SA 3GEHA 3ZLJA 5F98A 1EWQA 4GMXA 5AUPB 2L0XA 3ZQJA 1KDRA 1XBTA 2QPAA 4XOIA 3UG6A 4TN1A 2VP6A 3BB1A 5L3SB 2A5YB 1OH5A 3DPUA 2J7PD 4ACAA 2PMKA 1CJMA 1KI3A 2V6JA 4Q5IA 2MMCA 3I5XA 1RC8A 2DFKB 3RNLA 4KAXA 3QBTA 3T1VA 4A6PA 1W1WA 3M4YA 2AXPA 2GCNA 1Q44A 2WICA 3X1WA 1TF7A 1DG3A 2YJTD 1SVSA 1A2BA 2IS4A 1E9CA 3IDQA 4LV5B 5EXTA 4A4DA 2GDJA 2ZI6A 2BBOA 4NMMA 2ZRPA 2W0MA 3PJRA 1GRQA 4RFSB 4DBLC 4Z1MD 2QM7A 3IQXA 4FINA 4PSAA 3KDSE 4NPHA 3SBDA 3WXMA 4F4IA 4NCHA 4Q00A 2C9OA 221PA 5FL3A 3WMFA 1CJUC 4M1KA 4A2PA 2QPTA 4P0TA 4X8OA 3RRYA 4L15A 4LV6A 1E2HA 1II0A 4Q9JA 3IHLA 4LYFA 3E70C 2ZVPX 1TNDA 2JLUA 2JLVA 1P5ZB 2Q9BA 1KGDA 2YWGA 2ZE8A 5DI3B 2AKAB 3QKRA 1KKMA 2G6BA 4QM7A 2QBYB 3R9WA 4LY6A 3VR6A 1FUUA 1ZRHA 3SQWA 2GF9A 1CF4A 1MO6A 4WW0A 1VG0B 5JWRA 1IXRC 1KSJA 2IBMA 4BUJA 4ZIRA 1G291 3C16C 4GNKA 2DB3A 2V3CC 3OIVA 4M1YA 2ERXA 1VMAA 1ZAKA 5BQ5A 3BAFA 5CLLA 2BBSA 3GLHE 3HPQA 1N0WA 4I81A 2DFLA 2JA1A 3MLEA 4FCWA 1D6JA 2QBYA 3VNUA 4Q9IA 2IT1A 3VTKA 3QF4B 1SKYE 4HLUC 4JIMA 5G53C 4D0LB 5DLQC 3W8NA 2JLSA 1KOFA 1XEXB 4C4PA 1U9IC 4MA4A 2ZIAA 2B7BA 4DLYA 5KSZA 1SVMA 3B5JA 4FMCB 4B3FX 4AURA 4EPTA 4PZZA 1QZXA 5JEDA 4HB3A 4QHYA 1KDTA 4URVR 5FUVA 1D2MA 2GJAA 1UKEA 4DLSA 1K5GA 1MKYA 3ZVLA 4BLSA 2QTHA 2FSFA 3A1WA 1PUJA 2ZI7A 1I4LD 1L8QA 4XWOA 5E7JA 2A3RA 3L0PA 4JLOA 3CIOA 1U81A 3I4LA 2GEUA 3ZVRA 3TUZC 2EVWX 4ZDJA 1SGWA 1FUKA 4HI0E 2FSHA 1G3MA 2CEAA 4YC7A 3R9IA 3OFNA 2F43A 1ZP6A 1D2NA 1GITA 2IYYA 2OSBA 3MGCA 1W4BA 5P21A 3SZRA 3I8XA 4PPFA 3GLFE 1N6KA 1X86B 1FTNA 1KNXA 2MSDB 3PXGA 1X8LA 2NIPA 2X77A 4YMTA 4UXJA 2REBA 2WKPA 2RGAA 5K8LA 5B30A 1SZPA 4A82A 4B3BA 2R9VA 2AKYA 5EQTA 2AK3A 3DM9B 2Y8EA 4OBEA 2NMVA 3U7EB 4G5GA 4M21A 1M34E 2BMDA 2BBWA 2AX4A 1GAJA 3NKVA 2LWIA 2QAGA 5F9FA 1C1YA 2WTUA 4DCTA 1IJFA 3U5ZB 1NNEA 5G40A 2OZEA 2YWEA 4BLTA 2QEQA 2FZLA 2OAP1 4PC7A 1J8MF 4X8LA 1CXZA 1NVXQ 3TVDA 3FWYA 1T0JB 4LDJA 2HF8A 3PVSA 5AK0A 4JL6A 4B6EA 2J0QA 1MOZA 4HEJA 3N5CA 3GLHA 1NLZA 1QVAA 4LHVA 3UATA 4B3XA 4JBYA 1N2CE 4Q02A 4RD1A 4KBFA 2WJHA 2GILA 3MJRA 4NHOA 4QGFA 4TLCA 3ND8A 5D3MA 4A36A 3WMEA 1G4UR 2H92A 3RS0A 1CEEA 1XU4A 4A8JB 3TUIC 2IXEA 2PLFA 1G8GA 3OAAD 1NG1A 3GLHB 3K8YA 1W4RA 1T8TA 4Q9HA 5K8IA 3QJYA 3RS4A 2OLKA 4BGDA 1JPNA 2ZRIA 4JYBA 5FTMA 5SZKB 3AKDA 1PJRA 3ZJYA 1VKJA 1G5RA 5A5GA 4OJQA 5L3SA 4KFSA 4PHFA 2FN4A 4LJ9A 1R0ZA 4GT1A 3EC1A 1G8HA 1OXSC 1CJVC 4ILEA 4O25A 4M1MA 1XMSA 4Q1AA 3DEFA 4M1WA 3WYFA 3OIWA 4FMDB 4TZ6A 2LKCA 4F38A 3SJAA 1X1SA 1XTQA 1VTKA 5A0FA 3OEHA 5EE1A 2FEMA 4EKDA 2CE7A 2ZRKA 4DLTA 1M1YE 1KDPA 1MABA 1Z8FA 3CONA 4HUQA 4TT3A 4CEHA 4J0QA 3KB1A 1GVNB 1W7AA 3CPHA 2BKUA 2QTVB 4WIAA 2IUUA 2IUSA 4IVPA 4EQ6B 1YR7A 3CWZA 4OQLA 1LY1A 3AQ4A 5SZJA 1UJ2A 1PZNA 1XD2A 3FHOA 2ECKA 2R2AA 4Q7KA 3NHAA 3U3RA 4Q47A 2XB4A 2EFCB 3THOA 2QM8A 3BXZA 4RZ2A 1ZNZA 2FWRA 2WAYA 4PHGA 1G9XA 4IOJA 2ERYA 3HYRA 4AKHA 2Q21A 3EZFA 4AYTA 4EQ6A 4D4KA 2EWVA 1VG1A 1Q3HA 1U94A 2QMEA 1HQCA 1LW7A 2VEDA 3CZPA 3QPVA 1GKIA 2CDNA 2ZJYA 3THXA 1KZ7B 2UKDA 3ZS9A 3IGFA 4LBZA 4Q4AB 3PQCA 1ESNA 2E9SA 1GRRA 2QE7A 3RC8A 3I73A 1KAOA 1E3MA 3A4NA 1NMZA 1U8YA 3ECCA 1XF9A 2WWXA 5JMTA 1Z6YA 3OAAA 4A0FA 4ZKEA 3RSOA 1Z0FA 1Z28A 3QF4A 2XXAA 1Z6AA 1ZM7A 2QSYA 4N1AA 3RSLA 3A6PC 4AIIA 3TQCA 4HDQB 1XFAA 5KDDA 4RD2A 5FPSA 2QP9X 1F2UB 4L8GA 4AG5A 3THYB 4GOJA 4JL8A 2GBLC 4M2LA 4ASUA 1N6NA 1WBBA 3K0FA 2JJ2A 3U7HB 1N5LA 5E4FA 3JVUA 5IT5A 1DELA 4WVFA 3OEHD 5GJBA 5KNBA 2QTFA 2KJQA 1G4AE 1DAFA 2WVJA 4HDCA 5FOWA 1QVRA 2GHIA 3RVBA 3FB4A 2ZUDA 4TQUS 3Q72A 3K0EA 4BFVA 4B73A 3U7FB 3CH5A 3THYA 3N2IA 2YKGA 4US1R 3EZ6A 5IK2A 1YE8A 3PG5A 2ODBA 1YZKA 5FH9A 3Q7QA 1Z0IA 4IDQA 4AKEA 4JVNA 4L5BA 4U5XA 3H0KA 3RYTC 2NG1A 3P26A 1E2NA 1GL7A 1FL9A 3DZ8A 4DIEA 5LB4A 4EIWA 1X6VA 1Z0AA 3CPEA 1E2LA 1HV8A 2QAJA 2HCBA 1AK2A 3TRFA 1V5WA 3REGA 2IS6A 4AK9A 1UDXA 5BN5A 5FBVB 2FFQA 4OI1A 3W3AA 2WKQA 2X8AA 1QHHB 2GAAA 3CO5A 3LDAA 5HCIA 3I8SA 3W34A 4HZUA 3AF4A 4IEEA 5DYGA 1Z0JA 3KQNA 2ZS7A 1T0HB 2D2EA 4M1SA 4UJ5A 1JECA 1OYWA 3A37A 1ZBDA 1KZGB 4YMWA 4ZKDA 1CIPA 1KO5A 3K1JA 3AVYA 3QOFA 4RD4A 3ZZTA 5KNCA 2BHRA 4M8NE 4UQOA 5D3QA 4IRUB 1E4YA 1CR2A 2XOKA 5CB6A 3WMGA 2CVFA 2ZS9A 4ACBA 3REFA 2HYIC 2QORA 1E79D 2IXFA 3AF3A 2A30A 3DKVA 3GEIA 4G5QA 2D3WA 2FF7A 4TMWA 1AZSC 3TLXA 4TMTA 4PTLA 2F1JA 3AKEA 4TLEA 3W6PA 1VHTA 3CBQA 4MQBA 2GZAA 4CIDA 1G7CA 3BBPA 4Q66C 2OAQ1 4URXR 3CWQA 4N0EA 5C1BA 3KX2A 1AS3A 3U2QA 2ZAOA 4A9AA 1OIWA 2GXUA 3Q85A 2YOFA 2HLDA 4AD8A 3B85A 5DN6A 2H8KA 4F91B 5FBRB 2V6IA 1E2PA 4B47A 1XB2A 1OXXK 3QSYA 3GLFA 2YVUA 2GNOA 4L4UA 3MMPA 5JS7A 3SYNA 1P2SA 5TXGA 3FGNA 2EFEB 2J45A 3OFND 4F93B 3GJ6A 4DVGA 3UMSA 4JLDA 1HA3A 4GFDA 3NH9A 3SJZA 4C0SA 3V4RA 4QJ4A 1XPOA 3AB3A 3X1XA 5LBIA 4ITRC 4PPGA 4LYAA 1BMFA 2VBCA 4MYUA 4V0ME 3X1ZA 3LW7A 3RWOA 4W5HA 4BLPA 2ZSFA 1JR3E 3EIHA 2AD5A 1R5BA 1XD8A 4ESHA 1BIFA 4P4TA 5CDFE 3PUVA 5FBQB 3VKWA 4AWXA 4ZCMA 2O8DA 1SQ5A 2Q9CA 4QJ5A 4DSUA 4C0HA 4EPYA 3GLGB 4Q4HB 3QNUA 4B3DA 1EFHA 2FOLA 4WOPA 3SN6A 4ZV4A 3THWA 5KSPA 2N1BA 4TMXA 3FFAA 2J0UA 4A2QA 4A0GA 1HH4A 2FPKA 3JVVA 5FOXA 3EZ9A 5G3YA 1XD2B 4UNRA 3GLGA 5CYPA 2O8BA 2QSZA 3KJIA 4C0AC 2RMKA 3B60A 4IDNA 1HT2E 1DS6A 4BEBA 1TU4A 2XNDA 1QDEA 4AYWA 1P4SA 2ORVA 4HB4A 5HR5A 4Q9LA 1XEWX 3LLUA 3VFDA 1GL9B 2DWOA 2GEDA 4IXMA 4UNSA 2Z0MA 1OIXA 2JJ2D 2ZXUA 1JXOA 1TUIA 1W46A 2AN9A 5KOYA 4Q4AA 2VL7A 3QENA 4DT1A 2FDCA 4NYJQ 1B23P 4A2WA 2O8FA 2BCJQ 1JEEA 2IC5A 2VPPA 4MDEA 1JJ7A 4MUAA 3OF5A 4FWTA 1W48A 4XD7D 2WWIA 3TW8B 3RRMA 1W0JD 1G19A 4OQMA 1BOFA 4GZLA 4EJSB 3K0CC 3U44B 2GJ8A 4M22A 4LC0A 4OHWA 2C9CA 4XSGA 5FFMA 4DB4A 2O8FB 3BFVA 1GFIA 2GCOB 1MO4A 2ZQ5A 3KKNA 2GJSA 4G5OA 4QM6A 1RPZA 3K0CA 2XZPA 1G21E 2WAXA 3OESA 1Z2CA 5AUOB 2HT1A 3T5DA 1G18A 1J7KA 2R62A 2B8TA 3DL0A 4MYHA 5DH9A 1TX4B 1KK2A 4IOKA 3A36A 1HE8B 5GVSA 3AGQA 1GUAA 1O87A 3K9HA 1YVDA 5L3QA 1IN4A 5EZ5A 4JKIA 1T8UA 1Y3AA 3BH7A 5TV2A 3LXRA 3QPWA 4YQFA 3QUSA 2XGJA 4RD3A 1LS1A 2I4IA 4B35A 5GJWC 4D6PA 3TAUA 1XTRA 1L2TA 2IYVA 4TLAA 1VIAA 1UM8A 1IOZA 1SHZA 1RZ3A 2QGZA 3ETLA 3NBZC 4TL7A 5J5CA 3ADBA 3FHTA 2B92A 4JLNA 3W90A 4PFSA 1P6XA 4NYMR 2VHQA 1OJLA 2V55B 2BEJA 1K5DA 1OHHA 4WZAE 2ZE6A 3PEVA 3R20A 4BE7B 1S1CA 2PMDA 3CNOA 1RRFA 1TPZA 1ZUNB 4H1VA 4ABYA 2GA8A 4CGZA 2IYQA 5KUTA 4PO8A 3TSOA 3WNCA 2GKSA 3EWAA 3AP3A 5FL7A 3QXXA 1E9RA 2DR3A 3Q9LA 2XOKD 3GP8A 1EFRD 4DHEA 2V1XA 3SBEA 1IONA 3B8HA 4BFTA 2YOGA 3CNLA 2C9YA 3FVQA 4O2LA 2XSZD 2ZROA 3NC0C 3W3ZB 2VH5R 2J5XA 2CJWA 4M9ZA 1E2EA 2NO7A 5KPDA 2AXNA 2EQBA 2VSXA 2D2FA 2ZTSA 4RSGA 2XEXA 2IEZA 2C95A 1DAEA 1TUEA 1VHLA 5EUMA 4TTRA 2O52A 4P33A 5TARA 5JSZB 4GDFA 1OXVA 1R4AA 3TUJC 2H57A 2W00A 2H5EA 4MKGA 1RJ9A 1R6BX 2A78A 1SXJC 2QT1A 1Z83A 2ZR9A 4MGYR 1CJKC 3ZD6A 2OFXA 5UKDA 1GL6A 1AZTA 1Q3TA 2ZRHA 3C8UA 3LAWA 3HPRA 2X1VA 1ZJ6A 2WPDA 1XPRA 3NEJA 2C8VA 4AKIA 5AJWA 5FI1B 3GLFB 1WRBA 2YINC 3ONWA 2QG6A 4MKIA 1E1QD 4Q48A 4OI4A 3U3MA 1UPTA 821PA 1U90A 2ZI5A 1NBME 2CLDX 1RJ9B 3A1VA 3QI2A 2VF7A 2XZOA 4DLVA 1GG2A 4LPSA 1U99A 3VKHA 1Q1ZA 1Q22A 4Z51A 4OI2A 3UG7A 1E99A 4E09A 3CRQA 2B8WA 3NBFA 1M74A 5J47A 4DSTA 3KQHA 4FW9A 2PX0A 3LVRE 3B13B 4B43A 3KJEA 1VCNA 2O5VA 2A5DA 1YR6A 3NBYC 3U3JA 4I1UA 1E9EA 2HJVA 4UKDA 5JS8A 2ZRBA 2R6FA 2O8EB 4US0R 5C4GB 1M6NA 1RE0A 3PCRB 5GJCA 5K8UA 4DDWA 4V0NA 4LV8B 1D2EA 3D3QA 5EE3A 2YNMA 5BWMA 3EX7C 4DDTA 1XNJA 2A2ZA 4Q1EA 1IAQA 3WYAA 1LV7A 1UF9A 1VYUA 2CXXA 3DO6A 2O0KA 3KQKA 4JMPA 5GJVC 2WMNB 1JAHA 4O2RA 4BFXA 4NCNA 3WNDA 1Z63A 1R5OA 1OSNA 1ZM2A 3BB4A 3D7MA 4QKQA 3B9PA 4C2TA 3AEZA 1DO2A 2BM1A 3QKSB 1UEJA 3FMIA 3CRW1 1N6RA 1H8EA 2J9RA 1WBDA 3OE7D 3LWNA 2G88A 3NVAA 621PA 2ZYWX 3AVOA 4MYTA 2Z5FA 3SQXA 1NI3A 2RGGA 1E6CA 1UADA 4DT1B 2A5FA 2VQSA 4LJ7A 4E5UA 2RGCA 3C4JA 1T6NA 2NGRA 3RABA 2GXAA 5CB8A 1E4VA 2BJWA 1Z0KA 5EE9A 1NBMA 4TSFA 4WZ6A 1UEIA 2X19A 4Q21A 4AYXA 1KK0A 1NL3A 4JJZA 5L3VA 4TT3D 4Q03A 1G7TA 2BCGY 2GJ9A 2N42A 4C0LA 3PENA 1K8RA 3PIRA 1JI0A 1TMKA 1VYVA 1KY3A 2C98A 4M53A 5KU1A 5JJLA 2OG2A 3IO3A 3RRNA 2ZU6A 1YQTA 2VO1A 3A1TA 1Q1BA 3EXAA 4NYIQ 3W8RA 5IHPA 2GETA 2JJ1A 1SXJB 3VNVA 3VR5A 2PH1A 1CLUA 1VCMA 4DUGD 1ZUIA 3GJXC 5L3QB 4IJMA 5FUXA 2JIZD 1EFTA 1W2GA 1RYFA 2ONKA 4CVNA 2ODNA 3QEOA 2J3EA 4HSEA 1EX6A 2WJJA 3EPHA 1P75A 2YV5A 5EZ6B 1E32A 3VQTA 3BORA 2PJZA 2GESA 3L2OB 3VX4A 4CRWB 3GEEA 3FKSD 1KO4A 1DPFA 5JLJA 2CHGA 3QY0A 2Q0HA 2FFBA 1IY0A 4NCIA 3I72A 4FMDF 4QRHA 3E1SA 3QF7A 3SNHA 4JLBA 5F2EA 3KJHA 2XSZA 4PAQA 2JIZA 3WYGA 2DHRA 2J0VA 2QAGC 2LKDA 4GOXA 3IBYA 4OQXA 5E3HA 2NO0A 4D0NA 3VR4A 1IN5A 3ZGXA 3CKLA 1KY2A 4DZZA 4C7OA 1A82A 2GXQA 4L16A 1JBKA 1QHIA 3L8ZA 2A7QA 1KJYA 2EU8A 4RZXA 2PT5A 3LW8A 1LTQA 5DHFA 3EIEA 2OCBA 4KU4A 3ZIAA 3U6BA 1MO3A 1N5JA 2AFIE 1E1QA 2FGKA 2KI5A 3LQQA 2V1UA 4MRVA 4JBXA 3QG1A 4U7DA 4A1FA 1R0XA 3IIMA 4Z8YA 1DAHA 1RKBA 5KDOA 4B32A 4BFYA 1S9DA 4TMKA 3K70D 5EP2A 2G83A 3WBJA 5G41A 2A5JA 3WHLA 4LJ4A 2ZETA 4PPNA 4TLDA 1NVWQ 2VSFA 1NSFA 4PHHA 5CM8B 1YRAA 1W36C 5AR1A 1II8B 4B76A 2FSIA 3GJ8A 2G0NA 4BFUA 4AC9A 2CBZA 3LA6A 4G01B 3NDBB 3IBGA 3DM5A 2CL7X 2FNAA 4URZR 1M2OB 1AIPA 2WKRA 4W5WA 2ZU0C 3CF0A 4D25A 4GBMA 2GRJA 4QBHA 4HUTA 3PUZA 4RFVA 4QGHA 4B34A 1FNMA 4ZDIA 3ICEA 5DSZA 1TEVA 1E9BA 1YR9A 3EARA 2PEZA 1NN1A 4EPRA 3C14C 2FJUA 3NC1C 1NVVR 2VIIA 5BN3A 1ZC4A 4TL8A 1GNQA 1AS2A 5ANRB 5FL7D 4YLGA 1CP2A 1ESMA 1VIYA 4QNRA 2FU5C 2QGNA 2GAOA 4GMDA 4LZZA 3ADCA 1Z3IX 4LK2A 4IDOA 4JT4A 5HPYB 3OIYA 4Q1CA 5G3ZA 1FX0B 1QHXA 3IEUA 3UPUA 1G3IA 2FV8A 2O8EA 1EESA 2PCLA 3LBNA 3BH6A 1YZLA 1COWA 3P4XA 2GXSA 1TU3A 4OI0A 1GSIA 4LHXA 1E2QA 3GQBA 4JLPA 4XTCS 3NWJA 3U4QB 4ZIRB 5BYJA 1M7HA 2IS2A 2XITA 1IBRA 2D62A 5E7IA 5AJYA 4G5SA 1TAGA 3MG9A 3ADDA 1NP6A 1KI9A 4GL2A 1E2FA 4W9MC 1XXHB 1U8AA 4MRRA 1E9FA 3TGPA 2G3YA 1WQ1R 3PUYA 2AD1A 4XTRA 3BFKA 4U02A 2PT7A 4CEJA 3W9YA 1XWIA 3CF6R 2ZUBA 4RKEA 2C77A 4JSTA 3SHWA 3SYLA 3IPYA 2GK7A 1Z6TA 4FN5A 3E2IA 3P20A 4YDSA 4PANA 4TYNA 1QHSA 1SVLA 2VP2A 3G82C 1GM5A 4ON9A 1T9HA 3AUXA 4TL6A 3X2SA 1T3SA 3AUYA 4OYHA 2CK3A 2WOJA 4Q1BA 2BBTA 3QE0A 1U98A 2ZR7A 4KYUA 3KXLA 5CK4A 1P72A 1A2KC 5FPTA 3T1OA 1P9RA 4PQYA 4Q18A 1LNZA 1W44A 2D4HA 4G3XA 5EE0A 4MGIR 3TH5A 2JATA 2HF9A 2D7CA 4MKHA 4NH0A 4BASA 4BWYA 3L8YA 4KVGA 4ZDKA 3EW9A 2ZVQX 4FCVA 1PLKA 3BK7A 1U0JA 1ZIPA 2IW3A 4HAWA 1ZCBA 1JXMA 3J81k 2F1RA 4DSOA 5DNYB 4QBGB 1ZINA 1JEDA 1XCPA 1YR8A 5HZHA 2GZDA 5C4MA 1Q20A 1SVIA 1ZC3A 2FG5A 4LYJA 1KO7A 2BWJA 2XNDD 1IN7A 1KMQA 3OEEA 4NYIR 2ZRGA 5CYOA 2HUPA 3TR5A 4WXPA
chains in the Genus database with same CATH superfamily
3JD2A 5I4BA 4IS3A 4H9GA 4HDRB 1M0WA 3VKUA 3FG9A 4PSKA 1SG9A 3NWBA 4GG1A 3VU9A 1UJBA 2VJMB 3VX3A 4PS1A 3NPAA 4B3GA 3DHEA 5JHGB 1QC5B 5DXFA 1V25A 3COSA 3HNOA 3OVMA 3P2MA 4F6LA 1W4ZA 5AOBA 4WZAB 3LZ6A 4RZUA 1XOIA 3AHJA 1OTHA 3GLIB 4NE9A 3ZHOA 4R2JA 5E9QA 1AZLA 3D43A 8ATCA 3GPIA 4WNIA 3HNPA 5BV0A 1CEXA 2XUGA 1E3IA 4C4ZA 4CMHA 3AY7A 3CG4A 3QVLA 3VR4H 4ALIA 2GF0A 3HVJA 3RI3A 3KSMA 1WV0A 4N8SA 2XA1A 2XOEA 1QF9A 3O1JC 5FHRA 4OFWA 3P2YA 3N8DA 2HIHA 5J1TB 1CY1A 1TCBA 1ZGAA 3CX4A 1UKBA 1Z6ZA 2H5IA 3F2VA 3HI4A 3PIDA 3UCEA 4EK9A 4ZI3A 5JG7A 3UJNA 4FCCA 1DFHA 1ONSA 4HO1X 4JA0A 2HRZA 1YQXA 2ODEA 3E22B 1WDTA 2PD4A 4BDSA 3ZEIA 5LMUB 3S3TA 2VSOA 3AB7A 4F21A 2BGKA 2YXBA 1OWMA 2ZBFA 4JASB 1F48A 5JZMA 1XWWA 3AUFA 3C6KA 3EIFA 4KUGA 2FFJA 5CCDA 1VIDA 2FH5B 3IQHX 4N65A 1DEOA 2VATA 4RXTA 4K88A 5EJGA 4UUNA 1ZNYA 1WVIA 4XD7A 4KLAA 2OAGA 2LIVA 2XB8A 4II2A 4AM8A 3FTDA 4OYLA 5B55A 1E96A 1X15A 5D3MB 3QELB 1JLKA 1HO3A 3CLUC 2KLHA 1GTJ1 2H4HA 2GNPA 2AC2A 2J07A 2JANA 2UZAA 3HFGA 4WFQA 5F1OA 5J9FA 2ZYAA 2P9JA 3N28A 4QFDA 4Y6OA 1PLLA 5LB2A 2IEDA 4ZCRA 2GM3A 2O7NA 2YJGA 4PFJA 3WWPA 3AHDA 2XKJE 2YY6A 4C0BA 1L7VC 3VMFA 1U4NA 4K9LA 3ZHUA 2DKOA 3AVXA 3GCWA 4V0QA 4EA9A 3G5TA 3BKXA 2PKEA 1V16A 1WNFA 2H1SA 2PAAA 3PFIA 3RIGA 1BX0A 5C3UA 5K8JB 1A98A 1O77A 2POCA 3E1GA 1JAZA 5J2UA 2QM0A 2OV2A 3EVEA 4MK4A 1N3BA 1H9AA 1ZONA 4EH1A 3ASYA 1HG0A 2GPNA 2WU8A 3DBOB 3KR9A 3S2ZA 4D3XA 1A7JA 2C9BA 2E87A 4XPZA 3RTBA 1YDHA 2PRJA 4NXNB 4RIFA 1V4NA 1XTPA 2W37A 3LUPA 1JSXA 2PPLA 3G2HA 4CM7A 1GDHA 5CT6A 1H2YA 4FTWA 7REQB 2CCJA 4S0XA 3E9NA 2B6NA 5EZYF 3H4IA 5CA1B 4YFYA 4ESVA 2WAMA 1N7IA 3WK4A 5EKUA 1ANKA 1AG9A 3IBTA 3W6OA 5I7WA 4C0KA 1D6MA 2VR1A 2J4FA 4TZKA 3ABZA 2OHFA 3W2IA 4K3VA 3OQOA 1D0VA 4YV0A 2ZT5A 1ZA1A 3FY4A 3IERA 4R2HA 4UJ3A 2BGTA 1RXVA 2Q8PA 3IVRA 1CS4C 3H4MA 4GRDA 5DWDA 2PAFA 1NQUA 3F97A 1ZL0A 3NRCA 1GUFA 4FUTA 5KNDD 4YRBA 5L51A 3KOZA 2O2IA 3DL7A 3CRRA 1ZNWA 2Z8YA 4M9QA 3MJVA 1O5TA 4A0HA 2QD5A 1D2GA 1DAKA 1ZM4A 4F2DA 4RO0A 4D8UA 1UZAA 4E46A 2PGXA 3TR0A 2KW5A 5M34A 1S0UA 2XE6A 2WU4A 5D85A 4X3OA 1K0FA 3L6BA 1KBOA 4OB7A 3PHHA 4MVJP 4QTUB 5EJEA 5JY6A 1C0KA 4ZCLA 2JC3A 2E5FA 3O3MB 4N3NA 2DTEA 3K73O 3TIXB 1ZJJA 4M7WA 2O3QA 1USIA 2QMQA 2HCJB 2W6QA 1EXNA 4M6WB 4YJGA 5DEIA 3ZQ6A 4F86A 4LXXA 3C3YA 1YS1X 2XAUA 3HVKA 1UBFA 3C6MA 4WT7A 5CHYA 3DVQX 3WIDA 1T4CB 1XTSA 3NOVA 3BHNA 4MQEA 2IIQA 3V9PA 5CPFA 2XXAB 4GLFA 2R751 3DW1X 3PNMA 4LRSB 5EC8A 4BS9A 2YJNA 2ZYSA 3WDMA 1PAUA 2YWHA 4Q1VA 2ZPUA 3WDLA 4EPVA 3S1LA 3GMTA 2ADOA 4H27A 3BSFA 4YUVA 3FBTA 2REOA 4A0RA 4W1RA 3V4OA 1PT5A 2YUTA 3IA7A 3RSCA 4BAZA 4DBLE 4EG5A 7ADHA 1LDMA 3ZU4A 2IKSA 2V45A 3HVHA 1DT5A 2ADFA 5KB3A 2AFRA 2V7VA 4XASA 1HURA 1QAOA 1BE0A 3A3KA 1KTIA 3KE8A 3RGGA 2CWDA 2F64A 3I6ZA 1L4BA 3A4LA 3IOEA 1JYEA 2GZSA 2R5WA 3KZOA 1KRHA 4PAOA 4LSGA 4OHZA 2H18A 2PR7A 3KZVA 1NUUA 1SQSA 2DU8A 1N2OA 2WJAA 5HG0A 2HZBA 3MYRA 3UOAB 5JH7F 4GOLD 1G60A 3I9JA 1TE2A 4C5AA 4XRGA 1YNSA 1UOPA 1L4EA 1UM9A 1EXDA 1CR1A 2NU8B 3HE3A 3PT5A 1NC1A 1YZNA 3A25A 4NJMA 5T4HA 3EGDB 1I9GA 3RANA 2MYPA 3SSNA 5LU9A 5IRCD 3PF8A 2D6FA 1T6ZA 3DZHA 1OFTA 1XP8A 4JKYA 4DUPA 3ER6A 2F9LA 4B3JA 2HFKA 5FWYA 2Z9BA 1U02A 3NT4A 2DQYA 3RBZA 1SQ0A 2PMBA 3ZHQA 1M7GA 2X2EA 3DBLA 4HXYA 1V8DA 4YMUA 1ZD1A 2OFOA 4HN2A 1Y6FA 3LSYA 5DN6D 4QHSA 3BRWD 1JQ3A 3HJUA 3DHWC 3LHIA 3WYNA 3GT3A 4DYHA 4C21A 1SVOA 1NG9A 2GEBA 5F4ZA 1Q92A 1D07A 3L40A 8OHMA 1DO0A 1KK1A 3JZAA 1RMYA 2B9VA 3LRPA 1U3VA 1E98A 4JSRA 5B1SA 3N8IA 2OD2A 2ORWA 2Q0XA 4I36A 4Z1MA 4B4WA 2QTWB 4F45A 3AOEA 2Z09A 5BSRA 5AVSA 3I76A 4HQFA 3TQHA 3H4TA 5KYUB 2P30A 4G97A 2IWRA 2IHNA 4YJ2F 1EFPA 1GP2A 1JG2A 3PITA 1IJEA 4JOBA 5CTJA 5JI3E 2P5TB 1EQAA 4IH9A 4U9UA 3UGQA 5EJ5A 4X94A 4JBWA 4TVSA 3NBMA 1M73E 1TU0A 3B9BA 3BTVA 4Q3NA 3B6EA 3VR2A 1L7EA 4YT4A 5EHZA 4YALA 1VLQA 3R7BA 5U1PA 2QPOA 8ABPA 2UZ0A 2VJQA 1LPOA 4Y2SA 2R7KA 3WIBA 5C31A 3QUBA 1NYRA 1RLUA 2V7PA 3KKQA 1QV6A 2CHQA 1JVNA 5U9CA 5B64A 5IW8A 1XP5A 3ZDBA 2P9BA 2EYUA 2J6BA 5J4HA 3D2LA 5CB4F 4ZVTA 1FRQA 1GFSA 1N5MA 3GGPA 3KJZA 4H1UA 4JJ7A 3RJ9A 2I55A 3H2GA 1CUIA 1JEQA 2IEYA 4LS3A 1XHLA 5IG2A 1J90A 2KYRA 3QK7A 1SEPA 2D1TA 3HBFA 1VMEA 3BJIC 3EVAA 1QE5A 2R84A 2FN9A 2CE2X 3FYTA 1J5PA 4OXYA 2EBFX 4PO9A 1Q0UA 2AA3A 4MP8A 3I9OA 5FCDA 5LZ5A 4J49A 4WXRA 3IQEA 1GR0A 1TW3A 2D1SA 1DKNA 1FP2A 2QZ9A 2XYHA 3BKWA 3QZUA 4X7PA 3ZJ5A 2H63A 4US2R 3SQOA 4B6QA 1S2NA 4HQ6A 4YCDA 4OKSA 2F55A 1XJCA 2QUZA 2HCRA 1QH8B 1IIRA 2DHQA 4PSCA 5BW6B 3TSWA 3A58B 4MPPA 2ZR8A 3V2UA 2ZIGA 3O8RA 5IDVA 5ICSA 1KO8A 3O8DA 3CLTD 1SULA 1V7QA 3PXEA 4FDTA 4G8DA 4NFHA 4NG5A 4TQ9A 1N1GA 1F60A 1NM5C 4LHZA 4D4LA 5C8VA 1PHRA 5I9NA 4JB2A 2HADA 2W2XA 3QE3A 2DWQA 1ZIOA 5HJ5A 4G81A 3TMYA 1Z6GA 1Q84A 2DFNA 5IAEA 3SQLA 2QL6A 5FTKA 4YCLA 2WW8A 3A6DA 2I34A 4DWVA 1PR3A 3QQPA 4ZI2A 2IP4A 4GPTA 1D8TA 3A6LA 3GJQA 5BQPA 1FC0A 3IQWA 1E5QA 1QH1B 1I6KA 3LFHA 5CIQA 1Y81A 3ZGOA 4OBXA 4M9SA 4TQAA 1OKKA 4JH0A 3ZKAA 2RE8A 1DIRA 3I1JA 1X1TA 1ISSA 2O4CA 3JASA 2PTHA 4JJ4A 3RFTA 1JTEA 2N3ZA 3KHSA 3MWLA 4RF4A 1SBHA 1MF7A 4QUGA 5EKTA 4G36A 2E4VA 3HN2A 1RYDA 3ZE0B 1NQVA 1GZ6A 5ELMA 1Z2EA 2GI4A 3QWIA 4WBNF 7GPBA 1ZJ5A 3N2EA 5FPYA 2QW1A 1SK9A 3P7MA 2VYFA 3GRPA 2HK6A 3SEAA 2XI4A 1LNSA 4CF4A 8AT1A 3F96A 4P34A 3ZJUA 4PBTA 3L0CA 1VKNA 1RM0A 1Y4SA 4RPIA 3STXA 2G82A 1ADGA 4FLFA 3VJKA 4D9HA 4DRXA 4DV6B 4LY0A 4F7WA 2ZJBA 3BCRA 3B7GA 2BMFA 4BP1A 3PGMA 2FDXA 3WGGA 1EKXA 1ZUD1 1B14A 3PJDA 4IDEA 4II7A 4AZWA 1GQ2A 3FF4A 2VYND 2JKYA 4DA7A 1GZSA 2BH2A 1NKTA 4P2GA 4ZQFA 1T4GA 1A9XB 3KT3A 1WMSA 5T6BA 1WPQA 2X4IA 121PA 3G5UA 1TKRA 1EI9A 1JHQA 2BC9A 4QNMA 5KAPA 1RU3A 1RRCA 1VHQA 2MSNA 3O2SB 3PE3A 1X7DA 1JHPA 4IJKA 1QGZA 3B8EA 2G1AA 2XUIA 4FOSA 1JR6A 2MOKA 3MTBA 2CVHA 2E4AA 3JZFA 4E6EA 3NDRA 2V7QD 3U1TA 5AM0A 2YZ7A 4IJWA 2KWIA 3I2YX 2IL1A 3PXAA 4KKVA 3FCCA 3L7JA 1UPAA 2V9PA 1E1LA 2TMDA 5FTWA 1L7BA 5EFZA 1Z0DA 3A05A 4QUAA 4A91A 1PVOA 1NXVA 3RFXA 1FUIA 2SKDA 4JU9A 3DYVA 5TT0A 3GZTB 1P73A 2C2BA 2PGLA 3PCTA 4MDYA 3TD6A 3JQ7B 2QM3A 3G0BA 4PGHA 4BAGA 5BN5B 1COWD 1JL3A 2WV7A 3IMKA 1WQ4A 4QWWA 1GPYA 3E3OA 4Q7JB 1QVZA 3PC6A 1GGVA 3Q6NA 3B78A 1PR1A 5FEMA 1JTVA 1SPXA 2OBMA 3ETNA 3EVBA 2NYUA 3UHOA 5FV7A 5CFOA 1IC6A 3H2HA 1FPMA 5I7VA 2AN5A 2VQ3A 5LDHA 1FTWA 4H7PA 4J43A 5BV1A 3HR7A 1TD9A 1CLEA 2PU5A 2Q5IA 1A4UA 2GO1A 2EZ4A 3HCCA 2OXCA 3OZVA 3QEMA 5CNMA 5EP3A 3T3DA 3WFIA 4DMRA 3D02A 2OK8A 5LP6B 1RI2A 4RPCA 5JRZA 3O93A 3E0QA 1U63A 4BNXA 1I3MA 3FPEA 2ENUA 1H8ED 1IN6A 2Y67A 2P65A 3UJAA 3LQRA 4D41A 3PPWA 4JLWA 2ZSEA 4XUGB 5HF6A 3ZN2A 5L9AA 1Y1RA 1NLYA 4KK4A 3UICA 3B6JA 5A4DA 3BH0A 3QKWA 2JGJA 1EAMA 2PBLA 3UA3A 4I8DA 3H83A 4ETMA 4NS4A 1GNRA 1QIMA 3BB3A 1N2ZA 4P5EA 5E7MA 5F51A 1LRLA 3E7PA 3H9CA 3AERB 2O3JA 5F64A 5CLFA 4HKTA 3O21A 3WBBA 2E55A 2X9LA 3DUWA 1ACMA 3EYAA 4CWAA 2ZE7A 1G9SA 4HLNA 1A5ZA 2R6R1 4KO1S 1QHHA 4R3NA 4EY8A 3NFYA 1KP9A 3EVCA 2H00A 3KJQA 2ZI3A 3D4BA 3N86A 4HSGA 1G64A 1H6DA 3M34A 3PA6A 4KVAA 1WABA 4M8KA 4WDRA 4YBRA 4DIUA 1Y82A 4OHCA 4I4IA 4TLMB 2OXRA 3E35A 4G1UC 4NMHA 4KR9A 4C0WA 2WNSA 4B3HA 1EGMB 1DKPA 1HY3A 2B4TO 2MSLA 2XVYA 3CVOA 1KYYA 3MJ4A 2FZ4A 3WLJA 5JATA 2ALJA 2CMFA 4X1YA 5TR9A 1W5TA 3ZJVA 4QASA 1HMYA 3A4MA 4IIEA 1T3LA 3K9WA 5DW3A 5FOSA 4WJLA 2M2IA 2YMQA 2QA5A 3TQTA 4S1PA 2RGYA 1UFQA 1Y3FE 1YZFA 5LFAA 4LISA 3B12A 1RXUA 1SB8A 2Z56A 4I6EA 5K4AA 4WBNB 4MS3A 4JENA 4RTLA 1P6QA 3SOPA 2IHBA 5G1OA 1W25A 2YWRA 4J1NA 4MW1A 3RSFA 4BIIA 4RKFA 1J49A 3VUFA 3CB4A 4CM1A 4CG2A 5L7WA 4MO2A 5EQDA 1HQKA 2UVPB 2NPFA 3ZWCA 4EVSA 1CCWA 1O0BA 4B44A 3HSSA 1OXUA 1JHRA 3U80A 1S3IA 3F6YA 1B42A 3I45A 3B6MA 1PNRA 3H0CA 1W35A 5H02A 4XEHA 4NESA 1U4SA 3NHBA 2WIGA 1CZUA 2GM9A 1ZJYA 2EFYA 4ZGBA 2EYQA 5LQAA 1N2CA 2B36A 4Z9XA 4ZVOA 3UIEA 2QV7A 5IEBA 3W7AA 4DLRA 3OOYA 5CYGA 1XEFA 3L93A 4W8HA 2P67A 1I2MA 1KQ3A 1YCGA 2GMWA 5CXXA 2WSSD 2IA5A 1T2UA 1O5OA 3EZYA 4IXWA 1QAMA 1QF7A 1Z5ZA 2FPOA 3HWRA 4Q34A 2AJDA 3UH0A 5I8PA 1XCMA 2RB5A 2O8BB 1Q14A 2X0JA 2C5BA 4FHGA 4R5HA 4R51A 1WL8A 4CL2A 2W6NA 3HCNA 5LYJF 1HYGA 1OYYA 1G5FA 4WK6A 3TQIA 1Q7CA 2ZANA 2VTKA 4R8RA 3R09A 3JAMA 3D8SA 3CLTC 1BA2A 1RJDA 1Y1LA 1S8AA 3HKEB 3QLVA 2ZXEA 4M9XA 3I05A 4YRJA 3V46A 2VCHA 4PYNA 4ZCQA 3NAGA 4UBOA 5AVJA 2D0IA 2RGNC 3BWMA 4WNAA 3TNDA 3GU3A 5K6TA 2R6CA 3UGJA 4B4VA 2UUAB 3N6VA 5LC1A 1US8A 5IKEA 3JASB 2QDXA 2Q4DA 1Y4DE 2QRNA 2I7CA 4KH0A 4OH7A 1JDSA 4ZXPA 4TV9B 2WU3A 4R0NA 1CJTC 1UBSB 1M83A 1VZ2A 4HDSA 1QS0A 2AZ4A 1OH8A 1YA4A 4RIHA 3K96A 1YVEI 4TRMA 2E6KA 2VDQB 2OTCA 2VKTA 2VF5X 2ZWAA 3BIJA 4FGZA 3WQRA 3CW2A 1PL7A 3HVRA 3BGVA 2QYTA 4K5QA 1ISIA 2F1OA 5TDHA 2F3RA 3QG5A 5IM4A 2IX3A 3RTCA 3DVLA 3GROA 4KSBA 3GJRA 4GVPA 4TYQA 4ND1A 4NYMQ 4RVOA 4JZYA 3UGTA 1F38A 1KOGA 4R5MA 2GN2A 2RH5A 1KYTA 5AI4A 4MKRA 1E3JA 1NUHA 4DW8A 3JWIA 1OR8A 3O8QA 2CFTA 4UOZA 4BV9A 1P7ZA 5H83A 5AD1A 2ZIWB 2HNBA 4FD2A 1JJIA 1BDBA 1BVYF 2AFIB 3B1YA 2FR0A 4ZO6A 2HSDA 1PK8A 3N0RA 3CRMA 5KNLA 4P0PB 3SZUA 3EAQA 4WCFB 2PZMA 5AHRA 4Q4JB 2HK8A 1QP7A 4HNHA 4EO9A 2O8CA 4OHKA 1SXJA 1N1EA 2BMJA 3LYAA 5HMLA 5I7EA 1X1BA 2NTYC 2EX4A 4BQSA 3VHXB 1VQ1A 1MPTA 1W96A 1JEYB 3FE2A 2QVGA 1KF0A 2I7XA 1G63A 1UKAA 3EWSA 3IOCA 4RNCA 4D02A 4C89A 1MOQA 3KUDA 2D2XA 4Q4JA 3KT8A 1G55A 4IUYA 1DOAA 2DUMA 5DEOA 4RW0A 5B36A 3UCXA 1QTRA 3LC2O 3CH6A 1DEAA 3CISA 4CW7A 2YN0A 5AHXA 1L5ZA 2FAXA 5IASA 4Q4LA 3DE3X 3EG5A 1OH7A 2AZXA 3DC7A 4B33A 2Z8XA 1SIWA 3LV8A 4MR8B 4CODB 3ZQKA 2XB6A 3IEKA 5KYGA 5IAJA 4J6EA 2WWFA 5JU6A 3SAJA 3PI7A 1IEWA 1S7GA 5D01A 1KPHA 2ZQYA 2CNWA 3KVRA 3G2MA 4QFCA 5EGSA 3SX4A 5F78A 1K63A 2AC4A 4FOOA 3PQDA 1W6RA 3VC2A 2ZDQA 2F6RA 2C1XA 5ED4A 2ONZA 3ZQ4A 3W2TA 1YKGA 2I99A 3ER8A 3CO0S 4LBWA 1SR8A 4OQFA 5AM4A 3NT2A 1TVCA 2CLLB 1ZMXA 3B2EA 5K0NA 3AZOA 4JLAA 1DZIA 4QSHA 3WBKA 1I4DD 4ZVVA 2W22A 2BOVA 1W1IA 3OP4A 5JO0A 4FYXA 5D3KA 1WMEA 1JXQA 3GEDA 3SKYA 1ECFA 4V0OA 1IY2A 1Y8RA 2VHUA 2OCXA 1T5HX 1UUFA 5IXJA 1PUXA 3ZG6A 1THGA 3DBVO 5C52B 3PLAE 4NAVA 1USUA 2JD0A 2Q62A 4A10A 2XYRA 1T9AA 1YJ8A 1Z68A 4HMPA 1WKBA 5FOTA 1P91A 2A4KA 4XJVA 4YT8A 2DWUA 1WUYA 4FXPA 3RS2A 5KX5A 1B6RA 2A1TR 2YMLA 4L4YA 3L0YA 2WJYA 5EINA 3RD5A 4ZAZA 1FVFA 4G0XA 4OCZA 2ZREA 1II9A 3R7WA 2W58A 3ZHCA 1MVNA 1HE1C 1P2UA 1QCCA 2ZI9A 4ZHQB 3FDIA 3O4RA 4L28A 4EPYA 4ZPXA 3VOSA 5C1OA 2AV6A 4QDKA 4U0JA 2BGLA 2QE7D 3K09C 2XCOA 1JA9A 2PWZA 4N8EA 3FPSA 2GKGA 3Q12A 4HFJA 4D4JA 4EVRA 5M5BA 4IIJA 2HJWA 1UBOS 3PF9A 1G6OA 4RV5A 5DVZA 4S1WA 2XX3A 2AR7A 4KQ6A 1W0CA 1UFOA 5FDFA 1P7CA 3E53A 2IP1A 3KXKA 4GZMA 3L7LA 4JS0A 3H11A 4RJ2A 4RYLA 5G2OA 3FMVA 2VUUA 4EY6A 5B2EA 5AP9A 4MWEA 2IPOA 2FPRA 3DG9A 3RTEA 1XQ9A 4KMMA 5AJHA 2RHTA 2ZP1A 3MELA 3W5HA 2XJ9A 3JATA 4UE3S 1ZM3A 3T3OA 1WZNA 2PLAA 3ZNNA 3G79A 5BOVA 3AF0A 1FNBA 3QE2A 4FSDA 3B6ZA 4LVNA 4G67A 2OXFA 3ILXA 1PEAA 4MUKA 1Q15A 3G89A 2HSZA 2BI4A 2P3SA 4ZO8A 1DDIA 3DQPA 4N12A 3GD5A 3C6BA 5I51A 1E60A 4V39A 2JEZA 5HQTA 4PNHA 3OUTA 5CBPB 3AC0A 2PZLA 4QTZA 2ECQA 3PICA 5L53A 3L6CA 3TLYA 3PGA1 3GJTA 5K45A 2IU3A 4OPMA 4Q4HA 3VU1A 2F3TA 3HCEA 2HA4A 2IWHA 3R6DA 4I5FA 4M99A 2VJBA 2Q1SA 1ULUA 5T4BA 2WKWA 1F5NA 1GPNA 2K5UA 4EEXA 4CFSA 1HFJA 2ON6A 4ZMBA 5H1YA 3GQBB 5BPHA 2DSNA 2J5QA 3MLAA 2QIOA 4NNOA 4UQPA 4WTOA 1CY8A 3SOZA 2MR6A 2A67A 1RAEA 2X86A 2AR9A 1KQFA 1RABA 1DC8A 3C5CA 1OLXA 5L95A 4RESA 2VDPB 4U4AA 5B1DA 1ZK4A 1A71A 1TRHA 3AI7A 3DMDA 3JXEA 2C96A 3P9CA 2HPZA 2A14A 4I1IA 4JC4A 1QIJA 4PBRA 2YXNA 4MW2A 5DHSA 1ATZA 2QVBA 4U1RA 1CZKA 1QHEA 2VDWA 4G86A 4N8DA 4BMNA 4JOSA 1B8VA 5HVNA 1HKHA 2OMEA 1YOVB 2QR2A 3FGOA 5DRYA 3SLKA 3IV7A 1FRFS 2QN6A 1D2AA 1Z35A 3EXG1 4MVJA 3T61A 1E5TA 1SKYB 3C43A 4UD6A 3WWYA 4KWEA 3W9SA 4Q3CA 4P31A 3R41A 3TEFA 4F4JA 4D96A 2ETVA 2WZQA 3AVWA 2G5TA 1B6TA 1C3VA 3Q5GA 3GJ4A 1UXKA 4YBZA 3GCGA 2PQMA 3EODA 3I4CA 3ZQUA 1IY1A 2W11A 2H2HA 5DO9A 1SUSA 2F8LA 4ZJUA 2OO7A 1SU8A 4Z3KA 3L8EA 1GZ5A 2Y77A 3CN7A 4B1FA 2PSDA 4WN3A 1A4RA 3BE4A 3I9V6 2AFHE 2CXOA 3O2QB 4I1RA 4IXDA 1QH0A 4MCHA 4KQ1A 3A6KA 3OCYA 4KSCA 1QFYA 1U0LA 3M81A 1GTMA 5DI9A 5TQ2B 5I3CA 3L41A 3OKAA 2AFIA 5D87A 1USVA 4YCNA 3LCRA 2H1WA 4EO4A 4PQFA 3L8DA 1JUDA 1W8IA 1YC2A 5AUQA 3TKAA 3TZCA 1Z47A 4X64B 4D56A 3HDTA 2CUKA 3LCUA 3WQQA 1WHSB 1LZKA 2V0GA 5HTKA 1UKCA 3ZXYA 3HXLA 1NDUA 1GSOA 2Q9AA 1DRWA 4HWOA 4LCJA 4MWDA 3QLUA 3CCCA 4L3WA 1WTAA 3A1NA 4MI1A 1ST2A 1L7QA 1Y3IA 4P4SB 4CG1A 3G7SA 3KQPA 4MH0R 4RU1A 4S35A 3AUAA 4DEXA 1I24A 2JAOA 2VZ9A 5ADVA 1P1RA 2W2LA 2G04A 3RAPR 1EUQA 2PUDA 1P7YA 5DT9A 3VI3B 3K32A 4JP2A 4ND8A 3CPJB 5KTKA 4TZ0A 3H86A 3T7TA 2G8NA 5HUHA 4O3MA 1C8BA 1P60A 2I8AA 4MO9A 4C1NA 3AYZB 4KDCA 1M33A 4P4SA 4F1KA 3JVEA 3VPGA 1ETUA 1XUOA 4N7RA 2G0TA 1NW3A 3KR1A 3P9YA 1N5KA 2PPVA 1TQ8A 5FWXA 3P0IA 2IYUA 3ZE6A 3AGPA 3QPBA 4LX0A 4W5OA 3KFLA 1U9CA 5DE3A 3RVSA 1OWNA 4AI6A 1FMFA 3V1MA 4BB5A 3D3KA 4DNOA 5CEJA 3NYRA 4D80A 2NW6A 1NATA 4HG2A 3T7KA 3X1DA 1TF2A 1U7OA 3S7TA 2JIRA 2V58A 3AKCA 1J1UA 3URKA 4FNGA 4J2HA 4TVBA 4UBLA 1EFCA 3VDNB 3C8ZA 2VP4A 3HEBA 4GP6A 3ORQA 3TRJA 4U2DA 4DCSA 1DC3A 4QYSA 2UXDB 3Q40A 3DCIA 4HH1A 1E1NA 3RYHB 4DA8A 2GB4A 2QSUA 2V7QA 2XLCA 2ZRMA 4ZZ0A 1Y8RB 5I01A 3UFXA 4TWAA 1IG3A 1XIVA 1IXYA 4M1TA 2OUKA 4BJHB 5C8YB 3E3NA 2GH1A 5FOQA 3HZZA 1MNQA 1N2XA 4C4RA 1G21B 1SBTA 2HEIA 2H4ZA 4PG4A 3OTWA 4Y7DA 3VH3A 3WK7A 1LBHA 5GONF 1V11B 5A0VA 1D6SA 3JQAA 5EIFA 4E0BA 4O6VA 4R54A 1S9HA 2QLMA 3WXBA 1W36B 1N6HA 4EB6B 4NDZA 1EVKA 1SOUA 1XU9A 2ZW9A 5I7SA 1W94A 3U56A 4F8JA 3R7WB 3AEUA 2HBQA 3L4BA 2FG7C 3LE8A 3OFVA 5HCNA 4Q3BA 1EVYA 3GRCA 1DV1A 1E3WA 3LF1A 3QXSA 4DLUA 4J1TC 4UHHA 2IYPA 4ENTA 1YFZA 1TA0A 721PA 4IIJB 4LWPA 4Y2TA 1S4MA 5ALJA 5JPDA 1MGOA 2I8LA 4D5EA 2YHAA 4OA8A 2JGDB 5KKAA 4RTOA 3B1XA 1PFYA 3FSRA 4Z53A 1AXEA 2VH2A 3ZOKA 4EB6A 2IY7A 2IK8A 4IHJA 2Q3LA 1NSYA 3ZI4A 1Q2UA 2EERA 1PHPA 2L82A 5KVSA 4HAXA 3PT9A 4CUJA 1DTSA 1V71A 2ZRLA 1JX6A 3PR1A 4CKEB 2RK6A 1O95A 4YRKA 5ITWA 1MT0A 4CPDA 3LM8A 2BKAA 3WL8A 1RRVA 1XTUA 4XJTA 4DTCA 1FW6A 3WLPA 4K6CA 5ALOA 2B30A 3IT3A 1YI8A 3PQ6A 2WJIA 1YQ9A 3F8TA 3KWMA 4MYCA 2OO5A 2HU8A 2G9NA 1I36A 5EGNA 2XD9A 2WSBA 3M9XA 2R47A 3JQBA 1XZJA 3H2ZA 4W7HA 4IRMA 5E4JA 1ZD4A 3JW8A 5A9SB 1HLPA 1XA3A 1A77A 2JLAA 1YE5A 1AQUA 2QQ0A 3DONA 1QGUA 3G0OA 1JI3A 3P19A 3GHHA 4FHZA 4KQMA 4MV4A 3OLVA 3VR2D 1PX0A 3TD2A 1V9LA 1XT6A 1V3VA 1OI7A 4IEIA 3VRHA 1PN3A 1XXHA 4QARA 5BSMA 1UBHS 3V4PB 1CWUA 4Z4EA 1OAKA 3OU7A 3LT0A 2VBIA 5T4FA 2YX1A 3K70B 4KSYA 4DCVA 4TVKA 4YDRA 5L6LB 2OXTA 1N36B 5LQKA 2GK6A 4RDHA 3H3FA 3TW4A 5CA1F 3C87A 5FFNA 4ZT5A 1A72A 1G6HA 1IBMB 1N0VC 5K3SA 3ZWMA 2NXCA 3TVTA 4Z3DA 1ZD3A 1HGXA 3PFNA 4GP9A 3DR3A 1P4RA 2P0EA 3KDAA 4V2UA 5E1MA 5HE9A 1JG3A 2PUJA 1EHIA 2WDZA 1DX4A 2XGGA 4QYXA 4RUKA 4E33A 1IHPA 2A9OA 5KMGB 1XEXA 4DILA 1YKFA 4KLCA 4CM3A 2RH9B 4N5IX 4K40A 5F5LA 2ZRQA 4MRMB 2ZI4A 1F8YA 2XMDA 3AR6A 3VR1A 5SY9A 4S05A 4IKOA 5CU7A 4U0KA 2ZYDA 4L51A 2QMYA 1OA0A 2G1UA 3WGTA 3L6OO 4YASA 3ID6C 3C24A 5ERXA 1M2NA 3DL4A 4EF4A 5A7FA 3RVDA 4DIOA 1XZNA 4RKYA 1H2HA 2VRWA 3HTXA 4HYYA 4JDPA 1MX9A 2C4WA 3H2SA 3KKPA 1K6MA 4MMXB 4QDXA 5FI0B 3IULA 1HYEA 5JEEA 1GTRA 4NU0A 3L8FA 4J2OA 3CLRD 3AWIA 5TS2A 5FTNA 2IW1A 1S6YA 2DXIA 3FSEA 4JLMA 5AVRA 4PVCA 3SKXA 3HYTA 3O3OB 4R8SA 4ZI5A 2R8EA 1BMQA 4H4DA 3OQHA 1G9TA 1U3DA 2DZDA 5DYIA 3KQYA 4A03A 5BNIA 1V96A 3OX1A 4C30A 1NW6A 3HJBA 3RV4A 2QW0X 3VV2A 4C03A 3G8AA 2AEMA 2OENG 3KEMA 1TOAA 4JJKA 2ZWOA 3U0BA 2C4VA 2OBFA 1VJDA 2PBRA 4FYKA 5LD2C 2VF8A 4XCVA 2B7LA 1T3TA 3VU9B 1KL7A 3SD7A 3Q3CA 2D5IA 1Z39A 3DOHA 2R8PA 3ABQB 4FCTA 1NU8A 4Q01A 5AICA 1GNVA 2FMKA 3IEPA 3TPZA 3HBLA 1DXQA 3G0DA 4OHRA 1YIDA 3EIOA 5JALA 1B73A 3PR2B 1ODLA 1X3LA 1XE3A 4ZWNA 2Z8YM 5H80A 3RWMB 2HSWA 3ZCUA 2NU9A 2C00A 2Y6UA 1LTHR 4TSFD 1W0KD 3AR3A 3KTFA 2I3AA 3ISJA 1KHTA 5KQSA 1OC4A 3C3AA 4EP1A 2DY0A 4QVGA 2YXEA 1Y98A 4U8GA 2EGHA 4GBED 1KI4A 2JHFA 4IIHA 5LMNB 4BEJA 1M54A 4D81A 3L05A 1U7HA 5KIAA 2EARA 1C7RA 1CTQA 1KY4A 1F1BA 1JQAA 4NBTA 4YCAA 1PT9A 5DYYA 4RABA 1KZ9A 5I6DA 3WO0A 4OK3A 1SC6A 2WD7B 3RAFC 4Y3UA 3VKVA 2X15A 2VF2A 2H31A 4INZA 3T15A 4JXJA 1M1NA 3TL3A 3WG9A 4I5DA 2H4JA 3JQFA 1A8PA 1MQSA 4XIGS 2AWNA 2WM9B 3WV4A 2AE2A 3W6NA 5FFFA 1E9AA 3FPBA 1JQKA 1SKAA 3UQYS 3UJ8A 3QUAA 4GNRA 5M2QA 2B6HA 2ZB8A 3DMTC 1MQ9A 1F6BA 1FF9A 4J9VA 3W06A 2ZZKA 4MGZR 2AOTA 3INTA 1T9KA 5GONA 5LXTB 2QX9A 3SFTA 1SOMA 3UMCA 5DNWA 1DJQA 3MC1A 1G8YA 1TAQA 2CNNA 4KIUA 5ALLA 1OB5A 2ID9A 2PJRA 1GARA 3EUEA 1AKMA 4R98A 5ALKA 2WILA 3ORRA 1LLQA 2K87A 3TOZA 5CCBA 1EUCA 3RKSA 1KWKA 4MUMA 5EXEA 1NMQA 1AQ6A 1E2MA 3E22A 3OZTA 1EVJA 3T3NA 3S2UA 4D3ZA 1QG2A 1S3SA 3GEHA 3CF4G 3KEOA 3KYJB 2E5WA 3OT4A 3JS5A 3MT0A 2CMDA 1KDRA 1X2BA 1XBTA 2QPAA 4XOIA 3UG6A 4TN1A 1ZWLA 1QYVA 2W2OA 5L3SB 3T7RA 2H65A 4MUGA 2YV3A 1TCCA 3LC1O 2DFPA 2J7PD 3BE6A 4ACAA 5BSHA 2PMKA 2JGMA 3B3FA 1XJWA 4Q5IA 2MMCA 1C1DB 5EMLA 1T8WA 1RC8A 2QVYX 2DFKB 1YZVA 3RNLA 3QBTA 4MA5A 4YRGA 2RGUA 3RCBA 3VTZA 3VO1A 1QYXA 3PFCA 1TF7A 3W9BA 2EV9A 4BPRA 2YY7A 2QJRA 4MHSA 2IS4A 3IDQA 4LV5B 3F6SA 1L4KA 4YRIA 2GDJA 1W6UA 4XQEA 3QGMA 2ZRPA 4NMMA 3PJRA 5IFKA 1AB6A 1GRQA 2GAFA 1J2RA 4FDAA 3ON5A 2RHLA 3TZQA 4FINA 2PUAA 3NPMA 4JYMA 3BL8A 5EJ2A 4HTFB 5DI3A 1FUYB 4N7BA 4UULA 4CKXA 3U5TA 1LDNA 3TTSA 5CG2A 4ZU3A 1CJUC 1BN7A 4YREA 2QPTA 2E1PA 4Z7QB 2PRKA 4KV7A 4X8OA 3S4YA 3BHMA 3PQ4A 4L15A 4QOIA 1E2HA 1II0A 3K6KA 5DNVA 4JNCA 4AECA 1Q0ZA 1ULSA 1HYBA 1TNDA 3ZU3A 1BCRA 4TS3A 3U26A 3D4IA 1PDOA 3F7NA 3KCNA 1U5BB 3GXBA 1A04A 4YXFA 5KTNA 2QBYB 3CNQS 3ZE8A 3VR6A 2W8BA 1ZRHA 2XBUA 4HQ0A 2GF9A 1CF4A 1O6GA 1YB2A 4RVNA 4FGLA 4UE2A 1ZN9A 3OKCA 3H65A 4LMAA 4P81A 1D1SA 4REOA 1R64A 4KGXA 1BX1A 3M6WA 1YZ3A 3ODPA 7ABPA 4MPJA 3V8QA 1TTQB 1ZAKA 5KJ6A 4DRXB 3UJ7A 3NAZA 4CTOA 2G5GX 5ITZA 1PQYA 4I81A 1GVHA 1JYFA 4FCWA 3WIVA 3P4UA 2QBYA 4Q9IA 3VTKA 4GL4A 4W5TA 2G5CA 3O7WA 5I7RA 4LDZA 5DBFA 1JWBB 1MXHA 2DM6A 2PXHA 1KOFA 1XEXB 2C8JA 3BA6A 3R0XA 4C4PA 4G0PA 1ORRA 5IUNC 3TNJA 4WUVA 5C8ZA 2P2YA 4ZOBA 2B7BA 4JOQA 4GPIB 4P7KA 5T64A 4CN9A 4O4HB 4WOJA 3TGWA 2Q28A 3Q6IA 4XFKA 3O8OA 4HFRA 1SC3A 3DH0A 1XZFA