4XWAA

Tmk from s.aureus in complex with the piperidinyl thymine class inhibitor with a c5 ethyl-amine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
204
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title A highly potent antibacterial inhibitor of Gram-positive bacterial thymidylate kinase (TMK): SAR of piperidinyl thymines at position C5 and L1
rcsb
source organism Staphylococcus aureus (strain mu3 / atcc 700698)
molecule tags Transferase
total genus 86
structure length 200
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwaA00
4IXMA 5F9FA 3SHWA 4JLBA 4Q4HB 1UPTA 3IIMA 3BGWA 1MRNA 4LJAA 1DADA 2REXB 1E2PA 2WMNB 4YDSA 3CRMA 4C3ZA 1KSHA 3H1TA 4A1FA 1XP8A 2DWQA 3AUYA 4IW3B 3QKRA 2NPFA 4US1R 2G3YA 1LB1B 1PUIA 1XJQA 3SBEA 1J70A 3GMTA 4C7OA 4LHZA 2HJVA 3E5HA 1TEVA 3X1XA 1DPFA 3AVVA 2A5FA 4DLYA 3PCRB 3Q3JB 1JXOA 3MWJA 4LBZA 3VX4A 3TMKA 3TLXA 2FFAA 1DAIA 1MABB 2J5XA 1ZC4A 1XMVA 2ZE8A 1HYQA 1Z0AA 3OF5A 3NBZC 3SZRA 1MO4A 3L2OB 2AD1A 2ZS9A 1R7RA 3GJ8A 2FFHA 2KJQA 3K9NA 4M8NE 1D9ZA 3AUXA 5HZKA 1S1CA 3LY5A 2KBFA 4KI0A 2YWEA 3LQRA 1OYYA 3UKDA 1Q12A 2EQBA 3LBNA 4B6EA 4RFVA 3HYRA 3MAAC 3WMEA 4MRNA 3T61A 3LX8A 3A58B 1S8FA 1R5OA 3KQLA 4OQXA 4JLKA 3K1JA 2JAQA 4RVCA 2AK3A 1IN5A 3SI7A 4R9UC 1L8QA 1W0JD 1NIPA 2VA8A 4UNRA 5AUPB 2HXYA 2Z43A 4MRSA 3QI2A 1HTWA 5GVRA 5E95A 2XNDD 4C2TA 1OIVA 1IBRA 2HCBA 2O0JA 4JS0A 4CDGA 5ELXA 3AEZA 3MUFA 4HATA 5GADl 3GJ4A 3KZ1E 3C41J 1QG4A 3GJ3A 1P2UA 2VH5R 2IYTA 2X8AA 1II9A 1Q21A 4HLDA 5E7MA 3FHCB 3D7MA 2IYXA 2H16A 2O0HA 3NH6A 1BMFA 2AFIE 2RMKA 1EXMA 4YONB 4HUTA 2H92A 5TDHA 4Z51A 1DAHA 1N0VC 2ZI5A 1VG8A 3R8FA 3IIJA 2WJIA 2NGRA 4ON9A 4ZDIA 5M04A 4RSGA 4GFDA 3RRNA 2A78A 3PR1A 1XX6A 1XJCA 5CLLA 2HF9A 3VR2A 4OYHA 4A0GA 4OHWA 3UMSA 4XVRA 3BD9A 4ERNA 1NLFA 2CJWA 3FYHA 3DM9B 3P26A 2OFOA 4JL6A 2B8TA 3MG9A 3PEUA 4LJYA 2QGZA 1F6BA 3DMDA 1HUQA 5KSYA 1YJ5A 2C98A 3FMOB 3PV0A 4Z8YA 5EP1A 2ZRGA 5B2ZA 2IXGA 5C1BA 1RFLA 1G3UA 1FMLA 1GIAA 1KY3A 3AVYA 2OLJA 3AKYA 2ZU6A 2ORWA 2QM8A 1N6LA 1SULA 3AH8A 4LJ4A 5G3ZA 2VP9A 4PHTA 1HE1C 4U5XA 1GL9B 4IHQA 1Q20A 2C77A 5HTKA 3JZMA 2WAYA 1XTKA 5C4GB 2F3RA 4HDCA 1YU9A 1CIPA 2VPPA 1XXHE 4MRVA 1XXHB 2QP4A 1UBEA 2XZOA 3RS7A 3IO5A 2JDID 1KDRA 1LS1A 5KDOA 2QA5A 1S0UA 4LWZA 4HI0E 2F6RA 3ETLA 2WJYA 2PMKA 2NTYC 5G40A 4BFXA 3GLFA 1N25A 2VIIA 2JLQA 1R4AA 4Q21A 3MJHA 1KI1A 4KFSA 1II0A 2PCLA 4BFZA 1XEFA 5F98A 5K8IA 2FEMA 1G18A 2GJSA 2Z6VA 4AURA 2FPMA 3K0CC 2VP4A 2ZVPX 3SJZA 4OJKA 2ZRCA 5K8LA 1ZVQA 2GXQA 3EIEA 3ECCA 1X6VA 1E1RA 3AKCA 3H4MA 5KTYA 2GXAA 2GCOB 4DEYA 3VKHA 2A30A 4OHXA 2WVJA 3DVLA 3FPAA 1IY0A 1VG0B 1ZMXA 4RY2A 4X8OA 5CJPA 1Z47A 3AF3A 2QE7A 3EWAA 4FXPA 1IHUA 2QT0A 3OHMA 4V0KA 4WA7A 1U8AA 1E32A 1RJ9B 4IFEA 2NMVA 1NJGA 4XTCS 3UANA 5JCZA 4BLTA 4FWTA 1G7TA 4XH9B 4UNQA 4CEHB 1D9XA 4WZ6A 2BJVA 4I1UA 5CIWA 1R5BA 1XBTA 3Q9LA 3CF6R 1TQDA 3JZAA 2GILA 4O2RA 5D3QA 4JJZA 2J3EA 4QJ4A 3HDTA 2H8KA 2WWHA 1TMKA 3MWKA 1M7HA 2BKEA 5JI3E 1OHHD 2IWHA 3K0AA 1RVDA 4B2PA 2JA1A 4GL2A 4ARZA 1NN3A 1X8LA 2D2FA 3QUSA 5J4HA 1JQLB 2BV3A 1D2MA 3LBHA 1Z07A 4OJQA 2ZROA 1C4OA 4WZAE 1T4GA 3E70C 4TTRA 3VMFA 3PVSA 1DARA 1KKMA 3B1ZA 2BCJQ 2JEOA 2IS6A 2XITA 3NKVA 2XXAA 3UIEA 2QUZA 4GSYA 2HDNB 2ZUBA 3OAAD 2BMFA 1JBKA 2ZI7A 3GEIA 4HEJA 4M1KA 3RS2A 3U6BA 2O8EB 4G5SA 4QM6A 4CGZA 5FPHA 4BRWA 1GZSA 2CL6X 1TQ6A 2Q9AA 1MO5A 4II7A 5G3YA 4TTQA 4DXAA 1G7SA 2V55B 4TYPA 1EWRA 4C4PA 4DSUA 5FBVB 4OHVA 5JLJA 2RKOA 2BBSA 3X2SA 5HKKD 2W6ID 3BB3A 2ZI4A 3GCGA 4H1VA 4B75A 2OT3B 4Z8XA 1IXZA 2NO7A 4D25A 1PVOA 5F3WB 1HQCA 1SVWA 1X1SA 3DZDA 1XDBA 2OBMA 3RWOA 2ODNA 4D80A 4D0LB 2FN4A 1AZTA 2QAGC 2XX3A 2YC4C 3AP3A 4X8MA 2FSFA 3C8UA 1PLLA 4Q7LA 3TSWA 3RRMA 4LHWA 3LRPA 2QPTA 4Q19A 5DYGA 1NMXA 3ZQJA 3TW8B 3AB3A 3MWYW 4L9WA 4O0MA 4PO9A 4EAQA 2W0SA 1D5CA 4NYIR 5IT5A 4D82A 2FV8A 4I4LA 3UXMA 3J81k 2HXSA 2QNRA 3PEWA 5L3QA 4AG6A 2IYLD 1ZM9A 3S1AA 1G41A 1E9EA 1Q44A 1G17A 4U00A 2QQ0A 1R10A 2P3SA 1E0JA 2C9OA 1D6JA 4JZKA 1E2HA 5DI3A 1FW6A 1Z2AA 2HLDA 3O8CA 2IYUA 1S3SA 1J7KA 2JLXA 1J99A 2FGJA 3V00A 4TZ6A 4KVGA 4LY6A 3K8YA 3FVQA 3K9HA 1JJVA 1X8KA 2ZYUX 4M9XA 1Z6XA 2WIBA 4GZLA 4JMPA 1E2FA 3WNDA 4ZCMA 1W44A 3WRYC 2GF9A 2TMKA 4LYHA 4HB2A 3K9GA 2OCPA 4FCTA 5AK0A 1AQYA 1HT1E 1QHGA 1W49A 2FA9A 1Y63A 3U7FB 2WICA 4HUQA 5FUWA 2F55A 1G291 4TSFA 3A8TA 3TRFA 4A2PA 5CYPA 3BC1A 3LX5A 4BFYA 3IEVA 2OO7A 1FTSA 2Q3HA 4A9AA 1Z2CA 2V4ZA 1ZUIA 4E09A 5AUNB 2JJ1A 1LF5A 1M34E 4QJ5A 1W1WA 4R2IA 1EK0A 2PEZA 2WJGA 5KU1A 2VHQA 4LYAA 1E2LA 1CJTC 2ERXA 3KJHA 3K70C 2ANBA 1N6NA 5CIQA 5HZHA 2DFTA 3ADKA 2PT5A 3GLHE 1ZD1A 3GLHB 1YR6A 2WIAA 4P4SB 5H8WA 1G4AE 4PX9A 2Q6TA 3ADCA 1E2NA 4URWR 2GXSA 1LVGA 4G5OA 3W6NA 4M9QA 4RD0A 2EYQA 5EZ5A 3EASA 3T1OA 1IQPA 5BW8A 1XD2A 3CIOA 4B6FA 4AKIA 1SZPA 1IM2A 5CM8B 3W90A 1ZM7A 3LLUA 3GFOA 1U0HC 1CJMA 4JYBA 1QVRA 2NZJA 2X77A 4NTZA 4BFTA 3F0TA 1FX0B 2MSDB 3QPUA 1E9SA 4JKYA 2AX4A 5FOUA 2C8VA 3K0SA 3AKEA 4B32A 2XGJA 1U9IA 4RD4A 1F2UA 4EUNA 1G3QA 4I99A 3RANA 1EESA 1PZNA 1FPMA 1U99A 4HLQB 4MRRA 3RYTC 3HPRA 4MGYR 3U3KA 1A1VA 1R0YA 4QHTA 3TQFA 1PLKA 4BLSA 4NYIQ 3IO3A 1M7GA 1YHNA 4PQRA 4JT2A 1OJLA 3HJNA 4HB0A 6Q21A 3DO6A 1E9RA 5J5CA 3CRRA 4CRWB 1G64A 1W0KA 3F8TA 3KKMA 4N1AA 1NG1A 5E3HA 3CR8A 2VQSA 5EE3A 2O8FA 2DFKB 2DR3A 4G3XA 1TADA 4ZPXA 3L8YA 4KFUA 4L16A 1NJFA 1KJZA 1WDTA 4LHXA 4XD7A 5HCIA 4DT1A 4DDTA 2IHBA 3U4QB 1YR7A 2A5YB 1F2TB 4D4MA 1WP9A 1G5RA 5KPDA 1F48A 2ZRMA 2J87A 4MITA 4FWIB 2QSZA 1Q1EA 4Q1EA 3KFVA 4RD3A 1E1RD 2QSYA 1JAHA 2WWWA 4PQYA 1VIYA 3GLGA 1NSFA 1B0UA 3ZLJA 4IEIA 2ZSAA 2P65A 3WHLA 1T3HA 2QE7D 4LPSA 1G16A 3QKSB 2E87A 1GM5A 2G1KA 4KJZA 1DELA 4EJSC 4HDQB 2C04A 2BIFA 4NHOA 3BH7A 3SR0A 3LD9A 5C46F 1OKKD 4W5HA 4XVQA 2VHUA 4KV9A 2A5DA 2IF2A 4FMCB 1CTQA 3AF0A 4PO8A 4UJ3A 1SVIA 2PLFA 2EFDB 4NCIA 2C96A 3KTAA 4TLBA 1N5LA 4DIDA 1HH4A 1OB5A 1NN5A 2ZI3A 3HU1A 4JLJA 2WWIA 1F60A 2QQEA 2RGXA 4V0ME 4DCUA 3AF4A 3PG5A 4D6PA 2GJ9A 1VCMA 2CHQA 4DVGA 1Z06A 3T5GA 4JLNA 4ZDKA 1DG1G 2EFCB 1Z0JA 4C0JA 1DG3A 1G8FA 2WSSA 5JWHA 4Q1DA 1SGWA 4Q7JB 1ZIOA 5SZIA 3VHLB 4A8JA 3IQXA 1GDDA 2R6GA 1EFTA 1ELOA 3UWKA 2Q21A 1Z83A 1E2DA 1A2KC 3QXJA 3VKWA 1TU3A 3LVRE 4KU4A 5JCPA 1G7RA 2GF0A 1YZKA 4BLQA 1QF9A 2ZR9A 4NCKA 1NN1A 4TMZA 1MKYA 3QBTA 3T1QA 2O52A 1ZNZA 2EVWX 4R2HA 4ZDJA 3BK7A 1T6NA 3I72A 5EXTA 3RAPR 5DO9A 1NVVR 5BN4A 4NYMR 2AHOA 4MUAA 2F43A 1FQJA 4PSKA 3CNOA 3NWJA 4A15A 1G3RA 2XSZD 3BIFA 2J1LA 1KJYA 4UNPA 5AUOB 3U6KA 4MH0R 3U5ZB 2QBYB 3CRQA 4M1TA 2JCSA 1KNQA 2A3RA 4WIAA 4CZ2A 2VP2A 2J7KA 2HEIA 5IDVA 4DLWA 4CEIA 3IIKA 3C4JA 1HA3A 1VCIA 1KSJA 1N6RA 3VU9B 4BFSA 1UFQA 4XWAA 4DKXA 2R65A 2D74A 2JJ8A 4US0R 3NBYC 1BS1A 4RD2A 3AVPA 2XAUA 2ZU0C 3QF7A 2FZLA 2GVZC 4KXFB 2WOOA 3UWOA 1ODFA 1ZINA 5LDDC 3CWQA 5DISB 5BN5A 1N5KA 1E6CA 1KAGA 4PC1A 4LSGA 5CK4A 1AJEA 3U2QA 3EPHA 4JVSB 2IHYA 4LV6A 2HCJB 3Q8XB 1G7CA 1H65A 3KFXA 3SJAA 1P72A 2OSBA 1Z6YA 1NSTA 2P6UA 2HLDD 1UADA 4WAUA 1XF9A 2O8BA 1W48A 1WE2A 2BKUA 3NC1C 4QGFA 4WXRA 5EXXA 2O8DA 1Z3IX 2D2EA 2FX3A 1VECA 3DKVA 5JWRA 2XB4A 4BFUA 3MWLA 2QG6A 3TIFA 4M4SA 3A1TA 3REFA 4B48A 5TMPA 2ZI6A 3TH5A 3WMFA 4YQFA 2JLVA 2ZXUA 3K0FB 2O8CB 2CK3D 3LLMA 4DUGD 2Q0HA 2VYFA 1MO3A 2WZQA 5FBWB 3WYFA 1TNDA 5AJVB 2NG1A 1IXSB 1LS6A 3GPLA 1UEIA 2JJ1D 1QHHA 1W4AA 4FI3C 3QOFA 4JLOA 2IUTA 1JQJC 5A0FA 4FMDB 1R5NA 2B8WA 1NBMD 4XWOA 1KNXA 4ILEA 1G8YA 3IHLA 3BFVA 4Q66C 4QKQA 1ZD8A 4V0OA 2GKSA 3I5XA 3SJBA 1E2QA 2W6JA 1NNEA 2I1QA 1G4UR 2J45A 4DDWA 3SS8A 2CE7A 2WPDA 3ZZ0A 5F2EA 2J9RA 3SHFA 3U44B 1GP2A 3PUVA 4MUBA 4ZKEA 4ASUA 5JS7A 1NVVQ 3OE7A 1E0AA 2GNOA 1XPUA 5FL7A 1OFTA 1YE8A 2H18A 5SZHB 4V02A 4XIGS 3ZDQA 2JLUA 3L0OA 4GRAA 1AIPA 1XMSA 3BOSA 5JEEA 2FWRA 2OM2A 2IK8A 3PITA 3QKRB 4TLDA 5DN6D 1IY1A 4IJMA 4DIEA 4DWJA 1Q57A 3KUDA 3R9IA 3OIUA 1H8HA 4YXWD 1XPOA 1E2EA 5H70A 3QG1A 4UNNA 2HYDA 2OXRA 2WHXA 4LJ7A 3SE0A 2ZIAA 4URXR 1T3LA 2UVQA 1R0WA 1XD9A 2QN6A 3EIQA 5DNYB 1KI3A 1SXJE 2R6FA 2ZJ5A 1D2EA 1I2DA 2OCBA 1A7JA 2IW3A 4Q00A 3NEYA 4KAXA 3TJZA 2P6RA 1PJRA 4HLUC 4TMTA 3EZFA 1DAMA 3Q5EA 1P62B 3V9PA 1UDXA 2ZYVX 4QJ3A 1XFAA 2J0VA 1SKYE 2WAXA 1SKYB 1U94A 2PZFA 4MKIA 5EUQB 3QVUA 2IC5A 4LJ8A 4PFSA 5CYOA 5FOSA 2MSCB 3SFZA 1VHTA 5FPKA 5JEDA 3KKQA 2FDCA 1SVSA 5SZKB 1CU1A 3BXZA 1OPXA 4BGDA 1E0SA 2CLSA 1SXJC 4DB2A 3KB1A 2XTZA 1VMAA 4ZIRB 5LD2B 3L0PA 3KXLA 4JVNA 3F5FA 3O8DA 3FB4A 1ZYUA 2GESA 3B85A 3NIBA 2FSHA 1UJ2A 4XD7D 3I5YA 2F1IA 3RWMB 1GILA 3I61A 2JLWA 2D7DA 5DYIA 1EGAA 1NMZA 4D81A 3QE0A 4Q1FA 4JL5A 121PA 1W36C 3BS4A 3SQXA 4HLUA 1GKYA 2IYZA 2VBCA 3ZIAA 4Y0VA 1EFHA 4LRWA 1YZNA 1S9DA 5L8VA 4Q4LA 2ZI9A 4PANA 2JLYA 5HE9A 2DFNA 1X86B 3A1WA 1Z8FA 2J0SA 4I1VA 2CCJA 4LUCA 3CKLA 3ND8A 4A0FA 3WXMA 1TQ4A 3THXA 3AVTA 1CP2A 1E9CA 4RZ2A 1SKQA 4K46A 5JI2E 1DAEA 1P75A 1XU4A 4B34A 2ZYWX 5BYJA 3WP1B 1I2MA 4Q48A 5FTMA 4W9MC 2V54A 1DTSA 2CCKA 3RNLA 3D6TB 4Q4JA 2CXXA 4JBYA 4Q4AA 2GVDC 1W46A 2CJWB 2QORA 3R7WB 4DJTA 3DL0A 2B7CA 2ZVQX 1JJ7A 1GKIA 4FD2A 2H17A 3CB4A 3RVBA 8OHMA 2GRJA 4DLUA 5HR5A 3CX7A 3C14C 4BWYA 2R6CA 4TYQA 3OIYA 5KNBA 1XEXA 2R62A 4DC9A 2XZPA 2J7PA 4YLGA 1P60A 3DOEA 2VSOA 3ZQ6A 3DHWC 4KODA 2WSSD 5AUQA 3FFBA 4HAUA 4TL7A 5A5GA 4XSGA 1KO7A 1GVNB 5FR2A 3K0EA 4TLEA 1UEJA 1CXZA 1XNJA 1NN0A 3LO5A 1WBBA 1Z0IA 4CW7A 2IF0A 1P7CA 2H1LA 1FP6A 4PC2A 1Z5ZA 2OAQ1 4QNRA 2Y8EA 4JKIA 1R6BX 1XMJA 1NLZA 4DZZA 3VNUA 4C0QC 4M1WA 2IYWA 1TAGA 2O5VA 1MRSA 4CT5A 3GLFB 1ZP6A 1VYUA 2PJRA 1W5TA 4EIWA 4ZKDA 2N42A 4I81A 1HT2E 3SEAA 3AGQA 4JL8A 2J41A 5J40A 5DE3A 2A2ZA 2ZJ8A 3B60A 1UBFA 2PH1A 3T1TA 4Q1AA 2FFQA 1OW3B 2QMUA 2GTPA 1KZ7B 2CMKA 2GHIA 4A4DA 4EKDA 4I1SA 2D3WA 5AJXA 1OFUX 1S3GA 3BFKA 1N6KA 3CRW1 3T15A 1EG7A 1UAAA 3QF4B 4Q5IA 3UATA 3EPLA 2QTFA 4LYJA 4PAQA 1TQ2A 1RC8A 1WBDA 3Q72A 3TW4A 3A1VA 2I1VB 4JVLA 4DDUA 2Z4SA 3WBKA 2V7QD 2NO6A 4GPTA 2F1JA 3W5JA 2AXNA 2IS1A 2ZANA 3RRZA 4DCNA 1YZUA 5GJCA 2OV2A 2BDTA 1U90A 3F3YA 2D7CA 1OXSC 5CDFA 2ODEA 3SN6A 4TMXA 1GL7A 2ZM5A 3FKSD 4RZUA 3EPKA 2HUPA 5TV2A 1LTQA 1FUUA 2R9VA 3K09C 4GZMA 3SYKA 3KQHA 2QI9C 1FFHA 3L8ZA 3Q7PA 1GRNA 3BH6A 5JFGA 4ARZB 1PUJA 4EQ6A 4LZZA 5B30A 4D4KA 3E1SA 1CR1A 1XD8A 2O0KA 4LC0A 4TWZA 2BMJA 1OLOA 2OBNA 3HP1A 4MQBA 2DWOA 4OHZA 2ZRKA 4QOSA 5C2JB 1E94E 1GOTA 1LV7A 3TUZC 1Q3TA 5EQTA 3OEHD 2GCPA 5E4FA 3PQCA 2GZDA 4AG5A 1E96A 2J0UB 1UKYA 3JVVA 3RHFA 1ZM3A 3O47A 1KMHA 3T35A 1ZAKA 3K0CA 4DSTA 4J0QA 4AC9A 3RRYA 2OFWA 4DDVA 1VYVA 2WOJA 3U3RA 1OH8A 5DIFA 1UKZA 2W6JD 1KI2A 3TSOA 3P4YA 1ONBA 4TQAA 3R9WA 2Z0MA 3A4MA 3V4RA 2G77B 2VP6A 4L15A 4HAWA 4EPTA 2QMHA 3BH0A 3ZD6A 2ZSEA 4XVUA 1Z6TA 2EWWA 2R44A 3BRWD 4OBEA 4ASUD 3VQTA 5A4JA 4LBYA 3OE7D 1ZC3A 3LW7A 4ACAA 2QRZA 3U60B 4G01B 4FCVA 4PC7A 5IHPA 4TLCA 4LHVA 2H7VA 4GI7A 1NF3A 5CB6A 2ZRPA 3FOZA 4QHYA 2FPLA 4NL4H 5FOXA 5JSZA 2OILA 2Q9BA 2P5TB 5DI9A 1W4CA 4GBMA 2GCOA 4JLDA 2XNSA 2BEJA 1D8TA 2DCUA 2FH5B 3B9QA 3C5CA 3PENA 4P4UA 3PFIA 1H8HD 3BBPA 3I3SR 2QROA 4Q9IA 1CR0A 4P32A 2JJ2A 1G8GA 5FBLB 5L3QB 4M1YA 4URVR 1RJ9A 1CKEA 1LW7A 3C5HA 5D3MA 1JNYA 4DEXA 2KE5A 1NKTA 3KX2A 4MYCA 2QPAA 5DI3B 4RZ3A 4LBWA 3I4LA 1RW4A 3SNHA 4QGHA 4M53A 1E2IA 4LJ5A 4D4LA 1GRQA 4NH0A 1X8JA 2C95A 4OQMA 5J4KA 3MSXA 221PA 3GLIA 3Q7QA 3GD7A 3AVUA 2QPOA 1FL9A 2YWFA 3PUYA 4CEJA 3CPJB 2J46A 1LF0A 2BM1A 1DE0A 2WJVA 2XOKA 4AYTA 4YMVA 2FF7A 1N5JA 3CH4B 5IF9A 1ESNA 4HUQB 1KI6A 3QVVA 4UXIA 1E4VA 2KWIA 4NCJA 3TAHA 1E2GA 4IVPA 3SBDA 2ZRIA 4DCSA 3CLVA 1ZD9A 3GJXC 4R98A 1IN8A 1Z22A 2P0EA 3FKQA 4RCZA 5KSPA 2ZS8A 4ZI2A 4MYTA 4LHYA 5JS8A 5JWOA 1GTVA 2VHJA 3FHTA 3EC1A 5KNDA 2ZE5A 1NBME 2ZE6A 4AYWA 1TEXA 4RKFA 5BWMA 3AVWA 1KI7A 4TT3A 2QAGA 1JAIA 3ICEA 1FQKA 1V43A 4KBGA 2OE2A 2DBYA 5JECA 3M0EA 3QSYA 1YR9A 2VF7A 3CM0A 3WNCA 2A5GA 4A92A 3W8NA 1OIWA 1P2TA 3QPVA 3AKDA 1RPZA 2OEPA 2XEXA 1XD2B 1XTSA 1IJEA 1GNRA 5J4YA 1YRBA 4HAZA 4L4UA 4W5WA 4EFNA 1N6IA 3B78A 1S96A 1US8A 4HDOB 4B44A 4OHYA 2BC9A 3MJRA 3T12A 2GEDA 3CR7A 4M21A 3WMGA 1I4LD 5KYKA 1E9FA 1SVMA 2PEYA 2GEVA 3OIVA 1GAJA 2ZJ2A 1RZ3A 4IOMA 4JIMA 1F2UB 4LCBA 3TQCA 1OFHA 4TMKA 1RIFA 4NZYA 4EPXA 1P2VA 4M2LA 2IEZA 2X1VA 5JJLA 1RKBA 1Q3HA 4QRHA 3IUYA 4IRUB 1WXQA 2J7PD 2PZEA 1BMFD 4A2QA 2WSMA 3A1UA 3NBXX 3UG7A 3EA0A 1OE0A 1P5ZB 3KKPA 3QQ5A 3ZZUA 2GK7A 3QPWA 2QM7A 4BECA 2R2AA 2WWYA 3QEJA 3OIWA 2W83A 5G53C 4A0HA 1X3SA 4PHGA 1V5WA 1WQ1R 1Z6AA 5FBRB 1Z29A 4E5UA 3PUXA 2EW1A 2RHDA 4EPVA 3FE2A 1XB2A 1R0ZA 2IS4A 1FOEB 1XEWX 2O8FB 1VCOA 3CPEA 2VEDA 1KI9A 2A9KA 4G5GA 4QL3A 4IDQA 3D31A 1J8MF 4QBHA 2GWHA 1DBSA 4UXJA 2YOGA 2C2HA 2JASA 1NVUQ 4IOJA 3AVXA 1JEDA 4F4JA 3C7KA 2ZSFA 4NPHA 4A6XA 1BYIA 1QHIA 1T3SA 4UXHA 3CNNA 4HZIA 4Q02A 4IVQA 4PC3A 1KK3A 1E69A 1W4BA 3ZS9A 1YZGA 4BLRA 2N46A 3LV8A 4POAA 1IN4A 3P4XA 3P1JA 1JALA 2QMOA 3GLGB 4LYFA 3A4LA 2GCNA 4M0LA 1FUKA 1DAKA 1G1MA 2WJJA 1N0UA 4IDOA 3ASZA 2JLZA 4MGIR 4PXAA 4EFLA 2V3CC 5AJWA 4MGZR 2YOFA 3C16C 2WBLC 4ZCLA 1NP6A 5F9HA 4PZZA 3CO5A 2C99A 4JT4A 3ZVNA 1CJVC 1E9DA 1G3IA 3CZQA 2L0XA 4GP6A 5JHHB 3DMNA 4CT4B 4TLAA 3CUEF 3RS4A 1KO1A 1G21E 2E9SA 3LWNA 3NDPA 1GKUB 5KNCA 2QU8A 5SZJA 3PEVA 1GFIA 4LV8B 3KTAB 3WNBA 1YR8A 3HWSA 3OEEA 3U3OA 4XOIA 1UM8A 1WA5A 5JJIA 2PBRA 2RGCA 1ZU5A 4H9GA 1J2JA 4BQSA 1HEIA 5C18A 3W8RA 3B1VA 3M6AA 1CLUA 1U98A 3THWB 4BZPA 4MKGA 4DLVA 5KOYA 4O3MA 2G9NA 3GEEA 4EFMA 4A8JB 3X1DA 4CIDA 3I92A 2YOHA 3BORA 2ZQ5A 3QXCA 5JRJA 3MFYA 3GP8A 5EP2A 4FMBB 3MCAA 4PZYA 1KAOA 2CEAA 1ZJ6A 2H5EA 1QVAA 2KBEA 2ZAMA 1Z08A 4I1OA 1OXTA 1ZW6A 1CR2A 5DH9A 1R2QA 2GBLC 1I4TD 3ZVLA 4DSOA 1KGDA 2CHGA 2FSGA 3FWYA 4OL0A 5FFMA 3LXXA 4PZLA 1EX7A 1SVOA 2ODBA 3N2IA 5C4MA 1JR6A 2G6BA 4S35A 1E9AA 1A82A 2YNMA 3TSZA 1P73A 3B1YA 3VR6A 2R6DA 4Q7MB 1XTRA 4Q1CA 1EX6A 1W0JA 3HU3A 4M1SA 4M1MA 3B9PA 5FI1B 1W36B 2ZRJA 4FMCF 4TTPA 5H1YA 3CH5A 4EJSA 1KK2A 2C5LA 4AKGA 1AKYA 2XNDA 4C2UA 1U8ZA 2G83A 3CF0A 2EU8A 3GFPA 4RD1A 2GZHA 4F92B 4TZ0A 3ADDA 1BO6A 1E98A 1XZPA 2GBLA 2OCYC 4UJ5A 3LNCA 4D0GA 1ZNYA 3QY0A 1KDTA 1JR3A 3G5UA 4F7WA 3T1VA 2VF8A 2GK6A 1F3OA 4HZUB 4WW0A 2JJ2D 4RFSB 3CX8A 1IOZA 5E7JA 3WYGA 4IOLA 1EWQA 2NPIA 1LFDB 2MSEB 4HAVA 1FNNA 3CONA 2FNAA 4U02A 4M9ZA 4LGMA 4ACBA 4GOKA 4GDFA 2I3BA 2O8DB 2O8BB 2QTHA 2WWGA 4Q01A 2NO9A 2D06A 1KO8A 3CNLA 4TQ9A 3TBKA 3R8CA 1J8YF 4JLVA 4OI4A 3W6PA 2FFBA 3B6EA 3CF2A 3HU2A 1GUAA 2OZEA 3LQQA 4O25A 2ZJBA 4MKHA 4V0MA 3PEYA 1M74A 4P3YA 2OCAA 1TX4B 2VHTA 4WBSA 3OFNA 1E1QA 5FR1A 2CNWA 4O2LA 1U0JA 3AP2A 1A5TA 2DHRA 4K81B 5JMTA 3U7GA 3P20A 1KI8A 1QHHB 4Q7KA 4GOXA 3DM5A 2OAP1 5UKDA 3RSOA 1NVXQ 3D8BA 4DLSA 1BYUA 1AS2A 3T5DA 4FCWA 3PIRA 4TT3D 4P0TA 3P27A 2Q3FA 1KSGA 1UBGA 1W2GA 5J4VA 1NG9A 2HF8A 1A2BA 3IKJA 1GRRA 1L7VC 2V6JA 2CVHA 3EXAA 1ANKA 1YZQA 3B7GA 3EC2A 4TSFD 1OSNA 2LCFA 2FGKA 3UMFA 1KJWA 3KXKA 4Q47A 1IXRC 5KSZA 4QXAA 1FP7A 3FMIA 2UZIR 3EWSA 1G19A 2IS2A 2R8RA 4PPQA 2XJ9A 4HLCA 3I73A 1L2TA 1Z0DA 2IA5A 1M8PA 1U0LA 1FMJA 2PL3A 1OFIA 4PR0A 1QG2A 3B82A 1DO0A 3LFUA 5L3SA 1W4RA 4TQUS 3ZD7A 1W7AA 1KO4A 1OXXK 1KDOA 4AKHA 2VP0A 3VNVA 4FIDA 5JHGB 3AF1A 1DOAA 1ZRHA 2PX3A 3DDCA 2F9MA 2GA8A 1WMSA 3B2EA 1G3MA 2AR7A 3NDBB 2ZEJA 1M2OB 2BHRA 4NYMQ 4LI0A 1G20E 2Z83A 4FMDF 1COWA 4KLZA 3ZGXA 4OI1A 3W34A 1MR3F 2F7SA 2V6IA 2IEYA 4IDPA 821PA 2BJWA 2GEUA 3N5CA 3X1WA 3N2EA 2GJKA 3U7EB 1KIMA 521PA 1Y3AA 4DLTA 3K70D 4C7OB 3IBGA 3GQBA 2VHCA 3K0FA 3KJEA 2IYYA 2Z5FA 3DOFA 3QJYA 2D62A 4E22A 4R71A 4DCVA 3X1ZA 1LY1A 4D4JA 2H57A 4NE2A 4EPYA 4EPWA 2CVFA 2BBWA 1Q0UA 1K6MA 4L8GA 4PSVA 1CF4A 4TMWA 3SYNA 3OAAA 2ONJA 3THYA 3EZ2A 1C9KA 3VX3A 2W58A 1XCMA 2ZSDA 1W0KD 4NDZA 3EZ6A 1TUEA 4U7DA 4XTRA 1G6HA 2JLRA 3KB2A 3L0SA 2AWOA 4MRPA 2DB3A 1VG9B 4QBGB 4C0BA 4CEHA 2EFHB 1IJFA 1RRGA 3U44A 1GITA 3TNFA 4F93B 3SQWA 3RS5A 2E1RA 2ZRBA 3QXHA 4PPGA 3WRXC 4Q4JB 4JSTA 1X1RA 5EJEA 4KITB 4Q4AB 4TYYA 4AK9A 1OXUA 5JJKA 5TY0A 3NBFA 2BMDA 4FINA 3VHXA 3TVTA 4AIIA 3OEED 3U3MA 2Q3MA 4FW9A 1JPJA 1XEXB 2RGAA 2ORIA 1AK2A 1TF5A 2YC2C 3V4FA 4NYJR 4KSCA 1G6OA 3EIHA 4OK6A 4OQNA 5LD2C 2EYUA 3RC8A 1K5GA 1T91A 1CEEA 3IPXA 1P9WA 2FSIA 2YWGA 1AGRA 3KUCA 3NG1A 4FN5A 1QHNA 4B2LA 2GJ8A 5JBQA 3KQUA 1SXJA 3MD0A 4Q03A 3CPHA 3H0KA 2PLRA 1TF2A 4JJKA 5FBQB 721PA 3HPQA 4D26A 3R9XA 1II8A 2FOLA 3LVQE 5FTJA 3UK6A 2ZRDA 3NHAA 2AWNA 1GWNA 1SQ5A 2ZUCA 2NZ8A 3IILA 3TE6A 4Q4HA 5LPNA 4AWXA 1HV8A 1ZIPA 2GAAA 4N0DA 3EAQA 1KOFA 3ZVMA 2CL0X 4B3FX 4K8OA 5EE9A 2IL1A 2PMDA 2VL7A 4B43A 3FDIA 2GAOA 1SHZA 2ODWA 4KHZA 3ZZTA 2IXEA 3MMPA 4JLAA 4ZIRA 2JLSA 1RRCA 3CWZA 3FMPB 2RB4A 1W47A 3LBIA 1MABA 4UNSA 5TARA 1N6OA 4V0LA 3B1XA 5EXPA 2ZAOA 3SC3A 4WOPA 2XTMA 4LC1A 2WV9A 1Z0KA 3TR0A 1YKSA 4Q9JA 2G88A 3SU8A 1ESMA 1U8YA 1IY2A 3UG6A 2AFHE 2ATVA 3UPUA 2ZYTX 3FFAA 4BZXA 4RZXA 4IKEA 2KB0A 1T0JB 3SDZA 3L82B 4BFWA 2PCJA 1KMQA 1JR3D 4B33A 4S2EA 3GLFE 4IVRA 3KDSE 3LW8A 1GL6A 4URYR 2OESA 4C0KA 2FZ4A 4HYYA 1NRJB 2ZRAA 4Z1MA 5CDFE 2ZETA 4B3DA 4Y0AA 5CM9C 4G5QA 1QDEA 1XJ0A 1E2MA 1M1YE 1VKJA 3CBQA 4GT1A 2V9PA 3FHOA 3PJRA 3KJIA 1QHSA 3R7WA 4LV5B 4URUR 2WJHA 4MKFA 3KL4A 2ZJYA 1GSIA 2V1XA 5TXGA 5EE1A 3SJCA 4TYWA 1HY3A 1CJKC 2BBOA 2AK2A 4EQ6B 1OB2A 1LNZA 4GNKA 5CLQA 2OFXA 3VAAA 4QG7A 3G0HA 5KHOC 5DHAA 2N1BA 5HCNA 2G0NA 2IWRA 1QHXA 4H1UA 3HYTA 4JLMA 3NH9A 3OFND 1E1QD 3SFVA 2YV5A 5B64A 3AM1A 2CNWD 4V0NA 1T9HA 2FMXA 1AA9A 3A4NA 4P31A 4NYJQ 5EE5B 1NMYA 5KO2A 5AWFC 2C03A 1KMHB 1JPNA 1NI3A 4OK3A 3AVQA 4WZBE 4WXPA 1FZQA 1Q1BA 2GXUA 5GVSA 2QP9X 2WWXA 4X8LA 1EFRA 4ESHA 3TUIC 2WMOB 1CRPA 4QGGA 5FOTA 3K0AB 4BLOA 4KLNA 2PJZA 4QC2A 4DLXA 2X19A 4JVMA 1XZQA 4B47A 3D3QA 1B23P 1D2NA 4TN1A 3MGCA 4BFVA 4B71A 2KSQA 4G5RA 2B6HA 3I8SA 3KKNA 1E3MA 3CX6A 3WY9A 5HPYB 1CJUC 4UKDA 3NEJA 1NL3A 2FU5C 4IXNA 2FE4A 2JGNA 4PO1A 4YMUA 2XXAB 3CW2A 3TAUA 2DWPA 4ABYA 3VR3A 4KVAA 2QTVB 3QEOA 5TVKA 1H8EA 3U7HB 1N6HA 5JSZB 4N0EA 1TF7A 2AD5A 2C9CA 5H68A 3T06B 4IFBA 1VIAA 3KJGA 4DBLC 5FUVA 1XXHA 1OYWA 2A5JA 1XCPA 3K53A 1AN0A 1N0WA 2YINC 1AQUA 3K09A 3QF4A 2WKRA 2A7QA 3RC3A 1OF1A 3ZJYA 4B3GA 1W2HA 4M9SA 1OXVA 1E4YA 1VYTA 5D3MB 4GMDA 2PZGA 1MV5A 1RYHA 2WPDD 5AR1A 5FTNA 1P6XA 2IT1A 1KI4A 2ZJZA 3LA6A 4Q9LA 1OKKA 1JEEA 4PQFA 4PAMA 1KK0A 2GDJA 3IPYA 4PAOA 3GLIE 1T8TA 1SVKA 2F3TA 1S4QA 2EWVA 3GLIB 1COWD 5FL7D 4B73A 3BERA 4IOKA 2CBZA 3FGNA 4DB4A 3ZYCA 4AKEA 1P2SA 4CEJB 3HR7A 4RJLA 4QFMA 3NVAA 2VTKA 3BJIC 2BEKA 3BWDD 4NBSA 3ADBA 1KI6B 4IEEA 4C0LA 3AGPA 1E79A 4R7ZA 2CCGA 1BH2A 3WHKA 2JIZA 3S1AB 3B5JA 2ZS7A 3TGPA 5IRCD 2DPXA 3GJ0A 1BKDR 2QEQA 1MH1A 4L5BA 2J0UA 5EP3A 2CDNA 3Q5DA 5KSOA 4ITRC 2C9YA 2G1JA 3PUZA 1RYFA 2WWFA 2QAGB 2EFGA 1VHLA 4DLZA 4LOAA 2ATXA 2B21A 3WBJA 2WTUA 2QENA 2ZREA 1E2JA 2QT1A 2ZJAA 1KY2A 1CULC 3IQWA 2XSZA 1ZNXA 3N70A 4TMVA 3Q85A 1A4RA 2F9LA 5FUYA 5CITA 3CRVA 4G0NA 2YHSA 2ZTSA 2DYKA 2QGNA 3OZXA 4CYMA 4ZI3A 4Q9KA 1YZTA 3I8XA 2LKCA 2ZJOA 3KKOA 4LJ6A 1US8B 4OK5A 4WVFA 4A2WA 2C78A 3ICQB 3ND9A 3ONWA 1KKLA 1R8QA 3U61B 2F1RA 2QRNA 2XB2A 1ZM2A 3ZIAD 1EFUA 1VDZA 4PHFA 5AJYA 1DEKA 4BASA 2O8EA 3W5IA 3BB1A 4QNMA 5DLQC 2P2LA 4NONA 3PUWA 5JZVA 3AVOA 4ZDWA 1CBUA 3I1FA 1SHKA 2MMCA 4DLRA 4Q1BA 3REGA 3SOPA 1Z0FA 1RRFA 5G41A 3THOA 4URZR 3X1YA 1Z63A 2QMEA 4OI2A 1JXMA 3IBYA 1GNPA 1ZBDA 3BE4A 1SXJD 2OXCA 1XTQA 3GJ5A 3TKLA 2QP3A 3A6PC 4Z54A 2G0TA 3ZH9B 4F91B 5TB5A 2DY1A 3NXSA 1G5TA 4M1OA 2QAJA 3FMFA 2IYQA 4EPRA 3U3JA 3B1WA 1MO6A 2UKDA 2ZUDA 5BXQC 2P6NA 2FEOA 3EZ7A 1E0KA 2V1UA 3KXIA 1ETUA 4LK2A 4A6PA 1XMIA 1XTJA 1ZUNB 3GJ6A 4YMTA 1W36D 2YJTD 3K70B 3DZ8A 2IYVA 4YDHB 5IK2A 5FH9A 2ORVA 3IEUA 4P4TA 2CK3A 4PSAA 5B58C 2B92A 2D4HA 4AD8A 4DUGA 2XTNA 1AKEA 2RGBA 1T5IA 3M1IA 3CZPA 1XCGB 4ESVA 1QRAA 5KDLA 2JATA 3EPJA 1FTNA 2BBTA 4DSNA 3T34A 1S2MA 1R0XA 1YVDA 1M6NA 5FTKA 4TL8A 5FI0B 2K5UA 1AS0A 1MOZA 1OH7A 3AQ4A 1NBMA 1Z6GA 4NP6A 4NCHA 1U2RA 2P67A 2X2EA 3MRSA 4W5JA 1U9IC 1TL7C 2YWHA 3RS0A 2AKAB 1DAFA 1AGPA 3G82C 2W2VA 3RLFA 2HJGA 2QY9A 5KDDA 4N3NA 4IDHA 3AF2A 4C9BA 4E07A 4C30A 4Z1MD 3W3ZB 5AJZA 2OBLA 4DT1B 1CS4C 1WCV1 2BVNA 4XSHA 1NKSA 1J90A 5FL3A 1MT0A 4OKSA 5DGXA 5ANRB 2ZRNA 2W2TA 1S9HA 3A1SA 4JYCA 3EZ9A 4LPKA 1UKEA 2RCNA 5DN6A 1XRJA 3JVUA 3NTUA 3GLGE 1U81A 2NOAA 2OHFA 2VSFA 3O8RA 5BYKA 3DPUA 4YXWA 3OESA 4BLPA 2EFEB 1ZU4A 2BCGY 3GLHA 5GJBA 1KDPA 2ANCA 2FJUA 4P4SA 5CJ2A 4XJXA 2REBA 4B74A 4NCNA 4F4IA 4QGAA 2IBMA 1XEWY 1RE0A 3L43A 3VTKA 1KZGB 5FPSA 1P9RA 3GFTA 3RDPA 1W5SA 4KFRA 5DHFA 5EXSA 4MGKR 4HAXA 1P4SA 4RCYA 1CRQA 3VR4A 1JB1A 2UZ3A 4GP7A 2YVUA 4AYXA 1NY5A 2PT7A 3LH5A 1NIJA 3I32A 5LB4A 2HYIC 3GJ7A 3AP1A 1WF3A 2HV8A 3W3AA 4MYHA 3TVDA 4QM7A 1EFRD 4AI6A 1RRPA 1GNQA 4KSBA 2REOA 2ZRFA 4NMMA 2RGNC 1FX0A 4UQOA 5FOWA 1L4YA 3VR5A 4L9SA 1ZCAA 5BQ5A 3QIAA 1N6PA 1DS6A 1VG1A 1C1YA 2ONKA 2LKDA 4OI0A 4F38A 3L0IB 4EJSB 3MLEA 2NO0A 1NVWQ 4BEBA 2FG5A 2CL7X 2NO1A 4HSEA 1H8ED 1WRBA 4RD6A 3BAFA 4HAYA 2QZ4A 4BEJA 4LJ9A 1JR3E 2HT6A 3WP0A 1OH6A 1CR4A 3LXRA 2F43B 4BPBA 2OG2A 2QL6A 3FTQA 3RSLA 2RGNA 4GOJA 4KBFA 1IN7A 4PPFA 5GJVC 4A8JC 1P3JA 4PTLA 4OQFA 3A37A 1WB9A 2VO1A 1E9BA 3A36A 3QXXA 1HE8B 5J4LA 5FPYA 1KO5A 4CEIB 1UF9A 1OH5A 1R8SA 1YQTA 1YRAA 2RGDA 4KYIB 4QBIA 5P21A 4BRUA 2F1HA 4Q9HA 1AZSC 4ZV4A 3U4QA 1F2TA 3TR5A 5CK5A 1OIXA 2ZSBA 1ZCBA 4KCGA 2IYSA 3KQNA 1UBCA 5BN3A 4AY2A 1IONA 1TU4A 1Q22A 2RHMA 4G1UC 1AS3A 1QHYA 4KO8A 2X2FA 4PC6A 4EDHA 4B3BA 1JECA 2YZ2A 4JBWA 1DO2A 1E79D 1IAQA 1VCNA 3EG5A 2W0MA 4OQLA 4BZQA 5KPJA 4TYNA 3THWA 3NC0C 4YMWA 5GJWC 4A0RA 3QKSA 2JIZD 4GMXA 2ZITA 1XWIA 1E2KA 3TUJC 4MYUA 1Q1QA 4DRZA 1KSFX 1HURA 3VR1A 2HT1A 5CB8A 1O3YA 2VP5A 4BE7B 2Z4RA 4JBXA 2WM9B 2WKPA 4XWKA 2NQ2C 1BOFA 3QG5A 1Q1ZA 3BB4A 3QENA 4MA4A 4F4CA 3W9YA 4A82A 2P5SA 3E2IA 4B76A 5L3VA 2ZPTX 2AXPA 2SHKA 1G5PA 2VRWA 4YC7A 2XOKD 3LDAA 1IN6A 1KK1A 1T0HB 2BWJA 3UMRA 2VLIA 4KYUA 2YKGA 4PPNA 3DEFA 3W6OA 1O87A 4QHSA 4DCTA 2RAPA 4MDEA 2AN9A 4YMSA 3O8BA 3VKGA 1PLJA 2BMEA 1T5LA 2FPKA 5KUTA 3IGFA 1ZNWA 2XZLA 1N2CE 1FNMA 3ZS8A 2AKYA 4D2IA 2IUUA 3ZVRA 1HQYE 4B2IA 2JDIA 2V8OA 3M4YA 2IUSA 3R20A 4CVNA 3TK1A 2ERYA 2Q9CA 4LDJA 5L3SB 1BIFA 5B57C 1TUIA 2XJ4A 3BFXA 1DVRA 2V7QA 3SYLA 5K8TA 3EX7C 2RH5A 3KQKA 4HZUA 1N3BA 2OLKA 5DSZA 4RFSA 1N5IA 1OT3A 2MMGA 3P32A 2QBYA 2CHVA 2ZR7A 1GG2A 4B35A 1TTTA 4C0AC 3QKUA 3LAWA 2IX3A 4ZO4A 2RGGA 2KI5A 3FKSA 1YZLA 3VU9A 4IDNA 2VSXA 5HE8A 3IDQA 3ASYA 4CF7A 1QZXA 4B3CA 2WKQA 4QBFA 1G8HA 1M7BA 2GJAA 3VFDA 4ZCIA 5EP4A 5IK2D 2R6AA 3H2YA 1NY6A 1JI0A 2CE2X 4LBVA 4C0HA 2GZAA 4Q18A 1PV4A 5FPTA 5JRZA 3I62A 3OEHA 1UKVY 2W2XA 4MDFA 1VTKA 1OV4A 2OUKA 5L3RA 2IXFA 5LB2A 3QBVA 3THYB 4D0NA 2J59A 3RS3A 1P61B 3QKTA 3B13B 2LWIA 5EE0A 1EFCA 2RGEA 1G8PA 1OHHA 2CLCX 5K8UA 3C15C 5E7IA 3DKPA 1ZM4A 5LBIA 3QNUA 5FOVA 2ECKA 621PA 1KYIA 3H86A 3EA5A 1Z28A 4PHHA 3PXGA 1TPZA 1S1MA 4HB3A 4NKRA 1ZUHA 2O8CA 3HR8A 5EUMA 4C0SA 5EZ6B 1G9XA 1K5DA 2I4IA 4X8HA 3NHBA 4P33A 1KTVA 2BOVA 3EW9A 4V03A 4TL6A 4A36A 4BUJA 4HB4A 3WYAA 2W00A 2ZRHA 1SVLA 4RKEA 2PX0A 4TL9A 4KFTA 2ZE7A 2B7BA 2IYRA 3K9LA 4NU0A 3GEHA 1VPLA 4US2R 2J0QA 4E03A 5FTLA 2CLDX 1E99A 1T8UA 1I4DD 5FUXA 1NLYA 5HKKA 4B3XA 2BM0A 2W6IA 5J47A 3THXB 1XTIA 2AL7A 1K8RA 2ASEA 1QBKC 4LX0A 2DFLA 1SXJB 3IHWA 1XPRA 1F5NA 3EARA 1UDWA 3RABA 2ZR0A 1KHTA 1P9NA 2YYZA 4JSYA 2NIPA 1AM4D 1II8B 3AV0B 421PA 4JLPA 3QXSA 4W7SA 2GETA 2ZRLA 4M22A 1L4UA 4DHEA 3H84A 3B8HA 1DAGA
chains in the Genus database with same CATH superfamily
4IXMA 3QWHA 3MS2A 3SHWA 3A26A 1UPTA 2BJHA 3DUWA 4H0FA 1ORWA 1TMYA 2REXB 2WMNB 3CRMA 3EGVA 3MJCA 5KYTA 2QG4A 1XP8A 3L8DA 4QQNA 2D00A 1BVRA 2A9VA 3PA8A 3VZSA 2EKLA 4DMKA 4OQYA 2G3YA 3PHLA 3O4FA 4CG2A 1RYEA 3EPRA 4UBJA 1J70A 1X13A 2HJVA 3E5HA 3X1XA 5ADUS 4CMBA 4JHLA 4OQDA 2BFBA 1YL6A 2A5FA 4ZODA 3N0VA 1Z7BA 1U7XA 3UUFA 3DLTA 3E3MA 3Q3JB 5A5DA 3PNVA 4FILA 3TLXA 3GVHA 2W4MA 1N36B 4BEWA 4W1SA 1Y8QB 3TRHA 1CQPA 1EVKA 3G02A 3F78A 3O93A 2H2HA 4EHLA 5CT5A 4RTOA 2RC6A 2Y1GA 3MT7A 2VJLA 4QOJA 3SZRA 3W5HA 3L2OB 5KX5F 2ZS9A 1R7RA 4E1BA 3GJ8A 2FFHA 4HWRA 4TOIA 2KJQA 3VXKA 5I4IA 5CB4F 4M8NE 5I01A 3WRXA 1OMOA 2B8JA 3SVZA 4KI0A 3ZX5A 3LQRA 3OICA 1U2ZA 4QAJA 3IQDB 2GFQA 2BEUB 3UKDA 4FE4A 4E5PA 3R77A 3AZPA 4OD0A 5CD1A 1PNTA 3LC0A 3ZHSA 1C0IA 4I9UA 2IGBA 4ZU1X 4BYMA 3G5LA 1A5SB 4II3A 3F74A 1MNQA 3K5PA 3KQLA 2X14A 2HR1A 3K1JA 3E18A 3GBVA 4IHJB 4ZGGA 3EC7A 3VR6D 1IN5A 1ECGA 4KQFA 2HIHA 4WH0A 2QTMA 2FP3A 4KYTA 1L8QA 1J5XA 1NIPA 1B41A 3IVGA 4MHSA 2Z56A 2HXYA 2Y9PB 2Z43A 3FNBA 4BGEA 3IC5A 1HTWA 2V6BA 4AJJA 2XCIA 1KC3A 1TTPB 2XNDD 5EZYA 4C2TA 4I9FA 4JS0A 4IS2A 2F8MA 5GADl 4BTEA 4WTOA 3C41J 1TO2E 1V4VA 5JOQA 2QOEA 2GPYA 2NP7A 1Q21A 5G0WA 1X9IA 2G1PA 4TRJA 3BTVA 3FLEA 3IH5A 3FHCB 3D7MA 3LUBA 2IYXA 2O0HA 5FD8A 1BMFA 2AFIE 2RMKA 3MTDA 5PGMA 2JK1A 2H92A 3T7EA 4RMNA 2LCIA 1N0VC 2VAVA 3R8FA 1XRLA 2NGRA 3RV3A 4GLOA 3I9OA 1R8YA 5JS2A 5HIIA 3QOYA 1WB4A 7REQB 4UTRA 2XBLA 2HDWA 4Y1EA 4DC1A 2OXTA 1IHYA 5BW6B 1MIHA 3D5QA 4KREA 4QYMA 4YAWA 3EMKA 4IDGA 5CCDA 2J9FB 1EJ2A 4BY9E 5BRAA 1ULUA 1UK8A 2CKMA 5T41A 4CM4B 5DTRA 4QTUB 3SYMA 3BD9A 3TXAA 3KG2A 1Q7TA 2CJWA 3FYHA 3MS4A 4BMYA 4JL6A 2OFOA 2VWPA 3RVKA 1NUUA 5HJ2A 1MMFB 5LMZA 4LJYA 3LA8A 2XHZA 3CVVA 1F6BA 3KE8A 1AKRA 1KC1A 3V8NA 3KHSA 3AYZB 2VQ6A 3UXEA 1B00A 1HUQA 2JGIA 1YJ5A 4YRBA 3I04A 4O1MA 4Z8YA 2V7WA 2ZOSA 1W6UA 1XZ8A 5DU2A 3WFJA 1M10A 3UPTA 4I3FA 3UOAB 5C1BA 1M8FA 1J7JA 3RK0A 2EX4A 2MYUA 3WYNA 2X0NA 3CLRD 2AYYA 3HC7A 1ES9A 2FWNA 5G3ZA 1WXWA 4J6EA 1FTYA 4U5XA 3BHJA 1U2EA 1BNCA 1Q20A 4IHQA 5TPWA 1ZEJA 3IMCA 5HTKA 2A1TS 1XTKA 3K72B 4BB0A 4BQOA 1MXFA 4ZVUA 2O06A 1Q0ZA 2R8ZA 2XZOA 4W1QA 3V8RA 3DJYA 1CUUA 4DKJA 3STHA 3IAM1 5KDOA 2QA5A 5H3CA 2TMDA 2YRWA 4NX2A 4QDOA 2PMKA 1SPBS 1NVAA 2QN1A 3OTHA 1R3DA 2YXLA 5JFTA 1X7WB 1N25A 4MQLA 4XGNA 2CVQA 4Q21A 4XWGA 2X15A 3JASA 4JEMA 2PCLA 4WJLA 4LZOA 5K3FB 3R0ZA 5BQOA 4PNEA 2FEMA 2ZYRA 4D97A 1CRWG 2IODA 4HDNA 4ZOQI 4MS1A 1AKUA 4P2BA 4E5SA 1MXHA 4TKMA 4X84A 2GJSA 1IJBA 5IYZB 4NPCA 1FLDA 3T0FA 2BDEA 2VP4A 4MQ6A 1EVYA 3NYRA 2ZVPX 5D1NA 2ADMA 3K32A 1PEKE 2ZRCA 5DLPA 5K2MA 4Z53A 1Q2XA 2GXQA 2VJBA 1VJTA 2A88A 4Y9DA 1X6VA 3LDGA 3W06A 3M6IA 3D3KA 4O8ZA 1DCTA 4LTMA 2GXAA 5TGDA 1DIGA 5EIFA 4BBAA 1IY0A 4AY5A 4M1QA 4Y1GA 1VKOA 5AOVA 2QE7A 4V0KA 4FXPA 2QT0A 2QRVB 2JPDA 3KS9A 5EI5A 2WR8A 1XRSB 3HB9A 1YO6A 1RRKA 1N2BA 2QN3A 1FW8A 2Q7DA 4X6YA 3V7NA 4XTCS 4OQEA 3T0IA 5EN4A 4YT8A 5AVWA 5K6AC 3IVCA 4I1UA 4JQZA 3SF0A 3V2GA 1QO0D 1H6AA 1R5BA 1PR2A 3R3WA 4UDXX 1JIIA 5A7GA 1QH9A 1TQDA 4G84A 2GILA 5G1OA 1H0HA 1Y37A 5H83A 4NABA 1FMCA 1XKTA 2O9JA 3CSSA 4C7XA 1N77A 2F8TA 2J3EA 2CXQA 4G1BA 4B82A 2I33A 2NTEA 3PNPA 4PEVA 2H8KA 3IAEA 1TMKA 3MWKA 1M7HA 3ZTWA 3WO1A 4NENA 2IWHA 1KMCA 5CPBA 4XGQA 4PBSA 4B2PA 1Q6YA 2R8OA 4OL9A 1VL0A 1GPKA 2WD8A 4BE4A 4FOSA 4S3MA 1YBMA 2QSUA 1CERA 2NVWA 1J39A 1JNXX 2JIDA 4DGSA 1D6MA 2H0AA 1WPRA 1C4OA 5AD1A 4WZAE 3WDLA 3QVWA 2C57A 3E70C 1U7WA 4NV3A 5JXJA 1S3FA 1AT1A 4JKOA 2DHQA 2E85A 2JEOA 3MRTA 4PLTA 3WZ2A 5K0EA 4EHFA 5ELMA 1MB9A 3G6WA 1XL0A 2HWYA 2YUTA 4UHCA 2QUZA 4M1KA 5FA5A 5L95A 2JHCA 3MA0A 1NP3A 3BMCA 4RZIA 1W6RA 4EELA 4I3GA 3IKVA 4GYYA 5FPHA 1CZRA 3JD2A 1CF9A 2Q9AA 1MO5A 3OP1A 1MAWA 4NLLA 4PFKA 1GLGA 2YRFA 1RWKA 3JAKA 4C4PA 3DF7A 2JB9A 1RPJA 2FUG1 5HKKD 1NV9A 1L8LA 3RU2A 1K0UA 4BNGA 4TKZA 4D25A 3DQPA 2X0RA 5JO9A 1BS2A 5ESRA 4ZVOA 4RUKA 4YRPA 3WB9A 5F3WB 2Y1CA 3K8OE 2JGDA 4NE9A 5AQEA 2OBMA 2G5CA 2XKBA 5CX1B 1JI3A 3VR0A 4HGPA 1ZJJA 3E2MA 3KEFA 3L6BA 5BN1A 4D80A 2WSIA 3DP7A 1TA4A 2JFXA 4GYJA 2FN4A 2QYOA 4OU5A 3ANNA 4U7JA 4J07A 1D7AA 2YC4C 1DKRA 4O3FA 3AF6A 1IZ7A 2O8VA 4H6PA 4Q7LA 1FJHA 1G2OA 1AXGA 2XB6A 3D4NA 1VXOA 3GIDA 3H2SA 1NMXA 1XDUA 2GLUA 1JJFA 2HRQA 4M60A 4DMGA 4ZOLA 2I3DA 4IDAA 2N1MA 3ZHRA 4EAQA 2BYTA 4BV3A 3HXQA 4RMHA 2E0IA 4L8WB 1D5CA 3KAQA 3TVYA 2IZOA 2V7VA 3EY4A 2FV8A 3UXMA 4D82A 2QNRA 1JQ3A 5B4TA 2ZIXB 1ZM9A 4EB3A 3S1AA 4HY3A 2H6EA 2A14A 4RELA 4U00A 1M6HA 4TSKA 2BR3A 2C9OA 1LQ2A 2Z9BA 1E2HA 4AJ1A 3SC2A 2REQA 2L18A 1BTOA 1Z2AA 3NQ41 2OBXA 2IYUA 4REMA 2WD7B 1J99A 4TRMA 2FGJA 1G2IA 4TZ6A 2H9IA 1SB8A 4MW5A 1JJVA 1X8KA 4M9XA 2D1QA 3LUFA 1SXIA 5FQOA 4JMPA 1PJBA 1WZ2A 2YVAA 4ZCMA 4JHXA 3TG2A 3WRYC 3G1TA 5A4DA 5AI8A 2COEA 2TMKA 2H52A 2OCPA 2V3CC 3B6KA 3ORFA 3USES 1RWBA 2GH1A 4NJOA 2XWPA 3NW9A 5FUWA 2AUTA 2XDAA 1UINA 4A2PA 3RG8A 4BFYA 3IEVA 1YDMA 5K09A 1KEPA 2HMAA 2V4ZA 1ZUIA 4Q39A 3ORYA 4Y9TA 1QOZA 4E09A 5AUNB 1ML4A 4YUWA 3M34A 4LHSA 3TD2A 5KYXA 3F46A 2KLHA 1IG0A 1W1WA 3C6XA 4CPDA 1SKAA 5KU1A 4WN3A 1HPLA 1WUKS 1Z2PX 3IX7A 3O82A 1CJTC 1PN3A 3AEKA 3O38A 4LYAA 3RBZA 1CS0A 3RUAA 3GVPA 3TIIA 3NAMA 1NUPA 1FDTA 2FKNA 2HU8A 1N6NA 1H1LA 4KE9A 3ADKA 4NY1A 3RJZA 1I32A 1DJQA 1Y6JA 1R00A 3U4GA 3CXUA 5H8WA 2GKOA 4F5DA 4RQAA 4PX9A 1F17A 3WRYA 1NW9B 5K01A 3ADCA 4AXBA 3E1KA 3NAZA 1Y6RA 3H3JA 3EVTA 3S2SA 2DULA 3W6NA 3SLKA 5DLYA 1DIHA 1F8UA 2JAUA 1CZNA 2Q45A 2PTHA 3C3WA 5BSUA 3UT5B 2EYQA 4KQKA 3NVDA 4PINA 2H2WA 3KQWA 2IU0A 3T1OA 1IQPA 1W8DA 1AA6A 3CIOA 1E6LA 3JY6A 3GVXA 5EY5B 2NO5A 2W2LD 1SZPA 2W71A 1IM2A 3EFBA 4MGEA 2Z1MA 4RHTA 1DT5A 5CM8B 3VR2D 3LLUA 2GCIA 1PL6A 2ZBUA 3B48A 1CJMA 3ICPA 3KQYA 4Y2XA 4G56A 3FRJA 1WCIB 2EJBA 4BQNA 2QLLA 1FX0B 1V25A 2MSDB 2OHIA 3N2ZB 4BLUA 4Z7NB 5TLSA 1E89A 3IUJA 2B2NA 2NUTA 4B32A 3V1KA 3SDBA 3ZG6A 2YZKA 3H1BA 4XIIA 2D2VA 5CXXA 1PZNA 4MB2A 3T4EA 3KHKA 3PHCA 1AKWA 1D1SA 1U99A 2MWMA 4HLQB 4YH1A 4LF9B 3HPRA 4LDQA 1ZMBA 1JFSA 4BMDA 3V2IA 2IP4A 4QHTA 3LBAA 3TQFA 4QLOA 2VI5A 1P6UA 3N1UA 2XI4A 1GSOA 2W90A 1L5KA 4PQRA 3ZZNA 4JT2A 4DZRA 3HJNA 1O8CA 1E9RA 4MB6A 1W0KA 2VNIA 3BIJA 1C3VA 3ED1A 2YXNA 3GLTA 4I5IA 4YP9A 1RQNA 1J20A 2Y0CA 5E3HA 4G4GA 4N9WA 5EEGA 1N78A 4L85A 1Z35A 2DR3A 1KQPA 1JHMA 1W1UA 5K0LA 3RK1A 5U4XA 3DEAA 2HL6A 2WKSA 4EYEA 1TADA 3FNRA 3L8YA 1THGA 3EDQA 1R50A 4L16A 1NJFA 5FNVF 3KHUA 5JZOA 5CXQA 3TLCA 1G6Q1 1A88A 3B6IA 4D79A 1CDEA 1EH5A 2A5YB 1F2TB 1VGQA 2G82A 3GUVA 3KYCA 5MGNA 3BK2A 1F48A 2ZBPA 1IJKA 1F8XA 3WGLA 5ADHA 2IX9A 3CLHA 1C0EA 4UCWA 4IPTA 3JQ8B 2VPTA 3L7BA 4LZWA 3G1WA 4EYQA 1E92A 4E51A 3KFVA 2XTJA 4PQYA 2H7CA 2OOKA 3Q3HA 4LJRA 1O7JA 1LNSA 3G9TA 2QUJA 4L2IB 4EY7A 2VCEA 3ND5A 4V3CA 3V6LA 4C03A 2IP1A 1T3HA 4BVAA 1JQEA 4RHXA 3OEYA 4J6FA 3GAFA 1ZN9A 3QKSB 4G4SP 4NJEA 2VRCA 1B0AA 4KJZA 4RHEA 4CUZA 4OX9B 2VK8A 2PJDA 2NXWA 2D8AA 4S24A 3HFGA 4HDQB 2R7LA 4NHOA 1KY4A 3ZHCA 5C46F 1SWWA 3UJ6A 2Y1KA 3IEKA 1ZVVA 4XVQA 1SCBA 3HCCA 2JHAA 4KV9A 4UBMA 4QREA 4FMCB 1CTQA 1G21A 1UXIA 4PO8A 4WUTA 4XQEA 4DV7B 1SVIA 2C1XA 3K6SB 1E1CA 2C5AA 2DVMA 3AFNA 3N6VA 4B3MB 3OWXA 1N5LA 4BNYA 3ORSA 5CT4A 2PUEA 3BXHA 3B20A 1CRLA 3A1FA 3BGDA 4ISCA 5ISMA 4DCUA 1QDUA 2RGXA 3INGA 3IURA 3AF4A 4V0ME 5F4BA 4KQ1A 2ZT6A 2QDXA 5DPMA 4AICA 4JLNA 2IE0A 1EK2A 1Z0JA 3L0DA 4C0JA 1A50B 1VOTA 5SZIA 2YN0A 1GPH1 1SGWA 3DUFA 1P29A 3K4HA 4Q1DA 4Q7JB 4Z0HO 2XWQA 1LZLA 4WL0A 5A4FS 4AWBA 4YALA 2AUMA 1OAAA 3U7RA 5GIOE 3NHKA 3H65A 4YAFA 4EYKA 1GFWA 2EHJA 3FYSA 1L7OA 1Z83A 2Q21A 3G6KA 1T2EA 3OCYA 4L1KA 3TCKA 1A2KC 2H59A 2WFLB 4AMVA 4C22A 3VKWA 4DBVO 3FCEA 2EZUA 3LUHA 3BXGA 3R3JA 3R09A 1I33A 4W1RA 5JCPA 1M2KA 2ZR9A 4GE3A 1OYOA 1MKYA 5KTPA 4RFLA 4EBFA 3M2TA 1X77A 3BK7A 3I9NA 1T6NA 1A5AB 1UZLA 3G2OA 3RF7A 1QTIA 3VJKA 1NVVR 2HWUA 5BN4A 2AHOA 4MUAA 1UBNA 2P4EA 2AOTB 5EERA 2AJTA 4PSKA 4ZVKA 3TLJA 1GFZA 1VSVA 1HSOA 4U0KA 2J1LA 1QYVA 2EZ9A 1H2YA 2R6ZA 3ZY6A 2R5WA 3U6KA 4KXXA 4MH0R 4WASA 3U5ZB 1NAIA 1SHTX 4D4HA 2CFRA 3CRQA 2JCSA 3E7FA 2RK3A 2W98A 1YT5A 3NWBA 2J3DA 2HEIA 4CEIA 3SAJA 1HA3A 4BFSA 3UQZA 3L6UA 1Y3FE 4DKXA 1FFCA 1HT3A 3P2KA 1EFPA 1RSZA 2C4KA 2JJ8A 4FDTA 2PZJA 3FF4A 4ZT2A 1BS1A 3R7LA 5B37A 3QYAA 2XCTB 3AVPA 5DXFA 3M49A 4EA7A 4O4LB 1SXPA 1KQ3A 4FC6A 1VA5A 3P19A 1CFZA 1ZNQO 2WOOA 4KIWA 1Z25A 3LHFA 4DTIA 3BSSA 4LRXA 4IL5A 3G85A 3WLAA 1ADCA 1MOSA 2H1VA 1T8WA 1TM2A 3CWQA 1PG2A 4RK1A 5DISB 5BOVA 1JIQA 4JROA 5HHTA 4PC1A 5CK4A 1NJ1A 3BZWA 2FRXA 2WHRA 9LDBA 1MJNA 1RHKA 2IHYA 2D59A 4LV6A 4TKVB 4UTNA 5JSQA 1KYZA 1H65A 3KFXA 3TPZA 1P72A 3NFYA 3UFXB 1MA3A 3COSA 2I7TA 1W34A 2HLDD 4Y7CA 1UADA 3D6UA 3H4TA 4M54A 4QGFA 2WA2A 1JQ5A 4ENQA 4HPWA 3K05A 1D6SA 4DREA 5CJJA 4JXZA 5M5BA 2HA6A 3CB2A 5J2TB 3AJ8A 4BFUA 2B4QA 4WZZA 5A03A 3OZSA 4M4SA 4B48A 3QLVC 3PR2B 4S1PA 1XCLA 3ZWPA 1A97A 1V41E 3IP3A 3K0FB 4Y6LA 1SUFA 4R8KA 4N82A 5CHYA 3LLMA 3LT1A 2K4MA 1RYZA 3KQOA 2HADA 1MO3A 2WZQA 2HD4A 5AJVB 2FZKA 4WADA 5JROA 3IXLA 1IXSB 3PLNA 2P3OA 5C3MA 5EC8A 1E20A 2CF6A 3ESYA 3KUKA 4FI3F 4MQFA 4WK6A 2JJ1D 2O2GA 3GPLA 1MJFA 1W4AA 4FHGA 4MV6A 2IZ7A 1EXNA 5C34B 1SCIA 1XELA 1P1CA 1Y8RB 2YJ5A 4D7AA 4N3CA 3OIGA 4XWOA 1EM8B 4ILEA 1G8YA 1AGNA 1S3IA 1T5BA 2EQ5A 3NTQA 4PYNA 3QE9Y 1O94A 4XPZA 3PP8A 5B6PA 4QKQA 3EVFA 2BDUA 1ZISA 2B98A 3D0RA 3OY2A 3QLVA 1MPTA 3EH2A 3HDVA 4DDWA 2LNDA 4RORA 1ZMRA 2XVXA 2QTGA 5F2EA 2QF7A 2UZAA 3PUVA 2MSKA 2NNLD 1FBTA 2FPUA 3JQ7A 1XQ9A 1NVVQ 2Z4TA 4NHEA 3V4LA 5JS7A 2DUWA 5F1KA 2Z2YA 3GA5A 3WLTA 2GNOA 1HK7A 2H4WA 2PGNA 4INOA 4XQCA 1OFTA 3LDUA 5B3KA 3BA6A 1SKBA 1I3LA 2CXOA 3D1JA 1UBJS 4TS3A 1BHJA 5LQSA 1L3IA 3D43A 3ZDQA 4WXEA 3TLGB 4CIWA 3VC2A 1AIPA 1P8JA 3FZGA 3PITA 4P35A 4TLDA 5IKXA 1ZD3A 1DOHA 3P2MA 3Q98A 1Z34A 1Q57A 5SY4A 1FFAA 2GNAA 1VGVA 4AJEA 5JD5A 1ZIDA 3GWGA 2BFBB 2RHOA 4ZXFA 4HO1X 4PX3A 3R40A 3JW8A 2OXRA 3PQ3A 3K94A 2IEGA 1T3LA 2UVQA 3EBOA 3NBKA 4LN1A 1GQRA 4BP9A 3EIQA 3KAPA 2ZJ5A 4BMOB 5C32A 1D2EA 3VPXA 2HDHA 1MC8A 2QTCA 2OCBA 2PSHA 3MCWA 4KQ9A 4OB8A 4U63A 3NEYA 4CKCA 1QGUA 3LQFA 2P6RA 1PJRA 4HLUC 2VRNA 4ZI7F 2AW3A 1P62B 5ALLA 1X7ZA 2WILA 1BWRA 1XRRA 2ADOA 2JLAA 1XFAA 1ZCZA 3IJ5A 3ZXXA 1QLHA 4J2OA 4J3NA 1EK1A 3DBHA 2Q5IA 5T7BA 3QVUA 5FOSA 3SFZA 3FH0A 1G5HA 1VHTA 4EYSA 3KKQA 5ALQA 1A72A 3UKJA 4BLWA 3G8CA 4CQLA 5TC4A 5MFPA 1TC1A 1YA6A 1CUHA 1NF2A 4BGDA 3EAFA 1USUA 3NJRA 2PKEA 4DM7A 3UJHA 3ABQB 4WLVA 2E49A 2Z3ZA 3JYOA 4XUDA 2ZJ0A 5E0KB 4IICA 1YMUA 2EXXA 3L0PA 1OZHA 3F5FA 3O8DA 4KPFC 3UQYS 3KLOA 4BO9A 1ZYUA 4YTEA 1A0OA 3B85A 5B1DA 4XD7D 1WW2A 3I61A 3I5MA 2QTZA 1RXYA 5LYJF 2D7DA 1EGAA 1ZVJA 3D2BA 4QUDA 2OYCA 3G23A 5HF6A 2HW8A 4LXXA 2OQ2A 3QE0A 1SPXA 1WU8A 1JAZA 1RKQA 1U0FA 5EZYB 1U0RA 3F90A 2VBCA 4HLUA 3ZIAA 1MT3A 4A6DA 3W5DA 3GEGA 4MR8B 5EHZA 4QOGA 1EFHA 4HDRA 1YZNA 1IB6A 4LRWA 4XQ0A 4BQRA 2FHPA 1NQTA 5AKGA 3RGWS 5HE9A 4R1OA 3QGMA 3N2LA 5DW0A 4YR7A 3RUEA 5KMGA 5LKAA 4E6EA 2OR3A 1TQ4A 3WXMA 3ZY4A 2FPXA 1Y34E 2UXBB 2Q2VA 1CP2A 3WOVA 5LR6A 4TUYF 5EGNA 3GW8A 4KYVA 5GWXA 3NIGB 1RYDA 2NU8B 3BUSA 3RTAA 4GGPA 3W3AH 3CCCA 3GDHA 3TDNA 5F78A 2JFHA 3IV7A 3GEPA 5CVUA 3P71T 2YXEA 2Q3BA 4W9MC 1JV2B 4G81A 4AF8A 3NVMB 5IULC 2CXXA 3M5PA 4JBYA 4UMDA 3V8VA 3WK9A 1W46A 2CJWB 2QORA 2EKBA 4XGIA 3R7WB 1TUBA 4EVSA 1N4DA 1QE3A 2LVBA 1E3JA 1VXRA 1WO8A 3WK4A 1O0BA 4K0KB 2GRJA 3CX7A 3RROA 5K6RA 3UGKA 5KOHA 3U49A 2DH6A 3QKIA 3MTGA 2GMWA 4EUSA 1CY0A 4P7JA 4RA6B 1JEQA 1VE5A 4DC9A 4W7IA 3QLUA 4YLGA 4Z3OA 1L8AA 1D2GA 5AHOA 5JNVA 1OQAA 4KODA 4N0MA 4ZYUA 1DX4A 1V5IA 3FFBA 1JP7A 3DT8A 1BGXT 1XKQA 1JRLA 2JGAA 4RLSA 1JHYA 1X0VA 4O2AA 4KACA 4XSGA 2X0DA 4IJUA 4OMCA 2NV2B 5BSHA 5IKEA 5ITWA 4EG7A 4TTVA 5L7TA 4RPIA 4XYEA 3LO5A 4CW7A 2H1LA 2GWRA 1Z5ZA 2JD2A 2FVYA 5FA8A 4DZZA 1NLZA 3LT2A 2H9AA 4XIYA 5B1EA 1Z38A 4YQZA 3S2GA 2BTEA 3WLFA 2X9LA 3TR6A 2X8WA 1VYUA 1YIDA 2XUGA 3ABOB 2X0EA 1E8MA 3N87A 3DSRA 1Y3BE 1W5TA 3MIZA 4V2UA 1T4MA 2CMDA 2Q4RA 4LI3X 4R1MA 1SUCA 3SEAA 2F1KA 5AM1A 3H17A 4B4UA 4ZAXA 4HDNB 4JL8A 3AOEC 4LWQA 4MS1B 2PWYA 3B3QA 3VVLA 2C4UA 1BXRA 1TRKA 4CHGA 2A2ZA 2ZJ8A 5GJBA 3WICA 4CDNA 3KZKA 1QFXA 1NYRA 2FP4A 4CDMA 2FFQA 3GFRA 1LV8A 3QUAA 2QW0X 1KOLA 1V9LA 2VJCA 4L5AA 4IF6A 4QU8A 1MAAA 2CMKA 4EKDA 1OFUX 1UM9B 3L41A 4DJFC 3U5TA 2ZUEA 3CRW1 3EUFA 3IPRA 3KJXA 2WT8A 5DEIA 1LDEA 4ZK6A 1P80A 3UATA 2GZSA 1AN9A 4PAQA 3KJFA 1TQ2A 1UXGA 4BNMA 1Y9JA 3OBBA 1RC8A 3JRXA 2I1VB 4JVLA 5EIBD 4COOA 1D07A 4F9TA 2V98A 5C8YF 2NO6A 3E9QA 1QH1B 3W5JA 3GOQA 3P9XA 1V3VA 2IS1A 2R6R1 5WRFA 3N75A 4JI7B 3JALB 2BEWA 4QDJA 1YZUA 3RSFA 1U90A 4MPJA 4DR1B 3FETA 5CDFA 3SN6A 4XM0A 2PV7A 5ILOA 1TCUA 1ZK0A 5A4AA 3OHSX 2IEDA 2ZM5A 5I4CA 1QCDA 1YUBA 2EEPA 2HUPA 2VFAA 1M1YA 2WSBA 3FCYA 4G1VA 4BQQA 2WQ7A 4KWTA 1FUUA 3DTVA 3VTFA 3WQRA 3OP4A 4GZMA 5D2CA 1ISPA 3A3PA 5JNLA 1Z5VA 3KQHA 2QI9C 2ID7A 3R7FA 2C83A 4CQJA 2BD0A 4X24A 1JFFB 5DXJA 4D4KA 1E1NA 3E1SA 3DLPX 1BDBA 2RD2A 1XD8A 3O6VA 3I52A 3DR5A 4GXNA 4RAQA 5CAEB 1YZHA 5BPHA 5BVGA 1F4LA 4KQCA 3JQBC 4F6LA 4MQBA 4OHZA 2NZ2A 3ZTYA 4QOSA 3EIUA 1GOTA 3A4TA 3TUZC 1Q3TA 5EQTA 4RGVA 4LRTB 5BSEA 1QFMA 2CLEB 3GUYA 3NTRA 4G4IA 1NJ6A 1E96A 1RBQA 2J0UB 2VBIA 3JVVA 3O90A 4CXMA 5BPFA 1RMQA 2JI6A 4PAWA 2FWJA 5LQJA 1P4HA 3H9GA 4AC9A 1L4FA 4OHCA 1VYVA 3JAKB 4EW2A 1Z4PX 5H82A 4BIIA 4GI3A 1A96A 2E4WA 4GC9A 3INYA 1KI2A 1YA4A 2ZUWA 3BMXA 4IGEA 4PYLA 5JYDA 3B7WA 3R9WA 4ENRA 3C8DA 2Z0MA 3GT4A 4IQFA 4OOFA 5CX4A 4L15A 4MNTA 1NR7A 2YJ4A 3BH0A 4X7MA 3ZD8A 5JR3A 1SC9A 3DAPA 3H1PA 3MWEA 4BQEA 3BRWD 1YDEA 4OBEA 1V1RA 3E5NA 3VQTA 1Z33A 2G9UA 3AOGA 3JQBA 1YNSA 3JXEA 1IG3A 2H2AA 3OE7D 4ACAA 2I67A 5JIBA 5A5VA 1ZI9A 4PC7A 5C51B 4TLCA 5BURA 3G79A 5DGIA 2H7VA 4RMGA 4YRKA 4KP7A 1NXWA 2HH9A 5H5JA 2ZWPA 3M81A 4FYYA 4QHYA 4R01A 2FPLA 2ZZMA 2OILA 3PNOA 4V0QA 5DI9A 1W4CA 3C7AA 1ZI8A 4GBMA 4ZOLB 5E9AA 4AJLA 2J6IA 2BEJA 2CVPA 2DCUA 3OJ0A 2FH5B 3C5CA 3PENA 1PWZA 4P4UA 3ZXYA 1XLVA 4X91A 1E6MA 4Q9IA 1GQYA 2EGGA 2G09A 5GINE 3LPAA 4V2IA 5FBLB 2Q46A 2HIMA 4U7TB 4M1YA 5CB0A 1K8ZB 1CKEA 3VJLA 4AO6A 2PUAA 3LC7O 1JNYA 2NM0A 1CK4A 2KE5A 2JFNA 2CNOA 2JKVA 3P0EA 4CEHA 4RZ3A 1SCQA 1RW4A 3AHIA 2REQB 3ESBA 3FUTA 4LW8A 3SC2B 2QRGA 3S40A 3VPDA 4G0PA 5EUCA 4W5RA 2VDNB 1GRQA 3JR7A 4OQMA 2CB0A 221PA 1HZZA 1QM5A 3FHLA 1CQJA 1RI4A 3M6MD 3PGXA 3Q7QA 3RVLA 3PR3A 3I9MA 2PGOA 2WU1A 3KHTA 4LNUA 4K6CA 2AX3A 2YWFA 4XI9A 3I2KA 5I3ZA 2J46A 2XOKA 1WKVA 1ZA1A 4MKRA 3LUPA 4AYTA 4CN9A 2FF7A 2D1TA 2ADFA 4E0BA 4PQEA 4YI5A 1Z4LA 3HG7A 1QO9A 2WW8A 1M3SA 3EDOA 3GRYA 2GAJA 2QL7A 3O3OB 4JB2A 5LUAA 4UXIA 3WAGA 3TAHA 1FYDA 1L3CA 4MJLA 3SZMA 3GDGA 4ML3A 2ZRIA 5BR4A 2HMTA 3UW1A 1ZD9A 2JAWA 3CXRA 5CVJA 4CQNA 2Z1DA 3FLMA 1Z22A 1Z39A 4CMGA 3FKQA 2CDBA 2JHGA 1M0SA 2JG3A 5CXUA 4KH1A 3UAYA 2R85A 5JWOA 1HX7A 3EC1A 1R0KA 3AEKB 4KQEA 4K3VA 4RVFA 3WLKX 1CS0B 3ETEA 1WMBA 2WM3A 3JQFA 1NBAA 3EWNA 1P3DA 1GARA 3PQFA 5BWMA 2XAAA 4ND4A 2PL1A 4PBTA 4Q6BA 5FF9A 1H1LB 2IZ1A 5JMPA 4TT3A 3ZUPA 5BWBA 5JTUA 4DIOA 2OMKA 1QGED 3R5SA 2MDTA 2ZYDA 3DPSA 1MB3A 4NNJA 4UEJA 3ZCRA 4KBGA 4EHBA 5HGJA 3K8ZA 1BH6A 5F52A 5BSRA 2DBYA 3R1IA 4P81A 4MUXA 3D7KA 3RVRA 3QWAA 3CM0A 2P9ZA 2AW5A 3TEMA 4JLWA 4YPOA 3ZY2A 3TXXA 2PR7A 1GZUA 4WCDA 2J6HA 2YMMA 1OIWA 1OV6A 2ZWIA 4G85A 3W8NA 4CIBA 4Q4DA 1P2TA 2HTEA 2IW1A 2XB9A 3IALA 2XEXA 3IESA 2W6OA 3N5KA 4P53A 4KK4A 4QTZA 1N1EA 3PXXA 1XTSA 4LE0A 3EVNA 1IJEA 2IYAA 4ENUA 5HQ3B 4QVIA 3TQTA 3CYFA 2OV6A 1KGSA 2IHUA 4KKVA 4W5WA 2O1SA 2Q2NA 2YVKA 1T9KA 3LX6A 2CZGA 4HDOB 2QNBA 3TLZA 2E55A 4NBTA 3AV3A 3C3KA 3R3ZA 3IXQA 5A2GA 1ULZA 2UYOA 1SVMA 1PD1A 5IZ4A 3H16A 2NUTB 1D4FA 2CYCA 2RG1A 4LCBA 3SF8B 5HNKA 2ZJ2A 3RTCA 3AFGA 3JQPA 3LUJA 4NZYA 4EA6A 1P2VA 2ZBDA 5IVKA 1Q3HA 4QRHA 4IRUB 1WXQA 2GO7A 1BMFD 4Y1RA 4B83A 1H0KA 1RWWA 2WSMA 3QFTA 4M7WA 3V7UA 1H42A 3GR6A 1VRVA 1P5ZB 4TV8F 3JRNA 2WJ4A 3TNLA 5E1DA 1OBCA 1Z2NX 2GK7A 2DQKA 2FEPA 3P0FA 3CTMA 3WIOA 1CZHA 1AUOA 2FN9A 4BECA 1J24A 2R2AA 1ID1A 4XIJA 3QEJA 1W76A 3ZH2A 1NPTO 3OIWA 4CETA 4MEJA 4A0HA 5EJ9A 1X3SA 4PHGA 3NO4A 3SC4A 5CGZA 1K0FA 1WM1A 4E5UA 3PUXA 5AK6A 4NF2A 1XB2A 2UZ0A 1R0ZA 4LDZA 1CEYA 1VCOA 4BBZA 1T9AA 1BEEA 1ZUNA 3CPEA 4L5IA 1JMVA 1KI9A 2Q1UA 2ZTMA 5D86A 4IDQA 4LECA 1JE1A 5GIPE 4LGYA 2FZGA 2GZ3A 5TNXA 3VAYA 2YOGA 2E2WA 3OT5A 5LVAA 2WLTA 5D5PA 4IOJA 1T0IA 1LLDA 4FCCA 5BR1A 3KOYA 5B3LA 4EG5A 2WSYB 4XEHA 2IH5A 5PNTA 2EFYA 3KYCB 5C7LO 3A1EA 2W37A 2FLKA 4BX3A 1L4GA 4Q02A 4AT1A 3I6ZA 2ZB3A 3HABA 3SKXA 1W4BA 3WSWA 4KXNA 1EDZA 5JVDA 1U63A 5K4HA 3MPUA 1RIIA 5DJ5A 1JZQA 5SYAA 1I14A 2O7VA 4DIBA 4DQDA 2PZLA 4H2DA 1DAKA 4BL5A 1KPIA 1T8YA 1VCHA 2WJJA 4QO7A 4IDOA 4QUHA 1KP2A 1T3TA 3ASZA 1YVUA 3CIFA 3FNFA 4DWVA 4NZNA 4NJEB 2H4HA 3OWHA 1N8KA 3LT5A 4TTJA 4C06A 2P9TA 5AVKA 5JJBA 3C16C 3S27A 4ZCLA 4IRMA 3KYJB 3PYMA 4ER6A 2N0SA 5KC8A 2XVZA 5T3UA 4PZZA 2C99A 2WQZA 3RIYA 4M0UA 3CVUA 1FJXA 3UGJA 3MM4A 2I2FA 5JHHB 4TLAA 1G21E 3NLLA 1G21B 1SMKA 2FUEA 3LS2A 1V6CA 4N0QA 4RZSA 4WSOA 5GM1A 5KS2A 2J32A 2OGSA 2QU8A 1U1EA 3EDRA 3U3OA 4XOIA 2C0QA 1COZA 2J09A 2PYIA 1GPMA 1FRNA 3IULA 4G97A 4MW1A 2XT9A 1Y4UA 3AJAA 2RGCA 1ZPDA 4MLDA 3NRCA 1T36A 1CZUA 1TQ8A 2PRIA 5J59A 4F72A 4BQIA 5C18A 3M6AA 2P4HX 1ENYA 4YMIA 4I5DA 3QBEA 5KOYA 1JDBB 4PYJA 3DUFB 4EFMA 1QU3A 5GMOA 2VOJA 4QLBA 4OGWA 2YOHA 3STXA 1KZYC 2C82A 3L7OA 2GBIA 3FCUB 3P9SA 2Q1YA 4MWDA 4FMBB 3MCAA 5EP2A 3V2HA 4EVIA 4QFBA 4X71A 1AVTA 1HG1A 5ICGA 1ZW6A 3TPFA 3M5CA 1YC2A 1WOMA 4RWZA 1XDWA 4WDQA 4DSOA 4R16A 2GO1A 4OQZA 2HJ9A 5H9WA 3ZI7A 1BU5A 1VLHA 3BTUA 4PZLA 4E12A 2HB6A 4G63A 3C8ZA 3M4NA 2IPMA 2NT4A 3BZBA 4S35A 1E9AA 3U4HA 1ZG3A 1WY7A 2YNMA 4L4RA 5KOJA 2OL4A 4J3FA 1ZL2A 1P73A 2PPVA 3SCZA 4K6GA 2CF5A 3I6QA 5A6VA 5I8WA 2QTWB 2Q7OE 4DMMA 4Q7MB 1OX5A 3VZCA 4KR3A 4LF6B 1ACMA 1DMRA 1YOVB 3OM0A 1YDHA 3H83A 4P3XA 2CZQA 4S1NA 5ALFA 3SQNA 5KOIA 4ZZIA 2AE2A 3RFXA 1UOQA 1ZDMA 3OCWA 4PZUA 1KK2A 5E1OA 2GLTA 3UMBA 1EFPB 2X2OA 3OTOB 4HOYA 4V3BA 2G83A 1YOBA 3GF4A 4OAQA 2EU8A 2Z6AA 3COZA 1K3FA 1GAEO 4OLBA 3P2IA 4RD1A 2GZHA 4YACA 2Z8YM 1C29B 3T94A 3ADDA 1BO6A 1E98A 1K88A 1XZPA 4IQGA 3NGLA 4RLFA 4DHWA 3QY0A 1KDTA