3T7TA

Crystal structure of complex of sah and bvu_3255, a methyltransferase from bacteroides vulgatus atcc 8482
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
b'NLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESVWFTDQRPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFILPENCWIEHYFAPQAKAEEIFRRKHAGSRIVEELITSNHHEAELYSKYKAYYGYAFFICKKGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
molecule tags Transferase
source organism Bacteroides vulgatus
publication title Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
pubmed doi rcsb
total genus 77
structure length 245
sequence length 245
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t7tA00
3A26A 3I5UA 4X41A 4MIKA 2CWWA 2QYOA 5EKXA 3B5IA 5FWDA 2CMHA 1JQDA 2IPXA 2P7IA 3G2PA 5CCBA 3KR1A 3UA3A 1DUSA 3DTNA 3LBFA 4X63A 5DTQA 3CVOA 5IH3A 5DSXA 3KPWA 4U7TB 2Z6QA 3I9FA 1ZG3A 4DMGA 3DR5A 5FUBA 3THRA 1NBHA 4PONA 1D2CA 2YVLA 1AQJA 3I58A 3GWZA 5KYGA 5CCXA 2GLUA 4PYOA 3E05A 1JG1A 3CJRA 5EOVA 5KS2A 1ZKDA 3BKXA 1VL5A 4K6MA 4PCAA 3ELWA 2OYRA 1T43A 2IDJA 4AX8A 4KW7A 3CC8A 5E1OA 4PIPA 5EPEA 3FTCA 3LPMA 4ZTBA 5HIMA 5T64A 4DF3A 3GNLA 4F86A 5F2NA 3KQMA 4XCXA 5DRYA 1O54A 4PYQA 3VYWA 3T7RA 3K6RA 3G7UA 5D1HA 1JSXA 4QQNA 2OY0A 5E1BA 4E2WA 5K03A 2B3TA 2AOTA 3TLJA 1JQEA 1NW6A 3L8DA 4FSXA 5FHRA 4PNEA 3FPJA 3DULA 3G89A 2FPOA 4IV8A 5CVVA 3KPUA 2QM3A 4DCGA 3EVZA 3MERA 4FT4A 2IH5A 1XCLA 3BGDA 1RJEA 2FRXA 5FA5A 2ZBQA 3BGIA 2AN3A 5CVDA 5LQRA 2NP6A 2ZSUA 2OB2A 5DM2A 2H11A 3FPEA 2FK8A 1RI4A 2E5WA 3I64A 4HC4A 3SSOA 1H1DA 5E9JA 3CCFA 4F84A 5FQNA 4E70A 1P91A 1R8XA 5LQUA 2JJQA 4FT2A 2I62A 4B17A 4YUXA 2XBMA 3FTDA 3UJCA 5E1DA 3HCBA 3OFKA 4OA8A 1EJ0A 3EVAA 3EVFA 4RX1A 4YMGA 3GIWA 3H2BA 3OU7A 4C06A 1XCJA 2YXLA 2R3SA 1VBFA 2AR0A 5DTRA 4GOND 2ZZNA 5LQCA 4GF5A 5FQOA 4YUVA 3G2MA 4BLUA 3QV2A 3DMHA 3CJQA 5JUWA 2O06A 2VDWA 3MAGA 4L7VA 3KQQA 4FR0A 1VQ1A 3EPPA 2EG5A 3RIEA 5LQJA 2ZIEA 3FZGA 1X19A 3KPYA 3P2IA 4OQDA 4HRAA 1AV6A 2H1RA 3MGGA 3NTVA 5K8VA 4CKBA 4MQ4A 5EMKA 1B42A 1KXZA 1JR4A 2UYQA 3U81A 2YX1A 1M6EX 2PX4A 5T67A 1WY7A 3B3FA 3GRYA 4HSGA 2O57A 4DQ0A 2ZIFA 3FUUA 3TKAA 3G2OA 2ERCA 1XDUA 2AOVA 3QOXA 4P7GA 1N2XA 5ICGA 1X1AA 2P3LA 3JWJA 3FPFA 5HEKA 3TR6A 2VS1A 2YXDA 2AOTB 1YZHA 2JHAA 4R8SA 5K0CA 3NWBA 2HMYB 3KQTA 3HVKA 4YUZA 4EVIA 3MCZA 3UJ8A 2B2CA 4NECA 3GCZA 3EVGA 2HWKA 1KYZA 3G88A 1MJFA 1WXXA 3OZTA 4QVKA 1FJXA 5LQNA 1G8AA 2HR1A 3V97A 2PVCA 4PYKA 3UJAA 4E2ZA 5BXYA 3A7EA 1VLMA 4Y30A 1L9KA 4YUYA 2F8LA 1O9HA 3TM4A 1EIZA 3LCCA 3UBTA 3DXYA 1RJDA 1WG8A 3ANXA 3FUWA 3LKDA 1ORIA 1PRYA 3NJRA 5K0GA 3NWEA 5EZSA 3FPHA 3B3GA 3HM2A 4V0QA 2P7HA 2PXXA 1L1EA 1WXWA 3X0DA 1ZHFA 2FHPA 2ZIGA 3B89A 4G56A 4U7PB 4YV1A 2NYUA 2PLWA 1L3BA 2PX8A 3BWBA 4IV0A 2P3OA 5GM2A 3O31A 3SGLA 1FPQA 3TMAA 2HTEA 4ER7A 2WA2A 3DXZA 5HIJA 1G55A 3HA7A 4E2XA 3C3YA 1R00A 4P58A 4PWYA 5ERGB 2A14A 3TQSA 4EMSA 3P9NA 1XDZA 5KQSA 5LQAA 2IH2A 4PYMA 1G38A 2IGTA 1KIAA 1L3CA 3ELDA 3EVBA 1Z3CA 3M6VA 4C08A 4FP9A 4C4AA 2HNKA 4MWZA 3PS9A 1YB2A 5CUQA 3SSMA 3LGAA 5GIPE 4BY9E 2B78A 1F38A 2O05A 3IYLW 5JR3A 5K05A 1JTFA 2NXEA 5FCDA 4GOMD 2N47A 1ZQ9A 3PTAA 5BP7A 4BP1A 2ZZMA 1VIDA 1PJZA 3THSA 2CKDA 1Q0SA 1I9GA 2Y1XA 2ESRA 1AF7A 3G2QA 4WVLA 5DRTA 2JH9A 4RYLA 2C7OA 3GO4A 3HCAA 1VP3A 1XTPA 1N7JA 5EC8A 1TW2A 2OPBA 3EGVA 1U2ZA 3G8AA 3KR9A 2ONYA 4ER5A 2AOUB 5HOQA 3TKYA 1SUIA 3KHKA 4LG1A 2PT6A 5K0FA 3FYDA 3MTIA 4Y2HA 3HVHA 2ZLBA 2ZFUA 3SSNA 4CKEA 3UWPA 4A6EA 5HZMA 4XUEA 3SMQA 2EJUA 1QYRA 5BW5A 3SM3A 3CKKA 2IH4A 1UFKA 4PGHA 4CKCA 5E2AA 2NXJA 2IDKA 3A4TA 2G72A 5C1IA 4P7KA 2UYOA 2P40A 2XYVA 3OU2A 5CD1A 3I53A 3KPJA 1RJFA 5EKUA 3BWCA 3T7TA 4C07A 5EMLA 1M6YA 3R0QA 4YUWA 5EMJA 5P8WA 4GC5A 1SQGA 2JG3A 2C7QA 3R3HA 2XYQA 3DP7A 4GOLD 5G02A 2P3QA 3F4KA 3KQVA 3FTEA 2OO3A 2ORED 3LCUA 3DXXA 3QOWA 4M36A 3NMUF 1BHJA 5K0NA 3MHTA 1RJGA 3BWMA 3OPNA 1OR8A 3EVDA 3CJTA 3OFJA 4V0RA 2O07A 3M33A 3Q7EA 2G1PA 1I1NA 1JG4A 4RTNA 3S68A 1KR5A 3TPZA 5DX0A 5FADA 4P7JA 2XYRA 2VDVE 3GJYA 4FGZA 3OCJA 4RTJA 3UFBA 2CL5A 1HMYA 2ZZKA 3DH0A 3GRZA 3KR0A 5GINE 3C3PA 5GWXA 3P9IA 3O7WA 5DX1A 4Z2YA 4AZSA 2ZBPA 1BC5A 2ADMA 4M37A 1G6Q1 2ONZA 4PYNA 1D2GA 5ICCA 3BWYA 2I7CA 3M6UA 3AY0A 3AXSA 5U4XA 3GRUA 2AN4A 4BLWA 5DXAA 3KQYA 4OBXA 1NE2A 2NNWB 2ZVJA 3KPVA 1SVUA 3FUVA 2GPYA 3HVIA 1ZGAA 3B7PA 3LL7A 10MHA 1O9GA 4RV9A 3P9CA 5E9QA 2UYCA 3B3JA 5B1SA 5GIOE 5E2BA 1ZGJA 1QAOA 4OA5A 5E8RA 2PY6A 5DM0A 3UZUA 3VC2A 4LECA 1KPHA 3BUSA 1KYWA 3ID6C 1R8YA 1BKYA 4KRGA 4O29A 3DOUA 1NW5A 3DLIA 1JG2A 2PT9A 3EMDA 4JXJA 3PFGA 2PGXA 4KIGA 5K09A 4RTOA 5KVAA 2YXEA 3NDJA 2QRVA 4QTUB 2GA9A 1XXLA 2AZTA 4POOA 1NT2A 3P8ZA 3P2KA 1R6AA 3GRVA 3JWHA 3KQWA 1KP9A 1XDSA 3DUWA 4OQEA 2AOWA 2VP3A 3PVCA 4CXMA 3E8SA 5EIWA 2R6ZA 1L3IA 3PT9A 4FS8A 5EGSA 4CTKA 2G71A 2EX4A 2H00A 2LD4A 2XVMA 2PV0A 3OE5A 2AVNA 1V39A 5F2KA 1RI3A 4DA4A 5CVJA 1DL5A 3E23A 1X1DA 4QDKA 1BOOA 2OZVA 3OU6A 4CWAA 2FYTA 4HTFB 4EQZA 2IBSA 5FHQA 1TPYA 2Y1WA 2C7RA 3LECA 2JH8A 4E2YA 4E31A 3M70A 3Q87B 4FSDA 2VZ9A 1NV9A 3KR2A 1ORHA 1X1CA 2B9EA 3LX6A 3BKWA 1IM8A 3NDIA 1R74A 4OX9Y 3GRRA 4LWPA 5DLYA 4HH4A 1EJ6A 5EVJA 3UA4A 1MHTA 1NV8A 7MHTA 2WA1A 3G5LA 4CTJA 1FP2A 3T7SA 2BZGA 3AJDA 3EVEA 4GBED 3UJDA 2JHPA 8MHTA 4RVHA 4BLVA 2JHCA 2V7EA 2PJDA 4ER6A 2P41A 3IEIA 3MCTA 4MTLA 5EG5A 3UJ7A 4MHTA 3KQOA 3MB5A 4R6WA 4X60A 3LKZA 3R6TA 4LWOA 3SXJA 3ERCA 3P97A 4DZRA 5LSAA 5K0LA 2Z6UA 3ER9A 5IKMA 4FZVA 4XUDA 2G8NA 1R18A 2FCAA 2GB4A 1RI1A 3EVCA 4A6DA 5FWAA 5K0JA 3RW9A 5DWQA 2CMGA 1YFLA 2ZWAA 1FP1D 1NKVA 5EEGA 3LHDA 4WXHA 5CVEA 3NVKI 2QE6A 2QRVB 4PCLA 5D1NA 2BH2A 4C05A 5CVUA 3A7DA 1RI5A 5HIIA 2ZCJA 3T0IA 2AN5A 2BM8A 5T6BA 2IFTA 3BZBA 1VP9A 2QY6A 1JSZA 3FYCA 4C04A 2P1DA 4PIMA 3MQ2A 3UJBA 3R24A 4UOEA 2AS0A 2IBTA 1QANA 4GQBA 1QAQA 3GXOA 1Q0TA 3FPGA 1IXKA 2IP2A 3A27A 3IHTA 4HTFA 2FK7A 3GU3A 4HGZA 5E8JA 1KPIA 2O0LA 5ICFA 3WSTA 3V8VA 4AUKA 4DM3A 2Z6AA 2DPMA 2P35A 3SX0A 3FUXA 5E9WA 4RVDA 4KIFA 3LCVB 3DLCA 3SVZA 3M6WA 4QPPA 2PWPA 2K4MA 2ZULA 4RTLA 5EQJB 2UYHA 9MHTA 2PXCA 1JTEA 4E30A 1P39A 2B25A 5HIKA 2NP7A 3HP7A 2Q41A 1Y8CA 2DULA 3PFHA 4R6XA 5FA8A 4C03A 3P2EA 1QAMA 1X1BA 2YR0A 3C6MA 1NBIA 3HA5A 1EAMA 3ELYA 4RVGA 4RVFA 3EGEA 1VE3A 3OZSA 1P1CA 3KKZA 1HNNA 3KU1A 1G8SA 2NXNA 1VPTA 3NVMB 3G8BA 4RSRA 1YZ3A 1XJ5A 5EHGA 4ER3A 3FRHA 3BGVA 5EEHA 3HA3A 2ZW9A 2GS9A 2AOXA 2BR3A 3KQSA 3PX3A 5K0EA 2YQZA 1RI2A 3LDUA 4RTQA 3SR4A 2HV9A 3K0BA 3EMBA 4X61A 3EEYA 5GM1A 2I6GA 5BW4A 5KQRA 5CIYA 4AZVA 4PYJA 1JG3A 2V74B 1NW7A 4PYLA 4F85A 3ORHA 1IY9A 2PKWA 3A25A 3VSEA 4RWZA 4R05A 3ME5A 3O4FA 1XVAA 4XUCA 5LQKA 4X1OA 3GDHA 2BM9A 2ZWVA 1M0EA 3RODA 2IIPA 4PGGA 5C9ZA 4GOOD 4HGYA 2OB1A 4H0NA 1NW3A 2EFJA 4QDJA 5F2OA 4ATNA 3FRIA 1D2HA 4GEKA 5EZQA 4RTRA 3PX2A 3JWGA 5EHIA 3FUTA 3UJ9A 3AXTA 3VC1A 3LBYA 5MHTA 3HCFA 5E1MA 2WK1A 3CGGA 4ISCA 4KVZA 1YF3A 3TM5A 4R8RA 1P1BA 3LSTA 5DX8A 1QZZA 2YUIA 2ZBRA 2OKCA 4KDRA 5K01A 1G60A 4RTPA 5DT2A 4E33A 3HCCA 4YV0A 2PX2A 5HILA 3TFWA 4RTKA 3GGDA 5CM2Z 3JWIA 2UZ4A 2G70A 2PWYA 3PB3A 4GUAA 1UIRA 3ER8A 1N7IA 5DM4A 2PXAA 3CBGA 4HG2A 1AQIA 5K0BA 3P71T 3EGIA 3C0KA 3P9KA 5LR6A 2P8JA 3M4XA 5DXJA 4EK9A 1JQ3A 3IV6A 1KPGA 3BXOA 4KDCA 1UWVA 4AZTA 4QVGA 1WS6A 2PX5A 4ER0A 2OBFA 4DKJA 1YFJA 1INLA 4M7RA 5FULA 3TRKA 3OZRA 1SKMA 4YMHA 3DMFA 2I9KA 2YTZA 3LDFA 2GAFA 5DPMA 5FTWA 5GOZA 4EKGA 3MTEA 5GP1A 2KW5A 3REOA 3E7PA 4YV2A 3TOSA 1SG9A 5EMMA 4E32A 3OE4A 1YUBA 1TW3A 5HFJA 1WZNA 3DMGA 2ZTHA 4IKPA 5DTMA 5EIFA 5M5BA 2EJTA 2OXTA 3BT7A 1F3LA 3PLAE 3ELUA 3HEMA 4QQKA 1EG2A 2XVAA 3D2LA 4P7FA 3C6KA 3HCDA 2BR4A 1FBNA 4PYIA 5DSTA 4BP3A 4RTSA 3HTXA 3G5TA 1I4WA 3HCEA 3NW9A 4KWCA 4QPNA 4QTTB 5DM1A 5H02A 3EEOA 1DCTA 4AZWA 3LDGA 1NW8A 1SUSA 2AVDA 2BR5A 3KQPA 4GC9A 4M38A 3R9XB 2VDUE 4EKIA 1KHHA 1SQFA 5ICEA 3M6XA 4RTMA 4IWNA 3FTFA 2GH1A 4PINA 2PSSA 3HVJA 3HNRA 3AWIA 4OBWA 1EQAA 2NXCA 2AOUA 5C0OE 2PBFA 2C7PA 3UJ6A 4DCMA
chains in the Genus database with same CATH superfamily
2H2GA 4K8OA 2REQA 2X6RA 2CXRA 1Z45A 4U2GA 2P1ZA 1G5FA 5FWDA 3THOA 1MEOA 4TXMA 1FK8A 2PJZA 4BZXA 3DTNA 2ET6A 2O9JA 2ZSDA 3FDFA 3HADA 5CDTA 2HA4A 4UE3S 2B5VA 5DTQA 3AKCA 3K2EA 5DSXA 3V42A 4IF6A 3PDJA 4MI9A 3WYNA 2A6PA 2XUOA 3MUEA 3A11A 2YVLA 1N5LA 3QEMB 5LVAA 1AQJA 1V41E 1ISGA 4H15A 4H6XA 5CFPA 3EG9A 4MQBA 3ZQ4A 1WD7A 4KO3S 3SS7X 4EA8A 3KOOA 3V7UA 2O8CA 4B3FX 1MBZA 1Y37A 3H87A 3P19A 4PAQA 4BP9A 5E1OA 1ENYA 1QR2A 1WO8A 3D2BA 2II6A 4JSRA 3EBLA 4DN6A 3RG8A 3VKGA 1G4UR 1H6AA 1QH8A 1EJBA 4V38A 1QMGA 3WLNA 2WIDA 3CZMA 3T9EA 7REQA 1SBZA 4Q9IA 4I55B 1W35A 1ZN2A 2O6LA 5DHRA 4JXZA 1ORVA 2IOQA 4FGJA 4PG6A 3AP1A 4D4LA 1J7JA 2NVUA 1M2JA 5JXWA 2P9CA 2DMRA 1ITZA 2XWPA 2ODTX 1SIWA 4MB6A 1MQ9A 5FHRA 4B4OA 3C4QA 4ZV4A 1KSFX 1GL6A 3WISA 2WM9B 2O5EA 4UE6A 1R5JA 2NVBA 4OAQA 3PPIA 2Q4DA 3HXQA 3FPCA 2ST1A 1GGNA 4CMBA 2YWBA 4OHKA 5YASA 3FR7A 2BDTA 1TD1A 3BTUA 4LBWA 5LYJB 2FZ4A 3IKMB 4BFLA 1KZ4A 3EC2A 1IUPA 3U19A 3IALA 3P0EA 1XJ0A 3T7EA 1SJ9A 2QW8A 4IZIA 3JQPA 2DTEA 4ID9A 1N6IA 2QWXA 2ZU0C 1GGEA 4FT2A 2HJGA 2JJ2D 4UD6A 4O0MA 4AX4A 4BNFA 1D1TA 4NFLA 4YUXA 5HUJA 5JXIA 4Y2TA 4EL0A 2VDPB 1C4WA 3HY3A 3M2PA 3DOEA 3O7MA 4ZDKA 3H2BA 3ZVNA 1MGOA 2JBAB 1NQWA 4OGGA 1USUA 2PK3A 3BF7A 3ZOZA 1Q22A 3T0FA 1E1CB 4F1WA 1G5HA 5AVQA 2VTKA 4HYYA 4OFBA 3CXRA 1OKKA 2WWVD 3TQHA 4CIDA 3DYVA 1C80A 4TX1A 3RK0A 4EBFA 4U2CA 3C7CB 4LTDA 4B9EA 2WJJA 2FZEA 1N1GA 5CJPA 1WZIA 4WOPA 2ZUFA 3WB0A 3IT1A 4OQDA 3FXAA 4HRAA 4J0EA 1DAOA 5B58C 1TEXA 2VF4X 3IUBA 3UEOA 5LIPA 1DQPA 4W1RA 2MHCA 3F2VA 3OOHA 1Y4DE 4XOUA 1V95A 4A91A 4NMHA 4ZCTA 2GETA 3ZHQA 4G0WA 5J59A 1ZC3A 4DQKA 3L7NA 4ZOQI 1PVDA 4MWEA 2X0IA 1TO2E 2X86A 3UHFA 1PEAA 1PE0A 2N9UA 4ERNA 1QJCA 1X94A 2AOTB 2DWCA 2W2TA 4Y2PA 1C3VA 2BGUA 1K92A 2I7VA 3V8EA 4AECA 1T29A 2WZCA 3KQTA 5AOCA 5SICE 1A8SA 1KI4A 2C57A 3M9XA 1SO8A 1RWNA 4QVKA 1KZHA 3COWA 1KJZA 2FQ1A 1JWAB 2NQ2C 3PVSA 1L7PA 5F73A 5AHKA 4ARZB 2JI6A 1O2DA 3RFTA 2QSYA 1DKRA 1W5SA 1WKVA 4QDZA 3FUWA 3KT8A 4GEGA 4RUKA 2UZ1B 5K0GA 1ABBA 1ADBA 2QMEA 1R0ZA 3CRRA 2A1UB 4MCAA 3N2NA 2HF9A 1MX1A 2V8OA 5SY4A 5EHXA 3P9XA 1UP7A 3IBYA 3AR2A 5EUMA 2TMKA 3QQ5A 4DVGA 3A3PA 4M21A 1GYPA 4M9ZA 4KH1A 2JCGA 2IF2A 2Y2VA 3ROKA 1IJEA 3IPXA 1BGWA 2EBWA 1PT5A 4BNKA 4YDHB 3IIMA 5EZ5A 4D80A 4MS3B 3HGMA 1LLUA 1T8UA 3PK0A 5KTMA 4NE2A 2I65A 4RJIA 3WRYC 5LBUA 4FGKA 4LVOA 3SSMA 1LWOA 1USVA 3H7AA 2OCXA 1X15A 3JTEA 1CSEE 2B78A 3AF3A 4ZI5A 5JR3A 4EHAA 4W5NA 1DKPA 3P0RA 4MA0A 1JZQA 2QYTA 3U49A 1FMTA 1PJZA 3OY7A 3BH7A 3VFDA 4H08A 3ROEA 4AF7A 2WE8A 3F90A 4YO8A 3HB9A 2QG9A 1Z0UA 2JH9A 1UT6A 2GCOB 2RGUA 4HQNA 4RYLA 1ZD3A 3V2GA 4BFTA 5C8YA 1TW2A 1RJWA 3X2FA 1QLHA 4J3NA 4E46A 3OH8A 1RYMA 4C2UA 3N8GA 3KHKA 1KMMA 2IF0A 4WFJA 2FPGA 1TL7C 3IA2A 1VMEA 3LZDA 4B40A 3EVTA 4IM7A 3T3NA 2YASA 2ZFUA 3MJSA 1GJRA 4JQSA 3TR0A 1R9JA 3SE7A 4AMYA 1F7UA 1JKXA 1QFMA 4IG9A 4U6QA 4A16A 2IUYA 5JD4A 1TJ3A 1GNPA 3NWJA 5JY1A 3FGZA 1ZL2A 3OLWA 4EYOA 3NYRA 4V0LA 4AS3A 2VYFA 5IN4A 2IZZA 1SVKA 1FU8A 4DXAA 5AW7A 1W29A 2XZDA 3E3LA 3HGTA 3AF5A 3VYUB 3ZWDA 3K1JA 1AT1A 3V7FA 4B75A 3TB6A 1UT5A 4QG3A 3AJRA 1UXHA 3A3KA 2X3FA 4DCVA 2F48A 5KYUA 4C07A 1M6YA 1JLHA 2VUSA 3TD6A 1C5KA 3HDYA 5NLLA 2ZRNA 2CY0A 2GCNA 4E09A 3O92A 5CK4A 2H1IA 1TLLA 2P27A 2XCQA 1KJYA 2O4CA 3ABZA 3IB3A 4M22A 2WT8A 4KK4A 5I51A 1TQ4A 1JEYB 4Y2XA 2QSJA 1OBOA 4RW0A 1VM6A 2QSUA 3ONWA 5FOSA 3T1VA 4C4PA 1U5BA 4F71A 1P2GA 3VC3A 4QU8A 3SR0A 1TT5B 3G2LA 3ACDA 3LZ6A 4B74A 1F60A 4V0RA 1T0BA 3PNPA 3QLUC 3OPYI 4JUFA 3VR5H 3SFVA 4IEFB 2C2GA 2YZMA 2Q49A 1RM0A 1LF5A 2ZRJA 5AP9A 3VU9A 3ZWVA 2F55A 4ZODA 3HR4A 3WDKA 1P74A 1ZRNA 1HDGO 1C8LA 3WP0A 2QTVB 3COPA 3UM9A 2BY4A 1XVLA 1LKZA 4Y67A 1ZRMA 4B81A 4FNMA 1M5UA 2GYVA 1M2OB 5JJBA 2NM0A 2B1RA 2PUCA 1K8RA 3TQFA 2J7PA 3K0AA 4V1CB 5I7SA 4P6VF 5DW3A 2ZVJA 1B8OA 1IK4A 4L78A 3A6LA 4A0SA 4QWWA 1KK2A 3PYLA 2NADA 4JP2A 4PS0A 3WBBA 2AFIE 5L3QA 5GIOE 4UUQA 5ALGA 1ZGJA 4Q4JB 3VC2A 4NPCA 2PY6A 5AOAA 1J20A 4NBKA 4KR3A 5HCIA 1K7SN 4XB1A 1PR5A 3ZWXA 1M2FA 3FGNA 3IRVA 4QOJA 4V2UA 1NW5A 4ZRDA 1I0IA 4LJRA 2JGIA 3PFGA 2L2QA 2FP4A 1J70A 2BUBA 3PT5A 2YXEA 3IQIX 3CUTA 1YL6A 4FX5A 1TM5E 3R7LA 4EY5A 4LXQA 4LISA 2A88A 4C6SA 2QQFA 1FU4A 4MIOA 3G9QA 1CNFA 1LTHR 5EIWA 4YRBA 1L3IA 3LKBA 1A2BA 1J8MF 2LD4A 2NV2B 1UEXC 2XD4A 4ZRMA 5G3YA 5EFOA 4E3ZA 2VQ3A 1E9AA 1H2ZA 3DGFC 3F6RA 4F0JA 4F60A 1T13A 3B1JA 3Q88A 3CE9A 1THTA 2BE7A 3EH1A 2HK9A 2OCAA 2XB9A 3MD9A 3B1KA 3MWKA 2IQIA 4NZ9A 1RYYA 2X5NA 3ZK8A 4BBAA 2HT1A 3MCUA 2AFHA 1NQVA 3NHWA 3K1TA 4L3VA 1HE4A 1L8OA 4FSDA 3L4SO 2W6QA 3CNEA 1JAXA 1UPUA 3ZHZA 3ZWNA 1DAHA 1HWYA 2Q4RA 2ZJ0A 3FWNA 1R74A 1AKVA 3GZJA 4MKFA 4YS6A 3T1OA 2CL0X 4C43A 5H8WA 4DB2A 1NV8A 5JYBA 1GPLA 1WCIB 5JATA 2I1VB 4I4TF 1X8XA 5IM4A 1SCIA 2PGLA 4LBZA 4RK5A 4MW4A 4EYKA 5LLDA 4YASA 1VKHA 5ADUS 3KJEA 1NJ6A 4H16A 3OCXA 4HXEB 1ZUHA 1TQ2A 4MULA 1SKYB 2CEAA 3SXJA 3U31A 3NGXA 3U1TA 5JSHA 2IOFA 4KBGA 1DRUA 1E3IA 3WIUA 4NU0A 2FCAA 4ZT7A 4LF6B 5KKCA 1CETA 4EEZA 5K0JA 2XCSB 5DIFA 1EX6A 4JBNA 3PC3A 5B55A 2WYVA 4KVGA 1YFLA 4J6EA 3NKLA 1IVNA 3AIKA 1N33B 2JIPA 3DS8A 4ZVLA 1O95C 2HAEA 4UZEA 2QRPA 2FX2A 3OPVA 3N2IA 3B70A 4HZUB 4CV2A 4YJ2F 4RHXA 1XZMA 3B1YA 2BELA 3RVRA 3FPBA 1ZVJA 1NJ2A 4Z9XA 3I9V1 3B1FA 1UBFA 2ZSFA 1BD3A 1NXOA 3I6IA 1FTSA 3F6PA 3BRQA 4LNUA 5CA1F 5JYEA 2WLTA 4FE7A 4GM1A 1GPNA 4FLMA 2ON6A 4HNUA 3QBVA 2GCOA 1HLDA 1YK1A 2PMBA 3GA7A 4KQ1A 2ZVPX 5ALLA 5E8JA 4ZEOA 3ETEA 2W2LA 3IESA 5ICFA 2RJNA 3LVBA 1N9ZA 1C50A 2ZUDA 2EFGA 3W6OA 4LSWA 4EYQA 1G8GA 5IW8A 4F5WA 4YJHB 2ATCA 3AR9A 1XZ8A 2HU2A 2PXCA 5C53B 1OAOC 3HY4A 4FDAA 2EATA 1EFKA 1LFAA 4AZ3A 1X6VA 3UWKA 2CJWB 4R6XA 3LT1A 4HUQA 4AKGA 4PFKA 1B8PA 2Q0XA 2GZ2A 2VAWA 3ZG6A 1H4VB 1QO0D 5C32A 2Q6OA 4YRLA 5JARA 5B37A 5FTJA 3J81A 3HYLA 1ODJA 2V8BA 3RQIA 2RE8A 1RMYA 2P5YA 1VPTA 1E5LA 3H2KA 2ZAMA 1IUOA 5I8ZA 4EHIA 5KYUB 1YXMA 1C9KA 4ER3A 1XNRB 4Z2AA 5D7NA 4ASUA 3OOJA 4LCBA 3WFIA 3QU9A 4M53A 5I9BA 3OCUA 2EW8A 1PT9A 3UBMA 1UBGA 2ZP1A 3SHFA 1DBIA 3PKZA 5KAPA 3SM9A 4LDRA 3PUXA 3AHIA 5B3AA 3R2JA 4B34A 2D62A 1QWSA 3TH5A 1KI9A 3I2GA 3LL4A 2NZVG 2FFJA 2PKWA 1GRQA 1RP1A 1CEYA 3WKEA 1COWA 3WLQA 3Q7QA 3LLCA 3WMWA 2XUZA 4X64B 3BSYA 4R51A 4L57A 2AJTA 3L01A 4B3DA 1CUVA 1VPEA 1O5IA 4PGGA 2JEOA 3DDCA 5LBIA 1N2CA 4H0NA 1S3SA 3H2YA 2I67A 4HB4A 3VA7A 4Q12A 2ABWA 4G0OA 4JEUA 5EZQA 2KBFA 4BB6A 1I2CA 3UG6A 1JIJA 2Y76A 1DXYA 1GITA 3H19A 1I24A 4O8ZA 5E1MA 2RONA 3VAZA 1KL7A 1DJMA 2IYQA 1WHTB 4MV6A 4O63O 1IBLB 3ON5A 4MX8A 1SUAA 4IKOA 1MJGM 4QXAA 1VB3A 3LUJA 1VSVA 4PXAA 2IIVA 4RDHA 1M34E 4JBWA 2BRUC 3TLYA 4KVFA 5A2GA 4F97A 3HCCA 4N6NA 3MXTA 5HILA 3QTBA 3C1TA 3W2GA 3AINA 2UZ4A 1POWA 4UDXX 5CH8A 4I55F 1GPDG 4L5JA 2WM8A 5CDFE 1IXZA 2E1PA 1KP2A 5DOVA 1WUTA 3EF1A 1B8NA 1TRHA 1CUUA 2C2ZA 5L9AA 2I9KA 1PEYA 4YT8A 1V9LA 1HFKA 2GJSA 1I33A 1T9CA 2O8CB 3KKEA 4AZTA 5INTA 4NENB 3ISVA 4F3KA 1S4MA 4EY6A 5LP1A 2DQKA 2FLKA 2DLCX 4OJMX 2A35A 2E37A 1Z2CA 4KQIA 4KYVA 2OFWA 2RAPA 1L5VA 2O5RA 1GZ6A 5J1SB 4X91A 4YAUA 1TVMA 3ZD6A 4N5DA 3SE0A 4R5HA 4LHSA 1V11A 1EGQA 3HKBA 1QHEA 2IHBA 4HWSA 5DNCA 1NLZA 5B12A 4I5GA 1DKMA 4K9MA 3GGGA 4GICA 4NULA 3R7BA 3GELA 3AIOA 2DR0A 1N2JA 2G36A 1LK5A 3R5TA 5LYJA 1VFNA 4BX8A 4EH1A 3CLRD 4JL5A 2Y6UA 1MAUA 1SH7A 4TMXA 2AKEA 1QYDA 1RWVA 2E6KA 2Q4OA 2TSYB 5ALEA 4A8JC 4EHJA 2GZ1A 1ZEMA 4OY3A 3PGLA 1H05A 5C1OA 4GC9A 5DNEA 2GHIA 5LUBA 1WCIA 4M1ZA 2AKYA 1LRJA 5F35A 4KREA 1S2GA 1RYBA 4UMVA 3CZCA 2XGGA 2C7PA 4OB8A 5TMPA 1TMKA 2YZGA 2FF5A 1JQDA 3PNQA 4HN9A 3L7KA 2MU1A 2QLNA 2ZI3A 4OMFG 5D6NA 1U1FA 3V1YA 2IHVA 3LA8A 3PGVA 3E9ZA 2VYCA 3KKNA 4L6CA 1BE6A 1I2ZA 5KVSA 1L5ZA 4TWJA 4H1WA 1AKQA 2GJ4A 2DQ4A 5KX5F 4PONA 5HWSA 5HQJA 5CCBA 3R5FA 3CZQA 3QX8A 2YWXA 2B4RO 4N3CA 5EWLA 2O0JA 1A5BB 1BMFA 3JYNA 4JB2A 4KHZA 3VR3D 4EUHA 1FTNA 1J9GA 1Z8FA 3EFOB 4UVGA 1OFTA 3DL2A 3PNLA 4OOFA 4OHCA 2E1RA 2HX1A 1KEPA 1P8JA 1E9DA 1MZPA 3REFA 2CD7A 4CKWA 3LPMA 3ZY6A 2JHGA 4HWGA 4NAHA 5BWLA 5HSGA 2O20A 3FYSA 3KQMA 5F64A 4RVUA 4PZZA 1O54A 3HV0A 3I2IA 1CD5A 4YGYA 2ZUBA 4S1PA 5FWXB 3RNLA 1N5KA 3EGOA 3H11B 3MRXA 5L8VA 1Z7BA 2FG6C 4UM5A 3ENNA 3O5AA 4YLGA 2OV3A 3ZDZB 2VPQA 2WV9A 1BA2A 1DKLA 1VHTA 2QM3A 1DIRA 5G40A 3RQSA 3MERA 3UB3A 2P4SA 4GM0A 4A0RA 1XTBA 3WIOA 2P9ZA 2AN3A 4RMJA 5CVDA 4OBEA 1RKUA 1PL8A 4ZI3A 4LQCA 1IBCA 1V8FA 3D4NA 5CA0F 3LYHA 4V03A 1D6NA 1YZFA 2AN9A 2Q9CA 1CP2A 2J3IA 3JQBA 3LY5A 5LQUA 1GG5A 4TVSA 3FZQA 3AUJB 2GDZA 2WKWA 3DOCA 4IGAA 4JB0A 1PG0A 5ECYA 3NUZA 5KTNA 1GZDA 4ZCQA 2G88A 1AOXA 4CG3A 3OTOB 4RPGA 3PF9A 1A9OA 3ZKAA 3W5AA 2RARA 2YXLA 4O4LB 5ECGC 1Y1LA 1SG6A 1XZIA 4CGZA 3U4QA 3X1JA 2QLLA 4YHHB 3PD1A 3SI7A 3LC1O 4FDTA 5AHOA 1V16B 2O06A 3OSZA 5A5GA 1PSZA 2E5LB 2HT6A 2E4AA 2XI4A 3CONA 3VOTA 3C43A 1VLZA 1PK9A 2CJXA 1DX6A 1D4AA 3I9JA 2JVKA 3M4YA 3EG9B 4DLBA 3T5AA 3GEHA 2HKIA 1EFPB 3RS0A 9ABPA 3FJOA 3R7FA 1ONSA 3R6DA 2PZ8A 3W6UA 1KBQA 5EMHA 3O26A 1OB2A 4PNPA 3U81A 2QX8A 3OEHD 3LWBA 3NATA 3DEIA 3X2EA 4XVQA 4HSGA 2BM1A 4PG7A 3RYFB 2MDTA 4FYHA 5FUMA 5AJZA 3JASA 4BNNA 4Q00A 1RCTE 2HV8A 1TU4A 3S0JA 5BR7A 2FAXA 5HX7A 3SF0A 4L3WA 4QLBA 1XJWA 3UAVA 3JAMA 4MQMA 2EHDA 5CDYA 4UQOA 1Q20A 1DELA 4DA6A 2FPRA 3WOVA 3QY0A 1GSIA 5E38A 4NXMB 2XTNA 5FKJA 2JAXA 3OZTA 3KSMA 1FJXA 2HR1A 4C3UA 2D13A 4E2ZA 1GZHB 1JHXA 1U5CA 4X7MA 4G0YA 3L1KA 4FEGA 4P08A 1DC5A 1V8BA 2UYYA 3IIIA 4FYJA 4QFBA 3UMBA 1KDRA 3H5WA 3DCIA 1HT2E 4B48A 4QLOA 3MUFA 3AY3A 3BB3A 5EZSA 4ZMRA 3IL2A 5JD6A 3L4BA 4ASUD 5LP6B 3O03A 3QWHA 4I4IA 3DVSX 1BE0A 1EUZA 3E1GA 1L3BA 4XEHA 5ILOA 3D4PA 4I1PA 4R2HA 4KTVE 2VNKA 3EDMA 2XUAA 4HZGA 3UAYA 3TFOA 1BS9A 5HNKA 3L8YA 2CJYA 4E2FA 3DXZA 2VWHA 1S7GA 2QPOA 1UMBB 3PC7A 4OHMA 4X84A 3SYNA 2MSNA 1G7CA 3WWDA 4E2XA 1QGYA 2EFCB 1PLKA 1R0YA 1RDFA 2FPUA 4AO6A 3ODGA 1J1UA 3RASA 2IGTA 1JBQA 4HMPA 3EVBA 2FZCA 1JA1A 4UNQA 2DKNA 3COVA 2IZOA 4MWZA 3PXBA 1EIWA 4ZCPA 1A2OA 1U7XA 3C98A 4BOYA 1F38A 2JFUA 3OF5A 4A3SA 4EZBA 1IG3A 3WK6A 3M6FA 2R66A 5JS8A 1GLNA 1JXMA 1URPA 2ATIA 2QUBA 2XQKA 1XJQA 4MUGA 3FZYA 1GHTA 4H1VA 1EX1A 1GKLA 2CKDA 2L19A 2FUEA 1V47A 2RJ3A 1XZCA 4JLNA 5IX8A 3ABSB 2OVBA 3JZFA 2QRHA 3L2OB 5IDVA 3QSYA 5DLDA 1ZOPA 1UIMA 2FFHA 1LBIA 3G7SA 3JAKB 3UMJA 2B8TA 3QFTA 3K72B 4LTMA 2G6TA 1ISPA 2O7VA 5KUTA 4G0VA 3HUTA 4LG1A 5AQ1A 1H1TA 1GUZA 1KE2A 1EUCA 1GADO 1HE3A 2VJAA 3K0CA 1U2EA 5JSUA 3OWOA 4URHA 2IDZA 1P4AA 4AN0A 2O0KA 4XUEA 1LI5A 4BKRA 4D98A 5BSKA 1W8DA 5IG2A 1P29A 3ZE7A 4PSKA 1NVDA 1A7JA 2XMBA 3F71A 4FUQA 4ND8B 1E5DA 3U7HB 1BE1A 5C1IA 5DFAA 5H80A 2XYVA 3DWGA 1Z5UA 4J1QA 1TNDA 3GBVA 1I5RA 1V37A 4K2AA 1PJAA 3Q7RA 4CE6A 1SHLA 3WK5A 3QELA 5CLIA 4GFDA 4OKIA 4PO3X 4X92A 2O2DA 3OE7A 2P2YA 4HDCA 1MAWA 2G9NA 4AN4A 5BN5A 1WHSA 5IH7A 3CUWA 1NJGA 3K09A 2WHYA 1JLKA 4EI2A 1Y1PA 5FPQA 3LCUA 4CMEA 1LQTA 4GP9A 2ZM5A 4PZPA 4GIBA 3CG4A 1GNRA 2VEOA 1V3QE 4YLYA 1MV5A 2ACEA 3C7KA 3E7DA 2VPYA 1J8DA 3IUSA 1VIAA 4MOWA 5FR2A 3IAM1 3UHAA 5AM2A 2PG3A 2JA2A 3CJTA 3OFJA 1R0KA 1ZA1A 3HYNA 4EW2A 2OOKA 3EDCA 1ZWLA 2HQSA 2Z98A 3A1WA 3NIFB 2GBIA 5AKYA 2Q50A 1KZ1A 5JNVA 3LS2A 2F1RA 3OCJA 4MINA 4JB8A 3LK7A 2Z2KA 4P5PA 4Y9UA 2R6R1 1B41A 2A78A 2GM3A 5AVUA 3FKSA 5M29A 4PZLA 4P8RA 3OZAA 2XUKA 5DX1A 1AQNA 4UCQA 2V4ZA 4Z6KA 2RB5A 5F1OA 1EGVB 4M54A 1FJGB 4EELA 1N6KA 2QU7A 3OF2A 2NOAA 3CU5A 4PYNA 4XXHA 3V34A 5LKRA 5KTRA 3KL2A 1TUBA 3N8HA 1U3UA 3DV0B 4K1LA 2LPMA 3LRXA 4CEHA 1N8SA 4ESVA 2KWIA 3VO2A 2IOFK 1YS2X 5DXAA 4QZVA 3WE7A 1ODKA 3H9GA 5KJCA 3LL7A 4RNCA 2UYCA 1O77A 1JZSA 3MBKA 3PC6A 3VNUA 1P9RA 4LYFA 4KO1S 1QKJA 1WNTA 4EMUA 1XMJA 2X0JA 1T4CB 3QVVA 3QBDA 5JS2A 2JATA 4BNGA 1Q16A 2GKOA 2PVPA 1M6WA 4W9RA 2A2ZA 4MYUA 5ALWA 5F7OA 1T0HB 1TZMA 2YV4A 1CY6A 5TEWA 5IJXA 2HSGA 2G40A 2OG2A 2PMDA 3I0NA 4GGMX 4J4HA 1M2EA 3WA6A 3EN0A 4BBZA 5JH7F 1KQPA 3PVCA 5CB4B 2PWZA 2ZJAA 1TA0A 1DTSA 2TECE 3HKDA 5AIAA 4CYMA 4GRAA 4QPDA 1FFAA 3MJTA 4HNAA 2WD9A 4RMGA 3ANSA 2VEDA 1H2RS 1II9A 1LC3A 1OWMA 2QLTA 3HRKA 2OZVA 3HU3A 1E0KA 2YXBA 3ET4A 4FOOA 4QDXA 5CR9A 4K46A 3FR8A 2GZSA 3IELA 2R5FA 4LKRA 3PC2A 3GFTA 1NM5A 2ZBEA 3M70A 1WDMA 3U0VA 5AJWA 3U4MA 3FWZA 3GUZA 4R8LA 5L6MB 1Z4NA 4DC1A 2FE1A 3BH0A 1U8ZA 2WM3A 3B1WA 2CJWA 2PHZA 4U9HS 2OBBA 4FOLA 3G5LA 3N2EA 1VRCA 5AJTA 1ODTC 3THWA 3KC2A 1W9MA 2I03A 5JNUA 1LJUA 4NPAA 1YRWA 1KYTA 1KZ9A 3JATA 1AZSC 1U3FA 4ZFNA 2BEUB 2FEWB 5IFKA 1DHRA 3LQQA 3S1SA 1M1NB 3RSCA 1RMQA 6YASA 3ICWA 1J8QA 4WT7A 3WB9A 3B78A 4BV9A 2M6LA 1E0SA 5FL7A 3KTAB 3KVOA 3KAQA 1FRQA 3EVCA 5TGTA 3W8FA 3T54A 4OREX 5EJ9A 2ZIXB 4HBZA 2VF8A 4NK4A 3GBSA 3W3AA 2W6JA 3T06B 4M1KA 2F90A 4N01A 3TIIA 2XV1A 1QIFA 5EZYA 4RHEA 1JR3E 4EMTA 3CH7A 4DNOA 5BQXA 4KGZA 5HIIA 1OT3A 1KVQA 4YT5A 4AS1A 4PV7A 2X9NA 3C8ZA 5AIBA 4OHZA 2BFEB 4TV9F 2QY6A 4GLOA 3OD5A 2AXNA 1N0UA 3ANTA 4R83A 5CW1A 4PPFA 1UBHS 3F5MA 2FB9A 5K20A 4GQBA 1PR9A 4TWAA 5KINB 4KSCA 4WKNA 1T6XA 1ZMXA 5LDHA 2WWRA 4YHBA 3U0BA 1GT6A 3LOUA 2IYLD 2ZQ5A 2P35A 5JAZA 4A36A 3RSOA 1SN7A 2J41A 2AFHB 2XD9A 3CWCA 3DOIA 1W4ZA 5C5EA 1P2SA 3HCNA 1D2MA 1XAIA 1KY2A 2Q2NA 1WEKA 2OV2A 1XNHA 3TRHA 1JTEA 3L0SA 4XWOA 1C3EA 3QSGA 1ONPA 2QVBA 3QE4A 4XFKA 1H0KA 4CMGA 4EENA 3JWPA 3ZU2A 4RVGA 1F4VA 3MMXA 4IQFA 3BWDD 5BMOA 3PKJA 2IYEA 4FLEA 4UU0A 3WRYA 5IJWA 2A57A 3KU1A 1JS1X 4AJEA 1WSWA 1KEUA 3HYTA 2JIZA 5JQWA 5IWAB 1G98A 3UN1A 1E2JA 3SX4A 1HFEL 4P7BA 5EQTA 2XMSA 1F2TB 3UK6A 2DT8A 1UH5A 4GI5A 5JCOC 2AMFA 3LDUA 2LUOA 3VYTB 1HQYE 1U7ZA 4FKMA 5D6OA 3U80A 1R6TA 4KXLA 5KQPA 1C4KA 4TVOA 5ALNA 3GCDA 4M6WA 4YREA 5CH3A 1RXEA 4R1QA 1QYWA 3O74A 4BUJA 4UW9A 5ECWA 3U7QA 2ZYGA 1QK4A 4RPJA 4ED9A 4KNWA 3BAZA 2JAQA 3NDPA 4PO9A 1KVRA 4RLFA 1SY7A 4I8IA 3TXYA 4D97A 1GD1O 5LLTA 4BXOB 2W8BA 3P20A 3GDHA 3QVGB 1ZM4A 2QJTA 4B3RB 2O0HA 4P82A 2OO7A 3VJRA 4CM8A 1UKVY 1EVJA 3SQNA 4F3YA 2GD6A 1U8EA 1G6OA 3Q15C 2EJCA 3TSYA 4YRKA 5IUJC 3HJCA 1CJVC 1EWRA 2XKKA 4MR8B 3OC6A 1EX7A 3F7TA 1SCDA 1XZQA 2VBIA 2ZIAA 2WDPA 2C4HA 4G9GA 3SIRA 4Z51A 2BC9A 2WG2A 3M82A 3OQNA 3N59A 2NZJA 2O19A 1H8HD 2X1MA 2EJVA 2EW2A 3BRSA 3DMPA 4A0QA 1B73A 4DGSA 1ZAYA 1JHDA 1P1BA 1QCYA 1K08A 1Q12A 1S8NA 4YEDA 1CW2B 1GCUA 3TLCA 3AIMA 2OKCA 2XNCA 4K9DA 4OLFA 5BNZA 4P4NA 1WEHA 4HAUA 3ECCA 2AUMA 2HSJA 3GJ8A 3K20A 2BFBB 1YDEA 2Q9AA 4JIGA 4L8GA 2C4TA 3CS3A 5AH0A 1QG0A 4CN9A 3PDIB 4IDFA 2GD1O 3WLEA 1Y5RA 2H8KA 1AC5A 2HPHA 3JWIA 5CM2Z 2PWYA 3BIXA 4JY7A 2A9FA 1H5UA 4M0KA 3AVYA 3NBZC 1M8KA 1YMUA 4JA0A 4X1YA 1AQIA 1ODFA 1JDSA 1K5DA 3EWNA 1K27A 5CHEA 4HRVA 3ZWQA 4D9JA 1WBJB 1XDBA 5DXJA 5FEMA 3L3BA 4IV5A 4YXWA 2EU8A 4C5CA 3TTYA 2WBLC 4CCAA 4HWTA 4NOLA 2XWBF 5GVRA 1RE0A 1CQJA 1KBZA 3D8UA 3U16A 5HP4A 5B1IA 1X1TA 1I1OA 2PCLA 4D8UA 4EX6A 3RSZA 2FEAA 1PDWA 4TMYA 1BQ4A 2LIVA 2VKQA 4R9SA 2ZSBA 4ZEWA 3T35A 4MS3A 4EKGA 1IN1A 2XWQA 3SKXA 3HUFA 4AWBA 3R6WA 3RBVA 1JI3A 1W5AA 4S35A 5FFNA 3DE3X 4C0XA 4MSUA 1WZNA 1QHHB 2VBFA 1VA5A 2ZTHA 2JGKA 3NJ8A 4IEEA 4KKVA 4GMKA 1V45E 2MSLA 3EUAA 3FW1A 4G2TA 4I9NA 1MV8A 3PQFA 2B7BA 4QHTA 1ETHA 3Q3VA 2BR4A 5EYPB 2WWWA 1CFZA 2QG6A 5CIQA 2KBEA 4EW3A 5JCJD 1DCTA 3PIDA 2XA9A 3EEIA 4A4DA 1UODA 5KWJA 1SR8A 1N0IA 3O4IA 2HPVA 3AR4A 4L85A 4CR6A 4IG4A 1JHPA 1QE0A 3M6XA 4IWNA 5C8YB 3M81A 4WRRA 2JFNA 3NX4A 4N9QA 5AJXA 2JNWA 5F23A 1IZ9A 2DUUA 1HETA 4I08A 5A3SA 4BY9E 3L0OA 2J7KA 3DO5A 4JJAA 1GU7A 2IXGA 3G2PA 1KR2A 3H16A 3PXDA 1QX4A 4KGVA 3TIXB 4WINA 3SXPA 2XCLA 1LDYA 3SOZA 1CP3A 1JV2B 3TPCA 3GAMA 2QTGA 1I4LD 1L4UA 1W0KD 4KN5A 1PX0A 4MVJP 3I9FA 2MINB 3M2TA 1IYZA 1M7HA 1G20B 3W04A 2GX6A 4P53A 4V0SA 2KQUA 1ST3A 4WADA 1XMPA 3E05A 1UXOA 5CYPA 4B6OA 1JHMA 4BWGA 4CEJB 1NC3A 2ZI5A 3B51X 2P90A 1GFZA 2GEUA 3WHPA 5A4JA 1ILEA 3AVXA 2VCEA 5AW6A 3K6SB 2HQ1A 1JQKA 2HLDA 1LSSA 4J75A 4NCIA 2OYRA 5BWMA 5FBHA 1DIOB 3PTAA 4ZTBA 1K3UB 1ADYA 3QLTA 5MGBA 5DRYA 4YT2A 1CS0B 1N2CE 3CHYA 2AXEA 3IKTA 4DSZA 4MDFA 1I4TD 4IOJA 2AJDA 3OCYA 2WIBA 5F5XA 3ZVRA 3ED5A 4W99A 3L0YA 2RGXA 3R0VA 1ZZGA 4CL3A 5JLJA 3BSFA 3IAXA 1CE8A 3IEVA 3H8SA 3ZC3A 3ZGOA 3D3WA 3GPIA 4MYCA 4ZC1A 4GSKA 4NP6A 4EITA 2FUKA 2XHZA 3HYCA 4MAFA 4PYRA 2IH5A 1QC5B 5HFNA 4HGQA 3T5DA 4B85A 1P7VA 4MUHA 2I4NA 1KJQA 1A8QA 1YZUA 3ZLUA 3JAWA 2RC5A 4ZTZB 4WKOA 5C5DA 1KTIA 2ZIZA 1VHLA 1D1PA 1NNI1 3DDUA 3HNPA 4LSMA 1YJXA 1YTUA 3WGLA 4F9EA 4BMSA 3DF9A 2V3VA 4Q3DA 2OKGA 1KYIA 2CE7A 2AD5A 3H2IA 4DPLA 1P7ZA 3AYZB 2EKLA 2FDXA 3CPEA 4HHEA 3T9BA 5FJJA 1KVUA 2JLWA 2EHJA 4GECA 1IVSA 2FRVA 2ISCA 3HDHA 4B6QA 2OLJA 3ZX4A 2J32A 2W5UA 1BXGA 3ZQUA 4XVCA 1TYBE 2QW0X 1MQSA 2R3SA 4QYWA 4XQGA 3UH1A 4GOND 4Z4GA 4OO3A 1JJBA 2VDLB 1HZJA 1J5EB 1KH3A 5EUBA 4G3XA 3OLZA 2C78A 2JAWA 2GSDA 1BRTA 2HSZA 3KZKA 3MAGA 3FPAA 4YH1A 3ZV7A 2I2WA 4BMYA 4I5FA 4D3ZA 2J67A 3QPBA 4BX0A 4OQLA 2VBGA 4X1IB 4ZYVA 4B3SB 1ZKMA 5LZ7A 2DUJA 1ZMBA 4JI0B 4QFDA 1GGHA 2O7RA 1O97D 1Z5OA 4KFSA 4LHVA 5HTOA 2ZJ2A 4G1EB 4EVRA 4DDMA 1AV6A 3SZMA 3OHMA 5K8VA 4HL6A 1T2DA 2D3TA 3M83A 2NTNA 3T3PB 1YR1A 4CKWB 3A6DA 1M5RA 1T4DA 2HUPA 5DYGA 2BAGA 3HFGA 3B7WA 4Y9SA 5T67A 5COBA 4UNSA 1UMCB 5FWYA 5BSMA 1BX3A 1E0JA 1QQ6A 1V6CA 2O2JA 2W2KB 3G2OA 2ERCA 3L04A 3Q7SA 4PC2A 1J9EA 3FPFA 1EDZA 1IJKA 5TPWA 2YIVX 1ZUIA 5D3MA 4QARA 2UYGA 1EZ1A 4WCFC 4QIHA 1BX1A 3NWBA 4PSUA 4RC9A 1D5CA 4AUEA 4ZTUB 2R4QA 1OTXA 4E5UA 4MYTA 3HR8A 4NECA 4U9IS 3NC0C 1Q95A 1NVVQ 1GGJA 3G88A 4JJEA 2IXTA 3VH3A 4HN4B 3H2HA 5F3RA 1T1GA 3RU3A 4FMCF 4PN3A 2YY7A 1O96A 1IZ7A 1JZTA 1QVVA 3L0IB 1O9HA 1T10A 5EIAA 1L5NA 5BNWA 2PZGA 5A1TA 3A9RA 3GH3A 1CPYA 1KIMA 2F64A 3HXKA 5AI9A 1BX0A 1DKQA 4MDHA 4LXUA 2ECQA 4UD2A 5SY6A 1OB5A 5CBKA 1L7QA 4IJ6A 5TARA 5G0WA 1CR1A 5DW0A 3BB1A 4LZLA 5I5GA 1K2VN 5JFTA 1R3DA 1NKTA 1TD9A 1Y5LA 2FEOA 2J08A 1J2TA 1US8A 3F46A 2EF0A 4V3CA 2FMFA 4XRRA 3RS4A 1UPBA 1RXYA 1MOZA 2G82A 3FUCA 3LBIA 1RWQA 4I1UA 2D2VA 1H2XA 3IMEA 4X20A 2GM9A 3ZKWB 3HA7A 4C7VA 4S05A 5F9FA 4NFHA 3WNDA 2R4TA 4OJKA 1ZH8A 2XCUA 1JVSA 2QTFA 4E21A 2J8ZA 4ENWA 4R9UC 1NWHA 4JX8A 5DMHA 4D92A 2DG2A 3JV7A 2DUNA 2ERXA 4XVHA 1ORWA 1J1IA 1GSAA 1XEWY 2FHSA 2HNKA 2JLCA 4TROA 3SBOA 2CV1A 4XDGA 1OTYA 1DQSA 3W8EA 1JSLA 1KDZA 1BKDR 1RKXA 2H9AA 3R0IA 4GOMD 4RZXA 3QVOA 4BNHA 1AO0A 4EB8A 1YONA 4DPMA 2ZZMA 1JJFA 4MW1A 3RYFA 4C76A 4E0BA 4BWYA 5LIRA 3QW2A 2I78A 3FPSA 1UJ6A 2OD9A 1G8PA 4GL2A 3GO4A 4URVR 5B6IA 3FSEA 4TYNA 4NNPA 3LUKA 4H7JA 1MQ8B 1J21A 3LP6A 1A72A 3HBMA 4G09A 4KPGA 4YMSA 1XROA 3R4VA 4C0KA 4IDDA 2HRCA 4KWHA 5EJFA 4B4UA 5LA6F 4XASA 1YZQA 1S9DA 1ZI6A 4N65A 3L0ZA 4Y0NA 3KQLA 2GPWA 4BFCA 2YKGA 2QL6A 2XQGA 4POAA 1DCKA 2CVZA 1V8ZA 1XQVA 1M74A 2G17A 1K8ZB 2MINA 4PVCA 3WYGA 2FUG6 4NU8X 1E4EA 2RK4A 4JHLA 5JALA 2UYOA 1X8JA 4NJOA 1B1CA 1A4UA 2ZYVX 4UEJA 2ZYDA 1IXYA 4CLRA 1QIIA 4N48A 1U2DC 1EWQA 2FPLA 4KI0A 3QU4A 2N1BA 5K1ZA 3TLAA 1QH1A 1HT3A 1OF1A 3HE3A 3AHDA 2FZKA 1KGSA 1CY1A 3EPJA 1OBVA 5L7TA 1WA5A 1X1RA 4M0MA 5EP4A 4ZIRA 2CLHB 2C4WA 3AHJA 5JC8A 2OO3A 4TLCA 2ZRIA 3GCWA 1EDEA 1VPDA 3O8DA 4WY8A 1G21E 2VT7A 3AG6A 4QDUA 3F6YA 2DBZA 1N2ZA 4QOEA 1W4LA 5FNVA 1ILWA 3Q5EA 4JI7B 5C1DA 1JA0A 3ZCUA 1J33A 2VT2A 1TYAE 1GUYA 3Q7EA 3B9BA 4BKQA 4U7FA 4D4IA 1JG4A 1WY5A 4RQBA 1KR5A 2HU5A 1LSOA 1MOSA 2NLOA 1UQTA 3KKKA 4FCWA 1WJGA 1TEHA 4FX2A 4JP1A 3A2MA 4FYKA 4MV8A 2VDRB 1E4YA 4UOQA 3RT9A 3ITNA 4EO7A 1K4YA 4ZHQB 2W7TA 2WFMA 3BDIA 4LJ5A 1MW8X 5A04A 5IVPA 4DV2B 4H77A 3R8XA 1FSFA 1Z15A 4LFCB 4WBNF 2F3UA 3V3TA 1Y3AA 2Q5LA 3CSUA 5IDXA 4O4IF 3UGKA 4B2IA 1Z35A 5UKDA 3LUHA 4LFBB 2P2ZA 1JE1A 3H6KA 2DYKA 4RM2A 3I1IA 3UUFA 2Y1OA 3BXZA 1CUEA 3ENWA 5FBVB 4LUCA 3RHTA 2OL4A 5KWVA 3WL6A 2GM5A 3EQ6A 1F48A 3A1CA 1N9KA 2KJQA 3V5NA 2XSZA 5DM0A 1RC0A 1AUPA 1QBKC 1TDJA 1XA4A 1Y8RB 2YVKA 3P0HA 4U2KA 3D2AA 3ZGNA 1E7WA 3PPWA 1YE5A 3EHDA 3QWAA 1MABB 3IDOA 4I36A 5HGJA 4DCOA 1P7CA 2UZ0A 3FGOA 5E6SB 4WA7A 4JX9A 1T9AA 1CY4A 1JLLA 2QRVA 2QNIA 1Y9ZA 3QX9A 3C3EA 4E1AA 2BI4A 3JWHA 2JARA 2R1UA 2CLEB 3A4VA 3RSHA 4HYTA 4FMDB 1FLAA 4QVIA 1TAUA 5A0VA 1AJEA 4ZU3A 4FMPA 4FS8A 4RAOA 1OX4B 4BP8A 2HXGA 3FB4A 3VVLA 1LLFA 2Q2OA 1QV7A 4RE6A 1JL3A 2O2ZA 5B1DA 4R7ZA 3P52A 1KH2A 1U2SA 1PS9A 3FF4A 5CAEB 3BF8A 5D3MB 2FMUA 3EQ2A 3TIFA 3J81k 5H9VA 1WZCA 5E6RA 3U26A 2YN2A 3GOHA 5TS3A 3L79A 4D4MA 2HK8A 2PBRA 2Y1WA 4PPQA 1BYIA 3EZYA 4G0ZA 2HQBA 4TYMA 4CIVA 1SFRA 3LECA 3H4VA 4X8OA 3WO0A 3TLZA 1Q6YA 5CW2A 6AT1A 2CDRA 2PZFA 3ONEA 4LPSA 1VE7A 5JFOA 5HQ3A 3ZY4A 1RAIA 3KR2A 3ZCPA 1QORA 4AF6A 1ULTA 1Y63A 1Y4SA 2NO4A 1H66A 2QTBA 4Z9YA 1C7ZA 2D1QA 3WOHA 4RF2A 1LLQA 1QZXA 3EVEA 2A1UA 2WF6A 1TTTA 1RXCA 4K05A 4KXMA 1A4IA 3BD8A 3TMYA 4BLRA 1NIPA 4PLHA 1FSPA 4YWHA 2JKYA 3L6EA 3ODPA 3T9AA 1EFRD 4Y6LA 2SHKA 4TLLB 4RF5A 5I48A 1Z33A 2F8TA 1K5HA 1LLDA 3G6KA 1JA9A 3A6FA 3FSGD 4FR5A 2AZ4A 3GI1A 1SZCA 2XUIA 3NHJA 4KIJA 2FW7A 4JROA 4A26A 3R9KA 2VH2A 1T36A 2H65A 4NIMA 5E3HA 4GP7A 1L1FA 1CUAA 1TIBA 3C6QA 2OILA 1LDGA 1J0EA 4RJJA 1TYDE 3O2NA 5CURA 3RLIA 1Y6RA 1UXKA 3U1VA 2FJ0A 3GA5A 5CTAA 5ARDA 4ALIA 4HUJA 2C2XA 2BTOA 1U8FO 1FQOA 2J6IA 1JILA 1NUHA 3STYA 2ZYIA 1NAIA 4BNDB 4L2IA 1ST2A 3T6KA 1C7IA 4HX2A 2QD3A 4DIOA 3FPGA 1QPBA 3I9OA 2NUPA 3R44A 4RIGA 5BYJA 3WWOA 1NSFA 1ZM2A 4DM3A 2Y6VA 4JBHA 4UZFA 4COKA 3SR3A 3V8VA 5JJKA 1IAVA 3WWCA 4HRXA 2VK1A 3FUXA 3AOEA 2NV0A 2ZBDA 2FPIB 4QXMA 1YI0A 4DJJA 1JPUA 1IY2A 3JARB 4FOPA 2ATVA 1LTKA 5LP6F 4HEJA 3HJNA 3LH5A 3FJYA 2EDCA 3FM9A 1YNSA 4NY1A 2VP9A 3P2EA 1GTL1 3T94A 4I1OA 4WECA 2XGJA 4L5CA 3R3SA 4F7DA 3I01M 1E9VA 2WUWE 2Q62A 3E7FA 4ZVNA 4BKPA 2KPOA 2VP2A 4BEJA 3EPRA 5EA2A 3TGLA 1CRLA 1U8AA 1Y4ZA 3Q72A 4WASA 1S3GA 1PFYA 2GGSA 2X15A 3JATB 3KEFA 5BSHA 1EFAA 1YZ3A 5EWMA 3GC6A 1E1QD 3QENA 5FOQA 5K8LA 1Q83A 1TKRA 1XP8A 3PDCA 2CGEA 4K6GA 5IVHA 2B98A 1JKMA 4LF7B 3BGSA 5DTJA 4D4HA 1OU0A 2E85A 5LWHA 1F3OA 1T0IA 2C9OA 2IEGA 4IOMA 2I6GA 4LVUA 4MVJH 3ZW9A 5GPBA 2J5QA 5HCUA 4FGWA 1QRUA 1RTTA 3JQAB 2VSFA 5JZVA 4FZ5A 3MTJA 2IHZA 4QOSA 2IY7A 3IB6A 5G4LA 3VSEA 2C3PA 1M1YE 3MOSA 1H6DA 4N8SA 5G2OA 3M0EA 4DFDA 1WP4A 1YR3A 2E4UA 4HGYA 1YBMA 4OK6A 1CUDA 2G63A 2PUEA 4KGXA 2D2XA 3T5PA 4Y6PA 2HGSA 1CZRA 4NATA 4GEKA 2FWBA 2POQX 4G8DA 4CPDA 2CFRA 2D7JA 3CUYA 3FUTA 4A5SA 3VISA 3TG8A 2OLKA 3MF4A 1B93A 3FCYA 4Q4DA 3SC4A 4DDVA 1UPTA 1VXOA 4J76A 3TM5A 1WZ2A 1OA0A 2EIHA 2SCUA 1UC9A 3UUEA 1S8AA 2FH5B 2BFMA 1E61A 1T9GR 2X5JO 4AZ0B 3V4PB 3QKRB 1AHNA 1GRVA 2HSDA 1A7KA 1YI1A 3UOGA 1L5YA 4ZGWA 4AC9A 3STWA 5LZ4A 5A03A 4CQNA 1RBYA 1I30A 5J9FA 4E5SA 2F4NA 2HF2A 4GUAA 1TOAA 3EQ9A 1AQ6A 2WJVA 4WW0A 2X9LA 3WHLA 3BFVA 2XIQA 3PR1A 1WXGA 3VR5D 5H68A 1SXQA 3H9BA 3IE0A 2AE2A 3C7AA 2RD2A 5THQA 4CEJA 2MWMA 4OKSA 4FFBB 1QZTA 4AJKA 1R0LA 2W6ZA 2QZ4A 2OK7A 2IHKA 2P91A 2AE1A 2ZRBA 4WK0B 4QVGA 1WS6A 1FC0A 2VATA 4XIJA 3WXBA 1YFJA 3DNMA 2XXJA 2H18A 4C30A 3LAWA 3O47A 3Q5GA 1DIGA 1I1HA 1JR3A 1ZK1A 2HBYA 3B1ZA 4P1ZA 3DLBA 2CL7X 3UH0A 2H4XA 3W5SA 1VL8A 3O73A 4PRZA 5FTWA 3W5JA 4Z53A 2KX7A 4RDCA 3LTEA 4LBYA 4F4JA 3AF6A 4LDAA 4W1QA 3W6PA 1ZINA 1EUDB 4X9XA 3IP5A 2CMDA 421PA 1TUIA 4K28A 1SZDA 3OY2A 2EZTA 1F3LA 1ZH6A 1ZCBA 3G8DA 1YHYA 4H2DA 4QQKA 4R1SA 1FXWF 2W98A 1T2NA 2QLFA 3D7MA 4DDUA 1FRFS 1E20A 3JZDA 5AW4A 2XNDD 1FS4A 4H6PA 3GRKA 2ZT8A 2GBLC 2VCYA 2OGTA 3D6FA 4M38A 4Q6BA 1ZM7A 5ICEA 4BUCA 4YRZA 1GKIA 2PTGA 3K7EA 2PMWB 4MK4A 2GKGA 4MLPA 4NR0A 1OJLA 2E87A 5F76A 4XGQA 3P9YA 4J43A 3KTDA 4G8BA 3ZWKA 4B5LA 4BV8A 5JBNA 3D8RA 1CUZA 1GCGA 1XK6A 5ILGA 3B5IA 4R84A 2ZB4A 3L93A 3TXAA 3PA8A 4EJFA 1DUSA 1Z0JA 3LVQE 1FU7A 2Q3FA 3ZBQA 1YIAA 4IICA 2C9CA 4PM4A 5HS6A 3NH6A 1EM8A 1EKXA 2B5OA 1JVNA 5EE1A 4YCCA 4U7TB 2Z6QA 1YB5A 4WCVA 2M6SA 4CEIA 3DBVO 4X1YB 5HM6A 3ONVA 3GHHA 2CMFA 1DS6A 3NP7A 4H7PA 4NBLA 2BHTA 3ADBA 3JD2A 4LF9B 2E5FA 2RI6A 4KG7A 1ZKDA 1V0JA 1MHPA 1C81A 1DTEA 1QDUA 1U0HC 1ZNQO 1I13A 2EZ4A 2NTVA 3A1SA 3D0QA 4MAAA 4EAQA 2PT5A 2DRIA 3VTZA 3FCAA 1EGMB 1FDSA 4G0XA 4MCHA 3VPCA 1GTMA 4HQ6A 1RPJA 1IY0A 1OIVA 4XGRA 4JLVA 3CBQA 4QQNA 2XQIA 1LS1A 1RWKA 3ZK7A 3ZZUA 4L2IB 4Y6OA 2WQ6A 4IO0A 4CM6A 3NC4A 3ESDA 2YFYA 4YMIA 3REQA 2ODBA 1DC4A 2X0DA 3W7AA 2AC7A 3AEQB 3MWGA 1Y3IA 3EVZA 1ESCA 1KXJA 1U28A 1A2QA 4OHPA 4FXOA 3RS5A 2RH5A 2NP6A 2WT4A 3DFMA 1EA5A 2ZXUA 1OU4A 3KYIB 5EJ5A 2AF3C 2IT1A 5E9JA 1ZCJA 1QIEA 5CYGA 1Q11A 3UATA 1NBMA 4GOJA 1R8XA 1EFCA 2Y9MB 3QITA 1ULSA 1F8YA 4BQNA 4G5OA 4HNSA 3JYHA 1JEJA 1IZ8A 4TM8A 1H69A 3GUVA 1ESMA 4GNKA 4OA8A 3DKRA 4PSCA 1JQLB 3EGDB 1UOPA 3G9UA 3PQ2A 3H99A 4XIIA 3MTAA 3Q9LA 4TVKA 5E4JA 3Q10A 3S7ZA 3TF5A 4LVCA 3AZQA 5CT8A 2VDKB 5FBQB 5T8KA 3QUCA 1KEZA 1R12A 2NU7B 3LT0A 3JYPA 3NVDA 4JUDX 4RK6A 3CPSA 3MGCA 4PC3A 4XFJA 1Z4QA 1WULS 1GYRA 1L7DA 2YHIB 4YRAA 4ONEA 5HUHA 2N0SA 1DAFA 4J4BA 2GO7A 1F06A 2ZIEA 5BOSA 2PKYX 2WQ7A 3OFSA 2AXQA 1XD8A 3EHEA 4K6KA 2PRYA 3RUPA 2GOYA 3GLIB 1B42A 3E27A 4BZPA 2MSEB 2QTRA 3DPSA 4HNHA 1KFCB 3ETGA 4Q16A 5B57C 2V1UA 3H8VA 3Q1LA 4EVQA 1HEUA 2ADOA 4RKYA 4BAZA 5EXEA 3EOZA 3FYUA 5KSOA 2R0QC 1XL0A 3AIIA 2YN0A 3I4LA 3VI4B 2XUDA 4DYHA 1YB1A 2Z2XA 2NTJA 4RD0A 1P6UA 3IUPA 1N4AA 2ZQYA 3BRCA 3AVTA 3ZVMA 1Y82A 1U7TA 2GZDA 1A95A 3KZOA 3UPUA 1MA3A 3L7YA 4AKEA 3HXOA 3E2PA 3ZJVA 1QC5A 4XYLA 2B2XA 1KYZA 4Q4HB 1MJFA 2Q5FA 4N5HX 5L3ZA 2GO1A 2ZRDA 1G8AA 1G5RA 3FYHA 3ICVA 1NXXA 2NVWA 1CY2A 3ORYA 4HJRA 1VLMA 2J6HA 4LN1A 4RENA 2QM8A 3CR7A 3M6IA 3A3YA 3Q7TA 3QJ5A 2VK4A 3CNOA 4CCYB 3GA0A 2G83A 1G66A 5ELXA 3OZCA 3UT5B 1WXWA 1FLVA 1TQDA 3K1YA 2HDOA 2ZSKA 2VHJA 4PSVA 5LU8A 2ASVA 4IV0A 3JALB 2PUGA 2P3OA 1Z06A 2P79A 2ZANA 3QE0A 2O8FA 1ZK3A 5K3FA 4IGEA 5G0TA 2FJPA 3O1LA 4J9UE 3X1WA 2FSIA 5KTYA 4FJ1A 1C41A 3N2KA 4Q7JB 4ZZ2A 5ERGB 3ZNPA 4B0OA 5G4KB 4DNXA 3PNVA 5JANA 2O8EB 1NTOA 5G1NA 1H8HA 4PO1A 3KIPA 4PYMA 5CM8B 4CT5A 4C6HA 2A9JA 4UKDA 1C7FA 1FTGA 2C2YA 1Z5NA 3ZZNA 3A6JA 4BE9A 5BUQA 2GTHA 4DA7A 3PD7A 2Z3ZA 5C4GB 2VDJA 3LWNA 5K3EA 3FNQA 4QICA 4C3VA 1O9BA 2H54A 5FCDA 1CNMA 1FUIA 4FTWA 2ATXA 3FPLA 1MVLA 2YVQA 1GG8A 3AL3A 3H1GA 3I9KA 3L7BA 3PEFA 1UMCA 4IDBA 1CEEA 1NRJB 1RW4A 4AMVA 1Q0SA 2QR5A 1S96A 3B85A 2MYTA 3MMNA 2ESRA 1PKEA 4J03A 4OG2A 5FIUA 3N86A 1Z63A 5DRTA 1BW9B 1ZI9A 2HLPA 1N36B 2Q4BA 4KQCA 5CX4A 5TPWB 4BX3A 5EC8A 5AQEA 5A6VA 1RZRA 4W5JA 1QRSA 4MUMA 2HBRA 3NJ4A 1I2MA 2QVCA 4DW8A 4FXPA 4A15A 4TWBA 5BWOA 4ZI7A 4H9GA 4RLHA 4D0LB 1LTQA 4DL9A 1LNSA 4CIWA 2QROA 2AKAB 2ZLBA 1SURA 2JIZD 2LDBA 4HF7A 1RADA 4IIXA 3IAHA 1I1QB 4QBHA 3ULKA 3H2ZA 3C5VA 2X4IA 2IRWA 4CKCA 5E95A 2VJMA 3WV4A 3ICCA 1XKQA 3M89A 2BDUA 2V7TA 4JLDA 3V9PA 1JJIA 4ENQA 2Q9UA 4L07A 4FWTA 2J9FA 4R2KA 1CJCA 1RLTA 2WAAA 4Q7LA 4A5OA 1R50A 3R5SA 3G82C 4IILA 1YU9A 2PXHA 2GASA 1C3XA 1PZEA 4YBRA 5EMLA 4RTPA 3AB8A 4LRQA 2R6GA 3W1VA 1Z4LA 5G0UA 2PWAA 3RTAA 4X20B 2BSXA 4ZQCB 1UFRA 3R3HA 4B5KA 1I0LA 3I6MA 3F4KA 2DBQA 3UICA 2WUGA 1CF4A 4M6WB 2XRYA 2B82A 2HIAA 3VTAA 3V00A 1Z7YA 3ZIUA 4P98A 1GQSA 1GPAA 1U7HA 4PC7A 4CG1A 3CUSA 3IXLA 1W2HA 4IY1A 3REQB 1RRGA 2Z3WA 3RFUA 1DVRA 1V5WA 3LHKA 2X1LA 4DMKA 4LZPA 5DM60 2O07A 3QOYA 4HLUC 1ZUD1 4ITVA 4LDNA 3ZHBA 2WMYA 1JDNA 5J2TB 3EDOA 1HRKA 5IVIA 2EWWA 2Y99A 4KWIA 2AIRA 3EZNA 2E48A 2ZZKA 1PBTA 1ENZA 3NVAA 1NDHA 1RE1A 4KQFA 3NEAA 3P9IA 4MS4B 3NV9A 1BTOA 2B8WA 3DL4A 2FRDC 5DHAA 4ZP1A 2CXSA 2RGGA 3ZQJA 1WUIS 1UKZA 1USIA 3M6UA 1THZA 2PLAA 2Q9BA 4MJLA 1Y0BA 4ICIA 2UXBB 3ET5A 1YBAA 2X7XA 4JN6B 3S28A 1A82A 3KQYA 3L5OA 5CTJA 4PG5A 1DKNA 3L49A 1IIRA 1RHRA 4IDNA 1GEGA 3MGBA 5K45A 5AK6A 1D4OA 2JIMA 3BK2A 3U9LA 2ZR7A 3K16A 4HXGA 2QD4A 2VDWB 2Z4TA 4PO8A 2G0NA 4HK4A 1Z0DA 2G04A 3WIEA 1CQPA 4O29A 4CMKA 4CQJA 2YHBA 3DVAA 3G23A 3ZCRA 1VG8A 2G07A 3O3MB 2O3TA 5AJHA 5BNFA 1ORDA 3B48A 3D8BA 1GCAA 1P81A 1OH6A 2AZTA 1JAHA 4G2NA 1NT2A 4EHBA 1BXZA 1KP9A 1SBNE 1TADA 3DUWA 1V5IA 4OQEA 3T7AA 2QMQA 3MFYA 3AR8A 2F3TA 1Q77A 4Z3OA 1CF2O 3PI7A 4TYWA 3N6VA 3PIIA 4M88A 4JAVC 3UMFA 2O1WA 4HCJA 1T1EA 1A2KC 3DCYA 4QUEA 1E2PA 1PYGA 4I50B 1I51A 1XOIA 3HEAA 3V6MA 3DDOA 1ZU4A 4R2MA 4BYGA 1PHPA 4HEHA 3CTPA 4NMLA 4TL8A 5AM0A 1REQB 1FTWA 4B82A 3RVOA 3R6GA 5C2JB 1FS6A 2DKFA 1V48A 3EAQA 3VR1A 2PRIA 1L7MA 4E5NA 3PXEA 2JGFA 4EDHA 2PJUA 2X0FA 2VCHA 3V4RA 3AVUA 4EUFA 3H13A 2C0PA 4YRNA 2AI1A 2AG5A 1OXUA 2GUWA 2ISQA 2CBXA 2GYUA 3M6MD 4M83A 3NYQA 4TRRA 1GDHA 1VE1A 3DZFA 2PN1A 2F62A 1JBKA 4MRNA 2HHJA 3BWEA 3GFRA 4LJSA 1OAAA 3F9CA 4MV3A 3MGKA 4EFMA 4YPFA 1IG0A 4MGIR 4RJTA 4F6RA 4GPIB 1LJLA 3GDGA 1GDTA 1N34B 2JGDA 2H29A 1Q84A 2F43A 3QA9A 3LKZA 4LWOA 5ALZA 2YJTD 5F7XA 1Z6TA 3U60B 4NXNB 3ERCA 2ZBVA 4MUNA 2RCNA 2HD4A 1CEXA 1E1KA 1XMVA 3AERB 1UFVA 4MQFB 1DLIA 2I22A 4JYZA 1I3LA 3VVBA 2P0EA 1VJGA 5JYCA 4RXTA 1RZRD 3KP1A 4GG1A 5CJ2A 3S1AA 4I9GA 5GMOA 2ASEA 3FKSD 3IQZA 5MN4A 3JYQA 3NXKA 4JHXA 3IEKA 5DP2A 5E6SA 5F4BA 3W2HA 2KMLA 3W6NA 8ABPA 1HE2A 5BW6B 2B0CA 4AJJA 5KYGA 1SXHA 4JLJA 2V6GA 1E89A 1GFSA 3IQEA 5KTOA 3K9FC 1JDJA 4ZO9A 2EJWA 1Q5PA 4WZAE 5B3JA 2IFTA 1Z6GA 1NQOA 1NURA 2HPZA 5AKKA 3FNFA 1GARA 3ZHYA 4HDRB 4LPKA 4PIMA 3TIVA 4GI7A 2NUTA 6NULA 2PMFA 2QTHA 3OP1A 5EL0A 1ESNA 3EDRA 1FTYA 1ABFA 3VHXB 1P0FA 1ISRA 5JJLA 1CE8B 2FK7A 4HGZA 1U3TA 1IFXA 2VQ6A 3HL4A 3GDOA 4D96A 3PYMA 1T25A 1TCCA 1OH8A 1CTQA 1KFJB 2CXTA 4YJ3B 1X8LA 2OA0A 2C2WA 2BTQB 2ZULA 3EY9A 2HHHB 2GF0A 4E30A 1YJ5A 2R8OA 3DNFA 1OLSA 4FBGA 5FA8A 2H57A 3W34A 2NG1A 1Z18A 2BGKA 3HA5A 1NBIA 1X3LA 3CEMA 2RAFA 4CIAA 3VGPA 2A92A 2F1OA 2IE8A 4LYYA 1DQNA 1QG4A 1QO9A 3DC7A 1Q7BA 2VPZA 1EQ2A 2FPXA 5JH7B 6GPBA 4UXIA 3GRPA 4ND3A 1NI5A 3KOZA 2SKEA 3CZAA 3UAOA 5GVSA 1DOHA 3MGAA 4XDYA 4EF6A 1TZJA 1Z6YA 1CUIA 4U6NA 4ZRNA 3QLEA 1SC1A 1SUEA 4L51A 1RHUA 1NYQA 1OZHA 1S1MA 1Z0IA 3LUDA 3MYRA 3U4IA 4HQKA 3TSAA 3E84A 4B0PA 3D59A 3N05A 1QO0A 1Y9AA 4PYLA 3HFRA 4W82A 5DBIA 1ZQ1A 3ORHA 4PWZA 3SHWA 4B6FA 4BQSA 2W58A 2R1TA 3ROFA 1YMVA 3KLOA 1P9OA 4IO1A 4EJSB 1BVUA 3ZDCA 4KXUA 1QTNA 5JZ9A 4J3FA 1MJHA 2VQDA 1EB8A 4WD3A 4OP3A 1PR3A 4YC7A 3RK4A 3WAJA 2DGDA 1ETUA 2XMRA 4HDNB 3VC7A 3VM6A 5L4SA 4YRQA 2XH8A 4HVAA 3GYBA 3LBYA 3QEJA 4NJMA 2IZ7A 4PLGA 4PLFA 4YYEA 4MP3A 4KVZA 1YF3A 3HPRA 1W87A 1XVVA 3AHCA 1M1ZA 4FCCA 4WFKA 4Y6GB 1QKIA 3ILYA 1WW8A 4D9GA 4CEHB 5C1PA 5BMVF 1OXSC 1DC6A 3ND9A 4G5XA 5JAPA 1WDWB 1FX1A 2XITA 4HPWA 3MIIA 3HRIA 3DXFA 1WMFA 5KKAA 1JT2A 3PUHA 5ITSA 1P0CA 1AGYA 3VOAA 2BEJA 1EINA 4XGNA 4UAVA 4YPOA 4JBGA 5DCUA 3GJ7A 3PB3A 2ZYUX 3DV2A 5KCMA 1U8TA 4GL4A 4NBTA 1UEJA 5KU7A 4HG2A 1PBNA 3SZRA 3RUEA 1YR8A 3FVQA 4Y6QA 1E7SA 2FUNB 4YYZA 1JU4A 1W6UA 4G6ZA 5CVCA 1P2DA 1PEKE 5AW8A 4PLWA 1T4BA 3ES9A 2X2OA 3CX4A 1Y6GA 1HH4A 4G5YA 2BZ1A 4FE3A 4O2BB 3MBOA 3DMRA 4PLTA 1XD9A 4RZQA 2UUBB 4LF4B 3GJSA 3R0XA 3LQYA 5GOZA 4OSPA 3H5AA 1E3MA 5IAGA 2K2WA 2YOHA 4MV4A 1UUFA 1P31A 4YV2A 3SDSA 5DMXA 2XVZA 3OE4A 1NF8A 3VZPA 3RSLA 4E32A 2H1OA 1C0LA 4TYQA 1NBAA 3UGTA 4FM9A 1FNDA 4LAFA 1H1LA 3NCTA 3PJGA 4BP3A 1NYLA 1KJNA 2V7UA 2XPCA 3H5IA 3KSDO 4JR1A 5AMXA 2HO4A 3LDAA 5EGNA 5H02A 4EATA 3TTTA 4JJKA 4MVJI 1TZCA 4L4YA 4AZWA 3S8YA 2H3EA 5KWSA 1ZAKA 3L7DA 4GZLA 3FFBA 4LJLA 3PQCA 1GKYA 4X8HA 8AT1A 5HRCA 1XPRA 1B00A 821PA 3Q9UA 4YAKA 2H7VA 3HNRA 1QH9A 4N18A 1EQAA 4TZ6A 4IDAA 1R9NA 3UJ6A 3VJLA 4M98A 5EKXA 1SUFA 4KP7A 2ZSJA 4II7A 1FQWA 4MIKA 3V1MA 2FPGB 1TIKA 3GVXA 4IS2A 1D5WA 4LMBA 1FXWA 5J43A 1H9CA 1E1RA 2R96A 4LYGA 1WRBA 2F59A 5DEIA 5BN4B 2VPIA 3PR3A 4PS1A 5FPKA 2IBMA 5EE0A 4LI3X 2OFPA 1RRFA 1DJLA 1D2CA 2QXUA 3QX7A 4L27A 4YMWA 4N5MA 2GPJA 2Y9PB 3S1AB 1RPNA 3RSQA 3CB2A 2I80A 2PUTA 1HO3A 2VTEA 2BCJQ 3ZZ0A 1SXGA 5HE8A 4RETA 4WKCA 1ZVQA 3ZU6A 2Q8QA 3JTMA 4NS4A 4PIPA 4DF3A 3NZEA 3PITA 4IH4A 1HURA 5CT5A 1N7HA 3SBXA 1EUYA 4PYQA 4OH7A 3T7RA 4XZ3A 3ONFA 4EARA 5DGCA 1S01A 1UP4A 5EIEA 3GGOA 4Q3NA 2O8NA 3RRXA 4A23A 2WU1A 5BR1A 1YC5A 3GRFA 3TLJA 1U5BB 1Q0RA 5D00A 3RDPA 4ZZ1A 2BHSA 5A5FA 4RFSB 4AG3A 2HCTA 4HDKA 4LF5B 1G7SA 2O7SA 5AESA 3EWSA 1OXVA 1QVRA 3BGDA 3PHJA 1S89A 2YQ4A 5FA5A 4DUGA 3F4LA 1GXSA 5FLYA 1V1MB 4OU5A 5DM2A 3CM0A 3CZPA 3UG7A 2GK3A 3MEQA 1LW7A 3A4YA 2HMTA 2H2HA 4WOKA 2WJ3A 1W36C 3RO7A 1RP7A 4ZZIA 3HA2A 3PXCX 5I3CA 4LV5B 2RIRA 5IEBA 4FBLA 3FPKA 2Q1UA 4AN1A 4ESHA 2X14A 1TM7E 3W5VA 4JL8A 3OFKA 2SICE 3P9PA 4KV9A 4S1NA 5BO5A 2FWRA 2G8LA 1U7WA 3RS2A 3I0MA 1ONOA 1HE5A 1YT5A 3LYLA 3UJPA 3GFFA 2DTDA 2Q7XA 2XJ9A 1BHO1 1YA8A 4LE2A 4S0ZA 1WSDA 4YUVA 3SYMA 1ZD1A 3DMHA 3NHRA 4ZI7F 5BQFA 1HDCA 3QIAA 1XLVA 3L0CA 4RY9A 1X13A 4UZSA 1JT9A 2A5LA 2JEZA 2OECA 3Q3CA 1U4OA 5GONA 4W9MC 3HHEA 1JR6A 5AI8A 2YRFA 2KHZA 2UAGA 4FDUA 1IEXA 2W2PA 3IQXA 4H17A 3DO6A 4FDVA 1ZICA 2ID9A 1XU9A 3QVKA 3AR3A 3UFXB 5ADHA 1SU8A 4JNCA 2FW8A 3GRAA 4BB9A 4KV7A 2CXHA 2GXUA 2Y8EA 5T4EA 3V4VB 1W48A 1Z8NA 1HK7A 1W75A 4BHTA 4IEIA 4WE3A 4J8PA 5FUWA 3RTDA 3TNFA 4F21A 2XJ4A 3AFMA 1IHYA 4XVUA 1PF7E 3HWWA 3LP8A 5AD1A 4S04A 5KNLA 1YVRA 2OFFA 2PKEA 5K0CA 4FK8A 2WSMA 4MYRA 1JB9A 5CYOA 1KC3A 2HWXA 3E9EA 3W79A 3ZU3A 3ER6A 1GNVA 3WQSB 4AW9A 2Q8NA 4R5MA 3EZ2A 2HWKA 4Q24A 1HRDA 3A6EA 3IURA 2EKPA 3FLMA 3L8FA 4F2WA 1ZS9A 1VLHA 3DDHA 3MMPA 2XAAA 1JDPA 4MEJA 4N03A 1AHPA 1E5VA 5C3UA 4YUYA 5JECA 5M3BA 2UXDB 3HACA 1G0NA 3WFJA 3PKIA 2QGZA 3F9IA 3NJRA 1TYEB 2IKSA 4MO9A 4FONA 4HXYA 4IF4A 4LY0A 3SDBA 3VKHA 4D45A 1U1IA 4YJ2B 4RL6A 5EQFA 3B3GA 1JH8A 2MYPA 2X2PA 4QX6A 1WQ1R 1CLEA 4MJ7A 2DB3A 4QOIA 2BBOA 1R3UA 3IJRA 2JCSA 2RGNC 3OCCA 2SBTA 2M98A 4RSGA 1PNRA 4XKJA 1MFPA 4OLHA 1PR0A 4N6GA 5KCZA 2WIJA 1KAOA 4Y18A 1RKVA 2X42A 2QMHA 4Z1MA 4F1JA 4EMSA 3K71B 2IH2A 3RPEA 1SA0B 1K9SA 5DOZA 1W49A 3ELDA 3U37A 1FFCA 1M8JA 3HN2A 1NT4A 2QTZA 3IP8A 1D7OA 3WSWA 1BA3A 3K5IA 5E4YA 3OQHA 4OGFA 3RNOA 4KQKA 1YK0A 3W2EA 4EUSA 5DM70 3P5SA 3LMKA 3B6KA 5F9HA 4LHZA 3RS8A 1PUXA 1EI9A 2GXQA 5JCXA 1I9GA 3FYUB 4XPZA 1F0NA 3KDAA 1QKKA 2XZLA 1QFZA 1MC4A 4WVLA 3UYKA 3RHSA 4Z7OB 1QG6A