3T7TA

Crystal structure of complex of sah and bvu_3255, a methyltransferase from bacteroides vulgatus atcc 8482
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
NLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESVWFTDQRPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFILPENCWIEHYFAPQAKAEEIFRRKHAGSRIVEELITSNHHEAELYSKYKAYYGYAFFICKKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
pubmed doi rcsb
source organism Bacteroides vulgatus
molecule tags Transferase
total genus 77
structure length 245
sequence length 245
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t7tA00
4HRAA 4E30A 2AOXA 3GRRA 2FRXA 5E2AA 2PX2A 3UJ6A 1RI4A 2JH8A 2VZ9A 4QDJA 5DRYA 5EKXA 2B3TA 1BC5A 5T67A 3B3JA 5LQUA 1M0EA 3CKKA 3M6WA 3BWMA 4DCGA 5CD1A 2PXXA 3OPNA 4V0RA 4E2WA 2GPYA 1X1CA 5GP1A 3FUXA 4E2ZA 4IV0A 4V0QA 4QTTB 4EKGA 3FPEA 5CVJA 1XDUA 5F2OA 2IBTA 4GBED 3G5TA 4PYQA 3C6KA 2OBFA 3LL7A 5GIOE 3NDIA 4WVLA 1I1NA 1R8XA 1L9KA 4GEKA 4GOMD 2NXNA 1RI3A 1Q0SA 5E8RA 3MHTA 3R24A 5FWAA 3NWBA 4U7PB 3VSEA 4RTSA 1XDZA 1UWVA 2ZULA 2YXEA 3GWZA 3P71T 5EHIA 5HIIA 2PT6A 2B78A 2GA9A 1NV9A 4YUVA 1OR8A 4PYMA 4KIGA 3GIWA 2OKCA 1IM8A 4EK9A 1O9GA 1JQEA 1HMYA 5H02A 5EQJB 3T7RA 3ERCA 5DM0A 3BWBA 3M6UA 4RTOA 4FR0A 4ER6A 3I58A 2BR5A 1YUBA 3BWCA 3TMAA 1DL5A 3ER9A 3NVMB 2IDJA 3KPUA 4HC4A 1NW6A 3DXZA 2XYQA 3KPYA 3VC2A 4CXMA 3K0BA 5EVJA 3UFBA 2Z6AA 4RX1A 4NECA 5E9QA 1XCJA 3LBYA 1AQIA 1XXLA 4LG1A 5EZQA 3OE5A 3G7UA 5CIYA 3G89A 5B1SA 4DF3A 4LECA 5IH3A 3OE4A 3O7WA 5IKMA 3DMFA 2F8LA 4X61A 2WK1A 5EZSA 1ZKDA 3C3PA 2IH5A 4E31A 4M37A 3M70A 5K05A 1R74A 4LWOA 1G55A 2I7CA 4DKJA 4X60A 2QRVB 4RTPA 2FYTA 5BW5A 4A6DA 5ICGA 5F2KA 3U81A 2I62A 4FP9A 3NJRA 2G71A 3NVKI 2YR0A 5DLYA 5U4XA 4QVKA 1AF7A 3DXYA 3DMHA 4YUZA 2VP3A 2HV9A 5K0FA 5CM2Z 2GLUA 2P3LA 3HCBA 4AZTA 1R18A 5CVDA 2GB4A 2N47A 1VIDA 2B2CA 3QV2A 3LDUA 1KP9A 4YMGA 2OYRA 4CTJA 3X0DA 3EVEA 3MCTA 3M4XA 2ZW9A 5EKUA 2NNWB 3DLIA 5E1DA 2HR1A 1KR5A 2ZZKA 1VPTA 4MHTA 5T6BA 2CMHA 3KPVA 1WS6A 3M33A 3I64A 3EMBA 3G8AA 2QYOA 4OBWA 3ELYA 1O54A 2ZZMA 5P8WA 1WZNA 1JTEA 1NBHA 1KYWA 1DCTA 4R8SA 3GRYA 3VYWA 5HOQA 1JSXA 2H00A 3V8VA 1FPQA 2CWWA 3ELUA 3HVHA 3C3YA 4GOND 1VBFA 5CVVA 1X1AA 3EEYA 3I5UA 4RVFA 2ORED 3PFHA 1SVUA 4DQ0A 5DTMA 4KW7A 5EG5A 2IPXA 4YMHA 1JG2A 2AVDA 2FPOA 3M6XA 3PS9A 3IYLW 1V39A 2XYVA 3P2IA 4ER5A 1RI2A 1BKYA 2YXDA 4FS8A 4F86A 4RTRA 2ZFUA 1P39A 4OX9Y 3MTIA 4CTKA 3BGIA 3P9CA 5HZMA 2PT9A 3LCCA 3EVZA 1IY9A 2R6ZA 1JQ3A 3EVGA 3KQYA 4PYNA 3TLJA 2R3SA 3ANXA 4MTLA 4QTUB 3FPFA 5EPEA 4F85A 4XUCA 5DSXA 3KKZA 5K0GA 3GRVA 4M7RA 5K0NA 1L3CA 3LDFA 1QANA 3HVJA 3MGGA 1P91A 5CUQA 5ICCA 5KYGA 2PBFA 3KU1A 4FSDA 2P41A 5DSTA 5BXYA 2I6GA 1ZGAA 2PX5A 2V74B 3KHKA 4RTKA 3LECA 2C7OA 3OFKA 5GINE 5C1IA 5EC8A 5BW4A 1B42A 1JQDA 1SUIA 5EHGA 1HNNA 2AR0A 5E9WA 5HIKA 2XBMA 1QYRA 1VLMA 1WY7A 2OZVA 1X19A 2PJDA 3HCFA 4M38A 3O4FA 3UZUA 4PGHA 3TOSA 5GWXA 3TKYA 3G2MA 1KHHA 3P97A 2Z6QA 2PXAA 2ZBQA 3DUWA 1BOOA 1BHJA 2VDVE 3HVIA 1MJFA 2AN4A 1EJ0A 3LBFA 4KRGA 2PX8A 1U2ZA 2IP2A 3UJ9A 3REOA 3FTCA 1L3BA 3EVCA 2C7RA 4E32A 1XJ5A 2G1PA 5MHTA 2H1RA 4RV9A 5E8JA 2DPMA 4OQDA 2ONYA 2QRVA 3A7EA 2OB2A 3EPPA 4RTQA 1N2XA 1T43A 2P35A 3BWYA 4RWZA 5LR6A 3FPJA 4PGGA 1FP1D 5FA8A 4BP1A 1Z3CA 3JWIA 3KQTA 1QAOA 2AOUB 3UA4A 4ER7A 5FULA 4AUKA 5C9ZA 3T0IA 2AZTA 1M6EX 9MHTA 2BZGA 3CJRA 5FTWA 3LSTA 4ER0A 1RJEA 3SSNA 5EEHA 4X63A 5FADA 1RJGA 3EVBA 5LQKA 2PY6A 3P9IA 4CKEA 3TFWA 4POOA 3MCZA 3FPGA 2IFTA 3PX2A 4FGZA 1JG1A 3AXSA 5EMMA 3A27A 2AVNA 3DTNA 3IHTA 1N7IA 2PX4A 2FCAA 3A25A 1JR4A 5DM2A 2C7QA 3FTEA 5DTQA 3D2LA 3HA5A 4KDCA 5CCXA 2ONZA 2PWYA 3B3GA 5FWDA 5FA5A 1SG9A 2G72A 3THRA 5K8VA 8MHTA 1EQAA 5K09A 5DRTA 1NE2A 3MTEA 1R00A 1R8YA 2QE6A 2HTEA 1SKMA 1WXWA 3GU3A 3H2BA 1ZG3A 3LKDA 5E1OA 4E70A 3BUSA 3DMGA 5C0OE 1JTFA 4P7KA 3UJ7A 5LQRA 2PKWA 4IKPA 5CVEA 3KQQA 4ZTBA 3UA3A 4P7JA 5EGSA 3TQSA 1SQGA 4X41A 5DWQA 5KQSA 4Z2YA 2PSSA 2NYUA 1D2HA 1RJFA 3CC8A 2E5WA 3UWPA 3GRZA 4GQBA 4Y2HA 4RTMA 1PRYA 3KQWA 3DOUA 3PT9A 3GNLA 4HSGA 4OA8A 4OBXA 1I4WA 5F2NA 3Q87B 2IH2A 2ZWAA 4KWCA 1SUSA 1JG4A 4BP3A 3HM2A 4L7VA 3R9XB 3NDJA 5LQJA 4PIPA 3HCCA 3KR9A 2VDWA 2EJUA 4CKCA 3OZSA 2CMGA 3BGVA 3TM5A 2H11A 3P8ZA 4ER3A 2JHAA 2XVAA 4KIFA 2G8NA 2ZSUA 4C05A 2UYHA 3BKWA 3HP7A 3C0KA 1G8AA 2P40A 3PFGA 4DM3A 2ZWVA 2Y1WA 5FQOA 3OU6A 4DZRA 3LHDA 2ZIGA 3HCAA 1F3LA 3DULA 5DX0A 5ERGB 4P7FA 4OQEA 4AX8A 3HVKA 4BLVA 3EEOA 3KPJA 4PWYA 5G02A 3LGAA 3CJQA 3EVDA 4QQNA 1ZQ9A 2CKDA 2BR3A 2FK8A 5HILA 2O07A 3CBGA 3FPHA 3GGDA 3LKZA 1QZZA 4E33A 1ORHA 5HEKA 2KW5A 3HCDA 5DXAA 1YB2A 5ICFA 3ID6C 4RVGA 4AZSA 3KR0A 3LDGA 3E23A 5GOZA 4C04A 4PONA 1X1BA 4XCXA 3EGVA 3FUTA 5EEGA 2UYQA 1PJZA 2ZVJA 2YUIA 1QAQA 3TPZA 1L1EA 3BKXA 3NTVA 3G2PA 3DLCA 1EG2A 1RI5A 2ESRA 5JR3A 1ORIA 1INLA 5EOVA 4PIMA 3V97A 4R6XA 4RTNA 3G5LA 2NXCA 2AOTB 2QY6A 4Y30A 3G2QA 3KR2A 5DM4A 5DX8A 5FQNA 2O57A 2AOUA 1NBIA 3KPWA 2AOVA 4GOLD 3TM4A 3RW9A 1YFLA 2NP7A 3CVOA 4LWPA 4FZVA 4PINA 5DXJA 5JUWA 5K0BA 2WA2A 3OU2A 1EJ6A 3P9KA 2UYCA 1G8SA 4HTFA 5KVAA 5KQRA 4YUXA 1KXZA 3HTXA 2ZLBA 2GH1A 3I9FA 4PCLA 2OY0A 1NW8A 4B17A 2EX4A 2I9KA 1NT2A 3KQPA 2YQZA 5EIWA 4BY9E 4XUEA 5K03A 2CL5A 2IIPA 3A4TA 1KYZA 3CCFA 4R05A 2BR4A 3JWHA 5D1NA 3PVCA 3SM3A 2ZBPA 2IBSA 3SXJA 4GC9A 4DMGA 4PYLA 2IH4A 5HIMA 3DH0A 4EMSA 4EQZA 1NW5A 3G88A 2HMYB 2OO3A 4PCAA 4C4AA 2K4MA 5FHQA 1P1BA 5GM2A 1R6AA 5E1BA 3HCEA 4GC5A 4M36A 1WG8A 3EGEA 5K0CA 3NW9A 4IWNA 3TR6A 3NMUF 5BP7A 5EMLA 4RTLA 2ZIFA 4F84A 1FJXA 1F38A 4PYIA 2PLWA 3GJYA 4MQ4A 2XYRA 3HA3A 1UIRA 4PNEA 3GDHA 5D1HA 2P7HA 4A6EA 3T7SA 3THSA 3HA7A 1YFJA 3A26A 3O31A 4YV1A 1NKVA 5GIPE 3UJAA 1D2CA 1TW3A 2NXJA 4HTFB 3ORHA 1O9HA 4JXJA 4HGZA 1VP9A 2XVMA 1AQJA 3EVFA 4C07A 1EIZA 4RTJA 2JHPA 3L8DA 4KDRA 3B3FA 4IV8A 4YV0A 2C7PA 2OXTA 4AZWA 2JHCA 4DCMA 2PGXA 2Y1XA 3ELDA 1EAMA 2B9EA 3E7PA 4WXHA 2NP6A 1P1CA 3GRUA 3OCJA 3KQOA 4U7TB 2ADMA 1I9GA 2VS1A 3G8BA 4FT4A 3G2OA 1NW3A 1XTPA 4QPNA 5KS2A 3WSTA 1JSZA 3UBTA 1G38A 3B7PA 4PYKA 2UZ4A 3BT7A 3P2EA 4RVHA 3DXXA 4PYJA 3FTDA 1VQ1A 5K0JA 1FBNA 5DTRA 1ZGJA 2YX1A 5E1MA 2UYOA 1VL5A 4FSXA 2ERCA 2PVCA 3FYDA 3R0QA 3R3HA 1ZHFA 5GM1A 3UJBA 4YV2A 2ZCJA 3GO4A 2QM3A 3MB5A 1WXXA 3FUUA 4OA5A 5FUBA 3CJTA 5CCBA 1FP2A 5E9JA 1Y8CA 1NV8A 2FK7A 5CVUA 3CGGA 2AS0A 2AOWA 3BXOA 5HIJA 2B25A 3SR4A 3UJDA 5FCDA 4FT2A 2PXCA 3K6RA 2AOTA 1KPHA 2NXEA 2P1DA 3FRIA 3OFJA 3P2KA 5K01A 4RYLA 3TRKA 4HG2A 4PYOA 3IEIA 4QVGA 3B5IA 2BM8A 5K0LA 1MHTA 4MWZA 3VC1A 4EKIA 4BLUA 1D2GA 2YVLA 3KQMA 3OU7A 2WA1A 4H0NA 3UJ8A 4C06A 1Q0TA 2ZZNA 1AV6A 2AN3A 3LPMA 4CWAA 1YF3A 3T7TA 4AZVA 4CKBA 2A14A 3BZBA 1KPGA 2GAFA 2HNKA 5EMKA 3PTAA 4R6WA 2OPBA 5LSAA 5EIFA 1TW2A 3EGIA 4QPPA 2YTZA 3KR1A 3SSOA 2BH2A 2EFJA 3FUVA 3JWJA 4MIKA 1G6Q1 2O05A 3EVAA 3JWGA 3SMQA 4K6MA 4C08A 5ICEA 4ISCA 2ZIEA 3RIEA 3QOWA 3AJDA 2P3QA 3ELWA 3B89A 3FZGA 4ATNA 3P9NA 2VDUE 1VP3A 2P3OA 3HEMA 4GF5A 1YZHA 3I53A 5DM1A 3TKAA 5T64A 3GCZA 4HH4A 2JG3A 2FHPA 4G56A 4P58A 3KQSA 1TPYA 3LX6A 5DPMA 5EMJA 3C6MA 1KIAA 4HGYA 2O06A 4YUWA 1NW7A 1XVAA 5LQNA 5E2BA 4X1OA 1RJDA 3E05A 1SQFA 3ME5A 3SX0A 3SVZA 3IV6A 2ZBRA 2Z6UA 2GS9A 1H1DA 4P7GA 4EVIA 2PWPA 5DT2A 1RI1A 3OZTA 1XDSA 4GOOD 4YUYA 5M5BA 3RODA 3A7DA 3LCVB 3HNRA 3MQ2A 1UFKA 1DUSA 3SGLA 4R8RA 3F4KA 1JG3A 3M6VA 1VE3A 5K0EA 2ZTHA 5LQCA 2JJQA 3FTFA 3SSMA 2OB1A 3DP7A 1YZ3A 2DULA 4KVZA 2PV0A 4UOEA 2YXLA 3PX3A 2O0LA 4E2XA 5LQAA 4RSRA 3DR5A 3FRHA 10MHA 3AXTA 2V7EA 3NWEA 4QDKA 4DA4A 1L3IA 1M6YA 4QQKA 2G70A 3LCUA 1G60A 2HWKA 2P8JA 3FYCA 5FHRA 1XCLA 4C03A 1N7JA 2IDKA 5DX1A 3Q7EA 3AWIA 2LD4A 4GUAA 4BLWA 4E2YA 3PLAE 1KPIA 3PB3A 3ER8A 2AN5A 2EG5A 3EMDA 3MAGA 3QOXA 4XUDA 7MHTA 4RVDA 2BM9A 2P7IA 1IXKA 2Q41A 3AY0A 1QAMA 3E8SA 3FUWA 2IGTA 3KQVA 3MERA 3R6TA 4O29A 3OZRA 3GXOA 3S68A 3UJCA 2JH9A 1X1DA 2EJTA 5HFJA 3BGDA
chains in the Genus database with same CATH superfamily
2ZTMA 5CK5A 1BEEA 1I4OA 3DB2A 4CV0A 2O50A 1GZVA 4E30A 2C95A 2AX4A 2ZPAA 1CS0A 1AIPA 2GN8A 4ZOEA 4Z9XA 5JCJA 2Q0QA 4MCHA 4D82A 3CKKA 5TXGA 1Q0RA 3FM9A 4NBTA 1RMQA 2WWWA 4EW2A 5AT1A 4J94A 3VC7A 1DX9A 1JWAB 1U0TA 5ENDA 2FSSA 4RIEA 3ESRA 4LXHA 1E3EA 3F2IA 4V0QA 2FDRA 2QD3A 2R8ZA 3EXAA 1ZZGA 3MOGA 3VAYA 3U7RA 2A78A 1T2FA 4OH7A 3W05A 3L01A 2CHUA 3G5TA 2QN7A 4I8DA 4NEGA 4WLFA 1RQRA 4X45A 2VAMA 5ADUS 3GC6A 5GIOE 2WQ6A 2A0XA 4EZEA 1R8XA 3DYIA 5E8RA 2WQ7A 3BRWA 1RRMA 5ICMA 4AG6A 3ZW7A 1A27A 5CFNA 4NXMB 4EGJA 5FTMA 4C3OB 3EG5A 4IOJA 1XDZA 2GCOB 4BWFB 1D6JA 3OZCA 3W6NA 1VG1A 1HGXA 3L8YA 4YO8A 1BH2A 1QHSA 1ZJ6A 2ECQA 1GIAA 1NV9A 2PRKA 2Q5OA 3HLYA 1VCMA 4BQEA 2NX2A 4D9FA 3I12A 5JALA 1XN1A 2EGGA 3V8EA 1XZCA 2E4ZA 1G5TA 1CD5A 2EIHA 2IIBA 3I5AA 4I8XA 4IIVA 4NICA 4OKNA 4X44A 1C1YA 8GPBA 5EJ4A 1Z88A 3ZY3A 2Y66A 4Q4HA 4DR1B 2FMTA 4YRFA 1TJYA 1WMSA 4MVJM 4F60A 1FX0A 1QTRA 3QENA 4HAOA 1RLMA 5AIAA 5LP6C 3C3WA 5IVIA 4PPYA 3K53A 3PDCA 5HTOA 1R4MA 3QLJA 4CT4B 1FQOA 3IMFA 4A23A 3L0DA 3TL6A 2UXDB 2RGNA 3HGTA 3NDRA 1E4EB 1LH0A 3BF7A 1IY0A 2GZSA 1Q7EA 1GUDA 1SXJE 2HH9A 3AIKA 3EZXA 3QNUA 3S2GA 4B3JA 1GPLA 3RSOA 4BO8A 2EZTA 2XBUA 1D04A 2RFLA 1DI0A 2BP7B 1BROA 2GMWA 4XLTA 1ZIDA 2FEMA 5ICSA 2L42A 4NAHA 1XE3A 1Z0FA 3NVKI 2G0AA 1G8FA 4GVLA 1Q92A 1AKRA 3WZLA 2ZJBA 3FCEA 1RQGA 2OECA 4MQ6A 1NBEA 3OQIB 5KNDA 4KNVA 2H3EA 2Y1FA 1LBIA 2GB4A 3D6AA 1D1PA 1HT1E 1PAUA 1BX0A 5K3SA 1RKBA 1L5QA 1QXSA 1YBAA 3IJ5A 4JN6B 1DBIA 3QUBA 1W52X 1K1EA 4NCNA 3X0DA 4CM7A 2AK2A 4NDNE 2RI0A 5TEWA 4UBOA 4J3NA 1KR5A 1GARA 2IEGA 2A7QA 2KYRA 4DYHA 4JLSA 4ZVKA 1G20A 1U81A 1WZNA 1JTEA 4B9AA 4IDCA 2X7XA 3GRYA 3ODGA 4ZZ0A 3C39A 1FVOA 1L7BA 3NHBA 1JHRA 3C3AA 3FNQA 4OOFA 4RPLA 2PDAA 5IXYA 1ETHA 2HJSA 4GOXA 4KZPA 3JQ9C 4GOND 4UU8A 4QXQA 5FDFA 1BDMA 5CB4A 1TA4A 1ONNA 2HZ7A 2ISQA 2Q5EA 4HB3A 1WOYA 1MT3A 4B74A 4H6PA 1IBKB 4YP1A 1QE5A 4B9EA 2HPAA 1VPLA 2ODQA 2C2KA 1FRVA 2X0NA 4LDPA 4ZU1X 3VDNB 4JI0B 3LRXA 3V00A 3IAM6 3NHZA 1LSSA 4YRRA 2MT9A 4HWKA 4JJAA 4WXYB 4BDTA 5AKKA 3EZ7A 3R40A 3UCXA 3MTIA 2I2DA 3MMZA 4M9QA 1E3WB 2FW9A 3WWOA 1T0HB 4YJ3B 3MWDA 2FQWA 4QXAA 1Z26A 2X9NA 2X40A 3FBGA 4LHVA 4R9RA 3T5MA 3U80A 4BECA 3VAAA 4MTLA 3QVSA 3ENNA 2WD7B 3FPFA 1KWKA 4KPYA 2ODTX 4XA8A 3IPYA 3W8RA 5KQPA 3IVCA 4X62B 5EUMA 3AVYA 4WDQA 2PV7A 1LRJA 1TO2E 3LXRA 1L3CA 3HKEA 1JWLA 3RRZA 3EAQA 2GCGA 2BGTA 3JQBA 4ACBA 4NZZA 2I6GA 3UEOA 4TV8F 2AWNA 4DG9A 2O5VA 2F1RA 2JFHA 3WRXC 3AG5A 3LYAA 2OLKA 4AMGA 2HA0A 3FWPA 3GQBB 3V3KA 1QH0A 4XKJA 3UXHA 1DBQA 1F8XA 4M1TA 1T1JA 5EJ5A 3WQSB 1C5KA 4REQB 5HHTA 2PMEA 2VF2A 2UUPA 2CB0A 2Y2VA 3NB0A 3K1JA 4HNAA 3Q3JB 5D8DA 1J0DA 4QZVA 2Z6QA 2WDZA 1BOOA 1BHJA 4EUFA 4S1VA 1BKSB 2Y71A 3IGFA 5HUHA 1HDZA 1JZQA 2RHLA 1CB0A 1RM3A 3D7RA 1VLQA 3EEBA 3H2IA 3H6HA 4LHZA 3FTCA 1WXHA 2C7RA 1XJ5A 4LXXA 2H1RA 2NO4A 3EGXB 3OOJA 4N5MA 1SU4A 2XUZA 5JPCA 5KSYA 3CPHA 1F2UB 4YIHA 4C2TA 1V7CA 2FZKA 2PRJA 3HBNA 5LZ7A 1MEOA 5REQA 5CYGA 2C2WA 3EIHA 1T43A 2JATA 4Q02A 4XE5A 3RSQA 5DIZA 2CFCA 1XTZA 2P35A 3BWYA 3NTRA 2R87A 2M6LA 4BFXA 2HA2A 1FTWA 2QTAA 4RF4A 3B53X 1W581 2EBHX 2AJ8A 1LPPA 3IVMA 4W7HA 4YQEA 3ZVLA 1V95A 4N65A 3MTJA 1F1BA 2NTVA 3J7TA 1N3IA 1B8PA 1OMOA 4H3HB 4J03A 1NFRA 4PWZA 4TTJA 1O2DA 3GZTB 1LQ2A 2RHJA 1SVSA 5KVCA 5LJLA 3G0BA 3IJRA 3WGGA 2V7WA 3O4HA 3WNVA 2P79A 4D0LB 1E63A 1Z2DA 3E22A 3TIIA 3HLTA 1Z6XA 1X0XA 2G8LA 4UM5A 2NZXA 4HB2A 1GN8A 3EFOA 1OFHA 1NOJA 4AKHA 2I4OA 2P6UA 1GN9A 2DE0X 1DE0A 2YMMA 5TPZD 1K8XB 4NFYA 5CCXA 1CE8B 4EIWA 2ONZA 1AK1A 1MT0A 1THTA 3ED5A 4UHJA 4MUNA 5K09A 5DRTA 3MTEA 3OT1B 2GZRA 1DC8A 4QUKA 5IBPA 4TTSA 1YC5A 2WJ3A 1HE1C 1SCUB 2WWFA 3DEIA 3GLQA 4IX9A 1MHPA 5C0OE 1VJGA 2OO5A 1AUPA 4XGIA 4HDKB 1S9DA 4IG9A 3ZE1B 1C0KA 5C53B 4R40A 2BFBB 2NW6A 3ZY6A 1PJRA 3C5EA 1XCPA 1YR9A 4HEA1 3DV2A 2GXAA 1E2MA 1PZFA 3OLYA 3DAPA 4S1OA 1Z08A 3TQSA 5IUNC 4QPZA 4FQ8A 1ITZA 1YQQA 4QO8A 4B80A 3VSBA 2H9IA 5EXSA 2FTKE 4RPIA 3NNDA 2ZYHA 1ZMBA 2CYAA 5D51S 1KK1A 1O9BA 5DHRA 5EXDA 1IH8A 2FSIA 3KQWA 3SF8A 4C5CA 2HRRA 3KEMA 4CKEB 4DCSA 1RWXA 2YVAA 4A2PA 3QE2A 1J07A 1LSJA 1SM4A 4UDXX 4MQ5A 4NYIQ 2IZ5A 3GUCA 5AI8A 2W71A 3GLGE 3F6SA 1USIA 1T2EA 2QLMA 1ZSNA 4IVNA 4MQFA 4IIDA 4G63A 3JATB 1E1CB 1DIHA 1WLYA 2MR5A 2CL0X 2B7BA 4FHDA 2DUMA 4G85A 5F3DA 4C05A 2F6RA 1ZM9A 3GNTA 1EQ2A 2YL2A 3HJHA 2AW5A 4HVCA 1GPYA 1Y9DA 1XU4A 2VT6A 4HCJA 3VZRA 4BTLA 4PN7A 4P7FA 4AX8A 4UJ3A 1MABA 1JR3A 4X94A 4DE5A 1XRSB 1LC3A 2W0MA 4ENTA 1QYDA 1Q0PA 3BXEA 1RE1A 3BXFA 3ZU6A 4CDRA 5AHRA 5BV7A 2ZDHA 2WKRA 4QHTA 3E7DA 1J2JA 3SLRA 5AKZA 2SECE 2UYQA 2W6ZA 1NI4B 1Q74A 2YUIA 3JZMA 1YDGA 4D4MA 3H19A 3T3GA 4EG8A 4QECA 1JLSA 3KL2A 5ALSA 2G7ZA 2AE1A 4M1OA 1NNLA 1YJXA 4JDPA 2JKVA 1DMSA 3NXSA 4XQ9A 1EEHA 3ES9A 2C8VA 5CEEA 5J5VA 4Q3AA 1IBMB 3ZLBA 2NUTA 3M5PA 4PC3A 4EEKA 1QO9A 2AOVA 4X93A 3MRVA 4G1MB 4LWPA 1HE4A 2FG5A 2HRBA 4HFNA 1YQEA 1U8ZA 1P7WA 2W58A 3H2YA 3LTNC 3LOPA 4JQOA 1AH2A 1C3JA 3S1AA 3KB2A 1ADJA 4Q3KA 4IGFA 5EKDA 1ZU4A 4RULA 4EL5A 1YVPA 2VRCD 3EOZA 1LWNA 5CVCA 3R0XA 3E9YA 4QOHA 5CLIA 5B6PA 3D8HA 3BWXA 3M4NA 3CCFA 3A4TA 3JWPA 2C2GA 1G2IA 1TCVA 4IIGA 4DDMA 1B3BA 4MI1A 4U6NA 1I9CA 3HKDB 5KNBA 2OE2A 5GPBA 1Q0UA 5EMHA 2COEA 4LJ5A 1XYYA 2G04A 3OKAA 4S1TA 4GLOA 3F7TA 5DLEA 1K5PA 4XFDA 1SBQA 2GCIA 4QT0A 5GM2A 1R6AA 2A1IA 2D54A 4RCVA 1IU9A 1ADYA 4Q9LA 5CM8B 3V2IA 1WG8A 3EGEA 1EXDA 1PT8A 5K0CA 3WAGA 2P9TA 4HAVA 3TKLA 2Q8PA 3E2IA 3FKSD 3KSBC 3DDWA 3BC1A 1M6NA 2PLWA 4NEHB 1F3OA 1SPBS 2F1OA 2XJ4A 1OVGA 1JW9B 1XRJA 3F8WA 4C21A 2QN8A 1U0BB 3IQGX 3MD9A 4PZ9A 3C1UA 3H0EA 2WNHA 3KUKA 2QPAA 3O31A 2QVXX 3KWLA 5BPHA 1E7RA 3D1VA 4NMHA 4D3XA 1B6GA 1QBGA 2QUHA 3COVA 4J49A 5JAMA 2D0DA 4HGZA 2XVMA 3PUJA 4D8TA 1B1CA 5JSZA 3LD9A 3NBXX 2PO7A 3WIOA 2QP3A 1DEKA 3OKFA 5HZHA 4GM4A 2JHPA 2RI1A 4UBLA 4G5QA 4GBJA 4YV0A 4GE0A 3QVVA 4L02A 2OBBA 5TMDA 5B4VA 5KIAA 4BN0A 1XMPA 1GZ3A 3IO5A 5CBPB 1APBA 2JHCA 2R7KA 1R6DA 5JCZA 2DFDA 2PRSA 3BIOA 1IL0A 1VRCA 1X7XB 3O21A 4FIDA 3HK2A 1UK9A 1ZNQO 2V1XA 2GNAA 2VDQB 1G1MA 1NSTA 2XMRA 3C3XA 3DGFC 1E2UA 1RRGA 3JCZA 3LIIA 4U7TB 3V2UA 2WIJA 3IERA 2PA0A 1F6BA 2IPLA 3PHGA 1U2QA 4OL0A 2PZLA 4E1AA 1XPOA 5FYDA 3KZMA 2VKTA 4LV5B 5A9TA 1E4YA 4B8ZA 2XB8A 1JT2A 1I4EB 4X90A 3OBBA 1OLOA 4Q1VA 5IVPA 2GBPA 3FTDA 1JIVA 3CVVA 4EYSA 1HDXA 2EJBA 3FPKA 1T6ZA 2XCQA 1AQUA 3DBRA 4F2WA 2PUWA 2PVCA 3OP4A 5FT9A 4UMEA 1T5HX 3MTBA 1NIJA 1C7EA 1FDTA 3D43A 2OCDA 2PH7A 4RXUA 1ZN9A 1WDTA 1GG5A 2PCJA 4BL5A 5FUWA 3IEMA 1N2HA 1Y8CA 5KOIA 3GGJA 4TN1A 2REOA 3CGGA 4QUEA 4XPZA 1E2GA 3I04A 4OUDB 1H9CA 4H16A 3NNNA 1IQUA 4U3JA 2FWAA 2Q2VA 1FJHA 4EB0A 4CETA 3QE4A 4UHEA 4HQNA 3RHSA 4YPOA 3KJNA 1IZZA 5I9SA 3FRIA 3WB2A 1MC4A 1SZPA 2WYUA 4IF4A 4CR7A 4B73A 4DWWA 3EXHC 3H4TA 4MRVA 2B6NA 2WYVA 5GAJA 4Q1BA 4TM7A 2OZPA 3CH7A 3AG6A 1NAIA 4AMZA 2IODA 3DMYA 1N6PA 4DCJA 2VZLA 2ZETA 3RDPA 2AN3A 4YK7A 3LRTA 1RAEA 3AZPA 5KEIA 1V9CA 2XD4A 2CNBA 3ZNNA 3PTAA 2VJBA 4OEHA 5I4BA 5FBWB 4KJZA 1H2WA 1TW2A 1L5GB 4DIMA 1ZOSA 2QJWA 3DDOA 1E2IA 2ZRAA 1G6Q1 5HE8A 4GGMX 5JMOA 2HCRA 3QM1A 4S3MA 1LBEA 1VKNA 3AEXA 1F2DA 3DVQX 1CZLA 5E0OA 5F5XA 2P3QA 3N2NA 2P3OA 1NI3A 5DM1A 5BSVA 2ETXA 4W5OA 3FFXA 3IV9A 5KSZA 1CRLA 3AILA 4WLVA 2V6GA 3W7BA 4Z4QA 5EMJA 3FOZA 3AFMA 3X1DA 1GPJA 1NM5A 2DFLA 1PR9A 4IKEA 3NHUA 4BX0A 1WABA 4DMKA 4AKSA 1VG0B 2WUGA 3LUPA 3IDAA 3DCNA 4FYVA 3HXKA 4JYPA 4H77A 1QH9A 2HU5A 4HKTA 4F96A 4NK5A 5FO0A 4UTXA 5DOVA 5F35A 3ETLA 4ZVMA 5AVQA 1Z29A 3BD6A 1XL0A 3KL4A 1B8VA 1VPVA 1KY4A 3NTXA 4I5FA 1D2NA 2X6QA 1J0XO 4NCAA 4BJ6A 5AK4A 5BMVA 2G77B 3PX3A 1Z25A 1T34A 1UBNA 3C87A 4EFNA 1KZYC 3MWGA 1P7ZA 4G24A 1EQUA 2XUGA 5B12A 1EFAA 2QGFA 3D5QA 5LWQA 1FUUA 3GZ4A 1QK4A 4H4DA 1M6YA 5I48A 1UEJA 2WD8A 5FHRA 3KKOA 5JTTA 1XCLA 3ZCXA 3VR6A 3CZPA 3L7DA 2P0AA 3AUAA 2LXNA 5HS4A 5JQWA 1FEZA 1H69A 3KHTA 4KK3A 3COWA 1OTXA 2Q41A 3FSJX 3JVEA 4HQLA 4PAMA 2IGTA 4YRLA 4K9KA 4QBHA 3B6JA 2CF6A 1E6LA 3R3WA 3W2FA 1C80A 2UDPA 1I0ZA 3TM5A 4P4GA 4FONA 3QELA 1KH1A 4YT8A 3L7LA 2A67A 2QNIA 4FCVA 3AUKA 1RI4A 3DUFA 4WBSA 2ZAOA 2NUAB 3W5SA 2I3DA 4JLJA 2IJGX 2QT0A 3M6WA 2F62A 4OXKA 1U3VA 1ZD5A 4E2WA 1BX1A 1KYIA 3Q6IA 4ND4A 3HWX1 2HL6A 4U63A 1GT6A 2WB4A 3ORFA 4HSEA 2BDTA 2HSJA 3FPEA 4XD7D 3VDRA 4HUJA 4XARA 2R6DA 1EP2B 1WNTA 3WFIA 1QF7A 2ZUVA 1ISFA 2VSFA 3BHMA 2W93A 4HFJA 3MAJA 4IBOA 3CX8A 4AUEA 4BO3A 3FIJA 3OCXA 3R24A 1YZKA 4PS0A 1OAOC 5JMTA 4S04A 2YYYA 5DW0A 1OQAA 1WF6A 4JD5A 3D4BA 5FI1B 1R9NA 2HRCA 1MH1A 1FS5A 4ZI3A 1E3JA 4EOGA 1BVHA 1Q0ZA 1C9KA 3ZWMA 2HLDD 4O4IF 5B2FA 2JKYA 2W37A 1OV4A 3HSYA 4KWHA 2JGDB 1WQ4A 2KMLA 3MLAA 1HFEL 3PE3A 3O8NA 3D8TA 4ER6A 1UMCB 2PUTA 1N3BA 5AM2A 1HL3A 1KY2A 4CKWB 1XA4A 2IDJA 1IUOA 1QYCA 3H1TA 4HGOA 4TKUA 5C8YA 3VI4B 1WQ3A 4G36A 3WQBA 3W9YA 4D45A 5KPDA 5IT9A 5JV5A 1TIKA 4W8GA 3W90A 4EKEA 5K8IA 4OFXA 1Z73A 3M81A 3OE4A 2ET6A 3T0GA 3DMFA 1N1DA 4P22A 4X61A 4O6VA 4BFYA 1U0RA 4EJSC 5JAZA 3HVRA 2BELA 1NYTA 1PQPA 4MUEA 5LDHA 2I7CA 3OOHA 2HXSA 1EBFA 1C0LA 1R0WA 4YLEA 4ZCSA 5JZSA 3I2YX 2XZPA 2NV2B 1OROA 2EBWA 2QG6A 1FFYA 3JQ7B 4IVPA 1GRCA 3UMVA 1XLVA 4GBGA 1A2OA 5EYPA 4JUFA 3E6AA 1KYTA 2GLUA 2PKCA 5CIQA 1JXMA 4PZUA 4CLXA 4E7OA 3VU0A 2WIAA 2CNKA 2IOFA 3A1TA 3GJSA 2JB9A 4JCOA 3FYUC 1S2GA 2ODEA 3CZ4A 2O2JA 3OC0A 4RS3A 3S2ZA 1UMKA 3U3DA 1VYVA 3LUKA 1AU9A 3QWHA 4UXHA 1TT7A 3IAAA 5EKUA 3SQLA 2NUPA 5TX7A 4IIJA 1NX9A 2Z08A 1JJFA 4HS9A 4PNZA 3WIVA 3CUVA 2WHQA 3LT0A 1RRKA 2INGX 3M89A 4HJXA 2C7VA 4YRNA 3K35A 3HP4A 4KI7A 4U8HA 4Y0VA 1Y3DE 4PTZA 1QSGA 4ZRDA 4Y6LA 2ZYTX 3VUEA 2CYCA 1FFCA 1T2NA 3ZLJA 3ZHBA 1YZVA 1MJHA 2R47A 3EXIB 2WZDA 3SIRA 1U63A 2ZSAA 4DNOA 1SUAA 3GLFA 3WQQA 3DYVA 3C97A 2I54A 2VDPB 2X3UA 3K9HA 5DV9A 1RWWA 1K75A 5LYJF 1WB9A 3L7AA 4PSCA 2AYXA 3GCXA 4QLAA 4PQGA 2QRPA 4G8DA 5F9FA 2CZCA 3G1UA 4NYIR 4P3XA 3MZ0A 4F1JA 4RKYA 5A4FS 2PX6A 1NLZA 2YFQA 3A9UA 4E5VA 1RCTE 2VLBA 3P9CA 2I91A 1CWUA 3LCCA 3S4YA 5KQGA 4QYTA 1JQ3A 3OQBA 4B3GA 1YS7A 3ICEA 3G13A 1K7YA 4YRJA 2XT9A 1WVIA 2IWRA 2Z2XA 4QM6A 2CLKB 4DSNA 3OJLA 4UUOA 1WHSA 2GJ4A 5K0NA 2J59A 3IT1A 3MYRA 2NMVA 3EQ2A 3KYBA 5EE1A 2ONKA 1QGUB 3FD8A 1IZ8A 5I4IA 2IUSA 3HVUA 1C3OB 3KHKA 3PC8A 1TNDA 1Y5IA 4HUQA 3X1JA 2BFDB 5C5IA 4OH1A 1T3ZA 2P9YA 2Y1KA 3D02A 2O0JA 4S0ZA 2ZB8A 1FYFA 2W6IA 2XW6A 5HIKA 2YIVX 3PT5A 1OFGA 1U04A 2EU8A 2AL7A 1Y8ZA 4IEFB 4FFDA 3GT4A 5KX5B 1E7MA 1JEOA 3O4FA 3DCIA 3QWFA 3MSXA 1XZGA 1NXPA 1UMBA 1YOVB 1YR1A 4FINA 4O4JA 1FFHA 2BI4A 1PG2A 4OXQA 3FOAA 2I7XA 2VJQA 4UQLA 1VIAA 1CUEA 2FFAA 1VHQA 3A9VA 1QZTA 3BB1A 3CSUA 4H4CA 4KO1S 4R31A 3I1IA 3MJRA 2YH2A 3O3MB 5EWLB 3REOA 3T3EA 5BQXA 3OQMA 2CJWA 1EX7A 3A1EA 3SDSA 3V7NA 3W7AA 3ONFA 3RRNA 1B16A 4YRBA 5JXIA 3E27A 2RGGA 3G2LA 3PHCA 3W7VA 2JLVA 4BN4A 5BYJA 4FLFA 5FA8A 3W5BA 2PXHA 2YV4A 3GPDG 2ZT6A 3T3DA 3DC2A 3OIGA 3AUJB 4AZ3A 5BV2P 3ECCA 5AXDA 2QIPA 1BHQ1 4MRPA 3DDZX 1R5BA 3OO0A 3GJXC 3NBZC 2QPTA 4NZOA 1JI3A 4I5EA 2IFTA 3V8PA 3GUHA 1R6UA 1L2TA 1WD5A 4RJ2A 1XAIA 2B5VA 3IUNA 1T5SA 5F2EA 2ZWOA 3T1HB 2GBGA 3QP9A 3F4LA 4O63O 4PLTA 1M76A 3N7AA 1PSDA 2QYSA 1PNOA 3L05A 1AA9A 3UXYA 5B7PA 5KPJA 1SOUA 3L8CA 2ZJ3A 4KKVA 3T1QA 3Q7SA 1SZCA 5ABPA 1EQAA 4LFCB 2YFHA 1IG0A 3ETEA 1USWA 2B0JA 1Z0SA 1X1EA 2CVQA 5LBIA 3VZQA 2V5UA 1JR6A 1ZG3A 1HL7A 2Z8YM 1QHIA 3LH5A 2HFKA 1NHGA 3N58A 3RASA 2OGZA 2H1VA 2J09A 3FR8A 4IO0A 1GFWA 1AZLA 3FHJA 1GCUA 1SHLA 4G01B 5BSMA 3OTOB 3S0JA 1LBTA 3LUJA 2JHGA 3JR3A 4FYKA 1I7SB 1NTOA 2D0OB 1Y6JA 2I2CA 2W6NA 2WHYA 1H0HA 3B9PA 4HQ6A 4WOBA 5E6UB 4EUHA 4HNUA 2QQ0A 3KVNA 3PC3A 3DOUA 1ZK0A 1KO7A 4G25A 3O8QB 2IH2A 3IQXA 3B8HA 3BCHA 4Y8VA 1CQIA 3O3NB 1NBME 5TQJA 3WVNA 3TLGB 2CD9A 2Q0XA 3ZIAD 3NDJA 3PQCA 5TGTA 5D86A 3E4CA 2OAP1 4QBTA 1LPSA 4UCFA 1VYTA 4RWEA 3WI7A 2J3KA 2JHAA 3ADCA 3CR7A 1BMFD 2ZSUA 3JW8A 3T0FA 4B6FA 1RP7A 4YCJA 3I5YA 2PR2A 1Z63A 4MS3B 4N0EA 2GXUA 3UMFA 3ELBA 4I6GA 1AS2A 3WKEA 3W2EA 4F7WA 3MUFA 1BFUA 1MIOB 4HPJB 2EQAA 1MRSA 3B1VA 3KAPA 3E8XA 3QXCA 4BKRA 4C5BA 4DCUA 1Q95A 1P17A 2P2SA 1EVYA 2BR3A 2CKDA 2DKNA 2WZBA 4AKGA 1QZZA 4Q9JA 2DPHA 1P2VA 1SG0A 2AUMA 4RETA 1YB2A 4BMXA 4F1KA 5BN4A 3AFHA 3GV0A 3KR0A 3LHSA 1MAHA 1NVBA 1N3YA 1WIWA 4LDJA 4RZIA 1RVDA 1EDDA 2ZXEA 4ZYTA 3IO3A 1ZK1A 4HLCA 1UBKS 3VAZA 2PGNA 3O92A 2J3MA 1BG6A 1E6KA 2ESRA 3H11B 3IAUA 2NU9B 5JDIA 4JBGA 4NABA 4OLJA 1V8DA 1JU3A 2QA5A 4PZDA 4I55F 3TB4A 3WHLA 1YJBA 4YECA 4U2EA 3WLPA 4FN4A 4URXR 2H54A 3HYCA 3D6FA 3IRVA 4RMNA 3F5DA 3OPMA 3STUA 2VN8A 2C61A 1QS0A 1G5QA 5A0TA 3WA6A 2BFWA 3H9UA 3LC7O 5JCOC 2IS6A 3EWIA 5K0BA 1GAXA 4RD2A 2TRSB 3G0DA 5KVAA 3W8FA 5BXQC 3L1JA 4PF1A 3UJHA 3EAFA 4DMFA 2OY0A 4KE6A 3HXMA 5H16A 1FTQA 2BHRA 3HABA 3G2JA 3JV7A 3SU8A 3STVA 2BZ1A 4LBWA 4JWTA 5FTKA 2OWDA 2JD1A 3N2KA 4XUEA 1LEHA 2ERYA 1IJFA 3O5AA 2BT4A 4Y1FA 5KYUA 3RC2A 1AA6A 4YRSA 1NP6A 3GYGA 4YAIA 2GI4A 4X6XA 3RSHA 3TJRA 5H68A 3ABIA 3ACBA 3RG8A 1CUFA 1F1JA 1E79A 4ZARA 2FSHA 3OQ1A 1MEJA 4K3UA 2WAOA 2NSHA 2HJRA 3LQYA 3N59A 1ZFNA 2YWXA 4LGMA 5TJ9A 4D0NA 5ITVA 1WBBA 3AU9A 3NGMA 1KNQA 4HQKA 1CUAA 2VHVA 2QN6A 1G5PA 5KAMA 4DRXB 4LDQA 2EARA 5HR5A 2XLCA 5LOVF 4PAGA 1IK6A 1UOPA 1DWOA 1ULZA 2H52A 3DZDA 3K8YA 4JDUA 2H8GA 4H7IA 4KQMA 4OXIA 3B2NA 3QFTA 3GMSA 4D6PA 3A3NA 3DOEA 2FKAA 4NQRA 5ILGA 1AGXA 4US2R 5B6IA 1NKVA 1I7LA 1UJ6A 1JKJB 1PP4A 2P6NA 1BQEA 5KHLB 1WAMA 1J99A 2VUSA 1CJBA 3ZE2B 1M0SA 2H92A 2G9RA 1AB5A 2H65A 2O4CA 3VPHA 5FH9A 4FM9A 1OLSB 1DBVO 1DX6A 2J9RA 3SHWA 1VKJA 2MCFA 1RMTA 2A5YB 2AC2A 2Y1XA 3ELDA 3Q6NA 3NJ8A 4HWRA 2J6BA 2FPPA 3E7PA 5A9RA 2J9XB 4UEWA 5ADVA 4MVJD 3KQOA 2ADMA 1GKUB 4F8YA 3R0VA 1FTNA 4UDOA 4GOJA 3HL4A 4X7RA 3ETDA 5HSGA 3T8YA 3WSTA 1BQ3A 1Q2XA 2HD4A 1KL7A 2Q7DA 4MIYA 4EJ6A 4ZZ1A 1CY6A 3FRJA 1US8B 2R7MA 4EBFA 1YBVA 1UFOA 1GNSA 3H18A 4H18A 4JCCA 1AMUA 2WOJA 4CEIB 1NNI1 3EARA 1V4VA 1LLFA 1ENYA 3OE7A 3AEUA 4Y1RB 1OBVA 3S99A 3WRYC 4B4UA 2PS0A 5KC9A 1ZLYA 1IATA 2ZCJA 2GZMA 3MB5A 2YHIB 3BEOA 1O97D 2WJGA 4O1IA 4RE5A 3GVCA 3FLMA 2PUCA 1YT5A 4P83A 1YQUA 4FWBA 3VFDA 2EOAA 1CK4A 3D4NA 2XAUA 4Y6GB 2FNAA 1P6XA 2OG1A 1KMNA 2IE8A 5L4SA 5A6SA 1QUFA 2BJHA 1T9ZA 3B1YA 2PXCA 3KC2A 4FT2A 4K2AA 1JWBB 1RYNA 4MMZB 4MUGA 4DPMA 1QFSA 2V6BA 1WUKS 4GLFA 4Z4FA 2I5PO 3EG9A 4MUBA 5CGZA 3ZLUA 3RTCA 3IA7A 3RRXA 2HM7A 4B5LA 5JBIA 3AP3A 1NSYA 1JJIA 1EVQA 4EKIA 3QBTA 3WLSA 5LP6B 3NOXA 4H7PA 3D3NA 2M98A 2WF7A 3RTEA 1O96B 4YYEA 2AZMA 1TB4A 3S5JA 3O8RA 1EM8B 1EMDA 3AR8A 3K4HA 4X1KA 2FEWB 4UNIA 4ZAGA 4E94A 1MGPA 3ZZ0A 4MUKA 3PYXA 4KQJA 2PUDA 4ILEA 1EXNA 5IHXA 2OG2A 4EGSA 1EPUA 2BH2A 5LPNA 2Q6VA 2W83A 4X1IA 4U6QA 1T8TA 1UXKA 4IHJF 2V9PA 2Q45A 1NDUA 1P7YA 1WMDA 2YVKA 3OEWA 4MKGA 3RYHB 5FO1A 4GGPA 1IB6A 3B89A 1CYDA 7MDHA 2FEKA 1QFJA 1L7NA 3GRKA 3NBMA 5G1PA 1E62A 4Z3KA 4KXYA 3S28A 2CNWA 3GCZA 5E6SB 4C4TA 5KBYA 4D4LA 1TPYA 2A6PA 4ML3A 2YHSA 5CURA 1KIAA 3SIPA 4NDZA 3M4YA 4LZPA 1QKIA 1SCDA 1Q0HA 1JJVA 4CE6A 5IJ9A 1OT5A 1RJDA 2XSZD 4HZGA 3E05A 1CUXA 1GL3A 4KN8A 4XDHA 3AY3A 3SX0A 2PWBA 3JYPA 5LA6B 1RIIA 2R751 3UICA 2WFMA 3B9QA 1PJCA 4JLOA 3JZIA 3UV3A 4D25A 5MGNA 1RI1A 2XLBA 3CO0S 4L0QA 3TCXB 3UV6A 4A27A 1HFJA 1DTWB 1EINA 1TA9A 2R1ZA 2YY7A 4HNQA 4B3HA 4KYIB 4B47A 3PNMA 1BIFA 4IIEA 3SGLA 3V55A 3D7MA 4R8RA 3VHXB 1G8MA 3WK5A 2O0HA 3GP8A 4W8HA 2H5LA 4Y1EA 3RSCA 1X80B 1DAGA 3AJ8A 2BM0A 3EK2A 4NPAA 4KOAA 3T3NA 1YZ3A 2DC1A 1KZ4A 2OEPA 3GMIA 2QX9A 3NU1A 5TQ2B 3TRIA 2PGLA 3DZCA 5AHXA 1XNJA 2ZSDA 4L27A 3R76A 1DSSG 2A4KA 2L18A 1B76A 3Q7QA 4WOCA 3U13A 1SELA 2GCOA 2CXPA 3SS8A 4EGFA 1YMUA 4L2IB 2GHIA 4B7ZA 2BHSA 3ZKWB 1R27A 2PVSA 4OJNA 5FJJA 4XWAA 1KP3A 4TPKA 3BRSA 4Z9AA 2HMAA 2NZWA 3OCCA 1SMKA 1O6ZA 3BD9A 3P2YA 3RVQA 3VR4D 4EDHA 2WE8A 3E8SA 1ZWKA 4K9PA 3RIYA 1QAMA 5HUJA 4M6WB 3HH8A 1Z62A 1N78A 2WM2A 1JGTA 3GMDA 3GXOA 4L4SA 2NAFA 1XVVA 4RIIA 4YA6A 2WPDA 2PT5A 1Q83A 4TYMA 1BS1A 4W5HA 1A9QA 2AR7A 4MCJA 5DXFA 4ZGBA 2QLBA 2P0EA 4HDOB 4B3TB 4Q9NA 1ZIOA 1FDRA 2ZRFA 3G3EA 3BWMA 3D3WB 4KI0A 1XRLA 1MW8X 3DDNA 1AY0A 4ZYZA 2FF7A 2A3RA 2C84A 2H2DA 1JHZA 4IV0A 2GO1A 2RB5A 2YZNA 3EH1A 3G49A 3JPYA 5INTA 5EL0A 1P9WA 5CVJA 1ZH4A 2OV8A 4CV2A 1NG9A 4UZEA 4PR0A 4G84A 2RKOA 3BXHA 1KAQA 3ESZA 2G63A 3OMXA 4DLUA 2I3ZA 3HI6A 3LY9A 3PXDA 2QS9A 4FI3C 3AX6A 3PXBA 3ZWPA 2EX0A 3IJPA 4N5LA 5AKHA 1QQBA 1RJ9A 4PSVA 5SY6A 3T5CA 1E3QA 4AWBA 1S4MA 1ZM2A 1L7VC 1HG0A 4BZZA 3OTGA 1IHOA 3PQ5A 4KIGA 3BTVA 1RT9A 3GIWA 1UP4A 2VF5X 3EA0A 4F21A 5H02A 3SP1A 4W99A 1GILA 1U7HA 2AXNA 3S5UA 2WHEA 3NQ41 4BE9A 3N2GA 3BWCA 1XV5A 1WMAA 3SYNA 1ZPDA 3PLNA 4GL2A 2C58A 3LOUA 4UBMA 1UXIA 5WRFA 3UFBA 1UZUA 3VC2A 3ABZA 3FH0A 2KX7A 2VA8A 3F8TA 1YDEA 5F1KA 1AQIA 5J47A 3ZK7A 1T10A 1KH3A 2BY4A 5D7BA 1NVTA 3VMFA 1E0AA 4FCWA 2C77A 1H1LB 4I4TA 2E1PA 1U3WA 5B2ZA 4YJFB 4DWVA 3M83A 3R5JA 2WAXA 2I66A 5HKAA 2CYBA 3DT9A 3AR7A 3GL9A 1U1IA 1UAYA 2CXOA 2V6IA 5AVKA 3V8NA 4H1VA 4CMKA 1HORA 3BM5A 4NZMA 4NNJA 4YV7A 4R1MA 4BRSA 3QPDA 3UTCA 2O8BB 1O97C 2WSLA 5F2KA 1I2DA 1ZM4A 3QPWA 2OCKA 3QU2A 1K6MA 2XQFA 4W9NA 2A5GA 3DMHA 4C6TA 2R7LA 3KLNA 4GI7A 4OOEA 1AKEA 3X44A 2OORA 4JI7B 3H75A 1LX6A 4FFVA 3GH3A 1PZGA 1JHDA 3SIWA 1X14A 3ZUPA 5ALEA 2VHCA 2DWPA 4DBLE 5CDTA 3BBPA 1U0FA 2I8AA 1V37A 3IOEA 2ZUBA 3MCAA 4FYJA 5JO9A 4X64B 1R9MA 2LVBA 4AY3A 4WCFB 4QEDA 1OF1A 2H08A 4MHTA 2Q5JA 4AQ7A 1ILWA 2WUVA 2CMHA 1W48A 2RHWA 4YJ2B 3ZDRA 4BGDA 4L7QA 4DV6B 2NV6A 2BVNA 2CZQA 4LC0A 1ECCA 5IT0A 4M46A 1N6RA 2QV7A 1Z7GA 3EIXA 3HACA 2JGEA 3VYWA 1X7WB 4BGVA 1HRKA 2O2IA 2BI8A 4FJ0A 3V8VA 3L0YA 3EF3A 4LSMA 4CEHA 2OGSA 2HWUA 4UQOA 4XIIA 2WUEA 3T5DA 1AOXA 3GOHA 1KEZA 3GQBA 1J0EA 5BVGB 4OMFG 3WYFA 2XB4A 3ISJA 1QR2A 4WLEA 1BW9A 5J59A 3PXGA 2G9QA 1F9EA 4DC9A 4K3VA 3RBAA 3V4VB 2IVFA 4O4LA 5LYYA 1ODJA 1IN6A 3C3MA 3N70A 2ZRLA 3KT0A 2G1KA 4JT4A 1FF9A 3DE5X 1X8KA 5CT4A 1B1AA 3GNQA 4FB4A 1LV7A 3D0RA 2Q5CA 1WULS 2C8JA 3JRWA 4IZOA 4TMVA 1GDDA 5DGCA 2IHYA 5AVXA 4WV3A 3SBDA 3DJFA 4OI2A 1I6LA 3VTKA 8OHMA 2AUTA 3L0OA 4MUMA 3TLJA 1GG9A 4XM2A 3I9LA 3QKTA 4QTUB 1VLLA 3GB9A 4TXMA 3DMTC 1P18A 3A6ZA 3N6VA 4HWPA 421PA 2IDMA 2X2PA 4A36A 4GRAA 1KIMA 1U2DA 4M7RA 3R9KA 4AKTA 1GQ2A 1SB9A 3LDFA 4ZCPA 1XRRA 1C0PA 1P91A 1FYWA 4ZHQB 4O3MA 4TZ6A 2AI3A 4XWWA 1CUWA 1A4UA 4D9KA 2B1IA 3FPLA 3QK7A 4O1HA 4CKYA 5BXYA 1JDTA 1N6HA 4V1CB 1VI6A 1Y6QA 5EIHA 5C1IA 5EC8A 4BBJA 1GYRA 3EXG1 5C3UA 1SUIA 4IUBS 4RD6A 3MPOA 4K9NA 4U2BA 1WZEA 3RS4A 2ATEA 1YJAA 3BJEA 4M38A 2ASEA 1SCKA 3ZWWA 1R7RA 2MHCA 2HWYA 2QTVA 2YZKA 3O82A 2LTAA 2B8EA 1QU2A 3I4LA 4BQRA 1WHTB 2QAIA 1GG2A 4E6PA 3EPHA 1D2RA 2WM8A 1X87A 3NYRA 6ABPA 5K2OA 3IILA 1Z0IA 1CE8A 5ALKA 1OVMA 3O03A 5MN6A 2PS1A 4B8WA 1CRWG 1N1MA 1X7ZA 2TECE 1Y8QA 3E9DA 3ENQA 1VE7A 3FDFA 1DLIA 3IQEA 3JVIA 3OT1A 3TZLA 4ITUA 3HWWA 1T3SA 4KQ6A 3HLKA 1NURA 1PNQA 3BHNA 3OQVA 4TKMA 2G7MC 3PR2B 4L1KA 4HDKA 1FW8A 1XKTA 1SEPA 1BMTA 3QVOA 2DBRA 4XPIA 4QA9A 1FVXA 1Z3CA 5DYIA 1ZRHA 4O4IB 3DL2A 2C2XA 4HI0E 3PJRA 1NIPA 3ANNA 4XYGA 4JLMA 4MPJA 3L0SA 1BEZA 4PXYA 2WFLB 3HJAA 4TXHA 5G4KB 4RVCA 4DM7A 3TLKA 4ER0A 2C0PA 5JECA 1T3TA 4JODA 3EBLA 5HFNA 1RWBA 3VPGA 4UCQA 4TWIA 4CKEA 3FIUA 4CLDA 3FE2A 3LLUA 4TS4A 3IUJA 3TIGA 3AXSA 2JZOA 1J5EB 4ARUA 4QDTA 2CHGA 3RSFA 3OEHA 2I4TA 1A8PA 1OH6A 1EWVA 4D3SA 4G9EA 3ZW9A 3R5XA 1UQRA 3KLOA 2WJAA 3FA2A 1KSHA 1KDRA 2Q4BA 3V32A 2CJFA 5GMOA 1VL0A 5HF9A 4BJHB 1DRWA 3R6WA 4R9VA 1AHIA 4QWMA 2C2HA 4S05A 4HZUA 5EESA 2XTZA 4NONA 5IJ0B 1NJSA 2E2WA 1GGVA 3E7XA 3E2PA 3P0RA 1TLFA 1AZTA 2ZWIA 3CA8A 3Q2OA 2HK7A 3RM3A 3TTTA 2ZI5A 3VV2A 5B1EA 4WGGA 1I3OA 1DQSA 1NBOA 1G18A 3WWCA 1QTNA 4CRWB 3KOXA 3O6VA 4F5YA 3DL4A 1Z37A 2QRQA 4ZJUA 4ND5A 1Z8HA 2B9VA 1EJ2A 3VR2A 1KEWA 2GYVA 2VXCA 3TRJA 4LE1A 1N8NA 4HGNA 3OQOA 2PE5A 4M0PA 1A5AB 2ZE8A 3TXAA 1YZUA 1P4RA 4FEGA 5FORA 3DVLA 1XDWA 4ZPXA 4TTIA 1TIPA 3QKWA 1U4OA 4URFA 2EFDB 5L8VA 1Y1PA 3I1FA 4F4IA 1MX1A 2EJUA 3LXXA 1V3VA 2CMGA 4UEQA 4ER3A 4NWIA 1NOKA 2J9YB 1EBBA 2J45A 2YYSA 3CX4A 2BHNA 1FSGA 3REGA 2XE8A 4INPA 1OFIA 2P40A 2IL1A 3PFCA 3VTAA 4IXMA 4EI7A 2ZCVA 1OFUX 3C7AA 4QUIA 3URKA 1VECA 2B7LA 3O8OB 3E9ZA 4UUBA 1NMEA 3WLAA 2XZOA 1E96A 2X3YA 3V8QA 3A8TA 1CG6A 4L5YA 1ONSA 4QQNA 5LYJB 1O6GA 3NEPX 5FBVB 1LRLA 4E33A 1RPTA 3H9EO 3LKZA 1Z8FA 5AKYA 3PIIA 3CRW1 1UBLS 4KMRA 4ZC8A 5IZCC 3N8GA 1EUCB 3HKDA 1ODFA 4HY3A 3T1NA 3ZGVA 1NN3A 2AFHB 4N7MA 3AHDA 3IOMA 3EXHB 4RD0A 5FOXA 2F3UA 2ZVJA 4BNGA 5BOSA 2HCBA 4QXPA 1NC1A 3DLCA 4GI2A 1SGWA 5DP2A 1ORIA 3RAJA 4FLMA 2A9QA 2HA6A 1FFXA 1VZ3A 5AVJA 1EGVB 1IWPB 2XBLA 2Y0CA 4EUKA 2QY6A 3JQ8A 2ZOSA 4JUAA 4ZYWA 4B6SA 4TLMB 1EIWA 4L9AA 2O57A 1F8UA 2TSYB 5BORA 2WP0A 3PFIA 2E4UA 2BCEA 4RMIA 2E0IA 2J0QA 5CRIA 4PINA 3MTAA 2I6SA 3OCUA 4YCDA 4HDMB 4ND1A 4LJ8A 2EFYA 4R8KA 1LRKA 5GZ6A 3UAOA 4M1ZA 4B79A 4UXJA 5I7RA 4F4CA 3RVLA 1ODKA 2BGRA 3L6BA 3HB7A 5KSPA 1L4GA 4IJWA 1NQOA 5A5EA 4WAUA 2N0SA 2W8BA 3TBFA 4NYJQ 2J5XA 3EBOA 5ALZA 1TD9A 3RFCA 1TU4A 3VZCA 3DPUA 5THQA 5D1NA 4PR3A 4QJBA 3UGTA 4A73A 1WPGA 5DYWA 5DLDA 1I14A 5TLSA 1HI9A 4PYLA 5A3VA 2A5JA 5E38A 5K2MA 4EQZA 2WWTA 3EQ7A 2DUJA 4TZ0A 4JROA 2CDBA 2GGSA 3ZHCA 1ZMXA 3COSA 1JFSA 3NG1A 4N0PA 4V0SA 5B1DA 1FFDA 1WKBA 2FETA 3EY9A 2GSWA 1IHUA 4IMRA 4C7OB 3DF7A 1D8TA 1QOZA 2FPGB 1T0PA 3IPAA 4OHFA 5ECDA 1O95A 3KHUA 4TZKA 3OWXA 5EZYF 3THSA 3R74A 1RXUA 2B4TO 2RHBA 3K70D 3CXUA 2JANA 2YYAA 4Q1CA 4YV1A 5GIPE 4Q1EA 3RQSA 4AN4A 2GEFA 4HYYA 4RY8A 2AMVA 1MBZA 1WW8A 3K2QA 5C7LO 4MINA 3AHHA 4OUDA 1XCGB 2H2WA 2EAUA 4BQFA 3TLXA 3TZKA 1ZC3A 4B4OA 5BSEA 1BWRA 2JARA 1PLLA 5ED0A 1FXSA 2I2XB 1S3GA 2G1JA 3BRWD 3AI7A 4IG4A 4IVQA 4MUJA 4QICA 2GHTA 3VZDA 4DCMA 2GK3A 4G5SA 4UVDA 2C88A 4XR9A 1P2TA 2C4MA 3PEUA 4XSHA 3WGOA 2NP6A 2O2YA 3G8BA 1Z7EA 2XRMA 4MB2A 1Q7RA 1MO6A 1A76A 2OFWA 3X1MA 5KS2A 3LKVA 1J0BA 4EBBA 1J22A 3X3HA 1FPMA 5JNRA 2P4SA 3NTLA 4R4JA 1QV7A 3L07A 4BBAA 4NI5A 2ID4A 4DJ5X 1DFIA 1FBNA 1EK5A 1OE0A 3ZBUA 3NYQA 2J7KA 2ZJYA 4YMSA 1IJBA 2Q3CA 4HFRA 3ZWCA 1NDQA 5H9WA 3NJ4A 4YMUA 2ZM6B 4TYYA 3GBPA 1C4KA 3LZ6A 1ZN2A 2AG0A 3S29A 4OA5A 2CVFA 4UAJA 1QBKC 4F6RA 4CYMA 4M0EA 2OT3B 4LC1A 4F5DA 4ONEA 3LT4A 2IXBA 1K4YA 4JASB 1UM9A 4DZZA 3H1AA 1KVTA 1CULC 3QVGB 4KFCA 3BHJA 4J16A 4GP6A 3BXOA 3LF1A 3ITKA 4LIPD 2X9QA 3ULKA 4G4JA 3UOGA 3RUPA 1OILA 4RPHA 5HQ3A 1MNAA 4ZRNA 3M6LA 2IPOA 3NALA 4CMEA 4I50B 2AOTA 2RG1A 2XCIA 1KPHA 4FOOA 3GNSA 3VUFA 3I1JA 4CMCA 2AYYA 3BL8A 1DT5A 5GONF 2WMYA 3HJNA 4O2LA 1QO7A 1ZVKA 3IEIA 2Q5HA 3CUUA 3H8JA 2BGIA 3U5ZB 4KX5A 4KIJA 1LK0A 5KNDD 4YIKA 5B1IA 5CA0F 3ILYA 5K3FB 1LSOA 3QVLA 1T6YA 1WE2A 4NNOA 3RS7A 3WGIA 1RZVA 4TWRA 1L7EA 3O3OB 4L0CA 3KSAC 2IQIA 3QI7A 4R6WA 1T1IA 4UCWA 1NJ1A 5G53C 2IV7A 1X1TA 4BYGA 1JBQA 5KNCH 3D6TB 4EHNA 4D8UA 2QUBA 4FFNA 4R81A 5KCZA 4ISCA 1KA9H 1OU4A 1R0YA 3IIKA 1T9GR 4FC7A 4XWGA 2H1SA 2VDUE 3CH6A 3I9MA 3KAQA 1G7RA 2RB4A 1EP9A 3DFUA 3JVUA 4P58A 3KQSA 1UJ4A 3GLHE 3ZR4B 1L7OA 1IULA 1TCAA 3S70A 4ND3A 2Y4NA 3AY7A 2RC6A 3T7DA 1UDRA 1J0CA 3W5VA 4JKIA 4KOEC 1XD9A 1K9VF 5BT9A 1GNTA 2ZBDA 3A4YA 5CA1A 2QQGA 3MIIA 1R6TA 3IT0A 4HXYA 2W42A 2EL7A 3EIFA 2QL6A 3BCRA 2G36A 3LCVB 3L84A 1JB9A 4MH0R 3CNBA 4HXFB 1ZR2A 2H1WA 2WYIA 1A2BA 2QM7A 4XGRA 2BI7A 1DELA 3A0UA 4BQIA 4J75A 1VE3A 4DIUA 4BO4A 3GGPA 3BBLA 1EK0A 2VK8A 4Q7QA 3ZWAA 1BVUA 1FYEA 4MS4A 5GJCA 2P2GA 3GRPA 3R3VA 5L45A 2X5XA 1H6DA 2OHGA 4QDKA 3W2GA 1MLDA 4ZT7A 3AEQB 3UO8B 4DJDC 2HWKA 5IWAB 5BURA 3WGHA 2ECKA 4GUAA 4YASA 3RYIB 4OLFA 1GTZA 4UTPA 4LPSA 1FY2A 1GGMA 3RIMA 2PEZA 1YVEI 1XAGA 4N7JA 1JSCA 1UOEA 2H4ZA 2ZQZA 4PZEA 1LI4A 4WZBA 2V3WA 3DLPX 4DLBA 4CKWA 1T9HA 2NO1A 4HRAA 3ZBPA 3FW1A 4Z7JA 1CF2O 1UP6A 3PNYA 1Y34E 4H3VA 5F98A 1GKLA 5LQUA 2W6QA 4EF4A 3B3JA 1WZUA 4HN2A 4F4FA 3L9WA 5L3RA 1GPKA 4YR7A 4D41A 3IRUA 3N0WA 1R16A 4CMJA 2DETA 1VL2A 1JP7A 4AM8A 4QT4A 3IP6A 4HDNB 4B4KA 2UVQA 4U2GA 3U3JA 4PYQA 3GR6A 3BH0A 3QU5A 4BO0A 2OV2A 1XZFA 4PAQA 3K70C 2IXAA 2EYUA 1CY0A 2H6EA 1D1QA 2XEXA 2D06A 5FUVA 3PUYA 3VSEA 2ZULA 4BATA 3F98A 2X86A 3ZZUA 5CDSA 4MUXA 3JQ7A 1HYHA 1DCMA 2GA9A 3ER6A 4IIUA 4DJJA 2F90A 4QDXA 4RJIA 4I8IA 1JQEA 1DHTA 1YS4A 3C3BA 4I3HA 3LQFA 1RJWA 3I9OA 4J4HA 1E60A 3QFSA 3FETA 3BMNB 1QJCA 1RBYA 1E8DA 4IH1A 5KWVA 1R0CA 3T7KA 1S5PA 3B1FA 4D4JA 4RX1A 2QXUA 3ESCA 2QT1A 3OQPA 1RQ2A 2B99A 2DPXA 2XUPA 3NTOA 4GM1A 4X0EA 3TAUA 4II2A 2VYVA 4G5XA 1YZFA 4I1YA 3IOCA 1DARA 2B0CA 4UEOA 1P74A 4TSRA 3RJZA 4EATA 1YCDA 2YJ4A 1KO4A 1FNMA 2YNMA 3IC5A 3ROFA 1T8UA 2HMTA 4AKIA 3MG9A 4PTYA 1GO2A 5L7YA 1VG9B 3E7WA 3VKFA 1ZLXA 1CERA 4LKRA 3B5JA 3EXIA 3BULA 1U11A 1NRXA 5EWMA 2P27A 3HS3A 1ECLA 2H4FA 3NJRA 4Y9UA 1SKAA 1OLUB 2PQ6A 2RGNC 4NG5A 4NPHA 4BC0A 1P7PA 1QNFA 1AGRA 1O0CA 1C30B 1JA9A 1UODA 2NZVG 4M0CA 3RC3A 2VNAA 3BTSA 4DG8A 2DLNA 2ZIXB 1KJZA 1W5TA 3JX9A 3MOIA 5DW3A 4ZZIA 2GF9A 4LRYA 3V1LA 3K9WA 3LQ2A 1I7QB 3PGXA 4LYAA 1QRTA 3M1AA 5KREA 1OC4A 4M1KA 3AB8A 3NDPA 4CTJA 3AV3A 1OZ0A 4QDUA 2JLRA 3RBZA 3SZMA 3H5TA 4B3BA 2A5DA 4MA4A 1IMOA 4IHJB 3HM9A 2WWYA 3RC8A 3TEFA 1M2VA 3ZHXA 2FZCA 2QYOA 3PNLA 1BOFA 1C1XB 4TVOA 1KYWA 2HDHA 1T15A 3ITDA 3JQAB 4RH3A 1C3OA 1G9XA 2O2EA 1Q1ZA 1FPQA 4IAOA 2BFDA 4C7VA 1O94A 1T4BA 5EE3A 4ZT6A 1E8NA 1SHJA 1A9OA 4P08A 1H1TA 4EM6A 3RT9A 5I7OA 2BKXA 3F5MA 3QEKA 5KX5A 1YDWA 1ZXXA 1MN6A 1JR3D 4DV2B 5BSTA 2FPOA 1N2IA 2HIMA 3W5DA 2XCSB 5DCUA 1TOAA 2HRQA 2GZ1A 2XXJA 5DHUA 5BWBA 1DDGA 2C3MA 1WEKA 5DTIA 3UMJA 3N5KA 3PQ6A 1EVEA 3QPVA 5CXSA 1VMKA 5AM1A 5ESDA 4ZKEA 1EJBA 3KQYA 4H7FA 3G8DA 3WGJA 1B00A 1XVUA 1YRHA 2HBZA 3V7UA 1U8CB 3DSRA 1SCAA 2EJWA 2HMWA 1PW7A 3IPLA 4NBKA 1B8OA 1EX9A 1G4AE 1KVQA 1QHEA 2FWRA 2Q6IA 3LYUA 5DCYA 1T9KA 1U2SA 1ZK3A 2H48A 1T1EA 3A6EA 4NIMA 3V8BA 3COPA 3KWJA 4QBFA 4PPGA 3WNDA 4IIXA 1Y63A 3LV8A 4DQXA 4IJKA 1NVUQ 1T1GA 2VSQA 1FSFA 5BV1A 4O2AF 3VVLA 3NS7A 4DNPA 4ARZA 5JYBA 1DP4A 1JQDA 4AJ4A 2AZ4A 3FPSA 2V6MA 9GPBA 1NF8A 2OV6A 2YHUA 4J0QA 1X19A 1OH7A 1XJQA 1KQOA 3PUZA 3B2QA 3KXIA 4FFWA 5LB2A 1NLYA 4G97A 1R3UA 3JQBC 5A7GA 2EDCA 3SZLA 3ZVNA 1XZDA 1PQ4A 1SHUX 1UXHA 2H1HA 2JNWA 1L4YA 5JZMA 1GZUA 4C5AA 3LBFA 1II8A 1RHQA 4I1RA 5GVSA 5KNBD 1JH8A 3TQQA 3UJ9A 1BS2A 5CFQA 2CLLB 1VYUA 3KYCB 4XYBA 1T29A 2GERA 2ZYDA 5A4DA 4KAFA 1E2QA 1XKLA 3EFHA 4MKRA 4OBEA 1M2OB 3OBIA 1C3LA 4I1VA 4XB1A 1N2XA 3FKJA 4TS1A 3C6YA 4EDFA 4Q1AA 4ARIA 1EAYA 3D6HA 2AOUB 3QTLA 2XITA 2ZRJA 4F8EA 3DEJA 4F93B 5C9ZA 2J3DA 5IVHA 3PGJA 1S2IA 2VWHA 3ENZA 1P1JA 1BYIA 3FFTA 3RROA 1YR3A 4EKYA 1Z15A 1L7XA 1RYYA 3CGWA 4I1IA 4C3UA 4X63A 4AJEA 3L06A 4R54A 3U3ZA 4KWEA 2NU7A 3P9IA 4CL0A 4RKFA 2A35A 3RANA 1J9ZA 1Y7IA 4XJVA 1AX9A 2ZB2A 3VZSA 1P5HA 2AVNA 3G1WA 3X2SA 4F6LA 1E77A 1K86A 1XG5A 1GSOA 1G16A 4NCXA 4AP5A 1U5BB 2HQBA 2NM0A 2YDXA 4QFBA 2SBTA 1R5NA 3JALB 4G26A 3D9QX 4Y2UA 1WDKA 3F3KA 4BASA 3FYSA 3IKVA 3PDIA 5CR9A 1MEEA 4OHOA 3W79A 3D8NA 5EJ7A 2C94A 3H2BA 1PEYA 2POQX 3C7DB 3HCWA 4MWTA 4WSOA 4YFVA 5E1OA 4E70A 4BVBA 2BSAA 1M1YB 1GFZA 2VKQA 3FNRA 3FY4A 3OA2A 5KO2A 1OBCA 3ZNQA 5AW2A 2H2GA 1NR1A 5LQRA 1U7TA 2OXFA 1IVNA 2O48X 4V1CI 5C52B 4OTZA 3ZD6A 5ALJA 1XHEA 5IC5A 3RTGA 3PUIA 3KQQA 2CHVA 2WU1A 4IUCS 5B6JA 1GCOA 1YFZA 1SQGA 2ZRMA 4LZAA 4DLZA 5JC1A 2ORVA 1P2GA 3JQQA 4HDSB 4XWKA 3NAZA 1RJFA 3CC8A 3KYIB 3ZXYA 2OO5C 4OYRA 3F1KA 1C29B 4OA8A 3FCOA 1KIFA 1I4WA 3Q87B 4PYRA 2OBNA 2OYSA 3F6PA 4JS0A 3O75A 4HWSA 4JBLA 2BE9A 1D6NA 4P4TA 3UHOA 1XMOB 1QLHA 4FCCA 3TZBA 2MSDB 1QP0A 4FYYA 4K0KB 1GEEA 2Q4EA 1KFBB 3WLNA 3PRJA 8ABPA 5CX4A 1E4OA 1VJTA 2QU7A 2WKWA 5BR8B 1KO5A 1Q0LA 2SKEA 4IIHA 3DE3X 1RQ7A 1NP7A 2H4YA 2YICA 3P9PA 4NK4A 4OREX 3ONNA 4W1QA 5DNEA 2ZUTA 1KMCA 1T5DX 2BFCB 3C4VA 4W4TA 4X1YB 3C98A 3JD3A 3LCRA 1Z4QA 1E9DA 1TF5A 2ERXA 4DZRA 1F0NA 4EPTA 5IP5A 2JFBA 1ZOLA 2ZRCA 1BJRE 4TTQA 1ZQ9A 3SSOA 4MJLA 1YB4A 1DKMA 1VE6A 2CHQA 2Y92A 4HOYA 4BNYA 5HEKA 1KQPA 3K2EA 5B7NA 4P4LA 1XR3A 1UXGA 1K3UB 2X8WA 2DUWA 3DBIA 5KKNB 3N3BC 5FOQA 2PPVA 1K3FA 4JP1A 3HXPA 1RXWA 4IHKA 5L4LA 4QG3A 3C4JA 1GUYA 4LGYA 1NP3A 2JJMA 4YP6A 1XZNA 5HJ5A 3KETA 2O7SA 4YP0A 4IZ6A 4R6XA 4JGGA 4YQYA 1A9PA 3KR2A 1IXSB 1M9NA 4TT8A 4NV0A 5A71A 2FN4A 5FPHA 4F91B 1G4HA 4LNAA 3LCMA 4FZVA 1IBSA 4EHIA 1ZBDA 1K06A 4C01A 5COAA 5ER9A 1GQYA 2FMIA 3NHMA 4LJKA 4E7PA 1E2FA 3JTMA 1HYGA 4YUXA 1XOIA 1W19A 1LNZA 3GDWA 4HX5A 4MGEA 3GPLA 2DXIA 4PLVA 1PFGA 3DKKA 1ZCZA 5FWXA 2QBYB 1XXHA 2Y8EA 2YQZA 4Z6KA 5JHHB 4EJMA 4BY9E 3HHEA 3BPSA 5LNK6 4FYWA 2IIPA 1W36D 4CGYA 1B93A 3WLFA 4F92B 1TQ2A 2XXAB 5C7OO 5ALVA 3SEZA 5HIMA 4IXWA 5FL7A 4G1CA 4OKIA 4GMHA 5FHQA 3VR6D 3SQWA 1PVDA 1YR7A 3BCUA 5JDCA 3UKOA 4YT2A 1K0UA 4GX2A 2NO0A 1QO0A 1Z06A 2V7QA 1EK6A 4V0ME 3UAVA 5C4IA 1YRLA 3K0FA 4CDMA 3Q7TA 4GR4A 4Y1RA 3AESB 2B94A 5I4CA 5CJJA 1JPJA 5F9HA 1W2WB 1Z75A 2REXB 3VU1A 3MA0A 2X9VA 4JT8A 1RM0A 4JEIA 3WICA 1YFJA 3A26A 1WXEA 2OESA 5JANA 3DAFA 5BSFA 4O2BB 1HT3A 3ORHA 3SX2A 4GX5A 4K6GA 1ESEA 1MOSA 3HNPA 2BBTA 4ZVOA 1XO1A 3EVFA 1H94A 1PJAA 2G0TA 1EIZA 4INAA 1TYDE 3MCVA 3PYLA 4TLEA 3UK1A 1KGSA 4B3XA 2X4DA 1PR4A 1NUAA 1UF9A 3PD1A 1Y82A 4O4HB 1Y7HA 2CSXA 4DLXA 1FVFA 1T91A 4WXHA 3OQJA 1P9LA 4YI3A 2JFUA 4UVIA 4ZXFA 3S3TA 2FMFA 3GUVA 2FJPA 4EY8A 1E66A 5HDBB 1B6TA 3BQ9A 3NH6A 1KZHA 3V4FA 1CFZA 4I9HA 4G2TA 4RA6B 2C99A 3P5BA 4PYKA 4Q66C 1T6BY 4RVHA 4DWOA 5EHXA 5LDGA 2PZAA 2GAIA 2W7TA 1PR6A 2MTBA 4FDUA 1WXFA 1RXCA 2PN1A 5B7GA 5C37A 1KZGB 1F8GA 1ISPA 3PNOA 3R7SA 4NE2A 1GCGA 1Z5VA 3KAJA 5LB4A 2PYDA 2C78A 1K7XB 4LNUB 1ESDA 1U31A 4YB8A 1WD7A 3D5TA 1WXXA 4J2HA 1JEYA 2H9YA 4Z7OB 2C5SA 2QVBA 3X43A 4KGZA 2RHHA 1KI7A 1RCUA 2DZDA 2IUFA 3AKZA 2DH6A 3ZWQA 5AW0A 3J81A 3CZ5A 3GHYA 3IBYA 2P9EA 5DMXA 1C9YA 3O0TA 1KXJA 3L9XA 5FNVF 3TW4A 5SYMA 2JLQA 2GBLA 2IXEA 2UUBB 1U2RA 1JAYA 2DWOA 2NLOA 4P3YA 5LA6A 3C8UA 3E61A 3PXAA 2IQ5A 4JJIA 5IAKA 4DKXA 2CKMA 4MGZR 3LG2A 2E5FA 2XTJA 4PCVA 5LXTF 4P34A 1HDCA 1OZGA 3A6HA 4H3KB 2D0IA 4JEUA 2ZK7A 2BOVA 1JQ5A 1Z2OX 3IEXA 3O83A 4P35A 3RCBA 2JGLA 1XPJA 3W6UA 3SICE 3F0TA 5EXXA 1XEXB 3WX0A 1ELOA 4NBNA 4AIIA 4ASUD 4EY3A 1TKCA 1E3LA 3RWBA 1C4WA 2JRCA 1D9XA 2ZRGA 2Q46A 1YQXA 2NVBA 1LLDA 4QBIA 1TRHA 4DR7B 4DA8A 5JSYA 5FNZA 1Y5NA 3D7NA 2GZAA 3SFVA 3HU3A 5BNIA 4N7RA 1GXSA 1BDHA 4D81A 2JA1A 5FTLA 4JXKA 1JJAA 1P0MA 2PBRA 4NBLA 3P9NA 1Z17A 5G1OA 1KAHA 3I3OA 1WV0A 2D5IA 3NUQA 3OTIA 5H3HA 5T64A 5COQA 3SXUB 3V5NA 2CD7A 2I4NA 3FPAA 4NOJA 3QEBZ 4MW7A 1HUQA 1RYFA 1XVAA 1YNOA 2BDEA 4X92A 3UJ3X 3F71A 5LMNB 2V3CC 1IDN1 2IOQA 1KFJB 1VE1A 4IMPA 4QM7A 1ZICA 1ZONA 1HYBA 3IV6A 1CETA 4L22A 4D3YA 5KTOA 2JLXA 2C1EA 4RLFA 1YK1A 3M4ZA 3T9FA 3USES 3VH2A 1UDBA 3AF0A 3D3WA 4GRDA 5BQFA 3AFNA 3UMCA 1FQKA 1SUBA 3OX4A 2OM6A 2CBXA 3LP6A 4QX6A 1OSNA 2JKZA 1NM5C 2WF9A 4UUQA 4KV9A 4C43A 2ODWA 4P4SA 4C7BA 2EBFX 3QYAA 1D5WA 3NAGA 3OWHA 3U1VA 3FTFA 1TZJA 3WK4A 3X2FA 2XQIA 3OZIA 3PFFA 4OI0A 1SUCA 3DR5A 3M2TA 3H8SA 1XZEA 4UDNA 5A02A 2FUKA 3DHEA 3WIEA 3A11A 1E89A 2PMKA 2PH5A 3FX2A 4NATA 4WLOA 5ALYA 2RGWA 1KKLA 1ST3A 3CO5A 3D4PA 3NH9A 4PC2A 4TWJA 3NGLA 4PQEA 1S89A 1DPGA 2UUOA 3OESA 4NULA 1NVGA 1BA2A 2IUUA 3TCKA 3H7AA 4E2YA 2BGWA 4CGZA 3EMVA 1YD7A 4DMCA 1IAQA 3N74A 1D9ZA 1FFSA 1QQ7A 2P7IA 1MX3A 4Q4CA 4E5NA 4XVQA 3I0NA 2GK4A 1XZ8A 5KB3A 3BF8A 4PLCA 4ZV4A 3M9LA 2JA2A 2W6ID 5EZYB 3ANSA 1H22A 1PWHA 2CCKA 1W4LA 1TAHA 2ACVA 5EERA 2L82A 4UEKA 3I2FA 3KEQA 5EXEA 5K0SA 4DCGA 3KQLA 1J23A 1IQPA 1F9AA 2OK8A 2VWPA 3WGLA 1MR3F 2GPYA 3AEYA 5AOBA 1CEXA 2H1IA 1UCFA 2J1LA 2Y67A 1CVRA 5LP6F 2PMCA 4H7EA 3EPLA 1JEEA 4GBED 5JFOA 4MQLA 5I9LA 3C6KA 7YASA 2WSYB 1HNXB 1PK7A 1MDBA 1JILA 1P9RA 4MW5A 3NX4A 2WIBA 1TU0A 4HNVA 1ECJA 2NXNA 4C4ZA 1Z6ZA 3QG1A 3QPCA 1U94A 3RADC 3U3MA 1NVXQ 4IDOA 5KTSA 5L6LB 2NSDA 3JY6A 2ZJAA 3M1YA 4FEEA 5A4IS 1I10A 4C3VA 3UMYA 3HDTA 4O25A 2OTCA 3H9QA 4K81B 1RKUA 3UJNA 5JG7A 3NNSA 4WNAA 3AJEA 1BCSB 3E81A 4HWOA 1UIMA 2XXBA 2YKGA 4KQEA 3OIDA 3UVEA 4D7AA 5DM0A 3DAHA 2Z09A 1ZNXA 3VNSA 4OLBA 1MOZA 5BV8A 1YUBA 4BVHA 4WCFA 1JG7A 1TUEA 1CUIA 3A1FA 1WETA 1V1MA 1XRMA 1XWIA 3TR0A 1QCDA 1Z0DA 3K9CA 3T38A 2V55B 1R4NA 3WB9A 2BSQA 3GFRA 1TF7A 1CRPA 1ZJWA 3HYTA 1WXDA 1IFXA 1AKMA 1TJ4A 1AHPA 3C3JA 4PRZA 3LX4A 2OBXA 4MV8A 2Y3IA 5IH3A 2GCEA 4V2UA 1DKUA 4NMLA 4BNLA 2XUKA 5P21A 3OZAA 3FMPB 1ORVA 4E31A 2IH5A 2AF4C 4H27A 3TQTA 3W2TA 1E9FA 3HV0A 1ZSVA 2Z4RA 4M7OA 3KD3A 4NNPA 5ALLA 2L17A 3ADPA 1LQTA 4JKYA 3EAGA 1Z4JA 3DXYA 3H5WA 5K0FA 1FQJA 1TX4B 2HQOA 3HCBA 3HCOA 3Q7IA 4LVNA 3F96A 5EE0A 3P0EA 1RYMA 2ACWA 2FH5B 3ZH2A 1DG3A 4F38A 3W1VA 3E9MA 2Y1GA 5EIBD 4CL2A 1VL6A 1PK9A 3GT7A 1PYOA 2I71A 2Z3WA 2XE6A 4RABA 4ZV9A 4QVIA 1UBFA 3BZWA 1TDJA 3CEAA 1EUZA 4U6SA 1KKUA 3DLIA 1ECPA 1A97A 2HTFA 4IFIA 4TSKA 3CX3A 5TMPA 4WJKB 4G1UC 3TNFA 2BN4A 2D5BA 3BMOB 4GUDA 3N9IA 1O54A 3WLKX 6REQB 5LC1A 1NBHA 3RAGA 2XOEA 4EZIA 1V96A 3V1NA 2IYSA 5C1BA 4H3SA 4BO6A 3NCTA 3EGOA 3KSRA 1JG6A 1EUDB 2BFOA 3O95A 4UNRA 4JAVC 4X85A 5FI0B 1HK7A 4RVFA 1Q57A 4RIFA 3UPDA 2XWBF 3U5TA 2PZFA 4JJZA 1SVUA 4G0WA 3AERA 3AF5A 3O2JA 3V1YA 4ENVA 3RVBA 1AV7A 4A6PA 1PYGA 4HGPA 1GPMA 3SBEA 3DAGA 1E1YA 1U0EA 4L4ZA 4N1AA 4EHJA 4ZN6A 1L4LA 2PX0A 5HK9A 4D79A 2EZ4A 1WTAA 3NC0C 1U3FA 1BKYA 2ZJFA 2R79A 4EFLA 2FEOA 3NBFA 1N7HA 1MC8A 2X42A 3H4VA 4ID9A 1OCEA 4P93A 3PV0A 2CBZA 1CC1S 1QGZA 2ZYVX 1IY9A 2N9UA 1OXUA 2QLFA 1U8YA 2W4IA 4I4NA 4MQUA 4XLLA 5ECGC 3U4CA 1AJEA 4GPD1 1XZBA 1RFGE 2VG8A 1UPBA 5FF9A 3V34A 2YIJA 4FN5A 4AY5A 5F4ZA 1BRMA 1SZJG 3PXEA 3OI7A 1HDRA 2VDWB 3E1GA 3HVJA 3MGGA 4O4IA 1DXQA 5CUQA 3L6CA 2PBFA 3UOWA 1YSCA 4Q7EA 1QVVA 2WJWA 3DM5A 5DBIA 1YA8A 4CM8B 5G4KA 3U3XA 1FDOA 3KU4A 4ZAVA 2EWVA 4JVMA 3QVJA 2VJKA 3BE8A 4RO0A 2PJUA 4ZTUB 1QYRA 2OZVA 2PJDA 4LRUA 2XBMA 1Q16A 2H2IA 2P9GA 2O9JA 4NFLA