3T7TA

Crystal structure of complex of sah and bvu_3255, a methyltransferase from bacteroides vulgatus atcc 8482
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
NLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESVWFTDQRPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFILPENCWIEHYFAPQAKAEEIFRRKHAGSRIVEELITSNHHEAELYSKYKAYYGYAFFICKKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
pubmed doi rcsb
source organism Bacteroides vulgatus
total genus 77
structure length 245
sequence length 245
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t7tA00
1NE2A 3GIWA 3TPZA 5CCBA 3PX3A 5GM2A 1I9GA 2IGTA 3KQMA 3CKKA 2JH8A 2P7HA 4RVDA 4CXMA 3DOUA 5E1MA 1RI3A 3HVIA 2NYUA 5DPMA 4HC4A 5FADA 5LQNA 4X61A 3FTCA 5EHIA 4YV1A 4RTLA 4HTFA 4YV2A 2WA1A 3ELUA 1N7IA 3WSTA 5FQNA 1ZHFA 5EEGA 4Y30A 5FWDA 2ADMA 4C04A 2PXCA 3M6VA 4KW7A 4MHTA 4QQKA 4V0QA 3FUXA 3TQSA 1RI2A 5CVEA 2JG3A 3FTFA 3B3GA 3MQ2A 1AF7A 3GO4A 3HCFA 5CCXA 4PYNA 2YR0A 4DQ0A 2OKCA 2PWYA 2F8LA 4RVHA 5BW5A 3KQYA 1G8SA 4PONA 5K0EA 4RTJA 1FBNA 3A7DA 3BGDA 3RIEA 3KQSA 4GC5A 4FGZA 1PJZA 1R00A 3G88A 2YQZA 3NWEA 3P71T 1RI4A 5E1DA 5GOZA 5LQJA 4POOA 4M36A 1ZG3A 2GA9A 3KPVA 5CVDA 1RJDA 1BHJA 5FWAA 1VLMA 1WXWA 2IDKA 4PWYA 1DUSA 3K6RA 3FPHA 3LCUA 2H00A 2UYCA 1P1CA 4NECA 4EVIA 1XCLA 4R6WA 3PX2A 4CKBA 5P8WA 1OR8A 1UIRA 5EVJA 3EEOA 2JJQA 5F2OA 1U2ZA 5K05A 5EMMA 5K0NA 1SKMA 2IP2A 4YUZA 2PBFA 3KR0A 4LG1A 5IH3A 2LD4A 3FPEA 3AXSA 2IDJA 1XVAA 3P9KA 4Y2HA 3TMAA 4CWAA 3NMUF 2P3QA 4PYQA 5DSXA 1NBHA 1XDUA 1NKVA 2BR5A 1NV9A 1R8YA 5DTRA 1QZZA 1G6Q1 5DX1A 2HV9A 3THSA 4E31A 2UYHA 2B25A 5K0JA 4EMSA 3GGDA 2QRVA 1NBIA 4G56A 1KHHA 2I62A 3EVEA 3HCBA 3MTEA 4KVZA 5DT2A 3DLCA 4E2YA 3C0KA 5K0LA 4OX9Y 3LCCA 3BKXA 3UFBA 3MHTA 2PX5A 4R6XA 3Q7EA 5E9JA 5HEKA 4L7VA 2OB1A 1Y8CA 1INLA 1BKYA 2BZGA 2QE6A 2QYOA 2YVLA 3B7PA 5FHQA 3T7SA 1XTPA 3MCTA 4QPPA 1EJ0A 2QM3A 3DR5A 3TM4A 4BLWA 5K03A 4FT2A 4C05A 3VYWA 2NXNA 4FZVA 2IIPA 1YF3A 1AV6A 3CJQA 2IH2A 1XCJA 3E8SA 3L8DA 4DZRA 3BGIA 3GWZA 3FYDA 3KPUA 5E9WA 1YFJA 3A7EA 2ZZMA 5F2KA 3EVGA 2O57A 2YXDA 3GRUA 2ERCA 2GLUA 3PB3A 2E5WA 1F3LA 4DMGA 2GH1A 5DM2A 2IH4A 1SQGA 1QANA 5KQSA 5FHRA 3BWYA 4WVLA 3BWCA 4B17A 3HA7A 2H1RA 4R05A 3HCCA 3P2EA 4HH4A 2QY6A 3M70A 2FCAA 3EMBA 4ER3A 3P2KA 2PV0A 1M0EA 1EQAA 3DUWA 2KW5A 2WA2A 1KYZA 4QPNA 3CVOA 1KIAA 2VS1A 3KQWA 2IBSA 2AVDA 2PLWA 1JSXA 2BR4A 1F38A 3DMFA 4OBXA 3SSOA 4E32A 5E2AA 1X19A 5FTWA 2B3TA 4GQBA 4AZWA 5LQRA 2UZ4A 2Z6UA 5K0GA 1O54A 3KHKA 3HA3A 2GB4A 4IKPA 3PT9A 1SVUA 1AQIA 2YXEA 2A14A 2YUIA 3KPWA 2AOTB 3EPPA 3FRIA 3TOSA 4YUVA 3FPGA 5E2BA 5T6BA 4YUYA 1L9KA 5EEHA 2JHPA 3IYLW 2OPBA 4KDRA 1KXZA 3CBGA 4OBWA 3I53A 4GF5A 4KRGA 4PYIA 5DX8A 3M4XA 4OA8A 3SGLA 4HSGA 4V0RA 5D1HA 1FJXA 3ER8A 2PJDA 3GDHA 3P2IA 2NXJA 5EOVA 1JQDA 3LX6A 3LBYA 1NW3A 2EJTA 4HG2A 4M7RA 3EEYA 1P1BA 4BY9E 2QRVB 2ZSUA 2P3OA 3M6WA 3MB5A 1R8XA 3EMDA 1WZNA 3ORHA 2P3LA 3LKDA 3BGVA 2P41A 4H0NA 1P91A 4PGGA 3HCAA 2Z6QA 1L3BA 2CL5A 2Q41A 3AJDA 2OB2A 1JR4A 1ORHA 3P9CA 5DRTA 4BP1A 5K8VA 4RSRA 5HIIA 2IBTA 3MERA 3TFWA 3PLAE 2YX1A 4P7KA 4P58A 5LQUA 5DX0A 1X1BA 1SUSA 2C7RA 3OZTA 1QAQA 4PGHA 2K4MA 2AN3A 1DCTA 1RJGA 5C1IA 5FQOA 2OXTA 3NW9A 1O9HA 2NP7A 5KQRA 5DLYA 1JG1A 3SVZA 2OO3A 3G2OA 1I1NA 4F84A 3KQQA 2IPXA 3CCFA 1KPHA 3QV2A 4LECA 4OQEA 1JQEA 2UYOA 3EVFA 5EGSA 2ZFUA 2CMGA 2PX2A 4P7JA 4C03A 2ZZNA 4X60A 4EQZA 1RJFA 3LDFA 2FPOA 1HMYA 3EGEA 3LHDA 2PXAA 1UWVA 3OPNA 3DLIA 3NDIA 4U7PB 1FP2A 1WS6A 1Q0TA 3OE5A 3E05A 4YUWA 1NV8A 3B3JA 4C07A 3BT7A 2ZBQA 2AOVA 5GINE 2P35A 3UBTA 3FZGA 4FT4A 2I9KA 4KWCA 2BM9A 1P39A 4GC9A 5FCDA 1IXKA 2ZBRA 2AOTA 3MTIA 3FUTA 2R3SA 3R3HA 2O07A 2PGXA 2ZTHA 3HP7A 2PVCA 3ANXA 1M6YA 3MAGA 2EX4A 3UJ9A 3P9NA 1JG4A 1NW7A 2FK8A 5H02A 2EJUA 4RX1A 2IH5A 3NWBA 5EKXA 1O9GA 3S68A 3UJBA 2CWWA 3C6MA 4RYLA 2PY6A 3SMQA 3V97A 3A26A 3VSEA 4DCGA 3FTDA 4CKEA 5FUBA 4RTMA 3ME5A 4ER7A 2PXXA 2G71A 3KPYA 4JXJA 3BWMA 3DXXA 5DXAA 2G70A 2V74B 3DMHA 2ZIGA 4ER0A 3G5LA 3MCZA 1RI1A 3OZSA 2B78A 4X63A 5EIFA 5K09A 8MHTA 1ZGAA 3BXOA 2GS9A 2YXLA 1VP3A 5BP7A 2FHPA 5G02A 3C6KA 1VQ1A 1KP9A 3R9XB 4F85A 5DM1A 5DM4A 5C9ZA 1WXXA 3PFHA 4LWOA 3UJ6A 1BOOA 3HCDA 3UJCA 2ZIFA 1BC5A 3B5IA 1JSZA 2ONZA 2BM8A 4RWZA 2XBMA 1SQFA 2JH9A 5ERGB 4GOOD 3CJTA 4BLUA 3I5UA 3X0DA 3UA4A 4GOLD 3LL7A 4DM3A 3SXJA 4PNEA 4YUXA 5LSAA 3OFKA 3UZUA 4RTPA 3UJDA 3TLJA 4XUEA 4DF3A 1R6AA 4BLVA 5ICGA 2G8NA 4X41A 3EVAA 4RVFA 3KPJA 4AZVA 5GIOE 2FRXA 2ZVJA 3BZBA 2IFTA 3EVBA 5GIPE 3KQVA 3FRHA 7MHTA 2VZ9A 2AOXA 2O06A 1XJ5A 4RV9A 5K0BA 1YFLA 3QOWA 4UOEA 4ZTBA 4XUCA 3FUWA 4PYKA 5KVAA 5DSTA 1TW2A 3CJRA 3HVKA 3UJ7A 3KR2A 5HIJA 4BP3A 3UWPA 2BH2A 3ELDA 5DTMA 4Z2YA 2ORED 3T7RA 2Z6AA 1KPIA 5EZSA 4EK9A 4FSXA 3UJAA 1MHTA 4PYJA 4HRAA 2PT6A 2N47A 1PRYA 3G2QA 1XDSA 4KIFA 5LQKA 4FSDA 3P9IA 1IY9A 5EIWA 3O7WA 3VC1A 4M38A 2AN4A 3LDUA 3DTNA 1G60A 3LECA 5CM2Z 3THRA 1VP9A 3O31A 3VC2A 4AUKA 3NDJA 4DA4A 4WXHA 4ATNA 5FA8A 4E2XA 4GEKA 1ZGJA 1NW5A 2AR0A 2CMHA 1D2CA 2OZVA 3KU1A 3I58A 1VIDA 5CIYA 3EGIA 1G55A 4P7GA 1JTFA 4CTJA 5BW4A 2JHAA 2XVAA 3EVCA 3M33A 1EJ6A 4E33A 4QDKA 5EG5A 1QYRA 5EKUA 4C08A 5EQJB 3DP7A 3SSMA 5ICFA 2UYQA 3TR6A 5K0FA 1X1DA 1YZ3A 1ORIA 2HTEA 1YUBA 2DULA 2GAFA 2GPYA 3SR4A 1EAMA 1ZQ9A 4AZSA 2G1PA 1JQ3A 2AOUB 2ZWAA 3ELYA 3IHTA 3O4FA 3OZRA 3LPMA 4PINA 2ZBPA 3HTXA 1HNNA 3HNRA 3SSNA 3KQTA 5EMKA 4IWNA 3P97A 3GJYA 2H11A 2AS0A 3DH0A 2OBFA 4MIKA 2OYRA 4QTTB 2NP6A 1L3CA 4MWZA 5KS2A 4RVGA 5HFJA 5E1BA 1IM8A 2P40A 4HGZA 2Y1WA 3IEIA 4PCAA 1WY7A 2PWPA 4QVGA 1NW8A 4YMHA 5EC8A 5MHTA 3I64A 3FYCA 3HEMA 1D2GA 3KQPA 4RTRA 4MTLA 4X1OA 3B3FA 3HA5A 5CVUA 1L1EA 2ZLBA 3LSTA 4QTUB 3FTEA 2DPMA 3OU2A 4QVKA 4CTKA 3R0QA 3KKZA 3Q87B 1WG8A 1SG9A 1KPGA 4F86A 2OY0A 3AY0A 3TKAA 1ZKDA 1JTEA 2FYTA 2NNWB 3E7PA 3G89A 4PYLA 5GP1A 4ER5A 3G7UA 5E8JA 1AQJA 1YB2A 3TM5A 4KIGA 3DXZA 4E2ZA 5FA5A 5BXYA 4RTKA 1YZHA 4MQ4A 2BR3A 5ICCA 4M37A 3EGVA 1RI5A 3A4TA 3DMGA 3BWBA 3PS9A 5JUWA 1VL5A 3ER9A 3GCZA 2ESRA 3PVCA 5F2NA 4GOMD 5C0OE 5HZMA 4R8SA 3RW9A 4LWPA 4AZTA 5ICEA 4XUDA 3T0IA 4FP9A 5JR3A 2XYVA 1NW6A 5D1NA 4P7FA 2C7QA 1JG3A 1X1AA 3R24A 1TW3A 4O29A 1N7JA 2XYRA 3NTVA 3GRZA 4PCLA 4QQNA 5HILA 3IV6A 1H1DA 1L3IA 2P7IA 3P8ZA 2AZTA 3A25A 1T43A 3E23A 3JWIA 5DRYA 5E8RA 3U81A 1QAOA 2AOUA 2HWKA 5HIMA 4C06A 4AX8A 2ZWVA 4E70A 2PKWA 1VE3A 2V7EA 2VDVE 3NVMB 2NXEA 3BKWA 3RODA 4RTSA 3B89A 4EKIA 5EPEA 5KYGA 1FP1D 3HCEA 1FPQA 3LGAA 1DL5A 1XDZA 2P1DA 2ZULA 3GU3A 2R6ZA 3V8VA 4YMGA 5HOQA 3FUVA 5CD1A 4E30A 2XVMA 1R18A 4RTOA 2ZZKA 3AXTA 2HR1A 3H2BA 3SM3A 3LDGA 5DWQA 2VP3A 3JWGA 3C3YA 3FPJA 3KR1A 5DXJA 5EMLA 1JG2A 1KR5A 3DULA 3GRRA 3NJRA 4ISCA 5HIKA 4E2WA 4FR0A 4A6DA 5CVVA 5LQCA 1VBFA 5T67A 3MGGA 2FK7A 2B9EA 3ELWA 3TKYA 1QAMA 5DM0A 2C7PA 1D2HA 3CGGA 5IKMA 1R74A 5M5BA 1V39A 4EKGA 1EIZA 4KDCA 4YV0A 3AWIA 2CKDA 3FPFA 5B1SA 2ONYA 3G8BA 3M6UA 4K6MA 1MJFA 3ERCA 4GOND 3TRKA 1SUIA 4XCXA 3F4KA 3UA3A 2C7OA 3DXYA 2VDUE 2AVNA 4DKJA 5LR6A 3OFJA 3PFGA 3JWHA 5E9QA 1Q0SA 3BUSA 3G5TA 4PYOA 3QOXA 1M6EX 2PX8A 2XYQA 2PX4A 3NVKI 1G8AA 2O0LA 5GM1A 4HTFB 4DCMA 3GRYA 4A6EA 4FS8A 4R8RA 3OE4A 4GBED 4OA5A 2NXCA 2B2CA 3G2MA 5CUQA 3REOA 3GXOA 4CKCA 1RJEA 5GWXA 1XXLA 2YTZA 3HVHA 4PIPA 1EG2A 1N2XA 2AN5A 1I4WA 3I9FA 2I6GA 3FUUA 5DTQA 3C3PA 2EFJA 3HM2A 3GNLA 3GRVA 5FULA 3D2LA 3T7TA 3A27A 1UFKA 3G2PA 1B42A 1X1CA 1NT2A 1VPTA 4HGYA 2EG5A 3EVZA 3K0BA 2PT9A 2VDWA 5CVJA 5U4XA 3KR9A 5EHGA 4RTNA 1TPYA 3KQOA 2ZIEA 4RTQA 2HMYB 9MHTA 2P8JA 3G8AA 3LBFA 3M6XA 5E1OA 4C4AA 2WK1A 3LKZA 5K0CA 5EZQA 4IV8A 4IV0A 2ZCJA 1Z3CA 3R6TA 2JHCA 4OQDA 2O05A 2HNKA 5T64A 2G72A 2I7CA 2Y1XA 3ID6C 5LQAA 3OU6A 3JWJA 4U7TB 3UJ8A 5EMJA 3HVJA 1KYWA 4PYMA 3CC8A 3OU7A 4GUAA 4PIMA 4QDJA 4ER6A 1G38A 3OCJA 3EVDA 10MHA 5K01A 3LCVB 3PTAA 2ZW9A 2PSSA 3SX0A 2AOWA
chains in the Genus database with same CATH superfamily
4KK4A 1Y7TA 3TNLA 2ZR9A 3BRWD 3WNQA 4FGUA 1W85A 4OQQA 2EWVA 2PH5A 2C7VA 3PNPA 1XLWA 2QUKA 3W9BA 4A4DA 1Q6ZA 4UNQA 4MQLA 2ZRGA 4FKBA 4EY6A 3DQZA 2EZ9A 4Y67A 4KQ1A 4FGLA 4YC7A 2AMLA 4P53A 4CF7A 2P27A 5JCPA 3HB4X 1KIMA 4NU0A 3M3DA 2WI8A 4Y2JA 4MOWA 1R9JA 2WWVD 5EJ4A 5E7MA 1P1KA 2A1IA 4MLCA 3ST7A 1FW6A 1NOJA 3VI4B 4F3NA 1AB6A 1YS4A 5DCUA 1UPFA 3MRSA 1P72A 2JFNA 1G7TA 2I6TA 2WB2A 1H69A 2QKYA 2VQ3A 1QB7A 1VJ1A 3DO6A 2CDRA 4GP9A 2IHYA 3BGDA 4O1MA 2GJ9A 1E2QA 3KKNA 5DI3A 3ZZUA 5EQTA 4AMZA 3BFXA 3FLAA 4F7WA 3D7KA 1ECLA 4KXQA 1F20A 1W4ZA 221PA 1GFIA 2JI6A 4EO7A 1Q7GA 2C1ZA 5B3JC 1TU3A 2ILTA 1K7EB 2HLPA 3BHNA 3UAVA 3UN1A 3OQBA 4J07A 3EGDB 2H00A 4LMBA 2B8NA 2LCFA 1H2RS 3EOBI 4GKVA 1NSYA 2EG9A 2N1BA 3QZUA 1MX9A 4FYYA 2JLZA 1D2AA 4O5AA 2GPTA 5AYVA 1PZXA 3CNLA 1UJ2A 1TI7A 1HM5A 1P7ZA 2BEKA 4YJDA 1MT0A 4I66A 1ADGA 4L2IB 2H16A 4X44A 3ZNPA 2HF2A 4B74A 1VJCA 5FLKA 3RK4A 1VIAA 2NP6A 4E1VA 1JDUA 4PNHA 4ZYWA 4U00A 2HK7A 3IBGA 3CRW1 3QF4A 1XC7A 4LNUB 1T4BA 4HFNA 4PZZA 3THSA 4EDFA 3V2UA 5C32A 3D5TA 3TR5A 2UYHA 4WY2A 2VA8A 1C1DB 2CWDA 4KO8A 1BFKA 1H8ED 4JJIA 2NX2A 2E49A 4CNBA 2CC2A 3TG2A 4MRVA 2P1ZA 4QFBA 3GY0A 4LY6A 4PPFA 5JQGF 4L5YA 3L1IA 2I87A 3H1TA 5GV8A 3UFBA 1GTSA 3B3QA 5K8LA 2JFZA 1ENYA 5KMGB 1U8AA 4JEMA 4BJ3A 1CEYA 1OLXB 4LYFA 3TEFA 4Q19A 2FR8A 4NCHA 5JJBA 2BW0A 4ZI7B 4LZJA 3CONA 3T7SA 5J4VA 3TG8A 4WE3A 5FO1A 1UT5A 2FP4A 2XE4A 1M2NA 1BGVA 2XUAA 4QDUA 3LPLA 4EOGA 2O3QA 1M5RA 1MPTA 2PK3A 1Q3TA 2DWOA 4K6HA 4ZRNA 4KR6A 1ZIPA 2CHEA 4B1FA 3V8BA 1E3EA 3SMVA 4TYWA 3EVGA 2IPMA 3FGPA 3PICA 5CX1A 5A71A 1IH8A 1P2TA 5MFZA 2IYVA 1Y4DE 2WTBA 3VDXA 1VKJA 4IXDA 4Y1RB 3A6ZA 2W6JD 4LZPA 1P33A 2Q5CA 1GNSA 2OAGA 5D7NA 5JPIA 4N39A 5JU6A 1MMFB 3AVQA 1E6KA 1OGJA 1T2EA 3ZE9A 4E22A 2O19A 1HQKA 2PSDA 2P2SA 1NI4A 1E61A 2PX3A 3Q7IA 4PN3A 1TGVA 3L77A 4UHBA 1QZTA 1YR7A 5DI3B 2G17A 4JNCA 4LGMA 1RC1A 1B8VA 2QR2A 1OI2A 1TZKA 4Q7LA 4Y98A 4AT1A 1AV7A 2WUFA 3O2SB 4BRWA 4ZODA 1EQAA 1DFHA 4KPFC 4CFYA 2CNOA 2DQZA 2G82A 3RS2A 4XWKA 1K6EA 3KQWA 3ITDA 5C5EA 3JU3A 2AVDA 1VHDA 5MN4A 1RWXA 3OT1A 4C6HA 1E2FA 4QPJC 1GRVA 3IMFA 4IDQA 1TNDA 3WWOA 1NN0A 1SVUA 1ZCAA 2QGNA 3C1OA 5TS3A 3EPPA 3UWMA 4F6RB 1BJKA 3P7MA 1DRJA 1JA9A 4WINA 3EA5A 3P0HA 2ZJ2A 2JBAB 3TLXA 1D0VA 1WXIA 1XF9A 2VEOA 4JUAA 4YJKA 3S6JA 1A8IA 5F2EA 3BMQA 4YASA 1NRIA 3PXAA 3NWPA 1EMDA 1BCRA 2H65A 4V0RA 4TUYA 4PSDA 4KOAA 1KK3A 3LY7A 3NNDA 4P3KA 1VMKA 1Y5LA 4G3XA 4BY9E 3AVYA 5DYWA 3MB5A 4KVGA 4B75A 1DKNA 4UHKA 2XD4A 3SZRA 4G8BA 5B4TA 2QJWA 2AL7A 3HH8A 4EK9A 1IPEA 2PL5A 2WTEA 4HNUA 5B37A 1YDMA 2VHWA 1OH6A 4CODB 2MTBA 3OO0A 1OFUX 5EE5B 1CB7A 1XKQA 3HJNA 4MZDA 5TQVA 3KC2A 4TQ9A 3MERA 4OSEA 3TFWA 1P7VA 2VSYA 5G2OA 2FUKA 4HDSA 2AH5A 4BMPB 2QK4A 4UM5A 2ZRPA 1Q1ZA 3QE2A 2NIPA 1G8KA 1LA2A 2NO0A 4BXOB 1RJGA 2N42A 3DEKA 1JUDA 1JXAA 3DZGA 3QUBA 5DP1A 5AVRA 2V0NA 1G18A 1V71A 5DB4A 1TLLA 2PS3A 2XKJE 3NM6B 4Z9AA 2R84A 3PYXA 4GLLA 2H7YA 2WJVA 5CBKA 2I7XA 1ZVVA 2H3HA 4DDUA 2HWXA 1VSTA 4YCAA 3L6EA 2A5GA 5D6NA 1YMQA 5DP2A 4KWIA 3BA1A 2PXAA 4HAVA 3R9IA 3WYGA 1FP2A 1WS6A 1WZEA 3MW8A 5IUJC 5IARA 4F3RA 1UL1X 3VHXB 4F12A 3HJUA 4BQRA 1NI4B 5HF6A 1FSPA 3W6NA 3LVBA 1ZHHA 4LGVA 4OJNA 1UR5A 3TVDA 1JQBA 2BM9A 5FUWA 4CM7A 3GEPA 4WBNF 1NZFA 2IT1A 1VPLA 3EAQA 2C0PA 4MVCA 4G4IA 2GM3A 3AIOA 3LPAA 3M2TA 3HHPA 2AA3A 2PZMA 1LB1B 4XZ3A 3ZIAD 1E2HA 3GZNB 3Q6IA 1T3HA 1PJTA 4J3JA 4Q1CA 4DCCA 1NW7A 5KNBA 1VHWA 5HRUA 1PJCA 5JTUA 3ZHVA 4L4XA 1AGRA 4OB6A 4FOLA 4EW1A 4ZEXA 3PQDA 1O5OA 4EF4A 5C52B 3RIXA 2ZKLA 3T7EA 1XYGA 5JMPA 4MWGA 4E03A 3CNQS 4UEKA 1X42A 1L7AA 1WXQA 1PWXA 5D2CA 2UZ1B 1Z0SA 2C0CA 4GWKA 4KGVA 3UMJA 3QY0A 4D4KA 2V74B 1HURA 1EA7A 4G4SP 3OZSA 2B78A 1HKUA 3CLTD 1Q2XA 3HJBA 3BXOA 3R0ZA 3ON5A 1NQAO 5FB3A 2GS9A 3O4RA 3OO1A 4V24A 3DMDA 2BKAA 3KYBA 5JNWA 3CZRA 3FCCA 3ZHBA 4AIIA 4QJ5A 1B0AA 1YUNA 3DA8A 4BLSA 1GZ6A 1RCTE 1SIUA 2A88A 4MRMB 4F2WA 5KYYB 2MR6A 2QROA 2FPGB 4GOOD 4BUCA 5KYWB 2ZEJA 2ZRNA 4HWTA 5F5NA 4GOLD 3WNDA 1GVNB 1CUFA 4UATA 3HZRA 3JD1A 4D74A 8ATCA 4B3TB 4OB7A 2YZMA 1E3MA 1XJQA 2BEVB 2YFYA 5JH7A 4C7OB 1II0A 1Y1QA 1LC0A 2H31A 5GIOE 1E96A 5K4AA 2JFBA 2HPAA 1QHYA 3FRHA 1XJ5A 2CD9A 1F5SA 4QICA 3GVCA 4QPZA 5GINE 1V5EA 4JUIA 4N7MA 4OI4A 1QUEA 4AMVA 1GITA 1VGRA 3IE1A 4MIEA 4EMBA 2V55B 3R0VA 5D84A 1EUDA 4GYJA 3L7OA 1RP7A 5JYDA 3EH1A 1RQ2A 4KQKA 3K4HA 4QODA 4EA7A 3F5MA 4QEKA 3MIIA 4WERA 4PPQA 4DZZA 2ETXA 3DL4A 3FDJA 3OTGA 4O0MA 4BWVA 4CEIB 3PDIA 4M38A 3RJTA 2O59A 1ZH4A 1BU5A 1KJ9A 2IP4A 3R7NA 1HETA 1B16A 1P5ZB 1G8FA 2ZIXB 1C9YA 3K9WA 3ONDA 3KAQA 4XW2A 1N6PA 3F97A 3JPYA 4O6VA 1E6EA 4JJ6A 4W5NA 1Q0RA 2FEAA 3PR3A 1ZRNA 1FFXA 2H5JA 2RJ3A 2ZITA 5A9SA 1WB4A 1IZ0A 3KTOA 4G0OA 2EFGA 3R3XA 3ZDYB 2BUAA 4L4SA 4OFBA 4YIHA 2OCAA 4YAGA 4TN1A 3ICQB 5B64A 1ORIA 2HTEA 2OFWA 3PC8C 1YUBA 4GX5A 1J5XA 4X92A 1CE8A 5CLIA 1EXVA 1JQ3A 1A7KA 4Q00A 1IHYA 2MSKA 3OZRA 4JBIA 2H63A 4HDMB 5UKDA 2YCLA 1KSGA 2OILA 4C22A 4RA6A 5BSWA 5CB4A 1CY2A 1V35A 2ZSDA 3ONFA 2AUMA 3PUIA 1MU0A 2JCGA 1DQZA 1DUIA 4AUMA 2HNBA 4JBLA 1Y98A 5KS2A 5DOZA 4MS1B 1RYEA 3WR5A 1X1RA 2Y1WA 5IX8A 4R1TA 3SC2B 2PWPA 2W2LA 1E1NA 3K9NA 3MWLA 1AK2A 4MVJF 3PSAA 1KYQA 4O2AF 1KI6A 3P9ZA 3I3OA 4W5RA 3UO8B 3AVWA 4KO1S 4PLPA 4BBZA 4S1VA 1VCHA 5TS2A 5CNIA 4B4WA 1Z15A 2GJKA 4CM8B 4OKNA 4Z1MA 4WSOA 1Z0IA 3OUZA 4OQPA 2CNNA 5H1YA 4UZSA 1SG6A 2H92A 4UVEA 5FEMA 3TKAA 4YJ2A 1PGNA 4BB9A 2C99A 1DINA 2V7WA 1R6DA 3AFMA 4NU8X 4B43A 5E8JA 3RGGA 1KTIA 2I4LA 2Q2WA 2JB9A 4KIGA 2UYYA 3QHQA 4KQ2A 3BF7A 2JIOA 3DPIA 3M9LA 5K8CA 3EIUA 1VRCA 3DNFA 4AULA 1L5YA 2R79A 1AUPA 2VNIA 3F6PA 3FYSA 1ZCJA 5IYZF 1JBQA 2LWIA 4RGVA 1BQEA 5LUAA 1DCFA 2RHWA 5DHSA 4FP9A 5BWLA 4HB4A 5D1NA 5EPUA 3RUCA 4RPLA 1WUKS 1OQAA 4K2HA 3VTKA 5BR1A 4PCLA 4A1FA 4UU1A 4RY8A 2EARA 4B6QA 3H2HA 1N9ZA 1ECCA 1S2MA 3IRVA 1MHPA 4BB6A 1F2UB 3N0XA 3NIWA 4J4HA 3U81A 2AOUA 3HDGA 2ZWVA 2JKZA 1IBLB 2B8EA 2R00C 4JZYA 2MT9A 2ZR8A 1FFXB 4P3PA 2EFYA 2NXEA 2EP5A 2ODPA 4ZT2A 4ALMA 5A9SB 1NXWA 2OCYC 4F96A 2UXCB 1OBCA 3HS3A 2ZJFA 4R2JA 1AKRA 1GKYA 4MUFA 3U31A 2RGAA 1JFFB 2UYGA 1JN0A 1EK1A 5BV2P 1ACMA 4NE2A 5KWSA 4LY0A 5H68A 3C3MA 2ZZKA 4LS3A 5E6SA 2C2HA 2HR1A 4J4TA 1NAHA 3WYEA 1JALA 2A1TS 3HFSA 4EL5A 4EG3A 2OD2A 1M8KA 2O8VA 3GRRA 2H2WA 3D7LA 4PV7A 3BK2A 3F5DA 1I3MA 4Q7EA 4RDCA 5KTTA 5LDDC 2ZJ5A 2FUNB 5HJ7A 4M0MA 4Q4DA 3T5BA 5TIIA 3GP3A 4REQA 5U9CA 2WD7A 1CVIA 4NTZA 2QTFA 1N1DA 4AG5A 3D8TA 5GMOA 4HN2A 1UBOS 1XRNA 4P4NA 3AWIA 3RRNA 3NBAA 4H27A 4L7QA 3UAZA 5IT4A 1GGJA 4GOND 4BO4A 3DYIA 1HOTA 4WACA 1T4GA 1VI6A 3DXYA 4CM9A 2R7KA 2RJNA 2XODA 2ZSKA 2H29A 2V1XA 5HF8A 4E1AA 3W5BA 3SQDA 4K0KB 3PZBA 4MUNA 1KYTA 4FONA 4HAIA 1B93A 3IUPA 1ZBQA 2W4MA 2XITA 3C1UA 3QOXA 4PYOA 4B87A 4DLTA 1SHTX 3O83A 5FNVF 3ILYA 3LWNA 3C4JA 3DV9A 3EMVA 1SXGA 1A4XA 4NYJQ 1CY8A 4QC2A 1DRVA 4UPVA 5K3BA 3AF6A 1RAAA 1XTVA 5F9FA 1GNTA 2Q7XA 4FCWA 3WQQA 3JATA 5DGDA 2AEFA 2E82A 3RSCA 2W6CX 2YYZA 4EEXA 1MO2A 4M87A 2C98A 3VYVA 721PA 2PZJA 1GPLA 1QGYA 1MA0A 2PZLA 3IFSA 1NBAA 4HDQB 5C1PA 1RRGA 5FJJA 1ZH6A 3ABRB 4MNTA 2HWYA 4LJ7A 4AQ7A 1M6HA 4HXYA 3P2MA 1X6VA 4MKRA 4NYMQ 4P98A 4IQGA 2YJ3A 4ZHQA 1PX0A 1CW2B 3IPXA 3PA6A 4TZKA 1FUKA 4BDTA 2Q2OA 2OG1A 1BXGB 1TQHA 5F73A 1JPVA 1HE2A 2RFLA 2HSDA 4IEIA 4LOLA 4PZYA 1Q7CA 1RRMA 2GVZC 4IS3A 4MV3A 4LEIA 4ARZB 2BISA 7REQA 4O4LA 2VO1A 4Y2PA 1Z3CA 3AFOA 3WGGA 4G23A 1Z26A 1NPDA 4QXQA 1TYBE 2WSMA 4HDKB 3RB8A 2NTVA 3WYDA 4U7TB 3F8WA 4B84A 2J6IA 4YALA 5LDHA 4XD7D 1DTWA 5JNSA 1RXIA 3QVGA 4KFCA 5SYMA 2MJLA 3EVDA 3ZJVA 1NVFA 5ALUA 2WJIA 3SX0A 1A27A 2E1PA 4GSYA 2H85A 4R8MA 1J42A 4E7OA 5JCZA 1WD5A 2C8JA 5DBEX 1OLOA 5LM3A 3A6PC 3STVA 3PNQA 4XR4A 5DPMA 1I7LA 4DSNA 4Q3KA 4BGUA 2UUPA 4O33A 2ZK7A 3PLRA 2XGJA 1R0ZA 1SQ5A 4EL0A 2X5KO 2ZRCA 4OHFA 3Q7RA 2ZG6A 5BRAA 1GL3A 4KTVE 4FNOA 5F1YA 3P2OA 4E5KA 5FQNA 1J0AA 3NB0A 1AOXA 2GRJA 3NANA 3TH5A 1FDRA 1FNNA 2HIAA 2HDHA 4D4JA 3S1LA 4LOKA 5CVEA 4F1KA 5IVHA 1BYUA 1XTJA 4LVNA 2B4AA 3Q8WA 3TTXA 1R10A 4FWIB 1NZDA 5LWQA 4PONA 4HZUA 3KQNA 4G0ZA 4IBOA 2PGOA 2Q49A 1U7PA 2VWGA 3ND6A 3PNOA 4H6PA 4E5PA 2BI4A 4G9EA 4ZOAA 5E1DA 1JW9B 4KXLA 4ZO8A 4KREA 3DAYA 3LO5A 4QYTA 5BT9A 1UBNA 3GGJA 3PWZA 4X6XA 1S0UA 3MWEB 5A7HA 3NDBB 3C6BA 1H2FA 1JLSA 3FPHA 3GGCA 3PQ2A 3WGKA 4BNDB 2VA9A 2GD0A 1EQUA 1NP7A 1RWNA 1J2EA 3CZAA 2X23A 1H3NA 4I5GA 4LNHA 3CH7A 1CF4A 1OBHA 4HSEA 3CUEF 4XFJA 3CINA 2RB4A 1JTVA 3LYLA 2C8LA 1ULSA 3P9QA 4V39A 3H9EO 4R2LA 3VR4D 3K2EA 3MWGA 3OBBA 5FLXA 2J4DA 4PC2A 1MW8X 4OI2A 4RVSA 4M9QA 4GI5A 1R0LA 2OYSA 2VPYA 4EW2A 1EFLA 4IW3B 1FX0B 2XQKA 1E7WA 1QB8A 2WNHA 1SZPA 3EFOB 4XWTA 2Q3DA 3V2HA 1Q0QA 1F1JA 1XXHB 3T3OA 1QZZA 5DX1A 5A5EA 1ZN2A 3BDAA 5B1YA 4CM3A 2O8DA 2GYVA 1NRWA 2FVXA 5K0JA 1YTUA 1BHSA 1N2EA 2OBMA 4KDEA 5K3EA 2H0RA 4MPTA 5JSYA 2VN8A 1OBVA 4JZKA 4K26A 3K05A 1LVUA 4G4SO 3TMKA 5LZ5A 5L53A 3G0HA 3PHHA 4WZZA 1Q1EA 4PHHA 4PPNA 4E5NA 4UTRA 5CAEB 3HU5A 1XZQA 2F2TA 3JVUA 5JYCA 1MIOB 1ORTA 2QYOA 4TMYA 1S1MA 1SBNE 4H7IA 3NVAA 3QKIA 1E92A 4H4CA 3RHZA 3ZZ1A 3WK9A 4Z4GA 4PYRA 2H5IA 1JF8A 3UMRA 5BQ5A 3VYWA 1ZQ1A 2NXNA 3C7KA 3I5MA 4WASA 2QQ5A 2BFCA 1G8HA 1R0YA 3K2BA 1P6QA 2OGTA 3KPUA 1PP4A 4XR9A 1E6WA 3OG9A 3QBEA 3ZV4A 2QRHA 3W3ZB 1MNAA 2FRDC 1QCDA 2W4IA 2X1MA 4HPWA 2XA2A 1YSCA 5KKAA 3VQTA 1BRMA 2Q62A 2WM9B 3BH0A 4JENA 2WTMA 1ZVJA 1G5HA 1M72A 3SFZA 3T1TA 2RG1A 3GP5A 4NR0A 1N34B 1LBQA 1SKYE 2LDBA 2HRRA 2POQX 3E35A 1T29A 2ZJ3A 3HFGA 4FNGA 4TRNA 1H0HA 4GNRA 4PZCA 5I4KA 1KKUA 2WYWA 1NR7A 2ZUSA 2CFSA 2PCJA 4NRDA 4WKCA 1BD3A 5LLDA 2PGLA 3D43A 2HADA 3H1AA 1KYZA 3CO0S 3I37X 5THQA 1VDMA 2P9CA 2QZ4A 1JL3A 1JU4A 3E22B 4YJHB 1VHTA 4I4LA 2FY8A 3DMFA 4YXFA 5IZCA 1F38A 4EX7A 4EECA 5LNK1 2CB0A 4JN6B 2JCVA 3K7EA 3PC4A 2XDAA 3R5KA 5AUPB 2PA0A 4MDHA 1UDCA 3ABSB 3WDKA 2A9JA 3DMRA 1IIBA 1ZM2A 1MG5A 1ZEJA 2ZCVA 4GIBA 4P1ZA 3T3IA 2P79A 3PHLA 2J3HA 3KL2A 4H1VA 5T4EA 4EI9A 3LP5A 4BLQA 3U5TA 4JJEA 1XQYA 1E63A 3I53A 4MPDA 3IEKA 1KARA 1MABA 4OA8A 4TMFA 5FLYA 3SGLA 1FL9A 4W4TA 2B7CA 5ADWA 4MS3B 3TLZA 1NVDA 3I2KA 1JX6A 5FTNA 2CLCX 1I1HA 4CKWB 3OPQA 1ZGCA 2NUPA 4MW2A 5JAHA 3K4QA 4CKEB 5B7PA 1TK3A 2A5FA 4LJ4A 4RMIA 2WFLA 2O1WA 3VHQA 5JEDA 1AJEA 3TL6A 3U6KA 3E2IA 4Q4AB 3TLKA 4H0NA 2ORYA 3PQ5A 2BMDA 2W90A 4OYRA 1ORHA 1OAOA 2HYIC 3KK0A 2CKMA 4I9NA 3EIXA 5MGNA 2QQFA 2EF0A 2GCPA 1YOVA 4P58A 2PMBA 3UKJA 5I3ZA 3FI9A 1OWOA 3M6IA 2CXQA 1M34B 3AW8A 3B1KA 3IJEB 1JYEA 2IOQA 3C6ZA 1ESCA 4A9AA 3MJRA 5FL3A 5B58T 1WO8A 4F6LA 4ZYYA 1GL9B 4YV7A 2NP7A 4Z9YA 1E1MA 4PRYA 3MQFA 4XVQA 1U8CB 2GN2A 1RQNA 4B31A 1QV9A 2ODBA 3QV1A 1M66A 4F4DA 1GNQA 5I5GA 3PI7A 1GU7A 2WSBA 5KI6A 1JQEA 3RASA 1C8VB 2X9LA 5EGSA 1RXYA 4HNSA 3ZCRA 4DBLC 4JVSB 4DEVA 1BJRE 1CZUA 1BXKA 3U80A 3DLIA 4Q7MB 2DMRA 1Q0TA 3PTZA 1NV8A 4P34A 1FTGA 1QFYA 3ABZA 3P5BA 2CLLB 1PNVA 3NBXX 2ZI6A 4MRPA 1F14A 4FZJA 4OHWA 1ISRA 3WLAA 2F1KA 4OHMA 4WZAA 1KBQA 2ET6A 4KWCA 4L9WA 4NABA 3ETNA 3PYMA 4AJPA 4B6SA 5GQSA 4CLOB 5GPBA 4HVAA 5E0OA 2QE7D 1PKXA 3H75A 4Q1DA 3B6ZA 4KWHA 1GNPA 1NOKA 3V6LA 5IJ0B 1ESDA 1ABEA 4KHZA 4LBWA 2JIBA 5CLLA 2NT3A 5LA6A 4MMZB 4UZEA 1JG4A 1G21E 3CO5A 1L5RA 4CCSA 3OY7A 3WSWA 3GROA 3UJBA 3SXUA 5DHAA 4ZHSA 1O89A 4QUBA 1GPAA 3AVTA 4H0CA 3AEQA 2PKQP 4MA5A 4RDHA 1KYXA 1DX6A 3OZUA 1P4HA 1H42A 3A70A 4M7WA 5B57C 2PXXA 2FUEA 3AEUB 4JXJA 3DV0B 2G70A 4LC0A 5BOVA 1S2LA 2NSDA 4F06A 1GXSB 1ZGAA 2YRFA 2FAXA 1XNGA 1SU8A 1K7FB 1LVGA 5ALIA 3WL4A 3IDOA 1KQ3A 3WYBA 1HA3A 5I7AA 1NJSA 1WXXA 2H7CA 1V2GA 4KPUA 2HJWA 2QN3A 2WIJA 4L4UA 4X84A 1X1EA 2Q5FA 4NMLA 1X9GA 3UMFA 2V8OA 3B5IA 1DMSA 2V5AA 1GTVA 4JQOA 5HE8A 3SKYA 3SZMA 1HTWA 2JH9A 4HN9A 3CT6A 4NYJR 3RVDA 3QWFA 5DGHA 4C3UA 3QU5A 1KSJA 4MVJE 1IUOA 3COSA 4R9UC 2OO7A 1FE8A 3NBFA 4PHGA 4AJLA 4BLVA 1QO0A 2DCMA 4X41A 1ZW6A 4YDHB 3UV6A 2VYVA 5F5XA 3WWCA 1NYTA 4I4TB 1AKUA 1FP7A 2R87A 3HJCA 4TVKA 4WA7A 2VZ9A 5IDVA 2IOHA 4NYMR 3ROFA 5KVAA 3PENA 5SZKB 4AG6A 2VKQA 4GX1A 2Y67A 3BGOS 4GLFA 4Z9XA 5IHPA 2I4MA 4A2WA 4FN5A 1SOAA 3UV7A 1XQWA 3C14C 5A4IS 2SKDA 1DAPA 5CVTA 1NM5A 1C3OA 3D7MA 5A5VA 1EK2A 3OCUA 1N1GA 2EERA 1IY0A 2RDMA 3Q0TA 3ENQA 3OT5A 1EFVA 2VH1A 5FTKA 3ZV6A 4CIYA 1P75A 3THRA 2ZQYA 3MIZA 4PAOA 5E4FA 5KSZA 4NV1A 1U4OA 1RMTA 4FFRA 1BG6A 4BQOA 3UOAB 2W2KB 2H4HA 3VYRB 4DUGD 4DV6B 3PXXA 2VJYA 3I58A 1WP9A 2XI4A 4TS3A 5C1BA 2HUPA 1DKLA 3T1NA 4XDHA 5B3LA 1UKEA 5ED4A 5C8ZA 2W0MA 3B5EA 2HIGA 3OQHA 2XDQA 1UM9A 3RYHA 3SSMA 3AV3A 2AI2A 4TX1A 3BGWA 2GAFA 3LUKA 2QY9A 4JOCA 3W2IA 1E2NA 5TPWA 3ELBA 3X1WA 2R8XA 1U99A 3ROPA 1HNNA 4M54A 3GMDA 1US8A 2V7PA 3Q3HA 1I13A 5CNKA 2O4UX 1R9GA 2FR1A 1OLSA 4I9HA 3DH0A 4MP8A 4OGKA 5DH9A 5IM5A 4G5YA 2H6EA 3OZWA 1JEDA 4I55A 1BE6A 3KWLA 1XZJA 2IHZA 3NATA 4GBMA 1TM3E 1U5CA 3WGLA 3TSYA 3BD7A 1IM8A 1RM5A 1KP3A 2VJKA 3AVPA 2R11A 5K8UA 1TQ4A 3FNBA 2B4QA 4XQCA 4YGYA 1ISIA 2GK3A 5AJYA 4DB2A 1W36B 2Z08A 3RJ5A 4QBGB 4HRVA 3K9CA 3L6UA 3ZDBA 3H2SA 4BFLA 4EG8A 1ZOOA 2AK3A 3K5WA 4QVKA 2DVMA 1UMBA 2WNIA 5ED0A 4DDKA 2J3JA 4MUMA 3RRZA 1L8OA 3JD4A 1Z9BA 2DWUA 3S2GA 2JCYA 2PZAA 1YDWA 2WDZA 1MJGM 2XQIA 4S2UA 1JTEA 1Q21A 2CCJA 4HWSA 1YACA 1AQJA 1JI0A 2P4HX 1NTOA 1UWLA 2GZHA 2W6PA 1FYDA 3Q15C 5CVCA 4BCCA 1GP2A 2YWBA 4XYEA 4BMDA 2Y68A 2YOGA 4D44A 3LD9A 1RLOA 3C39A 3DEIA 2VHCA 2D5IA 3M5PA 5BWOA 1S5PA 2SECE 3L8EA 3I6MA 5CB4F 4XVRA 4ZDWA 4LXHA 2I1QA 1ZHOA 3INNA 1KSFX 2BBTA 2WMNB 4NBTA 4PC7A 4HI0E 1EXMA 1ZFNA 2O8NA 1YRBA 3ESAA 4K03A 4QQNA 3GBSA 4DN6A 2NN3C 2YHIA 3TQHA 3WV4A 4W6ZA 4JYBA 4D6YA 1D1QA 2AFIA 3T95A 5L3QA 5IKEA 2C78A 1IG0A 1S2NA 1LBIA 1UK6A 2A0WA 2VR1A 2ZI7A 4RKFA 2C77A 2Y1DA 2X0DA 4BO0A 3PC3A 5I4IA 5P21A 1ZRHA 3W7BA 1C7IA 4Q3OA 2YY5A 2CCGA 3DZHA 1KI8A 2OQRA 3OIWA 2Q1WA 2GF2A 1C29B 1VMDA 3RODA 1X7ZB 2G9QA 4IP0A 4V38A 1NR5A 1TTQB 5A3SA 1OAAA 4AAYA 2I3GA 4CKZA 3GLGB 1IWBB 3EQ6A 4LQCA 1SKBA 1R1DA 1PV1A 3DEFA 3OIYA 1ZOIA 2SCUA 4HMPA 3VI3B 4GVPA 3WKDA 1XBTA 3GU3A 3GLRA 3JQ7A 3V8VA 2A35A 4KQFA 4E30A 1PR5A 5ES4B 4Q48A 1EKXA 1HF3A 1L4EA 4ZEOA 3GWGA 2VF4X 1W1IA 1FSGA 3DJFA 2QF7A 4FYKA 2OHHA 5EMLA 1GRQA 4P93A 1JILA 1ZJJA 4ISCA 2W93A 3BZWA 5WRFA 4ZGBA 1W4RA 5J2UB 2VT7A 4O2BB 2V7XA 3KZVA 4M1TA 1D2HA 1MQSA 4QBTA 5A5DA 1REQB 4M98A 4Y9UA 1PEYA 4TXHA 1IBSA 1RBQA 2GVDC 2Q6KA 2W2NA 4RKRA 5J9FA 2Z98A 4BMVA 5T5QA 3L0CA 2I22A 3MWYW 3PUWA 4WKNA 3ZBUA 3ERCA 3B53X 1L0BA 1N6HA 4YT8A 3ETGA 2Z3ZA 5D7BA 3VR5D 3F3YA 4LBZA 1BWSA 4IILA 1L5HA 4ZVNA 3BS4A 4J29A 3NI2A 1A8SA 2PUTA 2WF8A 2YV5A 4QYIA 4M0KA 1N2ZA 2HV8A 3VJKA 1IZ7A 3M5WA 3TVTA 1M6EX 2ABWA 1GL6A 2XYQA 4E08A 1LXCA 2FRDA 2VCYA 1N0UA 2GZSA 3IAS1 4W9NA 4DS3A 2Y6UA 2WWWA 3DZKA 3OEEA 2O0JA 5F3WB 1T10A 2GKOA 3OE4A 4KEAA 1A8PA 4NJEB 1SCAA 1T5DX 3OQNA 5I7WA 1G63A 4ALKA 5CITA 4CG2A 3I61A 2V03A 1RJEA 5EZ5A 1RACA 2I2AA 3BG5A 4PIPA 4UEWA 1N2XA 1T91A 2Y76A 3BIOA 1JEOA 1JHUA 1XROA 2IV3A 2XOXA 1CDEA 1GCOA 3FUUA 4HLCA 4LIPD 4JL6A 3TW0A 3S2YA 1GO2A 1DAIA 3CLUC 3ZDQA 4XLTA 1T36A 2JLUA 4DLWA 4HEJA 4B3SB 5L3QB 1O87A 4BWGA 2O5VA 2IIVA 2BKXA 1P9LA 2NM0A 3E84A 3HBFA 2GERA 5DHPA 1LTQA 3H4VA 2Y1EA 2VOJA 3KOMA 3V4ZA 1V26A 5HG0A 4GEGA 1MJGA 4YI5A 2W2MA 3VUEA 2EATA 3PU6A 4IV0A 4R31A 4TYMA 3L04A 2R2GA 2FEWB 5JG7A 5F3DA 2OO5C 4FOOA 4EFLA 5AVYA 1XNJA 2FQWA 1TAHA 3JWJA 3Q3IA 1A9YA 3UJ8A 4AW9A 5ICMA 3BICA 5EHQA 1KYWA 9ATCA 1OPXA 4H3KB 3ED5A 4MYSA 3BHJA 4J0KA 1EX1A 1YVPA 2QAGA 3M1YA 3NHWA 1PHPA 1VMAA 2FWBA 2ZS8A 1KI7A 2Z56A 3GIWA 3LK7A 4C3OB 4K8RB 2W2OA 2P6MA 4IMRA 2CMKA 3KT0A 3AP1A 2IRWA 1B0PA 4RE5A 1SY7A 2VWQA 1TM5E 3LOQA 1U0EA 2J9ZB 2Y1GA 4HZGA 1UXHA 2C07A 5K2MA 3M6MD 5FKJA 2ZBFA 4ZIRA 4FB5A 3UEOA 4DADA 2Q9UA 4N0DA 1ZHFA 5JSHA 5EEGA 1TT5B 4JQYA 4LOHA 1ESZA 3CE9A 1F4VA 4MHTA 3R20A 4II3A 1C7RA 3QNWA 4GM0A 3RKUA 2ZXFA 3EF0A 1B14A 1ESMA 4NDAA 4O4LF 3HCFA 3QKRB 3WLOA 5CCXA 3LLUA 2NO5A 2VHZA 3A36A 3H6KA 4FMDB 4Y2YA 4MW0A 3KP1A 1AGPA 3RKSA 4CL2A 4CG0A 2V9ZA 3RIEA 2YZ7A 3UOWA 2QD2A 1R00A 3RSQA 2A9KA 1IBCA 1TT7A 2RBKA 1V11A 5AKIA 3F47A 1IHXA 4YLYA 3N2GB 4TSKA 1G8YA 1U7TA 2QRKA 3LC1O 4WJLA 3ICEA 5ILQA 3L7BA 3GW8A 4JU9A 2B4RO 4RLHA 4K9KA 3JYNA 4RFVA 5E6RB 3E4DA 1DV2A 1JR3D 2F3RA 3GJRA 3QXSA 3F9CA 3H9BA 1NQXA 2C5AA 4ZAYA 1SVWA 2ZROA 2GCOB 3LW8A 4JI1B 1W4LA 2Z2JA 5EMMA 3GEIA 3OC6A 1GPJA 2Y77A 1L4HA 2CZCA 4KV9A 4Q16A 3GDOA 2AHOA 2E7ZA 2X9NA 3CX3A 5F4ZA 4P5DA 3K72B 1V2HE 2AG6A 4TM8A 1DIRA 2ONCA 1RKVA 1Z8HA 3FM9A 3JR3A 1J56A 3QTLA 4I6GA 4L95C 4M76B 4INJA 3CVVA 5I9BA 4EEZA 1C5KA 5BNTA 1GD1O 1MOSA 4TL9A 3SQOA 4AJ4A 4DC1A 2QTZA 1TCCA 4HK4A 5KNCD 3EW9A 4HB0A 5L3RA 3OTHA 3G0DA 3MTEA 1WQ3A 1XWIA 2HA7A 1LNQA 1TMKA 3H0KA 3OEHA 4IV5A 2R5WA 3Q85A 4JGIA 4RD0A 4J1TA 3SC3A 2OCKA 4E2YA 5CA1A 2WP8J 4DARA 1T4CA 3S2ZA 1T9HA 3J81k 5E9JA 1H1LB 1XZNA 2P77A 4URWR 4DNQA 4AO8A 1RWQA 1RJ9B 1UMKA 5THKA 1P3Y1 3KUKA 2CHGA 3LOPA 4HWPA 4K6GA 2QLMA 3RJMA 2XCSB 2PNFA 4WXPA 1IU9A 1PK8A 2Z9CA 4S2EA 2VNSA 4GRDA 1SKQA 5T4BA 4BPRA 2X13A 1GPNA 4ISBA 3VX3A 4CQMA 3GBVA 2FE1A 4DV3B 1KH2A 2ERCA 3CNBA 2KWIA 3P0FA 1E7SA 3LH5A 3OX4A 2JFGA 4N8SA 5DM2A 1M1YA 1O95A 4QGSA 1U65A 1HFEL 2JAWA 5IAEA 4K05A 3T4EA 3WIVA 3SLGA 3D3QA 3WL7A 2MSEB 2WOOA 3VR2D 4UPEA 3P2EA 2OVBA 2R60A 3NHUA 4JVOA 5EXDA 5JW6A 3F1KA 2IZ5A 1GTZA 2FMHA 4LJSA 3N3BC 1U9YA 2IXGA 3E82A 4WFIA 2CN1A 3ENVA 3KKOA 3IP9A 3VX4A 4QM7A 3OZGA 1T1IA 3IUEA 3JWPA 2CUZA 2YVKA 4CHGA 2ZYUX 1YR2A 3AERB 2XGMA 1MV5A 1C8KA 3D6FA 2XMCA 4JSRA 4QFDA 1M1NB 3DLBA 3EG9A 1X19A 2WHYA 3CNNA 4I50A 4KE7A 4GQBA 3AL3A 4BGDA 2Q8NA 2RAUA 2NQ8A 2OKGA 2YMQA 3MM4A 3WK5A 1M0SA 1AQIA 2A14A 1K1EA 2FKAA 3FYHA 2ZB8A 3FPAA 2HGZA 2H1HA 4AUNA 1X70A 2H1FA 4QUHA 3DDNA 3D4OA 1MOPA 2VJNA 3NETA 3UXYA 1DIGA 2JLQA 5F1OA 3N87A 1JVNA 2FQYA 3QBJA 3I72A 3KKMA 3IB3A 4JBWA 3BIXA 4J0IA 1QCZA 1YDGA 2YQ4A 2VF8A 3CWZA 1RWMA 3FROA 4Y0NA 4ZDJA 1E9SA 3P2IA 1SOMA 2EU8A 1R0WA 4MLPA 3TUJC 2WQ7A 5LFAA 5CR9A 1QIJA 1NBMA 2IHUA 4GBGA 3B7WA 2XXAA 2V54A 4QL3A 4MYRA 5EAIA 1DADA 5ALMA 1AXEA 3LKDA 2P41A 4TKLA 2ETVA 4ZOQI 4IJKA 1TEHA 4M6WA 1XGKA 1DBIA 4I5IA 4XB2A 4X1IB 5T8KC 4GRIA 1JR4A 1J2TA 3DAFA 1W87A 2O8BA 1KGSA 2FVYA 1NTRA 5ALFA 5EKSA 4YXWD 2G4LA 2BMJA 1MH9A 1SCIA 3UMYA 1C7ZA 2JHGA 2PTGA 3FTPA 2G5PA 5DLDA 3ZQ4A 4YDQA 4P4LA 2QSYA 1QE0A 1L7MA 4BNXA 4D57A 3ADKA 1ZMRA 2J6HA 3PJFA 1UBJS 3ZY2A 3H04A 3IOCA 4U2GA 2OO3A 5HOEA 1C1XA 4U2KA 4JU8A 3F3MA 5FAXA 1Y3HA 5DF1A 4KN9S 4MQFB 4OQEA 4PZAA 2J9RA 3L7AA 2WSSD 3PC2A 3THXA 3IURA 2F43A 3G2NA 1RKQA 1H4SA 3RIMA 1IBKB 1PO7A 2I4IA 3K20A 3NWOA 3ZWWA 4ZI2A 4LCEA 1G4UR 4FR2A 4YDRA 1M1YB 4ALLA 2OCBA 3OE5A 4RK7A 3RFUA 3WNBA 3AY3A 3RIGA 1E0SA 2D8MA 1Y89A 2EFCB 2OAP1 2R6FA 3QEMA 1U80A 3BT7A 3KYIB 1C30A 1JZQA 4EB8A 1DBWA 4YO8A 1HG1A 1DKQA 1ULTA 3DCIA 5FFFA 3RC3A 3ZE7A 3R3HA 2BGTA 3B20A 2ZTHA 4CMKA 5BYAA 1Y5NA 3RG8A 2XRZA 5EN4A 2QYSA 3EDQA 5EJ9A 4ARAA 2QBYB 2FF5A 2I2DA 2XE8A 1ZUNB 2C20A 1NJ1A 3EASA 3SOPA 1X9IA 1F4PA 1N2BA 2NGRA 4JQZA 4PS1A 4Y2TA 1DQSA 4I4TF 4K6OA 4UDOA 2VDQB 3SYMA 1GNRA 3HDTA 3FTDA 5MN5A 4XX1A 1Z3IX 2AMYA 2DTDA 1E4EA 2NOAA 3L0OA 2YIMA 5B7NA 5B7QA 3TW4A 1NVXQ 4RTMA 1Z73A 1SUDA 3D0KA 5CB0A 2PR2A 3HB7A 3ODGA 1E0DA 3MCZA 1RI1A 3FSRA 3P9SA 1R50A 5LNK6 2QTRA 3CVXA 2WJAA 3NG1A 4L28A 3RCBA 1GUYA 2QLLA 5DM1A 3UFXA 4BL5A 4QO7A 4CZ2A 5CDSA 1DJQA 1U2QA 2BV3A 1ZK1A 4H2DA 1JSZA 1R3UA 2FTKE 2QRUA 1KOFA 1U7UA 4D9JA 2VJAA 3EDOA 4YH1A 4HQKA 1PDOA 2WFZA 4EHHA 2BFEA 1T8TA 2HMVA 3ZPXA 1UFQA 2RHGB 5LA6F 2YIVX 5EXPA 4P80A 1M8FA 4DSZA 4MITA 3A4MA 4P2BA 4Y1GA 3A4VA 4LWQA 2OQVA 4AF7A 1N2CA 1Z8NA 3N0WA 2EL9A 1WBBA 1DUVG 2IHBA 2O06A 1EVLA 1UBSB 2GK4A 2GM9A 3KL4A 4YO7A 3SS9X 4UOEA 1L4MA 4N0EA 4XUCA 2EYQA 3HR7A 4YJ3A 5DSTA 5F7JA 3BMNB 3UQYS 5KTRA 4FE7A 4DG8A 2YYAA 3PVSA 2HA6A 1MEOA 2GD6A 1OF1A 4QOJA 3I39X 3GDFA 2YCBA 3HY4A 3W9SA 5KOHA 2GK6A 2L19A 1X0VA 2H57A 3P9PA 3IJ5A 3SEFA 4AG3A 3LV8A 1T1RA 3CT4A 2IBMA 1SC6A 1YU6A 3LDUA 3VJLA 2EBUA 1TEZA 1J07A 4G2TA 1CK4A 2X7HA 3R77A 1D2CA 1LQ2A 2VCEA 5ALKA 4EHAA 3ZCQA 5LLTA 5ESXA 3WWDA 6REQB 3RLIA 4EGJA 3DBVO 4LV5B 2ZT8A 4R7TA 1T6NA 4EWLA 5BW4A 1XZ8A 2JHAA 5HW0A 2VJOA 3FIUA 1SPBS 1XMJA 4ZQBA 2X0FA 1G0OA 1CP2A 3L1JA 4BMXA 4OLBA 1KVTA 2R2AA 4KIWA 3CLSC 3RUEA 2UYQA 3KLOA 5K0FA 1E5VA 2V7QD 3KJIA 3UANA 4UMEA 1FMLA 5KBYA 3R6DA 1EAMA 3AEXA 1LK0A 4LRXA 3G13A 2WIAA 3NV9A 1GQSA 4Z0TA 4LWZA 5B36A 1S3FA 4NE7A 3QF7A 1EHIA 4Z5XA 5I47A 1K66A 2VK2A 5HKLA 2YHUA 3I1FA 2OBFA 1QH1B 1NQ5A 2Q3LA 1XEXA 4QTTB 3UB3A 1YKGA 3DZJA 1GN9A 3GZ4A 1NDQA 2FFRA 2UV8A 4RVGA 2MINB 4WZBB 5F1PA 4YY3B 2HX1A 2QXTA 1PJ8A 3IKLA 4RKYA 3WL6A 2L0XA 1EQ2A 2JA1A 2PO7A 3I64A 4TWAA 5B1EA 3FB4A 3RYFA 2G88A 1FQOA 2WJWA 2ZLBA 4HQOA 1YTLA 4QYXA 4RMJA 4UTZA 1U1IA 2R6CA 1FU4A 3MEQA 1ZD1A 3UKOA 1MO5A 1VXRA 3R0QA 3KKZA 4MGZR 4P86A 5E7IA 2VXBA 4A2CA 3T7IA 1SG9A 3EIEA 3KTFA 1CETA 5HKBA 3IDFA 4QNRA 3GCGA 1SVIA 1VCMA 2FYTA 3OJFA 1PGJA 5AJUA 5GP1A 1NW4A 1W0JA 4MPJA 4ACAA 3LUBA 4NIMA 3ROKA 3JY6A 4ETMA 3DKVA 3O4GA 4M9RA 4EY8A 2FJ0A 3M6FA 1CZHA 3K9GA 1A8QA 4DGSA 1U28C 1YZHA 3MINA 1V7PC 2JIZD 4QGHA 4CIAA 5KJFA 1WUTA 3LM8A 3KLBA 4MV5A 3EGVA 4ZVKA 1L8QA 5EJMA 4YJ3B 1Q1QA 3ER9A 3MD9A 1NJFA 3ZLBA 1HQCA 3I52A 2R1ZA 1SWWA 4GOMD 4D97A 5IN5A 1PLKA 4TLMB 4CDRA 2XTZA 4IDPA 1C7JA 2QUBA 3ANYB 4G0MA 4I55F 4JP5A 5AR1A 2RAFA 1NN1A 1JDJA 2WM8A 3OCWA 5J2UF 1N7JA 1R0CA 3BH6A 3HKDB 1P4AA 3GZJA 1IQRA 1UFOA 5AKXA 4EH1A 2P7IA 4OM8A 3P8ZA 3L4EA 3GLUA 3G8YA 1WMFA 4Y8VA 3P2YA 5I9NA 2OLJA 3SZLA 3TWOA 1PG5A 3W9UA 2NUTA 1JEYB 4UHJA 3RFVA 3CRQA 3EXAA 2CK3D 3FA2A 4LOJA 1DI0A 4FHDA 1QO9A 4QDZA 3OX2A 4MQUA 2RI6A 3RAEC 1C50A 1FS4A 1K5GA 2PM8A 4CLXA 4EKIA 1QFMA 1YHYA 2YJNA 3FWYA 3VZPA 2IDMA 5LIPA 3GG9A 2F59A 5D3MA 5BV1A 4KFRA 1MNQA 3G17A 3L18A 5IJ9A 4JC4A 4YMGA 3I2GA 2W6IA 4JBYA 4OJKA 3ZWXA 1SOWA 3G9ZA 2Q4DA 3C24A 5C34B 3SM3A 3C3YA 5DXJA 3QQPA 1LLUA 2FXVA 4GP7A 1WX1A 2FEXA 1N8TA 3NJRA 3ZQUA 4EHJA 5A3QA 4CIDA 5KJ1A 3WRYC 4EB6A 4UBOA 4OAQA 1JE0A 1SCUA 2HEIA 5CVVA 3AFIA 4FI3F 4DMFA 5IBCA 1KEUA 4OAPA 3EQ2A 3CGGA 3DOEA 4H0FA 2GEUA 2WYHA 4V1CA 1D4ZA 4I5EA 4ZI5A 3HBAA 5AVTA 3COVA 1O94A 3L5OA 5KSPA 1RWWA 1WDLA 4REMA 2J3QA 1FYWA 1ZD4A 3CUVA 3KOZA 4KYVA 4JKIA 3R6LA 2C7OA 5BV8A 4Y9DA 3QFFA 1XTKA 3CCCA 1T1GA 3QOFA 2DPXA 3ZY3A 3MG9A 1CNFA 1TU4A 5IZCC 3BUSA 1C4OA 2YVQA 3IKMB 4D9CA 3DTYA 1XF1A 1GVHA 2IXEA 2PX4A 3IODA 3I05A 3FSEA 3WA6A 3ESQA 3K6SA 3CW9A 2F8TA 1CFZA 4MO2A 4PRKA 4WKBA 4J0QA 2UXDB 4AJHA 2OBXA 3PD1A 1I3KA 2HCTA 4UBJA 1CUUA 2WG0A 3DT6A 3BRQA 3GA0A 1ZUD1 2II6A 3HBLA 3EW7A 1XXHE 4MPRA 1V5FA 3DEZA 2GCIA 2IXTA 3HN6A 4RC9A 4AS3A 3KWMA 4JD5A 1XA4A 5CBPB 1EM8A 2IEYA 2QHXA 2ZYHA 3FCAA 5F7XA 4ZVUA 2B9VA 1HT1E 3KFXA 2FMXA 5JPDA 2DTXA 3FBGA 1P8JA 3GCWA 1B6RA 2JGMA 4QASA 3C8UA 3ZHXA 3MWJA 2ZOSA 3FSJX 4GO1A 3DBHA 4NBLA 4B6EA 4HQ6A 4JL5A 4JT2A 1NQUA 4O2LA 3QBVA 4LISA 1TPYA 2H9YA 1U1FA 1ZK3A 2GVNA 3AESB 3A1SA 4MVJI 2OGZA 3LWZA 3VOAA 1OLUA 1P61B 1E9EA 2H08A 4AKEA 4URVR 2IV2X 5FBKA 1PW5A 2IHVA 2WU3A 4TT3A 1ORDA 4BFWA 2W00A 2AE1A 4WESA 1U04A 4YCJA 2WVHA 4L6AA 1Z4PX 2ZPAA 1IJFA 4I8DA 4R69A 2PT7A 4UTNA 4IF4A 4NOKA 1VKRA 2YJ4A 4TYQA 1PNOA 5ADHA 4YUWA 3NQ41 1S3IA 5BV7A 3V6MA 1ODSA 2ISQA 2HBZA 3HABA 1S8FA 4QDJA 3CLVA 4DL9A 4WGFA 2VSXA 3IUNA 4O63O 5CIWA 4UQOA 4C0HA 4JYPA 5KREA 10MHA 2ZI9A 3HB5X 3S3TA 2VZ0A 5GM2A 3QVOA 1CQJA 3U7QB 2JIMA 5JJLA 3DF9A 3QVLA 1MB9A 2JH8A 3RE1A 1XQVA 3PGLA 1LDYA 5T8KA 3BZUA 3NX4A 4MHOA 2AMJA 1BSVA 1JAZA 2J33A 1TECE 3QPCA 1WSAA 3IAAA 5DEOA 4OV6B 4RTLA 5C1OA 4HAYA 1YC2A 4KX3A 2YDXA 1AMOA 1KOGA 1C0LA 3IHLA 4LC1A 4RZUA 5HTOA 3X1KA 4ENVA 4LE0A 2OHXA 3EEBA 3VOTA 3UGQA 3FR8A 2PA3A 2ZE8A 3M6VA 4HDOB 4ENTA 3OHSX 3WIBA 1Z63A 5AHKA 4KH0A 2PT5A 1Z07A 3CA8A 1ST3A 4UW9A 3UGJA 2Y66A 3VPDA 4DRXB 4NFHA 5EFOA 4U8HA 3TOVA 3BK1A 1G291 4EJ0A 5EE3A 4LFAB 4EYKA 3KQSA 3QSGA 2C2BA 4GC5A 4DY6A 5DDIP 1RAHA 3PNLA 1P62B 3KPVA 4RNDB 1QHFA 1BHJA 2FSHA 4E6PA 1E2PA 3FWHA 4WK6A 2HJHA 1L5MA 1AGXA 2A7XA 3HB0A 1K2WA 4M1QA 2B94A 4FGKA 1TM7E 4YRNA 1BXRA 1MC5A 1UMDA 3JZFA 3NPMA 3PCRB 2UYCA 3USCS 1ZIYA 3EG5A 3EGXB 2GYUA 3AEYA 5AWFC 3R7SA 3IAS6 2F6RA 2NAFA 1W8IA 3MB8A 4D8UA 1UIRA 4R01A 4JB0A 3TJZA 5TNXA 5JCJA 5JS1A 1C1HA 4US0R 1CUDA 2CHFA 3G9TA 5AJVB 1V8PA 3GMTA 2V6JA 3SKVA 1M73E 2C03A 2YWXA 4YUZA 2RK4A 2CXTA 2PSFA 1M34E 1LK5A 2A0UA 2M32A 3RABA 2JGAA 4DQLA 3S2EA 2FF7A 2WWRA 3G5MA 4PYQA 5B58C 1SCJA 3TQIA 1T5LA 5EWMB 3TGWA 1FTQA 1V6CA 3HSSA 1Z0UA 1PK7A 1IL0A 3NASA 3NGLA 4Q3NA 1UWCA 3SIRA 1SHJA 3BCRA 4IVRA 2A84A 1YVUA 4ALJA 3OI7A 4IIVA 1VCNA 1Y5RA 1LNZA 3WI7A 2GBPA 4IOJA 1SWVA 5BR7A 1AUXA 1EB9A 1K6XA 3X2FA 3X43A 3HHEA 2PJRA 4OO3A 4HX9A 1BAPA 4UHCA 4LTDA 5KTNA 2IS2A 4CMBA 1JR2A 3HZOA 4BP8A 5BVGA 4JLMA 2CL7X 2IK8A 2JGIA 5BN4A 5HPYB 3VNUA 4GU5A 1BKYA 3AHFA 4ILEA 5IF9A 1YZYA 2A6PA 1CQJB 2NLOA 3KUXA 5JDIC 3TKLA 2Q1YA 3QUSA 1GLGA 1JFSA 2VUSA 4LKRA 5TR9A 4TXLA 4Z2AA 4XIJA 1QH8B 2XRYA 1KQFA 3L8DA 1J2RA 1IEXA 2QVCA 4K9OA 5CJPA 4RXMA 5REQB 4HQNA 2BZSA 5TQ2B 4M0DA 5TMPA 4BNUA 1B6TA 1K8ZB 1HEUA 1HE5A 3JAWB 3KE8A 3TAXA 2OCGA 1GZSA 1X1SA 1G9XA 1W0KA 3AJEA 1VPWA 1DO0A 2PKYX 3DMYA 4FBLA 2REQB 4GHWA 4JEUA 3RTGA 3P96A 2H1RA 2P4SA 5JJIA 4BNMA 2DHDA 3D5QA 1TCUA 3WQRA 2P65A 2ZYWX 4NPCA 4W9RA 3UHFA 1RXWA 4HNAA 2AKYA 3OJ0A 4UVDA 1V3QE 4EHFA 2F1RA 1IQUA 2ZT7A 4W5WA 3LQKA 5LJLA 3RVPA 4ARSA 2VSOA 1Z88A 2I1VB 3LYUA 3ZLVA 1XX6A 4QAQA 4G9GA 2ZRFA 1BXZA 1BXRB 1HDXA 4NNJA 5COQA 4LFBB 4UHEA 3RT7A 4I08A 5KTYA 1QIGA 2OTCA 2RMKA 5FOUA 2VTBB 1KRWA 1CQXA 1GEGA 4M99A 4D41A 1KDPA 1Z4LA 2GD2A 1RZVA 2REBA 3JZDA 2EW8A 3OT4A 4YUYA 4G0VA 4KR0A 4MYUA 4XARA 1KXZA 2J3LA 4FMCB 4KRGA 4QUJA 3HYTA 1OX4A 1IY8A 3MS2A 4DLNA 3NJ8A 2GAAA 1T5HX 2PD4A 1U3DA 1XEFA 1YS2X 4JMPA 2BP7A 2P3OA 3F2VA 5E9AA 1CU1A 1U9JA 3QA3E 3F6SA 3KJZA 4JWTA 4MVJP 1SCNE 1O7JA 1P4RA 1UFVA 2P3LA 2BTOA 4TROA 4YREA 1KVQA 1O03A 1QXSA 3RBZA 3DBIA 1L3BA 4N3BA 4KXFB 3FOZA 1TEVA 4HT3B 1VLQA 4PGAA 5IAOA 4ZCMA 3MT0A 3EDRA 1N32B 1OXKB 4RBNA 4IIJB 2XBLA 1NRJB 4ZGWA 3BMOA 1GUFA 3OZTA 4I50F 1NIJA 5JAPA 1LDNA 1W4AA 1JPNA 4FC6A 5FQOA 2O2EA 3N2NA 1KDRA 2Q8QA 5EJ8A 1YMVA 3JQGA 1GUBA 4IHJA 3VOBA 5BPHA 3TLMA 3WYFA 3SVZA 1M2GA 3NO4A 4I2VA 1U8EA 4X95A 4CQJA 3QV2A 4DE5A 4DWVA 6CHYA 1HL3A 3R6GA 3ENNA 2J67A 2KPOA 3GFPA 2FPPA 3DFFA 2DFPA 3P0EA 1OFUA 3O94A 4D98A 2WZCA 3ECAA 3VTAA 5M2QA 1WETA 3WLJA 1QRSA 4ZJZA 2Q9BA 3FYUA 3QMPA 3WXMA 1QGZA 3KD3A 4YR7A 2IE0A 2I78A 5GJWC 1O77A 2I9KA 1HK7A 1YJCA 1QYIA 2NU8B 4MUAA 2AFHA 2BHRA 4TVSA 4YRRA 3TRFA 5GGXA 3KSMA 1EXDA 4GH5A 1OGYA 4FSHA 2K2QB 1M6YA 1NLFA 5HA5A 4ZWNA 1I2BA 1HFKA 3P9NA 1U9IC 4HBGA 4IYJA 5KNDD 2O8CA 2G80A 4KXXA 5EQDA 2HU5A 3S68A 4KC0A 2NTNA 3I09A 3OQIA 3TQQA 4IJWA 3NIFB 2PY6A 1EFDN 4HDRA 5TARA 4E3ZA 1YZNA 3HUFA 5HHTA 1W36C 1JAXA 1L8AA 1NSFA 4YHHB 1Q7RA 3GR6A 3EF3A 3HN7A 3RJZA 4ZO7A 1Y3CE 2YH2A 3WLIA 5LDGA 1CF9A 3GMSA 4CM4B 4ER7A 4C2TA 3L1HA 2G71A 2YIJA 3MJTA 3DXXA 5KNBD 1Y7PA 2GK7A 3K1AB 1OIXA 1V37A 1O97D 1V7CA 4X63A 5BSUA 1CQZA 2EFDB 3T9EA 3WLQA 1ZOSA 1ETHA 5KU7A 3CSDA 4HEQA 5LOVA 3T35A 5BP7A 1L4LA 2DPYA 1FNSA 3WRYA 2Q07A 4BAGA 5LJIA 2HY7A 1W59A 1W93A 3ECSA 3MBIA 4IKEA 3K1YA 2XBMA 2ZIFA 2UU9B 2H1IA 3NZEA 5TJ9A 2GKSA 1L7EA 4NJOA 5FWYA 5LBIA 3FGNA 3U44B 1PFWA 3I5UA 3GJTA 4JJKA 4KB5A 1E1CA 2WE7A 2CV2A 1B0UA 2XB8A 3A9CA 4DM3A 1JI3A 1BE1A 3PKIA 4I36A 1U2DC 4RTPA 2G07A 3FG9A 4GMGA 5ICGA 3L4SO 3IEPA 4G1MB 4HNTA 2BGIA 1X1QA 1EZ4A 3BMOB 3V80A 3HV0A 1YB1A 2O23A 2Q5IA 3QU7A 2OBLA 1PR9A 1YB5A 2OVFA 4TRJA 5BRNA 4AICA 1FF9A 3HUEA 2I8AA 3RVBA 1ZSNA 2RHRA 3UWPA 2BH2A 1IUNA 4H17A 4MSUA 3RD5A 1N3LA 5AVVA 1O9BA 4L74A 3MCUA 1JHQA 2GF0A 4OOEA 5JNUA 1JQLB 1LBTA 1T6YA 5BSKA 1RPTA 3LPNA 3OQMA 3O0DA 4DSUA 1ZIOA 3TJMA 4UTVA 4DJDC 3OIFA 1E9AA 2XNDA 5DV9A 2GZAA 4OHVA 5D01A 3URMA 3WG9A 1MOZA 5H80A 1YRHA 1TMGE 4ND2A 1VFNA 2IKSA 4C0JA 1LZLA 2ZJ6A 2AFHB 1FYXA 2MHCA 3DE6X 3PT5A 1RPNA 4GEKA 1FA9A 4FEEA 5ECGC 1E6MA 1JBKA 3RARA 4YMUA 4F8JA 4OP3A 3CXRA 3EWNA 3DT8A 1N9GA 1V3UA 4E33A 3BH7A 3ZWYA 5FDFA 5IANA 1BWQA 3A1DA 5A1JA 2FG7C 1XA0A 5EQJB 3TZLA 3DP7A 2IL1A 4OMUA 2YJ6A 3EZ2A 3DFKA 3L0SA 5AVZA 3TZBA 3GRKA 2DULA 1CZOA 3WYAA 1N6OA 2Z5VA 4K88A 3PDCA 1XAGA 3LPMA 1PZGA 2NG1A 3D6AA 2VXOA 1NC3A 5DCLA 2HDNB 5KPJA 1KAQA 4DV1B 4YJ3F 1JE1A 1NVAA 1E79A 1ZLYA 3BAZA 3I01A 1CJSA 1GRNA 2FCRA 3BE6A 2PRSA 4ID3A 3RK1A 1CUZA 1N8SA 3ZDAA 1HSZA 1U81A 2Q0SA 3NAQA 5EYPB 4B5KA 4DG5A 2XCTB 4NVRA 2VCHA 1HKHA 4XGRA 2ZYAA 4GYKA 5AQ1A 2P40A 3R5FA 2QP9X 1P5RA 5JV5A 1UXKA 5DVZA 4UE2A 4CR7A 1JKJA 3L43A 3PHBE 5TSDA 3SE0A 4EHDA 5JNLA 1U3VA 5EVCA 1IYZA 2GGSA 2SKCA 2ZUVA 3OLZA 1OREA 3OU2A 4G36A 2P8SA 2M6SA 3IPLA 4HYTA 5FWYB 1RZRA 1DC7A 1BVHA 1YJQA 1YQ9A 4AP6A 2WBLC 1D6SA 3HXMA 3VC3A 3UYLA 4YK7A 3ET5A 2AQ8A 2W2LD 2J3MA 4YPFA 3TO5A 4PQGA 2A1UB 2QMYA 1DJLA 3VR5H 3OOWA 5B3KA 4IH9A 5DHUA 2AR9A 1DO8A 3ZVKA 4UFOA 1QFXA 1WSBA 1UKAA 2AQKA 3COPA 3U3XA 3UVEA 4MR8B 4Z1MD 1ATZA 3IOYA 2IZOA 3QBTA 1P0PA 3PXEA 1JHMA 1Q44A 3GCZA 3DVSX 1PD0A 2WAMA 3AR6A 4JV5B 1JR6A 3DM9B 3DLAA 3FR7A 1IJBA 4YMIA 1G2OA 5G0VA 4DHEA 5K0ZA 2V65A 3S1AA 3ZHUA 7MDHA 2A9OA 2VF5X 3GRZA 3QJYA 1PK9A 3NNNA 5C4IA 2CNKA 1LPNA 3GFFA 2HPVA 2WLTA 2AZTA 4PX2A 1T43A 4UVGA 2HIMA 5CFPA 3EQ7A 1WLYA 4YRFA 4EW3A 1NQWA 2XZTA 4C06A 4EG0A 4EENA 2XQJA 4N0PA 5JE8A 1UJ6A 1BIFA 3S0JA 3V32A 5SV2A 3W8DA 1NR1A 5TC4A 5BMVA 4NJMB 3TDKA 3Q7QA 3QVVA 2FWPA 1NVEA 2RGNA 2O2CA 5CGQB 8OHMA 1UPAA 2OWDA 3GMIA 1MOQA 3TB4A 2DC1A 3WYCA 2ZM6B 4CF4A 1JJIA 3VDQA 2ID7A 1LF5A 3LFTA 3PC7A 4RSMA 2O1EA 4YCSA 1KMQA 4AQDA 3JASA 4FEYA 5CFZA 5LD2C 3AJRA 4B73A 3ED1A 1VZ2A 2YFKA 4MA0A 1ZKMA 4DLZA 2YDYA 3TW6A 2GZ3A 3TUZC 1GWNA 3Q2IA 1KZ4A 2HMAA 3C97A 4Q12A 4C20A 3IP6A 4LVUA 3ZDFA 3TZ6A 4AJ2A 1DBSA 4G5HA 1SAYA 1CY4A 5E3JA 3CEAA 1QAMA 4HGOA 3O75A 3QLUA 1WXGA 4WFKA 4ZQGA 3TCNA 5JASA 4G84A 4WKOA 3I4CA 5FWXA 5B12A 4GDFA 2I66A 3TNFA 1M0WA 1E3WA 4X1YA 4G0XA 5B1SA 4TXNA 5EWJA 4X20B 4D26A 3A9WA 3B12A 3Q88A 2I6QA 4FEGA 4UEJA 2R1VA 1MUUA 3ZGNA 4WXEA 1PJ3A 4AJKA 2XJ4A 2GD1O 3UGKA 3Q3EA 5HXAA 4AKHA 2RHDA 4IUCS 1QGOA 3OETA 3O6VA 4FYJA 3G5TA 3W9YA 4BS9A 4B83A 3O92A 3CVWA 1KI2A 1S96A 1S6YA 3CF4A 4IIDA 1H93A 3K35A 3RI3A 1CQIA 1E1KA 4HCJA 2P62A 4ITVA 3T4UA 2X2PA 3OOJA 2HO5A 2H3EA 3FNRA 2QUZA 2R4UA 2I3ZA 4BV9A 2XXJA 1JFVA 2B4KA 2KS6A 3MPUA 1TIBA 2CXXA 4FFSA 4L02A 3P4YA 4QOFA 1SXJC 3PQ4A 4KPGA 2V7TA 3LY5A 4R3WA 2I6GA 2RARA 2I1WA 3GDGA 3OMLA 2DLNA 2FN8A 1GT6A 1T9GR 2VHYA 4FQ7A 1C8LA 1DP4A 2EJCA 2PBLA 2ZTMA 3GNTA 4HVLA 2ECFA 3K0CC 4P9NA 3N9IA 4F92B 4IQ8A 4KAFA 1QK4A 3K0BA 3BBLA 2QG9A 1DO2A 4Q39A 5GZ1A 3N28A 4HB3A 4IZOA 4NBSA 1DAMA 1RWVA 4YNBA 1VJDA 3OM8A 1URPA 3EULA 1OVMA 1Y34E 2WJYA 4Y1EA 1EJ2A 1ARZA 4UDYX 2BEUB 3TI9A 3TVYA 3NBZC 2Q4BA 3IVCA 1Q1AA 1UAGA 5CU7A 5T64A 1CRPA 2HSJA 3QMWA 1XAHA 3QUTA 3HCNA 4Q01A 2ZE5A 4TKUB 5FYDA 3ZZ0A 5LQAA 2JI7A 1EX9A 521PA 1DLJA 4QJBA 2VUTA 3N8DA 5BW8A 2LR0A 5FLEX 5CB8A 4LY3A 1K27A 5HM8A 4KZKA 4HF7A 2DBYA 3LCVB 4CKBA 2PSSA 5K01A 3HXPA 3TRIA 4Q4HB 2NU6B 2C8VA 2QVLA 4ZT5A 2ICAA 5E6UA 2BJHA 4RF2A 4NZZA 3VDRA 3BDIA 2N9UA 2OCXA 2YXPX 2FPIA 2OV3A 3DFMA 4DMKA 1QC5B 5KSWB 5FADA 2Z5LA 3STXA 1OWMA 1CQPA 1WSWA 1YZTA 1ZGZA 3FWPA 1XLVA 4DMMA 2H1OA 1EP1B 3NC4A 5CTJA 3TIIA 3H8VA 5IW8A 2D62A 4D5EA 1RNLA 3V3KA 4YUAA 2PGAA 3QLJA 2H5LA 3FWKA 3MT8A 3DZBA 2ADMA 1XLUA 1T3SA 1QYDA 2PXCA 5K1ZA 5ITZA 2E4VA 3VUFA 3BREA 5TY0A 5LB2A 1HQYE 4EFDA 3B3GA 1U94A 2P0AA 4IUDS 5KYUA 1VDZA 3U2QA 2Q5OA 2QL7A 1GCIA 4UXJA 4YAUA 1E20A 3RVSA 2GAIA 3C7DB 3IT2A 1L5KA 3F96A 5LU8A 1FFEA 1Q2UA 2WC1A 4X65B 2P9FA 2NUAA 1U8ZA 2IS6A 3NWEA 3CVJA 2WU8A 2D5LA 2GA9A 3OJWA 1KMHA 3AMVA 4PG7A 2AJTA 4MIOA 2FOIA 4JYMA 3DLTA 2CFIA 1ZD3A 5IDWA 1R27A 1MX3A 3SN6A 3X44A 4F9FA 1W6RA 2C92A 4DC9A 4LYAA 1OR8A 1ZPDA 4J91A 3I8XA 1XZEA 4B8WA 3N8GA 1TVMA 1Z0KA 1XDBA 3ACBA 3R2JA 1EK6A 5F2OA 4J7CA 3HU2A 5SY9A 4B34A 1QIHA 1V7ZA 2OZLA 1PTKA 3IXLA 1ZJ5A 2PEZA 4RF4A 3RREA 3JVEA 2BGLA 2F90A 1FFSA 1N5LA 2OK8A 4WVFA 1XVAA 2J85A 4Y2HA 3CVYA 5HFAA 3KJGA 1HFWA 4LTMA 2PIDA 2R7LA 4A5SA 4EA9A 2HV9A 1CUCA 3KTAA 5HK9A 5ELXA 2ZJYA 1QBKC 4JNKA 2LKCA 2WVGA 2YYYA 3MN1A 3RUHA 2NVBA 1N2GA 2PPLA 4KI0A 3EVEA 1WKCA 1NVBA 1TTTA 3CRVA 3HLKA 5EUBA 5JD3A 2JATA 1M1YE 1L5FA 2YW2A 2JANA 4AYTA 4YX9A 2W9XA 3Q7EA 3RS8A 2CFOA 4EPWA 2HIHA 4GX2A 4IICA 3A04A 3QQ5A 3TM4A 2QA5A 1XVVA 1TYDE 2FPIB 3ZK8A 1EVEA 4LI3X 4X54A 3ZLUA 1K5HA 1CJCA 1DVRA 3WGMA 2B61A 3X1YA 4ZQHA 3ZD6A 1XHFA 4DNXA 2BMVA 2FPMA 1YONA 1UDRA 2WMOB 1N57A 3QVWA 3WMRA 4L15A 5JMWA 4U7DA 2IH2A 4Q82A 1QP7A 4GL2A 3NOXA 5FPSA 2HUNA 3JZMA 2YXDA 3GRUA 5LQSA 2WJJA 3T5GA 3U1BA 4C29A 1F3LA 4PLVA 3DHYA 5CW2A 4FMCF 2BFNA 3M1LA 1B2RA 3AZPA 3KB6A 3WQHA 4CR8A 4XLZA 2YZNA 1Z36A 2PLFA 4MICA 3A9SA 4A92A 1I5RA 4ZMBA 4IDCA 2PH1A 3QVKA 1GG2A 2I03A 4QGAA 1F6BA 4RELA 4Z4HA 4R05A 2HGSA 2VUIB 5J63A 1CJBA 4AVYA 4LQ4A 3HN2A 5AXBA 5I7EA 2IOFA 1L4YA 3L7MA 4I7EA 2P2YA 4ASUD 2C59A 2ZKIA 5BNIA 4QLBA 2IPNA 3FJ1A 4L22A 4IFEA 3RIYA 4P8RA 5GJVC 4QPNA 1YBAA 4BO5A 3CUTA 2AE2A 4LHVA 3EXFA 3SF8B 2G36A 3LCJA 5TXGA 4DQUA 5JCOC 3KSBC 3JQBA 3DBLA 1GKLA 2R8BA 3IEUA 1B1AA 3LI2A 3NBUA 1P2UA 5E2AA 4PLWA 5IKXA 4W9MC 1Z18A 5H16A 2UVPA 3FPSA 5FNZA 2ZT6A 4KQGA 1UQTA 3I2JA 4CV3A 3E1KA 3AK4A 3NLLA 3BJEA 1HBJA 3MZ0A 4UHHA 5E2BA 1R8SA 1LV8A 2GBLA 1B4DA 2C5SA 2CLIB 4XE5A 5B1IA 1NLMA 5K3FB 3FFBA 1QU3A 4LYHA 4CCYB 4GMDA 3SZOA 4IZIA 1Q12A 2G25A 3ZWCA 4C43A 3M4XA 4B3IA 1XTUA 4KPYA 3K16A 1NJ6A 4CN8A 4G89A 4IOKA 1POXA 3AOGA 5C18A 1X77A 3KTAB 5DCWA 2KX7A 1F1BA 1YE3A 3AUSA 4RLSA 3X1XA 2LPMA 1UPXA 3HGQA 4BBPA 1AG9A 2QRQA 3RSFA 5ER9A 3NHPA 4YRMA 4YRAA 4ZZ3A