1GRCA

Crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
193
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(formyl)
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
publication title Crystal structure of glycinamide ribonucleotide transformylase from Escherichia coli at 3.0 A resolution. A target enzyme for chemotherapy.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 193
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1992-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1grcA00
3W7BA 2GARA 4S1NA 4YFVA 4R8VA 3Q0IA 3AUFA 4ZZ2A 4ZZ3A 3O1LA 1NJSA 3NRBA 5CJJA 1RC1A 5J9FA 3DA8A 4PZUA 1C2TA 4ZYWA 1GARA 1FMTA 1GRCA 1CDDA 1RBQA 1RBZA 1RC0A 4QPDA 4EW3A 3AV3A 4EW2A 4ZZ0A 3OBIA 1CDEA 4Q12A 4QPCA 4ZYZA 3GARA 1ZLXA 1ZGHA 4ZYYA 1MEOA 4TS4A 1C3EA 3TQQA 3P9XA 4ZZ1A 1RBMA 1S3IA 3TQRA 2YWRA 4ZYTA 4ZYUA 3N0VA 4TTSA 4IQFA 4DS3A 4ZYVA 1JKXA 1MENA 3DCJA 4NV1A 3LOUA 1ZLYA 2BLNA 5J63A 4ZYXA 2BW0A 2CFIA 1MEJA 4YFYA 1RBYA 4TT8A 4EW1A 3KCQA 2FMTA 1YRWA 3R8XA
chains in the Genus database with same CATH superfamily
2N3ZA 3AUTA 1JFLA 3JQFA 4HNRA 3ZQKA 3ZX5A 3EMBA 5CDYA 1R4ZA 3THWB 1BWSA 2JFZA 2DQYA 2HH9A 4M9CA 4M8KA 3OIFA 1I6MA 3U9SA 2JARA 3C1AA 4C0JA 5JJLA 2G06A 1Z75A 3K9WA 3QKSA 3PVCA 1SY7A 3WB2A 1BSVA 2BEWB 5D00A 1PG2A 3WDSA 2IC5A 2GAJA 3UYLA 1GKIA 1ODTC 1G19A 1NC3A 1P60A 2GPYA 2YTZA 3R9IA 4B7ZA 1NKTA 1WKCA 2CLFB 3KLMX 4JT2A 1NUSA 1OX5A 4G1VA 4EF4A 1DWUA 5I9IA 1Z26A 3U1BA 2DSNA 2Q5OA 4A2CA 3UA4A 4C4PA 1QR6A 3CONA 5BSKA 3ZKWA 4WKCA 4L72A 1HQDA 3KT0A 1E9BA 3OPYI 1XEWX 3PC6A 5JCOA 4YP5A 4U0KA 3L1KA 3IBGA 3L04A 2I1LA 2QX4A 1Y89A 4HZGA 4DJEC 4RQUA 3RVJA 3U9LA 1VCOA 1SD1A 4MRMA 4D9IA 1MTZA 3A7EA 5JSUA 4BE9A 1DFGA 1YL6A 3TPFA 1E1CB 2FEWB 3FPEA 4KO3S 5KINB 2W83A 4QJIA 2FA9A 3SYLA 1TKBA 1YTUA 1RRMA 3I34X 4LJ4A 3CNOA 4XR4A 3M49A 4BO8A 3QLTA 1Q22A 1REQA 1TCAA 3SC4A 3UB3A 4B0PA 3O1JC 2HU8A 1R66A 5F76A 3HCDA 1QCYA 4LK2A 3FFXA 2EJWA 3AILA 1QHHB 2ZRLA 3FTDA 4MNTA 4MQEB 3DW1X 4OA8A 1GHTA 3SQMA 4ZAFA 3T94A 3I4FA 4B71A 3B3AA 1Q74A 1KJYA 3DHVA 4NDZA 3CVOA 3N2YA 2O2DA 1DEHA 3GEDA 2ID9A 2G4VA 5IAKA 1Y1RA 4K6OA 4ESEA 5DNEA 2G1PA 3KR0A 3D1VA 3ZGNA 1SO8A 3CNHA 3DSRA 1AF4A 2GWHA 3JAWA 4HADA 3AHJA 1JR3A 4MLCA 4NC9A 5I9NA 1FUYB 3QY9A 5DTQA 2QRVB 2WAYA 1HI9A 1T3ZA 2HHAA 4TMVA 5GV8A 3M6IA 2JF0A 1B42A 1ISPA 3BGDA 2F2TA 4UU1A 3ZEIA 3SYKA 1P18A 2W6ZA 2R1ZA 1E18A 1ECFA 4MKXA 4TSFD 4POAA 4F91B 4DQ0A 5FI5A 4B6FA 3U7FB 1JEQA 2X58A 4LRQA 5FA5A 2X0KA 5BYAA 4AFNA 2J59A 3CC8A 4FJ0A 2AQHA 2FZ5A 4H31A 3ZWWA 4S35A 4W1RA 1KDYA 1N6NA 2J6IA 1FOEB 1W4BA 5BVGA 4MHSA 3OY7A 2YWGA 3FNRA 4V0LA 3ETNA 4HTFB 2XKAA 4G9BA 3ACDA 2ZUWA 4YAJA 4DT1B 1PV1A 3VKHA 4UPDA 2Q8PA 2XVZA 1BDMA 1CZNA 3ZJ5A 5JD5A 4NHEA 3DT8A 5JWOA 5IH7A 3BRWD 2G67A 2HIGA 3VNVA 2MINB 1W1IA 3I6MA 3RD5A 4KXMA 1W36D 1Y82A 4POOA 5JBNA 2XOKA 4MI6A 1F17A 1XX6A 3OPYB 4FFBB 3BE6A 1XHLA 2R47A 3H2HA 2AOVA 4JODA 3HHPA 4LZNA 3RLIA 4CMGA 1ZJ6A 4H0NA 1LBEA 2BMVA 5JS2A 4U6QA 1YGPA 2EIXA 4XA8A 3KHUA 4Y2RA 4TLMB 3SS7X 3WRVA 5JAIA 1XJ0A 2EDCA 1B73A 3OH8A 4ICIA 3CUWA 4PYOA 4OXYA 2C03A 2KM1A 4JVSB 4WZZA 3ROXA 5JRJA 1QP7A 2GEKA 1BMQA 4WTOA 4ZGWA 1UIMA 2OGUA 4RDCA 2P2GA 1MFPA 5AVXA 2FP3A 1USGA 2P3OA 4I5DA 3SHQA 3IJEB 5IHPA 3K1ZA 3GX1A 4NYJQ 2CCGA 3DVLA 3T1YB 1DS6A 2B6HA 4U7DA 2V7VA 1H2FA 1A82A 1EUDA 1P7YA 3MGCA 4QGAA 2YWBA 3NASA 5BT8A 4B75A 3DVSX 1ZK3A 1GPLA 3JVIA 2C00A 3DDOA 4MI3A 4EDFA 1U6JA 4ZHSA 2OFWA 3ZE9A 1DP4A 3VKGA 2CZQA 2FPXA 2NADA 4JJGA 2CNDA 3DA8A 5LB2A 4Z4QA 2FZLA 2IELA 4AJ2A 5A9SA 1JLRA 3U31A 3VVMA 1OB2A 1DWOA 4RA9B 4DQDA 4D02A 1I13A 2WJJA 1G8JA 2QJWA 2YVQA 2Y6UA 4CI0B 2ZTMA 2HADA 4ZVMA 1G55A 4G5GA 2AG5A 3QYJA 4NPHA 2YMPA 1YFJA 1YB4A 2ACVA 5H3LA 1FNDA 3JQFC 4IS3A 3RSFA 1H6BA 4ASUA 4UEOA 2WEKA 4P32A 3Q8LA 3R5JA 4GDMA 2BH2A 3R40A 3C3EA 3KTAA 1NVKA 4FMCF 4N5IX 1SU8A 4JX9A 4OREX 4WCDA 3OJCA 4BRWA 3PDWA 1CZLA 1PL7A 3I30X 5ABPA 2IYRA 4K3VA 3QX9A 4UU8A 5A05A 4B2LA 4JROA 1IM8A 3JALA 1F8YA 2FPOA 3TKYA 2JLVA 1YC5A 2HPAA 5L3SA 1E5QA 5LMNB 1VCHA 1GFIA 2R62A 2QMYA 4AJ9A 3WA6A 4MAMA 3WO1A 5KQLA 2FMFA 2P3QA 4TWBA 4KIFA 1BQEA 4M1MA 4HHEA 1VMKA 1RIIA 2VH5R 5LJIA 1FLDA 1S9HA 1JA0A 4IH9A 1IJFA 5DSZA 3TRFA 1PO7A 4XIJA 3DD1A 3QF4B 5HWSA 5IPFA 3H75A 4JNCA 5GJCA 3SICE 1Q1EA 1Z6ZA 3QWHA 3KX2A 3H13A 4CM4B 1ZD1A 2ENWA 5DTIA 4C6SA 4LF4B 1GT6A 3O3CA 3JW8A 4A0QA 3CVVA 1XTRA 3WDKA 2QD4A 1R3UA 3VFDA 3GVIA 4FHZA 3TNJA 1MFZA 2ZUDA 4HH0A 3ZV7A 1UWLA 3PTZA 3P0HA 2IHKA 4DS3A 1PFVA 2ZVDA 3HACA 4D79A 5GOTA 4RQAA 4QUBA 3ROPA 5KSPA 3A2MA 2I78A 3BJMA 2AK3A 2LR0A 4K05A 4D4HA 3IHTA 1LKZA 1ZKMA 1A8UA 3GDOA 4M9QA 4PLZA 2C4VA 2FW8A 3EB9A 5DGHA 1M1YE 5DYIA 1UBJS 3KJEA 1RDFA 3OIGA 4CM8B 2AOXA 4BXOA 4KAXA 4XDZA 3RARA 2ADFA 4BNLA 3E2MA 3MF4A 4V0KA 5I5EA 3DGEC 3Q3CA 4FGLA 5JECA 1OXMA 4YRAA 1SULA 3QUBA 3V5NA 1SHTX 4RMNA 3FUTA 1PJQA 1HXHA 2OXEA 3HUTA 3WGKA 5C18A 1CC1S 2BDEA 3GFRA 3M9LA 3BSFA 3NATA 4LNUA 1SIWA 1A9ZA 1PR3A 2DFLA 1USIA 1PZGA 3RU2A 3AFNA 5F7OA 4O1MA 4AQDA 2VF4X 3QKWA 4M60A 3TLAA 4AKEA 1LQTA 1RWPA 2B1QA 2R85A 3EA0A 4XVHA 3L7IA 1X7GA 1QYVA 4OKSA 4R0NA 3VAAA 3HGMA 2Q3MA 4AN1A 4NRDA 5ECWA 3NIBA 2R86A 4JC5A 2Q45A 2YYAA 4YV1A 1HBJA 4HDMB 4IP0A 3U60B 5GY7A 3EAQA 5MN5A 4D3XA 4Q0MA 4IKOA 1C81A 4WSOA 1LX6A 4P4TA 5BV8A 1HRDA 4DJAA 3BXZA 3A4IA 3RU3A 1U99A 2HF2A 3GZ4A 4NR0A 5B4TA 4JP5A 1O89A 4Y1FA 3N53A 2WA1A 3BZWA 5EEGA 4P4SA 3X2EA 2VAXA 3DUFA 2VP5A 1OXSC 4JBXA 4CL8A 2JK1A 5BSEA 2XCIA 5BVHA 2XUZA 4G1FA 1CR0A 1X80A 2EJUA 3KLPX 2GDZA 4J94A 2QGNA 4QPPA 4WCFA 1KDOA 2I0FA 5ALWA 5TPZA 4YALA 3B8HA 2Z4SA 4GSLA 1DT5A 3ETGA 2Z2KA 4R1OA 5LD2B 1W46A 3HJFA 1JEAA 2PRZA 3I5XA 2JI9A 4R9UC 4Z2YA 3AF3A 3ILXA 3F47A 1QNLA 2LXNA 1VG0B 2BSXA 4GC5A 1S2NA 2FPIB 1NSFA 2HWYA 4GM4A 3IEPA 4HLDA 3GN1A 1PL0A 3FG9A 2WY2D 1FYDA 2FZWA 5LCXA 1V5EA 3UICA 4QDXA 2E21A 1FCJA 1GLNA 4HR7A 3FKQA 2HK7A 1EFLA 5B12A 1FDWA 1Y8CA 3NT4A 3ZTWA 3LW7A 5DLYA 4KE9A 4RLFA 1RYYA 4JUFA 4U1RA 3DNPA 1A71A 3LCRA 1DINA 2K87A 2VKTA 4CR8A 3RI3A 4LA4A 1XQ9A 3PQDA 5KWVA 4WOCA 4JLMA 4I2NA 1A9YA 4M7PA 4LDPA 1KU0A 2A5YB 2ZWIA 5BW4A 4FN5A 1PNOA 3EEYA 2B5VA 4FYKA 4BO9A 4ZHQA 2J0VA 3G79A 2DMRA 4GKAA 4LRUA 2XKBA 3JR3A 3TPCA 2B36A 5F7ZA 1IG3A 3AERA 2PUJA 1A7AA 1UC8A 2C3PA 5FWDA 2WWGA 4MPJA 3U4HA 2W58A 5C3MA 3C6BA 2JD1A 4MW2A 4G23A 4DWVA 4R69A 3P71T 3RTEA 5IKXA 4HLQB 4UOEA 4V2UA 1XP5A 1W0KA 3MYYA 4WBXC 2BM1A 2CNWA 4CJXA 5H1YA 5BWCA 1E89A 5D5HA 1JZSA 2RDMA 3EZ6A 4PYKA 4TKMA 3W6ZA 1NI4A 2BH9A 1ZJ4A 3RS5A 5KSWB 3KUDA 4LXIA 1SCQA 1E2GA 2YJNA 4OFZA 4E33A 1DQPA 5E1MA 1P2UA 3E27A 1OPRA 5BN5B 2H1FA 2QU7A 4BZQA 3R20A 4MO9A 4L22A 1N5OX 3SQOA 1L3CA 1J4AA 2FWAA 1VCNA 5FOSA 4JEIA 1WRBA 4KIUA 4JI6B 4KBGA 2VZEA 4O1HA 1QOPB 4M0MA 4MQ5A 2WPDA 2QUJA 1FVHA 4IHJB 2I2AA 3DPSA 1EFUA 5D5PA 3FGOA 3N70A 4K8RB 2XQJA 5JTUA 3VMFA 4W6ZA 1Y5NA 4O29A 1JQ3A 3O1IC 3DDSA 3NOOA 1GRRA 1MQ8B 3NI2A 1WKVA 2REQA 3IE1A 3MJRA 4OQLA 4CWAA 4WK0B 2AJBA 2C5AA 1OA0A 4HXGA 5T6BA 1KRWA 2B1JA 1G8GA 1LSJA 3FGZA 3HFRA 1U1DA 3UMVA 2WSMA 3C70A 3CVUA 3OE1A 4BYGA 2ONKA 5FUMA 3GA0A 3QFTA 1SWWA 3I5MA 2YWEA 1Q0QA 1TI7A 2BR4A 3S1AA 1EIZA 2P75A 4YJKA 1AZLA 2VT7A 1WLYA 1VHJA 3O47A 2ORIA 3O94A 4GQAA 5DWVA 2C9YA 4ZT7A 3G5MA 3VJLA 4QD3A 4RGBA 1QKIA 2I5PO 3MSXA 1OKKD 3CLUC 3HXOA 4XB6B 5DNWA 3C48A 3THXB 2CMFA 3DZDA 2ZJOA 3IMEA 3OO0A 1TO6A 4ZQHA 1DXOA 2YYSA 3DXZA 1L7RA 2IYXA 5EUQB 2ZS7A 5A5VA 5U1PA 1XOIA 4GXTA 1JS1X 1KQGA 2GO1A 1C0LA 2PGJA 3JARA 4Z9FA 3O4RA 3U56A 4UM5A 3N5KA 3RYCA 1NVAA 3Q3VA 4FPXA 1DEOA 4CV3A 3GRPA 4IGFA 2W9XA 3H11A 1MZVA 1JBEA 4IV5A 2ONYA 4JFAA 3U0BA 5KTKA 1PJSA 4I55B 1GCAA 4RK1A 2JJ1A 1BEEA 4TRRA 4GPD1 2H4HA 2AHRA 3BH7A 1ZL0A 2B34A 3NNSA 4HDNB 4DYVA 3E8XA 1E62A 2J9GA 2WWFA 4M87A 3P4XA 3UMRA 3NH6A 3WK6A 3Q9UA 4E3ZA 3A2LA 5KOIA 3H4IA 4OIFA 1R50A 1T5SA 4A6EA 4OI0A 2B0CA 1AN0A 1Y3IA 1FE8A 2YXBA 3QLUA 1VLLA 4RY0A 3K8YA 2FUCA 2CKMA 3VSCA 1R0LA 4F3CA 1XRMA 2ODNA 4LHSA 5PGMA 4D92A 5BWLA 4UDOA 1M2VB 1GZ5A 2LGJA 2R8PA 3PQ8A 2GJ8A 2EKLA 2P4QA 4RCZA 3ZQUA 1EGMB 3KT6A 4KQCA 1QUFA 4F5EA 1RJ9B 2LDXA 2NYUA 2IYUA 1E6UA 4N0QA 4ZXFA 3CZ4A 2XT9A 2QRZA 5HW0A 3C43A 4BFSA 3KQQA 3R6TA 4DCOA 2ZUEA 4IJUA 3S55A 1OFIA 3A9RA 4HB0A 3AVPA 3S2SA 1W88B 1AHHA 3O93A 4DM7A 1CQZA 5D3KA 3RU9A 2JGDB 4OATA 2J7PA 2C3YA 3AFIA 2IDJA 2O2CA 5AK0A 3KQKA 2ESRA 1M6WA 2PVPA 3VPBA 5GAJA 2IV7A 3WIOA 3IUJA 1X6VA 4R2IA 3UXYA 4N49A 8ABPA 2ZXUA 1E9FA 2EWWA 2R7NA 3AR4A 1ZVQA 5CT5A 3ZXYA 5AR1A 1JHDA 3RK1A 4C0XA 2FQXA 1YT5A 4GMDA 4OFXA 4R5HA 4WCFC 1ISJA 2P9HA 4FFVA 2BHNA 1WIWA 1S8NA 3G17A 4J75A 1ESCA 2EKQA 4M0DA 3TVDA 1G4AE 1BNCA 1PTKA 2J9FA 3C0KA 4DA7A 3LWDA 3H5VA 1CULC 2Z5VA 1DZ3A 3GUUA 5G4KA 1UZNA 1FF9A 4NCBA 1YDHA 1MJFA 3GEIA 5EKDA 4CPDA 4LY6A 2PX2A 3FHJA 2OKCA 3UEOA 1T9CA 3KOOA 3BHIA 2DJIA 3Q6IA 3U3RA 1H0KA 1ONNA 2NU7B 1WPQA 3BKWA 2V55B 3NBQA 2PXCA 4TKUA 1T9HA 3T7JA 4ETNA 3SZOA 4N7MA 4KN6A 2J45A 4FC6A 4CHGA 1X2EA 3GQBB 1PJRA 1R0RE 4XUDA 2P8JA 4C05A 3H1EA 1PT6A 2W8BB 2ZLBA 3AVOA 3LRPA 3WWPA 3Q0IA 1RXVA 2BR5A 3OMWA 1P62B 1GYQA 1FZTA 3PQCA 4X24A 1S01A 1H0SA 3CH7A 3PHLA 4GP6A 1N36B 1OYVA 3O4GA 1N25A 3RYFB 4UULA 4A6DA 2H4FA 3CUVA 1ADJA 5DSTA 1SMKA 4KN9S 2OD2A 1RQPA 3I39X 3JAKB 4XWTA 5KX5F 3VHQA 1D3AA 5DSXA 1AO0A 4OFWA 4CT0A 2AKYA 1WY5A 4FFSA 3L93A 1XD9A 3DL2A 3JQAA 1UP7A 4FYJA 4HWTA 4JBGA 1X19A 2PH7A 2Z8YM 3UMFA 3TTUA 2VJAA 1CR4A 4H77A 4N6NA 4PNZA 4XJSA 5F77A 3WLPA 5JVDB 4E2WA 5GADl 3M82A 1Y5IA 3MFYA 1WR8A 3NHZA 1P1IA 2IF0A 3AC0A 4DLNA 4GICA 2F55A 3CX8A 4N47A 1XT6A 2X4GA 5KTSA 2FMUA 4J9VA 1G8SA 3BE4A 1Z4NA 2QUBA 5KNBA 1AQNA 1GKLA 2AH5A 2WKPA 3WLIA 2GZ2A 2HDOA 5CB4B 4PHHA 4F4HA 1QP4A 2OPHA 3BDAA 5EJ9A 1H93A 4RSGA 3SR0A 4BE7B 2BCJQ 2AD5A 3LQ1A 5FR1A 1UPUA 3KEGA 4UBJA 4ALIA 3ITKA 5AI0A 3DZFA 1DWPA 4BFYA 1XVAA 2OZVA 4BUZA 4D99A 5B7GA 3D6TB 4R2HA 3PP8A 3L8FA 3W06A 2WHYA 1T5BA 4DYDA 1AV7A 1II8B 2XTMA 4YIHA 4DLKA 1T6YA 1NU8A 1S1CA 3AJ9A 4MUBA 4JSYA 5GM1A 4AB1A 4O4IA 4YRNA 2K7FA 1NC1A 2VEDA 2QTTA 4EPWA 4ERXA 3Q3IA 3PXCX 1DCMA 1I1QB 1QZ3A 4FMBB 4H1HA 2ID8A 3HVKA 5K6AA 2QLFA 4PSVA 1VHTA 1L6IA 2N47A 1A1SA 2XCQA 5IABA 2X41A 1W9HA 3B70A 5AXAA 2FJUA 2MWMA 1SZDA 3RSSA 2GZ3A 1HM5A 2PL5A 2PGOA 5IUNC 2YV3A 1X2BA 2WHXA 5ELLA 2Z5GA 3R7WA 3DE4X 4S2UA 2WQ7A 4DMUB 4PYQA 3TTXA 4BEWA 3KZNA 2DUUA 1JXAA 2QMZA 2WHRA 1GJRA 4LV8B 3GLTA 3RYIA 3KYDB 5DU2A 4MAFA 1SHUX 3X3HA 4G36A 5LMZA 3BA6A 1ZEJA 3WKEA 1XL1A 3TLGB 4GX5A 3EA4A 4C3ZA 2XYPA 3N6VA 2E6KA 4A0FA 2XBMA 1FMLA 4C0BA 2QQGA 4A10A 4JI4B 1X1DA 1W4LA 2JFUA 4GS5A 3VPDA 2HWWA 4QNMA 4A73A 3AH8A 4OQQA 4ND6A 1I3LA 1XTVA 4TLLB 2QTLA 4OJNA 1DPFA 4G0VA 3HXLA 4NU6A 3DZ8A 4ZOEA 4HBZA 4OYHA 3WLKX 3RHFA 4WXRA 4LZAA 1C7RA 1EM8B 2IHTA 5AHKA 1JHRA 4DEVA 4URWR 3PQ2A 1WXHA 4U9IS 2XGJA 4U02A 2FUG6 3QLUC 3ZD9A 2CZCA 3QITA 1ADGA 2REXB 1M2WA 2Y1KA 8OHMA 1ESZA 1FP4A 2AUMA 1DARA 3DS8A 4Q9DA 4DKXA 5AQ1A 3CLRD 1NJ6A 3ORYA 1ZU4A 1ESEA 4WECA 5F64A 4F9GA 2NXJA 1MH1A 2Q41A 4FZRA 2FEMA 1WZUA 2DQKA 1VLVA 3DHEA 1I3KA 1A2QA 4JHXA 4C43A 4XI9A 2QJTA 4HKTA 2IOHA 3U7QB 1JJAA 1SKQA 2HREA 1ZAKA 4QICA 5BO5A 3G6WA 2FZEA 1PNQA 4QNRA 4KXFB 3W5DA 4PTZA 3I9LA 4TTPA 3W7VA 4LSZA 3QVKA 2K6GA 4KPYA 5EZQA 1PZFA 4EKNB 1ISGA 2XE4A 4YAUA 1YVEI 3SC6A 1D8TA 1YGYA 2JAUA 1N1GA 4Z0NA 4P4UA 4OP2A 3URKA 4H6PA 4E5PA 1U5BA 2HDWA 3ROEA 1PEYA 1SQFA 1TM1E 4UXJA 4F2DA 4MA5A 5TF4A 3U80A 2IOFA 1DBWA 1CQPA 3KVVA 4OQEA 2Q0HA 3RTAA 3JPYA 3LUBA 1DTWA 1G4HA 1XK6A 4EHFA 5GZ3A 4MYUA 1QH8B 1AU9A 2CLMB 4B31A 4X62B 3A9VA 3ZZTA 1C2YA 1OLSA 1QH9A 1KAEA 3TOXA 3NAQA 5J5AA 1FBNA 5EJ2A 4F85A 1QHYA 3I37X 3RRBA 3ILSA 1UPAA 2R66A 3RGGA 4PSDA 3CLSC 1RJEA 2OWEA 1KKLA 2BV3A 2F90A 1KBZA 4KMMA 1UKYA 2GYYA 1HZJA 1X92A 1E9SA 1ZUD1 3FTQA 2I2FA 4RE6A 4J1QA 1A9XA 4QG7A 3LKDA 4JP8A 3MTEA 4X85A 2XZOA 4L4ZA 3I0MA 2VH2A 2YN0A 4D8TA 3EWIA 3FY4A 3ROMA 2BKXA 2V54A 1LW6E 3VGJA 3RLFA 4U8HA 4YLEA 3SVZA 3GRVA 3TQQA 3LKBA 1N6KA 4MP6A 4D43A 4MW0A 1ZC4A 4H7IA 4Q6WA 2WUWE 4MR8A 5E4FA 1UBCA 4YJHA 3GMSA 5HA5A 4DN6A 2PZAA 4J0KA 4KR9A 5DRYA 2GLXA 1X1AA 1UPCA 3I6IA 1ABFA 1G21B 3WLMA 4DR6B 3KE8A 1GA6A 2M2IA 3GJ8A 5HTKA 5KMGB 1POXA 4EX6A 5BSUA 1NG9A 2HTEA 4AXBA 1XEXB 3AFGA 4D4KA 4KQGA 1KK3A 4JFRA 1SIUA 4FFLA 4B85A 2IV2X 4U2FA 4QULA 1AG9A 2VYND 1U4OA 4DV5B 1E79D 3K0KA 4OG2A 4RVHA 4EFNA 3OJLA 5ANRB 3SBEA 4JP3A 2IX3A 5FAKA 4YK7A 1CHNA 3CUSA 4UMEA 1QK4A 2ZTHA 3L6CA 4EDHA 1W6RA 3W9SA 2HD4A 1J49A 4L4YA 2FN9A 3OPMA 1DELA 1SRRA 1WV0A 4AZSA 4RPHA 1H3NA 4IUCS 5FTNA 3DEIA 1FQKA 1SHZA 5DJ5A 3WL5A 2R8EA 1FMJA 2CDRA 1Y7LA 2P5TB 2PUTA 3OAAA 2YQZA 1V41E 3V8RA 2VDJA 2VDRB 1YRBA 1RJWA 2Q9UA 2XT0A 4GZMA 2QY6A 1JG3A 1PNVA 4Y6RA 2QD5A 1XTQA 3GWGA 3DEJA 4NS1A 5K6AC 1HDEA 4FBLA 1RKVA 4PFQA 4BNUA 5HFJA 4RTSA 3FLEA 2HJ9A 4R8RA 3U13A 1GPBA 5A5FA 4IGKA 3AO0B 4H7FA 1UMDA 1YWGO 4JT8A 3TYXA 2CYCA 1DG1G 1ZH8A 2NT4A 4G6ZA 2HO4A 5A3VA 2FRDC 3L77A 3OJXA 3TNYA 2J4DA 3PFIA 3ACBA 1H4SA 1WAMA 1ZO8A 4XQGA 3T7SA 3QQ5A 3TLCA 2C0PA 2B2NA 4RKFA 4MV3A 3B7GA 4PLHA 4WUVA 4DLYA 5AVTA 5HGXA 4DR1B 1QM5A 1V8ZA 3VH1A 1N2IA 1XTSA 1VKJA 4ISCA 4KZKA 2QN3A 3BTUA 3HH8A 4JR2A 5EP2A 4F1JA 3R41A 5F1PA 1E9EA 4PVDA 3WWZA 3RUIA 1CUCA 3L6BA 2C59A 4HSEA 4E2XA 5K3SA 3BTOA 5C2JB 2ZI9A 1XDDA 3D3NA 4JS0A 3F8TA 2V97A 2XB6A 2ASEA 1B6GA 4TXHA 1EFVB 3B5IA 4RWZA 2Q2NA 4JB2A 4ZQBA 1JLLB 4AECA 4DRXA 3ME5A 4HYYA 1UJCA 1BEUB 4Q4LA 4TV9B 1KDZA 4Z53A 2ZSFA 2CUNA 1GSIA 4RAQA 1GG9A 2BF7A 1NFRA 3C3DA 4YCAA 5GONA 1OOEA 5C8YF 1M0EA 3GWZA 4O6VA 5BR8B 4UMVA 4US1R 4GI5A 1SIBE 1HLPA 2HT6A 2VAVA 1IY0A 3R0ZA 4RCYA 4E5DA 5KOHB 3ICCA 4J29A 2JLXA 5ENVA 4HNTA 1H3EA 3AUSA 3D3WA 1AKEA 1HE3A 4WZAB 1NE2A 1WZNA 1IUPA 2B3TA 2WZQA 1Z8NA 2YY5A 3FOWA 2BFOA 2RSLA 3L1JA 1MUUA 3EVAA 4K86A 2X6TA 4L5JA 2FWJA 3VJMA 3SI7A 4Q12A 3SXJA 4E6PA 5LP6F 1U8CB 4BAGA 5JPIA 4X8LA 2JH3A 2LIVA 1N9GA 1QB8A 2ZUTA 4EJ6A 3E9RA 2C5BA 3NOVA 4ILEA 1C0KA 3VPFA 4EGAA 5TGTA 3VU1A 1SUSA 5HM8A 1BTOA 5KYTA 4FR2A 4F5ZA 1A1VA 4LFBB 3DBHB 2W6PA 3IAAA 1OH6A 3QEMA 1OC4A 1Z83A 4DRYA 3WKCA 4LTDA 5CEFA 1ULZA 2GEVA 1G9TA 2ZJAA 4HGQA 1V1JA 3V6LA 2CXUA 2QVXX 1IN1A 1R0ZA 1TLTA 2XD9A 4V1CI 1Y4SA 4LJ9A 3T6KA 1TIBA 3LLVA 1YI1A 3IJPA 3I09A 4JLAA 2Y1DA 5J2TA 4C04A 2C77A 2X0JA 2XAAA 1H8HA 4NMWA 5BWOA 3R9WA 3ESAA 1QGUB 2H2WA 3I72A 1S3SA 5KWEA 3WFZA 3HR8A 1N6PA 3GGGA 1UDCA 4CF4A 3T7KA 3IE0A 1SAYA 1HEUA 5FUYA 3UAXA 1RWQA 2O8EA 5CEEA 1JSLA 2ZJ6A 3B1JA 1G6OA 4AN0A 1PFKA 1PKEA 1SXHA 1KZ6A 2O50A 2IFTA 3VYRB 3VZCA 2X6RA 2W2KB 4N54A 2F00A 3BWYA 3NEJA 5F1KA 4A8PA 2GN9A 1U28A 1UZMA 2BGLA 2PL1A 3IPCA 4MYTA 4P38A 3H3JA 3FZEA 4F4FA 1AQJA 2Z95A 3FRIA 4A8TA 5AW2A 5FLKA 1YQXA 2AVDA 4ZXPA 4KDCA 2HY7A 3BXPA 1GRNA 5CA1A 2BGWA 2BMWA 4G85A 2BI4A 4V38A 3F3MA 5EG5A 4RSMA 2AJ8A 4PNPA 5LZ2A 1HNZB 5JCXA 1PEKE 4L4SA 4XGNA 2QROA 3NNDA 3BCRA 1EKXA 4M3NA 1P81A 1QE0A 1CNEA 5AI9A 3AWDA 2N75A 4J43A 4DAOA 2ZKIA 5AJTA 4Q7QA 1KKMA 1DJMA 2NTEA 4JMPA 3GNSA 3D31A 2ZE6A 3UPUA 2A5JA 2NOAA 3KU4A 1U0LA 4RM2A 2B99A 1YBAA 2OECA 4DIOA 1BWPA 4TLEA 3LHKA 1KI6A 5T6MA 1SCIA 3DNFA 3NP7A 4CMCA 3FMPB 3MJCA 3VHXB 3UJBA 4HVAA 1UBGA 5D5QA 4CG3A 5L4LA 1HKUA 3ZY6A 4G25A 5G1NA 3ESRA 4EF6A 2Q6VA 2IHVA 4S3MA 1YZLA 2QLTA 4BPRA 3VYTB 1DG9A 3DFIA 4F9EA 1GYRA 5F73A 1MGPA 1O3YA 1SCUA 2BUCA 3KWFA 2IPMA 1Y63A 3AB3A 3HNPA 2PJUA 4K5QA 1V16B 1Y6JA 4QLAA 3A6LA 3B1ZA 1QYIA 5FTLA 2HHLA 1V45E 3RGWS 3PPVA 4CQMB 1AB6A 3KR1A 4C2BA 1X87A 3KQMA 2O1WA 3MXTA 3P94A 4GYWA 2ZUSA 4RKRA 5ECYA 3V1LA 5LDHA 5E6SB 1QQBA 1Z18A 4L76A 4UNNA 4PY2A 1YTLA 2ZTUA 4WXHA 4DF3A 4LDNA 1Y7PA 3R5HA 3T38A 4V1CB 1CFJA 4EA8A 1OX4B 2P62A 4KN5A 4RK7A 1FVFA 2X1HA 5HDQA 2WYVA 5BMVA 2YUTA 4AURA 4KFTA 4B3HA 3KAKA 3SBOA 5I7EA 1QDLB 3EF3A 4U2CA 1YR7A 4CKCA 4MZXA 5PNTA 3OJ0A 1TQ4A 3OZRA 1G2OA 2H8KA 4GVPA 4Y9SA 3RBAA 4BCCA 1FNNA 1BXKA 1Z6TA 3O9VA 5IYZB 2J09A 1XDBA 3CSDA 1RCUA 5FBVB 2I7VA 3NJ8A 4Q82A 3HV0A 4C5CA 3LK6A 3LZDA 3WYFA 2WW8A 1PGPA 1T43A 4GSYA 4CODB 2VR1A 1EUYA 3RHSA 4DLBA 2J3EA 4YRBA 1X1CA 4MUEA 1L4HA 1ZCJA 1E2MA 4TYMA 1TYBE 1DQRA 1YONA 2EDAA 2VWGA 2Z6VA 3C4VA 4ZT6A 2A59A 3UENA 2I9PA 3EXFA 4HATA 4HS4A 4MRAA 5AOVA 1L1FA 1DKLA 5M5BA 2IT1A 3ZXXA 3WKAA 2J87A 2GCIA 4CG0A 1M5RA 1JKXA 3FNBA 2ZEJA 3AF5A 5BY2A 1ZRMA 3UOAB 1Z73A 3DOJA 2ZQYA 1QOZA 1V5GA 1ZWLA 2YIJA 2WD8A 1QC5A 1CVIA 2UZIR 4GKBA 2B30A 3L7LA 1ZN8A 3I6ZA 1O94A 4U7JA 2C97A 4A8JA 1E3WA 2JCYA 2OR3A 3DWEX 3BH0A 4MVWA 3RH0A 3WRXA 3U4IA 1XCGB 1SC4A 4IQ0A 3DULA 2M98A 4KP7A 3S29A 3HZRA 5I6DA 1SVIA 2DPGA 3LXXA 4P54A 1LF5A 3BX1A 3WBKA 4I9GA 1VMDA 2OCAA 4WA8A 1XNQB 1L1QA 3I04M 1SPBS 3LX4A 1JE1A 4LQ4A 3NKVA 4OBXA 1XI2A 2IU4A 4M0KA 3QBTA 1I4WA 4PYNA 4LVOA 1HTWA 3CT4A 4Q3OA 3T3NA 4F97A 1SA0A 1QVZA 3LL4A 1QTIA 2DWCA 3JQ8B 4L27A 4OK6A 3U7JA 4YASA 1K3UB 3QZUA 1KWKA 1U8YA 2B4QA 4LQDA 1Q7BA 4M8IA 1XRQA 1QH0A 5LP6B 4MITA 3AWIA 2SECE 3K0SA 4D4MA 3O73A 5T3YA 1I14A 1TMGE 3EF0A 4IIGA 5KCZA 1G41A 5K3AA 4UZSA 1OI4A 3ABQB 4B7CA 2QLLA 2UYQA 3WO0A 4MRNA 3N2EA 1TCVA 2FU5C 1QAQA 4X00A 1QTRA 4B6OA 1YJAA 4I8IA 3K70B 4EABA 2ODBA 2ZJ0A 4RZ3A 3SFZA 3ASZA 2DM6A 2OAQ1 4OBBA 1PK8A 3OTQA 1PSZA 3D0KA 4JP1A 4XARA 4YRCA 5EMMA 4ENWA 4ZOQI 2OFOA 3KSMA 3IQGX 1M76A 3VTKA 1KFBB 1O8CA 2NO5A 1J06A 5AKZA 1COWD 1UJ2A 1V0JA 3UAZA 1W30A 5KYUA 3WGOA 4K6FA 1F6DA 1MT3A 5JC8A 4A91A 3G89A 2QJRA 3FMGA 1RD4A 3E81A 3FX2A 1DO8A 2PKEA 1C0PA 2FSVA 2GPTA 3MWGA 1RVDA 4G07A 1ABBA 1BE8A 2B8WA 4GVXA 1RHMA 3CIOA 4BO1A 3UW1A 2WJHA 2OQIA 4IXTA 4F8JA 1TYAE 3UAWA 4FKZA 7REQA 1KWGA 3ZJ4A 4R2WA 2YXNA 4II2A 3DV0B 5JQWA 4IUYA 4F6RA 1U8TA 2G25A 4Q66C 1EFPB 4Z1MD 5B64A 3AVUA 5TSDA 4CEJB 3FKSA 5H9WA 1KYIA 1YFKA 1F7VA 1PU2A 4ZAZA 5EVJA 2Z0MA 2HYIC 4TX1A 3R6DA 1EAMA 2DHCA 4A0RA 4RZQA 4Q6BA 5A4IS 2FEAA 4C4ZA 2QM7A 2WWXA 4FBMA 2UZAA 5EQJB 1D2RA 2JJ8A 3VR4D 3PEEA 3ZD8A 4Q3AA 5F5XA 3ONFA 5BXYA 1D2CA 2V3WA 4P5PA 3HHEA 3KOXA 3ZWNA 3A4NA 5F5NA 4K8OA 1NJ2A 3H84A 3HKDA 3H7IA 3K15A 1H65A 3NC4A 3FOBA 1I9CA 1Z7GA 2BJWA 3TSCA 2V6MA 4FB5A 4MR9A 5CXUA 1K8ZB 1KAMA 3CNBA 5SZHB 1HETA 2F7SA 4OMUA 3SF8B 1F12A 3U37A 4M36A 1OILA 1WUKS 5MN4A 1DKOA 3IAM1 1WJGA 4G8BA 3BWCA 4GFDA 4HEA1 5H16A 3O3MB 1OSNA 3O83A 4Y1RA 2QRHA 5FWYB 4MMZB 1ZQ9A 5MHTA 3D43A 4D8XA 3K0CC 2P3SA 5A9TA 4U7TB 3RRFA 4RJJA 3BWVA 2H11A 4XDYA 3FWZA 3DMYA 1I5EA 4G1UC 2FSIA 1GRVA 3DYBA 3GRRA 1NBOA 1MG0A 3L4BA 1YS9A 4N01A 4OB8A 4F2PA 2MHCA 5AYVA 3CVJA 1EDOA 4G1CA 2FCAA 2A9PA 4TUYA 4IO1A 3M6LA 3AKCA 1PUIA 1SVWA 3LCVB 1Q44A 4OLHA 4AROA 3ZE2B 1OF1A 2C9CA 2GXSA 4JLWA 4S0XA 4UREA 5AD1A 1N2CB 1AXGA 4OHVA 4BKQA 2PZJA 2FRVA 2XUJA 4MUKA 1IXKA 1VECA 1XZJA 1EWVA 1YU6A 3ULKA 2CFRA 4D8UA 4UVDA 1TL7C 1AZSC 3UK2A 4RW0A 1M6HA 4HS9A 5FPYA 2F1IA 1AQLA 2ZXEA 5FQOA 2ID7A 5EUMA 2OCDA 3UUFA 4L4XA 4TQGA 3VAZA 4ZCRA 2ORWA 3R3ZA 1EDDA 1K86A 1SBHA 5BWNA 3VV2A 1NOKA 4EB6A 4OJTA 3H9EO 5FBQB 2IYLD 2G77B 3M8KA 4N7BA 2UVPA 3ZIAA 2OZPA 2J0SA 2EBWA 4YP1A 1A2OA 4C22A 1OE0A 5D2CA 4P3OA 3S68A 4H6VA 5CLFA 5IAOA 4QOSA 2WB2A 2J32A 2QYSA 2IWHA 2DBVO 5C1PA 1FDTA 5BP7A 1KP9A 1IAQA 2H1LA 1CRWG 4JBWA 4XWOA 4KQ9A 1I4TD 2CMGA 4RV4A 3RJTA 4BEBA 2IPOA 1O94C 3A6DA 4G1MB 1LNQA 1VDZA 2EZ8A 2BBOA 3B52X 3LC0A 4HGPA 1G3QA 4IEIA 4JU9A 3DFFA 1MLDA 3EXHB 1BZYA 5ER6A 3SXUB 2NO0A 3QYPA 3H5WA 5ICSA 3JWPA 4DABA 4F5YA 1F20A 1PS0A 4WXMA 3ZXSA 8ATCA 3I32A 3A10A 2JIDA 3NHMA 1E61A 1WCIA 3AHHA 4LDAA 4PZEA 5CNMA 2J6HA 1TD1A 2Z1NA 2VF2A 4U5XA 1J8MF 3VZDA 3U4GA 5A2QA 4BNFA 1S1MA 4M89A 2Q0SA 1XRPA 1F48A 2NPFA 1JFSA 1Q1ZA 1WBBA 1KXZA 4C4OA 4LRSB 1B26A 3M1LA 3I42A 3KV3O 1S8OA 4UZFA 5ALVA 4C3UA 3D8SA 5HZHA 2E89A 1H8ED 2DC1A 4LN1A 5F5LA 1EQ2A 1ZD2P 4TTAA 2J3JA 2ETVA 4ZTUB 2DERA 2O19A 1Q95A 1TVKA 3WXMA 1GQQA 1OLOA 1EUZA 3E0QA 2ZYSA 3HSKA 3NFYA 3NGMA 4PZLA 2V5VA 3BD6A 2P3LA 4L0MA 5J2UB 5C0OE 2R8XA 2IRWA 4OF4A 1WP9A 4D5EA 4RVUA 2SICE 2VDMB 2BFFB 1FTYA 2Q2QA 2WF9A 1HTBA 2FKAA 3GRKA 1HMYA 1DDIA 5P8WA 2CXPA 4MQ4A 3G8YA 3UF0A 4MCIA 4RVGA 1N2BA 2FOIA 3K0AB 1AS3A 4WRRA 4CG1A 4TLBA 3RNOA 4MS1A 4UFPA 2FE4A 1G1AA 4KIGA 2OOKA 3QU2A 1I4OA 3H9QA 4ZV9A 5EWLB 5KKNB 1WB9A 3CW2A 2FSVC 3QHPA 4O2AB 4PIMA 1PHRA 3DLTA 3TLJA 1Q12A 3VOSA 1MX9A 4P7BA 3IEMA 1ECLA 3T5DA 3LMKA 5CJPA 3TQOA 4C88A 5T67A 3UV6A 3MWDB 1CDOA 3WWOA 4KPEC 5J59A 1YOBA 1OWMA 4L0QA 1Y8QB 3LF2A 3MJEA 4KWEA 4C0KA 3AQ4A 4PCUA 3NKFA 3C97A 3TSYA 1N7GA 4FDMA 1OLXB 4UEWA 1FTSA 1K7XB 4ENSA 4RK5A 1X1RA 1G6HA 3CB4A 1B1AA 1RXEA 1NF8A 1ZW6A 2ECOA 4INAA 3RWMB 2YIDA 2HCTA 3T4UA 3SPXA 3D6MA 2XYHA 4O8ZA 1ZVVA 4B3TB 5DGXA 3DEZA 3L5OA 1H4VB 2AFIA 3HEMA 4BNYA 3S2UA 1J23A 4O2LA 4X1IA 1R0WA 1WQ1R 3LBNA 3UJHA 1SEPA 4M8SA 1Z0KA 3K16A 2FCRA 4RH3A 1I3OA 2Q1SA 2R96A 3WG9A 1LTHR 3GNQA 2A78A 4PC1A 5LIPA 2HWUA 5KJ1A 1FFBA 4MEAA 3VM6A 2Z30A 4OM8A 3GP8A 1T5IA 3AETA 2WOJA 4I50B 1N2SA 2FK7A 3NUQA 2C31A 4X71A 3GHHA 4BNIA 4EYGA 1ELOA 1DXYA 4ZVSA 3ZU5A 5G40A 4E51A 1UKAA 1V39A 2HQ1A 2NPIA 3CH6A 1T9DA 1VL2A 1CJUC 1DOAA 4UAGA 4W63A 3TE7A 3GLFB 2H65A 3UMCA 5B3KA 4RDHA 2IY7A 3CRVA 1CB7A 5K2OA 5DISB 1P1FA 3PGVA 1X9GA 1Y7TA 2YHUA 4L2IB 5EKXA 1QH1A 3GXOA 3SJ7A 3OZFA 2QZ9A 4DMMA 2BMJA 1GA4A 1YUMA 3PR3A 4CI9A 2XECA 4RTKA 3TVYA 2RJNA 1Y6FA 2BSQA 3L4BC 1VPTA 4BFWA 1G3UA 4PS1A 4BFLA 4NEQA 1ID1A 1E4OA 2NTVA 2VJKA 5HRUA 1R0KA 1Z4QA 1U2TA 1XZMA 1FS5A 3B8EA 3I23A 1MDFA 2VSXA 1UM8A 2BTQA 3ROTA 3QVOA 2SHKA 4K9RA 4GZ6A 2K5UA 4JIMA 3L8MA 5J5CA 5FL7D 4EATA 1VXRA 1GL7A 2PPLA 3HADA 2JA2A 3M3DA 2YICA 5I4CA 4PLCA 4ZARA 1VI5A 2J30A 4O08A 5TQ2A 5C1DA 2R48A 2X8JA 3G68A 1YRHA 3SU8A 5AW0A 3DEKA 5L53A 2WJ6A 3OT1A 4TV8A 3A3OA 1MHTA 1NNUA 3C6YA 5ALPA 2H92A 5A0FA 2GBLA 3ND6A 4NP6A 4TSKA 4DIBA 4UOQA 5IKEA 1JHUA 3A1EA 4N0MA 1GL6A 2I91A 3ICWA 2D7CA 4LSMA 4ROTA 3RRNA 3IALA 2AI1A 2W6OA 3IO5A 2JCXA 1TJ4A 2HRBA 4XGKA 2C4NA 4NDAA 2F8LA 1DHRA 2VHQA 1M67A 4K46A 1PK9A 2AJDA 1XDWA 3ZU4A 4J7CA 3ZHRA 5TIIA 1BD4A 4FNOA 4B6QA 3P9NA 3TDMA 1QS0B 2PZGA 2OD7A 4HUQB 3O4FA 3GY0A 3I2JA 4BU0A 2YFKA 2PT6A 4HG2A 4ZP1A 4BO5A 2H2GA 2CXXA 4YLYA 2WVGA 1G5HA 3CEJA 4KFSA 1YKSA 2D5IA 4FU0A 3UGTA 4D3SA 3VSEA 1FSZA 3V33A 1M2OA 4BQPA 3OZTA 4QYMA 2D1RA 1C7QA 1W8IA 5TQ0A 3OIUA 1ENZA 4QXOA 1RPZA 2XNJA 1BW9A 1QHNA 4L6CA 5DN9A 4PSAA 3TW0A 4DSTA 2PKYX 5FOWA 2R6FA 2W4IA 1OLUA 3MRSA 3QNMA 2E85A 3AESA 1Q1GA 3PB3A 2XSZD 4FDUA 2QKYA 1CQWA 3JVEA 3K73O 3NU1A 4G1EB 5HZGA 2QJFA 4ME6A 4KX5A 1D2HA 3K6SB 1ZZGA 5H02A 3CZMA 3KSBC 1IJEA 2FE1A 2W00A 5IDYA 1D5CA 2NYAA 4RIFA 2P4SA 5H5JA 4N0EA 5EINA 4ZRDA 1GAJA 1UXJA 3H9BA 4I3HA 3ZHSA 4FNMA 3AFOA 5HG0A 1TCBA 4QTUB 3ORHA 3QE9Y 4E70A 4UJ5A 1RYZA 3P9QA 1M1NB 1Q2XA 3JRWA 3VKUA 1GXSB 3WZLA 5JC1A 5I7HA 3EMDA 1GUDA 2B98A 1ULTA 1HFWA 2EKZA 4GXRA 4YJ2A 2V4UA 4TXLA 2ODAA 4HXEB 3RVKA 3GOQA 3HE3A 2CSUA 2HIAA 1E0AA 1LBSA 1UF9A 1FTNA 1T6ZA 2A0YA 1NDHA 2B7LA 2P9BA 1SURA 1Z36A 2HWXA 3OE4A 3T9BA 4F45A 1THTA 4K0RA 3AR6A 3RPEA 5LQRA 3GLIE 1O5IA 3L7DA 2CF6A 2GN8A 1IQ0A 1A27A 1C7ZA 4MWCA 3C1UA 3LCCA 1G7RA 3FLMA 1UFRA 2HLDD 2IZ0A 2XMDA 4CIYA 2QGZA 4HQ0A 4AY3A 4PIVA 2C83A 4IF4A 2MCFA 2KS6A 1NMQA 1KVTA 1Q7RA 4BVHA 4E5UA 3ZHQA 1KBQA 1RC1A 3NGXA 1CB0A 4FOTA 4NICA 4PZDA 3TZCA 2VK1A 3BSWA 4JA0A 2AHOA 2XUHA 2ZSUA 3C39A 1ZJZA 4R31A 4RXTA 4YRJA 3W5UA 4BN0A 4H1WA 3A3YA 3LH5A 1PE0A 4NABA 5AUNB 5AVUA 3ADBA 1JLKA 3S7TA 4CKWB 1A9OA 1T91A 1VG8A 3IVCA 4OM7A 4YT5A 4AO7A 4LF5B 2H5JA 1Z7BA 4PSKA 3GLKA 4QVGA 3RKUA 4FR5A 1ZUNB 3OLWA 2QM8A 4E5VA 2GNOA 1AQYA 1WD7A 1Y0BA 1THMA 1ETHA 2EKDA 2NZUG 2WVAA 3EDQA 4WXPA 5CW1A 4Y0NA 5FD8A 4Z8YA 3V4OA 3T95A 2O2YA 1BFUA 4ESHA 4GM1A 5IDXA 1GGEA 1XGKA 4S0ZA 5C8XA 3MCZA 2OYRA 1PJZA 2H51A 5IWCA 4J16C 4CMJA 4PR0A 1CDEA 3ND5A 3U4QB 2O8BA 3RS8A 5BV1A 2AFHB 3H2IA 3E4CA 3GC6A 2UYYA 3LTEA 5K3FA 4B4VA 4JLKA 1W75A 1OHHD 5FA6A 3SXPA 1VE7A 1M1UA 3EXG1 2XWPA 3GPDG 1FDSA 2JL1A 5REQA 4JVLA 4RPLA 4EFDA 1K4KA 1KY3A 2J4FA 4UCQA 2QUAA 4KO2S 4BQNA 1EGHA 1O95A 2ODWA 4Z4IA 1CS0B 2CLCX 1G66A 1GADO 4OGFA 3IPYA 1EIWA 5ALEA 3D7SA 2FSHA 1NMZA 1M74A 3D1JA 1ZZEA 2GXUA 2XGSA 1FIUA 3RADC 2RAVA 1PFUA 2CK3A 3BHJA 1Z2EA 4R1SA 4ZOCA 3DE7X 2CEKA 3TDNA 3L06A 4BGVA 1I7NA 2ATVA 3BXGA 4G8JA 1BYUA 2PQ2A 5CDUA 3KETA 1Z4IA 4EMSA 3DZCA 3OA0A 4LDQA 5JXIA 1V3QE 1N8TA 2WHPB 2XRMA 3VDQA 4DR4B 1GZ3A 3T9FA 1AMOA 1P75A 1C7FA 4YDQA 3X1KA 1T9GS 3L1UA 3IOBA 4HC4A 3X1JA 3DCJA 2AZMA 3RSCA 3DVAB 2J5XA 3JATA 1QAMA 1NYLA 2GASA 2QMUA 4KXQA 4LXGA 1PKXA 2Z04A 4GO1A 2WMNB 2IK8A 2YC4C 1PWHA 1KYWA 3GGSA 1B1CA 3WOVA 4EX7A 2IPNA 3EGXB 1D2EA 4L5IA 2IZ5A 4TM8A 5HILA 3B2QA 3KZXA 3Q7EA 4DBLC 1NPDA 1RPAA 2EQBA 2B1RA 2GXAA 5CFZA 4GMFA 3WV5A 4LQLA 2O06A 4I81A 1NU6A 1VFPA 1YQGA 2EG5A 2I54A 2RHRA 5HJ2A 6Q21A 3PTLA 3LVFO 3A6HA 4MQFB 3R5XA 1ND6A 2VSFA 1VMAA 2WP0A 3I3SR 4NZOA 4EYOA 4LRTB 2DH5A 1AQ6A 3BMOB 3QPBA 2PJZA 5GJVC 4CBVA 4HQKA 2P9EA 3DDCA 3LVQE 1S2MA 2GBLC 2H6EA 1VMIA 4HWSA 1U8UA 2AG6A 1U7UA 3FVQA 1YS7A 1RJGA 4IIJB 4DR7B 2WFZA 4NE7A 3TLZA 4YLGA 5B1EA 2PPVA 5B55A 4OYRA 4X8OA 1VZ2A 1YS2X 4C78A 3QELB 3EXEA 4MRPA 4PQFA 2ZCUA 2GCGA 4ARVA 4EUHA 2VSNA 4G89A 4PRKA 4K26A 5DBFA 3HO6A 2J3QA 1ZD3A 4PS0A 4WZBB 1VSUA 2J3LA 3HJHA 3OQHA 3Q3HA 2M6KA 1PV4A 5JOQA 5GINE 5J5VA 2PXHA 1D03A 5AVQA 2C2OA 5CFMA 5CK4A 3VPGA 2EJVA 4W7SA 4GZ5A 3VKFA 3C6KA 1E8NA 2LVBA 2HRZA 2XYVA 1RLIA 3EGDA 3KZCA 3NANA 4F7WA 4YUWA 4W9MC 2QUZA 1BVRA 3CPEA 3HJUA 3KEMA 2FZKA 1JYEA 4LFCB 5KVAA 5KWSA 2QLBA 5THKA 3ZU3A 4UDYX 4F3KA 3SHVA 3NMUF 1JB9A 3F7MA 4ZVPA 4JXZA 1RADA 4LYYA 1G59A 1LLUA 3NBKA 3F5MA 2GKGA 4KQXA 2QD2A 1JIQA 1HT0A 1QLWA 3TM5A 3ZHXA 4KRFA 2O8DA 3IP6A 2CL0X 1K63A 3PWTA 2A67A 1EZ1A 3QLVA 4LVCA 1M8FA 2VK4A 2EFCB 1G16A 1XXHB 3JQRA 3DC7A 3JQCA 3NV7A 5KOJB 4Z0PA 3AV3A 4CCWA 2FY8A 2QRKA 4J2HA 4UMFA 5IBRA 1JT9A 1IMOA 4JLNA 2FZCA 3SLGA 2ZFUA 3ZJVA 4EL0A 1JKIA 4JOSA 3QP9A 1QCZA 4IWYA 1T0HB 3C4QA 2V1XA 1JB1A 5CDGA 1QR2A 5TEVA 3NDPA 5AI5A 2C8JA 4RVCA 3DE0X 3N28A 3A6KA 2A57A 5F78A 4DDTA 2ZB4A 4M0EA 1F8UA 1Q3HA 2FX2A 2D5CA 4Q01A 4C06A 3DFUA 3V1MA 3TGPA 1EUQA 3IQIX 3MMPA 5IH3A 3VU0A 4GDFA 1LS1A 1YFLA 2CHFA 2HHCA 3ICPA 3H97A 1XZFA 1WUJS 3DBIA 3EFOB 3OSUA 1IULA 4O4HF 5E3IA 3I9KA 4FYHA 4I9HA 4P3YA 4Q4HA 5BR1A 1ZA2A 3DHYA 4N5NA 4UHDA 5C5EA 2F4VB 1VCMA 4BMVA 2AOUA 2AUTA 2G3YA 3CSUA 4LPSA 3F4LA 3PF9A 4DBVO 4AS1A 3IERA 2D6FA 2ACKA 3NHPA 4L8YA 4U6NA 1W0CA 4Q1FA 1DB3A 1M0WA 9ABPA 4CFYA 4BDTA 4ZVVA 4MW5A 3ONVA 4ZOLF 2NT3A 4RF2A 4CQJA 4EA9A 3VU9B 4U2EA 4UBIA 3ER8A 1SXJE 3C1TA 1ZGAA 3LWBA 1L6RA 4YP0A 2IYZA 5CCBA 1U9ZA 4YCLA 2AFIE 1WMSA 1E7MA 2ODQA 1E1KA 4GIBA 1XD2B 4D7AA 4GG1A 4UPVA 1O54A 1EAYA 3OKAA 2FWPA 3RANA 2YS6A 4YC7A 3K2EA 2Q5HA 1CF4A 4QREA 1L8OA 1VE6A 4KQIA 3LG2A 4X97A 3SIXA 4IPTA 4ND7A 4RZUA 3TDKA 5CDFE 4KXUA 1VB5A 1L5LA 5D1NA 5FFMA 2PV0A 1L5ZA 1U0FA 1F14A 2M6SA 2I7DA 3PIRA 4R8SA 3UXHA 3VU8A 3M6XA 2HNBA 2DETA 3DPUA 5HIKA 3MILA 4Y2UA 2SBTA 1SKYB 1Y7IA 3LRTA 3TM4A 3L0PA 1GKUB 1K0FA 1BC5A 2CDBA 4YQZA 3REGA 2B2CA 3A1TA 3K0FA 2YMQA 3GFSA 3T3HA 1VPLA 3PKIA 4MPDA 3SNKA 1O95C 5DLEA 3ROQA 4DUPA 4E5KA 1RWXA 3EIWA 4NZNA 1BDHA 1JVSA 2Q7OE 2AVNA 4KDFA 3COVA 4OA5A 3GNLA 4KR6A 2C04A 5ITSA 4QBHA 4QOHA 1Y5LA 2OMEA 4FGKA 3JQ6A 3QE3A 1JR6A 5H83A 4DV1B 3TRJA 1ZMOA 4DMFA 4S04A 1FQWA 4CMIB 4RTPA 2HCFA 1DC8A 4H35A 2RFLA 1KDRA 3TFWA 4DRZA 4RZSA 1LNSA 1NLZA 1UBNA 2E4AA 4DBLE 4I4CA 4MRVA 1T5LA 3IAEA 1WE2A 1SD5A 3H9GA 3JY6A 4FGSA 5DHAA 4EO9A 3OE7D 4LJAA 1H4TA 4KQWA 5J9FA 3U81A 3P27A 4QODA 1GPWB 2I34A 4A23A 1B8VA 3GLHB 1JEJA 5HHTA 2GCEA 1A4RA 1FP2A 1OFVA 3GW8A 2X8BA 4F3NA 4K9MA 3D7KA 4OQDA 4O8CA 2PZKA 1P74A 1R15A 4IOLA 3ZWKA 3PEUA 4CLRA 3D3EA 2VRCD 2NAFA 2QAIA 5CCEA 1H22A 2YH2A 4M7RA 1HK7A 1PD0A 2ZI5A 2QLMA 5D3ZA 3SC3A 3ZW8A 5K0FA 3KU1A 4TYWA 3E22A 5IASA 2COKA 4HNVA 2K2WA 1MC5A 3RIXA 3RSHA 3BH6A 5JHHB 2P69A 2RKWA 5BUCA 2CNKA 3TGWA 1NLFA 1QVAA 3SSMA 1XNRB 4LY9A 3A70A 4PNHA 4JDPA 4D6YA 2NVBA 3ZDEA 4N39A 2CHVA 1N5DA 1AF7A 2CLDX 1XZEA 2A7XA 3OZDA 3CR7A 2A1IA 2QBYB 1WMAA 3T4EA 1YCFA 4EJ2A 1C0IA 3HYCA 1QIHA 1N0HA 3HKBB 2QQ5A 4CEHA 3FTNA 4YJGA 2XUIA 2QTWB 4OHOA 5U9CA 4FX2A 4MVJI 4RSRA 3TK1A 3N0WA 4Z7NB 4FFPA 5C35A 1I7PA 3UV7A 3UJ7A 3L4KA 3WNBA 1YVPA 4II3A 1U2EA 3IBTA 3WHPA 3KJXA 3AEUA 4GYJA 4AWBA 4EEZA 1PL8A 3S28A 4MKFA 2J9RA 4KDRA 1E2KA 5JQGF 3GN2A 5JTTA 2CBZA 4YPOA 3B3QA 3TJMA 4EJMA 3WYEA 2IYAA 4JLVA 1KQFA 1GTSA 1G0NA 1UAGA 2YXPX 1KO4A 2A9RA 3QLVC 5FNVF 4TSFA 1FUKA 3MAAC 4LISA 4QAJA 4CDNA 1O57A 4AJNA 2JS7A 1HQCA 2FFJA 1NN3A 3WSVA 2CVHA 3BT7A 2BLLA 4CCAA 3ITDA 1AQUA 1CUBA 5B2FA 1R6UA 1K5DA 3DMGA 3FHCB 4XR9A 2O7SA 4X1KA 3ELYA 4DM3A 1CZHA 2PYZA 4TXMA 5HF6A 1OTHA 3SS8A 4JYMA 1C8VB 1GUYA 1K9SA 4R9NA 3I9NA 3IS3A 1USUA 1DKQA 4L4UA 1NQUA 5FPPA 3KYJB 4ARZB 3DQPA 3OZGA 3N2GA 3LM8A 4H7PA 5A6SB 2E4VA 4XX0B 1C7JA 2PMEA 5C1IA 2Y0BA 3E5MA 4CM9D 3BRWA 1YVDA 4XCXA 3OIVA 1ISIA 1Y4ZA 2ZI6A 3A04A 1WXWA 1M6YA 3BKXA 3C8UA 2B92A 2AF3C 3IQHX 4BZWA 2UVQA 1M9NA 3D81A 1J9ZA 3HUDA 4KO8A 4XGIA 1RMQA 1N6RA 1WKBA 2PX0A 3T0GA 4JB0A 3V9AA 3PTAA 4J49A 1F2VA 4XM1A 3V2IA 3R3JA 2Q1XA 2Q3JA 2ZTSA 2F43A 3EVNA 1R4AA 2PYIA 3G2OA 5AKHA 4Q7MB 3DFMA 1P9WA 2LW7A 2QL6A 3FNFA 5AO9A 2AR0A 5FCDA 2QIOA 3DAYA 1BA2A 3IJRA 4UCXA 3AJAA 4DMKA 5CJJA 4S1OA 2FZGA 4CTJA 2Z8ZA 1W59A 1ZYUA 3D4OA 2P9TA 2GM3A 3L7NA 3VR4H 1RTTA 4BFXA 5G3ZA 4F9TA 3VR1A 5KB3A 5JJIA 5IP5A 4GUAA 1QV6A 3JVVA 4P8RA 2MSLA 1RT9A 4RNDB 4DUZB 1JKFA 4ZVLA 4D4GA 2I6QA 3ESQA 5DX1A 1MRZA 2ZS8A 1KZ9A 4PEVA 1U0OC 3EEOA 3PNSA 3STVA 2C1EA 1QPZA 3SY8A 3VRHA 3RT7A 4F96A 2RHJA 3MN1A 4MUFA 3IAUA 1U8XX 4N3GA 1QFZA 5JLAA 3TKLA 3PC3A 4ITUA 4WOJA 1CP3A 2NU8B 4D81A 5BQOA 3LGSA 4ZMSA 1TM3E 1T8YA 4E12A 2NU6B 1C0EA 1V8BA 1U7HA 4IOJA 5EKTA 1EGQA 2BFDB 3N7AA 1R27A 2NUAB 1FFDA 3ASYA 4DG5A 2B25A 4MEBA 3FAZA 2V7QA 1F38A 2HMYB 2DT8A 2O07A 2QB5A 1KFCB 3GVPA 2VNSA 1ORRA 4R3UC 2VTBA 2EX4A 3E84A 2WD9A 4MIOA 3EEBA 5EIFA 4K88A 3CJRA 1U4NA 5HX7A 1SCKA 1KS9A 1QONA 3M5CA 3P20A 3E9EA 5IJ0A 3VDMA 2YL2A 2F4NA 2OO5A 5D3MB 1NV9A 1MAVA 3KQSA 1X7YB 2MMGA 4KQ6A 3RDPA 3TI9A 4DIMA 4F84A 5J1SB 3H1PA 2QY9A 4R54A 1V6CA 4XWKA 2JAXA 3MINA 1SXGA 1LDEA 3FCSB 2C4KA 3L6DA 2O0LA 1I01A 1FP1D 1T4DA 3I28A 4MUAA 5SY4A 1NT2A 1HYBA 5H82A 4QSMA 2BGTA 3QEKA 5I7RA 2LRHA 2AYYA 3I2KA 5IMSA 1F0YA 2D1YA 5FLYA 4IXNA 1J6UA 4FFOA 1JMKC 2P79A 3NUZA 6REQA 3NRJA 3HEAA 2EFHB 1QYWA 1YQUA 2PL9A 3ECAA 2R8YA 1UM9B 1N5LA 3M0EA 3FVRA 3A6EA 4G2NA 2GTPA 3LHFA 3Q7IA 4J2OA 4JD5A 4Q03A 3R7LA 2Q3FA 5HIMA 3V1YA 3RVQA 5L9AA 1YZFA 1OFUX 1V5FA 2JRCA 2PS3A 4KNVA 2JIRA 2WYIA 2ZWOA 4YMUA 5K0CA 1YRWA 3EZXA 3GEMA 4RA6B 4WXEA 4R98A 1OW3B 1YVUA 1Q6ZA 1PBTA 3W1WA 2ZITA 3VYVA 3WC4A 1MABB 2OA0A 2W42A 4RTRA 1H05A 5C51B 1T8UA 2FUEA 1UAYA 1SNYA 2FPLA 3D6NB 4IDPA 1KK2A 2P1RA 1CUJA 3OECA 1QVRA 5DGIA 3JZAA 1E60A 1HA3A 3EH1A 4OBEA 4Q19A 2RGEA 2HI0A 2VZLA 4QYWA 3IR5A 4HQFA 1RAFA 2C92A 2H9AA 1H1TA 1TQ2A 1WU8A 4C20A 1J0AA 4RVSA 4BTEA 5CDTA 4L85A 4X95A 4FINA 1EG2A 1M2NA 3JQ7B 4LRWA 1BXGB 1Z0IA 4NI5A 1NVUQ 3ZWXA 2WWRA 4ZQFA 2YDXA 4PZYA 2XX3A 1JU3A 4QWWA 1ZC3A 3TRKA 3ZK8A 4DWOA 1VIMA 1Z35A 3RTGA 3KZOA 3VNQA 5AXBA 5CITA 2QQEA 2W0MA 1GQ2A 2HLPA 2OCBA 4WAUA 4MYSA 4N0PA 5ESXA 4A0SA 5B53A 2DLDA 1T4CA 5BSGA 3NFRA 1QAOA 3ED5A 4DB4A 1GZDA 2ZT8A 3D7NA 2GN4A 2RB5A 3HUFA 3VH4A 4ADSG 4EO7A 4BC0A 2Z43A 5DKFA 4EQ6B 2EZ4A 1V2GA 4YA6A 5LOVF 1ZDMA 1TQDA 3DTVB 1J5XA 2GFQA 1MOSA 2HQRA 2WIDA 4H3HB 1E0DA 1G63A 2PO7A 3IPLA 3OLCX 4M9ZA 2EBFX 4HH4A 4Y9DA 4LYDA 5H3CA 3VHRA 4B87A 5AM2A 1K7SN 2X9LA 2OUKA 1QPBA 3R6GA 5I7FA 5KKCA 3SQXA 3QEBZ 4P33A 1C9KA 3TMYA 5CXQA 5H70A 7AT1A 2ZZMA 4P22A 2VJDA 3KPJA 5EQFA 2XA1A 1OAAA 2DPYA 2PD4A 3PFWO 4UVGA 3RFUA 1IPEA 2A94A 3DKIA 1YI0A 1BN6A 2CB9A 2EKPA 4GVLA 1P0IA 4Z3OA 3WIVA 5A4JA 2Y92A 3EBOA 3LC7O 1X7DA 3SG0A 2GD0A 2L82A 2G7MC 2MYUA 4M1KA 1W5BA 1W36C 2V0GA 3WHIA 2WK1A 3DJYA 5CFRA 1QOQB 2VEOA 1TTHA 1EG7A 1XZGA 4FIDA 3G9ZA 4N9WA 3U49A 4F9FA 5IW8A 3GLGE 3FDFA 4YMVA 1AK2A 4EIWA 1FX0A 5ES4B 3M1YA 1X38A 1FVOA 3HA7A 4EB8A 2MOKA 2LTAA 4KSCA 1CUWA 3JU3A 3B20A 5E7IA 3SKVA 1R8SA 3P45A 1UQTA 4X20B 1RHJA 4L4RA 1KSJA 2X7XA 2WTXA 3K1AA 3MTBA 3T34A 4BS9A 1L3BA 4HJRA 5KAPA 3INRA 4HK4A 2P0EA 3HB4X 1XMOB 3WQHA 3V55A 1X1QA 1R5OA 3OKCA 4JSRA 2DTXA 4MKRA 3GUVA 3A6PC 4W5WA 1ORTA 2V45A 4JBNA 4BDSA 3LQRA 3KVNA 4FFMA 5CCXA 1WCV1 4L07A 5EL0A 3ODGA 2CEAA 5DTEA 3TQCA 5KJ6A 1HE2A 1QQ7A 1KO8A 4HX5A 3KQLA 1JAZA 2QPTA 1MH9A 5P21A 1LPPA 1W2HA 1GN8A 4XWAA 1RM4A 2VSQA 2WJPA 3FOFC 2CXRA 5TPZD 3B12A 1SKUA 3FD8A 4N7RA 4D57A 4TQ9A 1YZQA 4A5OA 1PNRA 1GDHA 3KJNA 1X0XA 3V2UA 4RE5A 5C32A 3GCZA 1DSSG 3BFJA 4PQYA 1ZL2A 4XPIB 3H99A 4X84A 3LXMA 5JMWA 3OQIA 1PJ4A 1ML3A 4BLVA 1US8A 5L51A 4HRAA 3CRRA 2YZMA 1TGYA 3FN4A 3V2GA 3N75A 4IMPA 5CK5A 2JD2A 2Y1WA 2YV5A 3AF0A 3CWCA 1Q7CA 3LP6A 3TOZA 4ZYLA 4MDFA 1GU0A 2OO5C 1KQOA 2IDZA 2BEKA 3DR3A 1XU7A 1Z0UA 1WXDA 4GOMD 5C5DA 3I61A 1HFEL 4YN3A 5HE8A 4KE7A 2G6TA 2NV0A 2RGDA 2VP0A 3VXKA 3WADA 3ZVNA 3JD4A 3VNRA 3DZJA 2WFMA 3O8LA 1KIMA 2XMCA 3VZBA 1WDLA 4MPTA 1J00A 1ZESA 4D9FA 3HP4A 3KQVA 4MP8A 3MBIA 1ADYA 4EELA 1E4EA 2E18A 1GCUA 1K3TA 3LAWA 3KJHA 4EP1A 4YXWD 1ZVMA 2ZAYA 2Q5LA 3EXIB 4DOMA 2BHLA 1CERA 2RAPA 4EGSA 1A69A 1Y6GA 1DC6A 5K8UA 4E1BA 2DFTA 1IBKB 5ICCA 4KGZA 4E5SA 4KE6A 1EFKA 1T0IA 3L7JA 4H4CA 1Q6YA 4BLRA 5LQMA 1Z7YA 3ZWCA 5K09A 2Q9AA 3PXXA 4WADA 3OURA 1OKKA 1HURA 1PV2A 1UH5A 4HRVA 3TQHA 3BWDD 4B33A 1WTCA 4BC1A 1CV2A 2A3NA 1EJBA 4R40A 2DY0A 2ZJZA 3FOAA 2CJFA 4ZAGA 4U8GA 2DSTA 4FX5A 3DDNA 3F9IA 2VDVE 1XA4A 3EK2A 4QXRA 5E7MA 3SM9A 1Z37A 2HSEA 3RSOA 3RS0A 3I58A 3WIBA 3ZHZA 2JIOA 5MF6A 1QG2A 4KSYA 1XJ5A 3ZNNA 4RKYA 2FWRA 3WTCA 4YXFA 4R8LA 5DWDA 1U2PA 3PENA 2F48A 3DZHA 3MRTA 3USZA 3FKJA 2OKGA 4I3GA 5EMKA 4XSGA 1KY2A 4UQLA 4Q3EA 1AHNA 4JJEA 4TL9A 1ILWA 3AY0A 5DHSA 1EWRA 1NVEA 2NTNA 2WMOB 4LQCA 5BSRA 5EZYF 3OT4A 5A71A 5HOEA 4DNPA 821PA 3CNNA 5KAMA 2A30A 4HO1X 3MS4A 2D0OB 3G8DA 2VTVA 1ZR4A 1GDDA 3AR8A 4WASA 2BGRA 3GCGA 3N0TA 4DLTA 1YRYE 5HUQA 2Y93A 2XJ4A 1XU9A 2D8AA 4JR0A 4JU8A 4YECA 3ILHA 4RS4A 2XMBA 1QANA 3QJGA 3C7KA 4OP1A 4BLUA 4DCGA 4DLVA 4JBYA 2P2CA 3SS9X 2FP4B 2IXDA 3F9RA 2VC2B 3GNTA 3QKSB 4LAFA 3VKVA 1IBCA 2WNIA 1KMQA 4C87A 3T4XA 4Q48A 4R83A 4D2IA 1G60A 3WWYA 3IVAA 2DBRA 2ZRFA 3N2IA 4NV1A 5CUQA 1FPQA 5JRDS 4ZCSA 4G5YA 4Q05A 2BZSA 4B3FX 3OC6A 5JAUA 4CR7A 1P1JA 3DE3X 2Q29A 1JYSA 3BK1A 3KHKA 4FSHA 1DAOA 1G5IA 1J0CA 1L4EA 3H1TA 4Q1BA 5AW1A 1MNQA 5TPWA 2DUJA 1LWOA 1RC8A 1ILEA 1KY5A 3MT8A 4BYMA 3O74A 1Z0ZA 4AKSA 1KU6A 5B7PA 3UTDA 3E82A 3MT0A 4NHOA 5CU7A 3WHLA 3QF7A 1HKHA 1TC2A 1PS8A 2BKAA 3BQNB 13PKA 3OTHA 4KK3A 3UVEA 2PBRA 2AMYA 3ZDFA 2D3WA 3ABSB 5KNCD 2JLWA 2ODEA 3W5SA 5C8DA 2ZT7A 3T8YA 2O5CA 3FYDA 3PZBA 4WJKB 2PSSA 1XAGA 3MTAA 2HNAA 2HMSA 2IYQA 2OCPA 2UVDA 3H6KA 1NUPA 3KOUA 1HRKA 4MVJP 2H1CA 2PQ6A 5DGCA 2C2BA 2QYOA 5JISA 4B6RA 1REQB 2WSSD 3SWWA 1JA1A 3OMXA 1WNTA 4IM7A 3T1VA 3FGNA 5K6TA 1ZD9A 1Z07A 2QR2A 4PYLA 3K9QO 3TIGA 2JLUA 5G1PA 1TYEB 3QWFA 2VUIB 4B4WA 1P2GA 1T9ZA 4Z7OB 4HGNA 3HCRA 1FFCA 2HRQA 2NV6A 3U17A 1LSSA 4IAOA 3QWBA 3OI7A 3FPAA 1OFGA 2BP7A 1FDIA 3DKPA 3GDFA 4INPA 5BUSA 1TUBB 5EN4A 5EJMA 3J81k 3WV4A 3QQPA 4NBUA 1P4RA 1EXMA 1ZOLA 4KMRA 3JAWB 1IBSA 4DNQA 2PKQP 3KS9A 3HRHA 1VJ1A 3NWBA 5C7LO 2GB4A 2D00A 5JS7A 4FFWA 1QWSA 2EL9A 2ZYRA 2DHRA 1ZM3A 3N2ZB 4JC8A 1V4NA 1DVRA 4RY9A 2YMLA 2AT1A 3KKPA 4Q4AB 5F2KA 2YJTD 3R75A 4PN7A 4Z4EA 3LYUA 3WJ2A 5C81A 4B48A 1MC4A 4MV9A 4QUIA 1KP3A 3ANYB 3LQQA 4PX2A 2D5LA 5JBQA 3U44A 4M0UA 2YW2A 2OV1A 2ADOA 2FFBA 2VJMB 4BPBA 1JTVA 2WKSA 3WL6A 2EX0A 1I51A 3OOWA 3UC5A 1W25A 1MQ9A 1P3DA 1ETUA 2H7YA 2BDUA 2HX1A 2PS9A 4W5JA 4HSGA 5BVGB 3L6RA 2BY4A 3EDOA 1T36A 4GWKA 1AIPA 2WD7B 3HKCB 3CLSD 1L8XA 4EFLA 1XJCA 1FU4A 1UUFA 1B8PA 2C9DA 4ZD6A 3STXA 4ZYYA 5TARA 1TZMA 1I2MA 3WQBA 3I52A 3CBQA 1TKCA 3QVGA 1BCSA 3PE6A 5KTOA 4NFLA 3EUEA 4LDZA 5BQ5A 2X9NA 4KQJA 3LV8A 4V0SA 1CQXA 3BIJA 3Q87B 2BKUA 4FXOA 5ITZB 3W79A 3ADCA 4CNQA 4YV2A 5JU6A 1HEIA 1ID8A 4RZXA 3BRCA 4GT1A 2GBGA 5DOVA 5JZOA 1W85B 3EWSA 1LQUA 2WPNA 2AEEA 1BVYF 1R4MA 5LJLA 3G9QA 1MB0A 1YIDA 2BFWA 3KXIA 4KUEA 1FPMA 2ERCA 4PZPA 4NWIA 3STTA 5IX8A 1DRKA 3KFXA 3MJHA 3V8NA 4MZDA 4HAOA 2AC2A 2W93A 3L8GA 4XQ0A 4BQOA 1JV2B 1PQ4A 1XTPA 4QTZA 4QUEA 3H5AA 4CIDA 6LDHA 1ZLYA 5JY6A 3LQFA 1CKEA 2IS2A 2JAOA 1SCBA 4BCBA 1AMUA 1MEJA 4C4TA 4HQRA 4MB0A 2C0QA 1AZTA 4E21A 5SY9A 3I8OA 2PGIA 3BB4A 5IAEA 1X7XB 4GX0A 3PUYA 4REQB 2C2GA 1HE1C 2F8MA 4C4SA 3BL6A 1ZUWA 4GLFA 1FRVA 1XNHA 1YBFA 4R41A 3GRUA 5F9MA 2IGTA 3AUKA 3E7FA 1F6WA 2QA5A 3WNZA 2R1VA 4N40A 4A82A 1QFJA 5BRNA 3AY3A 1Y98A 4ISBA 3ZHCA 2PFSA 2PKQO 4B35A 5C1BA 2Q5JA 5EP3A 1ZXBA 4OUDA 2OMKA 3OLVA 4INZA 3AP3A 4QUGA 3SNHA 4CCSA 2GNAA 4ND5A 5E1DA 3NUGA 4RGQA 1DOHA 2IQIA 4CMBA 1RWBA 1Z39A 4MCJA 1E2QA 1ZRSA 2JFWA 1CUHA 2QXYA 3QEOA 1NFQA 4I1YA 2E55A 3K72B 1BG6A 1RKXA 1BA3A 1IVNA 2XLCA 4EUFA 4ZCTA 1VIVA 4EG5A 1Z5OA 2JZOA 3OQBA 3BXEA 1CIJA 5IG2A 4OXRA 3KTAB 2W2LD 4L9RA 2ATCA 4PF1A 4QRHA 1FFXA 2C1XA 1XPUA 2O8FB 4BMDA 1E3MA 1YB6A 3TZHA 3FHLA 2PZBA 3RHTA 3ET4A 3O4IA 5U4QA 1KMHA 1NQVA 4I6EA 3W5JA 1I3CA 1KVSA 1NF3A 2XTJA 3JALB 2KI5A 4TLAA 5EHGA 5C37A 5JAQA 1V7QA 1N3BA 5LDGA 2RB4A 4FE4A 3PQ6A 1B8OA 3C8MA 5DT9A 1EGVB 4KODA 1ISRA 1JXQA 4H1VA 1PQPA 3ICOA 3PKZA 4TRJA 4GPTA 5H4HA 3UHAA 1F5SA 2A5FA 1ISFA 2NSJA 3PX2A 5G4LA 4WIAA 3STUA 3OEWA 1SOWA 3T3DA 1NXQA 1FUUA 1Y1KE 5F51A 1P9OA 2N1MA 3ZV3A 2MSWA 1IFXA 1Y48E 4XKJA 2X22A 2D5BA 3OBIA 1UPFA 1KFJB 3MERA 3LCJA 3O2NA 1NNLA 5CLHA 2WAOA 2GZHA 1SFRA 2BR3A 1IN8A 5K0TA 4KRGA 4BNJA 1GNVA 2BFPA 1B4DA 4LWOA 1D6MA 5G0TA 3V00A 1NYTA 5JXHA 1ODKA 2BEVA 4G63A 2FHSA 4Q3KA 4QYIB 5DNUA 3GDHA 3BBLA 1PLKA 4Q9HA 4BV9A 2WF8A 5LQSA 1PG0A 2EFJA 4ZKEA 2BFNA 1CQIA 2AYXA 5ICFA 2C3MA 3GRCA 1TPZA 3E7XA 5BYBA 5BNWA 2EP7A 2P7IA 1XLWA 4XZ3A 4WKNA 4NXMB 1N1MA 3IPRA 1GM5A 4RZHA 2BUBA 5LBTA 1RHKA 4MLPA 2NG1A 3FM9A 4LNUB 5AKIA 2AMJA 3VR2D 1BROA 1GV0A 1NY5A 5DM2A 1KOLA 4Q4CA 3GCWA 5LXTF 1ECCA 4LJLA 4FSDA 1UBFA 5KYGA 1MENA 1A0OA 5L3QB 4N5HX 3OZVA 2BZGA 4NG5A 3CQ9A 4IG4A 1MO6A 4P0PB 4B81A 3FZQA 2ZRQA 3TMKA 2VAWA 5FWNA 3TLYA 1I0LA 2CFIA 1WB4A 1XAIA 4JL8A 3DE2X 2I03A 4IKPA 1JDJA 5FHQA 4RTMA 1OBFO 3OUTA 4A0GA 2ECQA 4ZQEA 1RAHA 4W1PA 3IQXA 1I5OA 4F8YA 2E1PA 1MOPA 4NMMA 3NDJA 2IVFA 4B2IA 1HDOA 4PGGA 4B7UA 2IUYA 4PR3A 3OT5A 2VYNA 2A0WA 5AHXA 3BD9A 1DTSA 4RFVA 1E79A 3ROGA 4WHMA 5IDVA 3QVTA 4HV4A 2ZIAA 1VSVA 3O4HA 3AR5A 3T1NA 4L5YA 1V4BA 3DUFB 3HY6A 2Q07A 5KTYA 2ZM5A 5J4LA 3CISA 5KWJA 2ZRDA 4Z8XA 1I2CA 1C3XA 2XH8A 2AW3A 4JJ7A 1M10A 4WCFB 3ZZ0A 3VA7A 2FSUA 1W94A 2GAFA 3D9QX 1J0EA 3KL4A 1GP2A 3MG9A 1JN0A 3RYTC 1Z0AA 3UHFA 4G0WA 3U6BA 5GIOE 4HEHA 3AIKA 1GPAA 2Q6TA 2QENA 2CHGA 3JSXA 2HDNB 2FGJA 5EWJB 3OEYA 3G1TA 1L7QA 1R0SA 2WT9A 3RTDA 3SEAA 2CE2X 1L5QA 4NZYA 4IHQA 2VDUE 1RXYA 4I5FA 3PITA 5E9AA 4J0QA 5LNK1 1PFQA 3AX6A 1WV1A 3KJFA 2DPHA 2PFGA 1GAXA 1G18A 4BO6A 2W48A 2EJBA 3PR2B 1CP2A 3SHTA 3E9CA 3EDMA 4CLHA 3S40A 2G6BA 4ZMBA 1BXZA 1FRFS 3PT5A 1ISMA 1HYEA 1JPNA 3BFVA 3HDGA 4LSGA 1C2TA 2VS1A 3ZZUA 1KDVA 2DFPA 5DDIP 4CV1A 2UUAB 3S6JA 2K4MA 2C58A 3GROA 2PUVA 5D3QA 1TFUA 3OX3A 2O52A 3KXLA 2B9EA 2Q1UA 3M4YA 3K2BA 2CVZA 2QX7A 3UIEA 4DEXA 1TUEA 3ZOZA 5K0BA 4DGQA 1QYRA 3AERB 5DHPA 3TGLA 2X3FA 3VC3A 5IJ9A 2O2IA 3A1DA 2R6DA 4NFYA 1ZIOA 5LYJA 2WIBA 3OM0A 1E1MA 2FQYA 1EXVA 1WEKA 3TZEA 2P68A 1ZJYA 5DXFA 2C98A 4RC9A 4MGYR 5FO0A 4BO7A 1LLDA 3SOPA 3AZQA 1NI4B 3CCFA 4O2BA 3THYB 1V9LA 3FPFA 4NVRA 3EGIA 4A5SA 3PSAA 3CLRC 1Q0TA 1I80A 3E58A 4AK9A 2PCJA 4ITVA 1LZLA 1R8JA 2HRRA 1BE0A 4MX8A 1MO2A 5HF9A 4YY3B 3F71A 1ZA1A 1SKBA 2UUOA 3II6X 3HDQA 1V48A 3K8ZA 1OAKA 1MPXA 2DPMA 4OHWA 5K0GA 2EC5A 3AFHA 2VHYA 2PWYA 4IMRA 3ZY4A 1Q21A 1U2DA 1OU0A 4KKVA 3ZZNA 3PJRA 1UEJA 1KH1A 3T9EA 4XRGA 2JFYA 2ZRPA 4HGYA 5D85A 3IR6A 1X7ZA 1G20B 4GI3A 4WQMA 2HXGA 1I2ZA 1I2AA 1Z38A 3V1KA 4B1FA 3PFHA 4QDTA 3FDZA 3M89A 3PD7A 4CV2A 3N58A 3AB8A 3F4KA 2DX7A 4Y8VA 5TXGA 1KJQA 4V02A 1FFEA 3U3XA 1DJQA 3WZ2A 5L6MB 2XWSA 2JASA 1M8PA 4BNNA 2I3BA 3CRQA 3V7YA 1B43A 5CYFA 1NRXA 4K1LA 4OLFA 4TWIA 4UKDA 3HMKA 3TG8A 3DBVO 3B6MA 3ICVA 1MO3A 2O14A 3GFVA 3G2MA 3VPCA 4Z2AA 3NWJA 1G3IA 3M6AA 5AWFC 3M6FA 1QHIA 1U9YA 3IDFA 3AU8A 4PVCA 1T5DX 3FTCA 1P5HA 3E5RA 2XA2A 1LV7A 5E9JA 4EBBA 4P58A 4Q93A 3JARB 1CNMA 1M0SA 3ILYA 3IDOA 3KBBA 4INOA 3ZCSA 2MYNA 1Q16A 4L5AA 4BBAA 1N4AA 3RT9A 5HJ5A 2XMRA 3H11B 4X54A 3U4CA 5BV7A 5KHOC 4W9RA 2ZIXA 4R1TA 4I0WB 4AS3A 3NXKA 3LZCA 1KR2A 2ZB3A 1RKUA 1SOUA 5K0SA 1G291 1U3FA 1U11A 2X7JA 3IDZA 2Y67A 1YAHA 4FWIB 4X7RA 4QLOA 2CVQA 2NVWA 2HK9A 2MIIA 3BEDA 5TB5A 3HVIA 2D3TA 4UVIA 5BSWA 2HXSA 1ZOOA 2DU8A 5JSFA 4Q1VA 2OYCA 3UJDA 4EA7A 4YV0A 2W70A 1FNCA 1QIDA 1QSGA 4K9SA 4ZHQF 1G5RA 2IPLA 4MS3A 2FJPA 2JCBA 4LK3A 4DC9A 3PE3A 4D8WA 1KPHA 4F56A 1U81A 1Z2NX 1BGVA 1LDBA 3W6PA 3AY6A 1J70A 1KY4A 4MQBA 4TWRA 2FR1A 4E15A 5JXJA 4Y6SA 2KSQA 2XB4A 1S7CA 1UXKA 2FWNA 5DTMA 2IYOA 4DG8A 4KC0A 2XZDA 3IXMA 2H7VA 1KORA 4ZI7F 1FJGB 2FN8A 1GGVA 1DQSA 1IY9A 3Q0EA 3UJ9A 1AKQA 1SVKA 2OCYC 1G7SA 3S81A 4F5WA 1ZFNA 1VG9B 1WG8A 3EVZA 3KPYA 4WK2B 5HQ3A 5IULC 4E07A 2HA2A 3MMNA 2RG7A 4KBYA 4WI1A 4M54A 1JDSA 2HSZA 3C3YA 1WLSA 4PG5A 1MG5A 3ZPXA 1N2ZA 1NQ5A 3HXKA 1T3GA 3H5IA 3TL3A 2G1KA 4HAYA 3DF9A 4J4BA 3VPAA 5MFZA 2RMKA 3EFEA 4K6MA 4DQLA 5CYOA 2W2VA 5AICA 2KJQA 5JWRA 1FRNA 3B9RA 3DW3X 5EOVA 1VQ1A 3TIVA 1MX3A 4DA0A 4QJ3A 1X70A 5AJZA 3SAJA 3ICEA 2BFBB 4OHCA 4PCAA 2NNLD 3FPJA 4U9HS 2ST1A 3IELA 4LIPD