1GRCA

Crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
193
Chain Sequence
b'MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
publication title Crystal structure of glycinamide ribonucleotide transformylase from Escherichia coli at 3.0 A resolution. A target enzyme for chemotherapy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(formyl)
total genus 58
structure length 193
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1992-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1grcA00
2FMTA 3DCJA 4ZYZA 4EW1A 4ZYUA 3R8XA 1ZLXA 4DS3A 4YFVA 5J63A 1RC1A 4Q12A 2GARA 1YRWA 3OBIA 4ZYTA 4YFYA 3W7BA 1ZGHA 4QPDA 4ZZ1A 4ZYWA 1S3IA 5J9FA 1NJSA 1CDEA 3KCQA 3P9XA 1MEOA 4IQFA 4PZUA 4ZYVA 1GARA 4EW3A 3Q0IA 3N0VA 4NV1A 4TTSA 1RBQA 3LOUA 3O1LA 4QPCA 4ZYYA 4ZZ2A 2CFIA 3DA8A 1C3EA 3TQRA 4TS4A 1FMTA 5CJJA 4ZZ0A 1MENA 1GRCA 1CDDA 1RBMA 4R8VA 1ZLYA 1RBYA 2YWRA 4S1NA 1JKXA 3AV3A 1RC0A 3GARA 4EW2A 4TT8A 4ZZ3A 2BLNA 3AUFA 3TQQA 1MEJA 1C2TA 3NRBA 1RBZA 2BW0A 4ZYXA
chains in the Genus database with same CATH superfamily
1Z38A 4R51A 5DHQA 1JSXA 2I71A 2OO3A 4N8DA 5CM9C 4B84A 3DWGA 4D9FA 2GBFA 4RS4A 3IVGA 1OLXB 2JFQA 4Y7DA 4BQNA 2FFAA 4BEWA 4UKDA 4E6PA 5AXDA 4DMRA 3QXGA 3RTDA 4E12A 2VHZA 4MW1A 4AO7A 1RWWA 3KHTA 1QE0A 1G18A 3AUUA 4WOCA 3W2EA 1M2VB 2Q2QA 1N78A 3BB4A 2DXIA 3FGPA 3DC2A 3H9EO 4ZREA 3ZUGA 4BO8A 4C3UA 3D3WA 1WP4A 1XAIA 2OHFA 2ZU0C 4GC5A 1KYTA 5ICFA 2JIRA 4J7UA 4KDCA 4L02A 4TVKA 5KYVA 3TTVA 3AWIA 3ON5A 2YWXA 3AOEA 5IVIA 3UV3A 3ENKA 4ARBA 4DDTA 3G2OA 2ZWPA 4JASB 3OQBA 4UREA 1QGED 4NRDA 4BAUA 3E9CA 4DJAA 4GR9A 3RIEA 3R6TA 5IDWA 1T5BA 3AFGA 3QLJA 2IE0A 2OP1A 3M5WA 1J56A 2FJPA 1F8XA 3FSRA 1ZH6A 2FFQA 5F12A 1V3VA 1TDJA 4BVHA 4DQKA 4KQKA 1YQGA 5FHRA 3R7WB 4KQJA 3ZV3A 4GPEA 5F4ZA 1EH5A 3P0EA 4PLHA 2EATA 3J81k 1WO8A 1XQYA 4AJ9A 2JGMA 1E2GA 4R8KA 4GECA 4UATA 5EJ2A 3ZU6A 2FZVA 1SKAA 4AJ1A 3KKZA 4XEHA 2WVHA 4RVUA 5IHXA 2FDCA 2BFEA 2OAEA 3CUKA 5D5HA 4PZAA 1XB2A 1FSSA 3HVIA 2WJVA 3LF1A 4I4TF 4KACA 5EKSA 5HIMA 5IVPA 3UPTA 4XWGA 2GPBA 4D4HA 2GKOA 3UFXA 2JZNA 1D8TA 1QH9A 3N2GA 3UPDA 2GHQA 5C34B 3X1YA 5IC5A 3V7WA 3KZCA 1OU0A 1EJBA 4LYHA 7AT1A 4ZQIA 1B3RA 4UXJA 5CLHA 3SKVA 3GLGB 3RU9A 2CJYA 3R3WA 5H3HA 4JN6B 2FZCA 3CQ9A 1F6BA 4FEGA 4H7FA 1NJGA 4JLAA 5IN5A 2PS9A 5IX8A 2W37A 1B8VA 4QEKA 1FC0A 1K3UB 1TE2A 4L8LA 1CZNA 3EBOA 3L1JA 3I5YA 3R7LA 3GJRA 4R3NA 4QUHA 3I04A 2O2IA 3A1EA 2PGOA 4R01A 4JQZA 2WHEA 5HZMA 1UZNA 5EXTA 3R75A 4R40A 4XCVA 5AJXA 5EGSA 3TE7A 4YR7A 4D82A 2YJGA 1DQZA 1MV5A 3AVUA 1G60A 1UANA 3O4VA 3ZKAA 5CEJA 3I12A 3H5RA 4XGIA 4BKOA 2ZZKA 1KNXA 3HJHA 1U2QA 2IWRA 3I64A 2BSQA 1VI6A 3EC2A 1N2XA 3KOYA 4DEVA 1PW7A 5FI3A 3ZWKA 3ZV6A 3TCNA 1DIHA 3PJRA 3L8FA 1MQSA 2YVKA 4DUZB 3CSSA 2R87A 3K6KA 3M9LA 2IUTA 4M22A 4MW7A 5TGDA 3PGXA 1T3LA 1NMQA 3OWOA 4H1VA 4BYMA 3FUCA 4LUCA 2BZ0A 1JAXA 2WWFA 2Y76A 1E3DA 3JX9A 1WUJS 2DWCA 2EC5A 3FFBA 4HFRA 1CE8A 4Y2QA 3LVRE 2DRIA 4Z86A 3U37A 4AYWA 1ILEA 4HCJA 2EZUA 2X7XA 4CQNA 3H18A 4XX1A 2OCXA 1G20E 1GQSA 3T3EA 2AKYA 4CM8A 2NM0A 1RJ9A 3QBVA 5AM5A 2OVFA 3O7WA 4FDMA 5ULLA 1E4EA 4JU8A 1QTNA 3INNA 4BNYA 1HDRA 1PGNA 4OHPA 3D5EA 3AEZA 4R3WA 2IYNA 1VZ2A 2I62A 1SZCA 3SMQA 2WZCA 2HLHA 4U0JA 1TU3A 5GP1A 5LQUA 3QMMA 2YRFA 3STYA 3T7SA 4O2BA 1DX6A 1MQ9A 4A2WA 4YPOA 1H0RA 3ICWA 3ZPXA 4D4JA 4BB9A 5A02A 3IIEA 3UGTA 2CVFA 1QP0A 4HH1A 2PX4A 1QFSA 4E22A 4BUJA 3EIEA 2MYNA 1RD4A 3BDAA 3HNPA 4GSYA 4RGVA 3T1QA 1J42A 3CX4A 3F6EX 4FCTA 1U8UA 3ROEA 5KX5F 2EEPA 2YQ5A 3M6XA 4AY5A 1QWOA 4D9NA 3G5UA 5HF8A 3QX8A 2FH5B 4RM3A 4A0RA 2EFCB 3MGAA 1EJ2A 5HMLA 2VQ6A 1UDCA 5DYTA 1MEOA 1YJ8A 3FPJA 1MT0A 4MRMA 5AVQA 1O8CA 4CR8A 5HK9A 4FS8A 2WJHA 2NXEA 3AY3A 3N8IA 1OIXA 3DLHA 1NHGA 4CMCA 3BICA 1CE8B 1OX6A 2DJIA 3M6AA 1TLTA 5JCJA 2RGEA 1G66A 2DFLA 3HU2A 4AQDA 3H9CA 1VL8A 4C0HA 4IBOA 4WKNA 4DCTA 1CQJB 3ZX4A 2AR9A 1I9GA 2PSFA 2X5NA 5CLIA 4C21A 2YJ5A 2Q6TA 3EODA 5CX1B 4AECA 1JMYA 1Z0UA 5CPBA 3T3HA 4ZZ2A 3VJKA 1U0RA 3PRHA 5EC8A 2JRLA 5DCUA 3K9WA 3V8EA 3W5BA 2QV7A 3ZHVA 4F84A 4G84A 3IFSA 4TTAA 4TKVA 2PUEA 1XA4A 5I3ZA 2I3GA 2VFAA 1U28C 1LW7A 2P4HX 4CCSA 1ZUD1 1YQEA 4RIGA 3L8DA 3RSOA 4OSPA 5JXJA 3H2SA 1N1EA 1GA6A 1WEKA 4YNBA 1C3LA 4RS3A 2PVSA 2R1TA 1GQQA 4ZOLF 3H0CA 2C2XA 3V42A 2BFBB 2C3MA 4EUSA 4E07A 5FLYA 3N3AC 3NEAA 1DCMA 2V1UA 5DNAA 1GNPA 2J32A 4AT1A 4QTZA 1O0BA 3GDFA 3IMFA 4S1NA 2BGWA 2YXEA 4K6FA 1L8AA 1VA5A 2BBSA 3EXIB 4J2OA 2HJGA 2FPGB 5HKAA 4ZRNA 2OT3B 2VUHB 3V1MA 2HW8A 2CJXA 2PL3A 4PGAA 3TXYA 3O92A 1LQUA 3MS2A 4MGHA 2H2AA 2DETA 3W2TA 4ER7A 1J0DA 4LGMA 3A7DA 4RK6A 3H2JA 3GV0A 1PFQA 1E6WA 2ILTA 4MEBA 4U39A 5B3JC 4P0TA 4ZJUA 3FLEA 4M7PA 3VBCA 1P5FA 3BFJA 2VJPA 5ESDA 4GBMA 1C80A 3VKVA 5EJFA 1QANA 4RXTA 1O97D 5DLYA 5J5AA 1T5OA 1D5CA 1GKIA 3HLYA 5EAIA 4BLWA 2V6JA 2YHIB 2OHJA 3OM1A 4TKVB 1I2CA 1X14A 4X8LA 3PICA 1ZJJA 2V4UA 1G7SA 1LLQA 1PDWA 3IALA 5JLJA 4TV9B 5ICMA 2YQZA 2ZRCA 2DZDA 3C24A 2Y0EA 4V0OA 4PLPA 3MG9A 1FVOA 2WV7A 1RMYA 1JWLA 3UPUA 3ZD7A 3KJGA 3IQXA 1CHNA 1ODJA 1XD8A 5TVGA 1CR4A 2KB0A 2W8BA 1LLFA 3QNWA 3CEPB 3WJ1A 5HFAA 3CUWA 5D1NA 3INYA 3NTUA 3SJ7A 5LOVA 2Z43A 5CT9A 5K99A 4CM9A 5EXSA 1JDSA 2FHPA 2Y1GA 3ZHRA 3GEPA 2J9XB 2XNHA 2B8JA 1SB9A 3QOFA 5CPFA 1RZUA 1DIGA 1R4AA 3CR7A 1MB3A 1DIRA 3B6ZA 3R3XA 4NAVA 4WW0A 4YFYA 4HLQB 1BW9A 1PSWA 5HSGA 3TQSA 3JALA 3SHTA 4TL8A 1W19A 4L78A 3V6LA 4EFLA 1PJ2A 1ZJYA 4FX5A 2I80A 4IDHA 5AJVB 4RHYA 2H5IA 4A4DA 4G0UA 5L3ZA 2NO4A 1QHIA 1P2TA 4KDFA 4QUGA 3RRJA 4F9TA 1OGYA 1VC2A 3L43A 5BQFA 1LC3A 2DU8A 2H2GA 2A33A 2F9LA 2JBAA 1BJKA 1F9EA 1E3WB 1E3MA 1ZD2P 2RGBA 4M9ZA 4CLOB 1GL7A 5JFTA 2WHYA 3S8MA 1PZGA 3DAPA 1P39A 1UMCB 3W5JA 2Y71A 1DMRA 5J4KA 4DCSA 2VSFA 3SC2A 1KI6A 2WTAA 3E53A 3KYDB 3NIWA 3TI9A 1T1SA 1WKCA 2X15A 1GG5A 1ZU5A 2ZDHA 3GUVA 5K8UA 1OA0A 3R2JA 1JHQA 1QRRA 3OOSA 1KJIA 3OE1A 1MO6A 4OYHA 1SNYA 3FFXA 4BWYA 3EIXA 5T7BA 1Z5UA 5J1SB 2XKAA 4Y2RA 2ZUTA 5L40A 1ZN7A 2XCQA 3EDCA 3RTCA 5ADVA 3I9V1 2WRZA 1VJ5A 1DAHA 1X19A 2HIGA 4XD7A 3UCFA 5CA0F 4K9PA 3P9SA 4GZMA 1HM5A 4MZDA 1GFWA 2H1SA 3G2QA 3RUAA 4BNTA 1XXHA 1BW9B 4IJ6A 1UJMA 2XT0A 3JALB 5CTAA 2LV8A 1MQAA 1U02A 4DWOA 2JIPA 1YA4A 1Z4KA 3FX2A 3QE9Y 1I0LA 1PSDA 2DFKB 2PMBA 1JPVA 2Y9MB 2VP6A 1KFBB 1ZS9A 4QYMA 4OQYA 3BHNA 3N28A 3NBXX 5THXA 1ZIDA 3OEED 3W5AA 4W5NA 1SC1A 2ZATA 3OCUA 1TU4A 2AG6A 4H7HA 1MD9A 1UZAA 1R0BA 2JLCA 4J7CA 2NYUA 5LQRA 3DFMA 1FW6A 4F9EA 5A6SA 3ZV7A 4Z4QA 4C7OB 3QVWA 3CLVA 1WNFA 2OHIA 2C3UA 3A9RA 3KELA 5DYWA 2Y1XA 3MMNA 3K1ZA 5CYOA 1C0EA 1U9YA 3LY8A 1XNJA 2GXSA 4NZOA 4KN6A 3ABQB 4EY6A 3EVAA 4I5DA 1BKSB 3ESXA 2VHWA 3LNTA 1M1ZA 4KSYA 4JI1B 2ZCVA 2ZSBA 3G23A 2ATIA 1JU3A 2YRXA 4CR7A 5C1IA 1ITZA 5E1BA 4FGZA 1XLWA 1MXFA 3PU6A 1F2UA 4QWWA 4ZC1A 4EG4A 1DC5A 2R97A 2ZVPX 3P1JA 5C31A 1SCUA 1UXIA 5LP6F 1CKEA 3PGMA 1F2TB 1E60A 4YGXB 2CD9A 1CQIB 2CK3D 4JSRA 3SYMA 4CM6A 3MLAA 1REQA 4XFDA 2V74B 1C0KA 1BX1A 1JW9B 1VP9A 2W6OA 3HSSA 3N0WA 4ZAXA 4MDYA 3REOA 4B2LA 1R18A 4NCHA 3MYRA 2B4RO 3IO5A 1JLKA 3RSHA 5JUWA 1PGJA 1X1BA 1V8OA 1RJGA 1YL7A 4FMDB 1N3YA 3GOQA 3THXA 3P9RA 3FDZA 5C3MA 1LA2A 4JJIA 1E1MA 3L7BA 2Z2IA 3CNNA 1QVZA 2X5XA 2BJWA 4M1TA 5IJ0A 2PTGA 4D1YA 3SM9A 3RSSA 1PJAA 4JI7B 2XX3A 3JARA 4BQRA 2MMGA 3DQPA 3RLFA 3EGCA 4O5AA 3TO5A 5ITZB 3EG9B 1H9BA 1FQJA 1KJ9A 3WC4A 3ZGNA 4DLAA 2Q9UA 1EGHA 1V8DA 1SC6A 1H05A 2QVYX 3PCXA 3COWA 4Q4HA 1NMXA 4RPHA 2CXTA 2VHJA 3BCRA 5BOSB 2J3JA 4JVSB 5ITSA 3U3OA 1GTRA 1UP4A 4WFQA 3MWLA 4LWPA 3F0TA 3SXUA 2QS9A 1FDWA 1YS6A 1O6BA 2QXUA 1MB9A 5FR2A 5TARA 2GAAA 1U3DA 5CLGA 2ZT7A 4JZYA 5H5JA 1C8VB 1MW9X 2G63A 2ZT8A 4LVCA 4OVKA 4TN1A 3VI4B 5KYYB 2IFTA 5MDHA 1XVAA 1CUBA 1REQB 1G63A 4JKOA 2HB6A 3TQRA 2WUVA 3X2SA 1QDLB 4O08A 4PAGA 1Z7WA 1IWOA 1MDBA 1T4CB 2VNIA 3DO8A 4DHWA 3HXMA 2FUNB 1S5PA 2NWQA 3CYFA 3TLXA 3G2NA 3U9SA 3L0BA 3THXB 1ZMOA 3BE5A 4HSGA 1SM4A 3FLMA 2C7GA 3ZU2A 3W90A 4EY5A 1TVKA 1XZLA 2XB4A 3PRYA 4PR3A 1W5SA 4ZAVA 1Y6ZA 2B1JA 4RPCA 4MITA 2E21A 2XVXA 3RAGA 1EFCA 3DAHA 3BGWA 4BQSA 5KOHB 2JKVA 4LYEA 3RFUA 3L79A 4TROA 3WSVA 4BP9A 3TNJA 1YMVA 4QJ5A 5DIFA 5FJJA 5IW8A 2HV9A 3EULA 4B09A 1XZFA 3UV7A 1T3ZA 4JENA 3QWIA 3X43A 4C7OA 3IOMA 3O74A 3OPYA 3PVZA 1FVFA 2VKQA 1Y9EA 1KYYA 2ZTMA 1SUAA 1E63A 2ZBRA 2OXRA 2RAVA 1E9SA 1KU0A 3B85A 2ROQA 1B8NA 4GGMX 4INAA 4FZ5A 4XDZA 4A73A 1XK6A 3FROA 1OWMA 3GJ8A 4GUDA 4HMQA 1YXMA 4Q6WA 5CJ2A 5B6PA 2OY0A 3MUEA 1U7UA 3MHPA 3K1AA 4FR2A 4I1RA 1DKUA 2H59A 4PIMA 4TXJA 3OHSX 1YR9A 1TTPB 4F4CA 3HCNA 3OMLA 3CR8A 1YFLA 4P86A 2DBQA 1PV2A 2C8KA 3GCDA 4FSXA 4YI5A 4NPCA 3V1TC 4D92A 5BV0A 2QTTA 4ZVVA 3U7JA 4BCCA 4EG0A 3DVAB 4FHGA 4LQCA 1SURA 1AURA 2XMPA 3HWX1 3IRUA 2VA8A 1ISSA 2XYPA 1HE3A 4GLLA 4A8JC 3HWRA 5M5BA 1EP1B 5TPZA 4YROA 5IJXA 4RANA 3GGCA 2F3QA 4CF7A 2HJVA 3DLCA 4OL0A 2QN7A 4RHTA 4J0CA 4NMHA 2YV4A 3DC7A 4NPAA 4K86A 1RYMA 1E89A 5LMNB 5CG1A 5CLQA 3NDRA 2EEZA 1E5VA 3K8OE 3KWFA 1SIUA 2WWXA 2IOYA 3FWNA 3NU1A 2VPYA 3IESA 3QA9A 4I4CA 3OPYB 3QMVA 4RK7A 5F1KA 2ZIXB 5DBHX 5T8KC 2HC9A 2REBA 2FSUA 5BR7A 1KQFA 4BV9A 1S8AA 1ZNWA 4Q01A 1YJBA 1U31A 1KR2A 1W9MA 2FWRA 3A6JA 3CH4B 3NHFA 3LO8A 3P4UA 1QYCA 5G53C 4DUPA 1VYVA 4EL5A 2R4TA 3JQQA 2QDXA 1G3RA 2P3LA 3L18A 3LUFA 4NV0A 5KQRA 2O8EA 3N0XA 3HXOA 1XCOA 5JS7A 3B1FA 5EPEA 3FPCA 4C0WA 1SVOA 3FZNA 2XHEA 3NNSA 2FKNA 3LECA 4M7OA 1TGYA 4MVJH 2XTAA 2ZRFA 1T5DX 2EBWA 3WIEA 4AU1A 2VAPA 4EECA 5KTYA 2AUTA 3QQPA 3K9LA 3S2UA 4MMYB 4OAOA 1AS3A 2Q4EA 4EVRA 4V0QA 1RACA 2G9NA 1RLIA 1Z4OA 1W36B 2Y77A 3M1YA 4ZEOA 2II6A 4V2IA 3H16A 3C74A 3P9NA 4L07A 1IOWA 1IXZA 2H1HA 3HSKA 1RHRA 3CH5A 1CUVA 3O8RA 2PUJA 2Z4TA 4GXQA 4B4DA 3H04A 3SZLA 5A4MS 5K4HA 1XWWA 4DA8A 1P91A 4TSFD 2XECA 3GLFB 4J2HA 3ZKWA 5H83A 5JQGB 3STHA 1HQCA 3A10A 4CU5A 1DVRA 4ETNA 3C1AA 3H8WA 5KKCA 1EXVA 3JR3A 4DUYB 2JDIA 1RQ2A 1QQ6A 3R4VA 3L6RA 1R3UA 4XWKA 1PJLA 2XZOA 4BFVA 5L3QB 2IOHA 1APBA 2NACA 4D0SA 4IGAA 2Y2UA 3R6GA 4FGWA 1B15A 2ZJ1A 4FFBA 4TTRA 1TMOA 1EMDA 3HXQA 3G0CA 4GQBA 4YO7A 3JY6A 3AIOA 4BWFB 5IZCC 5JWHA 3Q87B 1L1RA 3JZMA 1YU6A 2O8EB 1IWPB 2H11A 1G6Q1 3L0YA 2W2XA 4X0EA 1CDDA 1M2NA 4XE5A 4YRJA 2R6AA 4XIFA 2DPXA 1F1BA 3VR4A 1L4LA 3DYIA 4L72A 3UQZA 7MDHA 4IG9A 4FSHA 1CZOA 1KP9A 1N7IA 3HZHA 4YRCA 3ZDAA 1EXNA 2JVKA 3JWIA 3ABRB 3N2ZB 4Q7LA 1F9AA 3ML1A 4R16A 2E89A 4NJOA 1UL1X 2EDAA 2PZGA 1L5KA 4BNMA 2V65A 4JLUA 3TIIA 1C9MA 2D0OB 3K8ZA 5EVJA 5EHXA 1W2WB 1FQKA 2BP7B 5F76A 2C5EA 2IHZA 1A69A 1FUKA 4CCYA 2B4QA 1RWKA 2WJ4A 2VF2A 3HCWA 3NP9A 3QW2A 4KXVA 2FEMA 1BNCA 4YA6A 5DU2A 3ZKWB 3MJCA 2I0FA 1Z0FA 2YZGA 3HN2A 1VE3A 3NV9A 4YRTA 5C37A 4F06A 4Y2PA 3UJPA 4EAQA 1QB8A 3WNVA 4YTEA 3WGGA 2GPWA 1ISFA 1ZM4A 3F5DA 5LDGA 3T4UA 1Z6QA 1ISMA 1FZTA 1EK6A 3HDQA 2IYLD 3LY9A 4PYNA 4FFBB 3VC2A 1Y3HA 2O4CA 2WUFA 4MVWA 4E5MA 3OZVA 4OB7A 5FWXB 5AXCA 2JANA 3BUSA 2QLLA 2HRDA 4ENRA 4IILA 1QB7A 4BV2A 5CFNA 2ZM5A 1FUIA 3FH0A 1ZPDA 1ESDA 4FW9A 3BKXA 2AEMA 2D7CA 1AB6A 3SQNA 2OFWA 1OJ7A 4RHUA 1LLDA 5JS2A 4AWXA 5KNCA 3TLBA 4H31A 3KTDA 4KXMA 3ZHZA 1SGWA 3FNFA 1IHUA 1JUDA 3K4QA 1V2HE 1Z5PA 2I6SA 1SUPA 3PDCA 4FDVA 3PR1A 4JJZA 5DBOA 5KO2A 2OLJA 3AB7A 3FPGA 4M9QA 4ETWA 2WJGA 5FTNA 3KQLA 4GOMD 2VDRB 3ROGA 4OU4A 3F6RA 4JT8A 2QMEA 5JMPA 2QTZA 2NU6A 4RHFA 1XLTA 1BXRB 1XWFA 5A9TA 3E22B 4EKGA 5HMMA 5LQAA 2ZYIA 3OESA 2D59A 1J8MF 4D0NA 3EJ6A 3UJHA 4EJMA 1UPXA 2JIOA 1T9DA 3IILA 1DBIA 3GLIA 1Z06A 3NI2A 2J5QA 3MQFA 1HE1C 1MVNA 1ONOA 1G291 3NWBA 4HLNA 5DM4A 4W9NA 4ZT3A 4CG3A 3MSXA 1SCAA 1NXQA 2XQJA 1MA0A 1QIDA 1GN8A 1YRBA 1YTUA 4R1NA 3WR5A 4ZQCB 1JKMA 5J59A 1HORA 2FI1A 3GZTB 1ZRSA 4Z6KA 4BS9A 1LC0A 4ZI7A 5FPYA 4X9XA 3V4OA 3PHHA 3DZ8A 4JEIA 2R86A 3I6MA 3BGSA 3WB2A 1KEWA 1XDBA 1YDGA 4L73A 4R1SA 1AIPA 4BMYA 1XSEA 2GT1A 4XDYA 1E1QD 1JA1A 4AD8A 2C7VA 1DP4A 3BTOA 2PJZA 3RTEA 1FMTA 2F1RA 1NW3A 4UPDA 3GMSA 1KZ1A 2H7YA 2H9IA 2ZREA 3WHKA 5H9WA 2VAXA 4M76B 1TD1A 1TT5A 3DULA 2E55A 3KK0A 4M1KA 1N1GA 3DR5A 1RXSA 4MS1A 3HBLA 1QK5A 2Q4OA 3ORYA 2H2IA 3DT8A 1O6CA 1PFYA 1YJXA 3GYBA 2RARA 4GYKA 4JJAA 4IRXA 4MUYA 1NVKA 2WWIA 4RD1A 3VR5A 1NW9B 3WLPA 4Q3AA 2BTEA 1NULA 2NU6B 2NO6A 1O89A 1EX7A 2E4ZA 4M1QA 5AKZA 5KTRA 3UV6A 3CPHA 3GLTA 3UKJA 1SD2A 2Y1OA 2VPPA 1P9WA 1Y4DE 1YAHA 4G4SO 1C1HA 2A9JA 2B69A 1KORA 5HUHA 3GLIB 10MHA 3Q8KA 3LDFA 1L4BA 4IR7A 2FQYA 3D6FA 1VIVA 1K2VN 4FDLA 2OO5C 2WSMA 1DBSA 1NBEA 3EIWA 1IXYA 6AT1A 2R62A 1UKAA 4NVRA 3NNNA 3VNRA 3IYLW 3NETA 3D2AA 3OF5A 4LXYA 1FX1A 2GM5A 4I8XA 4L50A 4QU9A 1SJ9A 4K7JA 4RESA 2FN8A 4DRZA 1FTYA 1K6XA 2ZTSA 2XUIA 4JB0A 1VE1A 4BNJA 4LYJA 2NXWA 2AB0A 3GCWA 5KKAA 3HBMA 5FPQA 2YWJA 2VDWA 3FMPB 1JHDA 1TT5B 4O8ZA 2GEVA 1DZIA 3HUTA 2O2YA 4TV8B 1PFWA 3VZCA 3ZTYA 1SO8A 4IX9A 4ACAA 3CPSA 2BVNA 3GA0A 3PXXA 4HG2A 4TV9F 3K0SA 3DCJA 3BZUA 5AJZA 3SIXA 4B6EA 5FAXA 1EK1A 4ABYA 1PVOA 1P1HA 4KWCA 2GM4A 3OURA 5TR9A 1G0NA 1GCIA 1RRVA 1X80A 2CDNA 1AE1A 1N25A 3DHWC 2HQSA 1DFIA 1MX5A 2C1XA 5EFZA 1XCPA 4PSVA 4LJ7A 5EY5B 3V46A 1EK2A 2JFPA 3UNXA 5D7BA 3NM5A 5L6LB 2G7MC 1U3WA 2IIVA 1MBZA 1HQYE 1RXIA 3VNBA 2EVWX 1CSEE 5ALSA 3W34A 2O5EA 1G55A 1T2DA 3CBGA 1D6JA 2WW8A 2P2ZA 2HADA 3GYGA 4CQMA 2HU2A 3CZRA 2QNRA 4INJA 2IYFA 1ZGHA 3OJWA 4KRXA 4L5CA 5DT9A 3DO5A 4YRPA 2Z5LA 2ZSFA 5FV4A 3EQ6A 3I76A 2RHDA 1VBKA 2F48A 5D5QA 2GVDC 1XF1A 3N6VA 4AZWA 4W1QA 1Y9DA 1KQOA 4QREA 3IOBA 1T8TA 4LSZA 3OEYA 2FSIA 5DN6A 1UZUA 1FS4A 1M0WA 3DSRA 5C5EA 4JVLA 1PX0A 3RC2A 5KDOA 2I1WA 3ZHUA 1Z36A 4C0XA 4X6UA 4DE5A 1NJ5A 2RBEA 3O5AA 3VR6A 4KXWA 1KP2A 2QQEA 4HQNA 2F3TA 1Q3TA 1U8CB 1L8XA 3RG2A 1L8OA 1NI3A 1FMCA 1S89A 3IQDB 2J7PA 1MVLA 2D7JA 3S2FA 3RABA 3VC7A 4HR7A 3JWJA 2RK4A 2PKCA 1M7BA 1F0KA 2H2WA 2Q3DA 1NFRA 2TYSB 3HG7A 1KGSA 3IR5A 1G9XA 3AL2A 2JB9A 4E94A 1FFHA 4BO4A 5CAEB 5K3DA 4DC9A 4QDKA 2NO7A 5JO0A 5BWOA 4E03A 5LOVF 4G1BA 3SLRA 5KYXB 3GZJA 4FLEA 4ARZA 3VSBA 2O5RA 1OASA 2YXBA 3FY4A 4JI6B 3G13A 3GWGA 1NXVA 2RHWA 4CQMB 3MCZA 4ZEMA 4XPIA 2CCKA 1RABA 3DT9A 1R16A 5BV8A 1A8IA 4N48A 4ARCA 1HG0A 1V37A 5A5GA 3V8MA 3DE0X 2W5UA 4QDUA 1LJUA 2X22A 1PT5A 5CVEA 5BSRA 4OLAA 4LI3X 3QE2A 2BV3A 3PE4A 5KWEA 1VIYA 4ZVRA 5AOAA 2RCYA 1WXIA 2YIJA 5FOSA 1G42A 1HDIA 1L3BA 1JFFA 1K7SN 1L8QA 1U9IA 2DLNA 2DBZA 4L9RA 5DCYA 4ZU6X 5KJEA 1KQNA 3S70A 3V1YA 4E4YA 3REQB 2AFHE 3CEAA 2VYQA 5FYQA 3ZBUA 1DQYA 3PXCX 3L8HA 1EIZA 3LC7O 5LDHA 4YYZA 2B34A 4CFYA 1H3FA 1H2XA 1GKKA 3LVBA 4B8YA 1LLUA 1N8NA 2J6HA 1KEKA 3HDYA 2VSNA 3RVRA 5JU6A 2AMJA 2NYRA 4YWJA 5CXQA 5HRAA 2AUNA 5IKEA 1VE7A 4TMVA 4UM9B 1P4JA 3UAWA 1ODKA 1V5IA 5DP1A 2VDJA 4OL9A 3OQOA 3KPJA 5JR3A 1P0FA 1ORVA 5J1TB 4CU2A 1ZRMA 2EW2A 4MKHA 1T9ZA 1R7RA 4KAFA 2VNJA 4EKEA 4ARZB 4V0RA 3LUPA 2OSVA 3T5BA 3D0QA 821PA 1BDJA 1Q6YA 4LG1A 1Z25A 4HN9A 1Y5RA 3E9DA 2BM0A 4G07A 4JK3A 4UDYX 5G1PA 2HXGA 1KRHA 5A3VA 4CV0A 2QY9A 1VMDA 4TYYA 2H7XA 3LXRA 3MSCA 1ZLXA 1C2YA 3I09A 4K2HA 1KI7A 2A9KA 5FJIA 2B9EA 4OSEA 1THZA 5B58C 4C4SA 1X0VA 1RI3A 4M0PA 3I23A 3TINA 3IP6A 4PHCA 4GVXA 4DDUA 4WNYA 2ZR9A 4FR5A 3PQFA 4DT1A 5FOQA 1K5DA 1N0WA 121PA 1M76A 1Q21A 1SQSA 3EWNA 3CLRC 3FZQA 3IT0A 2NT4A 3T0IA 3N8KA 4CKCA 3RK4A 1QF6A 2PKRA 4M1ZA 1YZFA 4A6EA 5K0JA 3MXOA 4B32A 4OLJA 3G5AA 4TMZA 2CJPA 4PWZA 4W7SA 1DJLA 2RG1A 2QRVA 2XEXA 3JQRA 4EW6A 5DRTA 3RREA 5B1YA 2ODPA 1V16A 4AKIA 2GXAA 1SZDA 1Z68A 2VNKA 2V6MA 4Q1EA 1EUYA 2Z8ZA 3KPWA 1E96A 4WOBA 2HWKA 1L7DA 3QUQA 2FSVA 2XOKA 3UT5A 3ZS8A 4ZYVA 5K3SA 1AQ6A 2PH1A 1VIAA 1YQ9A 4GXTA 1BWSA 2DBRA 4JNCA 5EIBC 5C18A 3ONEA 2E18A 4TYNA 1MJHA 1N0HA 1Z13A 3D0RA 4HQ0A 4LX0A 3LGAA 5AVSA 1H3EA 3F3KA 4OYRA 5L53A 4TKUB 4I1OA 5ICGA 4YHBA 1YQTA 5LQDA 2I9PA 3ILVA 4UUNA 4QVIA 1JVNA 3AVPA 2BHTA 1WOMA 2R1ZA 1U9ZA 3MWYW 3CXUA 4U9UA 5H59A 1I2BA 1ZGGA 4YMLA 3M3HA 1EVLA 1KEPA 3PPIA 3H05A 5EFOA 1Q0PA 2Y1LA 2YCBA 4ZCQA 2FWMX 3LKDA 1T1JA 1NAHA 3FAZA 2NIPA 3OPMA 4GHWA 2BGNA 3AJ8A 1I7QB 2L17A 3LUBA 2PJDA 5D87A 1LB1B 3R7AA 4G1UC 2Q9BA 2QA5A 2P0AA 4AWAA 5EKUA 4I55A 3UM9A 1I1HA 1IRXA 1E2UA 2W7TA 3DMRA 4FT2A 4NSNA 2A9RA 3GJ5A 2NT3A 1LDYA 5DLEA 2P9ZA 2NUBA 1RBYA 2W22A 3KSRA 1V16B 3PFNA 4OGFA 3QVMA 3NATA 3DEJA 5FOXA 4UCXA 1PW5A 3FDIA 3K0EA 2B8EA 3NTLA 4GU5A 1EXWA 3BMOA 3C8MA 3TNYA 3UT5B 1OWPA 2PS1A 3FAKA 4MUEA 4Z49A 4QL3A 4P4TA 3KOOA 3G7UA 4LYYA 3CZ4A 3VSDA 5DWQA 4J91A 2FCAA 3D0OA 3VKHA 5FEUA 1XQXA 2F3RA 3NOVA 2VN8A 4DCUA 5ALRA 2I6XA 1Z8FA 2JFGA 2FN7A 2H85A 3ILHA 3R5XA 2Q27A 1M54A 3I32A 3PGJA 2C4VA 4K9LA 5F2EA 2J3DA 4DCGA 1W4RA 1BXKA 3W1EA 4F46A 1N7HA 4BKUA 2DFNA 4DYDA 2H63A 3KJZA 1UK7A 4LOKA 3R7NA 2A14A 1IBRA 2PRSA 1M9NA 1Y3BE 2EGHA 1XV5A 1ZW6A 3KJQA 2PX3A 4Q1DA 1RQPA 1XCGB 5BSFA 3B2EA 1CTQA 3X1WA 3SLKA 1WD7A 4J6FA 1LRLA 3OEHA 4X1YA 5TJ9A 4Q03A 2GZ3A 2QJOA 5DTMA 1IZ7A 3FDXA 3O8CA 3CUTA 1G2IA 2WU4A 2Z8XA 3AIKA 3TM5A 2ZJOA 3QYAA 1W48A 1RXUA 5KWVA 1YRAA 2Y6UA 3M2PA 3VKWA 2NO9A 4XDHA 1AMNA 2MSLA 2JAHA 3Q3EA 4IUBS 4K9QA 1XEWX 2EF1A 3P8ZA 4L8GA 1HV8A 4F86A 3C15C 2JARA 3SFVA 4V0LA 3AILA 3W1VA 4CJXA 1QC5B 3L06A 4IHAA 4M8IA 3CE9A 3QU9A 1QO0D 4BMPB 3S1LA 1GIAA 3M83A 1J0AA 3L7JA 4P83A 1R4MB 4BLQA 4ZVOA 4WNAA 3C3BA 1XMJA 3E9ZA 5FOWA 4YX9A 3EAGA 3L8CA 3DDCA 4ND5A 1TLFA 4E5KA 1E59A 4R5MA 4YK7A 4Y67A 1TEZA 4OI2A 1VHJA 1IXSB 4OB6A 2PSJA 2C7QA 5E38A 4C03A 3Q6MA 1IK4A 4PLGA 4XSVA 5K51A 1QO7A 2PRKA 5BNIA 3LHFA 4LBWA 3OD1A 1XRLA 1M34E 3H2BA 2EHJA 4KIJA 3OEWA 4QPCA 2AWOA 4IDBA 1JEYA 4YP6A 3V4FA 4C2UA 4N8SA 1HYEA 1QIEA 1SAYA 1V7ZA 3ISTA 4BJHB 3WL6A 1JB9A 2QUKA 4KW7A 4FMBB 3ER9A 4X1YB 4G5YA 4WVLA 2ZYVX 1TQHA 3H99A 1Z7BA 3IV7A 4IQ4A 4TS4A 3VH1A 3F78A 1N5RA 4G5OA 4I1YA 5AVZA 5JQGF 2N46A 2ZXEA 3R74A 4EUHA 4BLOA 1MO4A 2FCRA 4MKZA 2OP0A 4XVQA 5KTOA 1FNCA 1GG8A 2JKZA 4C0LA 4GWKA 2E0IA 3B1XA 2P9CA 1ZGAA 1Z47A 3E9QA 3T3MB 4R1QA 1NG9A 1SUDA 4MW0A 1WB4A 4MRRA 1EEHA 3AEKA 1MPTA 1XQWA 1Z8NA 3I2FA 4L4SA 4H17A 1TCAA 2GPSA 2I6FA 3DBLB 4K5QA 2J07A 4D98A 3ND6A 4EHHA 2AH5A 2H1FA 3HFSA 4DZTA 4JY7A 5KSWB 3ADCA 5CNJA 3RVJA 1UBTS 1YQWA 1W5EA 4WNAB 4Z0TA 2JFYA 1Z4PX 4HT3B 1TQ6A 4FDAA 2JLVA 3CVYA 5ALDA 1G8HA 3MC1A 1HOTA 5IWCA 1LGYA 3S99A 4AKSA 2C5GA 4L4UA 4BB0A 3HB9A 2PKQP 3G17A 4CL2A 4UTPA 4US2R 3TNFA 1A50B 3LQ2A 3OC6A 3QPVA 3RNLA 1J0BA 4FYVA 1PR3A 3TQQA 2EARA 1SWWA 3FJOA 4Y9UA 4AF6A 1U2DA 1SC3A 1YR1A 3JYHA 2BJVA 1I8TA 1QQ7A 4HNAA 2BMAA 4IMIB 4ESOA 1JEYB 3DG9A 4QM7A 3EPHA 4H7IA 1CF2O 4EHAA 3DGEC 4DNPA 3E27A 2O2HA 4YRMA 2A9OA 3O8LA 1P4RA 4NMXB 1ZI8A 3KQMA 4W63A 1G41A 1ST2A 2VYVA 1U9CA 3IAXA 1JG4A 4L0DA 2YY6A 5BUCA 2DR3A 5EMMA 4WQMA 1UWCA 4XCQA 2ODTX 5IM5A 4ZJPA 4PM4A 2CDRA 4BQEA 1R10A 1GJRA 3H0EA 1AB5A 1H2WA 1K98A 3R6LA 4XWYA 4BGEA 9ATCA 2QTAA 2IH2A 3WWCA 2ZT6A 3HZZA 2C4MA 3RVNA 3S68A 3SQMA 2DBVO 1NLZA 2W2NA 1IATA 3AEKB 2H0QA 2QUJA 4RQBA 4WFIA 4OP2A 1LZKA 1ZZEA 4Q48A 2PT7A 4Z9AA 3USCS 2NXNA 5K6AC 2GYYA 1BA2A 1V8FA 3DVQX 3JQGB 4OFXA 4UQPA 1J0XO 2Z2JA 3WLSA 1RU3A 1Z82A 1PJQA 3D43A 1RKXA 3LDHA 3IT2A 3LQ4A 3QVGB 1ML4A 3JYNA 2BTOA 5JISA 3QYPA 5ALTA 2HDOA 3RIGA 3KHUA 2Y68A 2I3ZA 4V0MA 4NU8X 5HWSA 4MXDA 4MKRA 2JCBA 3NHWA 3JPYA 4QO8A 1NJ8A 3KQSA 4WINA 4L1KA 3I4CA 1MABB 1FSGA 3FMVA 1GL6A 5CNKA 2A1TS 5IEBA 3IERA 3UGKA 3MN1A 1KE2A 4EARA 4URVR 3VUEA 4F8YA 3GP8A 3DOEA 2AT1A 1DC6A 2OBFA 4FBLA 4B7CA 4AJNA 1QPBA 3PGA1 2ZI7A 2HSJA 4KWTA 3SD7A 5LBTA 4F4HA 2PG3A 2ZVDA 2XVMA 3LRTA 3QVSA 1C5KA 4GBED 3NOOA 3BH7A 2W0MA 4HZUA 1FMLA 4RQUA 5LLSA 3X2EA 4E5YA 5C81A 1I7DA 3AHHA 1JR2A 5KJ1A 1AX9A 3Q7SA 3NFYA 1G98A 1R4ZA 1LBTA 2Q8PA 3F8TA 2BLLA 4ENPA 3EA0A 3BJMA 4LSMA 2QROA 2BKLA 3R40A 4G5FA 3TKAA 4V3CA 4A1FA 4HP8A 2ZIWB 1W5AA 3OY2A 3EEOA 3D4IA 5SYAA 3SICE 3TX6A 5GV7A 1DIOB 5DHRA 5A3RA 3KR2A 2PBRA 4HEA1 3DCNA 1OW3B 3K3PA 4LV6A 1EZZA 1VM6A 2BEWA 4MYDA 3VR3A 3WGTA 1X1DA 4DSAA 3KTOA 3NM6B 4BFXA 5C2JB 2NTJA 3EDOA 2PR7A 1ODIA 3AF2A 3K15A 4HRYA 4AF8A 1B1CA 4V38A 2VUSA 1UFVA 1SHZA 1TZBA 3MXTA 1PNRA 4TXLA 3GRFA 4U8HA 2CSUA 4HXEB 3FYUC 2Z1MA 4RVCA 5CLLA 1G21E 5AYVA 5JVDB 1EVEA 5CDTA 3AEXA 1ULHA 4KO2S 2G88A 3L6BA 4GBJA 4MUNA 1QYIA 3O03A 4BFZA 2VSQA 4TLEA 4FFMA 3S2YA 4AZ0B 1ZC3A 4Q7KA 2WVAA 5FOTA 2IEZA 3LZCA 1B74A 4ZVMA 3RKUA 1AO3A 4BBAA 5BR4A 2AZXA 2OXCA 3HHPA 3MM4A 3WP0A 1QF7A 1ZUWA 3G79A 1R2QA 1NWHA 4IJVA 1U8TA 1BKYA 2PN1A 3AUFA 3D9QX 3HFJA 3NV7A 4D02A 1MT3A 4FN5A 4C78A 2J9YB 1QBKC 3RYIA 2ZTUA 3LT0A 3OE7A 3Q5EA 3GQVA 4I6EA 4QGGA 3W8EA 1FYWA 3PS9A 1G4AE 1A9QA 1RYHA 4PG4A 1COWD 2NV6A 4ARSA 3B60A 3MQ2A 4PRKA 4AKTA 5E6UB 2FFJA 3STTA 4BMSA 4EO9A 1Y9JA 1BYUA 3L6DA 3VPBA 1K4KA 2BEWB 3U62A 1YB7A 4BO6A 3QWAA 1JYSA 2MCFA 2VJMA 2F7SA 3G0GA 1FRNA 5E0OA 1P0QA 2HXYA 2JCSA 1ZL2A 3W6ZA 1UUFA 4NS1A 1USUA 4Z2YA 1SULA 4ENWA 2QHXA 5AKEA 4J07A 2IZ6A 4FNOA 3ZE8A 4AY2A 3CRZA 3MS7A 2WB4A 1AKWA 3FYCA 5CURA 3BMQB 4XWTA 4N18A 4CMKA 3L40A 5GJCA 1Z0ZA 1IJFA 3KLPX 3PZBA 4CEIB 2YHUA 4TMYA 4CMEA 3GMIA 1GRNA 3HB1A 1BKDR 2QPOA 3ZJ4A 3WADA 2A0YA 4UBIA 2I6QA 4YMTA 1RAFA 1L2TA 1JH9A 3S2ZA 3N7AA 4D8UA 3GPLA 4H15A 4Z4FA 4ZYTA 2YXLA 4DR7B 1RT9A 3I53A 1X7ZB 1YFZA 3A05A 1U5BA 2P6PA 5B3LA 1S2LA 4RSHA 1G20A 2IPAB 4CDGA 4DXAA 2DYKA 1VMKA 3HY4A 3P9XA 3KBBA 1OGJA 3P9YA 5H02A 1QHEA 3GXBA 4EFDA 4HH4A 3CZMA 1DFHA 3VR6H 1QHXA 4JJGA 5D2CA 1E0AA 3HDHA 3H7IA 3SBDA 1LBSA 3BK2A 1R6AA 4MMXB 4YXWD 4FI3C 2VJMB 4Y1FA 3OP4A 4LISA 4QXMA 4M1MA 2VEOA 2C88A 3AHEA 3ASYA 3JQAD 1PDOA 2IU3A 3NTOA 5B1DA 3THOA 5C7OO 4P4SB 2DM6A 1L4FA 4WT7A 5AM2A 4DR1B 3WISA 1HOXA 3VR2A 4NQRA 1X8KA 1VJCA 5K8JB 5CW1A 3NZEA 4L51A 3VFDA 5I4KA 1GCOA 3BF7A 4HB3A 3GG9A 1LSOA 1AZLA 1A4RA 1YS7A 4QXRA 2E3JA 3O2QB 4RTJA 4HL6A 1NYTA 4YDSA 4QEDA 4K40A 1B42A 4DVJA 5ENDA 1KK1A 3PNVA 3AUKA 4AROA 4JEMA 4OF4A 2ZU6A 4YV2A 1A71A 2EX1A 3VYVA 1XPJA 3MWFA 4BTLA 4MIEA 3K2EA 3D8SA 1RHMA 4Q9AA 3NRJA 1U5BB 2FEOA 2NTVA 1HL7A 4UCQA 3CF4G 3ZN2A 5B57C 6ADHA 3PITA 5I47A 3QXXA 4E6EA 5KTMA 4OOEA 5FLEX 5EHNA 4R2JA 4LXGA 1LQTA 2EV9A 1YB5A 2PZ8A 2BF4A 1P80A 3P0IA 5JQWA 1SU6A 2VZ0A 2YC4C 3MAGA 1HDOA 1IAVA 3L6OO 1E8NA 1E0JA 4WCVA 4PGHA 1DTEA 1NUHA 1R8XA 1SXJB 4XTCS 4EJ0A 3T7IA 1KF0A 1RRMA 1UF9A 2C9DA 4ZOEA 3SZRA 5L4NA 5BW5A 4A5OA 1JB1A 3A2NA 1M8FA 4HATA 2XCTB 4FFVA 4B3FX 1Z37A 4R9UC 3DMFA 4PO1A 1K9VF 5LZ4A 1R0KA 4JD5A 5AVTA 3FPHA 3F71A 3QW4B 2ZIGA 3OU2A 4M9CA 5B4UA 3P32A 2WKSA 2RHCA 1F4VA 2OG1A 3LBAA 4OXNA 4YV7A 3R8FA 3HWWA 4UFOA 5D84A 2PMWB 2UUAB 4MQFB 4TTQA 5HKKA 5CT8A 7ADHA 3PUIA 2FSFA 2YS6A 2OKCA 1L7PA 4RAOA 3M3DA 2OB2A 5JH7A 1NRIA 4D80A 2IXGA 4DZZA 4PNPA 3UJDA 5JASA 3ZY5A 2Z2YA 1RIIA 3H65A 2GVNA 5LJLA 3GUUA 3U7QB 4GI2A 4RHXA 3BJEA 4IMRA 1UXJA 5D01A 2IK8A 4AS2A 2ZTVA 3GRRA 1O5OA 3DLTA 4FYHA 1EWRA 3UWOA 3K05A 2CJWA 4DBVO 1OIWA 2YMMA 4NYMR 1T0BA 4E32A 3B3QA 5J63A 3FPBA 4DW8A 5E6SA 1FSPA 3ZWPA 4GKVA 2CF5A 4MJ3A 3MS4A 4BL5A 1NPYA 4YY3B 4LF7B 3GZNB 3IE0A 2QXTA 3P9ZA 4QJBA 3M6UA 3RM3A 2HZ7A 2X8BA 3V8BA 5KHOC 2C0PA 3FCAA 3VGPA 1OH6A 2PA3A 1ZWKA 4UXIA 4Z4HA 1BO6A 3ELBA 3KWLA 3PD1A 5F4BA 3H8VA 2XRYA 1GEGA 3W5UA 2GYWA 3CGGA 1ZXLA 3KEGA 2ZWIA 1KMHB 1Z83A 2JJ1D 2WSIA 3DNFA 3P2JA 5IAGA 1JT2A 4BOYA 4JXKA 2HQ1A 5IMBA 4F4JA 5LIRA 1IDOA 1P19A 1YS2X 2EKBA 1F14A 3H19A 4EKIA 1EBBA 1JIIA 1EK0A 2VJOA 1TUGA 4Y1GA 1C9JA 1TPZA 4JBXA 4DQ0A 1R0CA 2UZ1B 1B76A 2ILVA 4PANA 4RORA 5TQ0A 3IPAA 1P9LA 2IY8A 4AMVA 1O03A 4ICIA 4YRQA 2BKEA 2A0FA 3V4RA 4LVUA 4MKFA 2PZFA 3H6KA 3EEQA 2VHTA 5FAKA 2PKWA 2RGGA 3ZW7A 2C4UA 2G82A 3FRJA 1DKRA 4L8YA 5EP2A 4CT0A 5IFLA 3S40A 1A9TA 1E4YA 1OYOA 3A4IA 4HX9A 4KVGA 4LJ5A 4C0KA 4ZVSA 3D6TB 1KS9A 4K6OA 4HWPA 4UZSA 1ZRNA 2V5AA 5K8VA 1L7BA 3TS1A 5A4DA 3BIWA 3HYRA 2FMKA 1HE8B 4IRUB 5AHWA 4N7BA 3TLJA 1FPQA 3PHIA 3W5IA 3T9AA 1N1MA 5KYTA 1QQ5A 3OCWA 4GM4A 2HF2A 4P4UA 4D9KA 5KJFA 1QG4A 1AT1A 3CUSA 4U2KA 1I51A 2AG1A 1IONA 2SNIE 3AFNA 3DKKA 2VNAA 1R9MA 3E2IA 3HO8A 3HRKA 1G8JA 3CRW1 3GGDA 3MA0A 3BHIA 2I4IA 2QVLA 1W29A 4G4JA 4QLOA 5DBFA 4RTPA 1NPDA 3KSDO 1IUOA 4RK0A 4TYQA 2ZJFA 4JEUA 1M8GA 3PI7A 3I61A 4IYRA 5ERGB 2ORWA 3EQ7A 4JR1A 4XGNA 5LA6B 4QU5A 2P91A 4WPGA 1P5ZB 4DV7B 3W3ZB 4MW5A 1NBAA 2XXBA 2V96A 4N3NA 4LK2A 3B9PA 3IDZA 5KSZA 1VLLA 2DR0A 4UUAA 2BFCA 4C4AA 3V2GA 4QD3A 2WTUA 4MP8A 1QTQA 3BJIC 4NBSA 4KIUA 2E4WA 1LNQA 1QGOA 3C4QA 4ZTBA 4FI3F 2B94A 2HA7A 4YAIA 5SY6A 3UB2A 3WSTA 1YSCA 5CHEA 2SKEA 1GPYA 4CMAA 1GQ2A 4KB5A 5LNK1 1AZTA 4BP1A 5KYWA 5KYGA 3ERCA 1NYQA 2NV2B 3FPAA 5IJZA 1UKZA 2DC1A 3V4SA 2XSZD 2YCLA 4JQOA 1ZSNA 2NQ8A 5KOJA 2FUKA 5I7OA 3H42B 3ADDA 1E79D 1NU8A 1WXFA 3T7CA 4YUZA 2BKXA 1JR3D 1T9HA 3DFIA 3QBDA 3FFWA 2RAFA 2GCNA 3FD8A 3UMFA 1TZJA 4A2PA 5KVVA 2YWDA 1OBOA 3ROZA 4B44A 1YOVA 1HQDA 4XGRA 2EGUA 3WWPA 1N1DA 4HUTA 4P80A 3TBHA 1TIPA 4FR0A 4J0DA 3NOQA 2BHLA 2CL7X 2REOA 3HBAA 4NHOA 4KR9A 4BY9E 3O8OA 3OIYA 2LDBA 2R1VA 4D97A 2ZSIA 4L4RA 3Q10A 1UC8A 2XR1A 4ISCA 1OLUB 4KNWA 4OQMA 4R31A 1L4NA 1MIOB 1XMXA 2F1HA 3LOQA 3LV8A 4ZPJA 2I78A 2GZDA 5AKGA 1UM9A 3RFFA 3WHLA 1AQNA 2RCNA 4TLBA 5HQJA 1EQUA 3CH6A 2OFFA 4EYGA 1J09A 3I5AA 3QXHA 1B2LA 1XRMA 2GSWA 1JR3E 4NBUA 1OB2A 4NJMB 2ONCA 1V3QE 4GOLD 3W5CA 2EZ9A 2JBWA 3RCBA 4IIXA 4OJQA 2RJNA 4P3OA 2XUGA 1HG1A 3A14A 3BMNA 3JQCA 1SFRA 4YECA 4E08A 3WSWA 3GFQA 2OHHA 3VVCA 1WKBA 4OIFA 4ERNA 4AJPA 4GNKA 3MBOA 3WWYA 4KNYA 2BFNA 2HCJB 3CVUA 3L6UA 4X24A 2MSDB 4B76A 1H8HA 3B9QA 3IBGA 1GCGA 3R3ZA 1I14A 5EGNA 4R7ZA 3EWIA 5IDVA 2JIZD 1JIKA 4PLYA 1ZO8A 1OYYA 2ZDGA 2ZJ6A 3KRTA 4PV7A 4AP6A 4BB5A 3D4BA 1P2FA 2A9VA 1MORA 5JNSA 1GNLA 4IIDA 4GDMA 1PF7E 1LSJA 5BN4A 1M2HA 1OTXA 5AW0A 1U7OA 4YLEA 4JYCA 3WMFA 3KXDA 4GRIA 4GVLA 3IQGX 2CEAA 3TUIC 4EO7A 3CS3A 1OPXA 2R25B 3NTVA 1EQ2A 4W1SA 3L7MA 4LOAA 3BHJA 1TA9A 3LXXA 3M6MD 1BQEA 1YBHA 1X8XA 3FOWA 4HXGA 2AFIE 2CLHB 2PT9A 3QGMA 4MI9A 1ULSA 4GGOA 1KQGA 1SXQA 4N39A 5HVNA 5KSYA 2GD6A 2BE7A 3MGKA 3A1NA 3CZ5A 1NNEA 2HK6A 4HPJB 5I7AA 4GXRA 1SKYE 4YCDA 1U80A 5E3IA 3HP1A 3PIDA 5BVHB 3WLLA 2CMFA 2GF0A 3C5WP 2GQ0A 1ZLYA 4X62B 3A0UA 1YJ5A 3PJDA 2Z4SA 3URKA 1CFZA 5H70A 3V8RA 3EC7A 4OQLA 2V7QD 1U81A 1QGZA 4AJ4A 1D04A 4F1JA 1GL3A 5A5DA 1II8A 2XA2A 1N2HA 1M6WA 1WG8A 2ECPA 2R79A 4X6LA 3WIUA 1DXQA 1JTVA 3B3AA 4HGZA 3MK31 3GJ6A 4KNVA 2G28A 4U2DA 3SP1A 1D2MA 3CN7A 3QTTA 5M29A 3QLTA 1NI4A 2ADFA 2HSZA 1K75A 1Z4MA 2ZPAA 2YBDA 4NCXA 1VG9B 4OFBA 4KTVE 3RADC 4M83A 4EPXA 3W3AA 4TLDA 2LR0A 1VSUA 2PDAA 3ULKA 4RULA 1BE1A 3IIIA 3DZHA 4CIAA 2G7ZA 5BN5A 2QRHA 3FVRA 2SICE 1AKYA 4XLTA 5DO9A 5CGQB 1V1RA 4NNOA 3MOIA 3BXFA 1EP9A 5GPBA 1N4DA 4LOHA 5A03A 4P3XA 1TKBA 2AE1A 3NPAA 3MWDA 2ESRA 2PA0A 2VKTA 9LDTA 2P69A 1RDFA 2UZAA 2WWVD 2XOEA 3V80A 5I7FA 2J0VA 3ANLA 1JHRA 4QELA 4RIHA 3IX7A 4ZVKA 1ESCA 1U5AA 2HF8A 1WXQA 5LM3A 3BTVA 3AM3A 6REQA 3S0JA 4U6SA 2Q5IA 4IAOA 3ZCUA 2AR7A 2FPRA 4LTNA 4ZGWA 3Q9LA 4XM2A 3RIXA 1ESNA 3MQ4A 1IHYA 2VP2A 5K2OA 4OGLA 4LYAA 3KJEA 1HYBA 2SHKA 1IZ9A 5F5NA 3VJLA 4ERXA 5ALMA 2B5WA 3PNSA 5IT5A 2ZCJA 4FFSA 4IH4A 4OMCA 2HBRA 4WN9A 1MOPA 3LY7A 1ISJA 2JFWA 3FTNA 4NCKA 1NI4B 1OHHD 1P6QA 4QUKA 3UIEA 2GX6A 3FNQA 1I2MA 1AKNA 2H4ZA 3HKDB 3OIFA 3OPNA 2G07A 4MH0R 5IVDA 4BN5A 1OT3A 2ZQZA 3H1TA 1XZQA 5G1OA 1Z6ZA 1QIIA 2ZBVA 1BN7A 3DMTA 2PU5A 1XCBA 3LYAA 1T8WA 3MCWA 5HHTA 4E2FA 3AGPA 5LB4A 1UMBB 1V1RB 2PYDA 4LHZA 1NFQA 5JEEA 2WSYB 4EI8A 3EF3A 2O2SA 3CXRA 3DPSA 5A5FA 4HWGA 4N49A 5JNRA 1FS5A 4X20A 2M9MA 3DW3X 3TIVA 1TUBA 5K7SA 4BNWA 1EJ0A 3HS3A 4KR0A 3V1LA 3NC0C 4Y98A 1DDOA 1R6BX 1AN9A 2NN3C 3L7OA 1SHJA 4D6YA 3LC1O 4J1TA 3OI7A 3TUZC 2GN4A 5FQOA 2XNDD 1GLGA 3BEDA 5DFAA 2CLEB 1PP4A 2P75A 1Q2UA 5DHFA 2BZ1A 2HZBA 2KLBA 4P38A 5BNFA 4FZJA 5KNBD 1A95A 2X2FA 4ZIRA 4Q93A 3S28A 4DNFA 1XC7A 3B36A 1U7ZA 2LWIA 4CF6A 1ODLA 2JK1A 2P6MA 4WBNA 5KSOA 5M3BA 5IKMA 1OV6A 3GIWA 3OFKA 3U9TA 4DSUA 1YB4A 4YCAA 1W36C 2CE7A 3YASA 6NULA 4NONA 5EE9A 3T7AA 2F4NA 4IQGA 5JVDF 4PY2A 1FTWA 1KSHA 3WQHA 3E7WA 2F3SA 4IG4A 1P77A 3X3HA 3QFCA 2BH9A 2V45A 4ZCIA 1XJ5A 1RTTA 5E1DA 2XIQA 3H5AA 3LLSA 3L41A 1G2OA 3P2IA 4ZZ3A 1OXXK 1YBFA 3DAOA 5ER6A 3N3BC 1UBJS 3H13A 3PVCA 2OCDA 3TTTA 2ZR0A 4C2BA 4JA2A 1YWGO 2JZCA 2QK4A 3CTMA 3ZLVA 5CXUA 5F5XA 5JYDA 2I7VA 1MP0A 2ZGVA 2OZKA 4R05A 4X20B 1T6BY 3TTYA 1AS2A 2QJRA 2QLMA 3WX0A 4UHFA 4OUKX 2HF7A 2GEUA 3FSEA 3G8BA 2J6IA 1NBME 4ND6A 5CYPA 4UMFA 5K3CA 5KU7A 4TSFA 2JD2A 1POXA 2Q0HA 4KQ6A 3EGWA 4ZK2A 1RLTA 3QFHA 4GR5A 4MQUA 3ZE6A 5AW7A 2AYYA 2CC2A 2G1PA 3RHTA 1FFXA 4BVJA 5GM2A 4YQFA 4JYMA 3T5MA 3KR9A 4EJFA 3ZJUA 4GNRA 2C9ZA 1Z28A 4DSNA 2NU9A 3ND9A 5EJ6A 1XDDA 1U63A 1A0OA 4DM7A 1Z0SA 2J0UA 4MWOA 4ZRMA 1YHZA 2VT6A 2ZPTX 3DBOB 3EW9A 2GO7A 4YFVA 4FFNA 2W2KB 4BO1A 2D3TA 1SA0B 1JZTA 1RC1A 4TUYB 2C07A 3VXKA 2WZQA 3IODA 4F2PA 3SEQA 5KIAA 2RBKA 4LTMA 2CDAA 1OD6A 1LH0A 1JVSA 3OZAA 5MFZA 1JHMA 2I4TA 2FR8C 3M3PA 4M55A 2O3TA 4HYEA 2Q0QA 3MIZA 3GEEA 1ID1A 1XHLA 2GK3A 4P22A 3QG1A 1Q92A 2HRZA 4ALJA 2UUPA 2OV1A 2PM8A 1IY1A 1N2SA 3FIJA 3N2NA 4PPNA 4RO0A 5H0IA 3F1LA 2HREA 4LWQA 3SEAA 3FB4A 5DLPA 3CC8A 3SC3A 1R6TA 3E1KA 2I6GA 2C61A 3OQIA 2VTEA 1R9NA 1TM5E 5EJAA 1G17A 1W6RA 2WIDA 3GJYA 4ILEA 4JCOA 4RK5A 1WUYA 2BGMA 3HEBA 1M1UA 2I5PO 2H7CA 3EX7C 2UZ4A 3R5JA 1PT6A 1NRJB 1TJ3A 2CNBA 3GFRA 3R3VA 4BE9A 2WF7A 1F7UA 4GOKA 4JI8B 2J6CA 5TT0A 1A3CA 1GY8A 2SKCA 3R5FA 4D4LA 2H65A 1DAFA 3A4NA 4LVOA 2YFQA 3H5WA 3PQ5A 4PXYA 4DBZA 2NXJA 1LBHA 4NFSA 3BD9A 2HY7A 2J0UB 4RVSA 3RUPA 2HH9A 4YMUA 2ZEJA 4IFEA 4UZEA 3FE2A 4W6QA 1RYFA 3ZCTA 2ZYGA 5JW6A 4ETMA 1WXHA 4F3NA 4Q1AA 4G6ZA 3P2EA 3NWEA 4KQ2A 3ZK8A 4U7JA 2R8PA 2EX4A 1FFYA 5AOBA 5H3CA 4I8IA 5K09A 3D59A 4PICA 4WXHA 1C7RA 1SUSA 3CLRD 1VCMA 3DP9A 1IN7A 3DYVA 2YIVX 1YR8A 3CF4A 5ELLA 4PYIA 1RBMA 5A4IS 4JU9A 2JHFA 3WRXA 3ENZA 3BXOA 1S7GA 3GELA 1T91A 1Z7YA 4IOLA 1QPZA 3OQIB 1AMUA 1YTLA 4JIMA 4I9NA 1VPVA 4ZT6A 2BMFA 1RNLA 3NGMA 2PPLA 3ZVLA 3RYFA 2X13A 1IL0A 4RU1A 5LLTA 8MHTA 4KLCA 2IZOA 1DB3A 2P9YA 3ZZNA 1GGMA 3QKUA 1ZJZA 4BMNA 5BNTA 3IMKA 3PI6A 2XTJA 1NVFA 1NNI1 4YBZA 2B25A 2PE5A 1DCTA 3JXEA 3CLKA 3AG6A 3F6CA 2IV2X 3TIGA 3PUVA 5K0GA 1KGDA 5JJ5A 1XDSA 4XYLA 4MB0A 4OXXA 4B35A 5U9CA 2FRDA 3BGDA 4WDRA 2P8JA 2GDZA 3EVDA 3HQ4O 4G65A 2JLWA 5K0NA 4LV8B 3HDTA 2F1OA 2QUIA 2HDHA 4U7WA 3RAJA 2FV8A 1G8MA 1FLNA 2HQBA 3JZDA 4PX2A 2PZAA 2VWQA 2X0NA 5CD1A 2ZRLA 2JGRA 1PAUA 2J4CA 2ZJ0A 3V4ZA 2R5NA 5SY4A 1B00A 1UBKS 2AXEA 3EOBI 3NBKA 1PL7A 5DK6A 3AUAA 2QU8A 2VI5A 1KAOA 4PHHA 2FWNA 1XVLA 1R0RE 2VDUE 3DPUA 3WNZA 1T3SA 1JDBC 2ERXA 3FBTA 2GGSA 4P32A 1FRVA 1YDMA 1HF3A 2JIMA 2VYNA 4PX9A 3G9ZA 3VPSA 1E0KA 1D6NA 1Z0DA 2P9TA 3I37X 1B8UA 2PRIA 5K2MA 2UXDB 3EMKA 1YRWA 4Z99A 1O94A 4V1CA 1GFZA 4EUFA 3IE2A 3O8QA 2O0JA 3U40A 4LY9A 2ZQYA 3RYFB 1POWA 4J16C 3FHTA 1CJBA 3RSFA 1PKXA 2OUKA 1U0OC 2C8LA 4HNQA 4RC9A 2C58A 5LC1A 3F9IA 3HYSA 3UUFA 1SCQA 3R1IA 2Q2OA 3ETGA 4R7TA 2WJ6A 3G0IA 4JEHA 2AKEA 2P1ZA 2R0QC 1GOTA 1X13A 3O38A 1DUIA 1WKVA 2B4TO 1UOQA 3B9RA 1GXSB 5IM4A 4URHA 1J2RA 4B71A 5KKNB 4KH0A 3C1TA 2DT8A 1G6OA 2ONJA 2P2DA 3UUGA 3QPDA 3OZSA 1EIWA 3PFHA 4GR4A 1OTYA 3L01A 1EI9A 2PT5A 3JD4A 3RS4A 3KYCA 4BZQA 4F1WA 5CXXA 1KDYA 1QLWA 1W0KD 3FPFA 2OA0A 3QVOA 5TS3A 3MJTA 1JXQA 4ZV7A 2B30A 1FP4A 5JH7F 4PRLA 4KL8S 1ZVKA 3IA2A 3VKFA 3AH8A 1NLMA 4WA7A 2ZK7A 2H1LA 2VTBB 2EYQA 1P81A 3WLRA 3WGQA 1O9HA 1T36B 3JTMA 4LY6A 3T99A 5CBKA 1MZPA 1DUSA 4P6VF 1BMDA 3RVMA 1JQDA 5ALOA 1GKUB 2RK3A 2AXNA 3K9BA 1OREA 4R2HA 3UUWA 5D3MA 5FDFA 3O8QB 3K0BA 3PJFA 4MAFA 1Y8AA 4N0DA 4Z9BA 3O0DA 2HTFA 3MBIA 3LQQA 1HEYA 3N8GA 2ICAA 2PYIA 5BR1A 5CDFE 3U4QA 2NQTA 4HSEA 1EWVA 1M1NA 1A9RA 4ZJZA 5TV2A 4DMHA 3CVJA 1HE2A 1BEUB 3IS3A 1A2QA 1QO9A 2IJGX 4MWGA 4DV5B 1CLEA 2G5PA 2RKOA 3EF1A 4IGKA 5G3YA 3X1XA 2FJUA 1Z4NA 3LLVA 3FWHA 2EBHX 2IBSA 3WGLA 4QAJA 2YYAA 5H82A 2QAGB 4GZLA 2E4UA 2N42A 2HCTA 1UEIA 2G1JA 3NH6A 1ADYA 1MMFB 2WK1A 3A9TA 1PE0A 3VAZA 3P0RA 2Q45A 3CM0A 3MJVA 2QVBA 1ZNQO 2RHOA 3DS8A 4MUAA 5PNTA 4B7ZA 2PH5A 1ZVJA 3SBEA 4F2WA 2DG2A 2HWUA 1GRRA 4WASA 1ZN8A 1P2VA 3IKJA 3LO5A 3PD7A 1UJCA 4G63A 1QYVA 4ND8A 4G0VA 2WC1A 3UJCA 1FBNA 3JWGA 4NBTA 4CI9A 2QTBA 4P3PA 2Q2NA 4QNNA 5DXAA 1ANKA 2QQGA 2IYRA 3OT5A 4ARUA 1R9GA 3RUFA 4EITA 2AFHA 3FRHA 2WUWE 1KRXA 2WJIA 4R41A 1JTFA 1NV9A 2FR1A 2CYAA 2OD2A 2ZSDA 3UCXA 3ROTA 2HMTA 3KVYA 4OLBA 2ADMA 5T4HA 3R9KA 4XIGS 4EB3A 1E18A 4L3VA 4H7KA 1QKJA 1CR6A 1USKA 1WB5A 3B8HA 3I2HA 5EYPB 1NBIA 3C7TA 2HSWA 4IIGA 2OGUA 3FVVA 1FSFA 3Q8XB 4M2LA 5B2ZA 2ZJ4A 5LCXA 4LXIA 4CNBA 3WKEA 4A6DA 2PH3A 2IBTA 1NYLA 1SCBA 1WDMA 2VJNA 3AM4A 3QJGA 3O91A 1EWQA 4V02A 3JQPA 3TW0A 1JPJA 1K06A 1Q1ZA 1IHOA 1EESA 4RENA 3DB2A 5KYUA 2L18A 4LHVA 3RTGA 3AQ4A 3ZWQA 1I4LD 8OHMA 4YVFA 2FPLA 4P92A 5J4YA 1O5IA 2EHDA 3P27A 1P0MA 2HPZA 3EPPA 3UEOA 3ZYZA 5L45A 2DPYA 1GZHB 5HW0A 4IGFA 4ZQHA 2V5UA 2CFOA 4AJOA 3DTVA 4ND8B 5JI3E 1KOFA 5HM6A 1CUCA 4DA4A 3O1HB 2XOXA 2XMDA 4BB6A 4FQ8A 2Z0MA 4OXKA 4Q1VA 5FRDA 2IQ5A 4FEAA 5ALGA 3P94A 4RJKA 4B3RB 1A8SA 4OU5A 3L77A 2QIPA 2R6DA 1T4GA 2OENG 3KM0A 2ZDQA 1QVWA 4MS3A 4OREX 4C6RA 2KE5A 4PQYA 1U9IC 2FTKE 3ORRA 5DI3B 1QP8A 2P5TB 5F52A 4NYIQ 2VK8A 4UUBA 1R5BA 2WFLB 5TF0A 9MHTA 1LQ2A 4D6PA 1KDZA 5FTKA 1W1UA 4NDAA 3EZ9A 3LXMA 4XZ3A 5DBIA 4QJIA 1Z17A 4GI7A 1C4KA 1QJCA 2R44A 3COZA 1P1CA 4LZZA 2O3JA 4W5JA 5AT1A 3V8PA 4BNLA 2C5SA 3K20A 4PBSA 1OY1A 4QEZA 4NYJQ 1FFDA 1Q0TA 2GN9A 2EG9A 4B40A 1X7YA 1ZUIA 2WPDD 3AJ9A 2YW9A 4HGYA 3WGNA 5KYUB 4EFKA 3V2IA 4F5WA 2O6HA 4UHEA 3IXLA 3OZIA 4HAUA 1C1DA 4KN8A 3ZNNA 2PGLA 5CEEA 2Q6KA 4MUFA 5C8VA 1KL7A 3HJTA 4YRLA 2BLNA 4G4IA 4RJJA 1B1AA 3DTVB 3H9GA 5G02A 1AD2A 2F8TA 1M2WA 1OPRA 2PXHA 3AK4A 3B82A 5EZYA 3W3AH 4AMBA 2YN2A 3KPUA 2XE7A 1KYVA 2Y3IA 3U4DA 4IH9A 5AHOA 2F90A 1KSJA 1TMGE 1B2RA 1Z75A 3GG2A 4Q39A 2W6ID 5D6OA 2WQ7A 1ESEA 1JLLB 1XTRA 4CM4A 1QQTA 4GIBA 5TMEA 2I2CA 3V32A 4DTIA 4CKBA 2ZRQA 3IVAA 2CWDA 4M87A 3GFSA 4XX0B 5FNVA 2AJ8A 2PGDA 1JVBA 3OVMA 4C4ZA 3VUFA 1BRMA 1TLLA 4HS9A 3OU6A 3W6PA 2C4NA 3WYBA 2XZLA 2A35A 2AIRA 5AVOA 3WLTA 3ZHCA 2YRWA 1EWTA 1EFRA 2C9BA 4X7PA 3P45A 3AC0A 3TXXA 1SEPA 4B85A 5HRCA 3H0KA 5KNDA 1YKFA 3UJAA 1TX4B 3OWHA 3HMQA 5A2QA 5JS1A 4E5SA 1X7YB 2V6IA 3B9BA 1RJWA 1VECA 1ORIA 4XQGA 4CKEA 4BN4A 4LC0A 2A0KA 4QUJA 4DQXA 3JTEA 1Y5LA 1NXPA 1CR1A 1TJPB 3EYWA 2QMOA 1EYZA 1KH3A 3EFOA 3IVMA 2FEKA 4HAIA 4YRGA 2J5RA 1IDN1 1ZXXA 1V5FA 5DM2A 2O0MA 3NCTA 3UN1A 1M75A 1TK3A 1EB9A 3RJ9A 5F98A 3GIDA 4WKOA 1DRVA 1C7ZA 1D8AA 2HUNA 2VXCA 2WY2D 4DLSA 2IGBA 1K8QA 3ETDA 3G0HA 1QRAA 3TZCA 5AD1A 3H5OA 3N2KA 2HJRA 1CDEA 1QIMA 1USIA 4G4GA 1SOUA 5ENVA 1SCJA 4C4OA 1IHPA 1XDGA 2O2EA 4G5QA 3ER8A 4ROTA 4BVFA 5BW8A 3EDMA 3T4PA 5BUZA 4MAAA 2MYUA 3IKLA 4RFSA 1QUEA 5JDIA 3C70A 3K1YA 3GJZA 5FNVB 3K09A 3PXDA 2OCPA 4HWSA 4FE3A 1RBQA 2PAAA 3KOXA 4H7DA 3ND5A 1TT7A 1I4WA 1DUVG 1YZHA 3F67A 3KDSE 4YREA 5KJ6A 1HT1E 1LDGA 1Z34A 2XH8A 3HKCA 3I45A 3X0DA 4MR8A 4DIBA 4F7DA 1KZHA 5JC8A 3FUXA 3SQLA 2MSWA 2IA5A 1FU8A 3GVHA 4NI5A 1RZRA 4FYKA 3KZNA 1OX4A 1Z4IA 2BHSA 2YNMC 3A7EA 2EYUA 3B6MA 3T54A 4URUR 4MAMA 3DOJA 5FWNA 1VJTA 4OSOA 4QRHA 1P44A 4BLSA 2FW7A 3R5HA 2AHRA 2P35A 5LZ9A 4YV1A 3T12A 4LF6B 3GLGE 1X74A 4DF3A 3C6ZA 5EJEA 3DAGA 3M4ZA 1ZCAA 2PCLA 4E2YA 1T15A 1DAOA 3IPXA 1V48A 1UKEA 5LYJA 4CLEA 2R6JA 4KE6A 4U3JA 1M34A 2NADA 5EIAA 2HEGA 4GMGA 1MNQA 4N54A 1H9CA 1PT8A 3QUTA 4I5EA 4RL4A 5IYZF 2ZYTX 3SG0A 4YDQA 3I83A 3QH4A 4P58A 3HJFA 3LW8A 1GCAA 4RFSB 5A7HA 4C5CA 2QI9F 1CFJA 4BCBA 4KVFA 2C5AA 5CB0A 2CVHA 4PO3X 4A2QA 3BGOS 2PH7A 5B7QA 1KY2A 4YLGA 3C87A 4NATA 5AQEA 5I7RA 4MYTA 4MVJE 1QIKA 3AF3A 1XWIA 2QPLA 3WE7A 5JYEA 1C30A 1M5TA 4FD3A 3MCVA 4C1BA 3K5IA 1BC5A 1HT0A 2YJZA 2A84A 3EY9A 3GD7A 2V0GA 4WDQA 1NN5A 1XEFA 1PG5A 2A86A 4R1OA 4G4SP 4IDEA 4UFNA 4ZI3A 1JTEA 1L4YA 1RXYA 1VJ0A 4CLXA 4NNJA 3EAQA 3DMNA 2INGX 2OGSA 2P2YA 5GJVC 1JEQA 2AS0A 2QQFA 5JMTA 1ZJ4A 1A5AB 4JP8A 1HSZA 1UMDA 3HGQA 4NDZA 5HE8A 5A4JA 4DB2A 1KEVA 1PJRA 1A72A 1ZL0A 3B52X 1TKAA 4RAQA 1UOOA 4B79A 1X39A 2VBFA 2X3FA 2Z98A 1NZFA 1Y7LA 3HCOA 3P9IA 4TXHA 5BSTA 1KYIA 4LWOA 4DJEC 5HZGA 3QX7A 4HVLA 3HCAA 1GQRA 4DIKA 1U7XA 1ZK3A 3CX8A 5JRZA 1PBTA 1EM8A 1BMTA 1KAGA 1TQ2A 4U3JB 3VO1A 4DJTA 4ALIA 2BGJA 2ZI3A 3HCDA 3K4HA 2Z6QA 3C97A 1II9A 1PS9A 4EGAA 3BIXA 1DAIA 2HA0A 2JAUA 2UYCA 4GH5A 1TCVA 1RIFA 3DCIA 3EQZA 3HB7A 4C0JA 1SUBA 4CUJA 4LSGA 3CZQA 2QJWA 2PFKA 3L6EA 4M46A 4TUYF 1Y5IA 5ALJA 3W6NA 3ZJYA 4IY1A 4L95C 1J39A 4NEGA 1THTA 2ZBDA 2A5FA 3JW8A 4Y6QA 5EWMA 3ESDA 3RS0A 2OR3A 1V1JA 3BVPA 4QECA 1D5WA 1VMIA 5I9TA 1LBEA 2XD9A 3RHZA 4PO9A 2JAOA 3CW9A 3I2YX 2FMHA 3CVXA 4B8ZA 2NUAB 3WAGA 4P84A 4N47A 1X6VA 3DOCA 3VVBA 1UPUA 3A3OA 1ZDMA 2R6FA 1KMNA 4MWCA 1XNGA 2PUDA 5DB4A 1T3TA 3VC3A 3QY9A 1UMDB 4P4LA 4C06A 3AHFA 3O4RA 1E9BA 4N3BA 4RDHA 3S1AA 1R6UA 2JW5A 2K4MA 2XAUA 4PE5B 3WTCA 4AAYA 1F17A 1L0BA 2MSEB 2XDQB 4NBLA 1DEKA 3RU7A 4AP5A 2QSZA 1JJIA 3M4JA 1UWVA 4A7PA 1JAZA 2WAXA 3Q88A 1SVIA 3HTXA 3T1TA 3FUVA 3TG8A 1J00A 4X7RA 1WVMA 3JWEA 3PQDA 1OLSA 5JSZA 3AIMA 3SVLA 4U2EA 4OY3A 1U2DC 4NP6A 1C7IA 3PE3A 4QTYA 3KXPA 4HLUA 1WW3A 3L4BA 5JCJD 1SVSA 1W1WA 3FPLA 3OSZA 1O6FA 1LCIA 1H66A 3B5IA 1HXHA 2FW1A 2PFSA 3AUXA 3INRA 4XM1A 1T2NA 4V03A 2CKDA 3UATA 2CXOA 3BD6A 2PL9A 1QU2A 5EWMB 1NDUA 3L0IB 1FZQA 1VSQA 2HOQA 1W8DA 3HADA 1AZWA 4YO8A 1E6CA 4FPXA 1U6IA 1U8EA 2WA2A 1Q3HA 3GNSA 3W05A 4EY7A 3ABZA 3FOAA 2X3YA 1GPWB 3WQRA 5JFOA 1KBQA 4RCZA 4QBHA 2C2GA 4UVGA 3H83A 1WULS 1L5ZA 3VYRB 1TAUA 3H5TA 1SHUX 3IBSA 2Y66A 3THRA 4B81A 4BTEA 1RCTE 5C52B 2EDCA 4ENQA 3WNQA 1RXWA 3ZVKA 3FWPA 4EPVA 4BFSA 1XPRA 1FLDA 3JD1A 1IN6A 2CXQA 2H5EA 3L1KA 2CMHA 3QKSA 2BGGA 3S1AB 1A96A 2NVBA 1XEXB 2QLJA 1N2GA 3PKZA 1CUZA 2FPIA 2FDRA 5JECA 1ZUNB 1G9TA 2JI8A 3CUEF 4PZPA 3RS3A 1QHNA 3AEUA 4UNIA 5L95A 1G21A 1N6NA 1D2NA 1Z2CA 2C9OA 3V7UA 1X2BA 4BC0A 4BNDA 4E0BA 1N5MA 1WA5A 3RKRA 2CBZA 4BUCA 1JRLA 4A6PA 2FAXA 3OIVA 4GD3Q 3ZDZB 5K0BA 1KVRA 3LIPA 3QEKA 1DHRA 3DL7A 4Q19A 3K5PA 5A9SA 1XZBA 2V6GA 4Q4JB 5AI9A 4Y9TA 5DXFA 4ZEVA 4ALMA 5F9MA 3D2BA 4LE2A 1V8ZA 3O4JA 1XR3A 3R09A 1YI8A 1PU2A 1TYAE 1FRQA 3E7DA 1YJAA 4J0IA 2PGXA 3ZWMA 1DC3A 3K8YA 1ZM7A 3ONVA 1W59A 3ZZ0A 4FK8A 1P33A 3E0XA 3PPWA 4BE4A 1CJMA 1F8FA 4LFAB 2XWSA 3ENVA 4I5IA 5F7JA 3RVLA 1E2FA 3I2IA 2HSDA 5G4LA 1NP3A 3LSTA 5TT1A 3MELA 5KQGA 2IVZA 2R8OA 3I8XA 2R8RA 2YZ2A 3NHUA 4E33A 5FUWA 2WICA 2C54A 4DEYA 3ZNOA 1XQ1A 2ZS7A 3SX4A 5L3RA 4YT8A 3QKSB 4KVZA 4R9SA 3D2LA 5TPWB 3RBAA 3STUA 2UZ3A 3V2HA 1KAEA 2O7VA 4FYJA 1UFQA 1X9HA 1ZITA 2VDKB 1VKZA 2NTEA 3OZGA 4N12A 2WM8A 4CM9D 3PNQA 5KVAA 1ONNA 2JIBA 3D54D 4BNDB 4A6XA 1D2EA 1R8JA 1SOMA 2GN6A 1NVTA 5FFNA 5B7PA 1T5TA 3F8WA 4ZT4A 1GG2A 3BXEA 1IM5A 2HUPA 1SB8A 1SQ0A 2O1SA 3ZIUA 4KAAA 3EVBA 3UAGA 4R2IA 3CNLA 2PAFA 1MC5A 5A9SB 5CFLA 1T1RA 2H3EA 2LP4Y 4KJXA 4YAWA 3K71B 4HDRA 2O54A 1CWUA 4MZXA 2EKQA 4J0EA 5KPDA 4EWLA 4MWBA 3G68A 1DADA 1IEXA 1KKMA 1X15A 1Z6GA 2Y1EA 4ZHQA 3S4YA 1BXGA 2G04A 2X42A 4Q7JB 4E30A 1RVV1 5IDQA 1CNFA 1S2DA 2NZXA 4PZ9A 2A88A 5E1OA 3OIWA 3QI2A 2AN5A 1FFAA 5T4BA 4CYMA 2BEUA 1EUCA 3U3MA 3C4VA 2D3WA 5I45A 2HEIA 1LPNA 2H0RA 2V54A 1RP7A 2WHQA 3WK7A 2Q9CA 3PCRB 2PSEA 5CIQA 1RYYA 3HB5X 1ISRA 4KO8A 1ZISA 2WD9A 2XUZA 5TLSA 4RBNA 1SD1A 4D41A 3TQTA 4GSLA 1YV9A 3WO0A 2AC7A 2W11A 4NR0A 1ZGZA 3DEYX 5FKJA 4BBJA 5LB2A 2IPXA 1L5GB 1JKXA 5IDYA 1BFKA 2WE7A 2Z9CA 4ML3A 2V7BA 1L7EA 3EGDA 4E88A 1DS6A 3PUYA 1SIOA 4HRVA 3RYTC 1TW2A 4F3YA 1ZGBA 1RC8A 4UPVA 3JASB 1VHLA 3P2OA 1BVYF 5BRJA 2QTWB 1FDTA 3HN6A 3WL5A 2XWPA 3RAPR 4A15A 3LZDA 3D0KA 4XD7D 2HA4A 3GEBA 1TA4A 1Z74A 4GICA 5IM4F 5C7LO 2NQ2C 2P62A 4D9GA 4S2EA 4ZXFA 1UFRA 2NYVA 1KHTA 3GT3A 3NALA 1BGXT 1T29A 1QPGA 2CFCA 4B7XA 5EMLA 5GJBA 2AN9A 3LT2A 1WD5A 2Q7DA 1E1RA 4CMEC 3A2MA 5A6VA 1QGDA 2ZRBA 1ISIA 1BXGB 1MRZA 8ABPA 1OXBB 1EUDB 5IP5A 4YAOA 2JI9A 1NPTO 4KE8A 1ACLA 4G86A 4HRXA 4CM1A 2FGKA 3K2QA 2WIGA 3QOYA 3EDYA 3F9CA 4ZVNA 1EUCB 2NSJA 1OYVA 2DY0A 3DMPA 2NO1A 2P4SA 3GH3A 3OZCA 3KB2A 3WTBA 4F96A 1OB5A 2HA6A 1HE5A 1CUAA 1F38A 2Y0BA 3C3CA 1KJYA 3I92A 4EF6A 2WP8J 4MV8A 3WL8A 3BL5A 3USES 1A9OA 3B1ZA 1UP6A 1ML3A 1UBLS 3UT6A 5SZIA 1T2AA 4OOFA 4BFLA 4Q3BA 2BDTA 3LP6A 3OSUA 5C8YA 4EHLA 4WZBB 1JIQA 4W7HA 1JU9A 1XX6A 1AMOA 3ROKA 4C6TB 2ECKA 2XDAA 3D1VA 3QVUA 3W7BA 1KEEA 2REQB 2VRCA 1SK8A 1U6KA 4RD2A 1Z4JA 2VJQA 4JGGA 4NQZA 4K46A 3I01M 3KSZO 4DA0A 3E8SA 1Y8CA 3KKKA 3B5JA 4DFDA 2ZRNA 3BK1A 4YRNA 3G88A 1A4XA 4PG6A 4HEHA 5IVHA 5C1BA 2O7QA 2AFRA 3FTCA 1N5OX 3ZXXA 4CM7A 2J0QA 4BMDA 1RRPA 1C1XA 1EDOA 1PFVA 3HI6A 3OQHA 1Q95A 5DGCA 1DX4A 5F73A 4ATNA 4QHTA 1E2LA 5AOCA 4REQA 5B7GA 5KVCA 3K6SB 1KAHA 2VPQA 4UPEA 4RZXA 4KQ1A 1CPYA 4E7OA 4YXFA 3D6UA 5A62A 2V4ZA 1ENOA 3CW8X 3W79A 3RV3A 4ZODA 4BLPA 2PWYA 4CLRA 4IVRA 1CETA 4GZ5A 2RJ3A 5CBPA 1J8DA 4A9AA 2YN4A 2R8BA 3IJRA 3OLQA 1G5PA 3TSWA 4J49A 1FDOA 4F11A 4E51A 5LQNA 2HO5A 2Q7XA 3BBPA 1H2EA 3MF4A 4UDNA 3LT5A 4R0MA 1V9LA 4JBGA 2WF5A 1DKPA 4M8NE 2FB9A 4C6HA 4D43A 1RJDA 3H11A 4MI3A 4BFTA 3CLHA 5JRDS 5ILGA 2FG7C 1JN0A 1NVGA 2B3DA 2BAGA 2GPNA 2QXYA 3ESZA 2I7TA 3HBFA 3OJLA 1DHTA 1GEEA 1KEEB 2EERA 3KR0A 4HDOB 4JDPA 5DNWA 3S2IA 1M2FA 1UR5A 2G3YA 1MNAA 3HP7A 3L93A 5E4YA 5EIXA 3CN9A 4CDRA 2BFDB 3B78A 4X1OA 2AZDA 2ECQA 3KFLA 2I6TA 3SQOA 4WECA 5IAOA 2IDKA 2DWOA 2XCUA 2GJAA 3CE6A 1RWMA 2PKYX 3AEQB 3UH1A 5DHPA 3BRQA 4WMLA 1PTKA 1DCKA 4CRWB 1MGOA 3H7AA 4N7RA 2AQKA 4HN4B 4Z7OB 1JHXA 3OMXA 1CRWG 1UK6A 3UMBA 2Z5FA 3KXLA 3EIQA 1D0VA 4KUEA 2JFVA 2P78A 3BILA 4RGQA 2YXPX 6GPBA 1M2JA 4U7GA 1FL9A 1LSSA 1MDFA 2FK7A 2NNWB 1Y1SA 3FHJA 5K5EA 1CT9A 1H0HA 4IXDA 1BEZA 1WLSA 1GKLA 4P35A 5DGDA 4D57A 5CBPB 1AGRA 1ZD1A 2VBIA 1OFIA 2J5BA 3F47A 3KLNA 3WLAA 3NWJA