2HD4A

Crystal structure of proteinase k inhibited by a lactoferrin octapeptide gly-asp-glu-gln-gly-glu-asn-lys at 2.15 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Crystal structure of proteinase K inhibited by a lactoferrin octapeptide Gly-Asp-Glu-Gln-Gly-Glu-Asn-Lys at 2.15 A resolution
rcsb
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2hd4A00
2WUWE 2TECE 4BWGA 4WOCA 3I34X 5B1EA 1GT91 3VYVA 3AJ8A 4ZOQI 4KPGA 1AV7A 2X8JB 1TM4E 3DWEX 2W2MA 2Z58A 1C9JA 1Y3DE 3WIUA 1GCIA 4HX2A 4GI3A 2ST1A 1R0RE 1Y1KE 2W2QA 3F49S 3DE1X 1CSEE 3DDZX 4KB5A 3OSZA 5FAXA 2V8BA 1MEEA 1AQNA 3GT4A 3DVQX 1WMEA 3D43A 2PMWB 5SICE 1ST3A 1Y33E 2X8JA 2ZWPA 3L1KA 3VTAA 1SCNE 2ID8A 2IY9A 3GCWA 2PQ2A 4HVLA 1Y3BE 3QFHA 1ZVJA 5AVJA 1PTKA 3F7OA 3A3PA 1R6VA 1EGQA 2W2PA 2B6NA 1WVMA 1NDUA 1SUPA 2PWBA 1WMDA 4AKTA 4OMDA 1KDYA 1TO2E 2SBTA 1SCAA 1KDVA 1Y9ZA 3HJRA 4CFYA 1SBCA 1SN7A 1NLUA 2PYZA 2W2OA 3H42B 1NDQA 1KE1A 1SVNA 2PRKA 1BH6A 3ZXYA 2SICE 2DUJA 3BX1A 3DE4X 3PTLA 2ID4A 4FONA 3VSBA 5JXJA 1PFGA 1Y48E 3I2YX 1TMGE 3EIFA 3SICE 5FBZA 3WIVA 3UNXA 3BGOS 2Z30A 4LVOA 1ST2A 4M1ZA 1GTG1 3TI9A 2Z2YA 1SUAA 3D9QX 2GKOA 1S2NA 1YJBA 2IXTA 4C3UA 2Z56A 3DE5X 3DW1X 4DWWA 2G4VA 1UBNA 1SIUA 2Z2ZA 1C9NA 1PEKE 2ZWOA 4H6WA 4I0WB 3DVSX 1KDZA 4KG7A 4ZARA 1S02A 3EE6A 3Q40A 4MZDA 1GNSA 1Y3FE 3DW3X 1AH2A 3GCXA 1SBNE 1SBHA 1Q5PA 2WV7A 2HD4A 1CNMA 1SUEA 3I30X 1TM3E 1Y4DE 1R64A 3CO0S 3AJ9A 3BPSA 1VSBA 1THMA 4K8RB 1OT5A 5ARBA 1BE8A 3A3OA 3DE7X 5AQEA 2QTWB 1C3LA 1A2QA 1BJRE 4C3VA 2Z2XA 1TO1E 1SUDA 3DE2X 1Y4AE 2ZRQA 2SECE 1GA4A 1V6CA 1SBIA 1TM1E 4YN3A 1DUIA 2XRMA 3GT3A 1SPBS 1SCJA 5I9SA 3WHIA 3AFGA 1P7VA 1EA7A 1AU9A 4CG0A 2HPZA 1TECE 1AVTA 1SUBA 5ARCA 1PJ8A 1TM7E 1C9MA 3DE3X 1YU6A 1GA1A 4JP8A 1BFKA 3LPAA 1ZVKA 4DJ5X 5AVKA 3Q5GA 3F7MA 3DE0X 2PKCA 4NE9A 2SNIE 1IC6A 1BE6A 1JEAA 4H6XA 2W2NA 1SBTA 1P7WA 1WSDA 4DZTA 1SUCA 4NMXB 4WOBA 1GNVA 4OMCA 1OYVA 3EDYA 3VHQA 1V5IA 5CW1A 3QMPA 2DP4E 1T1IA 2P4EA 1AF4A 3LPCA 3P5BA 5FFNA 3QTLA 1GTJ1 1XF1A 1LW6E 3WQBA 1GTL1 1TK2A 3A3NA 3SQOA 3DVRX 1YJAA 3VV2A 5JXGA 4LVNA 3I37X 5K7SA 1S01A 1AK9A 5AMXA 1KE2A 1YJCA 1SCDA 4AKSA 4J94A 1Y34E 1Y3CE 1IAVA 1OYOA 3PRKE 2WUVA 1SIBE 3LPDA 3DYBA 3DE6X 1SH7A 4RYDA 4NE7A 1P8JA 3TECE 5ARDA 3T41A 1T1EA 3LXUX 5JMOA 1TM5E 2WWTA 5JXHA 5B1DA 2E1PA 3CNQS 3ZXXA 2XTJA 4Z2AA 1HT3A 4CFZA 1SIOA 2Z57A 1MPTA 1GA6A 4OV6B 5JXIA 2PWAA 3VV3A 1WMFA 1T1GA 4H6VA 1DBIA 3TI7A 4B5LA 1BFUA 1SCBA 1SELA 2DQKA
chains in the Genus database with same CATH superfamily
1U2PA 2CMHA 2FP4A 3RVJA 4IIJB 1TTQB 4LPKA 1UBRS 1KI6A 2PFSA 3DP7A 3QXHA 3ZNPA 5JAMA 4G1BA 4ZA2A 2GM9A 5KJ6A 2PUCA 1CR2A 1C5KA 1JR3A 1EHCA 1P0FA 3BWDD 3DAYA 3QJYA 5K3FA 4REQB 3COWA 4A0HA 1OV6A 1W25A 1U2SA 1VL2A 2J9YB 3D7NA 4YRQA 5D8DA 5I3ZA 2RB5A 1PT9A 1USUA 3X1WA 3U6KA 1Q1ZA 2D4HA 2DBVO 4J3JA 4D96A 4EFKA 5C53B 1V35A 2I66A 3DG9A 4DLTA 1H2XA 2IZOA 5L4NA 4C4XA 1ORVA 4DANA 2FEMA 1XA0A 1W5AA 1LXCA 3QYFA 4B6FA 4R8SA 4YWHA 5JNRA 2ZGVA 3ZG6A 3JD1A 2HGSA 2K7FA 3JQFC 1R0RE 1L1EA 1G8SA 1Y1KE 3B1XA 5F9MA 3VXKA 1NUSA 1NC3A 4CFSA 4COOA 4IMJB 5B7QA 2WAMA 1ZOLA 2PX8A 2J6IA 2ZRMA 3BJIC 4UEQA 1SD5A 4EPXA 4MTLA 3PNYA 2IH2A 1WHSB 2L17A 4U2GA 2XKBA 3ER9A 4M7WA 5DBOA 1KSGA 5KOHA 2ZRAA 4YAGA 1PZXA 4ECEA 2W58A 2BEWB 3RRYA 3ES9A 1OD6A 1N7JA 1THTA 1XAGA 4LZOA 4RF2A 4L4XA 3GJTA 4ZTBA 3GV0A 5TJHA 3D0OA 2C9YA 4D8WA 3ADBA 1F7VA 3HI6A 3JD0A 1ISHA 3WK4A 1FF9A 2OXRA 2NU7A 2Z09A 3R3JA 1BRTA 1QYRA 4PU0A 3I28A 3OPNA 4F3CA 3S5JA 3N2KB 1PTJC 5EVCA 2OGWA 3OPYA 4J3FA 2PFKA 1GSAA 16PKA 1DC8A 1NE2A 3F6BX 1XCBA 2J30A 4GMGA 3MINB 3U26A 4Z49A 1A4UA 1ZCAA 4UU7A 4EO7A 3DTYA 3FPGA 2HAEA 3R3YA 1WXIA 4G0NA 4Y6OA 2XE8A 1I2ZA 4JYMA 4KWEA 2XXAA 3C70A 1W36C 3JQGB 1J24A 5JISA 1T26A 3Q9NA 5IANA 4C3ZA 3LDHA 5CA1B 4EF6A 5J9FA 4D56A 3WLNA 4O2LA 3CFYA 1NW4A 3KQOA 1RJDA 3KPWA 1SUPA 4GWGA 6AT1A 4ER3A 3ZJVA 1ESDA 4F4JA 5TC4A 4N41A 4ZAFA 1DG3A 2PL3A 1KYIA 2GBPA 3V4FA 5TQ0B 1XD2B 2HA5A 2QLLA 2WF8A 5LXTB 1FMTA 5AJUA 2D06A 4G1UC 3MD0A 4DCUA 1ADGA 1ORRA 4PAOA 4AMZA 4FFPA 3S7ZA 4G5YA 5DOVA 3B13B 3K8QA 2CUKA 2RGCA 7ABPA 2FPUA 4MUKA 3ZHVA 4C4SA 3GMTA 1KEPA 4XX0A 5EJMA 2OM2A 4M8IA 2XRFA 3AHFA 1KKMA 1EDDA 1KAHA 3A1SA 5KQRA 3DXZA 4CIWA 1NRJB 2ZIZA 2IP1A 5LN1A 2YZKA 4CG2A 4Y1RA 4YUZA 4Q4CA 2JGIA 2OYRA 2VF5X 1E4OA 4FYHA 3M33A 4I8IA 5LQRA 5JAQA 1SOVA 5ANRB 1QGOA 4EG1A 1LRKA 1UJ6A 4QPDA 1DC4A 3UO8B 1FDIA 4EUFA 1UOPA 1XNQB 3C3WA 3GK3A 1LI4A 1NHWA 4NAHA 1KE1A 3RNOA 3WLIA 1YB5A 4MO2A 2F4VB 2QV0A 4ZI5A 1VMKA 2R65A 2B4TO 1WV1A 4KQHA 4HFJA 2VQ3A 4URXR 2B1GA 3PNOA 4WGGA 3AI1A 1NOIA 4MVJA 1YCFA 3C4VA 4KXFB 2R1VA 3PXGA 2CL6X 4E5UA 1AM4D 1U0RA 4IZ6A 3GVCA 4H0FA 3RVKA 1QIKA 8LDHA 2ZLBA 2WC1A 1CG6A 1T3SA 2JI4A 2JS7A 1P4JA 4IGFA 4TN5A 3C6ZA 5CNKA 2PGNA 5BSMA 1D2RA 2P0EA 3IIKA 3EGOA 4WXMA 4BC0A 2IYYA 1BS1A 4L74A 4LHVA 1MV5A 3I42A 3SX0A 3U3DA 1IJKA 4GBJA 3IE1A 4V39A 5JFTA 3EIFA 1RAAA 5HGJA 1OXVA 1NXQA 1BZYA 2OO3A 3VOTA 2QN2A 1N3IA 2AK2A 3JTMA 3ZV6A 4IOKA 2CNWA 2IKQA 4JJGA 4YRJA 4GZLA 1A9XA 4B7AA 5FPSA 3HWRA 1FU8A 4JELA 2Z95A 3WGQA 3GEIA 1E2UA 3H86A 4KSCA 3II6X 4YI5A 4ZD6A 2RHGB 5B7NA 3GBSA 4AAYA 3ZHYA 4YAWA 2AE2A 3MGAA 3ZE6A 4EGAA 4ZHQB 2IIPA 1PD0A 4N3GA 4KQWA 4QWMA 4LFCB 3W04A 5C1OA 2BAGA 4LJ9A 5FWXB 4HWPA 4GOKA 1T0HB 5M34A 2H7VA 2H3EA 1VYUA 1O4WA 2ZUUA 4Q6BA 4WESA 5H70A 5ICFA 5J59A 4C0QC 2FW7A 1RI3A 4YC7A 3WK8A 1NFFA 1TEHA 2W6ZA 3BB3A 4Q1CA 1RBYA 3D9QX 3BIFA 3GCZA 1SKYE 2JAUA 4ERNA 2I9PA 4OBWA 2Z08A 2MSCB 1Q0RA 1JLSA 5CIWA 1UPAA 3KQKA 3FPLA 1TA9A 1B15A 1U7UA 4EFNA 1L7PA 1YKGA 1I0LA 1LDBA 2DSTA 2QQFA 3TVDA 3D02A 2ZANA 1KAOA 2A4MA 2PSSA 1ZD4A 2LRHA 4N49A 4XDGA 5G4LA 5FUVA 2PRZA 3FWZA 1W6RA 3HJNA 1IAQA 3MRTA 4W5QA 1XHFA 3FAZA 3OCCA 4LWOA 4Q3NA 2OLEA 4BVEA 3E58A 4K2HA 4WNYA 3BIXA 1XRPA 1UXKA 3VYWA 1P77A 2ZT7A 3K0AA 1ZUHA 3RC7A 5SY4A 3ZVNA 3KCNA 1RWVA 5E38A 1DO0A 1S02A 2KBFA 3LBIA 3VGPA 3LPNA 3OMXA 4PLYA 3QEBZ 2GVZC 1SKMA 3W2TA 3NHJA 3CVXA 4X1IA 1XF9A 3ZHXA 1CRQA 1XDBA 3GPCA 4YAJA 4BBZA 4X6YA 2QVLA 3U44A 2WIBA 4FU0A 2ZIUB 4MZDA 4Z2YA 5KJCA 4P5PA 1JDBB 1XL0A 2VSOA 1Z7WA 4IMPA 1KPIA 2Y3IA 2X76A 1BCRB 4IVPA 1SBNE 1XZQA 4ZYTA 3RJ9A 2IRWA 4GX5A 4QOJA 2M98A 3ZZ1A 1CW2B 2V9PA 2WFAA 2HMTA 5A3QA 4CG3A 1GKUB 2ZBRA 3A6KA 3EUEA 4CV3A 1VG9B 1ENPA 4GX2A 4N6GA 3WZLA 5C34B 3PA6A 1HRDA 4DIFA 13PKA 3WK5A 1A82A 1R9GA 5ALEA 2JZCA 1UBTS 2KB0A 2KM1A 1C29B 4BQNA 2XCRB 3W5SA 5AESA 3BWEA 1Z06A 2XMCA 3H11A 3OE4A 3EXEA 4ZOLB 4Q34A 3SJBA 5JH7A 3CZPA 5J43A 1EXDA 4UCXA 1T4DA 2FCRA 5JI2E 4BVAA 2FPSA 1ZCZA 1XRMA 4O4LA 1KYQA 5ICMA 2QM0A 5IT4A 2AFHA 3VVLA 2P6UA 3ITEA 1VKRA 2OZLB 1RCFA 1GWNA 1EK6A 1LBTA 2HF7A 3NC0C 2B5OA 1UWCA 4ER5A 3T1YB 1Q77A 4TSFD 3A3OA 4QJIA 1T5LA 4C0KA 4WXPA 2O8EA 2O2EA 2VUIB 4BPRA 4BBJA 4XVHA 1T1SA 2TMYA 4F5DA 3EF1A 2AD5A 2JZNA 3KPYA 1BW9B 3LUAA 4FFMA 4MJLA 1VE6A 4ERXA 3MFQA 4W9MC 1CP3A 1SUDA 3M3HA 3T3NA 3K09A 4G81A 4R1NA 4BFCA 3B2EA 3NM4A 4GWLA 4MYCA 2J9XB 3HLYA 5DNAA 2SECE 3ZBPA 1UAAA 2GCPA 4MUAA 1SBIA 4HNQA 1U2GC 3HG7A 3WIEA 1WBBA 1I5OA 4REMA 4XUCA 4PEVA 1VFPA 3MGGA 1I3OA 4HUJA 4DBLE 3JALB 1HQDA 5DF1A 5AO9A 4X1KA 1QKKA 2I1WA 1Q0TA 1GN8A 1TA4A 1TT7A 2P69A 2WYUA 1IEXA 1R8YA 3NIFB 3OX3A 1W88B 3GVHA 3GGGA 1IZZA 1YJ5A 2ONJA 3MQ2A 2QJTA 3AFGA 3P32A 4ND6A 4PC6A 3MUOA 3N2ZB 1AGYA 4MCIA 4WCFC 3EFHA 1LPPA 2C5AA 3FPBA 4NS4A 4AJKA 1X92A 3ZWOA 4NU6A 3I0ZA 4W63A 3PEYA 3ZKAA 1EEHA 3M4NA 1ZJYA 4I66A 2PJUA 3WFIA 3HDYA 4JI1B 1P17A 1H22A 4IO0A 3F4KA 2IOYA 3EYWA 3W9YA 4TTTS 2B30A 2OBMA 2C29D 4KCGA 4B83A 3M81A 1GADO 3FYDA 4RM3A 1D5CA 1U3DA 4CM6A 5CIYA 2ZUEA 4QM7A 4WZBB 3G2IA 2H06A 5DP2A 2EZUA 4NONA 3OESA 5J3JA 2BJVA 2DFVA 3A2KA 1ISRA 5DKFA 1NULA 1KS9A 1SHZA 3IRVA 4YJFA 1C8BA 5DGXA 2QG6A 2PVCA 1NNI1 3D3JA 4KJXA 2QHXA 1J8MF 3HNOA 2ZWAA 3CLHA 2O2DA 3F7MA 3K0CA 4UXHA 2FZ5A 1T6ZA 3AB7A 3SC2B 4LHYA 4TTJA 2FRXA 4XB6B 3ENNA 3TOVA 4N7MA 4EM6A 4PZZA 4AULA 1FNMA 3LYUA 3QELA 5ELXA 1VECA 3DXFA 2O5CA 2FUEA 4RVUA 4M6WB 1E4EA 1L7NA 4D0LB 3QU4A 2ZIEA 1OHHD 2H4XA 2X2EA 4H7KA 2UXCB 2AUTA 3NTOA 4BX3A 1T8WA 2DH5A 2XCLA 3QUAA 3M5PA 3RU7A 3UWKA 4BTLA 1I1QB 1JPUA 1O58A 1PUIA 3AR3A 3OICA 4WOBA 2X5NA 4Q15A 4CM1A 4W5HA 2JFQA 5JW6A 1RQGA 1X1AA 3CH7A 5CJ2A 3O3CA 5JJBA 4NXMB 1CEEA 1NBMD 2AJTA 2AKYA 1DZIA 3BOSA 3E3MA 5B58T 3MIIA 4RVNA 3PIDA 4C0AC 3C24A 5CVTA 1YAHA 2J3KA 3QVUA 3BRCA 4M9UA 1N4AA 3FSJX 1N57A 3F9CA 1NTOA 3ONFA 1QIGA 2GZ3A 2OUIA 4IUDS 3LV8A 4DDKA 2ZWMA 1XQ1A 1GNLA 4UU0A 1GZ6A 1XQ9A 3P5BA 2M6SA 3GA5A 5IJ0B 5JBNA 3H0EA 2WSSD 1NR7A 3HH8A 2WF5A 2A9KA 2IOQA 1L4GA 2DG2A 3TIGA 4DR3B 2BRUA 5KTKA 2G28A 3VNQA 1YR9A 2BGRA 2WAYA 1Y4SA 2BJHA 2CEKA 3H2KA 4MIYA 2CCKA 1SRRA 2FPIB 1ZW1A 2FR8A 3QPBA 4HWRA 1HEUA 3SBEA 3BHMA 1SRQA 2XUIA 3PHBE 3SM3A 1QIMA 3STWA 4EQ6A 3VJRA 1L8XA 1SC4A 2JLBA 2HCRA 3PNSA 3T4UA 4UUAA 3ZHUA 2PZJA 3MOIA 1WNFA 2BCGY 4P3OA 4GXQA 3VHXA 4BNNA 4CNQA 1GQYA 5LB2A 2CLIB 1ZP6A 2C2GA 4BO0A 1J0BA 2EKBA 4P32A 1GKLA 4O29A 1KARA 5C18A 2PLFA 1W4RA 3Q0IA 2FPOA 3I58A 3TCNA 4PZAA 1JA1A 1YS6A 2ORVA 3R6LA 2AIRA 3FNEA 3DLHA 1DQRA 4Q7JB 4HGQA 2EKPA 2XTAA 1F8XA 3CT4A 4LJ8A 2WVHA 3E8SA 4I4TA 4YJ3F 4B6RA 1RDFA 2CCGA 5A6VA 1ZSVA 3EY9A 1J23A 3A7EA 3WYDA 4ID9A 2XKAA 5AI4A 5FI1B 4RABA 5CH8A 2QVXX 3EN0A 3UK7A 3WYCA 3ZY5A 2O0LA 1NI5A 3DHEA 1J9ZA 1MAUA 4ZICA 1X1RA 1E3EA 1EFRA 3CLTD 2QPLA 5FUYA 3U31A 3ELWA 5B4TA 4BGIA 3QWHA 4BUCA 3JVUA 4ZYYA 5BV0A 3I5XA 1UXGA 3U5TA 5ALTA 3F6SA 1QGUA 3A9CA 3PP8A 2JCSA 2Y1LA 3QVGA 4AURA 4AY3A 3M3PA 4F11A 1V11B 3W1VA 4EJSC 1RQNA 1VA4A 2QMEA 4U63A 3SF8A 3X1ZA 3JVEA 4KBYA 1GXSA 4LKOA 4I5DA 2WNSA 4RWEA 5IUNC 3PHGA 2OHJA 3RUEA 2YXEA 4DG8A 1Q92A 4CKCB 3IB6A 3T5PA 2EV9A 1ESNA 5CP8A 4OXNA 4YECA 1C7ZA 2FZLA 4YUVA 4EA9A 5FUXA 3KU1A 4Z8XA 3VJKA 4QPJC 4DDWA 3I0NA 3IKTA 3L5KA 5EERA 5F7ZA 1AOXA 1JU4A 2YNMD 3IUBA 1JHMA 3AHGA 4TMTA 3QFFA 4OQFA 3RF6A 2IDKA 4Y1EA 1FPQA 1A98A 3L06A 5ED4A 2BGGA 4C14A 3H4VA 4NENA 1DCMA 1X7XA 5D87A 4Z4FA 1EDZA 4NEQA 2J9FB 4M0KA 3ELDA 5BYAA 1OVMA 1LPMA 1QIEA 1KVQA 3AJEA 3N8HA 1H05A 3I9V6 5BVHB 2RGYA 4CM9A 5KJ1A 3GIDA 4BYMA 3ENWA 4M87A 3CEMA 4CKZA 1Y3HA 1SCBA 3F6PA 4XM0A 2CXHA 3F5QA 1DIOB 4QHSA 5BPHA 4JC4A 3I62A 3CVYA 1CPYA 4HZGA 4BNJA 3D6AA 5TGZA 4Y1FA 4U5XA 1IQRA 1JTEA 1WZIA 5CAEA 5JNSA 2V03A 2V7TA 2G4LA 1RPNA 1UCFA 2PXAA 1KVSA 3CSSA 3VPSA 4BVLA 3KOYA 3Q5DA 2QDXA 2YFKA 3OY7A 1V7CA 4N54A 3KHSA 2XDQB 4K26A 4WXYB 3F7TA 2LIPA 3DF9A 3E9YA 2FLWA 4FQ7A 5E1BA 3ZIUA 4TS9A 1K86A 4OP2A 4D3DA 3Q7EA 2WAOA 4KPGA 4R1UA 4XYBA 5DBGA 1JAZA 5IYZF 1TW2A 2G06A 4FVTA 1K97A 1ZIYA 1B73A 3BTOA 4TRMA 1YZHA 3L6UA 4LJLA 5FNVF 1ZJJA 1FSSA 1J42A 1QO0A 2HA4A 3AZOA 1M54A 3AUSA 4FBMA 3R76A 1BGVA 4EH1A 1IM2A 4F0JA 2BMWA 3ZV7A 4D8XA 4PLVA 4OY3A 1E2KA 1JVNA 1LPAB 4D0SA 1A9TA 3V33A 2XOKD 4GLFA 5C8XA 3WLKX 2JFUA 5T7BA 4OHYA 4RIFA 1UP4A 1T36A 5F2KA 1SXPA 3BL5A 2Z4SA 3DOEA 3EVFA 3UQYS 3THWA 1UK6A 3EXFA 1C2YA 5FA6A 4QQRA 3OU2A 3U17A 4RPIA 4K28A 1KR2A 1CJTC 2AG0A 4ZGBA 3RUCA 5L6MB 1OPXA 3PC4A 4J1TC 4ALKA 2CV1A 1EXMA 3E61A 3NBQA 4K6MA 2E0IA 3DUFB 5B7GA 5EWLB 4INJA 3SJUA 5ALSA 4P80A 4BXOB 2E2WA 2BF4A 3UMCA 1NT2A 1OAKA 4EY4A 5DK6A 1S8NA 3QKRA 5K8UA 2QD4A 1RS0A 3KL2A 1Q3HA 4TV9F 3AC0A 5KTPA 5HF6A 5HE9A 3TZLA 3EUAA 4FE7A 1FYDA 2FRVA 3ZYCA 2XMPA 1WB5A 1YRAA 2OB1A 5IVDA 1SCKA 1ML3A 1GNRA 4F5ZA 4ZYUA 5HVNA 1JFTA 2FSVC 1B1AA 3A32A 3HV2A 1I7DA 4L2IA 4EF5A 5DLQC 1P1JA 1VIYA 4DF3A 4KKVA 2BZ0A 4DYDA 2FFRA 2JGKA 4TKMA 5DHQA 1JEQA 2WJGA 5K3SA 2W2XA 3SZMA 4YX9A 1ABEA 1KFEB 5LQMA 4HJRA 4YVFA 1QF7A 1QHFA 4IFBA 2EVWX 4WFIA 1QAMA 1QYCA 1TMOA 5KYUA 3EUWA 3B1JA 4MYRA 3D8UA 2Q9BA 2X8LA 3KQLA 1M73E 4L22A 1X80B 4G9GA 2NP6A 3NBAA 3V8EA 4WJKB 2Z1DA 4JLSA 2VR1A 1E1MA 2QUZA 3FUXA 5EN4A 3WQHA 1EIWA 4GBMA 2IE0A 1KYVA 2QB5A 1Q22A 1SGWA 3S68A 4R9SA 2DUWA 4R1OA 2XHZA 3HEMA 1VHQA 2XUPA 4HOYA 3EGCA 4RGVA 4ENSA 2O19A 4OB8A 4CMCA 2IS2A 1K88A 1OX5A 1PR4A 1CUYA 1IXKA 1TO2E 1HMPA 2CXTA 2PH7A 5PGMA 3ROMA 3IPRA 2MJLA 1RLIA 3L49A 9LDBA 4GR5A 4NPHA 2YWCA 4HV4A 4UMVA 1EVIA 2DTDA 3K9BA 1BDHA 3ZWQA 1T3TA 2X1LA 1HTTA 1VPEA 3F6CA 3R3XA 3ZC3A 4BNXA 2REBA 1FDOA 1ZUWA 3SMVA 4TYWA 2NU6B 4JVNA 2Q27A 4GZ6A 2NP7A 4QARA 2FVXA 4FX5A 5BQFA 4OHMA 2PUVA 4RHFA 4QNMA 4HVCA 1E60A 4PRYA 3LT1A 3OCZA 1OMOA 5J4LA 2WG2A 1G3IA 4OU5A 3R44A 1UC8A 5BSVA 4E5YA 2OXEA 4YV0A 3ZCUA 1JAHA 1QZ3A 4DCGA 3AL0C 5LJLA 3D3EA 1CDZA 3W4JA 1E9VA 4LE0A 1YGYA 2VYNA 1HZZA 3NRJA 5TGDA 3RFUA 5E1DA 2RGBA 2YVLA 4NP6A 2O2JA 1RHRA 2RHMA 2HPVA 4CF3A 2DUJA 3DZFA 4JS0A 3OHSX 3PD1A 4A1FA 1USKA 1NPTO 3O38A 1UBHS 3OPVA 4KQKA 3PWKA 4CMAA 3SVZA 1OZGA 2RK4A 3ITDA 4RA9B 1KH3A 1C1XA 3F5SA 2GX6A 1U3TA 1Q3TA 3TLEA 4M9XA 1PFGA 1W29A 1J2UA 1TX4B 2JGMA 4KFSA 5BWLA 1Y63A 2B4YA 3UOGA 4EJ2A 3SHQA 1IBMB 3CF0A 4PGHA 2G0AA 4JUFA 4MQBA 4ZXFA 4KMSA 5ETJA 4DRXB 1TUBA 3H8VA 3I5MA 3LQRA 4BV3A 4B3IA 2RB4A 4WY5A 3TJMA 3DJFA 4EA6A 4L57A 1UMDA 4XSHA 2CWWA 1EZ4A 2IYRA 4OXIA 1P7PA 4X71A 3E9NA 1D2NA 3P9YA 3VU8A 1FL9A 4CU2A 3LP6A 3GLFB 4FN4A 4L5AA 3L7JA 1WW2A 3AKCA 2VP6A 1VG8A 4EYOA 1UBUS 2L82A 1EBUA 1JSZA 1X1SA 3GLHE 1NP7A 3L4BA 1SB8A 1JIIA 1SQ6A 4PAMA 3RBAA 3TNDA 1ZD3A 1F2DA 3U4CA 3VDXA 4YUAA 2PBFA 1N5LA 5TMDA 1T2VA 1WWKA 2QX4A 3VNSA 4H7DA 1EP2B 1MJGA 2CL5A 5DBEX 4CM5A 4NWIA 5MF6A 4LXYA 3EOAI 3G9QA 3LDUA 3OOHA 4ZJYA 1BNCA 4JIMA 1KS2A 3WKEA 3LUJA 1KP2A 2H1RA 4HXYA 1MLDA 3WKCA 1C9DB 1ECFA 1E0KA 1Z6XA 3EGDA 1R6BX 1USIA 2IXTA 1OXKB 2IXFA 1I3CA 2QMOA 2ZKIA 4MR7A 3COJA 3K30A 4LC0A 1BX3A 1C4WA 4I19A 4E2WA 4WK2B 4JBGA 1SC6A 5JWOA 2VJAA 3ZE8A 1UPCA 1C2TA 3NHBA 4V0OA 5CDHA 1K3UB 2RIPA 1XQ6A 2FGJA 3A8TA 4G5QA 4GOJA 4X1YB 3FYUA 3UN1A 2UYCA 4BDTA 1G5QA 4C4YA 3JR7A 4GXRA 2XR1A 1CRWG 1H8ED 3AF2A 3QBJA 3VYRB 5K99A 5DYGA 2QAJA 4N7BA 3DVSX 1YCHA 4US0R 4V24A 5CYFA 1KDZA 4EHIA 1FP2A 4QULA 3CHYA 1NVGA 1NBAA 2YIJA 5DSZA 4PBTA 3W90A 4EL0A 3SVTA 1E63A 1VC2A 4RGQA 2C4TA 5F7JA 4WZAB 1N6IA 4XPZA 3SDBA 4A8JC 4ZJPA 6ADHA 3RJTA 4FWIB 4NCXA 1MV8A 4G36A 5TX7A 5E6SB 3KR2A 3OM8A 2R8BA 3GA7A 1MORA 5ERYA 3WC4A 1XU4A 5B4VA 4AK9A 4DCJA 1CNFA 1U9JA 2D0PB 2LWIA 2VZLA 2I6TA 5JS7A 1RU3A 1XVTA 4EKDA 1AQJA 1T8TA 3MWLA 2VF2A 5CDFE 4EGSA 2HLNA 3BS4A 1DB3A 4P36A 3CRVA 3MCUA 4ZAYA 3IP1A 4MVJM 3L40A 1HDYA 1SWVA 3UGKA 4BUJA 1U3VA 3VDNB 3HEBA 1T34A 4ZO6A 3WKDA 4HDRA 1PF7E 1OTXA 4NESA 4X3PA 4Z0PA 5A2GA 3CO0S 4RXUA 5AKLA 3QVOA 2RH4A 2FH5B 4C9BA 1II8B 2CVZA 5JUWA 2P9JA 2KLHA 3I9JA 4UARA 2HWXA 2DRIA 3ZE0B 3DTVA 3D7RA 5KYWB 4YRNA 3THXB 1N4DA 3NIGB 2WWVD 1EB9A 3I9NA 1CERA 2BCEA 1L7RA 2JGDA 4NDZA 5AI8A 6CHYA 1FYEA 2REOA 2XGMA 3CLRD 4DWOA 5K45A 2D1FA 2Q45A 2BD0A 2ZRKA 2ZSUA 2Z8ZA 2NU8A 1IK6A 1AGNA 3ILHA 4IJVA 3AZQA 4BP1A 4DLSA 4JV5B 4B74A 1A8QA 2XUAA 4QRIA 2C31A 2I6GA 1F0NA 3H9GA 3R40A 1C3LA 1A2QA 1GARA 1G8HA 1MDBA 1ULHA 1E3WB 1YS9A 2WVAA 3CB4A 2QXTA 2ZWVA 1T0UA 3DE2X 4LJ7A 3JATA 1DOZA 4LI0A 3A1DA 4MR9A 4D57A 5BR1A 5M04A 4LF9B 4M55A 4P3XA 4QKQA 1GCUA 3BZUA 3Q2KA 5LQAA 1WJGA 2LCFA 2V6IA 1T5BA 3GLTA 3FHLA 1EM8A 2RAPA 4Y7DA 1W44A 4O5AA 1VBMA 4XJSA 2BHSA 1IHOA 3BC1A 4ADSG 1JDSA 4PYLA 4DRYA 4Z1OA 2G8LA 4MINA 4FGWA 1ZQ9A 5BW4A 4H4CA 5CR9A 4DY4A 2O48X 3RTDA 1YCDA 3GZ4A 1ZM7A 4ZI2A 1WBDA 1H8HA 1ZWKA 2YX1A 1VCHA 1Z63A 5TRTA 1CDEA 3NUQA 4BWVA 4MS1B 5TR9A 1BX1A 2V3WA 4QUJA 5HCIA 4QLAA 3FTDA 2CJWA 1LD3A 3X1DA 1FNCA 1PJ8A 1TYAE 3HFJA 3FW1A 4UVEA 2EL7A 5E7JA 2FWMX 3M6XA 1XEXA 1RRVA 2DQSA 2BTQA 3DYIA 4CQJA 5CG1A 1J09A 3R24A 3CSUA 3WJ7A 4DRZA 3OLQA 1C3JA 5H02A 2BMFA 4ENWA 4CLRA 2B9EA 3IMEA 4MUBA 3KKQA 3IC5A 2PLNA 1GEGA 1LGYA 4LQLA 4RH1A 1QHXA 4NBSA 3G5TA 3BH0A 3HJGA 5EE1A 1ZVKA 1W4LA 4JK3A 5GVRA 4TRJA 4EVQA 5IKMA 2XAUA 1RRGA 5LBTA 2XBUA 2FOLA 2PSDA 1JJVA 2PKRA 4HTAA 2EP7A 3D0KA 2JBWA 1RLMA 3PLNA 3VSDA 4X7PA 3PCRB 4ZT7A 4NMHA 3J81A 1PJ4A 4KO8A 3ZKWB 5LZ7A 2VJCA 1Z37A 2H0QA 3STYA 4AFNA 2BKXA 2BUBA 4TL9A 3KSRA 4YNBA 3E5NA 1IN8A 5EE3A 4HAOA 1M8GA 2V58A 4IIDA 1E32A 3HXKA 3BTVA 5DU2A 5JNUA 5KQGA 2WM2A 5AIBA 5H83A 1GNVA 1L3IA 4UPEA 1W1IA 3IVXA 1QZZA 3OLYA 4B75A 2B7BA 2IUUA 2CB9A 1HDIA 1VRCA 2AK3A 2H4YA 2PZAA 1TUIA 3HRIA 4JUAA 1XZAA 4M46A 2VPYA 1Z36A 5SY9A 2X0DA 4TYNA 3DHNA 5KKCA 3HCBA 1T43A 1AKWA 1P8AA 1FBTA 3QMPA 3UK1A 1YR1A 4BMVA 1NMYA 2GHRA 1KKLA 3LXMA 3OJWA 4KRYA 4IXNA 5IKXA 1KEEA 1ZOOA 4UFNA 1XQVA 2W2VA 2WPDD 1LFDB 2ZQ5A 2HN9A 2IYPA 2JAPA 2ZT5A 2FSPA 1N5MA 2VTBA 1V8DA 2IA5A 4HDSB 4OPMA 2WVJA 1W93A 3D31A 4Y2YA 5IP5A 5HSGA 3EIOA 4MQ4A 1AZSC 5HILA 5GGYA 2OCXA 4CKBB 3FMOB 5IAOA 1F2VA 1THGA 1B23P 1X7YB 2WWWA 5LMZA 1L1RA 3L8DA 4OI2A 3P2KA 1XWWA 1ZG3A 3FCAA 1G19A 2WJIA 1W5FA 4MKRA 4S1NA 3W6ZA 2BDTA 4A2WA 2YR0A 3NC1C 4YV2A 1UBJS 4WLUA 4QODA 2Q99A 2XEXA 3DFKA 2WYIA 4BHTA 2GM3A 2JD0A 2VUTA 2SHKA 3KD3A 3V7FA 3FKQA 1Z5OA 3WMEA 4BGEA 5ITVA 1Y7PA 1RPAA 3KEQA 4GC5A 1QTNA 2ZBQA 1A76A 4KREA 1GPLA 3V4OA 3FFTA 3PFNA 1JIUA 2QVYX 5BV1A 3WTBA 4B81A 3NXSA 2FSUA 2X14A 4W5OA 5B64A 4H1TA 4XB1A 2EW2A 1YL6A 3WGKA 1O3YA 1SXJC 1WS6A 2XVYA 1M6HA 3RRJA 3U3MA 4BVBA 1CETA 1SNYA 2DJIA 3HP7A 3NDJA 1RWWA 1OLUA 5IDWA 3E48A 1PG5A 2QROA 2PZLA 3HB4X 2FN7A 3OZVA 2H5IA 1MA0A 5AHOA 2PO5A 3EXHA 4XE5A 3BE6A 2RGEA 5CM9C 2CFCA 1EESA 1O6ZA 4HFMA 3OD1A 4J49A 3G82C 2YINC 2O3RA 4A6EA 3WDMA 2VG8A 3DO8A 1I1OA 1WBJB 3CX7A 4ZCQA 3TR0A 1WZ2A 2PUWA 4F56A 4KXYA 3HCAA 5C5IA 1KMMA 1KK2A 2QRZA 2MSNA 3ETHA 3DKPA 3RGWS 5DULA 1E6WA 3WIOA 2P8SA 3JSXA 1VHLA 1T15A 4LCJA 4EZIA 3RVSA 2R96A 4KNWA 4YQZA 4F8JA 7MDHA 1T91A 5KYUB 3ISVA 3WRYA 4Z2AA 2FXVA 5DRYA 1DQNA 1T9BA 5I9IA 3OOYA 4QDUA 2DR3A 2WG0A 2VHZA 4BLTA 3QPCA 4OV6B 4QVKA 2HA6A 5G3ZA 5I7RA 3I5YA 3BM5A 2N1MA 2QVBA 5CFOA 5IM4F 3FVTA 4N3AA 3AMVA 3MXTA 2PUAA 4JC8A 4UBIA 2R751 4WXRA 4IDAA 1MHPA 3GEMA 3H6GA 1XOIA 5DE3A 3N2EA 1R6AA 4YLEA 3UJ6A 4DC1A 8OHMA 2DULA 3IAHA 1VPTA 3K4HA 4RPCA 5KKAA 5JVDA 1KJWA 2CBZA 4P0PB 1Z7BA 3I9KA 1GRRA 3HU5A 2F3SA 1FK8A 4TS3A 1K8YB 4KFRA 3DZKA 4EKNB 1S1CA 2FWRA 3D6FA 5D2CA 3HVHA 2BFFB 3UJNA 5CDGA 1CZLA 3LTEA 4B4UA 3BIOA 3IXMA 3VR5D 3LI2A 4XUDA 2D2IA 5L3QA 5K2MA 4UHHA 4NBWA 1BGXT 1CZOA 4WY8A 3EDCA 3V32A 1ODIA 4J29A 4FMDB 4L95C 2VNAA 1N2XA 1E1QA 1XTJA 3JQ8B 4FYIA 4MNTA 3VC2A 4EYSA 3ZU3A 4GI2A 4DCCA 5SYMA 3QU9A 5KX5F 3SXPA 1HLDA 1DJQA 3TCXB 4R7ZA 2IS6A 4CXMA 4LSMA 5JCJA 2D3WA 2GRUA 2SCUA 1FJ2A 1Z0JA 3D3QA 4HHEA 3ZHSA 2A5FA 2P91A 2ZI7A 3UOAB 2YJZA 2F55A 1Z5ZA 3NHFA 5F2OA 3D4PA 1WLYA 3BSFA 3KJFA 4Q82A 2OV1A 3C5WP 2IHYA 2AW5A 3WHPA 1HL7A 1YVRA 3KNZA 2P27A 5TEWA 2A33A 4K3UA 4MQFA 5EZQA 1NAHA 1OLXB 1X7WB 4W5TA 1CVIA 2JI6A 2ZJOA 1B8PA 3PFKA 4DUPA 2FSGA 2X9LA 5LP1A 4INAA 1J4AA 2JHFA 9MHTA 5SV2A 4C03A 4AQDA 1TYCA 1HNZB 4TLEA 4R6XA 1FNNA 3SYLA 3V55A 1TF7A 1A9QA 1S2MA 1M6EX 1QC5B 5EHNA 1PNRA 2VEOA 5BSUA 2IOHA 2IZ5A 3MPUA 4HFRA 1YZLA 4MS3B 4NMMA 4YRMA 4DA8A 1OGYA 1Y0BA 4GPTA 3AWDA 3WGVA 2EGUA 4GX0A 4F3YA 3RIMA 1P2TA 4IMIB 1V45E 3QVWA 4I1IA 3Q12A 4JYBA 5FLEX 2VHYA 2JLYA 2IEZA 3OQ6A 1TC1A 3HV0A 3OC6A 3PDCA 1W87A 2OOSA 4MUIA 1KRWA 3VTAA 2AZTA 4E5VA 1N5DA 2QENA 2QRGA 1XNGA 1NQTA 2JAXA 3BD9A 3N87A 3HPRA 2VXBA 1JKJB 1SKYB 2WD7B 3LZ6A 2NIPA 4OJTA 4PAWA 5IM5A 1QS0B 1ZVJA 4IY1A 1Y9DA 3H13A 4Z4EA 5EIFA 1KSHA 2H1HA 2DWCA 1TU4A 1QVWA 2GN0A 3L3BA 4QXAA 4Q18A 1IN4A 3PENA 1P0CA 1II9A 1V1MB 2H4JA 3I2KA 1I5EA 2W71A 4MPDA 2EKLA 3PEUA 1TZBA 3IBSA 3QU7A 1VLHA 2I0FA 3VR6D 1E5QA 2B6NA 4Q9NA 1JAXA 5HMLA 3QF7A 2C0QA 3L4SO 2PV0A 3DMTC 1AD2A 4KO4S 2FF5A 5HF5A 3WGGA 3ZY4A 4BO2A 1PEDA 1CJBA 1GG8A 1E6CA 2BEWA 3IP6A 3IMGA 3SEQA 1RC0A 3ECSA 2UZAA 4HAIA 5SY6A 3ORFA 1PSDA 3ITNA 3PC3A 4NC9A 1KDYA 4B47A 4PYJA 4LW8A 4ZTZB 1VQ1A 1YUMA 1N77A 1ABBA 3DUWA 1GKIA 4WT7A 1O95A 1I1NA 1JPJA 4BP3A 4ETNA 3E2IA 3N2KA 3LQ1A 1T5TA 4D0RA 1T2EA 4B2IA 2EBUA 4FFWA 2B7CA 4EI7A 3CW2A 2P9GA 5EOVA 5TLSA 3PKJA 2BM8A 2NWQA 4HQRA 1NU6A 2HRCA 2ICAA 4JI3B 4OHVA 1HL3A 5IC5A 1V0JA 1ZD1A 2WHQA 4EPYA 3BHIA 3R9XB 4G8DA 2Y1DA 4DR2B 1TVCA 2BSQA 1P31A 3WGOA 3B51X 2QMZA 1E2FA 3G8AA 4C22A 3JQGA 2AUMA 1L5LA 4EYKA 1N92A 3SU8A 1W0CA 2J0EA 3UC5A 4B6OA 2Q1TA 4UTVA 3RROA 1X0XA 1XQWA 5C1DA 3KHTA 4FYVA 4G07A 1F20A 1CFJA 1N1EA 1BHJA 3E3NA 4NPCA 3SCZA 1U8ZA 3AHHA 1V1RB 4MWTA 3QFSA 2QQGA 3FYTA 5AOVA 4MI3A 4Y2RA 3A9TA 3EZLA 1CRLA 2WWRA 3OE5A 4LXQA 4P4SB 4H2DA 421PA 5K3DA 3WRVA 3O0DA 3ZTYA 1SULA 1Y5RA 1XD2A 5HJ5A 4ZDWA 5LXTA 3STXA 3CVUA 2O8DA 1Q83A 3JD4A 3PXCX 2ID9A 1PNVA 1YB4A 2C4HA 1H2RS 3EEQA 4DG5A 4N01A 4O2AA 1A8IA 4PAGA 2JASA 2FPMA 4XAQA 4DJJA 1M2JA 2P8JA 1B43A 2PKXA 3DQQA 4UAGA 2WSLA 2COUA 4ZQFA 1MKYA 1PGPA 2GJKA 3IO5A 3A70A 5FEUA 3JAMA 2JJ2A 1DC3A 2G25A 2ZSJA 3O8LA 5A5EA 2FG7C 4JODA 3F97A 2RGDA 3RGGA 2ZULA 3WL4A 4UUNA 3LCCA 1I6KA 4YAUA 5K0ZA 2DBRA 1WOMA 8ABPA 3OUZA 1GR1A 3H1GA 4JOSA 4D1YA 5L3ZA 5JMWA 3UJ3X 3FKJA 4DS3A 4ZVNA 3G0CA 2MSWA 2ZB8A 4EENA 4TGLA 1OAOC 1O96B 2GM5A 5KVQA 2HO5A 3PYMA 1WTCA 4J0HA 3K5WA 1K3TA 4WAUA 3ZEIA 5B4UA 4A8HA 1QP4A 2QD5A 3BXXA 3LQKA 3WGUA 1H4TA 3GG9A 4HQKA 2Q8NA 4K5QA 1E6MA 2BZ1A 3G88A 4YMIA 5SYAA 3VYSB 3VU1A 1JA0A 2IE8A 1BMFD 3M6WA 5E3JA 2CDRA 2IY7A 1THZA 1XJWA 3OJCA 1VPWA 1FMFA 2CFIA 4J2TA 1N2CA 4TYMA 3PUJA 3BA1A 5L51A 3PD7A 4B7CA 4G9BA 1PGJA 2ECQA 4BKUA 3RODA 3V00A 2VKTA 3MOSA 3P2YA 3LLSA 3RG2A 1NVXQ 3QH4A 5IDYA 3BQNB 3H2BA 3D6VA 1L9XA 4AKIA 4B87A 1PEKE 2P7HA 3U81A 3GVXA 3VDMA 2ZAGA 2XBLA 1L4FA 1SEVA 4UFOA 4QNNA 1NVVR 5A0TA 3KIPA 1E1RA 1RXWA 4MWOA 3HL0A 2F9MA 3D2BA 3BAFA 2PQ0A 3M1IA 4PYKA 4ZVTA 3SR0A 4AZVA 5KDDA 2XRZA 3RSOA 5IJXA 4M8LA 3Q3GE 3EXIB 4QBGB 1EFDN 5FWXA 1AA6A 1JVSA 1JLLB 1NBHA 2GFIA 2GO1A 3D6TB 3HXPA 5CU7A 2RC6A 5EEGA 5AR1A 3AXTA 1ZX1A 2WAAA 3EVNA 4XCXA 1O97C 2HHJA 5CVJA 5BSWA 2XGSA 3AVTA 3G5MA 5TPZD 4RV5A 1SBYA 1RMYA 4KR3A 4GLJA 4L07A 3RVNA 5K51A 4AWBA 4CE6A 3PVZA 2QP3A 4A0FA 3DKVA 2QY9A 1FFBA 2DFPA 2J4CA 4PZDA 1DBRA 2VWHA 1AO0A 4LHEA 1JXQA 2ZXFA 4YHBA 1EE2A 1QTIA 1XUOA 4RTSA 5J2TA 3BL8A 3D6UA 5WRFA 4IIVA 3RRXA 4U2EA 4ZQIA 3HYNA 4HQNA 1XRRA 1UBFA 1TCVA 4KOEC 1GLVA 3FGZA 1DKLA 4YWJA 5A02A 2O54A 1X3SA 1NUPA 5E9JA 1I24A 4GX1A 2YJGA 4UE6A 3SIXA 3UFXA 3IDZA 5DZSA 3MTJA 4HGYA 2VAWA 3LT4A 3Q85A 3FZGA 2X8BA 5EZ5A 3P4UA 5FF9A 5DLPA 4KUEA 5DW0A 1BXGA 3WL8A 4ZI7F 2OCBA 3UOWA 3VZQA 4EPVA 1SXQA 2W43A 3KX2A 3MA0A 3ROZA 1I2AA 2PZGA 4JKYA 1PJSA 3QYPA 2EWMA 3OZXA 3GJ5A 4G67A 1P5RA 1Z8HA 1L5GB 3INGA 4X24A 2W70A 5A62A 1J1UA 4EDFA 5F52A 1BCRA 2I03A 4LJRA 1BJRE 2J31A 1ABFA 3O4JA 4PV7A 4ZYLA 2CJFA 3KVYA 1YR7A 2WNIA 4AIRA 1KTIA 4LJYA 4BRUA 5JTUA 4QYSA 3AJDA 3G02A 2QL9A 5JAIA 3GUYA 3UJ9A 4I2NA 5B3JC 2D1SA 2VH2A 3IEIA 5JARA 5K3EA 1ANKA 5KNDA 1E2MA 1MENA 2PQ6A 3O4FA 3LLUA 3QBVA 1MH9A 1N2HA 3TLJA 2ODNA 4JU9A 1ZDMA 2J3MA 2VIIA 1I5RA 4NEGA 2NNWB 3RSSA 1DRJA 3DMRA 4ZOLA 2X77A 1J8FA 5DIFA 3WHIA 4M22A 2DLNA 3NCTA 4BNTA 1DPGA 4PZPA 1Y5NA 2NYUA 4DJTA 1QFSA 3WIDA 1WSBA 1X7ZB 2C5EA 3L1IA 4PS1A 4X8LA 1J90A 2FPGB 2HPZA 5TB5A 1TECE 2Q0XA 3IDFA 3FCEA 5CCXA 3VVCA 1OFUA 4F97A 2QE7D 4O0LA 5B6PA 1WTAA 1QKIA 4G0MA 1GO2A 5GPBA 2VP0A 3DE3X 4KQ6A 4UM7A 3TZQA 1BW9A 3NALA 1R37A 3Q5EA 2Z04A 2JC3A 1UJNA 5KSWB 5J4YA 1W47A 4L8WB 2VT7A 3P1JA 2ZTHA 3CVWA 4YXWA 2Z8YA 1NX6A 4MRNA 2VK2A 4IHJF 3WYBA 1NAIA 1AC5A 4CMHA 4BY9E 3OF5A 4DGQA 4DCSA 3NJRA 4LF8B 3WWPA 3JALA 4MP6A 3QFTA 1A2KC 4OM8A 1I2MA 1V39A 4LOKA 4FT2A 3VOAA 2R5FA 2ZRJA 5EJEA 5B55A 2IZ6A 5IXYA 4LBVA 5F77A 1XTBA 3OWXA 1ICIA 5DH9A 1V8FA 2QYHA 3E1GA 2KW5A 1IC6A 2DHDA 4TYQA 5EP4A 5T57A 3E5HA 3AOGA 2HB6A 1DSSG 4XGRA 3Q7RA 4RFSB 1PRYA 4UAJA 1MG0A 1F7UA 2VTVA 3NETA 3WNDA 3M2PA 2ZQZA 2VS1A 4HWTA 4TZ0A 1JI0A 1P0IA 3E9DA 2VRNA 3PRJA 1IOLA 4H27A 3ROGA 1TTPB 5AKHA 1N7HA 4LWQA 1DLJA 4WZBA 2MINB 5HG0A 3I01M 3Q9SA 3V34A 1AKUA 3LC2O 4DV1B 3FETA 1UT8A 5EQDA 3AF5A 3EZNA 5KSZA 3G0IA 4F91B 3RADC 2D3TA 2XA9A 3HR8A 1BMTA 4QUKA 5CG2A 1C3OB 2DFDA 3CZMA 3ZD6A 2B8TA 3OH8A 5K9ZA 1HRKA 4LS3A 3E03A 4XUGB 1OC4A 1NNUA 3BXFA 1MX1A 3CINA 2JK1A 4CMBA 1PAUA 4DYHA 5BW5A 1HQCA 1DPFA 3CE6A 1GTJ1 2GJSA 2HPAA 4FPXA 1JH9A 1B6RA 3CEHA 1KI9A 3GW8A 1V6SA 4BQQA 4M6WA 3X1XA 3COYA 3T7JA 4EMTA 2P4SA 5BY2A 3ZUPA 1GTL1 1COWD 1NN1A 3A3NA 2GPAA 2HJVA 3JWPA 3SQOA 3UMSA 4RXTA 1W76A 1JT2A 2E1RA 2VTKA 1DZ3A 1SOWA 2R8YA 1DBVO 1L4EA 2ZUTA 1P6QA 1FVOA 3AUYA 1A8SA 3NBMA 5FPQA 3RRNA 4YJGB 3LLVA 1AURA 1T0PA 1O0CA 2FLKA 3BF8A 4GO1A 2ETVA 3STVA 3R0IA 4FYMA 3G6KA 3S8YA 1JXAA 5K3CA 2H1LA 2G17A 4JEHA 2ZE5A 1E2EA 4NG4A 1D1PA 2YYSA 3MMNA 3AG6A 2XQKA 1KWKA 1JQ3A 2B7LA 1FDRA 1M0TA 2PX5A 4IGEA 2RGRA 1FVHA 1UIMA 1EAMA 1XLWA 3AERA 4IYRA 2H4FA 2G9QA 1IULA 4UHJA 3FLAA 3R0VA 4MCHA 3RIEA 2AL7A 1MU0A 2BGUA 5H5JA 1P6XA 2WSYB 1ULBA 1U3FA 3EQ2A 3K15A 1YA8A 3KZVA 3L9XA 4Y2TA 4A92A 5IJ0A 4P1ZA 3OA0A 4FZRA 3B1KA 2FEAA 4F72A 4XWKA 2XF2A 2ZRFA 5FP0A 2O7RA 1O94C 5LZ4A 1U8YA 3AEUB 1VI2A 3N2LA 1U8UA 2BDUA 1UJBA 5DYTA 1TL7C 2W8ZA 4L4RA 2ZIAA 1E59A 4A6XA 1K5GA 1N1MA 2FPIA 1GV1A 3FDIA 3QVTA 4HGZA 3RBVA 5BUSA 1DDIA 1XKTA 5AXBA 4BRZA 2LIVA 3IDQA 2HRDA 4PSDA 1DAHA 2FQXA 1RE1A 1VHJA 4FFSA 4WMLA 1QFJA 3HCCA 4DQKA 1YBVA 2GO7A 4LCEA 1ZZGA 1P2VA 3ENVA 1S9DA 2K5UA 1G7RA 3SQMA 1VMDA 4N7RA 1I9CA 1WHTB 3UAYA 1YH3A 3CN9A 4G0QA 1NU8A 3VPFA 2X5JO 4KWIA 2G7ZA 3VA7A 4O8CA 3MPOA 1XALA 4JT9A 3SD7A 3R3SA 2FYTA 3DBHB 4ZP1A 2ASVA 5E1MA 3BTUA 4R4JA 3WKBA 5KC9A 1ODFA 3GLIE 3L0PA 3PICA 3G6WA 4JUDX 1DL5A 3A9UA 4XDZA 3OIGA 5AQ1A 1IBLB 2Y1OA 3AIIA 1T6YA 1M7BA 1F3LA 2F1HA 3W9UA 2I22A 2ZSKA 3RKRA 5EHXA 1CUHA 1NUQA 3I2IA 4YYZA 3ANLA 3ZVLA 5CW2A 5IG2A 3L4EA 4Q5IA 4BRSA 3SS9X 4CWAA 3A14A 4NCNA 1IN7A 1GCGA 2X7XA 5HZMA 4CM7A 1DQPA 1WXEA 4OAQA 1FU7A 1MOZA 5IPFA 1VIVA 2UUPA 5K8VA 2BFDB 3TD9A 5EHZA 2FDXA 4HWGA 3L7CA 3PZRA 1NMZA 4UUPA 4IF6A 1UKBA 4BZPA 1EE1A 2C5GA 2F1KA 4CKCA 3H2HA 1QLWA 4MKHA 1JZSA 1CIJA 1TU0A 5CT6A 4BN5A 3OX2A 1ZRHA 2J3JA 2W2KB 1J5PA 2WUWE 2GZDA 1PE0A 1AQYA 1DTWB 3AESB 3ANYB 3NX4A 3IDOA 4WW0A 3L7BA 5EKXA 1NVVQ 4Z99A 3H3FA 1RJEA 1U6JA 4KX5A 3HCFA 4NFSA 4G4IA 4PLHA 1AS0A 1C8LA 3HE3A 3L6EA 3ZNQA 4DIOA 1HKHA 2P6RA 5EJ2A 4PPQA 4JLVA 4FFOA 1J0XO 2PS3A 3HO6A 4IO1A 1HDXA 4KK4A 1SOUA 4R84A 3BREA 4DLUA 2F17A 2X8JB 1EGMB 2E55A 3E7WA 3N70A 4EY5A 5JZ9A 1E0AA 1WKCA 4ZAVA 4JLOA 5IFLA 2O52A 5BVHA 1R2QA 3SP1A 4EVRA 1ZRNA 1CZRA 3GCDA 3DDCA 3NPMA 1JWLA 5JJLA 2HR1A 4GI3A 2XZDA 4AECA 1JSRA 1GP2A 3TW6A 2OQVA 3TRKA 1WVIA 2UYYA 2QRPA 1W48A 2C82A 2WE7A 4H0NA 4MI6A 1AHNA 1JHPA 3U5ZB 3IERA 4OQZA 5GP1A 3KFLA 1A4RA 2OHFA 2J7PD 4JOQA 2AJ8A 3DZGA 3T34A 4ZZ1A 3CRRA 1WXWA 1YB2A 3N8KA 3RS2A 5IKOA 4HH3C 1H3EA 3HDVA 3ASYA 5GONB 2WKQA 3CNBA 1WLSA 2XDQA 4IGAA 1JFLA 4D4JA 1DAFA 1XZBA 3GLHB 3P2IA 2NXWA 3OIVA 2ZTSA 4M86A 2ONCA 1LW7A 4GOLD 2VJNA 5JMPA 4JXZA 4NH0A 5A7HA 2P1ZA 1QB7A 2F48A 4RYLA 5I4IA 2CC2A 4FJ0A 3QE0A 3J7TA 1Q7BA 2D1TA 2W7TA 2BGKA 1WXDA 3RS8A 4EIWA 3OP1A 5FIUA 4AZ0B 1KMNA 4FR5A 4EKEA 1XCMA 1BEUB 4D9JA 5LLDA 2ECOA 1KRXA 1K6XA 4C2BA 1DG1G 4A8PA 3IBFA 1Z17A 4O2BB 1KYZA 4KAAA 4ILKA 4MVJE 4Y18A 2C9BA 3LGXA 4TTAA 1SK9A 3LNCA 3IIMA 5J40A 3THSA 4TL8A 2QN8A 4KLRA 1ZNWA 1KAEA 2IODA 4NJMA 4PE5B 4Y9RA 6PFKA 3BXPA 3TIIA 5CITA 2CXXA 3EZ2A 4RJIA 2Q3EA 4CKWA 5LIPA 5JY6A 2ZI3A 4AYWA 1HE1C 1JAYA 3ETLA 3BVPA 3K5IA 4C4ZA 4XIYA 4CETA 3EOBI 1AT1A 7YASA 5E9AA 2KS6A 1RNLA 3FWNA 3I1FA 2CXNA 4MP3A 1WF3A 3GFOA 3ZR4B 3DUFA 2CXUA 2XGJA 4QQKA 5EWLA 1JHQA 3AX6A 3HCRA 4BXOA 1Z5VA 2FPXA 1MBZA 3QXCA 2CNDA 3T3EA 1Y7LA 2QTNA 3O26A 4DSTA 2W4IA 1U5AA 3PHLA 2RGNA 3QLVC 1M0WA 1QYDA 1FYVA 2GVDC 1E6LA 2SBTA 4DQ0A 1HC7A 2WWHA 5IUKC 1S7GA 2JFHA 4LVCA 1OC2A 3NHYA 4MW1A 5TV2A 1ZINA 4DTCA 2DBYA 5FPHA 4EPWA 2OO5A 3M4ZA 3OAAD 3OZWA 4FFDA 1UAGA 4CFYA 3M6IA 1VZ3A 1YDGA 4D41A 1K4YA 1EGHA 1PR5A 4LRQA 4O3FA 2D5LA 2C9OA 1FSGA 3U40A 1IXSB 3W4KA 2VK1A 3AUUA 4MI9A 4YAEA 2YWBA 4UQPA 1MFZA 1GG5A 1W52X 4ZO9A 4D4GA 1YE5A 5KQMA 1GPNA 2CLFB 1ZH0A 3P0HA 3F5DA 4MZXA 3OOSA 3PNLA 1LS1A 3TOCA 4NHEA 4BE4A 5JHHB 1WZEA 5JEEA 3AU9A 1PWHA 4XWYA 2HSZA 4AG3A 1IYZA 1GQ2A 2AG1A 1G59A 2PRKA 2F6RA 3B53X 3VR0A 1P1FA 2SICE 4LMRA 3TO5A 1S3GA 3AR7A 1Z0ZA 1Z38A 3Q7QA 3PTLA 1AGXA 4OGGA 4HB0A 4C0JA 3R0XA 3V1NA 1DDOA 3PDIB 3DDSA 4E30A 3FDJA 1IUKA 1G98A 3TZBA 1R6UA 1TK9A 2G5TA 4JDUA 4BU0A 1KOFA 1DJLA 5HDBB 1OROA 4NS1A 3B48A 3H2IA 3ZHTA 4V1CB 4J16A 3RIGA 2NU6A 3G7UA 4KVFA 1K27A 2GEFA 3OT1A 4FFLA 4KIJA 3ZWMA 4BJ6A 3L43A 4KP7A 4JLKA 3N07A 4J4HA 2JBAB 4NYIR 3KOOA 2WIJA 1G6HA 2WJ6A 3E35A 3IUNA 4TVBA 5I8ZA 1GNQA 1ZJ6A 3ZHQA 2D7DA 5DIZA 1PWZA 4WKOA 5DSTA 2C9ZA 3PHHA 3VU9B 1DUSA 1EWRA 2B8EA 3CBQA 1DV1A 4BDSA 3QLTA 3QIAA 4RVGA 2OORC 3O94A 2NV6A 4OQPA 4W8GA 4XR9A 4B2YA 2Q2NA 3R41A 1C1YA 4P98A 2GBCA 3K1YA 3UAXA 5EJ5A 1U0BB 4PIVA 1GTG1 3LXXA 4PNEA 4OGKA 4DIEA 4HDKB 2ZPAA 5DXJA 1JQLB 2A1TR 2DKOA 1V4BA 5DGIA 3L2OB 4K1XA 4R2XA 4U2CA 4B44A 4RA9A 4WFJA 1YDEA 1YL7A 3IT2A 3NTVA 1FRQA 4J0FA 1LQTA 1WVGA 3DV0B 3Q1LA 1C0PA 3R6TA 3F9RA 4RUKA 3DE5X 5H4HA 2O50A 5I9TA 1RZRA 3JARB 4QJ5A 5FOQA 4RJJA 1PFVA 1GSOA 2A5JA 1CF9A 5CTJA 2G4VA 1VRVA 4FDUA 3RHTA 1IWPB 4C88A 1MB4A 3T7TA 2H8KA 1YS4A 4QE3A 2XLCA 3GLFA 4YASA 1JLKA 2QAGB 1UK7A 3JASB 3ZXUB 1OZAA 3ROPA 4D8YA 4MWGA 2I62A 4H6WA 3KE8A 5ADUS 4I7EA 3N58A 4AI6A 2WKSA 4NDNE 3T1VA 4PG4A 4ZARA 2R8RA 3HJHA 1BKYA 3VPDA 2F3PA 3W5JA 1GPMA 3VBCA 3HDJA 1YQ9A 2D1QA 3AM4A 5CLQA 1DIRA 2RGAA 3AI3A 3ME5A 1AA9A 2XMZA 5EE9A 4OUDB 1VLQA 1TA0A 5KYKA 3NKLA 2JEOA 3KJIA 3N7AA 3UTDA 1MR3F 4DCTA 1ZXXA 1GGMA 2EBWA 2WICA 4FHGA 4IS2A 3L6CA 5F4ZA 2JFBA 4JFAA 5DT9A 3RC8A 3HYLA 2D8MA 4QRDA 1RKVA 3KVVA 4J0IA 4R5HA 3L7OA 4NZMA 3ESAA 2P9HA 1NW5A 2TYSB 2Q41A 5CLFA 2WV7A 1QE0A 4UTXA 2R7NA 1TM3E 2H85A 2GAJA 2LBPA 1US8B 2I3BA 4U0JA 3VMMA 1XZPA 4BVFA 4X1YA 4CLDA 3WAGA 4B3SB 1EINA 1NVWQ 2I99A 3R4CA 5KQSA 1OA0A 4UPVA 3MWJA 2QPAA 3BA6A 1WF6A 3ORYA 3LS2A 4QO7A 3LRPA 3T94A 4IEEA 2H5JA 1ZAKA 5LIRA 3NJ4A 3AEYA 5A4IS 3E23A 5C7OO 4W9NC 5EJ9A 4JWTA 1FDVA 4QYIB 1C7JA 5I7AA 5L3SB 2J0VA 3AKEA 4WZAA 5CVDA 4C43A 3WMFA 4YALA 1M6VB 1NOJA 2QT9A 4NIMA 2CBXA 1U2DC 1QONA 1UZNA 2AXNA 5E6SA 1VP9A 1SU6A 1V8OA 1XLTC 1K1EA 4XJTA 3ETGA 1RAEA 3CPHA 4HC4A 1CUXA 2QBYB 1MX3A 3FCXA 3MXOA 1CZNA 5D01A 1KSJA 5FUWA 3I1JA 1WEHA 4E09A 2IX9A 2V5VA 3ZLBA 4BGUA 3UMMA 1L3BA 1PV1A 2YWJA 1M1YE 5E6RB 2GEBA 3K3PA 1DUIA 1MUUA 3FVVA 4ZEOA 3SI7A 2D1RA 3OE7A 3NVDA 4M2LA 5AH0A 2EW1A 1KIMA 3GLQA 5YASA 1Z3IX 2AQHA 2VC2B 4RLSA 1KZ1A 3D0RA 3SG0A 3MUFA 5I9SA 2H7XA 3OSUA 4RK1A 3JVDA 1II8A 2J5RA 5KYWA 4C08A 3THXA 2MT9A 2IIQA 2C5BA 3H5AA 3PIIA 1ZBQA 2JHPA 3RPEA 1Y8AA 2FNAA 3VNVA 1OWLA 3T95A 1F4VA 2FFQA 2HMAA 4HNRA 4KLCA 4ENPA 1HA3A 1PZFA 3UT0A 4CW7A 1BOFA 4M7PA 3BEOA 2CHEA 2CNKA 1E1YA 4ECAA 2CXPA 4LE2A 4DNFA 1MJ5A 2F8LA 3COVA 3PJGA 5AOAA 2A9PA 1WZUA 2DUMA 3O7MA 5DLYA 1KBZA 1E3WA 4BKPA 1M5RA 1R12A 2I54A 2IHJA 3GJ0A 4TMYA 2R44A 3NNDA 5CA0B 5A9SB 1VI6A 3GJ7A 2ET6A 5FYDA 2QW8A 4GC9A 3ZY2A 3EA4A 4O0MA 1K63A 1UC4B 1XVIA 4KQFA 3TSAA 5A4DA 1YV9A 1F5SA 1UIRA 1VCIA 2DM6A 2HLHA 2ZIWB 1O5IA 4DJ5X 4C7JA 3HSYA 3GJRA 2AX3A 4Q0MA 5GVSA 1VJDA 3D54D 3FOBA 4FOOA 3SSNA 2D74A 5C37A 1RWMA 1L5RA 5E2AA 1NLZA 1EUCB 2D1YA 2G80A 3FX2A 1E96A 5BT8A 1RWNA 2GT1A 3O8OA 4XCQA 1DUVG 3KEOA 1JJ7A 1P2UA 2PXHA 4NLLA 1YONA 4BFUA 2FJPA 4LHZA 1BWQA 4MS1A 4W9RA 5I7FA 1E5DA 2C77A 1I36A 2ZIXB 2VWQA 1AX9A 3H84A 4M9QA 4B45A 3KKEA 3GRZA 5ALOA 1TD1A 1G5TA 3IIEA 3IYLW 3RR2A 3BRWD 4YMWA 4B0PA 2VDVE 4BFSA 3SEFA 2LCIA 1F4PA 1X94A 3NYRA 1H9BA 3QKTA 1ZA1A 3ZWNA 3BB4A 3UJAA 2DPMA 3A10A 3PRHA 2O06A 4BPBA 3SBDA 3FHOA 4LFAB 2WFMA 3RSHA 5CFMA 3H16A 2JAWA 1OZ0A 3ET5A 4XQ9A 4C06A 4XH9B 1LV8A 3G7SA 5LNK6 4C4AA 2DSNA 4H7IA 1BQEA 2PMKA 1P1BA 4RO0A 3E7DA 4EHLA 2ATIA 2JLWA 1AGPA 3CUKA 5FLYA 1T4CB 3ZDBA 3KZ1E 1RLTA 4A0RA 4XLTA 1F6DA 5AK4A 4BWYA 4KQGA 3HGTA 4RSHA 1EWQA 3KKNA 5CCBA 1I8TA 1LRLA 1D1SA 1HSOA 3AUJB 1RRMA 3LFHA 4OJMX 5LWHA 2FPWA 3M70A 4IV8A 4K86A 3W3AH 3KYBA 5ICEA 3H4MA 1E1KA 1QIFA 1U7DA 2ZYHA 2VHEA 1XTZA 1QJCA 3IUSA 2EX0A 3Q1KA 3Q3EA 4NL4H 1JJAA 5DNDA 3GT0A 1C81A 4KVAA 4H08A 2BBOA 4R1PA 6REQB 1UADA 3E2PA 4OP1A 3T4XA 2D2FA 2XRYA 1JYSA 1NRWA 1OH6A 3GY0A 1MF7A 2E7ZA 2Z2IA 3TRJA 3AONB 1OXBB 1ZMTA 4W8HA 1L4UA 2R8ZA 4BNFA 2XCOA 4RQAA 4WXEA 4EYEA 2OBNA 1ADYA 1Z5NA 3WMXA 1YJ8A 1KMCA 4PVDA 4TUYB 3LBNA 4RD1A 5E6UA 4A8TA 5IJWA 5BPFA 5K6RA 1RVDA 5LWQA 621PA 3R7DA 3NB0A 1KKUA 2D2EA 4MICA 1YRQA 4H7EA 2WMNB 1XRNA 4RS4A 3SZUA 3VYTB 4EKGA 3RREA 2R00C 7REQB 3P0JA 2GPTA 4MV3A 3VFDA 2CDNA 2QN9A 3PXUA 3EPLA 4Z7QB 4K1LA 1M66A 5E2BA 3PZBA 1U0SY 4NH4A 4PHTA 2DFTA 4NZPA 5ESRA 4HUTA 5I6DA 4ZEVA 3L7YA 4HDSA 5DJ5A 1FTSA 4F2DA 2BGJA 1E6EA 2PV7A 4CKBA 4OO3A 3FDZB 1DV2A 4JJ7A 1SQSA 5ILQA 1MNAA 4UM9D 2Q1XA 1X7YA 5ES4B 4MLZA 1I0IA 1TM2A 4MOWA 4JY7A 4J0GA 3VKHA 1XYGA 2H1FA 2I6SA 1UM9B 2BHRA 2ISSD 2YXBA 3BUSA 1MB2A 2VBIA 4HGOA 4EFMA 3I72A 2GCOA 5E4JA 1QM5A 3VQTA 4RS3A 2QTBA 1E2HA 4NTZA 1IMJA 2TMKA 1IDN1 2Z3WA 2F1OA 3N8GA 1LX7A 4PGGA 3WAJA 3QPUA 2PUBA 3KEFA 1XXLA 5EQJB 4NYIQ 3VR4D 3WR5A 4GQBA 4QBHA 2MR5A 5I4KA 4OBBA 2Q9UA 2JDIA 3KSBC 2B36A 2H1CA 2CZQA 5G40A 1ACJA 3ZE7A 3HYTA 1SXJE 5BXQC 1SR8A 2ZTUA 3UB4A 4TQAA 1ZNQO 4C78A 4I1YA 3KPUA 1MPTA 1LBSA 4NYMR 4EAQA 3WJ2A 1W1WA 3L6OO 2IUEA 1REQA 2PWAA 4R1SA 1XLUA 4GIBA 5EJFA 3ON5A 2Y1XA 3ANTA 3AR4A 3FPFA 4Q4AB 3VOSA 1WMFA 2EEPA 2AMFA 3N39C 3OZTA 4G4SO 3RW9A 4EG5A 4LJ5A 4JJ8A 3UAWA 4AF6A 3QRWA 1HUQA 4GSYA 5EWMB 3UXHA 4FM9A 5H0IA 4K8OA 1RQRA 3EYAA 3PQ7A 1FQKA 3KXKA 4URUR 2ZYUX 2V98A 1ISMA 3PDUA 4QUBA 1T4MA 1OGIA 1A7UA 4X00A 2H65A 3LW7A 1VKOA 3WO1A 4KE9A 4IV5A 2BBWA 3DULA 1W36B 3KAPA 2REXB 3SOZA 3F3YA 3CX6A 1B8OA 1SELA 2AEFA 2VT6A 1J9EA 1F12A 1ZITA 2PCLA 3O9MA 1QG6A 3OTHA 5DCLA 4ESEA 3EBPA 1R0BA 1SUFA 2O2GA 4R71A 4ACBA 2XV1A 3MG9A 5HA5A 2MSEB 5L95A 4GNRA 5MGNA 2ZJ4A 3FTPA 2FZ4A 3N05A 4XD7A 1YA6A 4LV6A 4QUEA 2I67A 1LKZA 1LK5A 1TB4A 3B20A 4F4UA 3LPMA 2MR6A 3D1VA 3ROTA 1ODSA 1YI8A 3K9GA 3NWBA 1JWAB 3UUFA 2XODA 5F9HA 1JS1X 1NFRA 1EWYA 1PN3A 3E5RA 4BNYA 1NRIA 3BT7A 4RY9A 5B2FA 1H6CA 2XTZA 4W1SA 4BMZA 4KE6A 2JCGA 2W2MA 4FZ3A 1YE3A 1R0ZA 4LYGA 3QHQA 1N36B 2YN0A 5HR5A 2J6CA 1GPUA 3ZBQA 2PA3A 2QGFA 3KRTA 4XIGS 2HYDA 1JBEA 1T8SA 1EVKA 2Q6IA 1ZMRA 4I3GA 3A1VA 3U4QB 2GTHA 4F4IA 1YZKA 1C0KA 2FMXA 5D5PA 2CD7A 4N5LA 2IITA 2IYFA 3EWAA 2I6FA 3H2GA 3JQ8A 4P4GA 1QTRA 2EZ8A 2R4QA 4J16C 5FAXA 1NQ5A 3HHEA 3TZEA 3AETB 3WHKA 4AKEA 3OOWA 4KGZA 3A6DA 5KSYA 5EPEA 1KFBB 5GM1A 4YR7A 3PRYA 2WKWA 3MBIA 1UZUA 4ASUD 4E15A 1B6TA 1MFPA 3A4NA 3RVBA 1TE2A 4OM7A 2OAEA 2P9QA 3N8IA 4IYJA 1Y33E 1ISSA 3R3ZA 3WGMA 3ZN2A 2XJ9A 4DSOA 2FSFA 3AKZA 2G6TA 3KT6A 1F3OA 2H8GA 3R5TA 4EG7A 1OLXA 3DV2A 1YB7A 3GFBA 3GCWA 1RKXA 3IMCA 4EECA 4HVLA 4QU5A 1F48A 3EUFA 2HNAA 4F1JA 3D7MA 2YJTD 2VDOB 1QF6A 4ZI7B 4MV8A 2K87A 4IDNA 1U0FA 4QAJA 3W5IA 1VJGA 2C8LA 1FYXA 1XZIA 4JL5A 1E89A 1V37A 2QMUA 4KQ1A 3LDAA 1E0SA 4F60A 4TSKA 4MS3A 3TRFA 4G84A 1PJQA 1QV7A 2C7BA 4PGMA 1EGQA 3SY8A 1QV9A 1BH2A 1G8KA 1M6NA 2EWVA 4MWZA 3WSTA 4DLNA 5K0JA 3CKYA 1OIVA 3EF3A 3UF0A 3W77A 5BSGA 3ZW7A 2Z5FA 1D6NA 1YZYA 4IDCA 4UXJA 4PZ9A 5IVHA 3N86A 1YT5A 2EX4A 2UUAB 3K4PA 1M6WA 4IOMA 3O31A 4L0CA 1LVGA 3OQMA 2XT6A 4KVZA 4OYHA 4DZTA 1N7IA 5IBRA 3R3VA 4BO9A 5DNYB 2FSSA 4IH1A 1YHZA 1CZHA 2AG5A 4GOND 3S6JA 1DCTA 4G01B 2NG1A 2M1XA 4L76A 5I9BA 3RC9A 5CNJA 2A9OA 3HBJA 3HJRA 1JKJA 2PZ8A 2WD7A 3MT9A 4I5FA 3GWZA 3E6AA 1QS0A 1Z4LA 3OX1A 4QLOA 3UGTA 2PU7A 3TVYA 5MN4A 3D7KA 4IJMA 4ZQEA 3EGXB 4PAQA 2XE4A 4YMSA 4YCMA 3DKKA 4JQOA 4J2OA 4CIAA 1KDTA 1UZMA 2O2CA 1U8FO 1VPLA 4RTQA 1V1MA 4OA5A 3JSAA 5A3RA 3X1MA 1UF9A 2A30A 1V3UA 3EIHA 3KXLA 3PGA1 4MGHA 3S29A 2HLDD 3BMCB 4OEHA 3TMYA 1VLZA 4Z7NB 2QNRA 3HXLA 3L4KA 4DV5B 4KV7A 1V7PC 3GJXC 2ZB3A 1YDWA 1JU9A 2PKQO 3FTQA 4OHRA 1LA2A 4I50B 4F7WA 4AJEA 1ZGCA 3UANA 4RORA 1NUHA 1ND6A 2VA8A 2W6JD 1Y4UA 1Z25A 4JCCA 4I6GA 4BLWA 2JG3A 5JZMA 1U7ZA 1XTKA 5HS6A 3KL4A 4FONA 1QH1B 3AGPA 4UTRA 6LDHA 3QLEA 1ZK3A 4JKIA 4O59O 5FWYB 2JFGA 3HJUA 4RFVA 3VSBA 2FX5A 3HBLA 2AD1A 4UBJA 1IZYA 3FHCB 2R4TA 4Y30A 3KLPX 1HFWA 1U9ZA 1W4CA 5CD9A 1IOVA 2BMVA 4GZ3A 4N0MA 1DJMA 1XV5A 1JG3A 4LHXA 5D7NA 4QGFA 3R9XA 1IZ8A 4YCNA 1RADA 1TAGA 5A1TA 1E2GA 1SUWA 4Q93A 5BRAA 2P35A 3C14C 4I5GA 1S0UA 3WY9A 3PL1A 4DV0B 1S5PA 1EJ2A 2CK3A 3ETEA 3VR2D 2F62A 2WTNA 2FGKA 1KU0A 5EKTA 4UU1A 2Z4TA 2A2ZA 5LP6A 3DR5A 4IWYA 1G8AA 2Z0MA 1E79A 1V1RA 2ZJ3A 4Q6WA 2HY7A 3L41A 3DNMA 3A6JA 3EMVA 4P4SA 3UXEA 5HCNA 1NQVA 1UODA 3CKLA 4LQDA 1P4HA 4HBZA 3ADCA 4KO1S 3IOBA 3QQPA 4D46A 3IR6A 1XYYA 4D8TA 2EX1A 5U9CA 2XGOA 4GE0A 1L0BA 4ENUA 3L18A 2C0PA 2VF8A 4I3HA 3WYGA 2WU4A 5JJ5A 4Z53A 1BKSB 4H35A 2REQB 3REGA 4EW6A 1WDWB 2GKOA 4RK0A 5JC1A 1S2NA 3P9CA 1XSEA 1DQZA 2ZE8A 3MILA 1YVEI 1X3LA 2J07A 3G59A 5LL6P 1O5TA 4LDAA 3IP3A 4UU8A 5IZCC 1M3SA 2V3VA 4QVIA 5FR2A 4OP3A 3MCAA 1PL6A 1CQXA 2OILA 2F43A 2NT4A 1VP3A 2X40A 4HH4A 5JD6A 3C5CA 1QAOA 3RYTC 3IEUA 1PJ2A 1DP4A 1GZ4A 3D3WA 3LGSA 1GNTA 1O2DA 4DA0A 4CLEA 3UPTA 3M5DA 1PL7A 3KKLA 4Q1FA 1HKUA 2X2OA 3CX3A 3PHIA 1XEWY 3NDRA 1UZAA 2NXJA 4DNXA 2JEZA 3PEWA 2I80A 2ATVA 2FHPA 5ECYA 1KP9A 2YYZA 4AUNA 3IP8A 4WCFB 5JD5A 1ISPA 4NAVA 4M54A 1XU7A 1CY0A 4KG7A 3BERA 2PT7A 2JJ1D 4JLJA 1CE8A 2ONYA 4RZ3A 2VP2A 3COPA 1NSYA 5F5XA 1J8QA 4QIHA 3I04A 2YHBA 3ZDYB 1ZXBA 2PT5A 3KM0A 1QH0A 5BSKA 1JQJC 3DD1A 4K0RA 2G0TA 4JI6B 2BBTA 3GEPA 3IALA 4AF7A 2P2ZA 1ZS9A 2N3ZA 1D0IA 3JQ9C 1M2EA 2J1LA 3DW3X 3SF0A 1DEAA 1WULS 5KHLB 1KY4A 3IBGA 4Q24A 4IV0A 2R84A 2PRIA 3QX7A 4TM7A 2Q1WA 3OIFA 2R66A 4BN0A 1KK1A 2FQ1A 2HC9A 2W37A 4PG6A 1IJFA 4J0CA 3UMRA 3KPVA 4G5RA 3A26A 4J91A 4HNSA 5IJ9B 4EB0A 3ZD8A 4Z0HO 1PIWA 4TSFA 3BWYA 1JEOA 1NG1A 2ODPA 4RTOA 2BE9A 4NYMQ 1JEDA 2AC2A 4D9MA 4PCVA 1ULAA 1IIBA 2NUTB 3MWYW 3ORQA 1HT1E 5CYGA 2Q2QA 4DCOA 3ZE1B 4XRGA 2P5UA 3AJ9A 4E4YA 4EGQA 1AMNA 4YRDA 1JKFA 4EG8A 1HYHA 2OV8A 1KP3A 1JLLA 2FUKA 3GAAA 1X8LA 1UDAA 3GO4A 5CM2Z 4KSBA 1QFYA 5CJPA 3JQAB 1M8FA 4D9NA 3SC4A 5ARBA 1S2OA 3NV9A 4X45A 5EUMA 2X0RA 4KQIA 5CEFA 3FB4A 2Q5LA 4ZCMA 4LKRA 1W6UA 1A2BA 2ZB2A 3DR3A 2FFHA 4C3VA 5BV2P 1P3DA 4A2PA 1P2SA 3LSYA 2NYVA 1SHKA 4I36A 3HCEA 5BNTA 4LTNA 1D9XA 1TEXA 1RFGE 2JKYA 4UBKA 4YN3A 2BKLA 4CF7A 2AZDA 4QJ3A 3ZDZB 1GILA 1LLQA 4HB2A 5LQKA 2O5EA 1RQ2A 1OBCA 4XQEA 3BD8A 2X9VA 1S8FA 2VP5A 4GPBA 4OK3A 3TAHA 4KR2A 2P68A 2SKCA 3U1BA 3QVMA 2WJPA 3NONA 5GJCA 4F12A 4JYZA 1XAIA 2WKRA 4HLUA 1G5PA 1WCWA 2NZ8A 3H97A 1VIAA 2PLAA 3KLBA 4MWBA 3RKUA 7AT1A 5CURA 3ILXA 4LRXA 4OXYA 3QOXA 4FCCA 1KAMA 1YBAA 3WO0A 3WRXC 5K3FB 4ONEA 4P4NA 1ODKA 2DZDA 3H5LA 3PUWA 1TQHA 3GUUA 3H1FA 1XX6A 4OLFA 3TGPA 4QYXA 2E21A 2RSLA 1PSWA 3SX4A 2PKEA 4E13A 2A3RA 2R97A 4MWCA 1XTTA 1JHDA 5EFOA 4EEKA 1B6SA 1V9SA 1W5SA 1OTHA 3Q7IA 3TE6A 2R8PA 4M4SA 4BBPA 3PWTA 5HOQA 2X9GA 1OHHA 2BKEA 1I30A 4JJ6A 1HDGO 1G38A 2PGIA 3L0BA 2Q6VA 1SOAA 2G09A 1JIVA 1EAYA 4JFRA 5JPIA 2C78A 2H54A 2X13A 4OK6A 3GLIB 2EHDA 3PI6A 1BWPA 1QQ7A 5JNVA 1XYVA 3UICA 1XJ5A 3H65A 4C7BA 4JP8A 4RZ2A 4DDTA 3FFWA 1L5NA 1M74A 4BQIA 4F3KA 2VDKB 4E3WA 5BUQA 1Q44A 4Y2PA 1DTSA 3EFEA 2D2XA 3C97A 1X7ZA 5SYNA 4KYIB 2VHCA 2ZBFA 3OQVA 4TKVB 1YI0A 2FPGA 2H9YA 1R4AA 2WUDA 1P7WA 3DOCA 3DZBA 5FWAA 4Q39A 4XDYA 3GAFA 1IBCA 1LUAA 3O8NA 4RK4A 5ERGB 1LJUA 4EJSB 4IEIA 2P6OA 2QMHA 1G3MA 4TTVA 3TLGB 4NOLA 4ZDIA 4IBOA 3WNZA 4BLQA 1FMCA 5GZ1A 1A1SA 1JAIA 3DLCA 5BWOA 1M2OB 1V3VA 3NWOA 2VH1A 5TT0A 4CMJA 4DT1A 4G26A 3RWOA 1P4SA 1QFZA 2AF4C 3MT8A 4KODA 5K0NA 3RS7A 1MAHA 5HS4A 1E3IA 4M0FA 2AZXA 5LLSA 5DI3A 4E08A 2P5TB 4L08A 3ZDDA 3V1TC 3IDSA 1QQ5A 2W6OA 3KHKA 1RQPA 1U0OC 1NUTA 4FEAA 5KYVA 5P8WA 4NBVA 1DU4A 2LD4A 1GLGA 3Q6IA 4D5GA 2QJOA 1HEYA 1IY0A 4OMUA 3VR3D 3L02A 4NABA 1GTVA 4CT5A 1A0OA 4AY5A 4CT4B 4QG3A 1Q50A 4WKPA 5AFSA 4GRDA 1WETA 4RFSA 4LZLA 2ZYRA 1FLAA 1MABA 4YMVA 1Z62A 1ML4A 2BL4A 2JHGA 3DNFA 3E1SA 3V48A 4YMHA 3H5RA 5LSAA 5JG7A 1ZXLA 3AP3A 2O7SA 4ODIA 5L45A 2PL1A 2Q3DA 2V96A 2GN1A 1MH1A 4UVIA 1W46A 5H59A 5HFJA 3MOGA 1OY1A 3PQCA 4M1MA 5AMXA 2I4TA 4LJ4A 2FRDA 3QWFA 3DBLB 3NH9A 2FPLA 4DA6A 3SQWA 2OV6A 3ZHZA 5K6AC 3K32A 1FUYB 4NAUA 1QRSA 3AB8A 3SBOA 4I8DA 1JB9A 1J1IA 1G41A 3DFMA 3DXYA 4YQYA 5BP7A 1R3DA 3HJCA 3PFBA 4DCNA 3U7EB 1Y3CE 2R60A 3OUTA 5H4GA 3QUSA 1Z4MA 5AM1A 2CXOA 5KI6A 2CCJA 5K0GA 4P7KA 4LDPA 2RC5A 4J0QA 1LZKA 1SH7A 1MC5A 4PSAA 2C2MA 1WPXA 4GXTA 2PGDA 2O3SA 4NJEA 5B53A 2PLRA 4JX9A 3EZ9A 4Z9AA 3C3JA 4ATNA 1E9DA 1QIHA 4D4LA 4HNVA 5T5QA 4M38A 3ZI0A 1XWFA 1YC5A 2CF6A 4D2IA 1PEYA 4RH0A 2YNMA 2R1VB 3LOQA 4MRSA 4RIHA 3AFIA 3H19A 3MLBA 3LXUX 4YJGA 4LDZA 4CKXA 5I9LA 2H3HA 3WGZA 3LKVA 2QRVB 2VHWA 1IHXA 1NXVA 5F21A 3MMPA 2NTVA 1P80A 1W4ZA 3HUTA 1HYBA 5KYXB 1CJVC 1X1DA 4Q3KA 1P1KA 3DB1A 4G23A 3NAMA 3UHJA 3SXUB 5J1SB 1POWA 3NT5A 4DUYB 3OQJA 4CV2A 3QUCA 2GEJA 4CFZA 1GIAA 1HFKA 3GYBA 5CVCA 3DFUA 4UZSA 3NTLA 2OQRA 1W581 2GN4A 1NQUA 1A9XB 4BE9A 5CBPB 3KZKA 4MXDA 1AO3A 1XVLA 2V5UA 5GJVC 5JVDF 1SCIA 3AEUA 1PBNA 1ZA2A 2CYBA 3HVKA 4YUWA 4WCDA 3SZGA 5ALUA 1AIPA 1RWBA 2WM9B 2BONA 2XQFA 3N6RA 5KBYA 3VPAA 1EUZA 3O2JA 2NAFA 3G49A 3KD2A 4JH0A 3G0BA 4B4OA 1FQWA 3BQ9A 5JRJA 3TI7A 1SU8A 2NTNA 3PNMA 4WESB 4IPTA 1KMQA 3AGQA 1R8JA 5CYOA 1PKXA 3QM1A 2EFHB 5HE8A 3K2IA 3E05A 1G8FA 1SVWA 3CTMA 5LC1A 1UMCB 4YXFA 4M8NE 2JLQA 4M83A 1FUEA 1WHTA 1XNJA 1O9HA 3RIYA 1YRBA 2GKSA 5MFZA 1J56A 1TJNA 2ONKA 4A5SA 4Z1MD 3HR4A 2KYRA 1ZGZA 2JHCA 4X94A 3KALA 2F3QA 4F9FA 4K05A 2OFPA 1T0JB 4EPRA 2Q8QA 2ERYA 1GZVA 2XOKA 2YRWA 3L92A 3LYLA 2PYIA 3DOHA 3F7NA 4KXQA 1P2BA