1DTWB

Human branched-chain alpha-keto acid dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
QTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE ALPHA SUBUNIT
publication title Crystal structure of human branched-chain alpha-ketoacid dehydrogenase and the molecular basis of multienzyme complex deficiency in maple syrup urine disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB02
3AHHA 1V5FA 1OZFA 1V16B 2Q27A 3IAFA 2IHVA 3DV0A 2JIBA 3IAEA 1QGDA 4KXXA 1QS0B 2Q28A 3LQ4A 3UK1A 2R8PA 1PO7A 2JLAA 2WVHA 1QS0A 2BFEB 3AHJA 5EJ9A 3AI7A 3MOSA 5DGTA 4ZP1A 2BFEA 1RP7A 4RJKA 2JI9A 1V1RB 3EXEB 4FEGA 3EA4A 3M7IA 2G67A 3KOMA 4GPEA 1PYDA 5K2OA 1V1RA 1OLSA 2VBIA 4JU8A 2C3MA 4QQ8A 2Q29A 2C31A 1YD7A 1OZHA 2AG0A 3EXIA 1UPAA 5ERYA 4WBXC 5K6RA 2G28A 1V1MB 1KEKA 3F6EX 2NXWA 2BFBA 2R5NA 5EXEA 2E6KA 5C4IA 1MCZA 2VK1A 1Y9DA 1TKAA 5EJ4A 1W85B 4JU9A 2Q5OA 1OVMA 5FEMA 4K9NA 3LQ2A 4KXUA 1W85A 4JUAA 2BFDB 4K9PA 3RIMA 2BEVA 2XTAA 2BP7B 2QTCA 1YBHA 1YI0A 4KXVA 1X7XA 4JD5A 2BFDA 3LPLA 1OLXB 3F6BX 1UMBA 4XEUA 1UPBA 1OLXA 1UM9B 1V16A 4QPZA 3DUFB 1YNOA 2VBGA 4JUFA 1UM9A 4FEEA 3AHFA 1JSCA 1UMCB 1OLUB 2IEAA 3ZHRA 4K9QA 2JLCA 2BEWB 1UMCA 1OLUA 4JUCA 1X7WB 3M49A 4K9OA 1ITZA 3L84A 1B0PA 1POXA 3EXEA 1X7WA 3JU3A 5DEIA 1TKCA 3M6LA 3AHGA 4C7VA 4KGDA 5EJAA 1T9DA 4D5GA 3EXFB 2JGDB 5EJ5A 1UMDB 3ZHSA 2V3WA 3ZHQA 1T9AA 2JGDA 2EZ4A 5I5EA 1Z8NA 1GPUA 4C7XA 1V1MA 1UMDA 4MPJA 2XT6A 5EJ7A 3OE1A 1L8AA 2UZ1B 2DJIA 4MPRA 2WVAA 2PDAA 5HGXA 4K9LA 5K3SA 2UZ1A 2XT9A 2YIDA 1OZGA 5EJ6A 3DVAB 4GM0A 1W88B 3FLMA 2QTAA 1V5EA 2BP7A 2W93A 2Q5QA 3DVAA 2Q5LA 1W88A 3D7KA 1X7YB 3AHCA 5ERXA 2YICA 4Q9DA 3AHIA 4JUDX 2VJYA 4KXYA 2FWNA 2PGOA 3ZHUA 2IHTA 2O1XA 1AY0A 2OZLB 2Q5JA 4GM1A 1V5GA 3EY9A 3DUFA 2JI6A 2UZAA 3EYAA 3FZNA 2JI8A 1V11B 5I4IA 2EZ9A 2VK4A 3EXG2 2OZLA 3UPTA 4D5EA 1R9JA 1V11A 5EJMA 1NI4B 1N0HA 2Y0PA 2BEWA 1TRKA 1T9CA 1NI4A 3ZHTA 2C42A 3HWWA 3OOYA 2EZTA 2X7JA 1T9BA 2J9FB 4COKA 1QPBA 2EZUA 2VK8A 3HYLA 1OLSB 1X80B 2WVGA 2C3YA 3EXHC 5IMSA 4KXWA 2AG1A 2J9FA 1PVDA 1X80A 3FSJX 1U5BB 2O1SA 1BFDA 1X7ZB 3EXIB 3ZHVA 5I5GA 1DTWB 3EXFA 2BFFB 5I51A 1U5BA 3E9YA 2BFCB 4JUBA 1X7ZA 4MQ5A 1DTWA 1POWA 2BFBB 2G25A 2BFFA 2JI7A 2IHUA 1UPCA 5HJEA 4MZXA 4MPPA 2BFCA 3EXG1 3EXHB 4GM4A 2C3PA 3M34A 1ZPDA 5HHTA 2C3UA 3HWX1 3AHEA 3LQ1A 2EZ8A 3EXHA 4QELA 4GG1A 2BEUB 1Q6ZA 5ESDA 4K9KA 3AHDA 5EJ8A 1PI3A 5K6TA 2BEVB 2R8OA 1WCIB 2C3OA 5HYVA 4K9MA 2BEUA 5DGDA 4RJIA 1X7XB 4RJJA 2PANA 2VBFA 2PGNA 1YHYA 2FN3A 1WCIA 1NGSA 1UMBB 5AHKA 5EXDA 4GP9A 1YI1A 1IK6A 1X7YA 1YHZA 1TKBA 3DV0B
chains in the Genus database with same CATH superfamily
1RIIA 4F5ZA 3AHHA 1X8JA 3Q11A 1SNYA 4AKGA 1WF6A 2P5TB 1YDHA 1I7DA 3RTEA 4NLLA 1FSPA 1B0AA 1KPHA 4K6MA 3GQBB 3LFTA 4IMIB 1ZR2A 2ZDGA 3GRCA 4JK3A 1M83A 1LQTA 5LQJA 2R6JA 1PE0A 1ZOOA 2ZW9A 4HDAA 1E8NA 2PL9A 1HORA 3PWKA 4P93A 4QYIB 4RZQA 2OBLA 1KAQA 3ODGA 2R5FA 5IT0A 1GQ2A 1CJVC 1D4OA 2FN8A 1P44A 2ZIVB 3NKVA 3D5QA 4FYIA 4BN0A 1BCRB 1WUYA 3G89A 4DIOA 1G38A 3P45A 1RKQA 5BMVB 1XVLA 4BE4A 4BX9A 1PJSA 2BHSA 3AI3A 4RHFA 1CZHA 1GZUA 2C2ZA 2C9MA 3ML1A 3GCGA 1NBMD 3MSCA 3L7KA 2P3SA 1J0AA 1H6CA 3K1AA 2B5WA 2GB4A 3DEZA 4EUNA 3O82A 3HZRA 3K0CC 4NFSA 4G1UC 3EHDA 2XXAB 4FC6A 4OBXA 2ZTSA 3MS2A 4WTOA 5DSZA 2VHZA 1EM6A 3ODPA 2G17A 4KAFA 1JSRA 4HYQA 4DB4A 3S7TA 2CZGA 2PGAA 2CV1A 1LSUA 4JYPA 1VBMA 4JP8A 1UZMA 3EFBA 2YJNA 1IJKA 4V0QA 1F12A 4BIIA 4JI2B 2QTFA 3PIRA 5JSFA 3WIDA 2IV3A 3MLEA 4WZBA 1KF0A 3G0GA 121PA 3OQOA 4A3SA 4HR7A 1V1RB 1YCFA 3ND6A 4XD7A 1JA1A 3WZ2A 1S7GA 4GH5A 3EUFA 3WLNA 3AF5A 2XB4A 1WB9A 2FMHA 4GS5A 4ZAFA 2O8FA 3HDVA 1LPNA 4WLVA 4B6QA 5IAEA 1FYDA 1JDBC 1TT5A 1SQ0A 2PRZA 3BB3A 3FPSA 3HJTA 4OGFA 4DKXA 1UJ4A 1QYDA 5AJYA 3Q7TA 4YUXA 4CWAA 4U8HA 2NO9A 3G3EA 2V1UA 2XXBA 3KOOA 3PX3A 2QAJA 1U9IC 2F8LA 2PRSA 1O08A 4HNVA 3NM6B 5IYZF 1HF3A 1V3UA 3HXPA 4LGMA 2VT2A 4OAOA 1J20A 1YS4A 2C59A 2ZI7A 4CODB 3M82A 3H5OA 4HNGA 4Y2RA 4R1OA 1PHRA 1LK7A 4C3ZA 1XX6A 3ZUPA 3Q5GA 1NNEA 1ODCA 3GRRA 3GGCA 3W5AA 1PFWA 4MW5A 1PTJA 2RMKA 4MO2A 4BNYA 1E6CA 1WM1A 2XTJA 4LVUA 3T7KA 1SQGA 4RD1A 5PGMA 3DQQA 1V37A 1NJGA 3E5NA 4KC0A 1YBVA 3HCFA 1DXQA 1MHPA 2AN9A 3WYBA 3NBZC 4GIBA 4Z1MD 2QMUA 1ADFA 2V6MA 3L7BA 4GE3A 2B1IA 1C7QA 1X1DA 5K0JA 5DULA 1FOEB 1LU9A 1LZKA 2QTGA 5JWHA 1X6VA 3VHLB 2GM9A 1W0JA 3L8DA 4ENUA 2JFHA 1UCFA 3F5QA 2AZDA 3HA7A 5HCIA 4QX6A 2X3FA 4IIGA 3L43A 4OIFA 1WY5A 1XAJA 4HH1A 1PK7A 3T0FA 1P77A 1EAMA 2EX1A 3NORA 1PTKA 1AKWA 5M7EA 1EXVA 3NGXA 4HWSA 1FRFS 5F73A 4LPKA 1WXWA 1XEFA 3TN7A 1QFXA 4N0EA 2QLLA 2YWFA 5LCXA 2O57A 5FUYA 3NRCA 1QYVA 5FCDA 1N2SA 1ZH2A 2JARA 1SFRA 2XYPA 2DH6A 2YYYA 3PC7A 4G1MB 3NUZA 2IBTA 5FNZA 4QLBA 4OA5A 4NV3A 1HDRA 4EJ2A 2NLOA 1GFZA 2DG2A 4M49A 2WOOA 1I3NA 4I9HA 3ZCPA 1B8PA 1MQ8B 1UWKA 2LKCA 3CW8X 1OFIA 4HJXA 3KB8A 3EVNA 4NCKA 5EERA 2NO1A 5C1PA 1GNQA 1Q74A 5J1TB 4K9PA 4OGKA 1JAXA 1I30A 1CRLA 1NZFA 3B1ZA 4RMJA 3D7RA 1NN3A 1L7OA 1NOJA 2WJ4A 1YI0A 2WOJA 4KXVA 3T1YB 1UZAA 3GIDA 3GWZA 5K6TA 4HUQB 4AYWA 2X5NA 3FCSB 4YP0A 1GNLA 1FU7A 1DG3A 2HWUA 2ZTLA 4L2IB 4WKOA 4ZOLB 3EAFA 4WI1A 2WF8A 2C9BA 3WBKA 1XRNA 2OO5A 4MRRA 4X45A 1NPTO 3LBAA 5CTJA 4JJIA 1HRKA 3DKKA 4KIUA 3FKJA 4ROSA 2HU8A 3L6BA 5A3QA 4NOLA 1QMGA 3LU1A 3NXSA 4GUDA 4HGQA 2ZLBA 2UYYA 5EMNA 1BOFA 1JN0A 3RC7A 5FV7A 1EJBA 4MI9A 1NHGA 3G2QA 2WWGA 3OQIA 1A7KA 3Q2OA 3VPAA 5JYCA 1UM9B 3VNVA 1LQ2A 4U7HA 4LRYA 5HE8A 1YNOA 3L02A 5DM2A 1L1FA 4ZHQF 1JFRA 1JFFB 3W3AD 3W7VA 3IP7A 2DM6A 3D2CA 4DREA 1JIUA 4Y6GB 3WYCA 1MMFB 5F5XA 1ONSA 2NUTB 5TPZD 3BXFA 4IZHA 1A2KC 3M6XA 3O2SB 5LBUA 2NAFA 1Q22A 1E7RA 3BCSA 1RBZA 1PU2A 2CNBA 4MWTA 1L4UA 2FPXA 5BORA 4J9UE 3FHTA 2EJTA 3NDJA 3LX4A 2AD5A 4IDQA 2WQ7A 4L28A 2HQBA 2JFPA 3BIFA 2NSJA 2IVFA 3NKLA 4D3YA 3N6VA 2HO4A 1K7XB 2VJKA 3AR3A 1D1PA 2XIQA 2JDIA 3EIQA 3HBLA 3K71B 2JLCA 3IQDB 2HH9A 3B8HA 1ZSVA 4ZQFA 3IDZA 1IJBA 1T36A 3PXCX 1OXSC 3WLRA 1T6YA 3ZJTA 1YH3A 2PL1A 4KRFA 3DT6A 3DO5A 5C8YA 4Z0NA 3DAOA 4HDSA 2FZWA 2VR1A 3HG7A 1OGIA 4KRGA 2GN4A 3V2HA 4D46A 5AVQA 3E05A 1KE1A 3BGDA 4I1IA 5MFPA 3DWFA 1A1VA 1OU4A 1B0PA 4EP1A 1GVNB 1QYWA 4JIGA 2I7VA 4QARA 4RSGA 4I9NA 4R5MA 4U7FA 4M22A 3OZCA 4HNUA 2AF4C 1UQTA 3U4DA 3S6JA 4HMPA 1KGSA 1C80A 1CY4A 1G3UA 4Y1RB 5AI9A 1D7AA 1GTVA 3DT8A 1EP2B 3KXDA 3FJ1A 4UASA 5JJIA 1O95D 3OQ6A 1E69A 4MI1A 1MBZA 2VF7A 2Z58A 4JASB 1E2EA 4UAVA 4XR9A 5IBRA 3CC8A 3I8OA 3NHWA 5D1NA 5BT9A 4NJMA 2I22A 3VC1A 1NJFA 5K01A 1C9JA 3T34A 1DJQA 1I7QB 3JAMA 4H31A 1P39A 3KQUA 3MERA 4LY9A 3RVSA 3WMXA 3OKCA 1T8WA 5DIZA 4N6OA 2C9DA 1J0EA 3U4IA 4K46A 1FDIA 3DLHA 5EJ5A 1W581 3LIPA 1DT3A 1GZ5A 4YRRA 1LPSA 1Z4PX 2DC1A 4HLQB 3FH0A 3QE4A 4LJLA 3VNBA 3HKBB 2JH3A 3QFHA 2V9PA 3K9WA 3WWYA 5FBLB 1KO5A 3SJUA 4HX9A 4OCZA 4CM5A 3WLOA 2HADA 2PA3A 1RQPA 1LCIA 2DUUA 2P9ZA 2DWUA 4LHWA 4MK4A 1B00A 1E1DA 5ILQA 2IXGA 2ONKA 1A8QA 2SICE 1UMDA 4LCEA 4XRGA 4P7GA 1NW3A 1GYPA 2BM8A 4M0PA 3SC6A 2OP1A 4HH3C 1V8ZA 3QIAA 1YQEA 3AGQA 4BNWA 4WK4B 3W9SA 5IC5A 3Q41A 3L4JA 1GZ7A 2AX4A 3IA2A 4AJJA 4MNTA 1CY0A 1SXJD 2MMCA 3OE1A 5TQ0A 1TMKA 4DG9A 4RTPA 4S04A 1ZAKA 2IYWA 1R16A 1JPVA 4Q3KA 4QBKA 3GXBA 5ICMA 5H0IA 3L7DA 1M2NA 1X86B 4LYFA 3Q3EA 2ZCJA 1FVHA 2HHHB 2F3PA 1T9GR 2PDAA 3ILSA 3I52A 5I9BA 1DXYA 1QTNA 3UGJA 2H3HA 4A0GA 2RHCA 1U1CA 2HKIA 3T9FA 5K99A 4NABA 4N5NA 1Q5PA 2R6GA 3A1SA 2Z8XA 4TRNA 4YRDA 2V8BA 1TZ2A 4ZU3A 5IUKC 4Q39A 4YP5A 3RLIA 3UAVA 3FWYA 1YOVA 3LUHA 1V9CA 3WGVA 5KYXB 1JUDA 4O29A 1EQ2A 3ADKA 2QTAA 4D3DA 4MQEB 4ZD6A 3MGGA 2FPOA 4KQ9A 5TNXA 3U81A 3UMFA 5TV2A 1QBGA 2GAOA 1TU3A 1VBKA 4D98A 2IYAA 3GL9A 1ANKA 2V8OA 5A4KA 1N92A 3UFXA 1LLDA 3LBHA 4P38A 4B3HA 3D7KA 1CQIA 2HF7A 1JMKC 2AFIA 2VTEA 1JW9B 2CFSA 2GBGA 3KYDA 4YUZA 5FA6A 2YY6A 5DTMA 2D5CA 3ULKA 3AHIA 4JUDX 4U6SA 3GUZA 3QOYA 1ZH0A 2ZS8A 3GR6A 5F9HA 4RVGA 1J0BA 4BKPA 4UEJA 5DOZA 1Y8QB 3PD1A 2BTOA 2B8WA 1LRJA 3GOQA 4B6JA 4BL5A 2OUKA 2R7AA 4Q16A 3P2MA 5BOSA 5IHXA 2QTMA 4Q3BA 2Q1WA 3BXOA 5LPNA 3HUDA 1A5TA 5J2UF 4H6XA 3U56A 1V5GA 2ZB8A 1FP2A 3EY9A 1A4UA 3QGMA 1O54A 3FVRA 5DLQC 3PDUA 1V48A 1PW5A 4UE2A 1ZVMA 5KINB 4B9AA 2XUPA 4NG5A 3KPUA 1Q16A 3O8OA 3D1VA 4MVJG 2MYTA 5TX7A 4D9EA 5I7HA 3ITNA 1ZCBA 3O0TA 5MF6A 5SZKB 1ISHA 1SBTA 1Z83A 4I08A 1FXWF 3RS7A 4J0FA 1R9JA 1X9IA 1CIPA 3DE1X 2UVQA 3OBBA 4AKSA 1MXHA 3QFCA 3UMRA 3V00A 3JAWB 4GQAA 4Q15A 4R0NA 5DLDA 5ICCA 4PTYA 4XUEA 4EZBA 3UV7A 3A2NA 3NC0C 4OBBA 1R6DA 4FYWA 1T3ZA 1K3TA 4FI3F 1EVYA 4BWGA 2YQZA 2ZB3A 4LXXA 1T3HA 4MMYB 4IR7A 4XARA 3ZHTA 621PA 3I9FA 2NV6A 1XC7A 5TT1A 3HJUA 5F9FA 1QANA 3SC3A 4MWOA 3RT7A 4NS4A 3H6KA 2VYNA 1NZJA 3KKPA 3T5GA 1KDTA 2MMGA 6Q21A 2YMQA 1MAUA 4CN8A 5BWOA 1AQUA 1GKYA 2FSGA 2G83A 5CB4F 1H93A 5BYBA 2W48A 2HM7A 3GNQA 3HFJA 3UXEA 2AQ8A 4EA8A 3BZUA 3VYSB 1YC2A 3OZAA 1IN5A 3P9SA 4REQA 3ZDQA 3PNMA 4WBNB 2XNDD 3L6OO 1Y1LA 4JZYA 4TGLA 4Q9HA 3QV1A 4F56A 2D5AA 3GDOA 2PSJA 3GA5A 3K6JA 4KLAA 1D9ZA 4FX5A 2NPOA 2YL2A 4HK4A 4JLMA 4O2AA 4WQMA 1EVEA 3R5HA 1PLKA 2ZQ5A 2R1TA 2YV2A 3BKXA 4EO9A 1RQ2A 2X9NA 1FYFA 1UFKA 4B3CA 5I5GA 3HNPA 3IP5A 5JJ5A 3JWPA 4G86A 4GGPA 4C89A 4DYHA 2WJ3A 4HDKB 2O0KA 1IBMB 4NAVA 3KTAB 2HF9A 4ETMA 3GLGB 2QRZA 3AP1A 4DQKA 5C7OO 1QOZA 1M0WA 2OK8A 3E22A 5A4DA 3CBGA 1Z17A 5EYPB 1PT7A 1C3JA 4MQ5A 2WU4A 1HFKA 2GVZC 2DLNA 5AM4A 1POWA 1HYGA 1RABA 1ZSNA 3QMMA 5ISMA 1YS2X 3AEKA 3BQ9A 2C2OA 4KLNA 3DLIA 2XVAA 5EI5A 2VCYA 4W5OA 1H69A 4TLLB 1XPUA 4I5FA 4O5OA 1EDOA 3NVKI 1HYQA 4FTWA 5BR7A 2W2OA 1EVIA 2ECPA 2NN3C 5CJJA 1U1DA 4GRDA 2RDMA 4U7JA 4LI0A 4M98A 2VHQA 3RREA 3WNQA 1HNXB 3BGVA 4FFWA 5LZ9A 4O3MA 2QROA 2FLWA 1CEEA 1SG9A 2UV8A 1PGQA 4ZHSA 2PE5A 3ETLA 4AUMA 4N1AA 5BQPA 3QKRB 2WRZA 1VHDA 4IJWA 4PLFA 3UAOA 4L4SA 1EWKA 2OQIA 3JPYA 1YGYA 3ABQB 3GFRA 5LP6C 4PVDA 1UWCA 1U0SY 2WD9A 2PIDA 3PFCA 4O2BF 5JANA 3K4PA 4RHCA 4E2FA 1EHYA 4P2BA 3FYDA 3H99A 1G9XA 4BCBA 1Z5NA 2R8OA 2VDVE 3G2HA 3HJFA 1I1NA 1ZXBA 2BHRA 4QHSA 5KWIA 2VJQA 2HRCA 2W6QA 1Y6RA 5HBRA 4FFOA 5BOVA 4BFYA 2PANA 2C5LA 2ZI6A 1UZUA 1AQJA 2GCGA 1L5QA 2G09A 3GGOA 4MVJD 4O4HF 4C0HA 4G0VA 4DV6B 4NCAA 1RZRD 1SC9A 2I33A 4I8DA 5FBKA 1CUGA 5LVAA 1NXVA 4G09A 3AEZA 5DYWA 2Q2WA 5EXDA 3VUFA 1IK6A 1YHZA 4GEKA 4TWJA 2YWDA 3TRJA 3ANLA 1VLHA 3IUBA 4NCJA 2IS4A 2HSJA 2GD0A 4NZOA 3ISVA 4JITA 1HT2E 1FX0B 2NQ2C 2VHJA 4OXKA 1S3SA 5KZMB 3C3EA 1PEYA 4DLLA 3FM9A 3E82A 4QQKA 1DIAA 4HSEA 5FLKA 3WLEA 2V96A 4UHCA 2WUGA 1HRDA 4PINA 3AVWA 2YIMA 2J31A 2IHVA 3IAFA 2Z5GA 5H3CA 4CQLA 3G85A 3LIIA 4DM7A 2NVOA 1G5PA 1QRDA 4WCFC 3NJ8A 2JRLA 2AC4A 2VA8A 1LH0A 1QGDA 3HXMA 2RJNA 2O7RA 3LG2A 4N5LA 4OB6A 4W8GA 5FQNA 4PLPA 3BL5A 5KVVA 1MN6A 1QGAA 2VS1A 4FFDA 3OO1A 5JJKA 3WGJA 2RD2A 2VJBA 3KVRA 4Z4CA 1IZZA 2JZOA 1GYQA 5IJAA 1UBLS 1BNCA 2GCNA 3SS7X 2CV0A 1MP0A 3B3JA 3E3AA 3EIEA 4EGSA 4F84A 1QGUB 2XYVA 1PO7A 2KM1A 3FUWA 3OZ7A 3ZCVA 1B6TA 2H59A 5EJ9A 4B3XA 2V7BA 3FX2A 1VJDA 1VGQA 1L3IA 2ZCVA 3V5NA 1VG0B 2QX6A 4QT4A 2VWPA 3B6KA 4TS1A 4DDUA 2CKMA 4Z6KA 3DBHB 3N07A 4WUVA 4KPYA 1AGRA 1PNVA 2Q6OA 4LQDA 5GPBA 4OI1A 1VJCA 4XQ0A 5HK8A 4DAEA 4EKGA 4S12A 1U11A 3EVFA 9GPBA 3D7MA 1CQZA 2XNSA 4RF2A 1O89A 2XECA 3LA6A 4NWIA 4TS4A 5FR1A 2RAVA 4RXMA 1EK5A 1MJHA 5D5QA 2D74A 3A05A 5A4MS 3SICE 2EG5A 1WD5A 1BD4A 2YZ2A 4QUEA 1G6KA 3U09A 4KDCA 1QBKC 3TG8A 3FAKA 3C7TA 1VPTA 3CEJA 5K2OA 4PW0A 5DE3A 4XASA 4JV5B 2PWAA 3PL1A 2Q8PA 3BB4A 3SEZA 4RL6A 3WV4A 3H1PA 5EE1A 4H7FA 1YFZA 4V38A 3E61A 4JU8A 1F7UA 2SHKA 2YDYA 4OAQA 3E3LA 4B45A 1H9CA 4QG3A 1DAOA 3FKQA 3FPBA 4OQ4A 2E6UX 3QFTA 4MS3A 3UGKA 2MCFA 2QSYA 5H59A 4ZA2A 2RGXA 3ZCQA 1JVNA 1NC1A 1ISGA 1NY6A 5K0LA 3ROKA 5CH5A 3TINA 2XZDA 5JEEA 5L8VA 3C15C 1IULA 2VUTA 3GIWA 5IN4A 3C1UA 4KREA 1SHZA 1E2BA 3B7WA 3DYVA 3O7MA 2ZUEA 4CT0A 3A7EA 3KJZA 1IN8A 3RNOA 1Y8RA 1SBQA 4NATA 3DEAA 1K4MA 2BELA 1R4MB 3L7AA 2WT8A 2JLXA 2ZYHA 2GBIA 3HA2A 3FYSA 3D3WA 1H8ED 4YJFB 2XDQB 5EP3A 4TYPA 3WGUA 2X3UA 3HJNA 4LIPD 3GFOA 4C14A 3F8SA 5B3AA 5IVHA 2IU6A 4D2IA 5IM4F 2EFHB 1QHXA 3LM8A 2I55A 1S2MA 5GINE 1M2FA 1Y9DA 4U2BA 4F1JA 1YA6A 4C2UA 2ZBPA 3ZWAA 4RZIA 4Y18A 1O5TA 1S2GA 3T95A 4HNRA 4MW7A 4II3A 5JRJA 2FCAA 5TGTA 1I7PA 5J3JA 2I6XA 3L4BC 1YJBA 2VWHA 3A1UA 2E5LB 4ZVOA 4LMAA 3TLJA 1GRNA 2XV1A 3M8KA 1MQAA 5E3IA 3I2HA 5C53B 3GVPA 4LGYA 3FNQA 3W6UA 3EWSA 3T3DA 3QBTA 5I9LA 1P1CA 1JWLA 5LXTA 2Y68A 4MWDA 4L0QA 1AKNA 2HA3A 4GL4A 2GPTA 1OASA 3LPLA 3WK9A 3JXEA 4RV5A 3VSAA 3AU9A 4NE2A 1ISPA 1H2HA 1N8KA 3F6BX 3KKKA 1VCIA 2B99A 4M54A 3EDYA 1LKZA 4N82A 4OO3A 3HB1A 4FWIB 5B7PA 4IFEA 2GBFA 3RUDA 5J1SB 2NPIA 1N2GA 3HYRA 1P6UA 4YRPA 3OKAA 4JT8A 1E8DA 1KHHA 2WG1A 5FI5A 6NULA 4R69A 5H3HA 2C2BA 221PA 1OLXA 1JG7A 3ZI4A 4EECA 2BMEA 3PC2A 2ZE6A 5D84A 7GPBA 5FWNA 4EVIA 1OZAA 3EMBA 2LV8A 3IOBA 5CGZA 2GRJA 3AF4A 3GQBA 4N7MA 1ZG3A 1LI4A 1S0UA 4HQ6A 5EVJA 3QUTA 4MIKA 5MGNA 1Z6QA 4QYIA 2W6CX 2OXTA 2DLCX 4L9SA 3GJ8A 3WWZA 5L9AA 5M2QA 2EQBA 3IOMA 2RGAA 3ZV4A 2P35A 1ZGJA 5BQXA 1U1IA 3DGFC 1T10A 5KQLA 4B3RB 1ISJA 3QPDA 1J49A 3EEYA 4Q1AA 4M7OA 2YOFA 1YB6A 4OAPA 3A3PA 2JLZA 1KI9A 1XL1A 3ZHRA 1Z25A 3IE1A 1QRTA 3FOBA 4ENVA 1UM8A 4K9QA 1T3LA 2A5DA 4EI7A 1O4VA 3TKLA 4IHAA 4R8RA 2P9JA 1PSZA 2XXAA 4LV5B 1J1UA 3ORHA 2GPSA 3FMGA 5H83A 1EUDA 4ZOBA 4AJHA 3B60A 4PCLA 1GNVA 2HCFA 4NAHA 4RQUA 2YNMA 3LDHA 3M6UA 1TDJA 4BNXA 2FRDC 4ZRNA 1CR0A 2V7PA 4MA0A 1VJ5A 3P9IA 4N6NA 2CVQA 2WA2A 3EGVA 1MW8X 2YUIA 5GIPE 2QKYA 1POXA 2WJIA 3H5WA 4LSZA 1XTVA 3VVBA 4YT4A 5AOCA 3W5BA 1KEWA 3NVDA 1EK2A 1RRKA 4Q7MB 2P27A 2F1IA 2PH7A 2EBFX 5JCJA 1KVRA 1XTBA 1QUEA 3H87A 5HKBA 5E38A 2RCNA 2P78A 2OG1A 3UC5A 1G3IA 4GZ6A 3KSBC 5LB2A 3ZW7A 1EFPB 3RS3A 3V8NA 4N0MA 2JKVA 3GDWA 5JSHA 1GEGA 4G4GA 1IC6A 3M6MD 1QF6A 3GRFA 2QG4A 3C6MA 1DG1G 2EJVA 3FR7A 2GF9A 3CKMA 1D1TA 1RTTA 2YW2A 3NTXA 2JKYA 1DKMA 1UH5A 2ZRAA 1V3TA 1R3UA 3ENNA 4PZLA 5IEJA 2PKWA 4BJ3A 2R8YA 3DLPX 4BO6A 3EIHA 4P08A 3IEXA 1JXAA 2FUNB 1PZXA 5DWQA 3CISA 5JQWA 1T5BA 4MB0A 1GPKA 4QEDA 1USGA 3COZA 5ILOA 4F8YA 2FUG1 2XWJI 4IIHA 4FYHA 1A95A 2G63A 2G88A 1RVV1 2NSDA 2BAGA 3B1YA 4HLDA 2CD7A 4MCJA 1CDDA 4UZEA 3H5AA 1JL3A 1T9AA 1EGVB 2GJKA 3F7TA 3TCKA 1OXBB 2H5EA 4RHYA 4P7BA 5C35A 1CIVA 1CBUA 5H16A 2YRFA 2IOHA 2J0VA 3SHOA 1UFRA 3REQB 4EITA 3QLUC 1AK9A 4D9BA 1TA9A 2QYOA 4DT1B 4FE7A 3FTCA 2J46A 3UGQA 4X63A 5H70A 4ZREA 3BHMA 4W6ZA 1GPMA 1A0OA 1J2RA 2N75A 2X6TA 1JDNA 2J9RA 1M2OB 3E84A 3K8ZA 4O1HA 2ZIFA 1AKMA 1ICIA 2OTCA 3PWSA 5FD8A 4PQGA 1H94A 2O8BB 4BVJA 1N5IA 3E7DA 4FR2A 1W5AA 3FDFA 3RU2A 4JJKA 1F2UB 3VC2A 5JRZA 1U3FA 4CTOA 5KTPA 3K9FC 4CM9D 1KJYA 4DUGA 3SXPA 2EFYA 1CNMA 1TO6A 1A82A 1W75A 3EDOA 3RFCA 1Z6AA 2ECKA 5HIMA 2HTFA 3WWEA 1FW6A 2DUMA 3L7OA 2IHYA 1YZ3A 4FGZA 5CU7A 3WYDA 2HF8A 3ZEIA 4H1VA 4ZQIA 1N6IA 4ARZB 2H1IA 2FFRA 3X1YA 3GARA 2IH5A 5EUQB 2P69A 3P26A 1SM4A 3ESBA 1ICEA 4XFDA 1SQFA 4IZIA 3RHSA 1ISSA 1LWOA 3WHKA 5HTKA 1KIAA 1LI7A 1N9ZA 3BHJA 1SXHA 1W46A 4KQMA 1E8MA 1Z0DA 2OXEA 2PNFA 3NH6A 2Z3ZA 4MQUA 2DKFA 5LA6A 3FE2A 3VOSA 4NQRA 5KNBH 3CUYA 4GWLA 2Q5QA 4BMCA 1SXJB 4RADA 2O59A 3MYRA 1V8FA 2FJUA 3HEMA 4YT5A 5JHGB 1TM3E 4I6GA 4IRXA 1ORDA 4JENA 2BH2A 2O8CB 5IDYA 3BAZA 4L2IA 4MKGA 3ZXXA 2ZYIA 1CJSA 2PKXA 3EMVA 3QJYA 4G8BA 4LOKA 4S35A 1SVUA 4PLZA 4D02A 2DHCA 3EBOA 1LV7A 2FZKA 1JHYA 1D2CA 1EE9A 1UQUA 3IS3A 2PWBA 2CT8A 1Z4NA 3U7HB 4BQFA 4MVCA 2PGOA 2WZCA 3S27A 4Y6SA 1PGOA 2DRIA 2B8TA 2HBZA 2PS0A 4OATA 3S7ZA 4G67A 4A16A 1FYXA 2OGWA 2ZK7A 1BYUA 1V4NA 3O4JA 3QVOA 2ZJAA 1E2HA 4EHLA 4IDNA 2BFWA 2J3HA 4MJXA 3Q85A 3WB1A 3NJRA 1LDNA 4YC7A 3W5IA 2GN0A 4B5LA 3B2EA 2JK0A 3AVTA 5EKSA 1RYFA 1E4OA 5FNVB 2BUCA 1XR3A 5AJUA 2Y1XA 1G1MA 1PYOA 2NUTA 6AT1A 1ZUHA 3N39C 1DPGA 3OMLA 4BZZA 1IK4A 1W36D 2PUAA 3IC5A 2RGEA 1FSSA 4RY0A 4WY8A 4DMGA 5CB6A 4ZAYA 1E1YA 3HR7A 4HWTA 5LKAA 3PXGA 2FFJA 5JJBA 2P5SA 1KIMA 1L5OA 1BH2A 2ZUUA 3C43A 4J16A 3ONFA 2F4NA 3C3AA 1BVHA 5KTOA 1W96A 3BRQA 3RAEC 2PYIA 1JMVA 3G0OA 1PK8A 2OD7A 4JP5A 1Y4UA 2XRFA 3V8MA 4UNNA 1KZ7B 2F62A 4DJJA 2JAWA 4ECAA 3AESB 1L4BA 3FMOB 1O5IA 4FI3C 2A5GA 4KQKA 3RKRA 3RSFA 3OZBA 1PT5A 3MQFA 5EFZA 1TUBA 3DGEC 1Y1SA 1Z22A 2R84A 5F9MA 5GM2A 2EP8A 3RJ5A 1R4NB 1SIUA 3VH2A 4TSRA 3HPQA 3EZGA 3V97A 4BKOA 3PNKA 1K3FA 3UAXA 3GPCA 2JGMA 3WJAA 4C7BA 2YZ7A 3OCYA 1AUOA 3DF7A 1SXGA 4MQLA 3ZV3A 2W9XA 1M1YB 5E7QA 3FHCB 4BEBA 1P62B 1DIOB 1GPJA 1QIIA 1SVKA 2C3YA 3C5WP 3EXHC 4KK3A 4W1PA 2LTAA 3LWZA 4HNQA 1NQTA 1WCV1 5BW6B 4WOKA 5IDQA 4Q3OA 5BV0A 2V5AA 2ESRA 3KHSA 3WO1A 1DFGA 4EPXA 3EC7A 5A3SA 2I5PO 1PVDA 4PN7A 4XR4A 2YHSA 4MWGA 4B3MB 3IH5A 4HZIA 1HQCA 1Q2UA 1U3UA 3KCQA 1XIVA 3VV3A 4DMMA 2OMKA 2BFPA 5K6AC 3ZWKA 3MBIA 4LF8B 2BGIA 3N2EA 4PV7A 1NR5A 1WSWA 3KYJB 4AMGA 4DA8A 2JASA 3RU7A 4DG8A 3BBLA 3P0HA 1CR2A 1V8PA 5E4TA 4HI0E 1J97A 1GPYA 3WLMA 4CRWB 1UKAA 4ZDKA 1TI7A 2C4KA 2EFCB 5AI8A 2BGGA 2FQXA 3NCHA 4QO7A 4ZDWA 2Y1DA 2A8YA 4RPIA 3F7OA 3OP4A 4HRAA 1GHTA 1DAMA 2I4TA 4E08A 4CG2A 3JQPA 4FBMA 1GKKA 3UWSA 5K05A 3TRDA 2XODA 1OR8A 4R8MA 1FX1A 1G291 1T24A 3MGCA 3PQ8A 4RF3A 5CVJA 3W4IA 4R51A 1JQDA 1KI8A 2A2ZA 2BFFA 4OGGA 4ZV9A 2AUMA 2FK7A 1UDCA 2IPNA 3DZHA 1YIDA 3D8RA 3O4FA 4HQRA 4OQLA 2IITA 3T7CA 3B2NA 5HQTA 1GTG1 5IH3A 3F5SA 3LHSA 5JU6A 4IJVA 3WJ2A 2J08A 2R6ZA 1WETA 4CTNA 3A28A 1Y6QA 2KW5A 3HN6A 4E5NA 1F2VA 1Q77A 1SBYA 4RCYA 1AS3A 5F21A 3G2OA 3TIGA 5L3QA 3G59A 1NLFA 1SY7A 3VZSA 1DZ3A 1J7JA 1PLJA 2FSSA 4WGFA 4WLFA 1RMTA 5KYUB 2O8DB 3UJPA 3VV2A 2ZRIA 5I4BA 2R1VA 1YKSA 3CXUA 3ZTWA 3LQYA 1KP2A 4W5HA 2V7QA 4XAQA 4QDXA 4X20B 3QFSA 4P31A 4QA9A 2DFDA 3PUHA 5ALQA 4O4JB 1CZKA 5JFTA 3GFBA 5ESDA 1WVGA 2BDTA 3GGJA 4QEKA 1II9A 2P9EA 3HV0A 1AKQA 5K0SA 5KQMA 1DSSG 1DVRA 2NPFA 4DSOA 3E9NA 3ICOA 1CNEA 3TAHA 4G9GA 3L5OA 2IZ6A 4H16A 5H82A 1Y3FE 3RRFA 3VNUA 3AVYA 3WQHA 3I5UA 2FN9A 4TTTS 1MAAA 3GRPA 5E9QA 5KYXA 3RF6A 3SJAA 1T4CA 3TUZC 3RV3A 4ZFNA 2QL5A 4KJZA 4WNCA 1YHYA 3TAXA 1JRLA 5EZYA 1FYVA 2KE5A 3TLEA 2KPOA 2FVYA 4OXQA 3T7EA 3FVWA 2JNWA 5CT9A 1WO8A 3TD6A 4YK7A 1A69A 3ROZA 2YWJA 3NLLA 5F3RA 3RJMA 1U8TA 3VPCA 2ZBRA 2PT5A 2WNSA 3ELBA 2A0UA 3I01M 4HVAA 1V5FA 5BYJA 1IM8A 1F38A 1N6PA 3OX4A 4L6IA 4WOCA 3SYMA 4BNMA 5MGBA 4KHPB 3FGPA 1R6BX 3IIIA 5FUXA 1E4YA 1VFPA 3ABOB 3O3CA 4Y2SA 5DCLA 3ZWWA 1AKTA 3I58A 4YRSA 3Q12A 3ZHCA 3K4QA 3G6KA 1YR2A 2BUAA 5KTNA 3U7RA 3MT0A 3CEPB 1J8VA 4KXXA 3GVXA 3EDRA 4HX2A 4BV2A 5C46F 2P3OA 4MW2A 1GADO 5A3VA 1VI2A 2VHWA 2Q4EA 3PXDA 3WQBA 5A7FA 4JC5A 3HM9A 2O2HA 3L6EA 3UYLA 3GLFE 2WINI 4IP0A 1H6BA 1YS7A 1T29A 5CM2Z 4Z99A 4TUYA 1U2SA 2OYRA 5ICGA 2J3JA 2AD1A 1FXSA 2E1PA 1QS0A 2P9GA 3BMOB 3G0BA 5CCEA 2JVIA 2ZBVA 1YS6A 4OK5A 3UZUA 4JXZA 1G7SA 1TLTA 4WNAA 5KHAA 5AFSA 2YXDA 4Y2PA 2AMFA 3SR3A 1WKVA 3CCFA 1OH5A 5EVCA 3V1KA 1V45E 4AM8A 4II2A 4EYGA 3EPKA 2XB2A 4U63A 5FI1B 4JP2A 4RD0A 4MRMB 1FMFA 5C52B 3G82C 1CVRA 2W5UA 2C0PA 4RD6A 2N9UA 2VNAA 2JFUA 3A3YA 4WDRA 5GJCA 4F4IA 3UJNA 3SZLA 2OBNA 3R3SA 4FMCF 4UBOA 5EIOA 3EA4A 5JCOC 1RMYA 5I9MA 4C3VA 2YXBA 4EF4A 4HP8A 4H77A 2BMVA 1A8UA 2YFHA 3EDCA 4YAWA 4NQZA 3I04M 3OMWA 5E6SA 3IKJA 3DAYA 1G8MA 1J42A 2AOTB 1H22A 1IEVA 1YFLA 3VKHA 4DR1B 4J4TA 4UVIA 3JQCA 2BT4A 3LDAA 1ZOPA 2XQIA 2C03A 2VSQA 2XR1A 2ZDQA 5JNTA 4AS1A 3ZCRA 2H1WA 4HFRA 3ZGVA 4I9GA 4CGYA 5E2AA 3T7DA 1YZGA 1DAEA 3BDAA 3O74A 3M83A 4KI0A 3WNZA 1XDBA 4QQ8A 4EEKA 3A58B 4P1ZA 4E5DA 4WBNA 2RH4A 4EHJA 3VR3D 5I9TA 4DAOA 5DRTA 1U04A 1ZOLA 1NQOA 1BVRA 2V65A 4H0FA 3VVLA 5LP1A 3VYVA 1Q1NA 4OHOA 3QOWA 1SUIA 2G4CA 2DCMA 1K8RA 1E5XA 1KSGA 4GI7A 3A9TA 4AIIA 3LPDA 3VSEA 4H4CA 1JXQA 4Q4JB 3OX2A 3VTZA 2EU8A 4HDKA 1TD9A 5ERYA 3RRZA 2G71A 4LY0A 1SH7A 3HWSA 3KTAA 3UXHA 3UUEA 4EDFA 1J5XA 4ZEWA 4JWKA 1AMUA 4XDZA 4P81A 4PXYA 4M7RA 3RBAA 1A9XB 5F7OA 3INTA 1WULS 3RROA 4AY3A 2FZEA 5EYPA 1R0SA 3ILVA 3U7EB 5JSZB 4DCGA 4M0DA 4PHTA 1JXMA 1DCMA 3F71A 1OWPA 1XFAA 4J1QA 4ZIRB 2Q21A 1KMHB 2G36A 5ADWA 1WW8A 3FNEA 4RVHA 4DADA 4GKVA 4L8LA 2HTEA 5EQJB 1T3GA 5KQPA 4W5NA 1ORHA 3ENKA 5LC1A 1ZDMA 4GPAA 4I5DA 4TSKA 2B78A 4KPEC 4A8JA 3JATB 4Z9XA 5IAKA 3IQFA 2ACEA 1QNFA 5LQDA 3MXOA 4HAVA 4OQDA 5JYBA 4PTLA 4XD2A 2EKDA 2X41A 4XLZA 3RS0A 4L51A 2BM1A 4ISCA 4EI9A 4JU9A 2QDKA 2QVXX 2WJPA 2AEFA 3I8XA 5TPWA 2QLFA 1E79A 3T3MB 2GBCA 4IFBA 2VLIA 1J1IA 4RFVA 1C7FA 1P29A 5AO9A 4NENB 3ICPA 3L8EA 3QKRA 4UXHA 4BTVA 2HA7A 3OZIA 4ICIA 4NRDA 1NYQA 4WOBA 1W4BA 3O03A 3RODA 3VR6A 5DKFA 4M9RA 1I3MA 1W52X 4A2CA 1JSZA 2CDBA 3QNWA 1FRNA 3KQYA 2QXTA 4DLKA 3RIMA 2ENWA 4S1NA 4YUWA 2UXDB 2BP7B 3C85A 1QHNA 3FVTA 1QKJA 1YK0A 4PZ9A 2NUAB 1AQ6A 3C70A 4F46A 1FNNA 1Y82A 2Q5HA 1R18A 3B6ZA 1T5LA 3VZCA 5LMCA 2HV9A 5EKXA 2NZJA 4I9UA 1VL0A 3TZBA 4JXJA 2SCUB 2P79A 1EWRA 3HY3A 1DQRA 4L5JA 1PV2A 1DOHA 1OWLA 1AF4A 1NLMA 3GGSA 1SPBS 1HDYA 3RARA 3REOA 4Z4EA 3WMWA 3QUSA 1AA6A 1KEUA 4P3OA 3OZFA 2BGKA 3F6YA 2JFOA 2EKZA 2Q4DA 3CSUA 4GNRA 5F7JA 3WKAA 3WRVA 4DMKA 3W4JA 1Q0TA 4E1BA 1D6SA 3D6JA 1JU9A 4RHXA 5SZIA 1BXRB 1FX0A 1FFDA 1PJRA 1Q7EA 4M0EA 1KR5A 1JR3A 2BHLA 2XF8A 4B5KA 4Q1CA 2VZLA 3ANXA 1SG6A 1LRLA 4LBZA 5JAIA 1Y6JA 1L1EA 3WKEA 2ZB7A 2HJGA 5ULLA 3QHAA 5SYMA 3DMTA 4JAVC 1RLOA 1XYGA 2CYCA 4YJ3A 1GUBA 2BDUA 3B48A 4EG5A 3ZOZA 3SEFA 4MVXA 4BFSA 1VIDA 5EKTA 2A88A 2VDKB 2DFLA 4CKWB 5KYNA 1NW8A 1ZK3A 3NOOA 3HJCA 3JQDA 3ES9A 3ED5A 2VYVD 1MVOA 1NAHA 3R24A 1UAAA 1TYAE 5JXGA 4UFPA 3ERCA 1C50A 2ADFA 2QV0A 5JD5A 2HD4A 3JRWA 4QU0A 4XFJA 1U0FA 1GL3A 2EDAA 1WZEA 2Y0BA 3HCRA 4WMLA 3TCNA 3KU4A 1CR6A 4IDCA 5B1IA 5TJ9A 3V46A 4B40A 1S2IA 2J0UA 3H2IA 3KSAC 1QGUA 3IESA 5D5PA 4B84A 1B42A 2HSGA 1SG0A 4I5EA 4MUGA 2JCBA 2HUNA 3R3ZA 2AC7A 4UHEA 1L5ZA 3H9JA 1URPA 5A6SA 3IIJA 3Q9SA 3DBHA 3SYRA 1NQ5A 3ZI7A 4JBNA 2GM4A 4AAYA 4KRYA 2ZSFA 3C7CB 3RVJA 1DPFA 1WHSA 2JJ2A 4QVGA 4YBRA 2Z2KA 3B3QA 4MYHA 1DKLA 3MBOA 3Q9UA 4KGZA 1T8YA 4LOHA 1D5WA 3OPMA 4ID3A 2VLBA 4QBIA 2B8EA 5CAEB 1M6NA 3ZBTA 2AK2A 1JBQA 1EFDN 2A7XA 2E87A 2QR5A 3I53A 3PFBA 2WHQA 2IEZA 2ZE5A 4JOQA 2CGEA 2PNJA 4RA6B 3E27A 2QGZA 3FFWA 3PUJA 4MDFA 1Y42X 4FJ1A 2XUZA 4WASA 4KIGA 2O5EA 1BHSA 3DM5A 3C3PA 4R8VA 2DPHA 4A1FA 4C0SA 4XJTA 4IUCS 2W90A 1ESNA 2JS7A 3PX2A 4C7OA 5HBGA 1C1DA 2VVTA 1M72A 3K6KA 4LZZA 2QTHA 3U2QA 4AL4A 1Q0HA 4ILKA 2WAYA 4YAJA 1RM5A 1LVUA 4FCCA 3FHOA 1IXZA 1MXFA 4B8ZA 1PDOA 5ERGB 1Y98A 3C41J 3MXTA 1Q7BA 1GOTA 1MHTA 4MVWA 1KK2A 2FGJA 4RVSA 2A9FA 2IT1A 3NHKA 1DELA 4O2LA 4PAQA 3W2GA 2OHIA 3N2GB 2QR3A 1ECPA 2EVWX 3IJRA 1M76A 3OZDA 2J3EA 4GP7A 4MJ7A 2VTVA 4Q6BA 3M4JA 1F1JA 5B55A 4RDXA 2P0AA 4Y9UA 4C7XA 3BD8A 3MAGA 5DV9A 5FORA 4IGIA 4XUGB 4WERA 3INNA 1O94A 1MIHA 3B9PA 3DCIA 4AS2A 2HA4A 2REOA 8LDHA 3THWB 4BX8A 2I9PA 4BFUA 4YJFA 3KQOA 2XDQA 4NBNA 1DUIA 4I4TB 1M74A 4OEHA 4P32A 1QFYA 2VP0A 2VAXA 1D3AA 1RS0A 3UENA 3ZXUB 4RGYA 1YZYA 2WLTA 2JLYA 4FN5A 4DNOA 1VBNA 3K9LA 4JS0A 4EG1A 3THRA 2WTMA 1D8TA 1R00A 2OLEA 3HNRA 5B1SA 2EWVA 4GOJA 4P83A 1VDMA 3O91A 4S2EA 2NZUG 4TWZA 4A1OA 5HGXA 3DZKA 5FJJA 1U02A 4MROA 4CL0A 1XJCA 2X5JO 2XT9A 3U3JA 4BE9A 2HRDA 4HQOA 4JXKA 5DNUA 2BWJA 4PZCA 3BK7A 2FQWA 4IY1A 4RH0A 2PL3A 2P4QA 4M3NA 4NZZA 3CLSC 1YQGA 2RHDA 2XUHA 3LC2O 4PYOA 1UOEA 2YJ4A 4G0NA 2D06A 5H1YA 3MRVA 3ROEA 4CF5A 4EW6A 3H1GA 1RZ3A 5C8YF 3EPHA 1Y7IA 2QTVB 1B8OA 4V2IA 3RTBA 3LW7A 3WLSA 5AW9A 4EW1A 1ZD8A 4RZSA 1PJCA 4Z1MA 3L0DA 4QDOA 4RELA 1S2LA 2UDPA 3QELB 5BQFA 3C97A 5HX7A 5JJCA 4AY6A 1U2RA 3CE6A 4M6WA 3REFA 1JQAA 2BEKA 4DS3A 1W88A 2BKAA 2QY9A 4B8YA 1Y7TA 2VXBA 4OOFA 3A6JA 4NCHA 2AN4A 3L7MA 1JPJA 3IP3A 4R0VA 1RC8A 3G9ZA 2GGSA 3OLQA 5AUPB 4AXBA 3EGDB 1U6JA 3OQHA 3HMQA 2GHQA 2PZLA 4ITVA 4X1KB 5CPFA 2JFVA 4BP1A 5B30A 2D3WA 2H4FA 3RFXA 3HP7A 2ZYVX 1G20E 4AJEA 3NYWA 1HV8A 3BTSA 4JLOA 1YJQA 4GPTA 4CIDA 3PEWA 5AK4A 2ON6A 4Z5XA 2IF2A 3FPLA 1VLQA 1XTPA 5REQB 2HW8A 4NYIR 1A7UA 1Z5PA 3AOGA 2JAHA 3M1AA 3T5CA 1B93A 4HPXB 1IN1A 3OIYA 4W82A 2AZTA 1F5NA 2Q2VA 3MELA 3H83A 2JI8A 3NTUA 4J90A 3T12A 4WKPA 5G4KB 4DSTA 5HS4A 5C1BA 4WDQA 2WQ6A 5KQSA 1RXUA 2YHAA 4L8FA 3M33A 2Z95A 3UK6A 3PNLA 5B2ZA 3PT5A 2QEQA 4G56A 1JLLB 1N2XA 1U2TA 1YIOA 2CEKA 2PJUA 2VNJA 5EJMA 2ZUBA 4KNWA 4NESA 4UAUA 5KYWB 1XELA 2EGUA 4M60A 2AG5A 3FPEA 3P9CA 3LCJA 1UXOA 4N3CA 3KJHA 5BN3B 2FAXA 3V8RA 3PL5A 4V2UA 4XH9B 4XTRA 1KMMA 1SMKA 2XD4A 3RGGA 1K7SN 5D8DA 2OYSA 4D9NA 4ZVQA 2IP2A 2O0HA 1VHJA 3BA6A 2QAIA 4K81B 5TS3A 1XXLA 2R4UA 3QA9A 2P4EA 5FBRB 4TZKA 4NYIQ 2EZUA 4WBSA 1RYEA 4KYUA 3HYLA 4Q7QA 5FAXA 2CHEA 5DT2A 2EAUA 3PTZA 3T7TA 1KSFX 1RVDA 1TK3A 1KPGA 3I37X 4AMZA 1XTIA 1W36B 2IYLD 1RI4A 2BR4A 3REGA 1HMPA 3QXCA 4YREA 1W44A 2J9FA 4H60A 1R0ZA 4Q93A 3H65A 4B1FA 1EFPA 1G4HA 1AHNA 4L50A 1UKEA 3TBFA 1GAWA 4EY6A 1ZI6A 3PQEA 3QXHA 1UEIA 2AN1A 3WS7A 3WGHA 1PNOA 1AVTA 2F3QA 4P3PA 2CFCA 1U5BB 2JIMA 1D2MA 3BTVA 3PE4A 5C3UA 3EY4A 2RBEA 2PAFA 3VAYA 5HFJA 4DF3A 4BXOB 3A4MA 5LU8A 5DHRA 4PS0A 3L01A 1MW9X 2NGRA 3SR0A 4NDAA 1JR6A 3PC3A 4Q1FA 2X1LA 1ULBA 2AXEA 1YT5A 3LFUA 4IJUA 5CH3A 3UB2A 3TEMA 2IYEA 3O4GA 1V0JA 4UTZA 3DKRA 3TXYA 3V7YA 4GZMA 1P5JA 1J56A 2PRJA 4OFWA 1H0HA 2PKCA 4WN3A 3H9UA 1DWUA 4LHZA 1U9YA 4ZKDA 4I50A 3EGCA 5ALNA 3VNAA 2XZPA 4BNLA 5KQRA 1PW7A 4DHWA 1UEJA 2QG6A 2OBBA 3GEBA 3PDCA 1PS0A 3E0QA 3QXGA 1E3DA 4BNKA 4MZXA 2WZDA 1I0LA 2GK4A 4YQEA 3ZK9A 5HRCA 2BSXA 2V03A 4ZT4A 1Z2DA 1S96A 3ND8A 3NAMA 4S1VA 4UMVA 5THKA 3RYHB 4A8PA 4Q0MA 1DBQA 4JJAA 1KEEB 3G8AA 1SIWA 3RYCA 3ELYA 1PJAA 2IUSA 2PO7A 5ALLA 4H6PA 1QZTA 1VSVA 2R7MA 4OPMA 4DLWA 1M2OA 3L5KA 1KOGA 6ADHA 2O8BA 1Q83A 1E0JA 3SZOA 4DQLA 1CP3A 4LFBB 3ANSA 2PZMA 1ZJYA 1F2UA 1QZUA 4LDZA 4RGVA 1WSDA 4N12A 2EC5A 4KE7A 4DMRA 4GG1A 2UU9B 2XE4A 3KVVA 2AFVA 1BJKA 3UWKA 3L1HA 1R1DA 3DJFA 3DB1A 4PNHA 3WXBA 1JQEA 3PXAA 4I6EA 4X6XA 4K9KA 4D3SA 1A9YA 2I1WA 1TA4A 3M9WA 4M0FA 4N9WA 1GN8A 1JEJA 3HLTA 3BRWA 4KQ6A 3BXEA 4O1MA 1W0CA 4U1RA 1R0BA 3WNDA 4AMVA 1AH2A 1RKXA 1D2GA 1UOQA 2C98A 3F6RA 4K9MA 4QHTA 1U3WA 2CWWA 4FNGA 4XSHA 3T3HA 3CLKA 4I46A 1X7XB 3PQ5A 3LHIA 1AHIA 4MW1A 1M6HA 4Q1BA 5B4UA 1OHHD 2J5RA 1IQ0A 2Q2QA 5U1PA 3DAGA 3L0CA 5LJIA 2W2LD 4H7IA 4LWZA 5JS1A 5E7JA 2H65A 2V4UA 1Q7GA 1SXJA 1JTEA 4UHDA 2D1TA 3MRXA 1T1GA 3IAXA 3RSZA 1CE8B 3D5TA 4YECA 1EWVA 4P4GA 4AQYB 2JCSA 1L3CA 5CR9A 4JJ4A 1VRCA 3U48A 1T0JB 4MV4A 1T3SA 5DH9A 4CN9A 1Q0UA 1V3VA 4H35A 1E2JA 2GAFA 4WA8A 3V9AA 1EE2A 3S8YA 5DTIA 3N58A 2PGIA 3MPOA 5M3BA 3UB3A 4HLNA 3U3XA 1G5FA 1HT3A 2VNKA 1P4GA 1TLLA 4CV1A 4I3HA 2X7HA 2HU7A 3ABSB 4Z51A 5HNKA 1NJ1A 3OECA 4O2AF 4B82A 1JS1X 3ZHOA 3V6LA 5L3RA 3U3DA 4GPIB 2Y99A 3AFHA 1XU4A 4QAJA 5DSTA 3H9CA 2OHOA 4MS1B 2YASA 4WY5A 2JATA 4NBLA 3WL3A 1XLTC 3PUYA 2ZRKA 5A4IS 3A37A 1HKUA 1XZPA 1L5LA 4C4RA 5FNVA 1MF7A 3WZMA 1H2RS 2IU4A 3PTLA 1HT1E 5CD9A 4Y2XA 5B6IA 3JWHA 3RRYA 1Z73A 3HFGA 4IXMA 3F4LA 1ZGZA 3EEFA 3I6IA 4PQEA 3Q5EA 3GLIA 2HEGA 3U7JA 3THXB 5CBPA 5B3KA 3TSWA 1BA2A 3RRBA 4C9BA 1LDMA 2R47A 5C2JB 1A9ZA 2ZBGA 3I28A 3OM0A 1GSAA 4LHSA 1X1TA 4Z2AA 3V4VB 3H4MA 2Z04A 2P1ZA 5FBVB 4YNBA 3A6HA 3CU5A 1NKVA 1L8LA 2GUGA 5GZ6A 1UT6A 1H4TA 2TSYB 4YAOA 3ZJVA 3UMYA 2QIPA 4QUHA 4WGGA 1DQZA 1AHHA 2IHJA 4RJKA 3TB4A 2P0YA 1ZUNB 4EG6A 3WRYC 4DMLA 4RBNA 4OSEA 4FEGA 4ZVNA 4PG5A 3VBEA 2O3RA 2JCYA 4GGMX 3D31A 4KIWA 2CL6X 2LRHA 1D0SA 3PR1A 5I7UA 3AIMA 4GLLA 1R4NA 1M66A 5IABA 2KSQA 2GZ2A 2IXDA 1HM5A 1VM6A 5K3EA 1JIXA 2GN6A 2YV3A 2G1PA 3NALA 2VZ8A 5CVVA 4NEQA 2IHZA 3CRQA 4HNAB 2QE7D 3TGWA 3FCXA 3RRNA 1CUZA 3HHEA 3SY8A 4PZ0A 2CHGA 3VPBA 5JFOA 4UREA 2C3MA 5F2OA 3FCUB 3NASA 2JGRA 4I4NA 4V03A 1A4IA 4GXNA 1SHTX 1STOA 2YHIB 3FR8A 2Q9UA 5DW0A 2Z5VA 1W6UA 3Q3HA 2QW8A 4Q3DA 4YHBA 3T5BA 1Q2XA 5IVIA 2FUG6 3RAPR 1HYEA 4DXHA 4PPFA 4KFRA 2QMOA 2X7XA 5L51A 2G1JA 2PXXA 5D3MB 2YW9A 4RZHA 3TRHA 4MGIR 1TEXA 1UPAA 1CXZA 1PG5A 2OM2A 2R1UA 3ZQKA 2EKBA 2Y66A 3KAPA 4PBTA 1HQDA 4KXLA 2FSVC 1G2IA 1P5HA 3D64A 3NPMA 1A96A 4UCWA 3IR5A 3WHLA 5CIQA 1SC6A 5CD1A 1L4YA 3ZYZA 2Z57A 4FP9A 3HGMA 3A4VA 2GEKA 4XWAA 2AFHE 2KQUA 3F73A 1U0RA 4FZRA 1K66A 4RVNA 3H11B 3NHSA 2J45A 3M3PA 4GXTA 4H27A 2PD6A 1GV0A 2YWXA 4TSFA 5C4IA 4IOLA 4U6NA 3VU8A 3I9JA 4RH1A 2CC2A 4UCXA 3IXMA 2YJ5A 1HLPA 2POQX 1N9KA 2R4TA 4DSUA 2MYPA 1GQRA 3WP0A 5TMEA 2VQFB 3ZDBA 1UBGA 3JD4A 3K53A 3MOGA 4KVGA 3LWNA 4MWZA 4TKUA 5H9WA 1G8AA 4L4ZA 2HDNB 4HY3A 3DXFA 1BVYF 3GAAA 3M1IA 4GX2A 4QGGA 1D2AA 1HLFA 2V3VA 1RPTA 4DCNA 3EWNA 5J58A 3PRKE 2OAEA 4X20A 1IB6A 2J3LA 3HCWA 3GLHA 1ESZA 1LC3A 2YX1A 3K20A 3NTOA 4O4JA 2YJ6A 4X66B 2DPXA 4C5CA 2GD6A 2QSZA 1H0SA 1RFGE 3KT8A 1T1SA 2H31A 1X1CA 3K09C 3ZWDA 3UNXA 3LX5A 2ZSAA 3U4QB 4YV0A 4OF4A 4OUKX 3OAAA 1COWD 2XWSA 3PFNA 1FFSA 1MRNA 1N7GA 5JNWA 1IFXA 1M6VB 5HW0A 4ZQCB 3FZQA 3HUFA 4B0OA 4L08A 3ZW9A 4NFLA 1UK9A 4G0QA 4IIJA 4FZJA 4W1QA 5FTKA 3ADCA 4AMBA 2ZQZA 3RH0A 5AOBA 5IKOA 1VLJA 4UBJA 1OXKB 2JGNA 5DYNA 4DJFC 3VSBA 2YBEA 4R2IA 4D1YA 1ZIOA 4RKWA 1JHRA 2ECOA 1H66A 2DT8A 1SD1A 1BIFA 1TXGA 4AWXA 4RMNA 4TMZA 3QXSA 4G37A 2DTXA 1U9ZA 1X2BA 3FCOA 1HL3A 1Z15A 2D7CA 2FPPB 4IQFA 4KQ2A 3RS4A 5HKAA 3U62A 1I3LA 3OM9A 2L0XA 1Q44A 3CONA 1D6NA 3CNBA 3IILA 5LA6B 2BZSA 2X0NA 4QRDA 3VC7A 1IXSB 1VE9A 2IU0A 2IC5A 1RAGA 4FKBA 1H2EA 4LISA 1SU7A 1PQYA 2XF2A 4RPHA 5K3AA 4DV1B 2O0MA 4A03A 5A05A 1Q3KA 1NUUA 1BMDA 2F2TA 3PI6A 1GO2A 4NHEA 2VUUA 4L8YA 4AJIA 4YMGA 3Q8MA 2Z8ZA 1Y1QA 4BMDA 5F5LA 4XPZA 1TEHA 4P4UA 2E55A 4FEEA 5AD1A 5TMBA 4ADSG 3FGZA 4C0AC 4JI7B 3WGGA 1RZRA 1HX7A 1KTIA 3ZLJA 3LO5A 2GN8A 3CO0S 3N70A 4NI5A 4IIUA 4DPLA 2F90A 4HVLA 3BWVA 3AVOA 1YSCA 3MJ4A 4WNYA 4Y9TA 821PA 2Y6UA 3GYGA 3EMKA 4E4RA 4LF6B 1BX0A 2LCIA 1BCSB 4ZVVA 3SHQA 3VKFA 1IJEA 4DZTA 1HZZC 5DGXA 1EZZA 4C5BA 2IUTA 4JYBA 3PDHA 4PVCA 1CUIA 4LRUA 2LE0A 1BSVA 2ATVA 1CWUA 3VOBA 1YA8A 1RPAA 3PYLA 4JDUA 4BNNA 4EWLA 1SUCA 1P18A 3BGSA 4OM8A 1Z7YA 4UNPA 4I1VA 3WB9A 3QE3A 5AW3A 3K70D 4AWAA 3RG8A 5IT5A 4L3WA 1JDTA 3VX4A 1UT8A 4PBRA 1T15A 2VHVA 3O3MB 3RVOA 1J7KA 4YAUA 1C4XA 1O95C 1ZRNA 4TMTA 1CY8A 2B7BA 2Q3HA 3SQOA 3DV9A 4HB0A 4JQSA 3TIXB 2J7PD 4XLLA 3W5SA 3KUKA 5JDCA 3HXOA 4LX8A 1CQPA 3VZBA 1J0XO 1WUIS 2Z1DA 2I1LA 1C7IA 4MMZB 2VZ0A 3RT9A 3CVXA 3I34X 4D45A 1GGMA 1RYHA 1DO2A 1Z5VA 2NU6B 4QREA 1Z7WA 3R7FA 3LA8A 2H5IA 4KGDA 1ESDA 2HA0A 3DLAA 3SIRA 3N7UA 3WNVA 4C01A 2AKEA 4EIWA 4G0MA 2C2WA 2ANBA 4UMDA 2B1RA 3LMKA 4ZMRA 1XWWA 2OCYC 4CM7A 4C0JA 3WB2A 3Q72A 2I66A 2ZG6A 3D4OA 4MJLA 2ZAOA 3H7AA 3SP1A 1M9NA 5IASA 1UANA 1WCXA 1OX4B 1LFDB 1SAYA 2G72A 3JQ9C 3ZHSA 4Q4JA 1RXVA 2R87A 4JNCA 3JASB 1NASA 5CT5A 2JA1A 3IPCA 4C6TA 2CVFA 1N5LA 3G0CA 2JCGA 3C2QA 5A62A 2VNSA 3THXA 1EEXB 1W25A 2CYAA 2O8NA 2WMOB 3QEMB 4OK6A 1KOFA 5EA2A 5EMJA 4NY1A 3RVBA 1HEYA 2AGVA 5JSZA 3S44A 4DR6B 3K9NA 1OI4A 5J47A 4E14A 3NHYA 2JH8A 1NYRA 2GRAA 5HRUA 3CUTA 4NG4A 4PBSA 4F86A 2YFQA 3ZVMA 1MEEA 3LXXA 3LS2A 1D0VA 5LMUB 2YWGA 3W77A 1G8SA 1I6KA 2FA9A 2V0NA 1HSZA 3JATA 3ZC3A 3ZNNA 3E2IA 5LWQA 4RHUA 1AK2A 4BLVA 4F3NA 1FLVA 1VJTA 4M0LA 4R01A 5CB8A 2C1ZA 2LUOA 3GLKA 3LK6A 2TMKA 3R0IA 4FGUA 3ZUGA 1EFVB 1U3DA 1OD6A 2PLRA 1C0EA 2P8SA 3B7GA 1NV9A 2XUGA 5GQSA 3TO5A 3WRWA 4F4HA 4NENA 1RHUA 1DE0A 3KAKA 1M8KA 5FR2A 3PQ6A 5IJWA 4G0UA 3DVAB 4ZCTA 5CNJA 5KREA 3KB6A 2XMPA 3SC2B 2RKBA 2I0FA 2QZSA 4BBJA 2ORWA 4KN9S 3KDSE 3ETDA 5G41A 4YYEA 1P4SA 1T5IA 2DHQA 2E4AA 1VG9B 2BP7A 1TYZA 2R25B 1RPNA 1H8EA 3DNPA 3JQEA 4HAYA 4BAGA 2NUAA 2HXYA 1XWIA 2NT4A 1H42A 2OAP1 1OKKA 1X7YB 2WSSD 2JCXA 2X5KO 2WHPB 3K32A 1AV7A 1T8RA 4MWSA 3H13A 4OL0A 4B75A 1OY1A 5JBIA 2SCUA 3HVIA 1RJ9A 4NNJA 1EJ2A 1YB5A 5ERXA 2BOVA 1T8TA 2R7KA 3MWYW 1UDAA 1MUUA 4LY6A 4DBLE 2N0SA 1Y8AA 5FOSA 2Z5FA 1JFLA 1LB1B 1O8CA 4EGCB 2WG0A 1LDEA 5KKCA 3ZV6A 4W6QA 1VBFA 3AKYA 1CS0A 4RDHA 3LLSA 4LW8A 5I7AA 4F4CA 5TE9A 3C6YA 3FB1A 3U39A 2ZJOA 3DTVA 1GAJA 3O4HA 3PYXA 4GOXA 1YVEI 1NW6A 3TW8A 5FKJA 3N2KB 4AJPA 2IPAB 5JZVA 1FFGA 2QRUA 2RH9B 2GPJA 2RHHA 5EIEA 1HDIA 1QPGA 2G07A 5TEWA 5IS2A 4GKAA 3CX3A 2I7XA 3OEWA 4R4JA 3MS7A 2EW1A 1UBCA 1JF8A 2Y0DA 1TYBE 4LGVA 2V0GA 4AQDA 4D5EA 1U7WA 3KQSA 2P2CA 3AJ9A 4E5SA 2C92A 5LUAA 1BGVA 3ZDEA 3ZJ5A 1YJAA 2IY9A 2O50A 5D6NA 5G40A 2PUEA 1EGMB 4YDRA 1CFZA 1JHPA 1N5RA 1ENPA 1WVIA 2VC2B 5EE3A 4M1YA 4HLUA 3BTOA 4UTXA 3QYJA 1FTSA 2FP3A 4GVXA 3BIJA 4TWIA 2HUPA 1VZ3A 4IL5A 1TTPB 3L6DA 4X1YB 2ATCA 5K0NA 4H1UA 3PR2B 2BFNA 4QWMA 4HDRB 4LWOA 1YHNA 1RBYA 1MO2A 1FY2A 1VXOA 2OCDA 2QY6A 1XZKA 3E3MA 1NBAA 3CRVA 3IOCA 3LKDA 2MR6A 3AZQA 3HCPA 3W0LB 1PL6A 4IKEA 4K9DA 4PPGA 4KLRA 4BN5A 3M5WA 1GG8A 4KQWA 5HEKA 3DTYA 3BAFA 4MV0A 1O87A 5JAUA 2FR1A 1JHOA 4Y67A 1JA0A 1O9HA 2V7TA 3HY6A 3WL5A 4CG3A 3GEHA 2Q07A 1VPVA 4P22A 1KH2A 3DBRB 2ZVQX 1NVMB 2WB4A 3G9TA 3KKNA 5EJ2A 3TOXA 5A4AA 5K45A 4NU6A 1XTJA 1TECE 2UXBB 4HB3A 5F35A 4TTRA 3ZGOA 4XIIA 4JLKA 2BM0A 2DQKA 3ZU3A 4CEIB 1APBA 1RE1A 2DBRA 5K4AA 2WYOA 4ND1A 3GG2A 2BUBA 3N6XA 1ONNA 1ZC4A 2FCRA 2WWFA 1BFDA 2O3QA 2VDWB 3JQAD 4CEJB 1AJEA 1X7ZB 2LDXA 3N0TA 1I9GA 1XMXA 2NU9B 1SCUA 5JLAA 2FWRA 1QF9A 3C14C 5HKOA 2BKLA 2C7RA 2GRUA 3B1VA 3LCMA 4EG3A 4II7A 4ZN6A 2JVJA 4QAQA 4M2LA 3R8FA 4A82A 5IFLA 2CBXA 3UBMA 4CKEB 1R8JA 3E9YA 4CLXA 3EBLA 3L49A 1HK7A 1HT0A 2P6MA 1DTWA 3E9ZA 1BS9A 5A71A 3SFTA 3UKOA 2XKJE 2W2PA 1NSTA 4PPNA 1RIFA 1Z4IA 1LDGA 1KHTA 2NTJA 1UPCA 1G3MA 4CDRA 1OAOC 4Q82A 3IGFA 3GH1A 5E1DA 1M1UA 2GESA 1TQ2A 2IYOA 1YZUA 2UYGA 1OIWA 3FF1A 3K9QO 3KK0A 2A86A 1AB6A 2GASA 1TGVA 2DR3A 2R1ZA 3K6RA 3KE8A 4MWEA 3THWA 4DEXA 3FGNA 4YQZA 1UINA 1WB6A 2PWZA 1F60A 4MGEA 2ACWA 3EAGA 3ACCA 2ZYGA 4D9FA 3M6FA 3JQGB 3VR6H 2VRWA 3PCXA 3RAGA 2WHRA 3CIOA 3ZZUA 3ESCA 2WKPA 1NRXA 5ED4A 1WXQA 4P4SA 3MGBA 4Q1EA 4ER0A 2VUHB 1BU5A 4MEAA 4WZBE 2J9YB 1KDOA 5EIBD 3N87A 5F2NA 2ILVA 5CLHA 4I36A 2IIQA 3TTWA 5GZ1A 3G2KA 2ZIXB 4MGZR 2QLTA 5EUMA 3FWZA 1P74A 2QRVA 5LZ2A 2IP1A 5DGDA 4NVRA 4JY7A 4ECEA 2O54A 1OA1A 1OCEA 2CLFB 2P9FA 2HHLA 1XCOA 2D2EA 2QTVA 1HDEA 4H7HA 4YMWA 1GGFA 2JHCA 2JGAA 3FTNA 1ZITA 5DIFA 4DA6A 4UHKA 1CB0A 4NICA 1UMBB 2IZ7A 2C84A 3KD2A 1XVUA 3UMVA 4MR9B 4B7CA 3TQQA 5IU6A 1BHO1 4BFVA 2W4QA 1H1LA 1EQAA 1OI3A 1USVA 1CUCA 4TLAA 4Z4IA 5E0KB 1ZM2A 1ATIA 3OG9A 5FP0A 2PX6A 3AX6A 3PS9A 4DOMA 5J4HA 4I1PA 3T3IA 1S3IA 4MUNA 3E2PA 3QU9A 3Q6IA 5EGSA 1LRKA 4CM9A 2CD9A 2AFRA 2IJGX 2JD1A 1EDZA 4QD3A 5BYKA 4F3YA 4OMFG 1JJ7A 3AUYA 4Q3CA 1RJDA 1XXHE 1GCGA 2DX7A 3C6ZA 3I9V6 4MTLA 3TTTA 3R6GA 3VPDA 3ENQA 5DXJA 2C99A 1IRXA 1ORTA 1YBAA 4JEIA 3NWEA 5JWOA 5REQA 2EEPA 3PLAE 1VL8A 2G08A 4Q1DA 4BZXA 5IH7A 4HH0A 4DR7B 4PYJA 4XB1A 1PR1A 2GX6A 1NPDA 2WT9A 4QTXA 1S01A 5LYYA 3SHWA 3HYCA 4KQGA 1E1CA 3F6SA 2WP8J 4C4SA 1I6WA 2EV9A 3UKDA 3MT8A 4I5GA 4ZOQI 4JMLA 3IQWA 1KAOA 4PZAA 4QOSA 1BKSB 2BGWA 2HQOA 5FPQA 3EW9A 2P2LA 5AW1A 1FJXA 1ZA2A 3GG9A 5ALPA 1LVGA 2JLAA 1K7CA 3L8ZA 3P7MA 3QP9A 3X0DA 4D44A 2Y77A 2PQ2A 1MGPA 3BD6A 1UBKS 4NEHB 2XCLA 3JSAA 1P7CA 2PRKA 5TT0A 2RI6A 3NDRA 1QLWA 3VC3A 3ZWPA 5KYWA 4M7WA 2BJWA 4ZP1A 1PZGA 1IY2A 1YULA 5TY0A 5K3DA 4UBIA 1XLUA 1R74A 5K0TA 1QDLB 5BN3A 3G7NA 2CNOA 3K9GA 2B30A 1YA4A 1L7XA 3ABRB 2EKPA 3EG5A 3HKDB 3P8ZA 4FB5A 1J8FA 4BBZA 1EMDA 4TL6A 4CLEA 4PC6A 1Q57A 4HGPA 4MQFB 2FR8C 1TVEA 4X0EA 4BKUA 4ZICA 1E6EA 1PYDA 1EGHA 3OPXA 3BF7A 5JLJA 3ETJA 2VHCA 1U0BB 4NFHA 3KBOA 2QP9X 2D0PB 3HI6A 2VDUE 4L8GA 2O05A 3EVCA 4MO9A 1XL0A 3QKUA 3O21A 4A9AA 2I4MA 3H5TA 4IOMA 5BR4A 1QO9A 4EG4A 1HG0A 3MWDB 3GFVA 1NI5A 1UQRA 4YP1A 3A1NA 1OPRA 1G3RA 1PFYA 3G2NA 3KPVA 3DD1A 2WYWA 2FMUA 2RGBA 5DYGA 2MDTA 3I5AA 1ECFA 2X86A 2W4IA 2HU5A 5FBWB 4OM7A 1Y7HA 1EXDA 3K0BA 4FFNA 3TSZA 1L4EA 3GA7A 4UXJA 4MDYA 2RE8A 4GOKA 2E21A 2HA5A 2V5VA 5JR3A 7ABPA 2R4QA 1E9SA 1TTQB 5LLDA 3DDNA 1CUFA 5T5QA 5AW8A 2WA1A 2ZJ6A 4ZI2A 4DG5A 4FBLA 4KB5A 4QIHA 5CM8B 1U2GA 1R27A 3WIBA 3WK7A 4DCSA 1ZHOA 4HG2A 2R5NA 2ZTVA 3WV5A 3N53A 4GHWA 3TIFA 2VXOA 3VNRA 2GYVA 1FQKA 2VYFA 3VMFA 5TF4A 2E89A 1ZL2A 2HPHA 2HSEA 3RYHA 5IC4A 4JGGA 4P0QB 2GM3A 4KWEA 4HQ0A 4W9NA 3IBCA 1CJCA 4BNDB 4EBBA 1THGA 1UBSB 1WUKS 2H5LA 3KEMA 4AKTA 5ITZB 4Q4AA 3RUPA 1MABB 1E60A 1GG9A 1MX3A 3B38A 4TVBA 1OB2A 4INOA 3EFHA 3LC1O 4D9JA 2CLEB 2CW5A 2CB0A 4GSLA 1NQWA 4TUYF 4XJVA 4Q48A 1CK4A 1YZQA 3RK1A 1RBMA 4EY3A 3MQ2A 2AHOA 2FSPA 2I8AA 1DBSA 4XCXA 2H7CA 3F5MA 5ALOA 5FUWA 3M3DA 1NATA 4LZOA 5KI6A 1YR8A 2B7CA 2FEXA 2BFDB 4TS3A 3U17A 2VQSA 4A15A 3PLRA 1RMQA 3L9WA 4I99A 4GC5A 3ORQA 1JFSA 1RWWA 3SVZA 2ZI3A 1Q1AA 4RKYA 1M1NB 2YZNA 5CNKA 4WZAA 4URVR 3A2KA 1X7XA 2PX5A 2PUWA 4EHAA 3VO8A 1PLLA 3IP8A 5CB0A 2QUAA 2I9KA 1UBMS 4KO4S 2W6ID 1I33A 2C2HA 2XB9A 4BO1A 1EG7A 1VP3A 3I05A 3ROPA 3O1JC 5DBIA 2O14A 2ONJA 2GCIA 4MHSA 4X85A 3BPSA 2H17A 1Y33E 4TV8F 5EY5B 3UXYA 3ZKWB 1CF2O 4PGFA 2C5AA 2Q8QA 2R6FA 2XMQA 3HR4A 1RLTA 2IA5A 3F90A 4I7EA 4CMGA 4C03A 1I1QB 2DTEA 1PZHA 1G16A 1YKGA 4BBAA 4BKMA 1FF9A 4OY3A 2PPLA 1FUYB 2QLMA 4EG8A 1QK4A 3QU2A 1JKFA 3QE0A 1KJ9A 2Q9BA 3EDQA 3ZZ1A 3KZ1E 4OQFA 5K03A 4Y8VA 3PXBA 4M8KA 3RTAA 1PR2A 2B82A 3GJQA 3QPCA 4D99A 2B4RO 3DZCA 1IVYA 1P0IA 2R2GA 2TECE 4JBIA 1ETHA 1R6UA 1TZJA 1WB4A 3K0KA 4LE1A 3EJWA 1GCAA 3OT4A 4GOND 4LZLA 4R2LA 3ROTA 1UKBA 2Q2OA 5AYVA 3UJBA 5AM3A 5BSKA 4LJ9A 4YBZA 4KKXB 2W0SA 3P9YA 4Y2JA 4Y30A 3T61A 5CIYA 3S8MA 1DC5A 1EA7A 2OK7A 2VFAA 4F6RA 1XQXA 5LFAA 3EZ9A 2Y1GA 1RWQA 1OYYA 1WUJS 3LQRA 2R8XA 4E88A 2AEMA 3LK7A 5ICEA 3ILHA 3RUEA 2GZHA 2IX9A 3DE7X 4J2HA 1NN5A 1BROA 2WP0A 3G5MA 2CEAA 4GYJA 1P4RA 4DV2B 1TPYA 2H06A 1MQ9A 1Q20A 2PD3A 4XCQA 4EA7A 2C04A 3G88A 1Y80A 1X8KA 5HG0A 2GDZA 5JXIA 2ZCUA 2HIHA 4TL8A 1AT1A 2V6IA 2BGRA 2D1FA 3U6BA 1A9QA 1MTZA 3DBVO 4C76A 3SAJA 3VR2D 4DN6A 1K6MA 4DE5A 4O0LA 4ETNA 4LJRA 2C0CA 1CU1A 2XBUA 3E1SA 1LUAA 1AUXA 4QBHA 2GTHA 3LTEA 1FK8A 4HS4A 1NUSA 3UT5A 1SOAA 4I4IA 1OSNA 1AGPA 3CYFA 3K0FB 2WJJA 2MJLA 2PYDA 1QAMA 4UW9A 3CX7A 4CF4A 1C3OB 1IONA 3V32A 4CUZA 1WLYA 4HNAA 5JALA 1OH8A 5AVYA 3O92A 1OBOA 4B83A 5JPDA 2Y93A 5B1EA 3ZTTA 3DTNA 1PJ2A 1AZWA 3N2YA 4NZMA 4R3NA 5IBCA 4BAUA 2A1TS 4MAMA 4DQDA 4RSRA 4C4AA 3LKVA 3R20A 5FTNA 2UZIR 4TL7A 2XUJA 2ZUVA 4D9MA 1JAYA 1WB5A 1XLWA 4FFRA 1A2QA 2O23A 4AMUA 3KEGA 4IX9A 3LP8A 1Q1BA 5LOVB 4MCAA 1GZ4A 4RK6A 5CX4A 3G2PA 1TNDA 1G2PA 4L27A 2I4IA 2A1IA 2V3WA 5DW3A 2MOKA 4JVNA 3RS9A 1KRWA 2FZ4A 4PCUA 4FYVA 1U8ZA 5AVVA 4RZXA 4FR0A 1YASA 4HD8A 1K2VN 4OMDA 1ISFA 2OA0A 2L17A 3CZQA 4ASUD 3QYAA 3OCJA 3HMKA 1DIBA 2PZGA 3MINB 4L0DA 1U2DC 1FIUA 1EM8B 5CLFA 3VDXA 4EDHA 2FSHA 1KDRA 1QH9A 3KUUA 2E2WA 3NWOA 4K1XA 4E1AA 4Y2YA 1UIMA 1KO4A 3HXKA 2B35A 1T0IA 2D54A 4OREX 3V4SA 1R8QA 3HVJA 4B9EA 2AVDA 4IHJF 5FHQA 3CLUC 4FCVA 5IZ4A 4L95C 3SF0A 3VU9A 2VF2A 2YIDA 1L0BA 3F2VA 4XIFA 1UBJS 2AI2A 1VKHA 2OL4A 4NC9A 5KAMA 3PF8A 5K3FA 3UAWA 3CTPA 3PICA 1UR5A 1CB7A 1QLJA 2C96A 1GCOA 1HO3A 5D1HA 2VP9A 2ENUA 5BN5B 1N9GB 4FINA 4EOGA 2OFOA 3UFBA 4IRUB 1O6BA 4HAZA 4Y2QA 3RS5A 1XEWX 4DRZA 5AVWA 4IWXA 4RPCA 3I2KA 1E0KA 3QPWA 1JHMA 2Y2UA 1M6VA 4GLFA 4PHFA 4XWGA 3STVA 3QSYA 4CQJA 2NZVG 3CF6R 2IZOA 5I7OA 2ZYUX 1JZQA 1Z0ZA 5EIXA 4NSNA 1AU9A 4Q9DA 5KWSA 1P7WA 1BG6A 1PGPA 2OORC 3K0AA 1RI2A 2VP6A 5HCNA 3W5JA 2NADA 3M4ZA 2FWNA 4LXQA 4MSUA 5JQGF 1TIPA 1XCMA 3IP9A 3P19A 5JVDB 1KPIA 4CV3A 4PC1A 3QTTA 4L9RA 3HU2A 1YRAA 1DEOA 4PX5A 1RXSA 4LQ4A 2O1XA 4OQPA 2L42A 4UQPA 2O1EA 2OZLB 4PZZA 5CH8A 3UWOA 1U8AA 1XZDA 3L7NA 5CT6A 2R62A 5KYKA 5EESA 1LLQA 1YDEA 3BXGA 3OOSA 1MB0A 1U81A 1XEAA 4KPGA 4Y2HA 5LLTA 1ADYA 1UXJA 3FOEC 2B94A 1SQ6A 4BEVA 1NMZA 5CVEA 4LF7B 2VSXA 3SMVA 1SKUA 1TUGA 1XZNA 1GU7A 1QJ4A 2YXLA 4AJ4A 4UHFA 4E33A 4RLHA 2HWKA 1MFPA 4BDTA 1UT5A 1C1XB 2HPZA 3A1DA 4DLNA 4F91B 4O33A 2VAMA 5FF9A 4IVNA 4YJ2A 1ZAYA 3FCAA 4RJ2A 3BG5A 2FZ5A 1Y6FA 3OIFA 3T0IA 1DRJA 2ZIGA 3GUHA 3FDZB 4CG0A 3PXEA 4FBGA 3VU3A 3WAJA 1N6RA 3E8MA 3AOEC 2XCIA 3L77A 5AP9A 4QBGB 4QC2A 5EWMA 4DR2B 1CLUA 4TRRA 5CDYA 1QWOA 3PFWO 2O7NA 3STTA 1KZ1A 2X8JA 3FF4A 3UQZA 1I1OA 2Y9PB 3NHAA 4TM7A 4E13A 1RQLA 3FTPA 3KZNA 4CLRA 1IRIA 1H8HA 1ZA1A 3HLYA 2NO5A 1WLSA 2J5XA 1U5AA 2Z4RA 3OTQA 4ER6A 2O8EA 2NXNA 3S0JA 1O96B 3KLOA 3T1HB 2FFHA 1GQFA 2Y76A 4KXWA 3NEAA 4FFSA 1ZONA 3DCYA 3WNBA 1Y0BA 1GL6A 1YDGA 3BXHA 3K8YA 2V3CC 2Q5IA 4D0RA 3QY0A 5AKIA 3C1OA 2YZKA 5HKLA 1O9GA 2NU6A 1HNWB 4YQFA 1Q19A 3GT7A 1QQ5A 2O1SA 3DZFA 1NNI1 1WOYA 4J94A 1VIAA 1VRVA 3AF3A 3DZBA 2QD3A 3AF6A 2D0OB 1T6BY 2GARA 1Z34A 1YB4A 4FN4A 3F4BA 1FP4A 3BBPA 1ETUA 2HJHA 1YOBA 4M76B 2EBWA 2OBMA 4EHIA 5KTKA 1EUQA 4OJTA 2B6NA 3WTBA 4F71A 1IHDA 3NV9A 4R16A 1G0OA 2A9KA 4EPVA 4R1LA 1QTRA 1F14A 5T41A 3EEQA 3WLKX 4E4TA 1OX4A 3IBFA 1OQAA 2FR0A 2P9YA 5AI4A 3FUTA 1MPTA 1U7TA 5CLIA 5I01A 1JLHA 1Z2EA 5DM60 2YFKA 2FW8A 2P6UA 1ZICA 3IV9A 1W4RA 2CMKA 3QEMA 2ZT7A 3EXG1 1ESEA 1RNLA 2ZWMA 3C3MA 3V8EA 3MCZA 2VF8A 4YASA 5AW6A 5P8WA 1X9GA 1T2AA 3ECCA 3R7AA 4BLPA 5FEUA 1P2BA 2ZRPA 3ZDYB 4LPSA 3D3EA 1TCUA 4E11A 3GNSA 1JDBB 3U44A 3MJRA 3NIWA 3PVCA 1WRBA 3JQAB 2EW8A 2C8JA 4NZNA 4QXAA 3BS4A 3OTHA 3TS1A 4KQ1A 5AESA 2WM3A 5AW7A 4U00A 3RV4A 5KJ6A 1ABBA 2A5LA 5DM0A 3HJAA 3LBIA 1PL7A 3N3BC 2DLDA 1NX9A 2ZWVA 4G07A 2ZS7A 5D3QA 4NCBA 3A14A 3G6WA 4MV6A 1DUVG 4H1HA 4MLPA 4MR7A 5A3RA 1ILEA 1TJPB 4DJTA 4FS3A 1Z5ZA 3EZ6A 3WMFA 5C8ZA 2I2AA 2ID9A 4DLZA 1EFVA 4R9SA 4ASUA 3WYEA 5K4GA 1ZD3A 2HC9A 2BEUA 5ALUA 1JX6A 3C0KA 3G2MA 2QD4A 1FBNA 3AZPA 1A8HA 3K9HA 3SC2A 1RHQA 2W2MA 2Y1FA 2A5FA 2RGCA 2OBYA 3M1LA 1L7BA 4P9NA 3H86A 4V0NA 5IUNC 3WMGA 1QQTA 1N6NA 2DR2A 5DX1A 2AX3A 1TC1A 1NBWB 1YI1A 1X7YA 1CUAA 1Z0JA 2I1QA 1GFWA 1JDPA 1KJZA 3LCRA 1PX2A 4ZO7A 1RWXA 5BN4A 1A88A 1Z08A 5C18A