1DTWB

Human branched-chain alpha-keto acid dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
b'QTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE ALPHA SUBUNIT
publication title Crystal structure of human branched-chain alpha-ketoacid dehydrogenase and the molecular basis of multienzyme complex deficiency in maple syrup urine disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB02
1YBHA 2BEVA 3KOMA 4K9MA 5I4IA 2C42A 1X80A 1QS0B 2EZTA 5EJ4A 1BFDA 2PGNA 4KXXA 1TKBA 5EJ7A 4C7XA 2G67A 1YI1A 2C3YA 1WCIA 2WVGA 1OLUA 1X7XA 1OLXA 4RJKA 4JD5A 2BFDA 2XT9A 2VBGA 2AG1A 2YICA 1V16A 4QQ8A 2IHUA 5I5EA 3F6EX 5ESDA 2FN3A 3E9YA 2BFFB 3EXHC 2O1SA 3MOSA 1POXA 5HJEA 1W85A 5EJ5A 1QPBA 1V11A 1YHZA 1OLSA 1GPUA 3UK1A 3M49A 4K9PA 2Q28A 1X7WA 3EXFB 4WBXC 1Z8NA 2JGDA 4JUDX 3AHIA 2W93A 2C3UA 3L84A 1DTWA 1U5BA 1B0PA 4K9NA 2JI9A 4QELA 3EXIB 4KXVA 2Q27A 1PO7A 2AG0A 4JU9A 4JUBA 5EJ9A 2C3MA 5EJ6A 4KXYA 4KXUA 1QGDA 2JI7A 5EJAA 1UMDB 3M34A 1OZFA 3ZHTA 3EXHA 2BFBB 1UPAA 5DGDA 5DEIA 5K2OA 4KXWA 5HYVA 1T9DA 1T9CA 2C3OA 1ZPDA 2BEUB 1UMBA 5ERYA 2JIBA 2JI6A 3HWWA 5HHTA 5HGXA 1X7YB 1RP7A 5DGTA 3AHHA 3LQ2A 4RJJA 1ITZA 3EXG1 2BEVB 4JUAA 1T9AA 3IAFA 2BEWA 4JUCA 1X80B 3M7IA 2E6KA 4RJIA 5EXEA 3RIMA 1T9BA 1W88A 2VBIA 1WCIB 5EXDA 4Q9DA 2BFCA 5FEMA 1OLUB 1NI4A 1UPCA 5AHKA 1V1MA 1OLXB 3EA4A 2IHVA 1OZHA 1X7ZA 2JI8A 2R8OA 4D5EA 3ZHRA 3DV0B 3ZHSA 2VJYA 2V3WA 1YHYA 1W85B 2EZUA 1YD7A 1PVDA 1N0HA 2PANA 2EZ4A 1OLSB 1UM9A 2O1XA 1TRKA 4JUFA 3OOYA 1Q6ZA 1V1RB 5I5GA 1KEKA 3LQ1A 2Q5JA 3EXEA 1IK6A 1JSCA 5EJ8A 2WVHA 1L8AA 3LPLA 2BFEA 2C3PA 2JGDB 1UPBA 2QTAA 4JU8A 1UMCA 3EYAA 1DTWB 2OZLA 2IHTA 2NXWA 1PI3A 3DVAA 3DUFA 2BP7B 2IEAA 3AHEA 5I51A 2R5NA 1V5GA 2Y0PA 1TKCA 2UZAA 2UZ1B 2VK4A 2C31A 4COKA 2G25A 4K9QA 3IAEA 3ZHQA 2J9FB 3EXHB 3EXG2 2PGOA 2YIDA 3FSJX 2Q5QA 3UPTA 2BEUA 4K9LA 3AHGA 4GG1A 1QS0A 5EJMA 4GM4A 1PYDA 2VK1A 5K6TA 4K9OA 4QPZA 4MPPA 1Y9DA 5ERXA 2BEWB 3AHJA 3D7KA 1V5FA 1X7XB 2PDAA 2X7JA 1W88B 2BFDB 2BFCB 4MZXA 1YI0A 1NI4B 1V16B 2Q29A 2DJIA 1V1MB 3AI7A 2XT6A 2JLAA 2BFFA 3ZHVA 3HWX1 5K6RA 1X7ZB 4GP9A 1V5EA 3F6BX 3AHFA 2Q5LA 3HYLA 2WVAA 3FLMA 2XTAA 3DV0A 1V11B 4XEUA 1MCZA 4K9KA 3EXFA 2EZ9A 4FEEA 1X7WB 5K3SA 4FEGA 1UM9B 3ZHUA 5C4IA 3AHCA 1V1RA 4GPEA 4MPRA 1U5BB 3EXEB 5IMSA 3M6LA 2BFEB 3EY9A 3EXIA 3OE1A 1POWA 1TKAA 4D5GA 1UMCB 4ZP1A 1R9JA 2VK8A 2OZLB 1NGSA 4MPJA 1YNOA 2FWNA 3DVAB 3FZNA 1OVMA 2BP7A 2VBFA 3DUFB 1UMDA 3AHDA 4GM1A 2JLCA 1OZGA 4KGDA 4GM0A 4C7VA 2EZ8A 2UZ1A 2QTCA 2BFBA 2G28A 3LQ4A 1AY0A 2R8PA 2J9FA 4MQ5A 1UMBB 1X7YA 3JU3A 2Q5OA
chains in the Genus database with same CATH superfamily
5JMOA 1ZD3A 4LYEA 3BDVA 2FI1A 4PCLA 3UT5B 5C5CA 3QK7A 1N5RA 3KELA 1G1AA 5FWNA 4UXIA 3VYTB 3B48A 2V54A 1JR3D 5DGCA 3CJTA 5CK5A 3HPQA 4F3YA 1H2RS 4E2YA 2MJLA 1BVYF 1JFFB 1FNCA 2VK2A 2YWFA 1DCKA 1V7ZA 4NVRA 4BVEA 1JN0A 3NTQA 1P29A 1N2IA 1SIUA 2VJLA 2E48A 4I4LA 2XLBA 3GJTA 4ZDIA 5L95A 4RXMA 2VP9A 2QE6A 4W8GA 4A15A 4IQGA 1T0HB 3ORHA 1PZXA 2ORIA 3K6SB 2O2EA 1NJ8A 3WWPA 2J5RA 2A9VA 2QZJA 5IXJA 2Q5HA 4LK2A 4IH1A 4RFVA 1K98A 3FYUC 4JD5A 3D8NA 4RIIA 3ZV3A 5BR4A 4W5QA 3HCAA 5AESA 3HM2A 3GFVA 3GVXA 3ZGVA 4E4RA 1UBGA 2H18A 1R0LA 4LV5B 3VMFA 4B6RA 5J9FA 4C2BA 2D0PB 3U3MA 3AVYA 5B6PA 1XZMA 2B1QA 4QQ8A 4CUKA 3K1AA 4C6HA 5F78A 5A05A 1SVUA 2HA6A 3G7UA 1DEAA 2GLUA 4MW0A 1GAJA 4OLFA 1ZUIA 4LWPA 5DO9A 4HDQB 5G1PA 1VPEA 1XRSB 4BATA 4BUZA 1J22A 1WZIA 5ALSA 3IVAA 3OFVA 1JBQA 2JF0A 1XZGA 1AKVA 2KWIA 1G16A 2PYZA 4GOKA 3JSXA 4R2IA 2ROQA 1STOA 1H2YA 2IZ0A 1K0UA 2O1SA 2MU1A 3CLKA 3PGXA 1O6FA 3LUDA 5MGNA 5LC1A 3NNNA 2HRZA 1FFYA 4U2GA 3D4NA 4E6EA 1VMAA 2IUYA 1ACLA 5A0VA 1YHZA 4DMKA 4EY3A 4EJ6A 4AWAA 3Q3CA 4PYNA 2ZYAA 3O8OB 4ZOLF 1VJ0A 2AFIE 7REQB 1GGKA 1VCOA 1DJNA 2VOEA 4LQ4A 1PG5A 4PW0A 5SICE 5AW0A 4FMCF 3KKLA 5K03A 1B74A 1P4JA 3F97A 3CRQA 1E1QD 3N2GB 1A1VA 1OBCA 1GY8A 2OM6A 1DC5A 1CF9A 1IRIA 1NBME 2CMHA 2CNDA 3HN2A 5FA5A 3VPXA 3KYDA 3AFGA 3NVDA 2AI2A 4DA9A 3JQDA 4EKEA 1FNDA 3G7NA 4NYMQ 3TZHA 2P40A 2ORWA 5IABA 5D2CA 1HNXB 4JUDX 1Y4DE 3BK1A 1XX6A 4IJQA 5TS2A 4KI7A 5HIKA 4JVLA 3J80A 2JIDA 4YONB 1Z0DA 1HWYA 4BJ3A 1PL6A 3S1AA 5A5GA 1TJ4A 5LYYA 3MRSA 4CMBA 3I64A 2IHBA 2CLOB 4NE9A 4B75A 4DR5B 4CUZA 5CVCA 5JT1A 3U4DA 1QVVA 2QTNA 3H7AA 5BOSA 1TUGA 1XRQA 5FUVA 3QFCA 2OV2A 3GUUA 1E60A 2V7PA 3HCWA 3I83A 3NH9A 2ZJBA 4HWOA 4OL9A 3STWA 5ITZB 1XO1A 4ARBA 3EGXA 3UJNA 5L4NA 1XJ5A 1S3FA 1EFRD 1FTGA 4P5PA 3K2IA 3ABIA 1M2HA 3DKKA 2XMZA 4RDIA 1KU6A 1PO7A 1QTIA 3JVVA 1DZIA 3CW2A 2Z2XA 4TRJA 5C8YA 2C77A 4RPJA 4O25A 1AB5A 2VJCA 1ADJA 1CZKA 4O2RA 1O89A 1Q22A 4GRAA 2IC5A 2ZIZA 2EJBA 1AQYA 3NIBA 4IJ6A 4JHXA 4R40A 4B35A 4V3CA 5BQ3A 3ETDA 4Y2VA 3O3OB 2A9FA 2GPAA 2VDJA 2YUIA 4GECA 4W1SA 3T3GA 5AYVA 1I4EB 1ZMTA 3ZJ4A 2X23A 1IZ8A 1GJRA 1P9WA 2EGHA 2REQA 3PUWA 1WMFA 4NBWA 4RHFA 5HQ3B 5JTUA 2O06A 1DS6A 3E9CA 3VC1A 1CJTC 1JH9A 2BFBB 4YJFB 1W75A 3SQLA 5HE9A 4N7MA 1BGVA 2FSVA 3EDYA 4M9QA 1EFLA 1G7CA 2QNIA 2VDPB 3D6TB 3UMJA 1LI4A 4RTKA 2D2FA 1E2GA 2PX4A 1NNEA 1U7DA 1N8NA 1W1WA 2B83A 2CY0A 2HUNA 4B6EA 1QKJA 3H16A 5T3YA 4N41A 4LHVA 1Y7PA 4TS4A 1XZPA 2Y67A 4TL7A 2LW7A 4YCDA 1C4KA 3FFXA 3MUNA 3QF4B 3SZGA 5HHTA 1Y9ZA 2FPPA 2L42A 3INNA 3WOHA 5E3HA 2WZCA 3R8FA 4L9RA 1XEXB 3I8OA 2KLBA 3NHWA 3NLLA 3HNOA 1C3OB 1L5RA 2B4KA 4PX2A 4RJJA 2LZ0A 5FRDA 1M33A 2FR8A 2SKEA 2ZJFA 4QTTB 4RM3A 1V7PC 1CY8A 3BIOA 1FU7A 1O54A 2GJ9A 1XIVA 2O3RA 3EIEA 4KEAA 3VO1A 4YXWD 1CHNA 3MFQA 4PF1A 4RYLA 4TTJA 5IG2A 3DZIA 5JROA 1HE8B 4NBRA 1S8NA 2BFWA 2D3TA 3E9RA 1JYEA 4ITRC 1IWOA 1P4HA 1ULBA 5J2TB 5KYXA 1DMRA 1CUDA 3IV6A 4JJAA 2R60A 5HF9A 2YJNA 1OROA 5ALQA 3PQFA 1CJMA 5J40A 2NZVG 3QVTA 2EIXA 5J5AA 2O2SA 5CIWA 1RYMA 1VRCA 5CDTA 1VL6A 1T9BA 1YCDA 4JQCA 3L7NA 2QD2A 4RENA 2GKGA 3SHWA 1TE2A 3DEAA 1M8GA 3ESZA 4KCGA 3WGUA 4EG3A 4Z53A 2Q3EA 3TBHA 4K6CA 1L4YA 3K35A 5A4AA 2IBSA 2PQ0A 4Q1EA 2FZLA 5ALUA 4OXKA 2ARKA 2VTVA 1NASA 1H2AS 2CUNA 3ZH9B 4BV2A 1VA4A 1OAKA 2BGIA 3JQ6A 3LO8A 3BIFA 4MRMA 3OOWA 3UQZA 4CDRA 1VTKA 5FV7A 4UM5A 4LF6B 1TM5E 4G5RA 2GTHA 3BMQB 3JD3A 5KWSA 1RM3A 1W6UA 1SCIA 4M9XA 5GV7A 1R64A 3R9XA 3U0BA 1C41A 2P9TA 4DDTA 2HRQA 1YZTA 4MUBA 4DUPA 2IL1A 4KSBA 1N8TA 1SCJA 3ZWNA 1WEKA 2NU9A 2Z5VA 3LXXA 1MFZA 4G37A 4B7CA 3AVXA 2JPDA 1T0PA 3DSRA 4WK4B 3RD5A 4ACAA 3DL7A 1C7RA 2XAUA 1KIMA 1DV2A 4HTFB 4FKMA 5LOVA 2HSGA 1UZAA 3B1WA 3H5WA 4JBXA 3K0SA 1G98A 3V1TC 3FTPA 3L7DA 4MWCA 3WGNA 2HM7A 2R7LA 3ZDFA 3T1OA 3L7BA 2JGRA 2JIOA 2VRWA 4LI0A 4BO5A 2IEBA 1QRDA 5A3VA 2O23A 4KR2A 1NJ5A 4OSEA 1U4OA 3L0DA 1MABA 3QIAA 4BN0A 3I4CA 2O4CA 2O1XA 2YH2A 3BGDA 1L5VA 1YUMA 1IEXA 4R7GA 4JK3A 4UVHA 5F9MA 4DDVA 3L4KA 2B8NA 2GM4A 1WY5A 4DHEA 5EIXA 4JQSA 2VUHB 5HXAA 4Q7KA 2JKVA 1HQYE 3K4PA 2OZPA 5I8WA 1CIJA 1RXUA 2BKLA 1W2GA 2K6GA 2PRSA 2WM8A 2FN8A 3GD7A 4CM1A 2C57A 2ZT8A 4TV8A 3TJZA 1JQBA 1EFVA 1R66A 2AJTA 2PMCA 4MW2A 4RL6A 3WZ2A 3DOUA 4CLRB 4IOLA 1XL1A 2E4AA 3NHPA 4GVXA 4XI9A 3WA6A 1LEHA 1T43A 2XUHA 3GFBA 5GJCA 5BW4A 2VRCD 1RSZA 1IDN1 2F90A 3DULA 4IEIA 2HB6A 3KJNA 1GRQA 2RAUA 3ZIDA 3EYAA 3KB1A 2F1HA 3Q15C 1KEUA 5DBIA 2XRZA 3PZBA 5LBIA 1J7KA 5A4DA 1HFKA 2R65A 3CG4A 2IOFK 4LXYA 3UXEA 4CEJA 4EI2A 1X9HA 5JEEA 1YZQA 4Z7QB 1JT2A 1H3FA 3MLBA 3AM3A 5SZKB 4AUNA 1PRYA 3OO0A 2YFYA 3DXYA 2COKA 5JQGF 3IHTA 1I4DD 1AOXA 1KI3A 4EUHA 3H65A 1P7VA 1AM4D 4Q4JA 4HQFA 2XKBA 1A4XA 2B5OA 1CUCA 1HYQA 1UDRA 2PR2A 4J7CA 1GQQA 2HMSA 2UZAA 3MZ0A 2ACEA 821PA 2HBRA 2C31A 3FF4A 4X1YB 3MJHA 4COKA 1XRNA 5JE8A 1NATA 4NPAA 3SBOA 1ZR4A 3FLAA 4IKOA 2HMTA 1Y3IA 4L07A 3F78A 1IQUA 1XA4A 3HM9A 2P27A 3EG5A 3CR3C 2GNOA 5AVUA 1SB8A 1UEJA 1NBEA 2QX9A 3MRXA 4GOJA 4YV0A 4EL0A 1I3LA 3P71T 1YOVB 3H3FA 4LI3X 4L3WA 1BQEA 2I7DA 4QYIB 6PFKA 1DO0A 2V74B 1S0UA 1P39A 3DE7X 1A1SA 1F6DA 2JHPA 3KLBA 4Q6WA 5TGDA 3UB3A 4F4FA 3HP7A 2GEJA 3AHGA 4YLGA 2OWDA 3EASA 1M2VB 5JPDA 5J43A 1KSGA 1TU0A 3TTYA 4QGFA 4BWFB 4DMFA 5C3MA 8ADHA 3L8DA 1VPTA 1EX1A 2F1RA 1ORHA 1WXDA 2IGBA 2P2NA 2QE7D 2YRXA 4GM4A 4MKHA 4R2KA 4DDHA 1JIJA 1NVVR 5MN6A 1DG1G 4RMJA 5A71A 1GZ6A 1AE1A 1PFYA 1W19A 2GN4A 2O8NA 3G2IA 3MIZA 4W5RA 2F3RA 3LXRA 1QFMA 1L5SA 4OHRA 5CVJA 4Z7NB 1ZSYA 2VJOA 1E6KA 5ERXA 3FAKA 1KFEB 2OG1A 3LP5A 1GYPA 1ZWLA 5C8XA 2P3SA 1N2JA 4AT1A 1OTHA 2QN7A 5K3FA 5B2FA 4DM7A 1WSAA 4Z8XA 1JMYA 3KAPA 1YAJA 4X8HA 4BFSA 4QXMA 4OH7A 3AEYA 4Y2YA 2X0JA 4Z51A 4XD7A 3IE2A 1VLQA 2PDAA 3CZCA 1ZJYA 1H5UA 1M1YA 4M0LA 4LZJA 4ROTA 4V0MA 2DVMA 4Y98A 3TKLA 4A0RA 1I1OA 4KACA 4PIPA 3H4VA 2YV3A 2QVYX 4U7DA 3BWVA 3UJ6A 1SXHA 3KD3A 4BVGA 4B4KA 2EJWA 2A67A 2W00A 1MAHA 1PT8A 3JVUA 4MVJA 4AMGA 5B12A 1DRUA 2PXCA 4X85A 3BQMB 3D4BA 4TWIA 1L5KA 2C4UA 3G9QA 4XWGA 5ARDA 5C5IA 1E3EA 1GFWA 1IPEA 2W6MA 3AI7A 3O8QB 3OEHD 4MCIA 4ZVQA 2BFFA 3EBLA 3NXSA 4UNPA 3V5NA 3K30A 2XNDD 3BGOS 5K6RA 5CFNA 1ADYA 2PAAA 2HIHA 5K0BA 2BFAA 5F64A 4AS1A 2GFQA 2HXGA 1XRJA 3CRZA 3L6BA 1NPDA 1N5JA 1N2CB 1KDVA 1VYHA 1XTBA 3CA8A 2AC2A 3O8BA 4B87A 3FLMA 3PEYA 2OBFA 4RWEA 1ILWA 3ZY4A 3VH3A 4GC9A 3W9UA 5AJTA 1KI9A 1DOZA 3BRQA 1U8AA 1J0BA 3GUCA 4OJTA 2ZJ0A 4NMMA 1VL8A 3KYCB 4HS4A 1LDYA 3CRNA 2RJNA 3DMYA 5E0KB 3TLGB 3ZE6A 4BKUA 2Z95A 1UKBA 2P6UA 1SK9A 4U7HA 3SDZA 5F9FA 1ZD4A 4KAJA 1GARA 3SJZA 1LFAA 1SXJB 4NY1A 3V8EA 4C7JA 1IWPB 1E6EA 1XU4A 3PDIB 4TTAA 3SYNA 3TGWA 1W44A 1TTHA 1FLVA 1ISGA 5E6SB 4C0XA 4BY9E 2NUAA 3E3MA 2IIPA 4Y7DA 3ZDRA 4TMFA 2FJ0A 2YCLA 1BXRB 2A1UA 2G1KA 3RO7A 3VZBA 2JH8A 3N3BC 3V4RA 4B8WA 1C4XA 2Q0QA 1Z4PX 1A5ZA 1BRMA 1NX9A 4TMYA 3ZE7A 4EKDA 5BNTA 1HFJA 3JATB 3LFUA 4E70A 5IMSA 3WLHA 4X91A 4RY9A 4RCYA 3GZNA 4QPDA 5AW5A 5ED4A 3T6KA 4BYMA 1U5CA 2QDXA 1DNPA 1HEYA 2C98A 2C59A 2DOKA 3W5UA 1KJYA 2RD2A 4KNWA 1KAHA 4J43A 3SVTA 2KLHA 4V0LA 4B31A 2HF8A 1XNRB 4ZI5A 1M8PA 2IPLA 1XZBA 2UV8A 4AJJA 2ZR8A 4JZYA 4PX5A 2PLFA 5JCJD 4UHEA 2H92A 1VE6A 2G7ZA 2GQ0A 2Y0BA 4F0JA 2XIJA 4MEAA 3V1KA 3PGKA 4MW5A 3REQB 3SE0A 5KC8A 2WV9A 5SY6A 3DMNA 1TJYA 1Z22A 2NU7B 4GDFA 1OWMA 3QQPA 5H5JA 4BZPA 2RB5A 1RABA 3DQQA 2LKDA 4OA8A 3AZQA 2RHRA 2Q49A 2VF2A 1C8KA 2NTVA 3QSYA 1FW6A 5KHLB 2ZWOA 5FL7D 4LRXA 4X93A 4B2LA 1I3NA 2UZ1A 4BBZA 2V7EA 4OV6B 2AV6A 3PNYA 4EFNA 3DOFA 4EGCB 4K0KB 2AF4C 3OT1A 2JD1A 1FLAA 2P4EA 4JC0A 5J2UA 4KGXA 2BFPA 3OE4A 5JHGB 2FE4A 2ZP1A 4P7JA 4BX3A 5JJBA 2QGNA 2E18A 3KTAA 4LZLA 4Z9FA 1AJEA 3KP1A 1HT1E 2H08A 5EEGA 1M67A 1VGRA 4J1SA 3E03A 1NA5A 1QC5A 4TTTS 5H80A 4PSCA 2DR0A 2ID9A 4JT9A 1SGWA 1K66A 2J9XB 3TVYA 1N0VC 3CUUA 3GRVA 3A9RA 4ZOBA 3ZCPA 1WBBA 3LKVA 1I8TA 4D43A 1Z0IA 3HCFA 4PYIA 1QB8A 3NO4A 1C1DB 2VTDA 1BXKA 3OTQA 4LXXA 2I4LA 3IAUA 5KNBD 3HXMA 5LXTB 1E3WA 4I2VA 4H1UA 2QVXX 4MRRA 4R2WA 4J0JA 3LPCA 3V97A 1P33A 4PS0A 4OAOA 3E9QA 3RSZA 3O4JA 3DLCA 3GF4A 1JU3A 2O2YA 3MTIA 1CRZA 2DULA 4OQQA 3MQ2A 2I3ZA 3KJEA 3QFSA 3Q87B 3VBCA 4BNFA 3V4PB 4ZI7B 4ZFNA 4OQFA 4NARA 2PBLA 1GZUA 3HJAA 2XEXA 3BMOA 3UGKA 1IN6A 2CXQA 1ZIDA 2W6IA 3GO4A 4ZHSA 4XQ0A 4U2KA 3Q3VA 1TLTA 4MH0R 3F73A 1FS5A 1G2OA 3M8KA 4ZT6A 4UAGA 2R6GA 2Y6UA 4C7XA 1KC1A 3LSTA 1RYBA 5CVVA 2OQVA 1T36B 2DFLA 3A1NA 1WUKS 1ECCA 1WCIA 2AXQA 3WWOA 2VPXA 1DHTA 1ZJ5A 4F2HA 5BWBA 1PT7A 2VA9A 3FRIA 4AG6A 2AYXA 1VCMA 1KP2A 1LDEA 1ATIA 1JLMA 2JJQA 2QAGB 3EF0A 3OJWA 4HDRA 1M10A 1JECA 1HG0A 3BGIA 1K0FA 5DLEA 1H0RA 3UJ9A 1EBFA 1EXMA 1WBDA 4O3MA 2AXPA 3OESA 5JJKA 2NXNA 4HGPA 4Q1VA 2X0DA 2O8BB 4DBZA 2O8EB 4HK4A 4EPXA 1C9DB 3T94A 3D81A 2GNAA 1NLYA 5TGZA 1HDOA 5LP6C 3UENA 4B2PA 5IVHA 4AXBA 3TWOA 3NH6A 1JHMA 5GOZA 3R5JA 4UU1A 2IHUA 5IN5A 3SN6A 3ZDEA 1T5DX 2BI4A 2D0DA 4QHYA 4WXMA 3ZI0A 4MWGA 4B3XA 4RY0A 4RHYA 5FNZA 2P2YA 3EXHC 1TO6A 2PCLA 2FPGA 2EFJA 3E7WA 4TWRA 3K0AA 1B0AA 4M9CA 4U4AA 5AOCA 3VPFA 5BSVA 1F5SA 4PG5A 4IRMA 4NCKA 3R0ZA 1EP9A 1RPJA 2A35A 1BVUA 1C7FA 4FCWA 4WCFC 1ANKA 2PBRA 3HBLA 2I1VB 3P9RA 3RBVA 1JHDA 1JG6A 2OHGA 4F1KA 3E8SA 2P41A 3KG2A 3DUWA 2DPXA 4YCBA 1HM5A 3MWDB 3N5KA 2NMVA 2O8FA 2VUIB 1CCWA 3S5JA 1OX4A 1XVIA 4GD3Q 4DIBA 3QBEA 4QYTA 2KYRA 4DCGA 1H8HA 4EY8A 1ELOA 1HZJA 1OPRA 1W4LA 2DJ5A 2W4QA 2Z9BA 3EGDB 5EWLB 4Y9TA 5CT9A 5FULA 2C5GA 1EFAA 2G36A 4IDPA 5LQDA 4OX9Y 1BOFA 1P4AA 1M1UA 1Y89A 3IUSA 2V8OA 2QV0A 3K1JA 4NHEA 2JAQA 3H9UA 4BKPA 3I23A 1ZK2A 1E64A 5AXAA 1WW3A 2ZROA 3TLBA 4C43A 3ZWCA 1QKKA 1ZHFA 2IY9A 2IYZA 2QSZA 3A7EA 1UJ2A 3B3QA 3B51X 3DAPA 1RBMA 4I2NA 3C4QA 5BYBA 3O8DA 2F3QA 1WLSA 1WUHS 2H1CA 1ZUHA 2P0EA 1TCVA 1GPNA 4FK8A 4HUJA 4P4NA 4U0KA 4RCZA 1JQLB 1USGA 2B5WA 4MYHA 3MG9A 3MMSA 3D1LA 2AOWA 3AV3A 2X58A 2JZOA 2DBYA 3HXTA 4L8LA 1VYVA 1SB9A 3OF3A 3CEMA 5B7QA 1U8UA 4LSMA 5KX5A 1QWOA 4WBNA 3BMNB 2W6NA 3FYCA 4FINA 3VGPA 4BVKA 4YX9A 2SNIE 1RLMA 4QVKA 3AR3A 4DJ5X 2WHQA 2VHYA 5BMVF 5K05A 4F8YA 2NU6A 3AFIA 4P5DA 1MC8A 1X7HA 2PH7A 4LIPD 1A8IA 5GIOE 4UDXX 3IDSA 2DHRA 4P4LA 4IZIA 4JCOA 2ISQA 4OP3A 4BKOA 1WV0A 1AHIA 1B1CA 4I8XA 3DBIA 3AVTA 1C1XA 1WO8A 1E7SA 1Y80A 2QW1A 3A3KA 5AM3A 1Z38A 3EMKA 1GTL1 4TLBA 4MW4A 4B3BA 1K27A 3BF8A 3NTXA 3GJXC 1OILA 4PSAA 3PUVA 2ID4A 1NU6A 3IOYA 3NPAA 4O29A 5E9JA 5AR1A 4A8JB 5JZOA 5H82A 2ZUUA 5IK2A 2BRUC 3W7VA 2NNWB 4G1VA 4E07A 1UJ4A 2ZM6B 3A28A 2O1WA 3P9CA 3RS0A 6LDHA 4JGIA 4M76B 3D8SA 2IZ7A 3IAHA 2WU4A 1EE2A 4GZLA 4EITA 1NJGA 1BE6A 3N8IA 5JVDA 1QFXA 2O2XA 3GZJA 1IXRC 4LY9A 1NBWB 1UFVA 1DJQA 4DR6B 2JI4A 3PNKA 5TE9A 1ECGA 4LISA 4C4XA 3BHNA 4EHAA 4NCAA 4XJVA 5H0IA 2FUG1 3M4YA 3P5BA 3G49A 2QQFA 3HYSA 5J59A 2DPHA 1R9GA 3DMTC 3SM9A 4LQLA 5WRFA 2WU8A 1RXCA 1V4VA 1WG8A 1RBYA 5KOJB 3PGJA 1U0EA 4RGYA 3KQLA 2G3YA 1SVIA 4F45A 3KE9A 3LHFA 3LYLA 3B52X 1RZRA 2O5RA 2XXAB 4ERNA 3JASB 3RLIA 5DTRA 1FMTA 2ON6A 1PIWA 3COWA 3ZWQA 4E5PA 4YT8A 2WA1A 4PHFA 3FHLA 3PENA 3ADKA 1M34B 2WD7B 3LT0A 4W63A 3M6AA 4IIXA 4P32A 5K0CA 2E21A 2EP8A 4WZZA 2F17A 3RAGA 3AI1A 1WXHA 5KO2A 3KR1A 1GP2A 3N0WA 3U3RA 4MW9A 1P72A 1U2DC 3L1JA 5HRUA 2GFIA 3GBVA 1Q20A 4PWZA 2LIPA 4AS3A 3VH1A 1O0CA 3VBEA 2WF7A 5B36A 2FKAA 4YP5A 4HDNB 1YL6A 3A2KA 5DVZA 1U2RA 3S7TA 1E3IA 2AFHE 2FCRA 4RVOA 4W99A 2RE8A 2NPOA 3PC2A 3RV4A 4CKWB 1EFKA 1USKA 1QIKA 4CZ2A 2BKUA 2H06A 3ZOKA 3I3SR 1RI1A 4RA6B 1DMSA 4J29A 2Y66A 1EVEA 2WYVA 4D4IA 5K09A 4OGWA 3NKVA 1I13A 1QOPB 1MBZA 1OZHA 1KDZA 1ZRNA 3DJYA 1SD1A 3OE7A 5DM1A 5ALDA 1OH7A 2AKEA 4I4NA 2JD0A 3BWYA 3IESA 1YCHA 1JJAA 2H52A 3FD8A 2NUTB 4WUVA 4DRXB 1LRJA 2WIAA 2GAFA 4CL2A 5KKNB 1BFKA 5IFLA 3LX4A 4PPQA 2ZKLA 3LDUA 4QNNA 3J81A 3AGQA 4ZPXA 1FLDA 2BR5A 4BNYA 2G5PA 4JLWA 2Q1TA 2Z5LA 3K09A 1OGYA 2CEKA 3K73O 3LK6A 3QX9A 3T5BA 4PBRA 1KWKA 3FI9A 3SG0A 4Q9LA 2H1RA 3SC2A 2Z6AA 4PG6A 1VYUA 5KYWA 3WGYA 1YR6A 2Y1OA 1W85B 4MK4A 5KTRA 4JXXA 2GCEA 3HVUA 2CN1A 1PVDA 4QBTA 1JW9B 1NN0A 3FZGA 4TLLB 2JA1A 3N8DA 4FOSA 3UCXA 3NM4A 4B9EA 5CDHA 1RYEA 3UFXA 1M7BA 2P7IA 3WE7A 1JDPA 2WF8A 3WBJA 1UT8A 2B99A 2H5LA 3A2NA 4N3NA 2EAUA 3V7NA 3ME5A 4K6KA 4RPGA 4HX2A 4UEWA 3LBNA 1H1DA 5L7YA 4IX1A 2ZYIA 5I5GA 1TA0A 2Q5JA 3IP3A 1EWVA 1QOZA 2FF7A 3K1YA 3P9KA 1RJWA 5D85A 3JQFA 3M5WA 4KOEC 4YI3A 1GADO 1D5WA 1P61B 1XJQA 3B70A 2XB8A 2NSYA 4RK5A 3UXYA 3QWAA 1Z06A 1D2EA 1U0OC 1W36D 3NAZA 4TVSA 3BDAA 1Z74A 1F48A 2FMIA 2W8BA 4U2BA 3EBPA 3ZE2B 2LUOA 1DAHA 2H51A 1Y6FA 5H81A 2KBFA 4PPYA 1UAAA 3GPCA 1L5YA 4MP3A 1WXIA 1QB7A 4B4DA 1U5AA 3DOOA 1K9VF 4DYHA 3WP1B 3L2OB 5HDQA 3ZK9A 1G1MA 1P7PA 4CU2A 1UKEA 1JEDA 1EWKA 2V6BA 4N82A 2CDBA 1GLGA 3VVMA 4UTVA 3IDZA 1YR7A 3QTTA 3LPDA 2VPZA 1KJWA 2WQZA 3EMDA 4LHZA 1EGAA 3NTUA 2OA0A 4QOFA 1E5XA 3OZTA 1IXYA 1KO4A 3OM0A 5BUSA 2C03A 1QZ3A 1KU0A 3U09A 3AEUB 3WRYA 1NJ2A 1CY4A 1ONBA 2PVSA 3DOCA 2XKJE 3MGGA 3R76A 3WKAA 3W9SA 1P2DA 2BTEA 1G9TA 3ZLUA 2IHNA 4P08A 1RAHA 2YX1A 3G0GA 4BASA 2VZEA 4W5OA 4LYJA 3A10A 1N2ZA 4NHOA 1F1BA 1OBHA 2DWOA 2YHBA 2YV4A 4X20B 3CTMA 4YCMA 4MCAA 1XVAA 3NCTA 4PGGA 3SAJA 4H7HA 1PS9A 1U1FA 3UM9A 3MINB 3TZEA 3C7AA 3VZQA 1NOIA 3MBKA 4M0PA 3DLBA 4CMEA 1C0KA 5IF3A 5A3JA 2BKAA 3PUXA 3R1IA 1K7SN 2PPVA 3GRYA 3WRWA 5BNWA 1XD2A 3VDNB 3MB5A 1RCUA 1WXFA 1H5QA 2FYTA 3HUDA 2QZZA 4NEGA 3WG9A 2I4NA 5CFPA 3HUTA 1Y3FE 1SBCA 2WIBA 1VJTA 4HRVA 3NIGB 1EFUA 4RPIA 5ILGA 4LHSA 5KYYA 1JZTA 4DCSA 4EJMA 2I5PO 4PO8A 1RJFA 2G0AA 4FNAA 5FI3A 4ETWA 2CJFA 3W9YA 2ONKA 4I99A 4DB4A 1OJLA 4R8LA 3ZTWA 5H3LA 1HZZC 4LOKA 3KU1A 1MH9A 1WBJB 1XXLA 2NV2B 4INZA 3EQ7A 4U8HA 1BH6A 2ZGVA 1GRNA 3R7SA 1F2TB 1PLJA 2AN1A 2AR9A 2FEKA 3G68A 2B69A 4PSVA 3LKDA 3RVKA 3LRTA 3WX0A 5JQWA 5KTTA 3BB3A 4RNCA 5JBQA 1T5IA 4OMUA 3JSAA 4KFTA 1K2VN 1TZ2A 2XGMA 3IALA 1OXUA 5GJWC 2ZUWA 1KAMA 4ME6A 2M2IA 3PL1A 5IVKA 2NUPA 4BFWA 4PX3A 2ECFA 3TAUA 3G2MA 4IWYA 1XA3A 2A84A 1W88B 1G21E 2VDUE 2BFDB 4GBED 1FP6A 2QUAA 2ZRKA 1U3WA 5EL0A 2A0WA 4BNWA 1CG6A 3LZCA 5LUAA 1FYFA 1CVIA 2ZJ8A 4BJHB 1NLZA 2Z2JA 2NX2A 2H11A 4R2LA 2D1QA 4FE4A 4PN3A 3SWWA 5IWAB 1JSLA 1DBRA 4RD1A 2XDAA 4UJ3A 2WICA 2BN4A 2X1MA 1RADA 2BE7A 3DLIA 1PG2A 3QIVA 4ANFA 3TGPA 4EF6A 2YR0A 1FYDA 1N0IA 4I6GA 4OK5A 3RAJA 4B40A 4DCVA 1KVTA 1ML3A 1P4RA 2NXCA 3GNQA 7YASA 5D84A 3OIYA 1N6IA 1S2IA 1N75A 3DEJA 5A1JA 4Z54A 1PFWA 1YULA 2JHCA 2Q3LA 2YV5A 3W4JA 3ZK8A 1IRXA 2XNSA 3L7KA 2C4TA 2QTVA 3QOXA 4LMAA 1V2GA 1Z56C 1ND6A 5AKIA 5EKUA 5FYQA 1XKQA 5DH9A 5KWJA 4OBEA 4BE4A 5LDHA 3QOYA 1Z4MA 3C97A 1MW8X 1V11B 3DBOB 1J0CA 2FPXA 3N39C 3UNXA 1U8XX 1P19A 3I09A 2BM0A 4XVQA 1AKRA 1TM4E 4RZ2A 5BW6B 1LPMA 4O2LA 4WRRA 5LMNB 3I5UA 3AQIA 2DPMA 2W0SA 2J0EA 3NTOA 1U7HA 1SUBA 3PQCA 1XRLA 4QGAA 1X86B 1T8UA 2XF2A 5HK9A 2IYTA 1MEJA 1D8AA 1PDVA 3FUVA 1YZGA 1XFDA 1HH4A 3C0KA 1JWBB 3GEBA 2JFNA 4M8NE 1EDBA 2R7KA 3LSYA 3C8MA 3V46A 1TAGA 1ZX1A 1G7RA 3QUAA 1CEXA 2EDAA 2C88A 2HO4A 3KR9A 1DC3A 4CM9A 5FOQA 4BP8A 1WDWB 1K2WA 2XUGA 1XJ0A 3S1LA 1Y3CE 4DZTA 5DULA 5IDVA 1YVUA 4PLFA 1V39A 2Z1MA 4PZDA 2VZ8A 1BW9A 2ONZA 5AKXA 1XRPA 4IICA 1X2EA 4QUIA 1BEZA 2GYYA 2FW9A 2WUGA 3EXEB 4ZVVA 3QEAZ 5HEKA 4LXGA 4RZHA 3MWLA 1ZK3A 2C2XA 2RGYA 2J3EA 5JASA 5F77A 4AG5A 1FYWA 2TMKA 1F8YA 4O4IA 4TVKA 1Y9AA 1XHFA 3NVMB 1FL9A 4IGFA 5FPPA 3RRJA 5CG2A 3F96A 2MT9A 1PGJA 4G5OA 3ZJVA 3CX4A 2MCFA 4NJEB 1R9JA 4TL9A 2DLCX 4LN1A 4XPIA 4GWGA 4EPWA 3U7QB 3VKUA 5K6AC 4FLEA 3SBXA 1WOYA 3OA2A 4PEVA 1Z7GA 4QHTA 4RTSA 2FWNA 4LRYA 2DAPA 5F33A 4TQAA 1B26A 5IULC 1E79A 2C7QA 4OGKA 5HDBB 3VDXA 4OI1A 2Q4EA 4YJDA 2ZTSA 4DQDA 2VWQA 4WXHA 1KVUA 3WXMA 2QIOA 3BTSA 2MSKA 1NVFA 3R0VA 1KZ9A 3JQBA 1JXAA 2ZDQA 5LP1A 1U65A 5C9ZA 5MFZA 2PUWA 3PDHA 2W37A 3JAWB 1AZLA 3KLNA 1F7UA 3AF0A 5HFJA 2EZ8A 1RNLA 2YY6A 3QPDA 4PLPA 4CF4A 3U17A 2A9PA 2HJSA 4W1QA 1B76A 3ASVA 3NT2A 4DVJA 3O74A 3DBRB 2WSMA 1GAQA 1SCAA 1ZNXA 2GJSA 3CW8X 4D9CA 1DO8A 3IAAA 4P33A 2GTPA 3W3AD 2YJ5A 3MWEB 1MNQA 3U1TA 4QXOA 3L43A 2EOAA 1HE3A 2M1ZA 2OFOA 4CM4B 4ZK2A 3NVAA 3A6EA 1YB7A 2W22A 3LL7A 3OFND 4DLKA 4QDXA 4CN8A 5H9VA 5A7HA 3MTGA 3T95A 5D7BA 1G5HA 4CTKA 1PEYA 1OFTA 1SHJA 4A2PA 2GPTA 4N01A 1EA7A 4X66B 1K6XA 1Y9EA 4XFKA 3EVBA 2H7VA 2O8DB 1PS8A 5CM2Z 2NLOA 2GRJA 5ALXA 3CO0S 3HK2A 3IULA 4COOA 3VKHA 1B23P 4LNUB 1ZGHA 1ZOOA 3B60A 4MYCA 3AF2A 2G80A 1FOEB 3AUAA 1BFDA 1VKRA 4TTSA 3RFVA 1ZVVA 3OBIA 1G5IA 3URKA 1XUOA 4MQ4A 3T5GA 4UPEA 5E6RA 2Q9UA 3HQ4O 3KD2A 1KDTA 2XD4A 3BH7A 4BNUA 1FMFA 2Q9BA 1S2OA 2ODEA 4JJIA 1FEZA 4XYGA 1E1CA 3SDBA 3T34A 5FV4A 1OZ0A 1UXIA 2WVGA 5GVRA 3ILXA 3S2FA 3QVGB 6NULA 4BMNA 3FOWA 1J90A 3GK3A 4J0CA 1X1RA 3PZRA 1FX1A 2Z57A 3JQAD 1XVLA 1ZBDA 2PXHA 1FJ2A 3UUEA 1RP1A 3V80A 4CIXA 1SHTX 4EYGA 4CIWA 2B6HA 2WK1A 2XT9A 4PSDA 4AJPA 4RVFA 4B3RB 5MDHA 2WKWA 4YMWA 4LFBB 2B1IA 1KY2A 4MDEA 1JE0A 2RK6A 5IBRA 4GOMD 4I1PA 1J2EA 5I01A 1F2UA 1MGPA 3TQQA 2C9DA 4P3YA 2QVGA 1D2GA 4OB6A 3NYRA 4CM8A 4LJ9A 4H17A 3L5KA 4QFMA 4HKTA 3SYRA 2ZB7A 5B1YA 5GZ1A 1QP0A 3OICA 1DAFA 3NAQA 4YRQA 1Z7EA 5LJLA 1FTSA 4KPEC 4OHFA 3IEMA 2DXIA 1GTRA 5FJJA 5AM0A 1KEVA 3HUFA 4GH5A 4DW8A 1U28A 5KNDD 2FG7C 3BXXA 1N6RA 1UEXC 1ABBA 4Q4CA 4N3GA 5TPWB 2VR1A 1E3SA 3FPAA 3VV3A 1ESCA 1LGYA 2DUJA 1U99A 3CR7A 1Z8DA 3CFYA 3IUPA 2AZTA 1ECFA 2H48A 3ECCA 9LDTA 1EX6A 3RANA 1G3MA 1AKEA 2FG5A 2OXRA 2Z0MA 3M49A 5CVDA 2K87A 4J9VA 1D4FA 1L2TA 3WC4A 1HA3A 3VOSA 2IKSA 4MI3A 2VNKA 1GSIA 2OO7A 2FOIA 3KVOA 5DBGA 5SY9A 3D3WB 5HM8A 1UQUA 2IPNA 3USZA 5JEDA 4CM7A 1GA4A 4MWDA 3WJ7A 1K5GA 3VHXB 4FKZA 3ZZ1A 1JNXX 1I3OA 1UJ5A 2CLFB 1NUAA 2A59A 3FVQA 2ZSJA 4XCQA 3UGTA 5ERGB 1FFXA 2ECPA 4FWIB 4MRPA 5EI5A 5DLQC 3EF3A 4D9NA 4UMVA 4ZCPA 1CDEA 3ZX4A 2X6RA 1WD5A 2R79A 2NAPA 3FBTA 2VLBA 3MHPA 1QHXA 3JAMA 3LY5A 3RYHB 1RHQA 2OFWA 3A04A 3EZYA 4DADA 1RAGA 4XGQA 1ARZA 1DKNA 1FSSA 4DWJA 4ZMRA 1YO6A 4R3WA 4MUEA 1LK5A 3EHEA 1YFZA 3BJZA 3C7TA 3Q0IA 3H9CA 2PKXA 2VDKB 3L1KA 1THZA 2D13A 2ZSBA 4MTCA 1M54A 4E33A 3ICOA 2P4QA 4FFSA 2MSWA 2WWIA 4NPHA 4XH9B 4CG1A 4R5HA 4O6VA 3O5AA 5B2ZA 1V5IA 2J0UB 5EIBC 3ZHZA 4M1ZA 4I6EA 1ODJA 5E95A 5A7FA 3PUHA 4LF9B 1U90A 3PRKE 4FB5A 3RRNA 1UBFA 3N9IA 4G84A 4QTUB 1G20E 3G0OA 2PLRA 4ZI2A 1YE8A 3B1XA 3W79A 4A8PA 1QIHA 3OX1A 1SKMA 4Q19A 1LC3A 1L4GA 1ID8A 2F7SA 1UMDB 4FPXA 4F6RB 4UBJA 2BJVA 3OPQA 5FKJA 2E5FA 1QX4A 4KXFB 4OBBA 5JAMA 3CH6A 3RLFA 1YDFA 3CUVA 2FEPA 4HNRA 2TECE 4CTMA 4YEDA 3F49S 2KM1A 3ZXXA 3QXGA 1EVQA 3GLIB 3SSAA 3JQAB 4PNPA 1QGAA 5I7AA 4LUCA 4O5AA 2G08A 4QO7A 1F60A 4MXDA 3AVPA 3VISA 5JC1A 1MB0A 1WEHA 5CCDA 4B34A 4GGPA 1PSZA 3TK1A 4DPKA 1ZAYA 2EX0A 2X76A 3SEFA 1UMBA 2V97A 1GD1O 3KX2A 5EINA 2ZAGA 3PC4A 2WSLA 4N12A 2IZ5A 2W8ZA 5KJ1A 2JI6A 4Y6SA 4DIEA 3AESB 1NKSA 2OCPA 2PMKA 4H1HA 5TC4A 5IH7A 2WWFA 4JKOA 1VOTA 1P3DA 3IKJA 1ZEMA 1G8AA 3P2MA 4G5GA 4P2GA 3MJFA 3WGJA 4EBFA 1GNPA 5E1BA 3BJEA 5EXPA 4YAOA 2FQWA 1Z15A 4CR8A 4YO8A 5H1YA 4MGHA 4U3JB 1KAOA 3JQ9A 4RKFA 2X4LA 4FIZA 3TQSA 2BEVB 1V9CA 3TOCA 1T9AA 1Z4NA 1CUWA 5C5EA 4QOEA 1RI3A 3TG2A 1LSJA 3NHAA 4GEGA 4HDCA 3T5MA 1ADGA 3D2CA 4L74A 4HVTA 5DTEA 1CUHA 4RSGA 1KWGA 1NXQA 1OD6A 2QM0A 2COUA 4EI7A 1XZNA 4P9NA 2MYTA 2YDXA 1ZQ1A 3AR9A 3T7EA 2X5NA 4QYMA 4ALLA 2SCUB 3E4CA 1J49A 1RRVA 5IN4A 5HJ2A 3VVLA 3EGOA 3KV1A 4PZUA 4HBGA 1DG3A 3T06B 3UG7A 4OXRA 1O0BA 1GTSA 2HHHB 2QUJA 1NI4A 1GPYA 1Y7IA 1L7VC 2BELA 2D2EA 3C8HA 3Q7IA 4MW7A 5AHKA 1RXYA 3RVDA 4ESEA 2ADMA 2ZS8A 1NUUA 1Z2EA 2A88A 2BBOA 2VLIA 4HL6A 4K05A 2QA5A 4PO3X 2WWHA 3T3PB 4DQUA 3SNHA 5CFOA 8ATCA 5KOHB 1RMTA 5IBPA 4EO4A 3EC2A 3LFTA 4XYEA 1YDWA 4MNTA 1E98A 1LI5A 2RKOA 5CVUA 5JY6A 5AVXA 1BA2A 3DC7A 1VSQA 2NU8A 1IFXA 2Z2YA 4PY2A 2YV2A 3TRHA 2R8OA 5IARA 5CFZA 2WHXA 3AEXA 3A70A 3D6JA 2K2QB 1W30A 1IH8A 2C5HA 2M6LA 2Q7DA 1MX9A 4GFDA 3H5AA 4D0NA 2GEDA 2A1IA 4PQEA 1G0OA 4F3TA 1UBOS 4YROA 5BXYA 3G13A 4M46A 4Z0TA 4B81A 3RFCA 5B7PA 2Q9CA 2H4FA 1ZMOA 3FYHA 3TI7A 1ETUA 1J8MF 1S7GA 1GSOA 2VZ0A 4HD8A 5J2TF 3OAAD 4MARA 4DV4B 4IHJB 1MRZA 4JELA 4OXNA 1KIFA 4XIJA 1PW5A 3R3XA 4K46A 4N0DA 4DIDA 5JATA 1RAIA 1AQNA 2CLDX 5ITWA 1A8QA 1HNNA 1VHTA 5D3KA 1TLFA 1AUVA 2J3KA 4L4XA 2ONCA 4MGIR 5JS6A 4KRYA 2GCGA 5KYGA 1S2DA 4R1PA 3NUZA 3O84A 4LHEA 1D8TA 4C0WA 1QAMA 2YRWA 3W5IA 1DBVO 2Q0XA 4ENUA 1SKAA 4LZAA 1MDBA 4Q00A 2WWWA 4AY4A 4F3RA 2VP6A 1A8SA 4ZO4A 4BNHA 1MG5A 1O4VA 1VZ2A 1Q7TA 4PZAA 3C1AA 2VXBA 4W1PA 3U9TA 1JALA 3UJCA 1RJEA 3KSMA 5AJZA 3AKEA 2QTAA 3X1ZA 2HA2A 1DFIA 1GAXA 1DB3A 2C04A 3JQQA 4GE3A 3C43A 4OK3A 3CF4A 1WV1A 3F3MA 4Q37A 3SQMA 3MEQA 1G8KA 3W2HA 1E2JA 2I4RA 5IM4A 2ES4A 2IHTA 5I9BA 2HT1A 5CYGA 3HFRA 4WIAA 1YIAA 1LCIA 1PHRA 5KYKA 1Y5MA 2HMUA 4BRWA 4EHIA 2P69A 3TQHA 1E2UA 3HCNA 3LWDA 3DUFA 2MYUA 3NVKI 2YNMA 2GDJA 3N5CA 1CXZA 4AO8A 1CNMA 3I8SA 4YRZA 1YMVA 2XCRB 1IZYA 4FMDB 1RQLA 1YUBA 1PGOA 1XCLA 1A69A 1L8LA 2O6HA 3A26A 3EOAI 3M82A 2IYVA 4NZYA 2OECA 3EUEA 2Q62A 3MAAC 3PFKA 5P8WA 3RJZA 5JDCA 2W2LA 2H0QA 4GMDA 4F56A 2PQ6A 4PTLA 4KPUB 1MRNA 1PJTA 5JAIA 1EE9A 3VSDA 2UUOA 3DTVD 1W25A 2IIQA 2IU4A 4D1YA 2FWRA 1V8ZA 3R4CA 1RXWA 3GZ4A 1VI5A 2BLNA 2LWIA 2F43B 1WUIS 2AMFA 1LD3A 3ID6C 4KN6A 4QWMA 4WJZA 3ADOA 3RVPA 1GKUB 1PZNA 1EBUA 4L2IB 3TAHA 3RKUA 3UICA 2XBLA 2V59A 1SY7A 3GAZA 3SE7A 4BQFA 1GYQA 3M6MD 1NBAA 5GONB 1OR8A 1ZAKA 3IVXA 3FZEA 2WKRA 3KAKA 1K4KA 1TADA 1FNMA 1ZVQA 2ZJZA 4J94A 4M21A 5TGTA 2DTXA 5A4IS 4P93A 1ODCA 1Y1LA 2ZAOA 4RIGA 2J6BA 4OVKA 4U9IS 4RU1A 1OOEA 2BMDA 4DC0A 3PX7A 3DCJA 4RF3A 4PC7A 2NTNA 1SG6A 2OMKA 3IV7A 3T5CA 3DE5X 3NHBA 2ATCA 4BMCA 4BMPB 3RBZA 4KKVA 3CKKA 2XOEA 4QGBA 4WE3A 5CURA 4EFKA 2HWXA 4CE6A 4JI8B 4R69A 1OXKB 4TLEA 3VPGA 1UEIA 2AFIA 3ETGA 1JQ3A 1VDMA 3BTVA 3GFPA 4KL8S 3F3SA 1E79D 3FWNA 3ZDZB 1HBJA 5FYDA 1ICIA 1OWNA 1JE1A 4HDMA 3CZ9A 3UAOA 3CXUA 1GZ7A 5EE9A 3LQYA 4P3NA 2HZ7A 2HRBA 1PWYE 4NECA 1CFZA 5FLKA 1AKUA 2O6LA 1U7WA 2ZTMA 3IFSA 3T4UA 1VBNA 4ETIA 4ERXA 2CZQA 2FLWA 3L04A 3W6ZA 4HYTA 5IXYA 4Q1AA 1TJ3A 1N9ZA 2I29A 5KTMA 4TZ6A 2IPMA 3QVVA 2JEYA 4QEKA 2RCYA 2ZZMA 1ZH4A 2X9VA 1XDSA 4BGVA 3AERB 2YXNA 3PHCA 4FYMA 4I9HA 4JWKA 4BO3A 3RVNA 2P68A 2Z30A 3W6NA 5KTSA 3R7LA 1YQUA 2HDWA 3IAM6 4XVUA 4H7EA 4LX8A 4P4SB 4EVRA 5TNXA 2IX9A 2JRLA 1AQJA 1YBFA 1TOAA 1REQB 1NKVA 2J3HA 1NVAA 1WNTA 2W43A 2XMBA 4RV4A 1NHGA 2VTBA 1XQWA 5JISA 5JNLA 3IMEA 1RHKA 2KB0A 1AA6A 1JLRA 2UXDB 2J5QA 5DBEX 4IYRA 3TQFA 1GUZA 5D3MB 4HH3C 5JFTA 4YBRA 1JNYA 2YJGA 1CY0A 1EZ1A 5DI3A 3DWEX 1EGHA 1JTVA 4KQKA 3I34X 4TQGA 5CYFA 3VU8A 5CCBA 1LJUA 2DR3A 5BWLA 4YMLA 5LZ9A 3E5MA 4K0RA 4B1FA 2VJPA 2R11A 2WSSD 2REXB 1EXWA 2DE0X 4BFCA 1RLOA 2WP0A 4U2FA 5HKAA 2JJ8A 1N7JA 2O3SA 4Q4HB 5AT1A 1V1RA 3B36A 4IV5A 3DTVB 3NR2A 4PXSA 3O0TA 4KW7A 3CJRA 1QO9A 3KYBA 1PKEA 2ZBGA 2VRNA 2YINC 3MWJA 4WESA 2EG9A 4E22A 2CFSA 2WJAA 1BAPA 2PUJA 4GI2A 3X1WA 2C2YA 2WOOA 3QPVA 1M72A 1I7LA 2YVUA 4WEOA 4DN6A 3T3IA 3JR3A 3OE1A 3RSSA 2WABA 1G59A 1TKAA 1R5OA 3QOFA 4EKYA 1KI2A 3VI3B 1THTA 1FSFA 2N46A 2P7HA 1GLNA 4UTPA 2B9VA 4REQA 4C4ZA 2JLQA 4EMBA 4HAIA 3RAPR 5FWXA 1ENPA 2P75A 1IBKB 5C53B 3OCXA 2PGJA 3I1JA 4O2BF 4JJ6A 4LKOA 3DV9A 4W8OA 3ZQ6A 1QH1B 4ACBA 2FU5C 3FKJA 4WNCA 3UJDA 3EJWA 3KQVA 1KMNA 3KJIA 4YTEA 1EWQA 4Q7MB 1R18A 2BP7A 1F6WA 4RPLA 3V1NA 1DC6A 1ZJJA 3DHYA 1HDEA 2CGEA 4L28A 1PV2A 4GNKA 2F4NA 1M2NA 5IMBA 3OEYA 2QMOA 2E37A 2Y8EA 3C98A 3IAXA 4WY5A 1JHVA 3AM5A 1KETA 3FHTA 2QN8A 4QBHA 5BWOA 2PRKA 3OJ0A 4YUWA 4F4HA 3THXA 2ZYRA 1O9BA 3RHTA 2XZPA 1IN5A 1DBPA 2J3QA 2Q3MA 3E22A 3H0KA 4G65A 3CE6A 3LUGA 1Q0UA 4IDHA 5K0GA 3DD5A 1KDPA 1N2XA 3BWDD 2OUIA 1ZNYA 1P91A 3L8ZA 1E4YA 2ATVA 3LO5A 4OKNA 4X1IB 4Y9SA 4M6WB 1UDAA 2R1TA 3UO8B 2QW0X 3W8FA 3DQPA 3GJ0A 1EWYA 1UJCA 2DPLA 3IOCA 3ZVRA 5JH7A 2HA0A 2ZRLA 4ZVOA 3TTTA 4BEWA 4BZWA 1KYXA 2X4GA 4A2WA 4EMUA 1M6VB 1RR6A 1T6ZA 3A6JA 1LXCA 3DM5A 2QG6A 3KEMA 4MR7A 3RFTA 3X1MA 1WSBA 2VP2A 2F3UA 3U3KA 2YMQA 2A8YA 3PNLA 3ZI4A 4C0BA 4UQLA 1A7UA 4OQXA 4JQOA 3E1GA 1MNAA 2E9SA 2WJIA 5DX1A 1J6UA 4ZVMA 3RF7A 5AVSA 1U0FA 4GSYA 5BR7A 4WEQA 3LAWA 1N6NA 5A6SB 3ZTTA 2P91A 1V3VA 4YAIA 3QI7A 1C9EA 2H1OA 3AJ9A 1SH7A 5JIBA 1TAQA 5DHTA 5HCUA 4CGZA 4LXTA 2PGNA 2YOHA 3B9QA 4Q1CA 1J8FA 1H22A 4NL4H 4QNRA 3VTFA 1TK3A 4PRYA 4CKEA 3W5CA 2DSTA 4BNZA 4KSYA 1UP4A 3QI2A 4DMRA 1RHJA 4AX4A 3PWZA 1KJQA 5EUMA 3G9TA 1Z13A 1M1XB 2YYYA 3KJXA 4GXNA 5K3CA 4Q9HA 4J2HA 4MMZB 5CFLA 5CDUA 4MI6A 5G41A 3BVPA 4RESA 5DFAA 5DXFA 3NJRA 2II6A 1I2MA 2PWYA 4RKRA 5C1IA 1ZLYA 3TG8A 2WHYA 1DOHA 3IR7A 2B37A 1QYVA 1ZCZA 5JZ9A 3K9WA 1CJCA 2LCFA 4KUHA 3ANNA 1S2LA 2JGFA 4UUQA 1LSSA 4PO9A 2G9RA 5CT5A 4LECA 4C0JA 4F04A 2FP4A 3S29A 1NQVA 3C8UA 3PFCA 4M0MA 5IKXA 1WRBA 2Q5FA 5AI6A 4LXIA 3I9V1 1YOBA 2I6XA 2RGDA 4H31A 1BE0A 1TL7C 1YA4A 3OLQA 2ZTUA 1U2EA 1VKNA 1Z6GA 3MUEA 4P4TA 2GSWA 1GXSB 4L85A 4I55B 4BZQA 4Z2AA 3PIDA 4JB8A 5KJCA 1FBTA 4KXQA 4LZZA 5CLJA 1NMZA 3HJGA 3IA7A 3R5KA 3WGKA 4Z1OA 5L7TA 1QPBA 2FPKA 3GEPA 2CNWD 3U3DA 2VJMA 3RFUA 4AKTA 4B3MB 3LUBA 5JV5A 1V6SA 3ICVA 4RKQA 1KAQA 2AW5A 1DFHA 1BWRA 1RXIA 3DBHB 4IQ8A 5B7GA 1UDBA 5BNIA 1KQGA 1Q3TA 3I37X 3HLTA 4H77A 1TQ2A 2NSHA 1F6BA 1D0SA 2A2ZA 2FZGA 2Q2WA 3PVZA 5CYPA 4JEMA 1SCQA 5E0OA 2XLCA 1XZJA 3BSYA 5EVJA 1JFTA 3C3XA 2IQ5A 4BLOA 5AK5A 2CJYA 4DSUA 2E4UA 3MTQA 1O9GA 3AKDA 3PJGA 1LNQA 1TW2A 3KOZA 3S4YA 5I7OA 1H65A 1QIGA 1D5CA 3B5IA 3GVCA 3ER8A 4QA9A 2WP8J 4DMHA 4AFNA 3KZ1E 1G8MA 5E7MA 1UBRS 2PH5A 2BE9A 1D1QA 1FP1D 1TC1A 4CI9A 1KHTA 3CCFA 2DHQA 3QVMA 4DSOA 1SAYA 4ZMSA 2E2WA 1CUFA 13PKA 2W2OA 4UULA 4HLUA 4ED9A 2I0FA 3N58A 4UHCA 4YJ2B 1NP7A 3FVVA 5KTOA 1Y8AA 3S1SA 2OK7A 4FGJA 1M76A 4HQ0A 1G4AE 3M6FA 3WA7A 3F47A 4TTIA 5DNVA 2O7VA 5TT1A 1O97C 4B3GA 1TMYA 2OGWA 3SCZA 5EE3A 5EE0A 3WSVA 2YL2A 1G0NA 1Y7HA 2VFAA 3AILA 1P2BA 3PNVA 2NYRA 1QO0A 1ZW6A 2QU8A 2V6IA 4LDRA 4LHYA 4EA8A 1GPLA 2PO7A 5KNCD 1FRFS 2HSDA 5K4HA 2R6HA 2YIVX 4LVNA 1AHHA 2H2IA 5CLQA 2PSFA 3FTDA 4WOPA 1W1IA 3PQ3A 5ELMA 3OFKA 2AJLI 1T8SA 1TQ6A 2VUSA 5KB3A 2CUKA 4DANA 4B5LA 2O7RA 2JFWA 4GX1A 4LZPA 3R6TA 4PFQA 4NEQA 3GNTA 1U7ZA 5C31A 3VKVA 3V2GA 3ZUPA 2FA9A 2IYWA 4Y1FA 3SFTA 1WXWA 3KSBC 1IZ9A 3H2HA 2WWYA 4ZQEA 3N6RA 3WKDA 5B3KA 4DRZA 4HH1A 2WWTA 1TYZA 4R8KA 5JO0A 2R0QC 3Q3GE 2CSUA 5I4KA 1VIAA 3GRUA 1Q7CA 4IDEA 3EAQA 2X14A 2JK0A 1V8OA 1XT6A 5AH0A 4PS1A 1T9CA 1MB2A 2Z83A 2C3OA 5DTJA 1SXJC 4TYYA 1ZPDA 2PQ2A 2OORC 5EHNA 4WN9A 1CR0A 5ERYA 5KMGA 3ZXYA 3QKRA 3A8TA 2GCPA 3C87A 1GPBA 4RHUA 2WFLB 3HWWA 2UUAB 3NPMA 1DWUA 1O03A 2Q5CA 2RGNA 2P62A 3LF2A 1GGJA 4TSRA 3ZDXB 3CN7A 2PSSA 1VIVA 3UT6A 3L7OA 3KUKA 3H5NA 4BCCA 3RBAA 1OBOA 1CF4A 4KH1A 4F2DA 4R3NA 5IAJA 5BVHB 2CXTA 3ZVKA 4D4KA 3H1GA 3P9YA 5E4YA 4LSZA 4AQ7A 3RVOA 1KK1A 4TMVA 3G5UA 4HSGA 3OF2A 4ZV4A 1BKDR 3M7IA 1KRXA 2JD2A 4F9EA 4KN9S 4NKRA 1MVOA 1NJFA 1OMOA 3OPYI 3D8HA 3D7SA 3R5HA 1XWIA 3GQVA 3BGSA 3HY4A 2PKWA 3HKCB 4Q6BA 4AULA 3ZCQA 3F4KA 3CSUA 3SD7A 1JG2A 1O94D 1DV1A 2DPYA 2Y1DA 5B6JA 2WR8A 1YS9A 2IE0A 1G5RA 2HJHA 3I6IA 4YYEA 3QW4B 4FC7A 3DYIA 1H1LB 5EYPA 4P1ZA 2G76A 3P4UA 2PEZA 3FGNA 3LTNC 2R62A 4MCJA 2XMCA 5TF0A 4YUAA 2IHVA 5ISMA 4I0WB 1PWEA 1RHMA 2XVYA 3Q12A 2NTYC 4F5WA 1A77A 3GN2A 1NVXQ 4J1TA 5HPYB 2I3BA 5A0TA 2W83A 4KQ6A 1RLJA 3HKDA 5F7ZA 5JNSA 4D8YA 3I61A 1YS6A 3W6PA 3ZGZA 2JAHA 1LDMA 4EW2A 4QOIA 1QRTA 4HH0A 3G85A 1GPJA 3FLEA 2WT4A 3OY7A 3KQPA 3AG5A 3H9EO 4IM7A 1TRHA 4D79A 3SSMA 3DZJA 3PPWA 3PYLA 4ZDJA 3DV0B 4S1TA 4RBNA 4G09A 4L4RA 4MRVA 1ZD1A 1XDUA 1GGVA 5CLIA 4C20A 3DB2A 3A36A 4DMMA 2ZWVA 3AY3A 1KKLA 4LK3A 2V3WA 4Z4CA 2A9OA 1N1DA 3A58B 5AKHA 3VNRA 1Y34E 3TLZA 2Z2KA 1VDZA 2KS6A 3C3BA 1TUBA 1YC2A 1N0HA 4HZIA 4LFCB 3S2ZA 4WOJA 1Q0LA 1T4BA 1VXRA 2WF6A 1FX0A 5DXAA 1ZD8A 3WLTA 1S89A 2YZ7A 4HTAA 3EHDA 2R5WA 5A04A 4WLNA 4Y6LA 3GW8A 3EFOB 2CW5A 3MILA 3ISVA 3L7CA 1E96A 1ZZEA 2DQKA 4GRDA 4I4TB 4Y6GB 3CBGA 3EGEA 2WTAA 4O2AF 2DBQA 1L4HA 3DTTA 3ONFA 1NBMD 4CV2A 3GGOA 2L69A 4KKXB 1EFHA 1UIRA 3L0IB 5KSPA 1JSZA 3RNLA 1ZONA 1C2TA 3WDKA 3P0JA 3A11A 3KCQA 2EFGA 1IY0A 1SUDA 4IV8A 4PNZA 4Z4EA 2DHEA 1E2MA 2Q0HA 4XR4A 1ZEJA 4C0QC 3FNFA 5EUCA 2QAGC 5JCZA 1HT3A 2ZIWB 1AO0A 5JS1A 3CLSC 2BV3A 1H85A 1YRAA 2YXDA 3IIEA 1PL8A 3UJBA 5B6IA 5L53A 1FQWA 1NW7A 4YRCA 1M1NB 3I73A 1P5ZB 2HSZA 2ZOSA 1QCDA 3UHFA 2FMFA 4RAOA 2FPWA 3DVAA 3I1FA 4LPSA 3NTVA 3I8XA 2Z4SA 2GB4A 3GYGA 1ZUNA 2AGVA 4B3DA 5CP8A 5C8ZA 2DMRA 3ITKA 4HYQA 4JKIA 1JDJA 1DKLA 4JX9A 2W2XA 5FAXA 1FFCA 3AK4A 4ILKA 4KVGA 1GKKA 1E4VA 4ER6A 2YXLA 1KAEA 4XQEA 4XOUA 1OAOA 1NXOA 1HTTA 3RREA 3S8YA 4JLNA 1ORRA 1D7AA 2YHIB 3IPYA 1ADCA 2I8CA 5DMHA 3AR8A 3VC7A 4D9EA 1AXGA 3MBIA 2XWPA 3HDVA 5IYZB 3FOFC 3IBCA 5CFMA 3ECSA 1QIDA 2JCVA 5ELLA 4RV9A 3VO9A 5CBPA 4FDTA 2NO4A 1S3IA 1Z0AA 4QNMA 3RTBA 1FRVA 5LYJB 4A2CA 3M4ZA 1B15A 3L6UA 3VAAA 1JR6A 1I3MA 5FTKA 3DWIA 1YQXA 3Q3HA 4UHDA 3EVEA 3PEWA 2P9CA 3HU2A 3OQMA 1SRQA 1K89A 1KJIA 1MJGA 2WA2A 3BH6A 4MR8A 4BFLA 4X1KB 4FI3C 4RE6A 1ZC4A 1SRRA 1VFNA 1AK1A 3WS7A 1SUEA 3SY8A 3IP9A 3OZCA 4RDXA 1Z0KA 2QV7A 3EQ9A 2QMEA 1RTTA 3OBBA 3HDQA 2O2ZA 1QRAA 2BHLA 1NQ5A 4K26A 5F23A 4YGYA 4ZYXA 2BZ1A 2ACKA 1DWPA 2WLSA 3FROA 1GQYA 1CDOA 1M9NA 4MMYB 4P31A 4M1SA 4XA8A 3HA5A 4WD3A 3HBJA 1NM5A 1IN1A 2Z9CA 2C2HA 3HCRA 2PMBA 3WB9A 4EO9A 5CBKA 5ARBA 4MPPA 4WLUA 5I3ZA 3P9QA 3FGZA 1VE9A 1VHDA 5LM3A 1RJ9A 1AGYA 2VSOA 2HDNB 3GP5A 3IO3A 3V8MA 1GZ3A 2FEXA 4MKIA 1E9SA 5JBIA 4J0IA 1XPOA 4EELA 4QQFA 4ENTA 5IZCC 4NFYA 4GPD1 4N6GA 3U7EB 1FS4A 1Y3BE 4MUNA 5HG0A 4L0QA 3B3AA 2VJBA 3KZOA 4OXIA 3QKTA 4Y9UA 3M2PA 4JJEA 1P5JA 3EGIA 4ZEOA 3P94A 2CCKA 2IOYA 2WPDA 4CF3A 4EECA 4ABTA 3L49A 1T3HA 4JC8A 4DR1B 2C4WA 4GX0A 4HQ6A 1FUYB 1TUIA 1V1MB 4M1TA 1OA1A 1R8SA 4R0VA 7GPBA 1PZHA 2B2XA 1R15A 2A58A 2MDTA 3QKSB 5K3EA 1LJ8A 1XTTA 4UCQA 5CAEA 2CBXA 2O19A 4BO2A 4K8RB 4G89A 1P0FA 3TPZA 2I67A 2HF9A 1CT9A 3TD2A 3T7DA 1MJNA 5HFNA 3KQNA 1U8YA 2GZ2A 3AHFA 1WB6A 2AHRA 4JFAA 2NQ8A 3D5QA 1UBUS 3Q6NA 3TEJA 5LU8A 2O14A 2QW8A 4NBNA 1FDIA 2XTAA 4E2XA 1XVTA 2XUJA 2W4MA 1WMSA 1TU3A 3G8DA 3HYNA 1E1KA 1M1ZA 5IUJC 3SMQA 1NXTA 1YR9A 2CNLA 2DY0A 4FFWA 3FFAA 4TWZA 1UUFA 3K71B 1EBBA 3P45A 1P44A 4G26A 4ZYUA 5CH3A 1W4AA 2D2VA 1DQSA 4NTZA 1L5LA 3SQNA 3U60B 3FYDA 1TA4A 2J87A 4PLVA 5BORA 2PBFA 3BH0A 1NMXA 2C2ZA 4Z9BA 3D2BA 2ZRBA 4IYJA 5K3SA 1NW5A 1GG2A 3RIGA 3HJHA 3KYDB 3TAXA 1T10A 3EIQA 3K94A 3D8RA 5G40A 1DLIA 3CPEA 3L1VA 1A2KC 3V2HA 4QXRA 2UXBB 1U80A 2HEGA 2IDJA 2LNDA 2XBUA 1X14A 3ED5A 1Q83A 3WWEA 3IUYA 4WLOA 5JC8A 3S1AB 2ZETA 3EWSA 3N87A 1GQOA 4MPRA 3JAKA 3LGAA 4OB8A 3W2IA 1XALA 2UVPB 4DSTA 5BSEA 3IIMA 4M1MA 3R41A 4EGAA 1FIUA 2HYIC 5ADUS 4UTOA 2KI5A 3K4HA 3DL4A 1POWA 4F46A 3V1YA 3JW8A 2QRLA 1ZOLA 4MVJF 2HV9A 1JILA 3PQ7A 1IG0A 5CGQB 5TARA 3KSAC 3PEUA 3SR4A 3FOEC 5HOQA 4O08A 1HOXA 1Z7YA 3A1EA 1JHPA 2I34A 3EVZA 2H1SA 1VMDA 2ADFA 2HPHA 4CLOA 3ZWMA 3EWAA 3RU9A 1H3EA 1YS1X 5IFKA 4MAFA 3RYTC 1GZDA 3C39A 1XSEA 2VHTA 4AMZA 3HRIA 3CRVA 1SXJE 2WM9B 4PC3A 5A4MS 2XHZA 3A3NA 1VMIA 5AJHA 4QG3A 2B4AA 3QVOA 4UEOA 3OUTA 3DFKA 5JXIA 2REQB 3VOAA 3AXTA 3PWTA 1Z39A 2QS9A 3OZVA 4EKGA 5G4KA 3THSA 1VFPA 3SXPA 8ABPA 2AFHA 4HCJA 4E1VA 1OZAA 1PEAA 4IP0A 1DFGA 4ZU6X 4E03A 2ZQZA 3U9SA 4YUYA 2J9FA 1U8TA 3STHA 4YRSA 3B78A 3INRA 4R1TA 4Z2YA 2I9KA 3LCJA 4IV0A 3UN1A 3B1ZA 4G5QA 2NG1A 3N6VA 5JNRA 3E9MA 1JQKA 3IOEA 1WZEA 3NUQA 3UMYA 2C8JA 1FYEA 1K7CA 2V0NA 4AJHA 5ALYA 4KQFA 5HKLA 2VT2A 4MI9A 2QPOA 3AR4A 4IDAA 5JLAA 4YDRA 1E5DA 4NZNA 3K0CC 5LMCA 1SR8A 1ISSA 4FGSA 2WHPA 5I4IA 1ZIPA 3B6EA 2PY6A 5FORA 4WZBE 1Q19A 1YRYE 2B8WA 4LV8B 4QOGA 1W4BA 1FB5A 1PJ3A 1EUQA 4FGWA 3VYVA 1IHUA 1Q57A 1IPHA 1IHOA 2HHLA 2CD7A 3IERA 4A0HA 4B43A 4CQNA 4GZ6A 5EJ7A 2WILA 2AZDA 2C7BA 2QYOA 1CZUA 1XDZA 3ENZA 3COPA 5CNKA 1R3DA 4D42A 4OX9B 4J0FA 1NONA 1YI1A 2XSZA 5DN9A 1KK0A 3G17A 4LA4A 2QN2A 3QXHA 4KG7A 3QENA 2FLVA 4OFWA 2YWDA 1DADA 5EIAA 1VI6A 3TE6A 3ZY5A 5L45A 2P65A 1JS1X 2QWXA 1K4MA 1DWOA 3NBKA 4FZVA 1O96B 1YJAA 3AUSA 4HVCA 1X7XA 1DKQA 5K4AA 4DPMA 3O91A 3LQFA 3R6LA 3DA8A 1U0NA 1JTEA 3H86A 1V35A 2Y93A 3G5MA 1JB9A 1P74A 4H3SA 4HFJA 4MV5A 3WB2A 5EP4A 3EB9A 5MHTA 1AV6A 1SU8A 4RDCA 2R6R1 1GGHA 1W47A 4K6HA 4MRMB 1GRVA 1HURA 4EFLA 4YASA 4MUYA 2PS9A 3RI3A 3JQEA 3R9XB 3RIEA 1XHEA 1K8ZB 1YA6A 2I2BA 2XCSB 1DLJA 1UC9A 5FOXA 3GARA 1H2ZA 2QRPA 5T57A 2I3AA 5KPJA 1G19A 1XD8A 1QVAA 1OIWA 1BZYA 3NB0A 4U0JA 3CUKA 4YAJA 3NDPA 3ZC3A 3B8EA 4TYWA 2PSHA 1W581 1GT91 1N7IA 3R09A 3N2LA 4G1FA 5LOVB 3PXDA 4J6EA 3N7AA 3T5DA 2A5GA 2V4ZA 2DTDA 5CXSA 2HQSA 3KSRA 5DWVA 3GCDA 1U8ZA 3OQBA 4C5AA 4UJ5A 1CNFA 3PK0A 4FVTA 1DJLA 1IWBB 3LIIA 2FRXA 2C78A 1M8JA 2X0KA 2W90A 1G8PA 1ZM2A 1WVIA 2IU6A 2Q1UA 2VF8A 3WWZA 1A9ZA 1T4DA 4H35A 1KZ6A 2Q46A 2BEKA 4K9PA 4YGXB 4C88A 2VHXA 1PJ2A 2HNAA 5LZ7A 3FR8A 3LKZA 1UAYA 2GVDC 5DN6A 4GX2A 3HEBA 2G8NA 1T5LA 3ZU6A 4E09A 2ZYSA 1H9AA 2ZB4A 3I5AA 4IJVA 3RK4A 1E8NA 3GPIA 4ZOEA 3OA0A 1YH3A 4KE6A 4TV8B 2UZ4A 4PZYA 3RNOA 4AP9A 4HV4A 1LSUA 4ZCMA 1OFGA 2NVUB 1F0KA 3SHFA 4DEVA 4DLXA 4IO0A 2PX0A 3F2VA 2C8KA 2FHPA 3DAFA 5M3BA 2PMEA 4L4SA 1FYVA 3TDMA 4B4WA 4ZGGA 1PK8A 5IJ9A 3EXAA 2GGSA 1UJMA 4G63A 1HEUA 1CK4A 3DVRX 2FETA 2AS0A 2DPGA 2FEWB 2JBAA 2RHJA 3RS8A 1OH5A 3Q11A 1MB3A 2I4OA 1DEHA 1M0SA 3MPUA 4X24A 2AA3A 5L3RA 4FYHA 1WX1A 4LWQA 3OZIA 2NP7A 2CVPA 2HLPA 2W2KB 2Z3ZA 3EXIB 2D3WA 3KR0A 4HMQA 4JB3A 5KAMA 5L3SA 4ALIA 3FCCA 1A7AA 4JFRA 1NN3A 1ZITA 4LJ7A 1TT7A 1B8NA 4OJQA 2O8VA 2V5AA 2PAFA 3A4TA 3WDSA 4Q4JB 2OHHA 3T54A 4KXUA 1LLUA 2XVAA 4IY1A 4J49A 3RBXA 2PUBA 4C2TA 2G1JA 1D6SA 1BDBA 1QK5A 2MSCB 3PQ2A 7AT1A 2ZUDA 3PFFA 2G83A 2CL6X 4H4EA 1P1RA 3FYUB 1FRNA 2BDTA 2Y68A 3C3PA 3JQ8A 1ZSNA 3QYPA 4MKFA 5LA6F 4M83A 1KDOA 1T35A 3E58A 1AT1A 1SULA 1HI9A 5EQFA 4BAUA 3BORA 5TPZD 3BD9A 3EXHA 4CQMB 2QTLA 1JEQB 5AVVA 1N2GA 1YS2X 1S9HA 2IOHA 3E8MA 1LV7A 3RIYA 1KEEB 1Y48E 2ZIXA 3HADA 4PLCA 4ZOAA 5A1TA 1GNRA 3DVLA 3I58A 2ODNA 1FYXA 1CX9B 5G53C 3SQXA 2PM8A 2CWDA 4GKVA 3EPHA 3GR6A 1L7DA 3EIUA 3GEDA 2ZKIA 1FDOA 3JRXA 4BQNA 1G60A 4RD0A 4U39A 2EBUA 3KKPA 2E7ZA 1Z6AA 5AW1A 3ANSA 1TPZA 2JIBA 4NCIA 4Q7EA 9ABPA 2H2DA 1Y7TA 3PC3A 2FG6C 3J7TA 4NAHA 4ENQA 2JVIA 4Y8VA 1TUEA 2ORED 1CLUA 1L7XA 3VI4B 4EYKA 1SKBA 5B3JA 5DF1A 1COZA 4K3UA 5EKTA 1KARA 3INGA 1EB9A 4R8SA 4MVCA 3TD6A 1R8QA 2AOUA 5DHSA 4KBFA 1P0QA 3K70B 2VF5X 3MD9A 3ZWOA 2BSQA 4IXDA 4C4AA 3IJPA 3HRHA 3QVXA 3QVLA 4RE5A 1GEEA 4Q24A 1XNHA 4ASUD 4AYXA 3GROA 1N3IA 3K5PA 3LZ6A 4QFCA 5KX5F 1HDYA 3DM9B 4XPZA 1ZR2A 1A9XA 3AU8A 5D86A 1E1RD 3H6GA 1BQ4A 1J99A 4IR7A 2I6GA 2JCYA 2FH5B 2PUFA 4TMWA 3HGTA 3QLVA 4M8SA 2FDRA 4Q4DA 5IT9A 2F00A 3D3KA 1G66A 3IEVA 1DAOA 5KI6A 1WQ4A 3BKWA 2J6HA 3M3HA 1VSVA 2ZBEA 1HLPA 3BSFA 3VHLB 4EMSA 3HLKA 3ISTA 5E8RA 2P9EA 3HI4A 1QGUA 2JIRA 3LCMA 2QX6A 2P9YA 1XHLA 3O4GA 5ER9A 3PFBA 4UMDA 2J41A 3HVIA 2QY9A 1WWKA 5JVDF 1U0LA 4MB0A 3OSUA 1WD7A 2Q21A 4XCXA 2HJ9A 2FK7A 4F71A 4WECA 1F12A 3MTBA 5TIIA 4DXAA 1SHLA 1VBKA 1M34E 2P9HA 3NC4A 3Q6MA 4HGOA 2Q07A 2HTFA 4EVQA 2QPTA 3GI1A 8MHTA 2ZJOA 1FXWF 4BMSA 3USES 3D6NB 3URMA 4FJ1A 3K05A 4PLZA 4UU8A 5BYKA 1KKMA 4M54A 3IKLA 2AC7A 4KE9A 2NT4A 2WUDA 1VHLA 4E5SA 1X3SA 3WLNA 2GSDA 3B9BA 4H18A 4Z7OB 3GFGA 4JLMA 3TQOA 2HMYB 3TSAA 4Q01A 3AWIA 3QLJA 1QP8A 3P4XA 4UVEA 5CH8A 1NQTA 2E4ZA 4HPWA 2WINI 5K3OA 1EGQA 2ZRHA 2GEKA 521PA 2ZI3A 1E6CA 5DOZA 4GSLA 1K6MA 4KLNA 4GUDA 5EWMB 5TMPA 4MP8A 4RIEA 3CIFA 1Q6ZA 2Z8YM 1CUIA 3CZ5A 5EEHA 3FFWA 1SVOA 4YS6A 2H3HA 4N7JA 1B8UA 3T9EA 3TTSA 2X42A 2ZRQA 5BQPA 4X95A 1BE1A 1PE0A 1L8AA 1FDUA 5BN5A 3PUYA 2XD9A 2X5XA 2OBLA 4DWWA 2FPLA 3GZNB 5TRTA 4RSMA 3PWSA 1FFHA 2JW5A 4NYJQ 3HB9A 4JU8A 4KQ2A 1BGWA 1QH8B 2VHQA 1T3ZA 2JDIA 4G5FA 1LDNA 4D9JA 1TMGE 3CEPB 1TVKB 1EAMA 2JA2A 3VJLA 1CJBA 3OZGA 1ZOSA 5E9AA 1VMEA 4ZCQA 1SUIA 1MMFB 1BRTA 3OCJA 3P2OA 3E3OA 4WOCA 3JPWA 4NBKA 3RYFB 2Y1LA 1CBUA 2Y0CA 4FYYA 4QDOA 5JD6A 3JD1A 4B8ZA 4B82A 3GLFA 1C3JA 1XTQA 2EP7A 2B92A 3HWSA 3WLPA 4UC0A 3OCZA 2IEAA 4YRLA 1R0YA 3QRWA 3FCXA 4JUIA 5FUMA 4Q93A 4IHJF 4LJSA 4CEIA 1P5RA 2Q3BA 1IXZA 3ACCA 3G9ZA 3VKWA 3WFIA 2GEBA 3N0VA 2E82A 1YQQA 2CMGA 1ZGBA 2UZ1B 2VDLB 1BKSB 1DKOA 1KA9H 1P31A 3A7DA 4OLAA 2FRDC 1XU7A 2FVYA 3OT1B 5DSTA 1QORA 2Q6LA 4HUQA 5J2UB 1O8CA 5J47A 2R84A 1A9QA 3ZHQA 1JKFA 1KYVA 3FSGD 2VKQA 2GFHA 4BGUA 1DEKA 2YVQA 5K0TA 2BD0A 3TZLA 3PTAA 3B3JA 1SN7A 4MV7A 4NIMA 1T2DA 4A8TA 5DB4A 3L8HA 4NH0A 3QV1A 5F1KA 1YJXA 3NG1A 3N8KA 2BL4A 5G4LA 3U1BA 2BKVA 3HKBB 1W1UA 4Q3NA 3EGCA 3TLCA 4E15A 4EA6A 4GKJB 2D1YA 4LF7B 3PFNA 1SKQA 2GCOB 1E3WB 2GWHA 3FVTA 2YMLA 3R77A 4KX5A 4O4JB 1DX4A 2HX1A 2XMGA 4GQIA 4PYKA 1BCSB 1OV6A 2WT9A 3L8EA 1XL0A 4QIHA 4P36A 1ECBA 1KQOA 3HCEA 3PRJA 1XCOA 2IGTA 3R24A 4KAFA 1WKBA 1PYDA 2C4VA 3K4QA 4LDPA 3JD4A 1Y82A 1JEAA 2AQ8A 3TIIA 3HXOA 3U7RA 5E7JA 5H8WA 1CS0A 1LVGA 1M5UA 4H59A 2QXYA 4I50B 4F86A 4L8WB 1ZDMA 3VR3D 3Q8KA 1SXPA 1IUNA 4C9BA 2VIIA 5CVTA 2B1JA 4FFRA 2BEWB 3B1KA 4DV6B 2HHAA 1C9JA 3T8YA 4ALMA 1PSDA 5LR6A 3GLGA 1J2UA 4HYYA 1L1EA 4IRXA 1KI6A 2HBZA 1V5FA 3E7XA 1N7HA 1WE2A 2BMEA 2VOJA 2X4DA 1BXZA 4EY5A 2W2VA 1AQLA 1XZHA 2PUHA 1NG9A 5GGYA 3VPDA 3RW9A 4CL8A 1T6XA 4UAUA 4HQLA 4TRMA 3ET5A 2B8JA 4KDRA 1ZY2A 2NO9A 2ZQ5A 2HJRA 3KPVA 3O7MA 1XCMA 2PKQP 3WRVA 3GPBA 2HNBA 1JH8A 3MTAA 4ND4A 4QECA 1G2IA 4D57A 1X9IA 3L7JA 5JSZA 5I9MA 2J7KA 1N7GA 2YHAA 3KT6A 3LVRE 3BPSA 1NW6A 1LX7A 1NJ6A 1S8OA 2VHCA 3E81A 3MT8A 2JJYA 3O3CA 1Z07A 1SC1A 4KN8A 3I53A 3T41A 4ARVA 4DUGA 4L8YA 3CZMA 2WU1A 1KH1A 3ZVMA 1M73E 1GFZA 1PTKA 5AKJA 3RWMB 2FPGB 4DR2B 3K0AB 4MJ7A 1C7ZA 5F4ZA 4KO1S 1NTOA 3LYUA 2Q0SA 4UBMA 4DLZA 3FG9A 2X0RA 4HAUA 1XZFA 4HGNA 2BGTA 1DEXA 2GI4A 4C0SA 1B7GO 4KYIB 5DGIA 3V00A 5HF6A 1A04A 2FFBA 5AVTA 1PWZA 3U3XA 3G2LA 1B42A 2XE6A 1OX4B 2PLWA 1I1HA 1Q1NA 2ZRPA 3DVQX 3EXFA 4K9KA 3D6FA 3UWPA 1ZU5A 1ZGZA 2O0HA 3ROGA 1BSVA 3ADPA 3PF8A 2LTAA 1U3GA 3VR6H 1CY1A 2G5GX 1UKAA 5A0FA 3ZHBA 4AJEA 4OOFA 4WXYB 2C96A 2C92A 3OQOA 2A9QA 2D00A 4FFDA 2A33A 2GD0A 5F12A 3T5AA 1Y81A 1CIVA 1UM9B 2GZSA 2CLHB 3KIPA 2R1VB 2R6CA 3D59A 4DUYB 3NHJA 4CMCA 1HKHA 1PJAA 1YKSA 4IUBS 1ZP6A 4TKZA 3HVKA 4LHWA 2IEGA 4XX0A 1T91A 4LBVA 1NHWA 1Y3DE 1A4RA 2H2FA 3R4VA 1DPGA 1JAXA 2M1XA 3GRFA 4PGFA 1MD9A 1K7EB 1OU4A 1JEEA 1UWKA 4MULA 3WBBA 5AOAA 2EKDA 1VIDA 3DE6X 4P53A 5IWCA 4PNHA 2JLUA 1HZZA 1VE3A 3BXGA 1BQ3A 4UAVA 4D97A 4MWEA 1RI5A 1N2EA 1ZMBA 3CEJA 4RGBA 3H9QA 3BK7A 2PWAA 3DMPA 3X43A 2WJ3A 3W5BA 2O52A 4ZAWA 3MERA 1FDRA 2VHWA 4WBNB 5EHGA 5LUBA 2HBYA 2ZJ4A 4IIJF 4MPTA 1QH9A 2A3RA 2HJWA 2VK8A 3VO8A 5KAPA 3CJQA 5EGNA 2OZLB 3JQRA 5AM5A 1YF3A 1IJEA 2JJ2D 3VPBA 1Z34A 3N76A 2NU6B 5AJUA 1G291 1Y6JA 5GAJA 4D9BA 1SBTA 1NUTA 4DMUB 2BEJA 4HAVA 1MR3F 5AW4A 4NRDA 2G04A 3FDZA 3ZW7A 1Q2UA 4BGIA 5FPKA 2JGNA 3O73A 1YZNA 3R5XA 2F3PA