1DTWB

Human branched-chain alpha-keto acid dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
QTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human branched-chain alpha-ketoacid dehydrogenase and the molecular basis of multienzyme complex deficiency in maple syrup urine disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE ALPHA SUBUNIT
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB02
4MPRA 5ERYA 1QGDA 2OZLB 2JGDB 3D7KA 1UMDB 1QPBA 1T9DA 1B0PA 3FLMA 5EJAA 5EJMA 5EJ8A 2C3OA 3FZNA 2BEWB 2Y0PA 1Y9DA 2VJYA 2J9FB 1X7WA 1PYDA 1UMCA 3AI7A 2R8OA 1W85A 1U5BB 2BFDB 1OLSA 5DGDA 1V1MB 1NI4B 3UPTA 3M34A 1X7YA 1Z8NA 3HYLA 2JI8A 3DVAA 2BEVB 2VBGA 3ZHSA 2C3PA 3DV0A 1V16B 1W88B 2PDAA 1ZPDA 2WVAA 1T9AA 2Q5LA 1X80A 1PVDA 1DTWB 4KXWA 2IHTA 2BEWA 2BFBB 2C3YA 3EXEA 1UPAA 2E6KA 1QS0B 1U5BA 1UPCA 3AHGA 1OZGA 1PO7A 1TKCA 5HJEA 2Q29A 1N0HA 2W93A 1YBHA 4QPZA 4KXUA 2QTAA 4QQ8A 1T9BA 1YHZA 4JD5A 4FEEA 3F6EX 3DUFA 4GP9A 2VBFA 5K2OA 1TKAA 2YIDA 3EA4A 4D5EA 4KGDA 1WCIA 1UMBA 4Q9DA 1OLXA 2BP7B 1GPUA 2BFBA 1UM9A 3HWWA 4K9MA 2BEUB 1TRKA 2EZTA 2VBIA 4GM4A 3LQ2A 3AHIA 1OVMA 2AG1A 2WVGA 5EXDA 5AHKA 1V5GA 4WBXC 3DV0B 2Q5QA 2AG0A 2IHUA 1R9JA 2EZ8A 1T9CA 5EJ6A 4D5GA 2G25A 2JI9A 2Q5OA 1DTWA 1X7WB 2J9FA 1OZFA 3EXIA 2G28A 5EJ5A 3EXHA 1NGSA 5K6TA 3AHDA 3IAFA 4JUCA 1OLXB 3ZHTA 2JGDA 2QTCA 4KXYA 2OZLA 1BFDA 3KOMA 4K9LA 5EJ4A 1X7YB 5EXEA 2BEUA 2BFEA 4ZP1A 2JLAA 4GM1A 2C3MA 1X7ZB 2JLCA 4MQ5A 4QELA 2XT9A 3AHFA 3ZHVA 2FN3A 2G67A 1WCIB 2Q28A 1X80B 2UZ1B 3EXFA 4GPEA 3IAEA 1X7XB 1MCZA 1V5EA 1OLUB 4KXXA 5I5EA 2EZ4A 2BFCB 3EXHB 4JU8A 4RJJA 1UMCB 5K3SA 3AHHA 2BEVA 4K9OA 4RJIA 4K9KA 2XTAA 2JI6A 3MOSA 4KXVA 5C4IA 3L84A 2IEAA 4JUAA 4JUBA 3EY9A 1V1RB 3AHCA 1UMDA 1YI0A 2BFFA 5K6RA 2YICA 1OZHA 2NXWA 5DEIA 5EJ9A 1YHYA 3M49A 3AHEA 3DVAB 1ITZA 3EXEB 1Q6ZA 3RIMA 1TKBA 1V5FA 2XT6A 3OE1A 1L8AA 2FWNA 1QS0A 1V16A 1W88A 1YNOA 2IHVA 4JU9A 3OOYA 1OLSB 2BFDA 2JI7A 3JU3A 1V1MA 1X7XA 2R5NA 1KEKA 2O1XA 5IMSA 3F6BX 3HWX1 1POXA 5FEMA 2VK4A 2JIBA 4COKA 3DUFB 2EZ9A 2VK8A 5ESDA 5HYVA 3ZHUA 1POWA 4K9QA 1UMBB 2BFFB 1V1RA 2UZ1A 1V11B 2EZUA 2C42A 5HHTA 3EXIB 2PGNA 2X7JA 4JUDX 4MPJA 2C3UA 4GM0A 3UK1A 2WVHA 3EYAA 4K9PA 1W85B 4K9NA 5ERXA 3M7IA 3E9YA 5I4IA 1YI1A 2R8PA 2PANA 2Q27A 4JUFA 3FSJX 4RJKA 2BFEB 3AHJA 5DGTA 1UM9B 2VK1A 3ZHRA 4GG1A 1X7ZA 5EJ7A 3EXHC 4C7VA 3EXG1 4MZXA 4XEUA 1UPBA 3LQ4A 2DJIA 2PGOA 2C31A 3EXFB 1IK6A 2O1SA 3LPLA 2Q5JA 5HGXA 1V11A 1NI4A 1YD7A 3M6LA 3EXG2 1AY0A 4C7XA 5I51A 1OLUA 2UZAA 1JSCA 1RP7A 1PI3A 2BFCA 2BP7A 3LQ1A 4FEGA 5I5GA 2V3WA 3ZHQA 4MPPA
chains in the Genus database with same CATH superfamily
1RD4A 4FFWA 4PYJA 3N8DA 1M2NA 4AKEA 1GTG1 2AMFA 5JDIC 5JZMA 1N9ZA 1UDAA 1PJRA 5I7OA 4P92A 4HQFA 1ZXBA 1NKTA 1G17A 2NVWA 4KPUA 4PSUA 5CR9A 1S2LA 2YDXA 3WKEA 3ZGZA 1KI6B 4M0MA 4BZWA 2ZYAA 5E1MA 5FLKA 4OLBA 5JBIA 4Y2VA 1VA5A 3FGPA 1Z8NA 2ENUA 2WFLB 1CKEA 1K6IA 4MOWA 4XGRA 1U1DA 4UM8B 3UKDA 3WJ7A 3R4VA 3HEMA 1Z5PA 2AX3A 3AFHA 1PFUA 5AESA 2AOXA 4PONA 1APBA 5DX1A 1HO3A 2HKIA 3RRJA 4AX8A 1CG6A 5CX1A 1OWOA 1TKRA 1P44A 1VB3A 4N8EA 3S40A 4ZAVA 2ADFA 4TLLB 3B78A 3SWWA 1VZ2A 3S99A 3TRDA 3W6NA 4EFNA 4YXFA 1P7PA 1S6YA 3RU9A 1F6DA 4GI2A 4JYCA 1A69A 3MG9A 1LPOA 3OSZA 4GX0A 4NAVA 3USCS 4II3A 2SCUA 3HWWA 4A8JC 3PEYA 3QKUA 2P68A 1Z29A 4BWFB 5HIAA 4YJGA 1LVUA 4OPMA 4EF4A 4EZEA 4YP5A 3E3MA 2LIVA 4FVTA 3AW8A 4WKCA 4BE4A 4RJTA 1YACA 2BKXA 5FADA 1JJ7A 1EQ2A 1QGZA 1IHPA 2PJUA 1RQNA 3ZX4A 2WUWE 3MLEA 3TJZA 3VTZA 7ADHA 4FTWA 5G0UA 2QL9A 1CFJA 1F2TB 4F60A 1NYLA 1DRJA 2NQ8A 4FONA 1PFVA 3S8EA 4GM1A 5C7LO 3AF5A 3DKKA 4QREA 1RKQA 3ZU5A 4X20B 5LYYA 2PRYA 2FN3A 3C15C 1D2CA 1SBCA 4NE7A 3RIYA 2NU9A 4DLNA 4ACAA 1ZVJA 1GKKA 3G9TA 3KXDA 1U94A 4IQ8A 5LP6C 1YRBA 4O4JB 5BW4A 2ZM5A 1UK9A 2RAVA 4BZQA 1M54A 3A1TA 3VJLA 3L7YA 2FPKA 3COPA 2ZETA 3KJHA 3O90A 4TMXA 2J45A 1VG8A 5BSVA 1ITZA 5HOEA 1GZ5A 1KEVA 3NX4A 2Q8NA 1GCIA 4R0VA 5BYBA 3ANYB 1CRQA 2HMTA 3OP1A 4LC1A 3KQKA 2VHYA 2XSZD 3RSCA 4MQLA 4BUJA 1O6GA 1Y5IA 1UP4A 4GPAA 4KVAA 2R6JA 2AEJA 2PS1A 4HVTA 3S1AA 3D54D 1LSOA 1TEZA 1XAHA 3GD7A 4LYHA 5EMHA 3ZOZA 3KT0A 1QGUB 3WV4A 2PQ6A 2PX2A 2C5FA 2E18A 2JPDA 2YV5A 2B1JA 4OB6A 4YC7A 3Q5EA 1VYVA 1YH3A 3KM0A 3SAJA 3WNVA 1LF0A 2VAMA 2W2PA 1E0SA 2W22A 3DLCA 4JJZA 3ZQKA 4BKRA 4D8XA 2M6SA 2QRLA 4IMRA 5BSKA 4RH0A 3MUFA 4N3BA 2F48A 1DSSG 3WHIA 4ZCMA 1RRVA 3U5TA 2ABWA 1QH1A 2XA1A 3VI3B 4HI0E 3WLMA 3ACCA 2M98A 1GAQA 1WV0A 3UICA 4ZAFA 2ZU6A 2B36A 3TR6A 3RV3A 2ZWMA 4IAOA 4DUGD 2J9XB 3CISA 4MV6A 4M0LA 2CL0X 3NBKA 2G0AA 1CR1A 3FZNA 3RVLA 1Z0AA 2WIGA 4KE6A 1U0RA 4MMYB 2OFFA 5FWXB 3OCZA 5A3RA 1GU0A 5ALEA 3VBCA 1F7VA 3TKYA 4B1FA 5DLEA 3M34A 4L6IA 4WUTA 1G8SA 1C3JA 3DKPA 2ZYGA 2CF5A 4WECA 1FQKA 4H3HB 4XE5A 2D0OB 3TCXB 3C1AA 1OA0A 4MP6A 1VKOA 1T0PA 1EJBA 3QBEA 1U11A 4PHTA 3U31A 1P1JA 5KNCA 4ZOLB 5HKLA 4RYDA 4W6QA 4Q00A 4RMIA 3KVYA 3ROFA 3ITKA 3Q1KA 2LTAA 2CMDA 5FP0A 4MEJA 1X0VA 1QF6A 4RORA 1SUBA 3LECA 1NPYA 3UMVA 1SXQA 3OLCX 3GGPA 1V8ZA 4KAAA 5FF9A 4F04A 3CLTD 1W9MA 1Z5VA 2UYGA 1RFLA 1SK9A 2ZJAA 3A9RA 3JALB 3CSDA 4JOCA 4NE2A 1DV1A 5H9VA 2YRFA 3SFTA 3ZVKA 1UBNA 2DPXA 4PBRA 4B7ZA 1NXQA 4R5MA 3HCBA 2G4LA 4F3NA 1YQGA 3OE5A 4U1RA 2ORWA 3KG2A 1Y7PA 3LLVA 3SXPA 3ZI7A 4W5RA 3RUAA 1P91A 2HNAA 2Q9BA 3N8GA 3ZBUA 1XTKA 1SVSA 4U3JB 1VGQA 4Z3DA 3AVXA 4QTXA 5GTDA 2ILTA 1HDRA 2PZKA 2W71A 1KI9A 3KDAA 3PICA 4O3FA 2PAFA 1IY2A 4G5GA 2I78A 5CJ2A 1U6IA 1UAAA 1W5BA 4B35A 1A1VA 4KDFA 1FTWA 4KPYA 1R50A 2ZQZA 5B12A 4P6VF 5A5GA 3AONB 1RJEA 3R8FA 1L4EA 4UARA 4R16A 2XUZA 3JSXA 2HD4A 3EEIA 4EKNB 2P41A 3SHFA 4MSUA 4DV4B 1OHHA 4KXXA 1NI5A 4WK0B 2O52A 3TAXA 2DETA 1SEVA 1TW3A 4OD0A 4OKNA 3STWA 5KDDA 2JAPA 2WD9A 5FWAA 1E2JA 1L1FA 1ACLA 4OHFA 4AIRA 3A9TA 4WASA 4OFBA 2XB8A 4ALIA 1BOFA 1ORTA 2ZB8A 1YB1A 5KYWB 4W63A 1DCFA 3LQQA 1QOQB 1HSOA 3N3AC 1E7SA 5I45A 1PJLA 1W88A 2B37A 1NMZA 4IDCA 5AJTA 1I33A 2WP8J 1D4AA 4LNUA 1GQYA 3O47A 2AI2A 4JT2A 3SQNA 1RBQA 2ZRIA 1F0YA 5FV4A 2F17A 2OCLA 2QW8A 1Y6FA 4PXYA 3FPBA 1T8TA 1WJGA 1K7EB 5K9ZA 3GLIE 4HRYA 2RGAA 1CU1A 2D0PB 1QYXA 2GEDA 4JUDX 2Q6KA 1TGYA 4M6WB 3DXYA 2PGLA 4CMGA 4E5PA 1P1KA 1F4LA 1Q6YA 1ZWLA 2R7NA 3HDJA 4C89A 5BWOA 1N2CE 4LWOA 4DFDA 3T5MA 1XZLA 1P9RA 3GC6A 3IAHA 3NTQA 2FWJA 2QUIA 4G09A 4AY2A 3EXHC 1PBTA 1LLQA 3F3SA 3TPFA 4EPTA 4JYPA 4DB4A 3SVZA 5J43A 4B6JA 1LFDB 5IN5A 3LPLA 4NQZA 3LBNA 4C0LA 2CC2A 1U28C 1RP7A 1A88A 4JODA 3DTYA 3RNLA 2JLQA 1ZS9A 3FYDA 2NXEA 4EHKA 2Q0HA 4G97A 2PKXA 3NBMA 1QG0A 4IF6A 5H83A 4F84A 1OWMA 4M60A 1N8SA 3QNUA 3HI4A 4F86A 3P0JA 1R15A 4MYCA 3VTKA 1SXJE 4JJ4A 5F51A 4MLPA 1RYHA 4PO3X 4YAUA 1XZGA 2J7PD 1E8MA 2QW1A 4FYWA 1N2GA 4RSRA 4YJGB 5K05A 4G0ZA 3S2UA 3KHUA 2G36A 4U5XA 4OHOA 2NVUB 3H9UA 2PZEA 4DLXA 3RSSA 2SBTA 3PD7A 1X80A 1VJRA 2BCGY 3C39A 3KUKA 5C5CA 1INLA 5KWEA 3BWBA 4F85A 4UHBA 3BHJA 3TLKA 1NOJA 4TQUS 2PO5A 3AL3A 4G67A 3V7NA 5KJFA 1HNNA 3RC7A 1YIAA 1CUCA 2OCDA 3GFPA 1XRLA 3L7DA 4U2BA 3EIEA 4XRGA 2H2WA 5KWSA 3ISVA 1UMBA 2X76A 3SU8A 3MJHA 1N4AA 3OMWA 1SHJA 1U4NA 3UKOA 1ZUNB 3EZ7A 1RMYA 4HXEB 2AJBA 2ATIA 2Q4EA 4DUZB 1GDHA 1EEHA 2XMCA 1J8YF 2IQ5A 3AZOA 4CM8B 1VGVA 3MWDB 5F77A 1FVFA 1L5QA 2EDAA 3ADCA 1LF5A 2OCBA 4KBGA 4B6FA 3EY4A 3MWEB 4E33A 1FMTA 3GBVA 2CBXA 1FUIA 1NSYA 3LAWA 2OZLA 2PBFA 1ULUA 3AILA 3IIKA 3LNTA 3PFFA 4NESA 3FFXA 3RB8A 4AY3A 2D59A 5BR7A 1XZQA 4KRYA 2VF5X 5K3EA 4MQUA 1PUJA 2QAJA 2RIRA 1IHYA 2XYGA 3WJAA 4QECA 3PC8A 3OY7A 1BNCA 2YX1A 3AF4A 2EFGA 3VAAA 3LA6A 3CG0A 1WLYA 2AL7A 1D03A 5JSUA 1RJ9A 4K6CA 4KH0A 2WZQA 4GKVA 1U2GA 3ZDDA 3WX0A 3K9QO 3ZD7A 4HJRA 4LJYA 2JDIA 4LRQA 4P98A 3ZCTA 2H1WA 1V4NA 3ZN2A 1SUWA 1UP7A 3VYTB 2RBEA 1FDSA 3BFKA 3CRMA 3SC6A 1L9XA 3UFBA 4IM7A 2FJUA 1SCNE 2VPPA 2CMKA 2FF7A 5FUVA 4DVJA 3GLGE 4FKBA 1P3DA 2A8YA 2DQYA 4ARCA 2BD0A 1GZ4A 3TM4A 1HDYA 3S2IA 4ZV9A 3DMNA 4P3KA 4PWZA 3NQ41 3T5DA 3LGXA 5JVDF 1U7PA 2QS9A 2RG1A 2ZI4A 2H4WA 5K3CA 3PKJA 5JO9A 3PWZA 4IDQA 3VO8A 1TT7A 2BAGA 2NZUG 4KAXA 1G7TA 1DV2A 2GA8A 2QV7A 4H31A 2YHAA 3GGCA 2Z9CA 1MJGA 3KCQA 3SM9A 4FW8A 4KFSA 4BGVA 1BE1A 1BXGA 3NHKA 3WYNA 1GZDA 1GPAA 3QEOA 5TF4A 4PYRA 1TYAE 3KKMA 3L18A 3IDZA 2BSXA 3AIMA 1AZTA 1VMKA 1PI3A 2P78A 4LY6A 4I99A 5B37A 2GOYA 2J6HA 2AJDA 2CK3D 4HEA6 3W90A 4B3JA 2FPMA 5B3LA 1H94A 1YR6A 4QM6A 4MWBA 4MRMB 2BY4A 4P3NA 5DTMA 3FOEC 1OX6A 3AVWA 2WM8A 1L4KA 3P32A 4AYXA 4EUFA 1AH2A 2IY8A 2R62A 5A4IS 3M6WA 1U5BB 3UMCA 4NU8X 3EFOA 4D4HA 1MA0A 4YX9A 2YS6A 1IMJA 1PJ3A 3CKKA 1GGNA 2TMYA 2HOQA 3OFVA 3VVCA 4EMSA 1XIVA 3DE0X 3MCUA 1V96A 1U0EA 2B8TA 2P7HA 3LT2A 5IAGA 4QUAA 3T3PB 4CMEA 1XGKA 2P4EA 3PYXA 2RJOA 2XE4A 3ZDQA 4JLNA 4CIDA 2VAPA 2HTFA 3MINA 5KKCA 1L4NA 4K0RA 3BIXA 4US0R 4S24A 3U7QA 1Y3IA 2V45A 3JASB 4JR0A 4LZJA 4CU2A 1N8KA 1MRSA 3Q8WA 1BD4A 2PJZA 4KPGA 3HCNA 3PRHA 4ND8B 5T6BA 3R7FA 4UDYX 4B2PA 1DC8A 2UAGA 5C53B 1EDEA 3L6RA 4G26A 1EI9A 2FRXA 3ADOA 3IR5A 1ZI8A 3IS3A 1E94E 4Q82A 2XCQA 5AKKA 5C3UA 5CX1B 3V2HA 3RC9A 1UFQA 4ZEWA 4G1EB 3K6SA 2B7BA 1FFCA 4OTZA 5FOWA 3GZNA 2V59A 5DISB 2O8DA 1LDMA 1S2IA 1OSNA 4B3TB 5IMBA 4J0IA 5K0CA 3GRYA 4JBHA 1MC8A 3L1HA 2G71A 4B80A 4FR2A 2OO5A 2HL6A 1V7PC 2C54A 1ZY2A 2M32A 3GZJA 4BZXA 4QNRA 3NYWA 1DFGA 1K0FA 3RS3A 1RAHA 3EIQA 4HWOA 3RREA 3L02A 1ODCA 3HZHA 4JCOA 1CJMA 3SZMA 4BX2A 1MV5A 4NBWA 3DZCA 4ZKDA 1NM5C 3IOYA 1CJCA 1JVSA 5EJIA 1S02A 2OGTA 3QOYA 4I1IA 1EE9A 2V6GA 3CXUA 5JFOA 3PD1A 5JFTA 4OM8A 5JYEA 4N5NA 3TIFA 5G4LA 2H85A 3PDUA 1PQ4A 2P2SA 3AQ4A 3H84A 4URYR 4OB8A 4M9RA 3KAPA 1NQOA 2JNWA 3N2KB 2IHVA 2Z0MA 1AMNA 1M73E 2I3AA 1UKBA 1LSJA 4G4JA 5CYFA 1TM2A 2Y1FA 3L77A 3MJSA 5HE9A 1KEKA 5J2TB 3FYUC 2E85A 2J3LA 2AQIA 1DG9A 4S35A 1UJBA 1NVGA 2OFPA 3LPDA 3UT0A 2QRQA 1I36A 1OGIA 1NP7A 1XN1A 2W2MA 1P31A 1RKVA 4AN4A 4DIEA 2QN1A 2O5EA 1O3YA 3DDUA 5HBGA 4LUCA 1U63A 4R1NA 4UBKA 2ZIAA 4RKRA 1RXSA 2GKGA 3OEWA 1FBNA 3NOOA 2BGUA 1QO9A 3FDFA 1UZUA 3NHMA 1BMQA 4P0TA 3HPQA 5AKZA 2PZGA 5DX8A 4DPLA 2NYAA 4PC6A 3FE2A 4RVOA 1GU7A 3HJRA 4MWOA 3GFGA 3M81A 4RK1A 2PV7A 1QO0A 1JXOA 2FG7C 2HO5A 2EARA 2XB9A 4OXXA 1MNQA 4MKFA 3OHMA 1JH8A 4C7XA 4EBBA 1RYNA 5K09A 1QIGA 1T13A 2KHZA 3AO0B 3BMOA 2BONA 4NFSA 4ZVTA 5AXCA 2VCHA 4HRAA 4QFBA 1G8PA 1JNXX 1GN9A 3WK4A 4MROA 3NEYA 1YQXA 4PCLA 4QT4A 2NXJA 2O1WA 4ZT5A 2WIJA 1D2GA 2VHXA 3KPUA 4B3SB 2GEJA 2P9YA 1HEUA 1C8VB 3JYNA 2R0QC 2ONZA 1X1AA 3L43A 1IC6A 2H92A 1TUGA 3A9VA 4IP0A 4Z1OA 1ECGA 2CXNA 2DFTA 2V6BA 4WDQA 4RTMA 1KYQA 1QPZA 3ECSA 3S27A 2IHJA 3LIPA 3ZU2A 1Y9EA 4ENUA 2I62A 4FB5A 3MWDA 1GPKA 2DBZA 2D1QA 1AE1A 3Q88A 4YT2A 4GLLA 4RD0A 5E8RA 3C6KA 5JNVA 5EKXA 1UBOS 4P35A 3OM0A 1MRNA 1WDTA 1E9RA 3ZLTA 2QB5A 4NCJA 1JGTA 4CM6A 5KVCA 4YREA 4JKYA 3W6UA 1G291 1HXHA 3JWGA 4E4RA 4TOIA 1DKQA 4LXIA 1KETA 3EJWA 1I7QB 4WL0A 2A94A 2NSJA 3OJOA 1Z3CA 2RAUA 3EUEA 2Q5QA 2O07A 2YMQA 4ZQFA 3X43A 1GG2A 1R9JA 4CDMA 1T9CA 1FA9A 4OUDA 4RABA 1HM5A 4C0KA 2F3TA 4JOBA 2FWAA 1KYXA 3NAGA 1YDEA 1E18A 3Q1LA 1W1UA 2CUKA 2GAAA 1N0UA 4HWPA 1LH0A 4KIFA 2EKDA 4D4LA 4UTRA 3EGXB 4MRMA 2W6QA 1Q14A 4NEGA 1YIDA 4J2HA 5ICCA 4RTKA 4TQ9A 4OH1A 3I05A 3KETA 3AUJB 1G2PA 3C4QA 1SAYA 4MR9B 2FX5A 1MW8X 5ENZA 2RGGA 1R27A 3IXLA 1UL1X 2B8WA 2BFCB 3R77A 2FPLA 2XDQB 3GLKA 4ZWNA 3WG9A 4IEEA 3F73A 2D7CA 4FYMA 1FU4A 2AG6A 2PMFA 2YWEA 4LE2A 5KAMA 2WWVD 3UOWA 3UOGA 3WL5A 2Q0SA 2BRUA 2DGDA 2OD2A 1M2HA 2YXNA 1T35A 2FZCA 3F6YA 5KOIA 3RYFA 1KZ6A 4JXZA 4NMWA 1AKWA 4P93A 3F47A 5DT9A 1U04A 5JAMA 3R7DA 5K3BA 1QX3A 2J33A 3P9SA 4QEDA 5TMDA 2JJ2D 3HCAA 4R9SA 1E62A 4BIIA 1KARA 1ISHA 2FRDC 1XU4A 1DJMA 4LFBB 2CNOA 3GXOA 1P3JA 2WYVA 3MJDA 5AVUA 3D8BA 3LBYA 1T5HX 4P31A 1LWNA 1NVEA 2C2YA 3PPYA 3EVAA 3PDIA 4GBMA 1E3QA 1G9TA 4K9NA 3EFOB 4WNIA 4EMTA 4FXOA 1RJDA 4R41A 2F7SA 5BSGA 1UOQA 1XTRA 2CZGA 4OGLA 5FH9A 3ZHYA 5FTLA 2O19A 4FHEA 4IG4A 1V3TA 4LOIA 2ANCA 2QUAA 2W6JD 1VBMA 3RABA 3EDYA 2Q5JA 1DPGA 3CKMA 3GVIA 1H2XA 2LVBA 2W00A 5E6RB 3RLFA 4EO9A 2X86A 4R84A 1AG9A 3FTDA 5ENVA 2EP8A 1K89A 1SUPA 2D2VA 5E6SA 1C7JA 3B6JA 4Z1MA 3JQEA 3DDHA 2NVUA 5EFOA 1GARA 3D7LA 3LRPA 2BZ1A 2DPHA 3NTUA 7AT1A 1CS0A 3N53A 2Y0PA 4EYEA 1WCXA 4DL9A 4Y0AA 1NHGA 1RWKA 1W85A 1OLSA 2ATXA 4FFRA 3K71B 3W1WA 1SCJA 4KXFB 5H70A 3RBXA 5TJ9A 5IJXA 4MI6A 1DC5A 4ND5A 1T3SA 4QKQA 3FM9A 3K0BA 4N6GA 2B5VA 3FRHA 3FYHA 1ZIPA 4OA8A 1G5HA 4X1IA 1ISJA 4ZCPA 3IXQA 4X0EA 3K4HA 1RLTA 1WS6A 2VJMA 4DBVO 4Y9RA 3UJNA 4M1QA 2Y0DA 2C5AA 1II0A 5J59A 4RTJA 4PSVA 5HZHA 1K6EA 5EKUA 3AKCA 5KAPA 1D1PA 4F8JA 4WZAB 3T7KA 1JUDA 2Y4NA 2IHBA 4IWYA 2RK3A 5M04A 1X86B 2IZ1A 3A6GA 4Q4HB 1QV6A 1W5SA 1ZH8A 4TS4A 4CV1A 3Q3GE 4RZHA 4V0RA 3ZQ6A 2AYYA 3LL7A 4ZVRA 4Y7CA 3DULA 1STOA 1ODJA 1P1HA 1DAKA 2JKZA 2EKLA 4MP3A 4MUKA 3I6IA 1QIEA 1WW3A 2HHCA 1J07A 4Q16A 5ELLA 3KYCB 2V8OA 1PQWA 3WQRA 1S3FA 4IKEA 2RGWA 5LJIA 1SOMA 1FUUA 4IOKA 121PA 4OM7A 4M4SA 4QU5A 5EVJA 3VHQA 3SNHA 4B4KA 2QWXA 4XW2A 3RAPR 3ZPXA 1JXAA 4KTVE 4Z8YA 2QAIA 5JAUA 3CTPA 3I0MA 1ZGCA 5JCXA 2JAHA 4RL4A 4AF8A 3ZVNA 3LP8A 3B5JA 4P9NA 5GJWC 5K45A 3CWQA 2PLAA 1LPAB 4QGSA 4HOYA 4I55A 4WX2B 2GCNA 5K3SA 4OY3A 5KREA 2QR3A 4TZKA 4MUFA 2JI6A 1V3VA 1X13A 3UMSA 2A0WA 2FUKA 5A2GA 2BFFA 4D9GA 2JZOA 3OZUA 4G5OA 1ECBA 2HHJA 1M6WA 2VDLB 4RTNA 1CYEA 3KZNA 4WQMA 1XDWA 3DFUA 2GNPA 1BH6A 2PKWA 1E3SA 3DMTA 2V9ZA 4HX5A 1ZH6A 4L8VA 4M7PA 4OJQA 1RC8A 3QUAA 2NU8A 5IHXA 3OLVA 2GD1O 1SHLA 3RTGA 4IJMA 4LZAA 4DLUA 5G1NA 2FSPA 4WCFB 4AMGA 5ESDA 2ZSKA 2Q1SA 2LDXA 2YVAA 2JAWA 3F9IA 2G9NA 1JL3A 4A6XA 4MKHA 3HEAA 4D9CA 3ETCA 1ST2A 3WA6A 2PE5A 2X15A 1ZJZA 1WY7A 1I9CA 4TXLA 4RFLA 1DQZA 1D1QA 3AUSA 3L0CA 3KKKA 5DHAA 1N9GA 1NXOA 1PT7A 3H0EA 5CVVA 4AY4A 5FOTA 1SVMA 4ECEA 1JAXA 3QEBZ 2DWPA 3ENQA 4HZUA 2FCAA 5DU2A 1KYIA 2CLSA 2A33A 2N42A 3KEQA 4FT4A 4WI1A 3KQQA 2YWGA 4U4AA 1CJBA 1N5KA 3NOQA 4E70A 2ZOSA 4ZQGA 1GR1A 4B8WA 3CSUA 3H4VA 3HUFA 1WBDA 1ENPA 1K66A 1LKZA 1SEPA 4NFHA 1EK5A 1OD6A 5GJVC 3AH8A 1JHAA 3AKEA 4KR7A 2OAP1 1U9YA 1F8UA 3EASA 2YMPA 2XT0A 1BX0A 2ON6A 3CH4B 5B7PA 4YBRA 3RWOA 3AYZB 3R3YA 1ZJWA 2B4QA 1VCMA 2CXTA 2WT9A 3I45A 2IK8A 4G0UA 3ZI4A 3UAGA 2CJPA 4RFSA 4PYIA 3DE5X 4Y2QA 4HTAA 5EWLA 1I5OA 3OQ1A 4DIDA 5KTKA 1WNTA 3HN2A 3I12A 4AD8A 3M4NA 2QSZA 1RQPA 3T4UA 3OQOA 4HY3A 1UJ2A 4E6PA 2CVHA 3QH4A 4F4CA 1ZVMA 1R4ZA 3TQTA 2POCA 2D1RA 1ZN8A 2ZROA 5FXMA 5M29A 4DB2A 3ZZ0A 4MI1A 1DTEA 2VJBA 3TMYA 2EW1A 1GNLA 7YASA 1IQRA 3BYZA 4BEVA 4JJFA 2GDZA 4KN8A 3ZWOA 3IIMA 4YMTA 2WWXA 1PWYE 2PGIA 3D8SA 2RHCA 3HCRA 4KU4A 5BY2A 4RESA 1X74A 2PUWA 2YFQA 4ZK6A 3O82A 4YECA 1XEAA 1U0LA 2P9JA 3DPUA 1J2EA 2YIDA 2FQYA 3G6WA 3JQAA 4IUCS 1JG3A 3GHYA 4OK5A 4UULA 2JVIA 1ENOA 3T61A 5M7EA 1BDHA 1DQYA 2PCJA 3E03A 3ELBA 3R09A 2JFXA 1RHQA 1J8MF 5DTRA 4E94A 5BR4A 1MOSA 4ZJUA 3FMIA 2B3DA 4W5HA 1EVQA 2FN7A 3O0DA 2X2PA 3BE8A 3HVHA 1ORVA 2GERA 1AQYA 3LUHA 3N8IA 1W25A 1O03A 4HFMA 5F4BA 1ZCZA 1J8VA 2PV0A 2QN3A 3OCYA 4F5EA 4QZVA 1UF9A 2NO1A 3IO5A 4DCPA 4ZQBA 1FFYA 4DCMA 2C7QA 2Y99A 5DASA 1N78A 2YIJA 2ZS8A 4AP9A 2A4KA 3HUDA 1FZQA 3Q3CA 1Q1ZA 2DB3A 4IH4A 3F5MA 1FU8A 4M1SA 4PFKA 3BXOA 1XHFA 2VZEA 2ZSUA 3IGFA 4GGMX 3W5UA 2IYOA 3IX7A 4WEQA 5TSDA 3KV1A 1NF9A 3JWEA 1WXHA 1F2UB 4YJ2B 1KDRA 4E1BA 4G5QA 4IIHA 1QCZA 2JGNA 2O2JA 3VX4A 1GT6A 4CL2A 3INYA 5G0TA 3UGKA 2O2IA 2CVOA 5THKA 1MHTA 4H3VA 2JHPA 2MSDB 3E0QA 4AM8A 4AKIA 3HI6A 3H1FA 4GSYA 3ZV5A 5B7QA 3F98A 3CVWA 2BM9A 4FSDA 3FUWA 5ALNA 3ZQ4A 4WHMA 1QU2A 4UUOA 4C7MA 1CUVA 3A11A 3CJTA 3C98A 3DCNA 4O4IB 4IFBA 1H9BA 1NBOA 5G3YA 3GF4A 3SJ7A 2CFSA 3HEBA 1DARA 2JLUA 3LT5A 2HCBA 2UZIR 3OEEA 1JDZA 1DDOA 4CT4B 2QDXA 1IWPB 1W85B 1M7BA 3DLIA 1JA1A 1Z5ZA 2ZT7A 3SLGA 1H1LB 1SBIA 2BTOA 1CUEA 1I4LD 1SQSA 3NAMA 4LXXA 4ND2A 4Q3DA 4RHEA 4WZ6A 1J2JA 4KR3A 3PFGA 3WDLA 4PPQA 1IATA 1FVOA 2I91A 3PXXA 3QVGA 1O5OA 2DBVO 2CFIA 4Q3OA 2ZVDA 3OCCA 3BE6A 4LJSA 2J08A 2PCLA 2B8EA 3MOIA 3F4KA 4TWBA 1QVVA 4XQGA 2AT1A 1D3AA 2ZR0A 2D54A 3ED5A 2Y9MB 3ZX5A 3NC0C 4GX1A 1ND5A 1H2EA 1NXVA 2WWFA 3GU3A 3L1KA 1AS2A 4EUNA 4I5GA 4IG9A 1TK3A 4IIFA 4YT4A 1WDLA 4BMOB 3VAZA 1H2FA 4MMZB 1RWWA 1FDUA 4JLSA 5B2FA 2R7MA 4WZAA 5F35A 4F96A 2P9TA 4K81B 1IOLA 1U02A 5F5NA 5C3MA 3A1UA 2ZXEA 1HT2E 2A5YB 2GXSA 2IIPA 3LXRA 2FMHA 1L5RA 2IYYA 4CYMA 5DDIP 3VU9B 2H7YA 1M5UA 2PKQP 3EIXA 4Q3CA 1JPJA 1LI5A 3BTOA 4CGZA 1VC2A 4PNPA 4KO3S 2FCRA 1NBWB 4EHBA 4YMVA 4BMZA 4GPTA 1AQ6A 1OFUA 1AKEA 3KXLA 2Q3LA 4ZJYA 3W9BA 1L7MA 2WTMA 5FR2A 3W5CA 2O7RA 3RYTC 1A9SA 1ZJYA 4LRWA 5GM2A 4B34A 3GYGA 4DYDA 2BBSA 1ULSA 1IBRA 3IPYA 3RJ9A 4C6TB 2YJTD 4XI9A 1O54A 4EMBA 2C9OA 3DE1X 3B2QA 3F5SA 5C81A 2VP4A 1L5SA 4BVBA 1RZ3A 2IV2X 2CFCA 4KQ6A 3MELA 1FBTA 2W70A 4MVJH 4CF4A 4IDGA 2BF7A 1UQTA 2C96A 4GM4A 4ER7A 3V9AA 4ZCIA 1BAPA 3AR7A 2YHUA 1KFKB 4ND6A 5AK4A 1M8FA 2AC4A 3TF5A 2H4JA 1QKKA 2ODPA 3GFSA 4ARBA 2HHHB 2JI9A 2VDVE 5ES4B 1VHWA 4ADSG 2DMRA 2IW3A 4F8YA 4YPOA 3OUTA 5CFQA 1SHZA 1VFPA 4GPD1 1UBSB 1HYHA 3ZNNA 1A97A 1YUBA 1KYYA 1YS6A 3G5AA 2JD2A 3KOMA 3LX8A 3ONFA 4NBRA 4JP3A 1MORA 1VCHA 2ZS7A 1GQRA 3B1VA 4KRFA 5EHIA 1S1CA 4UNPA 4OHRA 4B4WA 4JA2A 4JQCA 3Q2OA 2PSEA 2JGMA 1GGVA 2FDCA 1R74A 4LRTB 1Z6GA 2WNHA 1E20A 3WLLA 4M8KA 2X58A 1P2VA 1UMCB 3CLSD 3PWKA 4K9OA 4KG7A 4P80A 2Q1YA 4UM7A 3Q6IA 4QTUB 1QGYA 4F3YA 3KQLA 3BULA 1H85A 1U3DA 2GCOB 1LK5A 4XLZA 4WJZA 2QP3A 5C9ZA 3IEMA 2X9LA 4TTSA 2WEKA 3AW9A 1SMKA 2B7LA 1JLLA 1MQSA 2NZVG 1ULAA 4LYDA 3VJMA 1U2SA 4XDYA 4I6JA 2K5UA 4JNCA 4MWDA 4PCUA 1E1KA 4DJJA 2EL7A 4QYSA 1NSFA 2YCLA 4KVFA 1G2IA 4ZZIA 4O1IA 1JA0A 2OXTA 3PDHA 3WWDA 1F7UA 2ZRPA 1VE7A 4QATA 5E6RA 4OJYA 5A3JA 3U37A 4CL0A 4GMFA 3NHWA 3TH5A 4A2PA 1RHRA 5CXUA 4IIBA 3TSZA 1T4CA 3QLUC 3RSZA 3UYKA 2Z04A 3V4PB 1T5BA 1EQAA 3EGCA 1SKYB 3JARA 5LBUA 5LM3A 1HZZA 4MWSA 3AVTA 2ZRAA 4QTTB 3T41A 3AWDA 5HZGA 1HA3A 2C1XA 1ZDMA 3INNA 2Y68A 1Z0DA 4MZDA 5DM60 1QGED 4HNTA 3FCYA 3GR6A 3BB3A 3AR3A 4IHJA 2J7KA 5TVKA 4BFTA 4EB8A 5IW8A 3LZCA 4MS4B 3C6ZA 1QHNA 2XYRA 4L1KA 3CEJA 1GPJA 1DAIA 1NNI1 2NNLD 4J0GA 4RH1A 2CMFA 4JJIA 1XHLA 3U61B 5EIBD 1QDEA 3RUCA 1FYEA 4DYHA 4DYVA 2Y1CA 2G1AA 5AKHA 3U7HB 4HQKA 3HP1A 4UEWA 4WNYA 3LUDA 5FTJA 2HSWA 4XVHA 1P73A 4O4JA 1R9NA 4OU5A 4PPNA 3LY8A 1J1UA 2OBFA 4B73A 1F0NA 3ZHXA 3E4DA 4TRNA 5KYUA 3OH8A 4BO8A 4J1TC 3O9ZA 3P9XA 3QE3A 5FBLB 2HJSA 4MKZA 4OXQA 3NO4A 4FW9A 3NGLA 4OVKA 1UBLS 1LC0A 2IF2A 2O1EA 4D9BA 4AZVA 2VTBB 1JB9A 1FRZA 1N2OA 4E32A 4ZOCA 2R66A 2G6TA 4QBTA 4CMIB 1ARZA 1YQUA 4MJ7A 4JGBA 5G2OA 4HDCA 4EL5A 5K01A 1JQEA 1PNVA 4GLFA 5HRAA 4H18A 3AGQA 1Y33E 2PX0A 1EG7A 2OCXA 4IV0A 3WA7A 1E5XA 2AEFA 1ZNZA 3RGWS 3EEBA 3HSKA 5F5LA 1SUEA 3FTCA 3G2LA 1VLMA 2AC2A 2M1XA 2P1ZA 4RK4A 3A2KA 1EA7A 2GXUA 4HLNA 5BWNA 2N75A 3A6DA 1MGPA 2BL4A 2NO5A 5MN4A 3HJGA 2GXAA 3TUZC 1UXJA 3FHCB 3KAKA 3Q8MA 2BGGA 4E15A 1USUA 2R8EA 1ESCA 4MUBA 2JGDA 2TMKA 2VUSA 4FZ5A 1WUKS 3RLIA 4BO9A 4ZP1A 4LZPA 4PF1A 5TGDA 1CUXA 1YVEI 1DAHA 4JVLA 3OKAA 1ZO8A 3OI7A 2UZ1B 1X80B 2WF9A 4CIYA 5LKRA 1AB5A 1HE4A 3AXSA 4MAFA 2REXB 5EQDA 1JEAA 2BOVA 1O58A 3BGDA 3L4SO 4NFLA 2CLKB 4AXBA 4CEHB 2YFKA 2IEYA 2FEWB 2LNDA 3B6IA 3ZCRA 4NBVA 3TN7A 3NHBA 4CU5A 3SY8A 3WISA 1YFLA 4L8FA 5E2BA 4HQOA 1DG3A 1TMKA 2O6LA 3H5WA 2YINC 4Y9SA 4L2IA 3TM5A 1AOXA 3B3QA 3N7UA 2QQ5A 4UE2A 4AS1A 5HX7A 3TGWA 3GDHA 1EFPA 2QN6A 1C0PA 3BXPA 5DXAA 2LDBA 3G2IA 3M8KA 4KYIB 5IM4F 1JV2B 3C74A 4LF7B 2CMHA 3JALA 1XMVA 1V11B 2Z2ZA 3IO3A 2BM1A 3GDFA 4O2RA 1CY4A 1V7ZA 4BVFA 1DIBA 3MWEA 2F3PA 1KI7A 1JLKA 3LO8A 4DJFC 3AUFA 1T8WA 1QHYA 3TFWA 1KVRA 3EGDB 4EP1A 2QBYA 2PD6A 1O9BA 2X42A 3EMBA 2D2XA 1EGMB 3D7RA 3FBGA 3ROZA 3F96A 1U0SY 5EZ5A 1XG5A 5FI0B 1LBIA 1TYZA 1Y4DE 3GPCA 3O4FA 3KK0A 2J3EA 4WVLA 3SHVA 1I7LA 1K92A 4M1KA 3UV6A 2BE7A 5KPDA 3C7CB 3TSYA 2DX7A 2BUCA 2VAWA 2I80A 5CX4A 3T9FA 1DGQA 1RJ9B 1TIBA 1T0IA 3WIDA 5KCZA 1WM1A 3Q7EA 4RA9B 4O3MA 3I2IA 3L7JA 3OZVA 2V0NA 1S9DA 3IH5A 1G8YA 4X8HA 3E9DA 4XTCS 4ZI7B 3T1VA 4TMTA 5AWFC 3DT6A 2NLOA 2YJ3A 2Q7XA 2WJVA 5C4GB 3ZE0B 3TZLA 1DAMA 2AFHA 4HNGA 3SHQA 1W88B 1SU8A 1TXGA 3F6PA 1B3BA 3DZDA 4RFSB 1BMFD 1NIJA 1Q20A 3UATA 3QX7A 3G7NA 3JVDA 2H2GA 3ICCA 1F5SA 1NY6A 3OIWA 4TS9A 4X41A 4YS6A 5EWMA 1DG1G 1Z4NA 5EJ6A 2PA0A 4OB7A 3HY6A 3V1KA 1XK7A 1F3OA 4AZ3A 3V34A 3NHSA 1Z28A 3B1XA 2LKDA 2WRZA 4GRIA 5IC5A 1Z07A 1O0SA 4DNQA 3KVVA 5H4GA 5T3YA 4J0JA 1AUQA 1QHEA 1CR6A 5F9MA 5LP1A 1E6LA 3E5MA 3NFYA 3CM0A 4I4TB 3A32A 4CQNA 1T5DX 4NARA 4V2IA 4R4JA 1HTWA 2KWIA 1RAGA 1TJ4A 3MT7A 5LKAA 5TB5A 4MVJF 2CXXA 3DTTA 1ST3A 1O57A 5C5DA 2FEAA 1ESDA 1TZKA 2IXEA 1QK5A 1ML4A 2XUIA 3T0GA 3UMYA 2QUBA 4KIUA 3HZRA 4JEHA 5K6TA 1XXHE 1UODA 4ZO4A 2FEPA 4QC2A 3TS1A 2FPIB 5BRNA 1RQGA 4FS8A 3VH3A 2RCNA 4BGIA 1ES9A 1YZNA 1ZVKA 1Y8RB 1GRVA 3DYVA 3U3ZA 2PVSA 3GD5A 4R98A 4BZPA 2IYPA 3P2KA 3DZGA 4QYIA 1OPRA 4TROA 5LMCA 2G77B 1DKPA 3NTXA 4MVWA 3LJKA 4PTYA 1T4CB 1BIFA 2B3TA 2WG0A 2GM4A 2VHQA 1TZCA 2RONA 5GY7A 2PBLA 1A2BA 1A4RA 4JDPA 1UPFA 3A9WA 3HS3A 2D5LA 4D0GA 2I99A 4FQ5A 4X1KA 5K3FA 2O8DB 1YL5A 4LIPD 4J0CA 3FPJA 1MFZA 2CYCA 1FTQA 2WPDD 3KOUA 2ZCUA 3A7EA 1BVRA 1Y37A 1X8KA 3W2TA 4P58A 2O59A 3C3DA 4YAKA 3IRUA 5AVQA 5KPJA 2P1DA 2ZW9A 5EP2A 1X94A 3F49S 4Y2TA 1VA4A 3OA2A 1GTMA 1SZJG 1FDOA 1PT6A 2CDCA 2GK7A 2R6R1 3LHIA 4QDUA 4YQFA 2YXBA 1T91A 1ZD3A 4FHFA 3FMOB 1G98A 4UQLA 2QPTA 2QTLA 2PWPA 1DWQA 4IIJF 3WVNA 1SUFA 4ZAWA 2SKEA 2FP4A 1RXCA 4BQRA 3PWTA 4GL4A 3RU3A 4A2QA 2JVJA 4EA7A 4GPBA 3V2UA 1KERA 3OQIA 4RVFA 2I71A 1FFSA 3KSDO 4TL9A 2HWYA 3RRBA 1RZUA 2P9GA 3WKCA 1FLVA 3R7AA 4B4DA 4EAQA 2NO4A 1EXDA 4BO7A 1FTSA 1UXKA 3MJFA 3OQPA 5ALMA 4TL6A 4N5DA 4NCNA 4Y2PA 5AK5A 4BNHA 4BZZA 2JJYA 1B41A 4BMNA 1MHPA 2P77A 2QN9A 3EQ2A 1US8A 3KVRA 3PNSA 1SXJA 1X2EA 1M2GA 2FZ5A 4MGKR 4MQMA 3VR2A 4BKUA 2BM8A 4OI0A 5HSGA 3ADKA 2HXGA 1K2WA 4KPEC 1NONA 1GCUA 1JHZA 3BILA 1ZMXA 3L8CA 2QRVA 4G9EA 1IHDA 2R1TA 3KJQA 5H68A 2WHPB 3S6JA 1P81A 3AFIA 1B14A 4R7ZA 1C41A 4K6HA 2PKRA 1U8YA 2FXVA 3BH0A 3WRXC 2C3PA 1ORHA 5A7GA 3W5BA 2XUDA 4ZHSA 4BTLA 5CDTA 4U9IS 5LDHA 1JE1A 3U3RA 3WLFA 3ZD9A 4AX4A 3IAM1 2UZ0A 5CDSA 4P82A 5D3MB 1MD9A 1ZEMA 1CSEE 3WNBA 3L92A 3RK1A 1B76A 1NKVA 1QJCA 1WBBA 3E58A 4RPLA 4P81A 2AI3A 4W4TA 5DI3A 4PBTA 4KHZA 1U7ZA 3KRTA 5FO1A 5CBPB 4YB8A 5J3JA 1E6UA 4PG8A 3E7DA 3QWAA 1U2RA 4OREX 4DR6B 2QBYB 1CUJA 1VMAA 2H48A 2A88A 2COEA 2HCRA 2WIKA 2FX2A 2C8LA 1NBME 2JFUA 1XDDA 1XKXA 3K94A 1L5VA 2C4MA 3A2LA 3NKFA 4GNKA 4N39A 1SU6A 2C0PA 5ALHA 4HVAA 3BF7A 1Z0ZA 5B6PA 3P2MA 1CUWA 1ZKMA 2DF8A 2NT3A 5EUMA 2V1XA 3RIXA 3STUA 4LY3A 4WRRA 3V48A 1R6VA 3A06A 2X0IA 4P54A 3KP1A 5HS4A 4KXYA 4GS5A 4NCHA 3PHIA 4DABA 4BXOA 1EFPB 3KTAB 1Y1RA 2EEZA 1LZLA 2GBPA 1N4DA 1YS1X 4QEZA 2EC5A 4CUKA 2VQDA 2B4YA 3L8HA 1X1DA 1PJAA 3NH9A 4D42A 3WGHA 2OB1A 1XZMA 2ZR7A 4L9SA 1G3IA 3WYAA 1PV4A 2QA5A 1EX9A 1C8KA 3LCJA 1LS6A 1F8YA 2VP6A 1DOHA 2O57A 2A7QA 3PF9A 3ODGA 4X93A 5BVHB 4GMXA 1Z2NX 4WY5A 3BJMA 1EIWA 3FFWA 4RMGA 2ZLBA 2IL1A 3H11B 5IAKA 3A1NA 4DQDA 4UAJA 4YCJA 2H54A 1IM5A 1W96A 3NM6B 4IILA 2CB9A 4V1CI 3HXQA 3QE9Y 1Y89A 4DVGA 2YFHA 3I0NA 4PEVA 1I8TA 5EFZA 4Q12A 3TSWA 4AMZA 4JJEA 4BNZA 1B6SA 4L02A 4QPCA 1XEWX 2H4YA 3TPZA 5KYXB 4QAJA 2RHOA 2XZDA 2ZZKA 4S2UA 3RYHB 2ZJ0A 4QJ3A 2G9RA 1P5JA 2CV1A 2WMYA 1GDTA 5I4CA 3QJ5A 5C1OA 3IMGA 2IVFA 5KVQA 3OFNA 2XH8A 1SBZA 4ZOEA 4BEBA 4I81A 2ERCA 3LOUA 4K1XA 3C3PA 5AH0A 2JH9A 1PP4A 1G8GA 4Y0NA 3AI1A 2D5AA 4BJ3A 1GZSA 1V47A 4DGQA 2C9BA 4TKVA 5HQ3B 4BN5A 3MMSA 1OYYA 4UZEA 1F4VA 2C31A 5AD1A 1QNLA 4MV0A 2GN4A 5DTQA 2X0DA 1RZRA 2EQAA 1AK2A 3AKDA 2AJLI 2BFCA 3K5PA 3H2HA 4LYYA 2G76A 4FJ0A 1JKIA 4NENA 4XOIA 5I5GA 5IDQA 3JASA 5JJCA 1UC8A 3ANNA 4A8JA 5I7HA 3IALA 1TGVA 2ZKLA 1P29A 4DLVA 1NRWA 5CYGA 1N3YA 3BEOA 3VR3A 3WGOA 2QTZA 3AEXA 4X7MA 4AMBA 4XD7D 3NVAA 4JELA 3VHRA 4YRTA 1P4RA 2NYRA 5C2JB 5JXWA 2G0TA 4C1BA 3N9IA 1V45E 2NXNA 2XEXA 1W36B 4ZQIA 5IFKA 2BEVB 2UXBB 1CZLA 3V4ZA 4E1AA 1X38A 3RBAA 3K70C 4R2WA 4YO8A 1LU9A 1CJTC 2XTNA 4LNAA 5FBRB 4Q9KA 3GRZA 4CLOA 2EP7A 4BVEA 1THGA 3L7OA 3ONWA 4X5OA 5LQRA 2XKJE 1S7GA 2HBRA 4MRPA 3WLQA 3TDNA 2V0CA 2OG2A 2PSHA 2QK4A 2C5SA 4DILA 1OPXA 1SD5A 3UXEA 4D44A 4L9AA 5KHOC 1PAUA 3UPDA 3UC9A 1NX9A 3DF7A 3GJ4A 1F3LA 3G79A 3N2NA 2QG9A 4MVXA 5JI3E 3DZHA 4CFZA 2WG2A 1GL6A 1FOEB 3MAGA 5ECYA 1E5DA 3V4VB 4CMIA 1T9HA 4C2TA 2GNOA 2QM8A 1MV8A 2HDHA 4O8ZA 4QUIA 5AICA 5BPFA 3Q2IA 4YRNA 4HWRA 4Q9AA 2XWPA 2SKDA 4X1KB 4P3PA 1QQ7A 3KHSA 2YNMC 2H5IA 3FNIA 1XVIA 1E79D 4C4AA 2VWGA 1J9ZA 3E7WA 5LYJB 4R01A 3EISA 4HH0A 4ZVPA 2XA2A 3KBOA 3HCPA 1SVNA 3EYWA 3OTWA 4V2UA 3WI7A 5D00A 2ZJOA 1R6UA 1RBYA 3HBNA 3RM3A 5L53A 2BM0A 1V8DA 3H2SA 4QELA 3IL2A 2O5RA 1FFGA 2Q5IA 3CEHA 3ELDA 1OIXA 3NHRA 3HCCA 3KE8A 3CLRC 4LXGA 3IP1A 3IT0A 2EQBA 1SB8A 1FFHA 3CHYA 3MWKA 2I8CA 3CVOA 1A95A 1R12A 4TPKA 5AW2A 5JY1A 1QAMA 3ZWPA 3LMKA 1XQ9A 4OAPA 3A1FA 4DLAA 2J3KA 4ZMBA 3P2YA 3M49A 4WXPA 4XH9B 3FLEA 4DRZA 4KL8S 3HUTA 4P8RA 4QASA 2N1BA 3EFBA 3ASUA 4TV8F 3EFHA 2LKCA 3HDYA 5BOVA 3AV0B 5JQGB 2LGJA 2P7IA 3H8JA 3LZDA 3GLHB 3P52A 4H4CA 3WLRA 3QXCA 4COKA 3K72B 4N5LA 1JHXA 3ZHUA 3LSTA 4KQ2A 4CM1A 2JJMA 1II8B 1LDBA 2F2TA 5AFSA 2H2HA 2W2TA 5KC8A 4BJ5A 3H18A 2CNNA 4OLJA 3U5ZB 4IH1A 2WQ7A 1YQDA 3M6VA 4YA6A 3RS9A 4MUNA 2GPTA 4C21A 5J2TA 3THWA 1VL8A 2H1FA 4DV5B 5IJZA 5TPZA 5AVRA 3SS7X 1MRZA 1ZA2A 3HZOA 4HDMA 4I5EA 2R1TB 4OYYA 3WGNA 1M7HA 2ZK7A 1S2DA 4J1TA 4QDOA 4A0QA 3NVKI 1G6HA 1GG5A 5LQMA 5KU7A 4AO6A 2QMHA 1QUFA 3LC7O 3I01A 4ZI7A 1Q3KA 3K16A 2FWBA 3AF1A 3M6LA 3THXB 3OM8A 1OLUA 2Q50A 1BN7A 2J4DA 3M3PA 3AINA 2FSSA 3VYSB 5B30A 3I62A 1LQ2A 1JBEA 1VKZA 4IS3A 4WOPA 4BO6A 1PS9A 4NYIQ 3V4RA 3G0HA 421PA 1CDOA 1EE1A 1UMDB 4OGWA 3HH8A 1DC3A 4EG8A 1IOWA 2I3DA 2PFKA 4L28A 3ZCPA 3ENWA 1J6UA 4MV5A 4DQXA 4DM4A 1N2EA 1NRJB 1GYRA 2ATEA 2XDQA 3CH5A 4GOOD 1CZNA 3W8FA 3ZK7A 1GAEO 1EAYA 2C0CA 4CQLA 3L4EA 5P21A 3B38A 1W6RA 1O94D 3P1JA 4J29A 1GKUB 3TTTA 3HP4A 2Q45A 5LQKA 4TM7A 4RAQA 5F4ZA 1NN0A 2G6BA 1WRBA 4HQ0A 5AVXA 4X66B 2CNLA 3OCWA 4U6QA 3HDGA 2VFAA 4KXWA 4P83A 1M2KA 1RS0A 3LQKA 1CJVC 4AO8A 3MZ0A 2HUPA 5LC1A 2BFOA 1KSGA 3NAZA 2QJWA 1G8MA 2OBYA 2E82A 4YCNA 2VTVA 4ZQHA 4TQGA 4Z7NB 5FNVB 4KFTA 2MCFA 4I8DA 5C7YA 2IITA 2C58A 3PR2B 3SPXA 3QLUA 3CZ5A 1KK2A 3VH4A 1YE3A 4Z7OB 3UG6A 1K4YA 1XTPA 2ONCA 3CR3C 3K96A 3V00A 3WNDA 2CXPA 3CS3A 5CIWA 2AIRA 2PZJA 4WLUA 4EM6A 3G9XA 4HDSA 5CNIA 2BSAA 4L15A 1C1DB 3RRFA 1XXLA 1IL0A 2B99A 2YZGA 3E70C 3G2NA 3HKBA 2IX9A 2Z1DA 3HL4A 3PHHA 3UMGA 4AZ3B 5B57C 3IP8A 3AGPA 3IQEA 3T7IA 4RSGA 1P4GA 3HFJA 3II6X 3WYBA 2WMDA 2X8WA 3IAFA 4WE3A 5BV2P 4KOAA 6REQB 2AW3A 4K9LA 2R7LA 3FN4A 3JYHA 4H35A 3BGSA 1OC2A 1E7QA 3QUBA 1DDIA 1EBBA 1GCOA 1W4ZA 1JIIA 2NIPA 2C2BA 3GLUA 4FDMA 3LCCA 5KOHA 5C34B 3URKA 1XCLA 1AKVA 2DFVA 2H31A 1G5TA 2ZRBA 5GGYA 1I7DA 3PDIB 3IJ5A 4NP6A 2E4AA 4RWZA 1TVKA 4OJKA 3ZWMA 2ZUFA 4IYRA 3WBFA 2P6RA 2DXIA 4GUDA 2J31A 2QENA 3H4TA 4DWJA 1L8OA 4IV5A 2ZE8A 3IODA 4W8HA 5CT9A 3T38A 4D0RA 3WP1B 2W2LA 1HUQA 3DP9A 1GPDG 5C7IO 2B4TO 4ZT3A 1GG9A 4KR9A 5BT8A 1P2GA 1W48A 3CQ9A 5DN6A 1PJ4A 4QFDA 4MUAA 4ZA2A 2X8BA 5K0ZA 1MOZA 4ZCTA 2R84A 5ICSA 1JDTA 1UJMA 2OV8A 1BE8A 5J4LA 1CS0B 3OKFA 4TXNA 3J7TA 2GZ2A 2D1FA 2F64A 3A4LA 4FUQA 2YQ4A 5GJCA 4TLEA 4C4ZA 5WRFA 4ZDJA 1LDEA 1I24A 1T5OA 3KZXA 5KYGA 2UDPA 4MMXB 1LS1A 3IXMA 4CHTA 1X7ZA 4BKQA 4DTCA 3C24A 1FLDA 2JGKA 1I51A 2JL1A 5BXQC 2A57A 1IIRA 2FK7A 3REFA 1FCJA 1Z4LA 4EF6A 3JQ8B 3WLJA 1KC3A 2VBGA 4H7JA 1XT6A 4G0XA 3B1KA 5C8VA 1DQNA 1RDFA 2CGEA 2HQRA 4JYBA 3MT0A 2CE2X 1R0LA 4PLCA 4D8TA 2NU7B 821PA 4RTSA 2H1HA 2NG1A 2QKYA 1JTVA 2FGJA 2CLOB 1Y4UA 1R9MA 4FIZA 4IUYA 4OKIA 1C0LA 2D0DA 3H9BA 4L5CA 4U2KA 1UEXC 2JK1A 4AUNA 1UJCA 4M55A 4CGYA 4Z1MD 3SOPA 4YPFA 3L9WA 3UT5B 4IY1A 1EWQA 4XCXA 3PF8A 4HNSA 4J9UE 3IC5A 5A3QA 2GASA 3MAAC 4UFNA 3T3HA 3Q87B 3TLGB 2X0KA 3VKHA 4XEHA 1NZFA 4HLQB 3RSFA 1EFAA 1X7YA 1Z6TA 5I48A 1CRPA 3B9RA 3JQQA 4RANA 2I1WA 1BQEA 1EESA 1R0YA 4K6MA 3R0ZA 3E7XA 5KVSA 2BTEA 1T8RA 2FHPA 3SS8A 5E95A 4F9TA 1QKJA 1EBFA 5EIFA 2V9CA 1KPIA 1J1IA 5IT9A 1G9SA 2FRDA 4KE8A 2AE2A 4QXMA 3VR4H 2VAXA 3GVPA 4GIBA 4XIYA 4E5DA 1QYCA 4G25A 4F72A 5J2UA 2W2NA 3V8PA 1L5YA 1U9IA 4RJLA 1HFWA 2Y6UA 4FS3A 4D3DA 4H77A 1GSAA 4NIMA 2YWXA 5HRUA 1TJPB 1JTFA 5BQ3A 3T5CA 5CW2A 1SQ6A 1U3CA 1PFYA 3OWHA 4D8VA 2AMYA 2EWVA 1SPBS 1PR4A 1G6OA 1Z4IA 1N7JA 1GPUA 1PJ8A 1W87A 3MHPA 4HZUB 4PQEA 4AKTA 3OQVA 2PX4A 3H3JA 4KXQA 1DEOA 1ID8A 2JJ1D 4ITUA 4K8OA 4QPNA 1YBVA 1QDLB 5KVAA 4BMVA 1Z36A 4DAOA 3THXA 3UWKA 8OHMA 2C7BA 3SC4A 2W6ZA 4YR9A 1C9JA 5L40A 1PZXA 4WINA 1U3VA 3GPIA 3UWSA 4Q37A 3VZBA 3WGKA 3UEOA 4ECAA 2YQZA 3W6PA 2JA1A 3BKWA 3FDZA 3R3WA 1K4KA 5DGIA 5EXEA 3T3MB 4Z7QB 1XNHA 2I6XA 1H66A 3C8HA 3H11A 2KLBA 1KJQA 1N2SA 4UD2A 4E51A 1OF1A 2WWIA 2IYSA 2B9EA 2PZBA 4JC4A 2B20A 3C7TA 2ZSBA 3DMTC 4AMVA 2E5WA 1U7TA 3O8OB 1M0SA 3KTFA 1ZAYA 4JVMA 1E6CA 2O0HA 5CYOA 3T7SA 1RXVA 3EIOA 3H4MA 5BQFA 4JC0A 2W37A 2QE7D 3IQIX 4GYKA 4IGEA 2P27A 5KTOA 1ADYA 2MSWA 4JDUA 2CHVA 2BDTA 4RLFA 1NV8A 2VHJA 2YS7A 4ZHQA 1FRQA 5BPHA 3QHQA 1H69A 2WTAA 4DY6A 2R48A 4YFYA 3EIWA 4GMHA 3ZZ1A 4ONEA 2PBZA 2Q41A 4ZCLA 1KKUA 3JU3A 1BXKA 1XYVA 5EWJB 4V38A 2BLNA 3HCWA 2GETA 1N5MA 2WKPA 2BR4A 3QI2A 2PH7A 3PPWA 4FOPA 1KEEB 3OEHA 1GR0A 1L7NA 2FETA 3PEWA 1YRHA 1RABA 5BXYA 3HKBB 4E14A 3MMPA 4NDZA 5DGTA 2ZCJA 3BK2A 5B7GA 4WFJA 1X8XA 4KPFC 2BHTA 3AEYA 1EAMA 2LPMA 4YYEA 5F76A 2ZRMA 2V6IA 2YWBA 3LQ4A 5AOVA 3GWGA 4GSKA 4JZYA 3UXYA 3THYB 1PWXA 2A5LA 2QRZA 3V1MA 3I8XA 4JGGA 5C8DA 4G0WA 3AF0A 3A9UA 1TCBA 2VP0A 3KYIB 3ILYA 1E3EA 3SZUA 1Z4KA 3ERCA 1H4QA 2V7BA 4FQ8A 4PYLA 4D80A 4G23A 5E3HA 1T1JA 2A0XA 3CJRA 4BLUA 2Z5VA 4MULA 1NWHA 5DFAA 1D0VA 1ZR4A 2IP4A 3SP1A 2YV4A 3QE2A 5SZHB 4RF3A 1YJQA 4KREA 5DGDA 2QLJA 3AEKA 3QPVA 4Q15A 4L07A 1OAOA 2VF4X 2QRKA 1RP1A 4INPA 2PEZA 2IE0A 4DJDC 3M3DA 1EXWA 3ABRB 4RE5A 4LFCB 4B09A 4B8ZA 1T5IA 2EFHB 3FCEA 1O95D 5AJYA 3ZW7A 3DEZA 1Z6QA 3F7TA 1T9AA 3PUZA 4H27A 5JLAA 1WMEA 4DUGA 4EUKA 4YXWD 1JRLA 4O4IA 3PG5A 4TTVA 4EY4A 3EQ6A 4H17A 3WGQA 1M34E 1YE8A 2OVBA 3NFRA 4UEKA 2WTXA 1X3SA 4YRBA 1M5TA 1VYUA 4XVRA 5JYCA 5GZ3A 3VTAA 4N5HX 4G84A 5DP1A 3UW3A 2E4VA 3AESB 3ST7A 4B76A 3R40A 3I5MA 1V5IA 3PA8A 5CEFA 2JIRA 3LQ2A 2HBYA 3KQYA 4WOJA 3UWPA 4BYMA 4EY7A 1L7QA 2Z5FA 4D9MA 2VATA 3WNQA 3RE1A 2B30A 5K8JB 2WF7A 3BAZA 1ZUD1 2FPPB 3KKOA 2YWRA 3L49A 4OFXA 2OFXA 2B69A 4FBMA 5AOCA 4LZLA 2O3TA 3KEGA 4NABA 1J97A 4BLRA 3IEKA 4OYRA 1OY1A 1NW3A 4NXMB 2EJBA 3K9GA 4PC1A 5HFNA 1G8KA 1T8PA 4GLBA 4ZC1A 1YXMA 4BV2A 3F97A 4AC9A 3KVNA 1GFSA 5AW4A 2H3HA 2QLBA 1KS2A 2OAEA 2DAPA 4HLCA 2X1MA 3H5OA 3QBVA 5AM3A 5JXJA 5K7SA 1SK8A 3DKRA 4NZMA 4UUNA 3UCFA 1T6NA 1NBIA 3A3OA 3KKEA 3HCOA 5ILGA 2Z8YM 1WR8A 3GAZA 3OCXA 5CFMA 5C1DA 2QLMA 4EQZA 4MRVA 2J0EA 4GI1A 2VHWA 2M6LA 4B7UA 2VH5R 3ZE1B 3RVOA 1Q0SA 1T9KA 2PUHA 3WBKA 1KP9A 2WHYA 2QMEA 1XWFA 4OLAA 4TYNA 4E2WA 1Z2PX 1Z4PX 2OPHA 1M6NA 3UF0A 3V32A 3JX9A 4CI0B 3PT9A 3ETJA 1DWUA 3N59A 3U60B 2RGCA 1VXRA 4EOGA 4OXIA 3FBWA 1BFUA 1PL8A 4WSOA 3KWFA 1RAIA 4C6TA 4J7XA 2Y67A 2WNIA 1W36C 2EAUA 1E3DA 1QCDA 3EA0A 1AGXA 1JKFA 3FAZA 1L4HA 4OMCA 2AFIA 2ZBRA 2VUTA 3S1SA 5A06A 4F3RA 4X85A 4UBOA 1S3GA 2IKQA 3KEOA 1YS7A 4KYTA 4N49A 1FMFA 3TQCA 1HFKA 2CLIB 1GUYA 2P4HX 1H42A 5ECWA 5BWBA 1Q0HA 3DDNA 2QJFA 3D6TB 4MPTA 3LNCA 4DJTA 1RJGA 2B6HA 5LMNB 3K5IA 2Q6LA 1CQJB 4X64B 2ONYA 2A0FA 2TYSB 2VHVA 4QXOA 3N6XA 4UAVA 1SH7A 1XZAA 3C3WA 3PNYA 1U8ZA 2UZAA 4HNAB 2AG5A 1B8UA 4M9SA 4MH0R 4U7FA 2CEAA 5ALLA 3IJRA 3CX7A 4GXTA 1QRAA 3G8AA 5ITZB 2PUAA 3R3ZA 3GN1A 3CNBA 3U9LA 2FFRA 2GD0A 2LCIA 1WHTA 4LRUA 1LD3A 5ALKA 1GPYA 1QE0A 1E3JA 3W05A 4RH3A 4WBNB 2ZPAA 3V8BA 1V26A 1JU4A 4FFMA 8AT1A 2ONJA 3LW7A 2BISA 9ATCA 2IU3A 2BE9A 3FH0A 1PTJA 3Q3EA 1K88A 2QU8A 2OE2A 1LA2A 1BCRB 3I42A 1BU5A 2HA5A 2PVCA 3EW9A 1GFIA 1WDWB 3K0SA 2ZVJA 4PPYA 4DIKA 4CMCA 1SD1A 2AI1A 3FSRA 2POQX 1G63A 2H06A 4PN3A 4TRRA 4AFNA 1XCMA 2JH8A 1ZGAA 5EP3A 4BO0A 2JD0A 3QVLA 4REMA 4AWXA 4G5YA 5I7RA 5DSXA 1J22A 4CWAA 5DMHA 5IT0A 2VHUA 1PIWA 4L0MA 2JFGA 1NPDA 2EOAA 1AT1A 1JDVA 1AV7A 2YUTA 3T0IA 1YA4A 2B2NA 1XRSB 4L95C 4BIMA 3OT4A 3CX3A 3ECAA 4FYYA 4CF6A 1C1HA 4PLVA 3UUWA 5M3BA 5IJ9B 3DEAA 4FCWA 3EQ8A 4IRUB 3EH1A 1WXXA 2AXEA 2Y3IA 1SR8A 2FW6A 5JJBA 1XCPA 2WFMA 1K8RA 1Y34E 3GMDA 2ZYRA 1TD1A 9MHTA 3K0FB 3PXEA 4KACA 1JG6A 2ODQA 5E1DA 3LXUX 4U00A 4TXMA 5CLLA 1VBNA 2J6BA 3CONA 5A02A 2JBAB 3P0EA 4XYEA 1M8JA 1VSVA 2ZZNA 3AJ8A 4Z2YA 4RVNA 3TBFA 5B4UA 2O0JA 2B25A 5K0TA 1SZCA 5B1DA 5BYJA 4EDHA 1QH9A 4PZZA 3IQGX 4QJ4A 3F7OA 1NBMD 2VXBA 1WCWA 4YI5A 3SK0A 1NP3A 4ND3A 3OVMA 3H7AA 3A4YA 1U0FA 1U9JA 1CDEA 3HVJA 3OIUA 5KTNA 4CDRA 3LUPA 4KFRA 3W77A 1PR9A 4PE5B 3TW8B 3OTIA 1T5TA 4MTLA 4BLQA 1JDUA 1QZUA 3BBPA 1GL3A 3WTCA 5F7XA 3ZJTA 4UKDA 5TXGA 3LFUA 4Y1EA 1GADO 2ORVA 3Q6MA 4TVOA 4AN1A 3WWCA 2C4VA 1VE1A 3OZGA 1Q7GA 2QGNA 1JFFA 3KQWA 3JWPA 2FW7A 3SXUA 3O3NB 3TCKA 4J07A 4B79A 1XTTA 2EKPA 1VIDA 1FRVA 5KNBD 3WGJA 2OESA 2D1TA 1BXRB 3OIYA 3VMMA 3FCSB 3LO5A 1YZVA 1GWNA 2AZMA 3LYUA 1PG0A 3VR4A 4DMCA 1U7DA 1ZWKA 3I6YA 1PX2A 5CITA 1J39A 3AIKA 2GD6A 3ABIA 1H0HA 4N0EA 5KNCH 1Y6JA 2WHEA 4JB8A 3PDWA 1E9DA 1UM9B 1SUIA 4D74A 1WCV1 1B42A 3SYLA 2Q9CA 4KB5A 4D57A 4HAXA 2W2OA 3L4JA 5MHTA 1NVTA 3EOAI 3UJ9A 1NIPA 1WCYA 4IBOA 3TQSA 2EHJA 4R1UA 1EXNA 1IDN1 2P9CA 2AFHE 3CLUC 3HU5A 4CEIB 5TT1A 3G8CA 4ZYZA 5CD1A 1DJNA 4TMWA 2W43A 1Z8HA 1B93A 3OEED 4XGQA 2H1OA 1K5GA 3OM9A 3GIDA 5E9QA 2GLUA 1SXJC 5IVKA 2QZJA 1KBQA 5KSWB 1E60A 2GGSA 3I2HA 2RHGB 3PDCA 3PXCX 5ALGA 5K4GA 3QELB 3QLEA 1XUOA 5D7NA 2ATCA 3JQ7A 1V8OA 1RWVA 3L8ZA 1BCSA 4OQQA 3QFFA 5KEIA 4FDAA 2QT1A 4BWYA 3NHJA 3UJAA 1Q3HA 3M0EA 3EHDA 4EVIA 1HE5A 2WVAA 4QWMA 1BS9A 2K87A 3CCCA 1SHTX 1REQA 2ODTX 4GQAA 1XQ1A 3VR0A 1BVHA 2C4TA 1O77A 1ULTA 1MN6A 3HRHA 3ND7A 5ESXA 2BKUA 3QMWA 1EWVA 4DCVA 1FYVA 1KYTA 3OCJA 4HDNA 1WLSA 3T9DA 3TL3A 1CF4A 1Y7LA 4J4TA 2JZCA 5DYNA 1EDBA 2INGX 4JL6A 1S01A 2X7HA 3M5PA 4OJTA 4XX1A 2IOYA 4PR3A 4C4TA 1ZUIA 3SOZA 3KR2A 4UM9B 1GPBA 1TKAA 3GOHA 1GA1A 2HLHA 5JQGF 3CE6A 4TRJA 3CNOA 5H3LA 1B2RA 4G8DA 4HEA1 3TOCA 2O05A 5T5QA 4GL2A 1NRIA 3HSSA 2QT0A 2YXPX 2I29A 5TARA 1XZ8A 4IINA 1Q12A 4TYYA 1GQOA 1PR3A 2Q4BA 1FU7A 5FWDA 5BN4A 1ZOIA 2MR6A 3HY3A 2O8CA 1ZSNA 4MIOA 5JJKA 2FMKA 3OICA 2B1IA 3RAGA 1M2WA 1VE6A 4GYWA 4YLYA 2IS2A 1THMA 3BXGA 4TGLA 4FCVA 1YCFA 2QZ4A 1NF8A 1P8AA 4HQNA 4JI2B 1MTZA 2X2EA 1FLAA 3WQBA 3DOCA 3DW3X 3HXTA 4K3UA 1CZUA 4YJ2F 4ZGBA 1C9DB 2Y1GA 4FPXA 1DELA 4TLDA 2H57A 2GVNA 1ZOSA 3C1UA 3PLNA 4N12A 4NLLA 2XW6A 2IX3A 2OUKA 2WT8A 4LCEA 4OXYA 1V35A 4YUYA 2H00A 3NWJA 5DK6A 5T3UA 4DA0A 5EZ6B 1NJGA 3CMCO 4NAHA 3DG9A 1MFPA 5HQTA 2AKEA 4ZPXA 4CIXA 4KR6A 2I5PO 2W2LD 3STHA 4IQGA 2GPYA 3VOSA 3X1XA 3DD5A 3JQ9C 1KO8A 1N36B 4HH4A 1U3TA 3E9YA 1UXGA 4YMWA 4DM7A 1X19A 1MPXA 4FFNA 2ZTMA 3A6PC 2DOKA 4I6EA 4HNAA 3B6KA 1V1MA 1YRWA 4A1FA 5A1JA 3N2IA 5IKXA 3SQLA 3SI7A 1IHXA 5FR1A 2D5CA 3WRYA 1QHHA 2ZBQA 1OV6A 4KGVA 1KQGA 3ZV4A 4U7PB 1X9IA 3UANA 3CRVA 3AU9A 3RV4A 3KZCA 3PIDA 5LZ2A 1L4FA 3KYDA 1Q2XA 3WQHA 2XMQA 4MIYA 5TVGA 5D6NA 1YI1A 2I4OA 3TLBA 2YNMA 2CFOA 1GIAA 4DCSA 1I2ZA 5LQDA 3E22A 2IOQA 4DA8A 1TNDA 2JBAA 3UUFA 1JJAA 2AJTA 1GA6A 4RHXA 1RM4A 1P33A 1H8HA 2FEMA 4RX1A 2CMGA 2BTQB 4YXWA 4PQFA 1LVHA 3NATA 2HC9A 1WD7A 3GFQA 4YASA 1I6WA 1PS0A 2J0QA 1KNQA 4N3AA 2SKCA 4K28A 2Q7DA 3RHTA 2X0NA 2VYVA 4FM9A 4PZ9A 2PRJA 4PRKA 4A0HA 4LJ4A 5IJ9A 1KDTA 2O2DA 1YBMA 5AVJA 3V8MA 2AXNA 3IKJA 4LHSA 2MINA 4PTZA 1QXSA 2CE7A 3U49A 2UYOA 4W9RA 5K3FB 4CODB 5J4YA 2QVCA 1WVIA 3IQZA 2WB4A 5K5EA 2BMDA 2IQIA 5EVCA 5PGMA 3OZXA 3ZGXA 1V95A 4BCBA 3MFQA 3RANA 4FBLA 3RDPA 2P5TB 2EFCB 2H1CA 1W0JA 2WU1A 3AHGA 5IFLA 2ZE6A 1BEEA 4V0LA 4G0NA 1RJFA 3QQPA 1DBIA 4IFTA 1W1IA 3KSBC 2IP1A 2G09A 1NVDA 1I13A 1WXGA 2C88A 4IVPA 4WCVA 1TYEB 3OTQA 3FR7A 3WY9A 4BHTA 1TAGA 2ZAYA 4QYIB 4C5BA 5BN1A 3K0CA 3JR7A 2XCSB 5DHQA 5G41A 2PUEA 4X45A 2O8BA 2AF3C 4A23A 3H16A 4YMSA 3JD1A 4DIBA 4EW1A 1X92A 1RXYA 5JYDA 4DNFA 5KYKA 3MXOA 3BH7A 3GA5A 3MNFA 4DRXA 3WIBA 3GJ3A 3SX2A 3QE0A 5BT9A 1UADA 2A5GA 2VHEA 2X19A 4HR7A 3OQJA 2FYTA 2I2BA 3HJUA 4UM5A 1XZEA 3H5NA 4KQ1A 4AECA 4Z5XA 2BF4A 5L3ZA 3GQBA 3PFWO 1CY7A 3C2QA 1NVMB 4S0XA 2VAVA 1XK6A 1C1XB 3JQFA 3PEUA 1CQZA 1UBUS 1E63A 4P2BA 4ALNA 1T8SA 4G1UC 1BE6A 4TV9F 2FA9A 4ZVNA 5JIBA 5KHLB 5KTTA 1EFRA 4CEJA 4CKEB 2ZP1A 3PCXA 4MINA 5C18A 3IVCA 5ADHA 3MFYA 4UEJA 2QU7A 3GJTA 3NEPX 4ZZ3A 3MOSA 3ZH9B 1C7IA 5KMGA 1DKMA 2VHCA 1QP7A 5K0GA 1N7GA 1V5WA 2WZDA 3GJYA 1EUDB 1URPA 1PL7A 1XCOA 4Q1DA 1KMCA 2OAQ1 4QSMA 2IV7A 4RULA 1GAWA 1CR4A 3E27A 3S3TA 3R41A 1Z6YA 2DT8A 3ELUA 3PUWA 4A3SA 3AUXA 4PNHA 2ISQA 2XCLA 4X8LA 4YGYA 2O8EB 3D1LA 1P4SA 1NMYA 1DKOA 1B23P 4BNGA 1LWOA 5HNKA 1SOUA 2ZXUA 1EINA 3EXIB 3G0DA 3RQSA 3SKXA 3SYTA 1JDSA 1MG0A 3VV3A 3WGYA 3A6FA 4E13A 1QHGA 3NASA 4LV8B 3I6BA 4FMCF 1E2IA 2P0AA 2W6IA 2J9ZB 4E7OA 3D0OA 4KLNA 1JIVA 3KOYA 4C0SA 4TMVA 4FNGA 1X15A 2Q5FA 3T7AA 2R9VA 3PFNA 2PGOA 2VQ6A 5CA0F 3O8RA 1REQB 3PPXA 1Y1QA 4L4YA 3UHPA 5CM8B 3TNFA 4C3VA 3MQ2A 1T43A 1A8SA 4TKUA 4HLUA 4KAJA 2JIMA 4NEQA 4MPRA 4BATA 1SHKA 4HMQA 3H8VA 3TTVA 5BNIA 3NT5A 1ZIDA 4FOTA 3OE7D 4O4HF 2V03A 3GFTA 1I5RA 1QORA 3T1QA 4BFLA 1PEDA 1U0JA 5CW1A 4CNBA 4CCYA 4O25A 4CM9D 4D6YA 2E5LB 3CE9A 4IVRA 4N48A 3MT9A 4Q4AA 5DF1A 3U3XA 3KR0A 4WBNA 3ESAA 2PXAA 3CNQS 3NRBA 3O9MA 4IR7A 5JD3A 3TOSA 4U6NA 2OXFA 1L7PA 3OC6A 4L57A 4CR8A 1PR0A 1RE1A 5D2CA 1SA0A 2XGMA 5FT9A 4UQPA 3TLZA 3RWBA 4E4YA 2VP5A 4GKJB 3BJIC 5KYXA 4RTOA 4ON9A 1E4OA 1N2ZA 3LTEA 4IS2A 1VE5A 2QR5A 4BXOB 4KXUA 5LJLA 3IOMA 4LDPA 4JHLA 3GUZA 1OYOA 3TMAA 1JAZA 2H2IA 1VHLA 4NBTA 5E8JA 4UXHA 4I5IA 5IAEA 3O8CA 2Q46A 4XCQA 3UM9A 4XVUA 1ZXXA 4TLBA 3NBFA 5EHXA 3PENA 3I9JA 4NJEA 1YR1A 2NP7A 2BMEA 2FQXA 3VR5A 1E89A 3H5RA 4V0SA 4X54A 1FFWA 1L5WA 1V5GA 3OURA 3SYMA 2FFQA 2PH1A 2O54A 2PJDA 4YN3A 1OWLA 3HXPA 3AJEA 4PQRA 4U2GA 1JB1A 4A15A 5FTKA 1JMYA 3Q9NA 4QBIA 1KJIA 5FOXA 1XAJA 2C2WA 4ENWA 4UC0A 2RHBA 3R9KA 2H1LA 4OUKX 4C7OA 1PT9A 3TW8A 2ZQ5A 2P11A 4BASA 1ZL2A 3MMXA 5JZ9A 4R8KA 5BMVF 5KQGA 1JSLA 1E99A 1E2GA 4WA7A 4XIFA 1X7DA 1OV4A 3GNTA 1TQ2A 3C43A 4ESOA 2VG8A 1RSZA 4JI0B 3QLJA 3DTVD 3ROTA 2WU8A 3PA6A 3DMHA 2BEVA 4JVOA 1ENYA 2QZSA 1C9KA 4R8RA 2HJ9A 5EKDA 3F5QA 3G68A 3UWOA 2JJ1A 4IOLA 1S5PA 2PKYX 2IYNA 5FTNA 5I4BA 3E22B 1YAHA 4ZANA 1C3XA 4I9NA 1H3EA 2BFDA 3CX6A 4BX3A 1SOWA 4QJ5A 4UOZA 3QMMA 4BWGA 4G1CA 1K8ZB 1ZOPA 3HM2A 3LUJA 2IU0A 1V2HE 5BRAA 3BTUA 5I9SA 4M1MA 2WIBA 1A8IA 4AJ1A 2PGNA 2Y05A 4JASB 1PL6A 1Y6RA 3CURA 1E96A 4L76A 2RI1A 3FJYA 5FUWA 6GPBA 3OEYA 2HB6A 1NPTO 3IERA 3C97A 1CUBA 3EZFA 3KBBA 2QYTA 2DTDA 4RIGA 4I50A 3JVUA 1JQAA 3PHJA 1NW6A 2WD7A 3MILA 1JWLA 3D6NB 4YRRA 3WSTA 5ARBA 1YV9A 1O8BA 3F9RA 4ANFA 1T0UA 3Q9LA 2HIMA 3Q12A 4DSOA 2VQEB 3WMFA 4K6OA 4CKBA 1IFXA 2P65A 4M38A 4UCQA 2C4WA 4EHAA 3NR2A 2HRBA 1NXTA 3MIZA 4ZI7F 4EX7A 4QBHA 4LFAB 3I30X 4RQUA 2P9EA 3QK7A 2HT6A 1GZ3A 2E1PA 3IP9A 1NUSA 2XECA 1A8UA 1OH8A 2FFJA 3R44A 1L6RA 5HMMA 2BEWB 3PVZA 4QSHA 2AR0A 2PH3A 3GCZA 4LZOA 5LIPA 4FGZA 1IXZA 3KELA 2WTEA 4HDNB 5JBNA 3NMUF 3QUCA 1A71A 1DHTA 2GF0A 3LW8A 4UDOA 3SX0A 5HUJA 4BY9E 5FQOA 3KO8A 2I7VA 4BP9A 4LBZA 2HWWA 1XAIA 4J0HA 1ZOOA 4K6GA 5KQPA 5DN6D 5JQGA 1EP1B 2P6UA 4DIMA 2DHCA 3HBAA 1AC5A 3RKRA 3WS7A 4UBLA 7REQB 3W5AA 4MLCA 5BV7A 3SEZA 1FTNA 1T9BA 1QE5A 3ETHA 1VJCA 5FPSA 4LK2A 4OJMX 1EDDA 4S05A 4QPDA 4RXMA 5J40A 1R66A 2I6QA 1PRYA 3LUAA 3ZZTA 3G2KA 3H1GA 4O4LF 3RYCB 3QEMB 3LP5A 4WT7A 2NU7A 3QPWA 1CZOA 3EVGA 5B4TA 4Y6SA 1FNDA 1FDRA 4N7RA 4XYBA 5EINA 3RJ5A 1GITA 1K8XB 1TL7C 1QFXA 1WOMA 2R6DA 1GKYA 1KAOA 2R7KA 2UVPA 2VEOA 3KZVA 4YQYA 5FLYA 5ADVA 4LRXA 5EIAA 4ZVVA 2C07A 4KE7A 2NW6A 1V8PA 2PU5A 4KGZA 5CXXA 4INOA 4KO1S 4D81A 3WGUA 3EDMA 5DULA 3WZMA 4MYDA 3KYJB 5EE1A 2Y0EA 3H1EA 3Q85A 1JT9A 5CNKA 4K9DA 4MCJA 1WCIB 1RQLA 3C3CA 4BE9A 4E5SA 4OQMA 5FDFA 3D1JA 3KKLA 3WTBA 4IZIA 4C87A 3JATB 2BHNA 1OH7A 1R2QA 4HDMB 5KHAA 3FUVA 3KLNA 2I03A 4O2AB 2OCKA 2NUPB 3WIEA 1QRTA 5ECGC 4P4NA 3A05A 3QU2A 5LZ5A 2XYQA 5BN3A 3PNOA 2J0VA 1SQGA 4JU9A 4URWR 2X3UA 4JBIA 1I4EB 5MN5A 4FDLA 3U9SA 4BO5A 3IQFA 4ZN6A 4TX1A 1IXRC 2CJXA 1S8OA 3RYIB 4H1TA 3GMTA 3H5LA 4LVCA 4WPGA 4DJAA 2OHXA 4JMPA 2XUKA 4GH5A 1RI5A 2OD7A 1N77A 4DCNA 3B3FA 2XCOA 2DUNA 1A2OA 1EWTA 5A03A 1X7GA 2Z9DA 4Q7MB 3IBFA 1ZGZA 2DFPA 5BOSB 1HORA 4KMOA 5DLPA 1VBFA 3WNZA 1Y4AE 5F5XA 4EARA 4YCSA 3BQMB 2BMWA 3IV9A 1D2NA 1U1IA 2OHVA 2AZDA 1HEIA 2E37A 2CB0A 1XWIA 3DOHA 2R2GA 3IT1A 1J2TA 4IRMA 2Z5GA 4L7QA 1P2UA 2JEYA 4TTQA 5EJGA 1OXXK 5B7NA 2Q3JA 5K0BA 5KINB 5AW6A 4O4LB 3O38A 4IO0A 4JI4B 2QVZX 4CMKA 2GYWA 1KH2A 1VYHA 1W0JD 3IQHX 4LCBA 3O8QB 2P69A 3LQRA 1KF0A 4MVJD 4F3TA 2QYSA 3BXXA 1VJ0A 3H2YA 2C9YA 3GN2A 3KQTA 4NBLA 4GZMA 1TVKB 5ESRA 2OQ2A 1R0ZA 1LB1B 3SR3A 2WUEA 2GHIA 5HIIA 1X87A 3LI2A 3RC2A 5EWJA 5C31A 1BSVA 4C5CA 3MN1A 5FFNA 1UH5A 1XFDA 2ES4A 1C0KA 2GKOA 5AHOA 3QQ5A 2ZUTA 1UBTS 3Q6NA 1R1DA 3VX3A 3OC0A 3P26A 1GTZA 3D6FA 3P9PA 4Y2JA 5EGNA 1R0BA 2H4XA 3P2IA 3NIDB 4J76A 3O26A 4A8PA 4XFDA 4LC0A 3ROEA 3WL3A 3MK31 5DNAA 3LTNC 3KOXA 3SDSA 2ZRFA 3OO1A 3PYLA 4MVYA 1A0OA 1LCIA 5K2OA 4CQMB 4QODA 1SCUB 2WUFA 1GZ7A 3E5HA 5I6DA 1Y4SA 1JHOA 2C2KA 2P8SA 3KQHA 1JHRA 1NXWA 2WVGA 4HDQB 1RWPA 4OBWA 5A5VA 4I7EA 2H51A 4GI3A 5IYZB 2UUOA 4OOFA