1DTWB

Human branched-chain alpha-keto acid dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
QTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human branched-chain alpha-ketoacid dehydrogenase and the molecular basis of multienzyme complex deficiency in maple syrup urine disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE ALPHA SUBUNIT
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dtwB02
1YNOA 1WCIA 3EXFA 2JIBA 3EXHC 1V16A 2IHVA 4KXWA 1BFDA 1PYDA 2BFEA 5ESDA 2EZTA 1V5FA 4XEUA 1UMDA 4C7XA 1OLSB 3E9YA 5K2OA 5K3SA 2EZ9A 2Q5JA 2PDAA 2PGOA 3MOSA 4KXVA 3EXIA 3M7IA 3HYLA 3EXHB 5HJEA 2JLCA 1YHYA 2BEUA 2VK8A 4JUAA 2Q5LA 3LQ2A 1UM9A 1X7YA 1JSCA 3M49A 3DVAB 2C3YA 3UK1A 1KEKA 1YI0A 3EYAA 2UZAA 1OLSA 1X80B 3AHIA 3FZNA 1ITZA 1UPAA 3OE1A 5IMSA 1N0HA 4MZXA 1UMBB 1IK6A 2J9FB 1V1MB 3EY9A 4Q9DA 5DGTA 1TRKA 5EJ5A 1RP7A 2C3OA 1OZHA 5EJ6A 3RIMA 2BFDB 2JI7A 1PO7A 1QPBA 2DJIA 3L84A 2VBGA 2VK1A 4GPEA 3ZHRA 3ZHUA 4COKA 1V11B 2BFCB 2UZ1B 1UMDB 5ERXA 5HGXA 5AHKA 2AG1A 4MQ5A 1DTWB 1OZFA 1UPCA 1X7ZB 5EXDA 1MCZA 2JI6A 1OLUA 2JGDB 2VBFA 2IHUA 2WVHA 2X7JA 3DVAA 2BEVB 1V16B 3F6BX 1PI3A 1UPBA 1X7XA 4JUDX 4MPPA 1Z8NA 1GPUA 3FLMA 5ERYA 3AHHA 3ZHVA 4D5EA 1NI4B 2C42A 4K9MA 4RJKA 3M6LA 1T9AA 2OZLA 2Q28A 3AHDA 2C31A 1V5EA 2EZ8A 4KXYA 2YICA 3AHFA 2IHTA 3OOYA 2WVGA 4JUFA 5EJ4A 2BFFA 4KXXA 4ZP1A 5HYVA 1OLUB 3IAFA 3DUFB 1V1MA 4QPZA 1TKCA 1V1RB 3UPTA 4K9LA 2BP7B 3JU3A 2O1XA 4JUBA 2UZ1A 1W85B 1V11A 2BFCA 2Y0PA 4KGDA 1YD7A 5K6RA 3AI7A 1AY0A 3EA4A 1TKBA 1QS0B 4K9NA 5EJ8A 4JU8A 2WVAA 2BEUB 2EZ4A 1QS0A 2PGNA 3HWWA 3LQ1A 5EJMA 2XT9A 5EJ9A 2OZLB 3AHGA 2Q27A 1W85A 3HWX1 5I51A 2V3WA 1X7WA 3DV0B 1ZPDA 2XTAA 2BFBB 3EXEA 5K6TA 4MPRA 1X7ZA 2G28A 3EXHA 3F6EX 4FEEA 4GM1A 5DGDA 1WCIB 3EXFB 1W88A 2JI9A 3LQ4A 2FN3A 1OZGA 2Q5QA 4FEGA 4JU9A 3ZHSA 1TKAA 1OLXA 3IAEA 3EXG1 3EXEB 4MPJA 4RJJA 3AHJA 1YHZA 1X7WB 1X7XB 2JLAA 4K9OA 5EJ7A 2R5NA 2QTAA 2C3MA 4JUCA 3ZHTA 2R8PA 2Q29A 2G25A 4C7VA 1UMCB 2G67A 1T9CA 2BEWA 4GG1A 1U5BB 2IEAA 2AG0A 3DV0A 1OVMA 4QQ8A 3KOMA 2BEVA 3D7KA 3AHCA 5I5GA 2QTCA 1Q6ZA 2XT6A 4WBXC 5C4IA 1UMBA 2J9FA 4KXUA 2NXWA 2VJYA 5EXEA 2C3PA 2BP7A 2W93A 1L8AA 2R8OA 1V1RA 2PANA 5DEIA 3AHEA 5I5EA 1POXA 1W88B 3DUFA 4K9PA 1X7YB 2Q5OA 1UM9B 2BFDA 1T9DA 1PVDA 2EZUA 2YIDA 4GP9A 2C3UA 1U5BA 4K9KA 1R9JA 5I4IA 1YI1A 1UMCA 2VK4A 4GM0A 3EXG2 1V5GA 1Y9DA 1YBHA 2BFBA 5HHTA 1POWA 4JD5A 4K9QA 1X80A 2JI8A 3EXIB 2FWNA 3LPLA 3FSJX 1NI4A 4RJIA 1QGDA 2BFFB 4D5GA 1NGSA 1B0PA 1T9BA 4QELA 2BEWB 2E6KA 2BFEB 1OLXB 2O1SA 2VBIA 2JGDA 1DTWA 5FEMA 3ZHQA 5EJAA 4GM4A 3M34A
chains in the Genus database with same CATH superfamily
1BEUB 2QRKA 3MJSA 4U2BA 3R0XA 1LI5A 2E3JA 3TQIA 3K8YA 2BHSA 3BXPA 1AIPA 3I0MA 4HD8A 4LHXA 4QUGA 1TUEA 2NG1A 5J1SB 3K71B 3A0UA 3CRNA 3OZRA 4OSOA 5B2EA 1DO8A 2PU5A 3CT6A 2JBHA 3E5HA 5TGDA 3AILA 4E33A 3DMTC 3LPAA 3RS4A 1CTQA 2YRWA 2IOYA 4GC9A 4UDNA 2LVBA 4G01B 1DX4A 2MINA 2H7XA 4YRTA 1Q0LA 1TIBA 2P3OA 3KT0A 1HRKA 3M1YA 2J30A 5CFLA 4X9XA 2UZAA 1YL7A 2ACWA 1KZGB 2FQWA 4QGHA 3OZ7A 1KHTA 1ZJ6A 4MVJG 1KXJA 2VAWA 4W99A 4WLOA 3ZWBA 1SCKA 2IBMA 4MB0A 4ZQIA 3QEAZ 3ERCA 1W59A 3BM5A 2VK1A 5KSPA 1WW8A 2IEGA 3W2EA 3HN6A 4XI9A 3SZOA 1Z4JA 1FLVA 4EA7A 3UV6A 1KRHA 4IZHA 2CLKB 1Z73A 1PJBA 2XUPA 3IQEA 3EIEA 2HQ1A 3WBJA 3J81A 5BN5B 4NCHA 3OPNA 4F4HA 3A06A 4D42A 5K2OA 3PXXA 1CETA 4GZ5A 3KDSE 1G9XA 1PJ3A 1SVNA 1MAUA 5CHEA 4WWHA 5LP6C 1IBCA 1O57A 2C1XA 1DKNA 2EFHB 4EYOA 4KQKA 4M2LA 1JUDA 1FDIA 2F3QA 4D4HA 4EP1A 1GRQA 4RNCA 1HOXA 3CHYA 5JSHA 2R1UA 4IUDS 4OI2A 2ZAOA 1J0XO 3UYKA 4DEXA 4LJ4A 1CZHA 3FOAA 1BD3A 1KP2A 2IUUA 4L57A 5K51A 3O2JA 3R41A 1FDRA 3WSWA 3D6JA 1CLUA 1J8VA 1WV1A 2FQ1A 3KTFA 3JYOA 4GOMD 4BFXA 2JLQA 7REQA 3PHJA 3QKSA 3LQQA 4HYTA 1IHYA 4RGVA 4ZQFA 5EZ5A 5JZ9A 3SG0A 3O0TA 2CJXA 3FGZA 1B23P 3AESB 4KYUA 1KMQA 5TQ2B 1LD3A 4PHGA 1ORTA 4DE5A 3Q85A 4IXNA 1GNLA 1K3UB 2O2EA 3H65A 5F77A 4CF3A 4DABA 1EP3B 1RE1A 4ENVA 5L40A 4NRDA 1SUFA 5J2TA 1BU5A 3MSXA 3U4AA 2WAXA 3QPDA 1K0UA 4QTZA 4EFNA 1KS2A 3CZPA 5A2GA 1K3TA 4KQGA 3RFUA 4RSMA 2EJUA 3N0TA 1Y3DE 2X5OA 3MTBA 4B44A 2XUAA 3FZQA 4JDUA 4OQNA 1ZOLA 4G2TA 1AXRA 1CY2A 2BKXA 4AYXA 3BMXA 4YT5A 3CCFA 4UNPA 5TC4A 2QN6A 1KO8A 4EA6A 2PKXA 5ICGA 1EQ2A 2H2IA 3OCUA 4JBGA 2FWRA 2FW9A 3GEHA 5FTNA 1N8SA 1SXJE 5AW0A 2QT9A 4PYJA 2PL3A 1LDBA 3I64A 3WLFA 3KVYA 5ABPA 1SUAA 3Q8MA 3IT0A 1CERA 1W47A 1Q7BA 2IYRA 2ODWA 5K3FA 2M32A 3QEMA 2ZXUA 3RK1A 3K1JA 4F04A 5D6NA 2P35A 2DRIA 3KYIB 3NJRA 3AFHA 4UUPA 3U7HB 2BRUC 2FHPA 4X8OA 3ICWA 3BGSA 1Z07A 3VKWA 4BATA 4U6SA 1LBTA 2JW5A 3EVZA 3IPYA 3QFRA 1UAAA 4JYPA 3TX6A 1XD2A 3OP4A 2XWPA 4FC6A 1WB9A 2PGDA 2DZDA 5I9BA 4DR2B 3IKJA 1APBA 1I7DA 2PMEA 3KYCB 1GTZA 1V4BA 4L72A 3WWDA 1CUEA 3ZE2B 5IWCA 2XQIA 3I01A 4KVZA 3M6XA 5DRTA 2PX2A 1S3SA 1UJCA 1QE5A 2O3QA 2XTNA 3DB2A 3OT5A 3PVZA 4XJXA 4C3VA 1MP0A 5JS8A 4GWKA 4HNUA 4KWHA 1JT9A 3MERA 3PXEA 3KOYA 1H2BA 4EKYA 1S9DA 5CDHA 1EVKA 1ZOPA 1GM5A 4JL6A 4B3SB 2CXOA 2P6NA 3KFVA 3VNQA 3W5VA 5ALHA 3THYB 4HNHA 4EHLA 3CVVA 1M1YA 4HYQA 4CCAA 1SU7A 3QXJA 1AK2A 1PGJA 2EWWA 3BE5A 4K9SA 5DDIP 5JFTA 3SKVA 4R54A 2F8TA 2WKWA 1G21A 4X66B 4C2UA 2DUUA 4EI8A 4RSRA 1RYHA 2MSDB 3JYNA 1MOZA 2CNOA 2CYCA 1OOEA 2V6MA 2XVAA 3LC7O 2O8DA 3NBFA 1XNHA 3K1YA 4R2XA 2OXFA 3KRTA 3TTSA 2O8FB 4ZICA 3IQWA 2IDKA 5HF9A 2TECE 5AJHA 3TCNA 1HT0A 1VIVA 1PIWA 2YICA 4YUYA 5A5FA 1LVGA 3PDIA 1GNPA 4Y6RA 2ODBA 1NW4A 1YQXA 1OFUA 4QXOA 4RGQA 1D07A 1LV8A 4U3JA 1E5VA 3R7FA 2WSSD 4AZTA 4ME6A 5K7SA 3SYKA 2K2WA 4H3HB 1H4VB 4Z0TA 1EHYA 2G7MC 5FPPA 5LU9A 1IL0A 1AD2A 4XJSA 1J23A 3DBRB 1PE0A 2D2IA 4Q4CA 3E9RA 2GPWA 3G88A 1N6LA 1NHWA 4K3VA 1HT3A 3AL3A 1WCV1 1QHHA 2WU8A 2WJGA 3A4NA 1CSEE 2IYTA 3I34X 3KD2A 3G0BA 3VPBA 2VHWA 3KR2A 2R7AA 3TFOA 1IUNA 4NZMA 1BZYA 3R9KA 2C94A 1E9VA 2LR0A 1TUIA 3QOYA 4ZRNA 2PXCA 1BW9A 4MQ4A 1JTFA 2XECA 4B33A 2ATIA 3DFMA 1E6MA 3IQGX 4BX0A 1IWPB 3TBFA 1H9CA 5H5JA 3C7DB 1E94E 1PW5A 2HMWA 3AZQA 3EN0A 2HHLA 3P96A 2VIIA 1E6KA 2BDEA 1EJ0A 1HDGO 2D3WA 3M6IA 2CFRA 5LA6A 3WKAA 1AZWA 2XQGA 3R0IA 1ZXLA 1XMSA 3M82A 2IUTA 3HJTA 1H1LA 1S2NA 3R7NA 4LDAA 5AK3A 2FWIA 5IJ0A 1JIKA 1CZKA 1A9TA 3RTCA 3V2UA 5LIPA 1A2QA 1XA3A 4UTVA 1V6SA 4H7JA 4EPWA 1Y6QA 3K2EA 2AZMA 2CMFA 3HDJA 3IAAA 1G3IA 1R5NA 1ZN2A 2EFCB 3FTQA 4BN4A 2PAAA 4AJHA 3T9FA 5IDXA 3KYJB 1HWYA 2GX6A 4OHRA 3VVCA 4BMVA 3UWPA 5H4GA 2QRLA 5LIRA 1N32B 3HCRA 2QL7A 4HADA 1U7TA 2WJWA 3K9CA 2X0KA 2O8CA 1KI1A 1OFTA 4X1IB 4HUJA 2HFJA 2AG5A 4D9KA 1LRJA 4GSYA 1U3FA 3HB5X 2AMJA 8AT1A 16PKA 3I9FA 2H2AA 1NN1A 5ENDA 1FNMA 1YDMA 2JIZD 3JS5A 1UOOA 3QA3E 3S2SA 5AKKA 4ZN6A 4GDFA 2W2KA 3LNTA 2ZTSA 2GLUA 1SEVA 2IKSA 2OCPA 3ZDRA 1BO6A 2NOAA 4LF5B 5JBQA 2GJSA 3UC9A 2OUKA 1A4RA 1A7JA 3FF4A 3SHQA 3GX1A 4K6GA 3V1UA 5KPJA 1PYDA 4CEHA 3HR4A 3PICA 2L18A 4ARSA 4CM4B 2RHDA 1SUDA 4CTNA 3F4KA 2IYYA 3D4OA 4EIWA 1P0PA 3ZU5A 5K3DA 1FJGB 3DT9A 1E89A 1KQPA 1VPDA 5FIUA 5I7AA 1YHYA 4WD3A 3SF8A 5JSFA 2CZGA 5I7UA 1KMHA 1N2GA 1X8LA 4NYJQ 3TFQA 5IKPA 4RS3A 1ICEA 4EG3A 4DIUA 3Q41A 1NXSA 1JA0A 2IDJA 5IMSA 2OC4A 4IUYA 3TJRA 1IK6A 4ZALA 1AQIA 1I7NA 5IKMA 1YRWA 3DBLB 3PLNA 1ECFA 4ZXFA 3BIFA 3JRWA 3EFOA 5KIAA 2DBVO 4G63A 4WK6A 1SKQA 4IV8A 4WEQA 2P4UA 2QVCA 1SCAA 4FX5A 3I2FA 4BBJA 4UUAA 3V4PB 1VE6A 5CX1A 2C8VA 1DX9A 1G59A 2KS6A 3AKCA 4DQUA 1SKUA 1TTTA 3U7EB 3DTYA 1RLUA 2YYAA 4TM8A 2TS1A 4BMSA 4HN4B 4C14A 1N5MA 1VG1A 1JFVA 1KR5A 1NX9A 3W5SA 1TVEA 3ZW9A 1V6CA 3DNPA 4G5SA 4JUFA 1TJNA 2AGVA 2COKA 3M9XA 4IVPA 5CD1A 4XCXA 5ED4A 3C8UA 3AR3A 4MQLA 4RDHA 4HDKB 4BNDB 3OT1B 2G9RA 2BFCA 5IMBA 5AW2A 2V5VA 4NCJA 1QNLA 1XQ1A 2UVPB 1W5AA 1NXQA 3U13A 4DA8A 3MWKA 1ZEMA 2GSDA 2I22A 1G16A 2W4QA 1P2BA 3GBPA 2VCEA 3JZDA 2I8LA 4YAIA 7YASA 1KDPA 1TDJA 4NAVA 4LV8B 4Q93A 1E1KA 2I3DA 2RMKA 4L5IA 4WACA 1Q2XA 2BYTA 1KEEA 3JD1A 1PJRA 1L8XA 5CH5A 4MIKA 5AW5A 4QJIA 4HO1X 1Q20A 1W6UA 2F8SA 4BMOB 2XLBA 2XVZA 2G4CA 4IAOA 2YJ5A 1U1DA 1DUIA 3KWLA 4NTZA 3A37A 4HRXA 5IVHA 4WNAB 4TYWA 4UDYX 1MORA 3ZXSA 1V4VA 4KCGA 3USZA 4LMBA 4E5SA 1Z2CA 1GYQA 1SCJA 3RVNA 2QX9A 1UC8A 3WV5A 4B87A 2Q5HA 2W2PA 3EEYA 4KBGA 1YULA 3SQMA 3WBFA 3ZY5A 4AJOA 5FPKA 1EFAA 1GAXA 4M8SA 3TE6A 2V7QA 4REMA 2H6EA 3C1OA 2Q1UA 4HH0A 2WI8A 3E7PA 3P9RA 3DUFA 4MWBA 3R9IA 5E4JA 4CXMA 1KC3A 2B98A 2PO5A 4G3XA 4MKRA 4NE2A 4OK3A 1KSGA 5HHTA 3QBDA 4AZ3B 1KR2A 1P4GA 4NESA 2ADOA 4W1QA 4YUAA 2MYUA 3C5HA 2V9ZA 2CBZA 3EGDA 3SMVA 5AUPB 4XM2A 3WGNA 5KPDA 1C9EA 1ZUNB 3PJRA 2E6KA 1LK0A 2NUPA 4WNAA 4WZBB 3RWBA 1NOJA 2P9GA 2VK2A 4H77A 2XZTA 1Z45A 4JXKA 2ZS8A 3OX1A 4US1R 1UKZA 1GADO 5EXTA 3E9YA 5CLFA 5FPQA 4YMTA 5TQ0A 3E4DA 3ZIAA 5GP1A 3GEGA 4I55A 3FI0A 4ZVTA 5K0CA 1TVMA 1U0HC 2HPAA 1K9SA 1N7JA 4XEUA 4U3JB 4MHSA 5KNDD 3FOZA 3OQNA 2PDAA 4FOLA 3OJCA 3M6WA 4F3RA 1EU1A 4KPYA 2Y0EA 2A4MA 1UBOS 2IP4A 2QUBA 5DV9A 2Q5LA 3EGXA 4LZWA 2GVDC 1Q57A 5D87A 5BR7A 3IDSA 5JC1A 1SC1A 1LI7A 4C29A 4F71A 2JHPA 3A31A 4MWEA 4ZKDA 2PKRA 3CNHA 4YRCA 2AJBA 3K09A 4HTFA 1OHHA 3RIMA 3SKXA 3SWWA 2DJIA 3OH8A 4KWTA 5JI3E 4J6EA 4A9AA 3JAMA 2PTGA 2XMPA 3MILA 4UMEA 3R7WA 3ANTA 3D3QA 1NC1A 3KAJA 1I5EA 1GRNA 1ZSVA 4G84A 4E11A 2WVHA 4L0CA 1Z6QA 3DTTA 5EXDA 1XAGA 2ZCUA 4JYMA 1FW6A 1XI2A 3B1VA 4CM9D 1MB3A 4CR6A 3A4IA 4EFKA 3UWMA 4ER5A 3K5PA 8ABPA 3JQCA 2XUKA 3ONDA 5AVTA 3T5DA 3OZFA 1QNFA 4OA8A 1AF4A 1IAVA 1M7GA 2W2LD 2XJ4A 3C7KA 1Y63A 4GE0A 4WCDA 4CVNA 2PUFA 3F6CA 3CNEA 1EWRA 4TV9B 4BP3A 2AF4C 3FWHA 4MAAA 3GT4A 2O7SA 3P5BA 2X3YA 3RC8A 2FP4B 3AOEC 3DGEC 1DBRA 2Y0PA 5THKA 5DF1A 3DBOB 2RIRA 1TIPA 2BMJA 2GWHA 1I2DA 1YJXA 5IUNC 4GNRA 2C2KA 5JYDA 5L3SB 3ZDQA 4XGIA 2G0TA 4BUJA 2I91A 2XA2A 3ZQKA 2OPHA 2K87A 3NX4A 1TK9A 5JISA 5ULLA 3I2YX 3VDMA 4F92B 2YN4A 4XLZA 4COOA 3EGWA 1IIRA 4KIJA 1NSYA 2JIMA 2LIPA 3DZCA 3F71A 3NGXA 5I7FA 2Q0QA 1PGNA 3SC4A 1N0IA 4GRDA 2I5PO 2HLDD 1CF9A 2OVBA 3L0BA 4FDUA 5LZ8A 3QEJA 3OQHA 2CFSA 2YZ7A 3DCJA 2AJTA 3H5IA 3S1SA 2Z1DA 3C6ZA 1DQRA 3W1VA 4DGQA 2QUJA 2CEAA 3LVFO 1N75A 4RPCA 4Q7LA 3DLTA 4RVFA 3TZEA 2GA9A 3O1LA 5JZVA 2FWJA 3H0CA 3IC5A 2O8CB 4C7OA 2V5AA 1DOZA 2OBBA 4UBIA 1EEXB 5JG7A 3GPBA 5G2OA 3RFFA 1QYRA 1MN6A 1RYNA 3VYVA 3CE9A 5J2TB 3A3PA 4LKOA 5I51A 2ZQYA 2YIDA 1SBYA 4JLVA 2EBFX 4NI5A 1D3AA 3OKCA 4G0NA 3H6HA 4HEA6 4IDHA 3AJ8A 2CK3A 4EPRA 1C3XA 1DU4A 1T29A 1BSVA 2D3TA 1TTHA 3LPLA 3N76A 4MUHA 3BJRA 2D4AA 4HDSA 5I9SA 4BO0A 3KE8A 3LUGA 4AIRA 1B8NA 4EPYA 3V34A 1H1LB 3LO8A 1OCEA 2R8RA 3HB4X 3GVCA 4CLRB 1PR4A 2ZIZA 3FLAA 4EZIA 4WCFB 1BHJA 1WY7A 2COUA 1QK3A 3OFJA 1AA9A 5DNVA 5BMVA 4RKEA 1RI2A 4NXMB 3COZA 3T99A 4YUZA 4ARUA 4MS1A 4E2ZA 2VEOA 4X1KA 2FPPB 5EESA 3MGCA 4ND8B 2B5VA 1L4MA 2IPLA 1O77A 2FUEA 2OCGA 2XGSA 3KTAA 4JMPA 3OHSX 4PZYA 3SN6A 4RANA 1JHXA 1Q0HA 1S89A 2CUZA 4AD8A 4B81A 4EVIA 1VKJA 3GGDA 1DWUA 1FFEA 1D4AA 2YWJA 1G7RA 2FKNA 3M49A 2FCRA 4Q12A 2WYOA 2QR3A 4Y3UA 1RM5A 3P1JA 5I4BA 2B1RA 3FM9A 1N2EA 2NUAA 3HU1A 1ZS9A 5EN4A 4A0GA 1P1IA 5DLYA 1T5IA 2WT4A 3E4CA 3VHLB 4NENA 1X7GA 4WXHA 1EBBA 4UKDA 1FFYA 2HIAA 4HNGA 3L0SA 1CLEA 5H0IA 3G23A 1V7ZA 4EQ6B 4WVLA 4EGQA 1WP4A 1Q74A 2R3SA 1NQVA 2FZGA 1ZESA 1MB9A 3TW4A 1S8OA 1YTUA 3CKYA 3PXUA 4YRQA 5IK2D 4G4SP 3QYFA 5EYPB 1W8DA 5FPSA 1HSZA 4DCNA 2OP1A 2PJDA 2V6GA 1ZA2A 3K0HA 3MCVA 3I5UA 4NS1A 5AKHA 5EIAA 1EVIA 5ILQA 2DULA 5AI0A 4D4MA 3VZSA 4Q82A 2X4IA 1W48A 2P0AA 4CIBA 2JBWA 3SOZA 1T8SA 1OFUX 1YJBA 2RH4A 3RSHA 3LSTA 3T3HA 4YCDA 3KWJA 3GBSA 5DNUA 4L07A 2VP3A 1P7YA 5CCXA 3PX7A 4UW9A 3CISA 1Z08A 2JJMA 1D2NA 1J9ZA 2ZWAA 2JFZA 5KOHB 4J2OA 1H1DA 4EOGA 4WBNB 3ZWVA 4R7GA 4CIDA 2AWOA 2DQ4A 2XHZA 4K6FA 4DEVA 1X7WA 2BFBB 4PR0A 3PC6A 1FEZA 5FBZA 1GZSA 1WLSA 2KB0A 3LUHA 2VRBA 4WJZA 4JV5B 5FLEX 4IO0A 1TZJA 4YJFB 2VF5X 1KJIA 5LZ5A 1EDBA 2YR0A 3GMSA 1F0KA 3K1AB 1BYIA 4FFWA 2R6JA 5F12A 4XWAA 2RGNC 2J33A 5EZYA 3EVGA 3BJEA 1GV1A 5CAEB 2A59A 4L9RA 2R5NA 1F2TB 3IYLW 2V55B 5FPYA 4RO0A 5KVAA 3U1VA 4FFNA 1Q7RA 3VR0A 2QL5A 1ML3A 4KMMA 1QO0D 4KQFA 3T4PA 2H5EA 4G8JA 3ZGXA 5JARA 2JLYA 3D31A 3SM3A 3ZJYA 4OLFA 4BFLA 2HEIA 1J2UA 1LTKA 1VA4A 4FP9A 1Q92A 3DLAA 3N59A 1CBUA 1LTQA 1D2GA 6ABPA 3MYYA 1QRTA 4E94A 3JZFA 1E0AA 2BKVA 3NVAA 1CS0A 1JJFA 1XT6A 3UOAB 5DK6A 2VK4A 3P9ZA 2HLPA 4OFBA 1KP9A 4DJDC 1P61B 1TXGA 3FCAA 2ZJ7A 2B37A 1Z3CA 1C9NA 1QB7A 4FZRA 1RFLA 3U3RA 2DXIA 4LI0A 1LB1B 1EFKA 1K98A 2XQJA 2YZNA 4NONA 4OLHA 5K4AA 3KVVA 2VP9A 1JJAA 2YNMA 5D5HA 4YDQA 3B8EA 2Y67A 2Q2OA 1TU3A 2VRNA 3PRKE 2GTIA 3OEHD 1T43A 2PQMA 2ZS7A 3D8NA 4PGFA 1XYVA 1VL2A 2RGEA 4LNHA 4B3HA 4FGKA 4QYXA 2H0RA 4XFKA 3SM9A 1FUUA 4O4JA 1JXAA 3DG9A 5JROA 3WLAA 2XODA 3PEVA 3FWYA 1U2EA 3CLUC 1NR1A 5L3QB 5A6VA 4F38A 2O23A 3DDWA 4XRGA 1O96A 2VHJA 1CFJA 7REQB 4FJ0A 3U9LA 4CIWA 3BRWA 1P6QA 3N7TA 4DSAA 4ZO9A 2C98A 5H02A 1K6XA 3WIUA 1X80B 4BS9A 3C87A 1SFRA 4WLEA 1P9LA 2RHBA 1GPAA 1XV5A 1YO6A 1O94C 2XB8A 4FYWA 2VQ6A 4F7DA 4M36A 2GB4A 3EVNA 1SBQA 2AXQA 3FI9A 3NGLA 3HABA 1YTLA 1ZD9A 1Q11A 4NYIR 5IFKA 2XZOA 4GR4A 4XZ3A 3VDQA 1QYWA 3QKTA 3EE6A 3KS9A 3QPVA 3MHTA 4FLFA 4TWJA 1X1RA 1V2HE 3RVDA 5JSUA 3GEMA 3QY9A 2A3RA 4LJ6A 1YA8A 2PBLA 4ZAXA 5LXTB 5REQB 4WOPA 2GCGA 3DL2A 5FKJA 1Z5ZA 1TB4A 1G3QA 3B52X 3DSRA 2FE1A 3EA0A 2A30A 3HP4A 4GFDA 4JJFA 3VR4A 5ARBA 2A1TS 2R85A 4KX5A 1JNYA 1WXFA 4YR7A 4UBKA 1KWKA 3OE4A 3FIJA 2OAEA 1XTSA 4Q6BA 2E4XA 2LKCA 2I7CA 4ZQEA 5DYYA 5LR6A 3KZMA 1Z5GA 4K40A 3SJCA 4FR5A 3F49S 1I94B 4CF6A 4F3YA 4DY6A 2EJBA 2QV0A 4Q3OA 1P19A 3BMOB 2X7HA 4PIMA 3L1HA 4G5XA 4H9GA 3X1KA 4X1KB 2Z98A 3ANLA 3PFGA 2UYGA 4ZCPA 1Z33A 1BKSB 3C8ZA 2G71A 1KZYC 2ZRJA 3AGPA 4YRIA 4TZ6A 3JQGB 4PV7A 1Z4LA 3TIGA 3SVZA 4CLRA 1OZGA 1AKQA 4WK4B 4R2WA 2VWPA 3J81k 2C82A 3DHEA 5HDBB 1LFDB 4R8MA 3JPWA 2FLVA 4PPNA 4UHKA 4JI4B 2K7FA 5JXGA 4OHFA 1M54A 4OQPA 4QICA 4E4YA 5L4SA 4O4IB 5CIYA 1U80A 4RTOA 2IHYA 2N42A 4KRYA 4KR6A 1HYBA 2G9VA 2O9JA 2VPPA 1SCIA 2E5WA 5ILGA 1T9CA 2VHTA 1D8AA 4P93A 5GIPE 1ESDA 1CQIB 2XB6A 3V8MA 4Z1MD 4DAOA 2HRCA 1NP6A 5B1DA 4EW1A 2QUHA 1SPXA 3EGCA 5J2UA 4WKNA 3WP1B 1PU2A 3FYCA 2QRVB 2XCUA 3HB0A 4MI1A 1K7EB 2WUEA 4J0IA 4J2TA 5ENVA 3WTCA 3LUBA 4N6GA 5JZMA 1W6RA 4O0LA 1V7PC 1IHPA 3B2EA 4E30A 4P4SA 3OQBA 1UFKA 2CZQA 3ESQA 3N2IA 2PUWA 4IIJF 4CLHA 2PKWA 5C1IA 4FI3C 1H2FA 3MT0A 4MA5A 3IP5A 5C8XA 4FNMA 4TWRA 1JLMA 2J6HA 1OWNA 1Y6FA 3W05A 2LTAA 2VZ8A 1A95A 1SUSA 2G5PA 3A6JA 3OC0A 4D99A 3GYGA 3TQQA 1MRZA 3M1IA 3QBEA 3PNYA 5D01A 1ADJA 2HA2A 5TS3A 3TR0A 2AKEA 1QWSA 3IP6A 2G04A 3GIWA 3DO5A 2IUYA 2AI2A 1J0AA 2FP3A 1HV8A 1TVKA 2YWXA 3QLUC 4XWGA 1HM5A 3FJ1A 4CT4B 3CEAA 1V5WA 4QKQA 621PA 1GXSA 1SZDA 2RAFA 4CEJB 1OASA 3SSMA 3BA6A 1IAQA 3VV2A 3TNYA 1NIJA 2FF7A 5B1SA 4CEIB 1UM9A 3HHEA 1QG2A 3OZXA 5DW3A 3W2IA 3KQUA 4TL6A 1WZIA 3NV7A 5CW1A 2B6NA 1ST3A 2VT3A 1XN4A 3X43A 5I47A 1RXWA 3U56A 5BWOA 1RP7A 4GX1A 5IUKC 5J43A 3BCHA 1EXVA 3B7GA 3JQ8A 5FLYA 1LNSA 1YGPA 4H2DA 2WTBA 3BKWA 1U6KA 4UOEA 2FPIA 3U49A 4B3XA 5DYIA 2KBFA 2DECA 2A67A 3F6BX 3UW3A 4QLBA 2QLJA 3MJEA 4EI2A 1LI4A 4AWXA 3ABSB 1NJ6A 4FBMA 4QOIA 4EARA 6LDHA 2CXNA 1RYZA 1KGDA 2RJOA 2XUZA 3BFVA 5E7JA 1U7OA 3OKPA 3QU4A 1EE1A 3PFKA 4TTSA 4D46A 3G2NA 4YCAA 3O92A 4DA4A 3IB3A 4DV2B 3N9IA 1E3LA 1SCQA 3IAFA 4MPDA 1CJSA 1IU9A 1NNLA 1TKCA 2O0HA 2I4RA 2ZPAA 4IYJA 2YJZA 4PYQA 4A91A 3GRAA 4CN8A 1JDUA 1UWVA 4FGSA 1P1FA 2FV8A 3PEEA 4XQCA 1WMAA 1G20E 1LGYA 1SXJC 1V7CA 1Y6ZA 3H11A 3KE9A 5DT9A 1LF5A 3M8KA 1GKUB 4DA6A 4UVHA 4WH0A 2CV1A 1S4MA 2YN2A 3OOJA 1KYIA 5ER6A 2GPJA 3GPIA 4YFYA 3V3KA 3QE9Y 1Z6GA 4BQRA 3BXEA 3ZDAA 1DRVA 3ASUA 2AR0A 3QF7A 4MJ7A 4MUEA 3DHWC 3NIBA 4F1KA 4P38A 5AIBA 1UWCA 1WMDA 3NHFA 3G1TA 5CJJA 5M2QA 3GLKA 4DADA 2PMFA 2HMUA 4EG6A 1KY4A 3U4QB 1EGQA 1B2LA 4BRWA 3FJYA 2QBYB 4MHOA 3QYAA 4D9HA 1UUFA 1VLMA 3LDUA 3WYNA 3GLSA 3QV1A 5G0TA 3CZAA 4BAGA 1KHHA 3IT2A 1A9XA 3EEIA 1R50A 1H5QA 2PH7A 2WY2D 5EQFA 4HMPA 4CLDA 1CZRA 4ZYUA 1CU1A 4RVUA 5IDQA 4HHEA 4HXEB 2GI4A 1UMKA 1SK8A 2I7DA 4LX8A 2FMHA 2QTGA 3LUAA 2HJRA 3D0KA 1AM4D 4F2WA 1Q0RA 1YOBA 1U94A 2HA0A 4EVRA 1KI6B 4KXMA 4R2IA 1XO1A 1AO3A 3TFWA 2C5LA 4YV2A 4I5EA 1T2DA 3RVRA 4C0BA 4RU1A 5HM6A 3WNZA 2FVYA 1PVDA 2WE8A 1NVVQ 2IYLD 3N7AA 4YK7A 5BURA 5GINE 3WGYA 2OD9A 1UBNA 2KLBA 1YQDA 2ATVA 2UKDA 1TQDA 5KNBH 1OXBB 3KZOA 4UTZA 3ZV5A 2FOIA 3DOCA 3FDIA 5HZMA 1K4MA 3ZGZA 4HVAA 5JNSA 1R4MB 3AJDA 1XD8A 2PXXA 3D3NA 4GIBA 3ZUGA 4Y0NA 5DLPA 2DU8A 4LQ4A 2GM4A 2QG4A 1VECA 2DPMA 3DWFA 3FVVA 2GPSA 2JFNA 4IIFA 4NE7A 5IANA 2B20A 1F1BA 1QFZA 4ZOBA 4AM8A 1M2FA 5L7WA 1GCOA 1RM3A 2OHJA 3STHA 3DLBA 4NFYA 1G2QA 1CZOA 1VDZA 4Q1VA 5IDYA 2KYRA 4H0CA 3VKHA 1NM5C 1OI2A 5AT1A 3AF2A 3OFKA 1T2NA 4GZ6A 3VTFA 3N2LA 3UAGA 1MIOB 3EFEA 1AKNA 5FBQB 1DXYA 2BGIA 3D6UA 3I3OA 4O2BB 4BYGA 1K5GA 2J31A 2ZJFA 1V6AA 2OLJA 3AV3A 3W3AA 4Q9HA 1DTSA 4I5DA 4WERA 3REGA 1BHO1 1XZAA 1BHSA 1Y9JA 4JDPA 3OMWA 3UB3A 5THQA 2RK6A 1ZIXA 1HTBA 2BWJA 4DIDA 3GLQA 4NFLA 5I8ZA 2PMDA 3HHPA 1VL5A 1F1JA 3ST7A 2VQFB 2LWIA 1WXHA 2IEBA 1JEOA 4YPVA 5CDGA 1BROA 2X0DA 3VOSA 1AK9A 1BFUA 1IY0A 5JNRA 1V71A 2Z3ZA 5K05A 4DRZA 4JLWA 4B71A 2E7ZA 3DZ8A 5LOVA 3GFQA 4AIIA 4LBVA 1XVLA 4MLPA 4NQRA 5FBKA 4N5LA 2EJCA 2CMGA 2OZLA 1PGOA 3U81A 1F48A 1TIKA 3FTPA 3RVPA 4I2VA 2QP9X 3TUJC 1E2UA 2E87A 3H99A 4H7EA 3FTFA 3IJRA 5J2UB 3BMQA 3R4VA 1HDZA 4WOCA 5CBKA 4LVNA 1YE3A 3C5WP 1DFGA 1JF8A 1XRMA 4LGMA 1T6NA 4ZVKA 1CZNA 4WA7A 4BLVA 1R27A 3QPUA 1VKHA 3I92A 4PU0A 4B4VA 1OFIA 4BRZA 5C7IO 3I45A 1U28A 2CJYA 4WBNA 4B4WA 4PS0A 2Q4RA 2PX3A 3KLPX 2ZSEA 1IOWA 3OFSA 3PP8A 5GJBA 4CHGA 2CE2X 1NJFA 2REQB 2VDPB 1KQFA 2ZIEA 2XXAB 1T3GA 1U0SY 2PJRA 3R5JA 3SR4A 5HKAA 1QVAA 2VJLA 2RD2A 4P82A 2HAEA 3OJ0A 3VYTB 1J97A 3Q5GA 1UBRS 2C4TA 2QAIA 3INRA 3ESBA 1RPZA 1G3RA 1O9HA 1GSOA 3FUVA 3YASA 2VTDA 3ZHTA 4XUCA 4MVWA 3MTQA 3CRRA 2A1UB 2P62A 4D56A 2FQQA 2FW6A 4AS2A 1F2UB 2BGRA 1E9CA 2J8ZA 2R79A 5DI9A 2JK0A 5BMVF 1LJUA 5JASA 2QZSA 5CLQA 5EJFA 1SIUA 2ISQA 4OL0A 4BCDA 2XW6A 2FMIA 1UKAA 1VL6A 5EWMA 1CR6A 4B3BA 1MF7A 2LGJA 4EELA 4QDZA 4NECA 3MQ2A 4GLJA 4IO1A 4QXRA 1DKLA 2V6IA 4JLMA 4MCJA 2IZ7A 4EHJA 1QO0A 1NMYA 3SIXA 2IY7A 1EP9A 2R7MA 3KKNA 4U2EA 4GBGA 5JYCA 3ZW8A 3B89A 4H3SA 4GI7A 1SC6A 4PO3X 4TQ9A 2YXBA 4HX2A 3PQ4A 4QA9A 1DTEA 4UVEA 4Z7NB 4J1SA 5JNVA 3DJFA 1DZ3A 4XCVA 3FYSA 3CVWA 2G63A 4JEHA 3IESA 1QIMA 2KMLA 4TXJA 5EHZA 3FOCA 4ZYTA 3NW9A 1N7HA 4Z4EA 2A9PA 5TQJA 1IVSA 3SX2A 4DWVA 3FNGA 4L6IA 4EQZA 5LYJF 3E2PA 4LX0A 1TA9A 2YRFA 1R8JA 1JHYA 1LSSA 3KOUA 3HSYA 2Q1TA 4U6QA 1TCCA 3C1AA 4JIGA 4BGVA 5SZJA 5CLHA 3CF4G 4DJEC 4ESHA 5H7XA 1DT5A 2VJPA 1UZNA 3UYLA 4TLEA 2VQSA 3IR6A 2K7ZA 5CT5A 4REOA 1QTRA 3IPLA 4QXQA 1WU8A 3ND9A 4OMUA 5DWDA 3U9TA 4V0NA 3MUOA 1OTYA 3B53X 5LLDA 1PJ4A 3VVMA 3H04A 7ADHA 1P1RA 4LE2A 3EPLA 3GUUA 1CF2O 2W8ZA 2HLNA 3DXFA 3P26A 1TM5E 4OQQA 3INGA 4RETA 3SC3A 2P40A 5LXTF 1ODLA 1W29A 4B6OA 1DQSA 4BNNA 1CVIA 2FSVA 4DJTA 2B8NA 4P7GA 3DCIA 3EGIA 4YC7A 3CNQS 3E3LA 2MINB 1TD1A 1V7QA 1BMTA 1PQWA 1J1IA 3BSYA 1RQLA 1Z4NA 2P8SA 5B1IA 4DV0B 3GARA 1ZIOA 1MAAA 4I5FA 3CE6A 3W5HA 5A05A 3WI7A 3OA2A 1N25A 1RHMA 3L7OA 4MPTA 3WL4A 1IDN1 2WA1A 4YLEA 5T64A 5H8WA 5DGHA 2BF7A 4O4LF 2XEXA 3PNBA 3I5AA 1ZGZA 4ASUA 1TF2A 4Y18A 1YKSA 1U3DA 2G09A 2H4XA 1COWA 3FMFA 2YFHA 1U2PA 4TRRA 4WLNA 4KACA 4PZPA 4D3SA 4LHSA 1HZJA 5LNK6 4U5QA 3T4UA 5FI0B 1G63A 1YB6A 1HYHA 4YWHA 1M6YA 4X93A 4TVKA 1VLLA 3ICQB 4CQMB 4TTRA 4LHEA 1TEZA 3I6MA 1E3JA 1DC6A 3GNTA 4BB5A 3EK2A 2JFHA 3NEAA 3SFZA 3Q8XB 2Y0CA 4MR7B 5K3CA 4IF6A 2TMYA 1PWZA 2ZIAA 1MGPA 4FIZA 4LXUA 1W19A 1JAXA 4ND7A 3WAKA 1FLNA 2WJ6A 3M33A 4E15A 4HPJB 3CS3A 1EX7A 1XZQA 2GGSA 4E1VA 2RAUA 1OXXK 4ZCQA 3UA3A 5A9SA 4NY1A 4PY2A 1XD2B 2AK3A 1E2EA 3OTGA 4H0FA 2ZSBA 3EXEB 4PX2A 3ESXA 3T3EA 1XYGA 2HA4A 4QU9A 4L4RA 3IBYA 1XKQA 2XKAA 4NK4A 1VPLA 3IP3A 2GXQA 3N2YA 5HE9A 1OBFO 4JT2A 4ZI7B 1FRFS 1XZBA 3JARB 5CM2Z 5IJWA 3PEWA 1RWOA 4OH7A 3FPSA 1K2VN 2PA0A 2RC5A 1U8UA 3WHKA 3EQ7A 3MWDB 3QQ5A 4F84A 5LL6P 5GJCA 2PCLA 4QYIB 2Q4BA 1D2EA 1BAPA 5K0BA 4OJYA 2P9TA 3L4EA 1VLJA 2AFHA 2A4KA 4S1OA 3LCMA 4ROTA 3SSAA 3CR8A 1DC5A 1GQSA 1QHIA 4ACBA 3AFOA 3BBLA 5JLAA 4D9IA 1NW5A 4CM9A 4F1WA 3UANA 4DNFA 3AVYA 2N75A 2G5CA 2AX4A 2JEYA 4BFVA 1I30A 4MW4A 4QU5A 3FFTA 3ZE7A 5KNDH 3PPWA 1ZD5A 4IDNA 4PS1A 3L4SO 1JDSA 2WFZA 3NVKI 1E2MA 3H5WA 2NO9A 1SUPA 2ZSDA 1PFGA 3FMGA 4ESOA 1CEQA 2B4QA 2X5JO 2Q07A 2CDCA 3D8UA 3KQPA 4QGBA 5I9TA 3IIEA 3AVQA 3FW1A 5EHNA 3VOTA 1T8UA 3PIRA 2DQSA 3HUFA 5C8YB 1OWPA 2YQ5A 2PGOA 3C8HA 5DM2A 1Y4DE 1ZMBA 1C3JA 3I23A 1T5TA 3DDOA 3RUIA 5HRUA 1X0XA 821PA 3PQCA 4GDMA 2C07A 4RQBA 1CR0A 3FCSB 4XFDA 4Y2TA 1E1RA 3EGDB 3V8QA 4K0RA 3X1ZA 5EWJA 5UKDA 4HVLA 2KWIA 4K28A 1ZMRA 2DG2A 1G4HA 3WK8A 2D13A 4C21A 2QQ0A 3G5MA 2ZJ3A 3QITA 4DL9A 2JLVA 1FDUA 1QH0A 1IVNA 2C3OA 4BQFA 5EJ6A 5A7HA 1BDMA 3DCNA 4GAEA 3FFWA 2HDOA 3RYFA 3G8YA 3VPCA 3ZDBA 3AVWA 1KEPA 3C6BA 4JVSB 1FFHA 4DR6B 2J9RA 1IXRC 5EKTA 4MDEA 3IE0A 4CFZA 1BXRB 4IKPA 3K2BA 4FN4A 5B58T 4Y2RA 4ALKA 3R0ZA 5B2ZA 1QZUA 4WA8A 3RRJA 1VLZA 3O8QA 4RXUA 4MR9B 5DCUA 3IP9A 1NBOA 3BMCB 5JJKA 4BNKA 3VXKA 3JQ7B 4MEJA 2MR5A 4PG7A 4HAWA 1CY4A 1EAMA 3GUYA 4UTPA 3K0SA 2NZUG 3V2GA 3TBKA 3UM9A 1GR1A 1WTAA 2Y77A 4PAQA 5HYVA 1I9CA 2OK7A 5ERGB 1DAFA 4GOKA 3THWA 4DR7B 3FE2A 3EIQA 1ZL2A 2BCGY 1O1YA 2V8BA 3UIEA 2IHKA 3FX2A 4O5AA 4D9NA 3WXMA 2Z95A 2A9OA 3LA8A 4JVNA 1TZKA 4Y1RA 3DOOA 3RIXA 5KREA 2QN1A 5DWQA 5BSRA 3URMA 1YMVA 3JY6A 1KMCA 2XBUA 1K6IA 3NKVA 4IPTA 4AS3A 3L18A 2YZKA 1R1DA 1QDEA 1N9ZA 1U9IA 1XELA 3P52A 3BJIC 1K1EA 2GDZA 3JYLA 1L7VC 2Q7OE 1YZUA 2Y1FA 5ANRB 5FTLA 1YDEA 4D4LA 3QVTA 5C1PA 3MWEA 3HR7A 4DDUA 1YDGA 2FN3A 3ONFA 4PAOA 4Q4HA 5FWAA 4EB6B 4LNUB 5JSQA 1IDOA 3DD5A 3TSCA 4Z7QB 1T2FA 3DEFA 3L7DA 2C95A 3ITEA 4JLUA 5D3KA 2O2DA 1C5KA 2R7NA 2G1PA 4MWOA 3FLBA 3OLZA 2CYBA 4R41A 3CSDA 1BMQA 2WSYB 4C7VA 2C8JA 2BEWA 4ND5A 1PVVA 3K0CA 2OA0A 1T3ZA 1A9YA 5FNVF 3ZNNA 4LCEA 1KF0A 2GJ4A 2P3SA 4N01A 3SLRA 1LXCA 3KZ1E 3U17A 4DIOA 4R9NA 3FB4A 2LDBA 1UIRA 2PANA 2X0JA 1BE1A 4AZ0B 3Q0TA 4WE3A 4Z7JA 1V3UA 2VHVA 3MBOA 3OEWA 1PTJC 1R9JA 5J1TB 1W0KD 3PQ2A 3W7VA 1N3YA 3OJXA 4TTPA 1B2RA 4C5CA 4G89A 1NW6A 2W7TA 3GO4A 3OUUA 1CUXA 2H54A 3THXA 5EE0A 3R6DA 3N8HA 1U2TA 1J5XA 1OIVA 2VSNA 3CKKA 1VJGA 3AEZA 4XB2A 5T5QA 5REQA 3D43A 3L0OA 2GEBA 3N3BC 2CL5A 4A2WA 4M83A 4MKZA 1EWKA 2Q0XA 4O2BF 4OEHA 4CM4A 1CUIA 1KJYA 2EWMA 1KK0A 1IZ9A 1ZOIA 1U7UA 4EYSA 3PTLA 3R4CA 2XYRA 1IXSB 5CNMA 1WCXA 2VHXA 5DTEA 5M3BA 3QEBZ 1X3SA 2CL7X 3M7IA 4RIGA 3CTMA 4LEIA 5EMNA 4BO2A 1JMVA 1QG6A 2MU1A 2RSLA 5FB3A 4CIVA 4MWGA 1ZCFA 3PQ7A 1U7PA 2G40A 5AM0A 3UK1A 1D7OA 5AKYA 2QW8A 4UE2A 3FZNA 3U2QA 3V7WA 1K8RA 5LB2A 4EUNA 3PXDA 4L3WA 4FWTA 1Z5NA 1FOEB 1O08A 2PMWB 3OCXA 4ENUA 4RIIA 1MNQA 4KSCA 8LDHA 4GPTA 4FYVA 3GLIA 2AN4A 1SXHA 3NYQA 3TDMA 2ZUFA 4ZHSA 2R6CA 2H2DA 4D9GA 3S8YA 4M55A 1RBYA 1ULHA 3O4GA 2J0QA 2C20A 4IDBA 3OZBA 4ZVLA 4WXMA 1US8A 3WE7A 3ZBUA 2J3EA 4FIDA 4AAYA 4OHYA 2H5JA 3W8FA 1RWMA 3GEIA 3GNSA 2R6FA 4NBVA 2RB4A 1L8OA 1QQTA 3ZH2A 4OG2A 4DQVA 4EHHA 4RTJA 2GLTA 2F3SA 1ZSYA 2JJYA 2VH5R 3HO1A 5FR1A 1GGMA 2NO1A 3A6ZA 3Q7QA 2FE4A 5ADHA 3Q8LA 3N0WA 3M3DA 1W35A 4PBTA 3RNOA 3OJWA 4RSGA 2O52A 1PWXA 2V8OA 4CL2A 4AS1A 4G0VA 1E3IA 1U7WA 1ZC4A 1XEFA 1VI5A 5BQFA 5KYWB 4QM7A 5FAXA 1KYQA 3TTTA 3WIVA 1X8KA 4KEAA 3RJTA 3D6FA 2PKYX 4KDEA 5BV7A 1PZNA 1F3LA 3DQZA 3ZIAD 3STYA 2BGGA 3OLXA 1DAMA 1UBCA 1RKXA 1KFBB 2CCJA 4DS3A 4RVOA 1EEHA 1NJGA 1ZMXA 2GK4A 2GQ0A 1PD1A 3KQYA 1Z5OA 2FR8C 1FSZA 3D59A 3PK0A 4PYOA 4DDVA 1KEEB 1QF7A 4Y2UA 4DMFA 3IALA 2MTBA 6REQB 4BQIA 3T9AA 5AM1A 1J09A 3P2IA 4HS9A 2ROQA 2PUBA 1L0BA 5LMUB 1Y82A 3TAXA 1EA7A 1E3TA 3UCFA 1NUHA 1RD4A 1A98A 2E4ZA 1GPH1 3UJ8A 1KBZA 2J3HA 2F48A 5DLQC 2O8DB 2QX8A 3PRHA 2PUVA 1GG9A 1G21B 3KOWA 1E58A 3P4UA 4IOKA 5LDGA 2SNIE 2VR1A 2ZYAA 1J56A 1RRMA 1KPGA 3UG7A 1J5PA 3UWOA 4NZPA 5BUZA 5ADWA 3TZHA 1UBFA 3O94A 3TW6A 4RVNA 2IYOA 4TV9F 5L3RA 3GA7A 1AUVA 5IJAA 4BBZA 1PW7A 4HDMA 3A4MA 4CUJA 1EIWA 4F9GA 3NBAA 5D7NA 4EUSA 3FUXA 5C18A 1A4UA 3THWB 3I9V6 1PUXA 4YJ2A 2OHHA 4R31A 4W6QA 5GVSA 1M2WA 2DBYA 1Z2PX 4OJKA 4ND3A 1DG3A 2IC5A 5FTMA 4QBTA 4F2PA 4WZAB 4Q4AB 4U1RA 1RJ9B 3TOVA 2IHNA 2Q21A 3B6JA 1S96A 5BRNA 1VBKA 5D84A 1GY8A 2O2JA 4KXQA 4BLUA 2CL0X 2QQFA 1YVUA 2NX2A 3QELB 4FPXA 4K8OA 1BXRA 1OLSA 4NMMA 4P4UA 4J3JA 3L0PA 3O1JC 3RARA 5IZCA 3F3YA 1AB6A 2FPXA 3GJ4A 3SICE 5EJ5A 1MX5A 5HIMA 1EVYA 2I6FA 2YY7A 4OQFA 4RV5A 4PZCA 5DXJA 4YN3A 3RYFB 3GOHA 3ELBA 2B8JA 3OM1A 4I1OA 1E0DA 4JWKA 4M1MA 4L27A 4II2A 1P7ZA 4MQ5A 2O50A 4R7ZA 5AKGA 3L77A 4G1MB 4OFWA 1V2GA 1KYZA 4D41A 5ERYA 5KNCH 1M7BA 2VF4X 2PD3A 3NOXA 4H1VA 3JYQA 4L0QA 4RH0A 4RY9A 5G0VA 3WB9A 2PTHA 3CVXA 1T34A 2DHRA 3F73A 4D9MA 2XB4A 4JR0A 5HJ2A 4Z5XA 3LSYA 4NNOA 4U2KA 2FVXA 3I39X 1F7VA 4KJXA 5BSGA 1JLHA 2NSDA 3ZWYA 1K8XB 1DS6A 2OO5A 3CGGA 3HFRA 3UEOA 4E3WA 3PITA 2CF6A 3IV6A 3F8SA 3G1WA 4LPKA 4LOLA 1G6KA 3OF3A 4XVUA 1GTVA 4OGWA 3LT0A 3GVXA 4FFSA 5FPHA 3TF5A 3WC4A 1A5AB 1N3IA 1F8XA 3K9HA 3LTNC 4GMFA 2NQTA 3VMFA 2EZ4A 5HEKA 1BQ3A 3P2OA 1NVWQ 1D4FA 4JL8A 2R6AA 5TQ2A 2Q27A 3EC7A 1XTQA 4CV2A 1GTRA 5DTJA 3LUPA 4DG8A 1HG1A 3H5VA 5CXXA 5AW4A 1CVLA 3M6UA 3N87A 4YV0A 3U3KA 3KCNA 3AJEA 4FYJA 2YFQA 3E3OA 3G8DA 3OECA 4TXLA 3QLUA 1F14A 5HKBA 2P65A 5EIHA 3AVTA 1LPNA 3F4BA 4AY2A 2Q50A 2HHAA 1EXDA 4F06A 5JPDA 2VA9A 3MIIA 2H0AA 3K1ZA 5EJ7A 2VPIA 1RJWA 1TJYA 3Q7EA 3OM9A 4B48A 3C98A 1L4NA 2OHXA 5HX7A 4B3RB 2H85A 4Q66C 2ZR7A 1HKUA 1Y48E 4JBLA 1FYEA 5F5LA 1L7PA 4GXNA 4ML3A 2BEVA 5C7OO 2Y4NA 3FBGA 3R75A 1SVLA 4F91B 1IEQA 2DUWA 4RHUA 1V96A 5IT0A 3I9MA 1Z74A 2Y1OA 3OY2A 1Q1GA 1KVQA 2JGKA 1ID8A 3N2NA 3LP8A 4ER6A 5E9WA 3BCUA 3IIKA 2P2YA 2Z5GA 4IVRA 1GU1A 2JI8A 4L4XA 5EPEA 1O5OA 1DEHA 2RI6A 3COVA 4NDZA 4Q3NA 1SOVA 1NMQA 3I04A 5DM1A 1E3EA 1GQYA 2G9QA 2Z9CA 1E1MA 3GFBA 3JRXA 3SF0A 1ZUHA 2G70A 2WR8A 2A9QA 4TX1A 4IRXA 1P0MA 1P7CA 2NQ8A 3GVPA 3P4XA 1NJ2A 1JQEA 2N1MA 2BR4A 4HLNA 4LWOA 2F6RA 2FRDC 1VKZA 4M8KA 4X3CA 5A3JA 1USUA 4BDSA 1MC4A 2OECA 1X9GA 3F9RA 5CNKA 2G5TA 5EERA 4ZANA 3HR8A 3G17A 1WETA 3ZCUA 5BR1A 3OTQA 1NMXA 3K6JA 4MQFB 4AN0A 2FW8A 3A9TA 1PK7A 2VRCA 4QBGB 1UBJS 4N3GA 3LX4A 2CNNA 2CCGA 3QBVA 3AL2A 3PUXA 5T67A 4R0VA 4S35A 2YXDA 2ZJAA 3D9QX 1LSJA 3QMPA 4HAVA 4I50A 1KJ8A 1L5WA 4IMRA 4KZPA 4AG6A 2HBZA 4Y0AA 2EEPA 1J1UA 2E48A 2P30A 5H9VA 3OQIB 1ECJA 4IJWA 2VUHB 1J22A 4LWZA 4MUBA 4QARA 5GY7A 1JALA 3ZTTA 1RC8A 3RBZA 2A58A 3H4MA 2E18A 1V11B 1XAHA 5KYTA 3DE1X 3LDAA 2X7JA 4DBLE 2G0NA 4OH1A 4D81A 3O8QB 1CB0A 2FW7A 3R6TA 1A4XA 2WFLB 3HTXA 1E3SA 4DLYA 4QFBA 5K01A 3IEXA 5IAOA 1JHVA 5ICCA 1YBMA 3JQEA 4J16A 1O5IA 3O73A 5IEBA 2UUOA 1SIBE 3ZHBA 1E5DA 4P5EA 4I81A 4ZI5A 4DIMA 4PGGA 4BX2A 3X1WA 3BAZA 2BR5A 1L7AA 2AE2A 2AZDA 1ZKDA 4ID3A 4RORA 5F35A 3OQ1A 2Q2VA 4LXQA 2V1UA 1O94A 2OZVA 3G8CA 4UFOA 4ETIA 4X0EA 1C9MA 1Y9AA 3LYHA 2NIPA 1ILEA 3LCRA 1SVUA 1T3TA 1SR8A 2ZSJA 4JP2A 1XJ5A 4YV1A 3ZHCA 2X9QA 1F7UA 1BX0A 1J99A 1XVUA 2HBYA 2O19A 2VZ0A 3GLGB 2I4OA 3OJLA 4IQ8A 4P3NA 4DDTA 2J5RA 3FVTA 4H3VA 1WU7A 2IZ6A 2PXHA 5FJIA 1P74A 1W36B 1NC3A 1U0NA 4JL5A 1CY0A 5TF0A 1YQEA 1YQGA 4DW8A 3KOOA 2JFGA 4KFCA 1DJOA 2DQKA 3GXOA 2UVQA 3N2EA 1V41E 2WWRA 3HNOA 5BSVA 5U1PA 1L1RA 3WVNA 4DR1B 2XYQA 4UNRA 1WE2A 3MBKA 3WKCA 1CYEA 2YVLA 4K26A 4N8SA 2IE8A 1GYPA 5CYPA 1OTXA 5DX0A 5EOVA 4N7MA 5DNWA 1T9GS 1UZUA 1YMUA 4MUGA 4KXUA 3LW7A 5CK4A 1GEEA 3KR0A 1CS4C 1N4AA 4LRYA 5D1NA 3E35A 4F5EA 1V0JA 3LLMA 1E7QA 1K92A 3IMEA 4R2JA 4NOLA 2JVKA 1QH1B 2ORVA 3ORFA 5IFLA 5TVKA 2OXEA 3RTEA 3O83A 2I67A 4GL2A 2JNWA 4KR3A 2IEDA 2AG6A 1TW3A 4ZQGA 4W1SA 1XZHA 1B0PA 3NM6B 4HKTA 2PRYA 3BWXA 3ICCA 1R2QA 1NDHA 4OQZA 3RUPA 2AWNA 4A5SA 4MICA 3HN2A 4LC9A 1EBUA 4LFCB 1NYTA 4MI9A 4B34A 4G67A 1NQXA 2DTDA 3S5UA 1KE2A 1L7MA 1MNAA 1O89A 3IMFA 4YMIA 4MWZA 4ENSA 4YGYA 5KQLA 5DM0A 3I83A 1QR2A 2XAAA 5BSEA 4PG6A 1RR6A 2ZYIA 4N0QA 2QSJA 3PC7A 1DPGA 2WM9B 2CHFA 5DM60 4X7MA 1C0IA 4J76A 2XUIA 3IP8A 3TD9A 4BX8A 1LX6A 2IYXA 4ZU6X 3EODA 1MW9X 2V6BA 4QRHA 4NATA 5AUNB 5DHUA 1RHRA 1UC9A 4UM7A 3UJBA 5JS6A 1DZIA 4I46A 3LD9A 1LQ2A 2B7CA 4H7HA 3SNKA 2MWMA 3SXJA 3A9VA 3MLEA 4TL7A 3IQFA 1FE8A 3HO6A 3TSOA 3CJQA 1Q3TA 1JDZA 1ZQ1A 3QXGA 5JWRA 1WR8A 1KAHA 3G79A 2IHUA 4JBHA 3D8RA 3JQQA 3M6AA 4P92A 4QG3A 2RAVA 4LKRA 2HIGA 4P8RA 2AW5A 2ZDQA 4TWBA 4DLWA 2D4HA 1I6WA 2ZIVB 3BH0A 3P9XA 3K9FC 3FA2A 2CXPA 4YRGA 1NULA 4ETMA 2IT1A 3PCTA 3O38A 3KT8A 4YJGA 1UXGA 3ENKA 3L7MA 5DLEA 4R1SA 2HB6A 3G2JA 1NSFA 1ORHA 1GSIA 1KI7A 1L4HA 3NPMA 4P5DA 1CX9B 3ZZ1A 4C6TA 4M7OA 4ZOLF 4RY2A 1YB1A 3GOQA 3AI7A 1QIHA 4F1JA 1OXSC 1P4RA 3Q3EA 4DYHA 1T8RA 1XLVA 3L07A 1D4OA 2QJRA 1G3MA 1M8PA 1YL6A 3LQ1A 1CVRA 3PA6A 3QM1A 5SZKB 3U1BA 1HDYA 2H1HA 1E1DA 1ZD4A 1K27A 4R51A 1FS5A 2QN3A 5AO9A 5AOBA 3U5TA 3SS8A 1H69A 2ET6A 5IT5A 1JE0A 3HLKA 1TA0A 4RESA 3BREA 1K5DA 5TIIA 3PUHA 2CV0A 2GJAA 1KO4A 2QUKA 4AMBA 4EW6A 4J6FA 3ONNA 4NBLA 5GONA 1F6BA 1LPAB 4G0OA 1NL3A 1YL5A 3TR6A 1M2KA 2JLWA 4E70A 3RVJA 3HBMA 2R1TB 4MWTA 3VX4A 1OC2A 2RGCA 3LE8A 4RSHA 2PX8A 1LLQA 1P60A 1H8ED 4J1TC 4MS3A 1PJ2A 4HCJA 4U2FA 5TJ9A 1N5RA 4IEEA 4DLKA 1GIAA 2HSDA 4HWTA 3TWOA 5C4IA 4X85A 3HKCA 3A2KA 1N3BA 1PVOA 1U31A 2XA9A 1LY1A 3DMYA 1RVDA 2IZ0A 4I4IA 4Z4FA 3L1VA 4TQGA 3C0KA 3WJAA 1W9HA 4BNGA 1YI1A 4QSHA 2O3JA 5JQGA 1X70A 5K0JA 2ZBUA 4IFIA 2POCA 1XN1A 4B0PA 5A3QA 4BRUA 4R05A 5KTSA 1XDDA 3FSJX 5JSYA 4FYXA 1ABEA 4MVJP 2Z04A 3HDYA 4NF2A 4LN1A 2G4LA 4QOJA 1E9RA 1N36B 1NJ5A 1V1JA 2WSMA 4KQMA 3VNAA 4ZTZB 5JVDF 3JQAB 4B09A 1NQOA 2VJQA 3AUYA 3S68A 2VOJA 2YZ2A 3FAKA 2O2CA 3KKEA 4RY0A 1JI0A 5ALFA 1EGAA 1YHNA 1JU4A 1B14A 1NT4A 2XE4A 3IHKA 4PCUA 4KP7A 3OTOB 3SQWA 1A8QA 3BORA 3WLRA 2IYFA 3W8DA 4KH1A 1T24A 2HDNB 3CZQA 5ALSA 4EECA 2F4NA 4BECA 2HHJA 3RJ5A 4DT1A 2OBYA 4TV8B 5HJEA 2JLCA 2I7TA 3Q5EA 4IILA 1KDYA 1Y7HA 1DGQA 4GLFA 4L5AA 5MF6A 2GNAA 1HE5A 1Z75A 4HPXB 1NVKA 4ZT7A 3AP3A 1C81A 4JA0A 1NZFA 4JBXA 1LS6A 1AGYA 4QHYA 3UTDA 2XRMA 3JQ8B 5IYZB 1N2CA 1B42A 3KHUA 3A6HA 1ONOA 2PYIA 2WNSA 1E64A 2A0XA 4PQRA 2QD3A 1K8YB 4J0EA 4HDMB 3AOEA 1TCAA 1LVUA 3K94A 3L49A 1GGFA 3N8DA 2H3EA 2QMOA 1YF3A 2ISSD 2AYXA 5JSKA 1H05A 4L51A 1SBCA 3LHIA 4LV5B 4U7DA 1J25A 3FLMA 1DCMA 4ITRC 4RK4A 3VPDA 3GAMA 2Z4TA 1X77A 2Q3HA 3NV9A 4DF3A 9LDBA 3OQ6A 4MQMA 4GMHA 1Q95A 4LK2A 1OH5A 2JRCA 5H4HA 2DLCX 2XBMA 3QTLA 3KHSA 5BNWA 1RWQA 2NT4A 2AFVA 4KO8A 3DO8A 3P9NA 4QNNA 1OYVA 1TGVA 5I9IA 1DAGA 3EGEA 4RM3A 3KX2A 1W581 4EYQA 4J03A 3JU3A 4FHZA 3PF8A 5DVZA 1GA1A 3SFTA 3GZNB 2D2FA 2WJIA 5P21A 5AJUA 4EB8A 1YZQA 1I8TA 4NBRA 3ZXXA 2CD7A 4EO4A 3CLTC 1XKXA 1W4CA 2FEOA 1DJLA 1URPA 3O5AA 3W3AD 3WLQA 1GV0A 1GU0A 4NOMA 2IKQA 1QP8A 4M6WB 4IX9A 3TZKA 2FZEA 2C0QA 4UHHA 1QV9A 2Q6IA 3T5TA 3TL6A 5TMPA 3RANA 3U16A 3F3SA 4IHKA 4R8VA 2PRSA 2Y27A 5A3VA 1NXPA 2HCRA 4PZ0A 3CONA 2WFAA 1W9MA 3Q98A 5TEVA 3RU2A 3UZUA 5JS1A 3HEAA 2ECPA 1RYFA 4NJEB 3RG2A 1P1HA 1B41A 3MT7A 4OKSA 1UBUS 1QHEA 2ZZMA 1D8TA 1KNXA 3KZNA 4MGKR 1XLTC 1MG0A 4KKVA 1HDEA 1YHZA 4P7JA 2JLAA 3JTMA 1ACJA 5CX4A 3O3NB 2QLFA 4NWIA 2LXNA 1IATA 2GEFA 4KOEC 1FXWF 4BJ6A 1KRWA 5EKDA 4EK9A 4HBGA 1SD2A 2ZR0A 2BMDA 2WJZB 1ZC3A 2WAYA 1BFKA 3CW2A 3OU7A 4QLAA 5AHKA 2WYWA 2AMFA 3CXRA 2Z57A 1HF3A 2G9ZA 1ZLXA 3QYPA 2PIAA 3LXMA 2WG0A 1NMZA 3N8NA 1VM6A 3IDAA 3ZNOA 1TTPB 3FCOA 4YT4A 2Z0MA 2HR1A 4V0MA 4Z0NA 4QL3A 2ZJZA 1SXIA 2JB9A 4HNSA 1BA3A 4TMXA 5HILA 1PRYA 2GRUA 4G0XA 4GKBA 3WR5A 2MMGA 4CV0A 2NYAA 1ZCAA 3JD0A 4Y6GB 4P53A 1IN5A 1XA4A 1R12A 3EARA 4G8DA 1GAQA 2CNKA 5J58A 2Q46A 5EMMA 4LBYA 4L8GA 1AMUA 2OB1A 2Z5VA 2I78A 4PPQA 3FBTA 3ROQA 4I4TA 3ZHQA 2YV1A 4DV1B 5DIZA 2JJ2D 2O14A 3NEPX 2DVMA 4D8WA 1Q3HA 5IM5A 1M76A 3NTVA 2AV6A 1IPFA 2DFDA 4PBRA 1L3IA 1N2CB 2BCJQ 2ZUBA 4S1TA 2PD4A 3D8SA 4Y2YA 1FFCA 5KMGA 5JPCA 3WGIA 1G0OA 1NOIA 1SULA 2V7XA 2QXYA 3W2FA 2YVUA 4A23A 4AXXA 4GEKA 1W93A 3P0IA 4KXVA 1QFJA 2ZAGA 5AKJA 4YMLA 3HKBB 2HN9A 3ENVA 1YA6A 2OCLA 1B4DA 1JQLB 3D7LA 4YH1A 2VH1A 4IY1A 3UBTA 1LZKA 2P41A 3K53A 2K6GA 2QM0A 4BNWA 1N6IA 2C3YA 3SBXA 4V1CI 2NAPA 1GTSA 1RLMA 4B6EA 5FFNA 3FGNA 4BKRA 1IJEA 3R44A 3VZDA 3HVJA 2VYVA 3KXIA 4X20B 1VHLA 3Q7IA 2VTBA 3Q7PA 4BLOA 3IV9A 3DMFA 1PBTA 4MGYR 1WPXA 3SQLA 5DTMA 3E5MA 1ZSNA 4KKXB 1ZN9A 2A0WA 3HCDA 5E6RA 4AFNA 4OXKA 3RV4A 1M2OB 1UDCA 3F7NA 1CUYA 1JHPA 2P2SA 2WYHA 3NH6A 1NLFA 3RC1A 2VQEB 2DB3A 2WFMA 1YVDA 1H2RS 3AH8A 2ZBGA 3QY0A 1PEKE 1ND5A 3HUEA 3JATA 3K35A 1A9QA 1SHTX 4MVJI 5C1DA 2HXSA 1HPLA 2CHEA 1VE5A 2W2VA 5BNIA 1AKYA 4EABA 5C1OA 4U02A 5CIQA 1X39A 3A4VA 2G6BA 2OGTA 3MJVA 4KL8S 1U0GA 1C3LA 4L78A 1MABB 3JALA 3AF4A 4ECAA 1NSTA 2WF9A 4FEYA 1UBEA 3NASA 4Y2VA 2VYQA 5KDOA 4C0QC 2UXBB 1E66A 1CUUA 1E2HA 5JH7A 4PTYA 1Z0IA 3DBHB 2NPIA 3TPZA 3RM3A 4DC9A 2JKZA 1QONA 1E6EA 1BTOA 1USVA 3FGPA 1WY5A 1Z15A 3QNWA 4J9VA 3RW9A 3QVUA 5E7QA 2CKMA 5GONB 1NUTA 2GESA 2WUWE 4IQ0A 3LIIA 2G28A 3ZJTA 2ZWMA 4YASA 5JXIA 3LC2O 4CYMA 1MQAA 2OM2A 1Y1QA 1C7QA 1G8GA 1YRLA 2VI5A 3DHVA 3THRA 4E7OA 2X0EA 1MX9A 4OQEA 1T15A 4ZMSA 4IJ6A 5IKEA 5AI8A 5FOXA 1E3WA 5MGNA 1N2HA 1EFRA 4UMDA 2C5FA 2UZ3A 1XVAA 3VO1A 1S2LA 5LQRA 4IINA 2JI4A 1CNMA 2YV2A 4BNXA 5BV2P 2AH5A 4M89A 4WZAE 5JR3A 1EFUA 1F3OA 1GTJ1 1T2UA 1Y8QB 1AS2A 4JENA 4UASA 4A2QA 2R1VA 1D9ZA 2QDKA 4Y1RB 5CDFA 4KYTA 4QYTA 3AUSA 4JLSA 3RIGA 2OBMA 4Y2PA 2FUG6 3DE3X 1P2GA 3PPYA 1QZXA 4LRTB 3MJRA 4TMTA 1ZDMA 2CBGA 4I1YA 5D3ZA 3K20A 4QECA 1X8JA 3ZLBA 1G64A 3JQ7A 1GFZA 3SDBA 3MRTA 1PEAA 4P3YA 2QENA 1XXLA 1M7HA 3GFOA 5KNBD 5G02A 3PE3A 1W4ZA 4XWTA 1T9BA 1JEDA 2PZ8A 1GDHA 1FFWA 2JGDA 2CHGA 3WLSA 3A2MA 3KXPA 1FF9A 1XJ0A 4CMBA 4UVGA 2NVUB 3GG2A 4UDXX 2AL7A 2E4AA 1F9EA 1BXGA 4YFVA 2QSZA 4TZTA 5DHPA 4PYKA 2DAPA 3CNOA 5U4XA 4BMPB 3OI7A 3DTVA 1CUDA 2OKGA 1Z6ZA 1HEIA 1ZGJA 1I2MA 3WIEA 3LWZA 4MV5A 1T0PA 1G5TA 1WSWA 3CC8A 2IU0A 5C7LO 4Z4GA 2IPMA 2CVFA 4UHEA 5BSFA 2QKYA 3CRZA 1Y3BE 5DGCA 1EZ4A 4G5QA 2VT7A 1QIEA 1E2JA 2PZAA 2RH8A 3D2AA 3OE1A 3V5NA 4BGIA 5K5EA 4LQCA 4QT0A 3V97A 2OQIA 2G06A 2IPNA 4MRAA 4FEAA 3SLGA 1T9HA 2R97A 4HMQA 4B76A 1EXWA 4FCVA 3LF1A 2HQSA 1E2LA 1N9KA 5D3MA 3T5CA 2R84A 1ZIPA 4UEQA 4BDTA 1J8QA 3MCZA 4MRRA 3E3NA 1W7AA 3OJEA 1U9ZA 2BEVB 3EBLA 3EZ7A 4V0QA 4DR3B 2NPFA 2CXSA 4J0QA 1OKKD 1PJCA 4GOND 4PANA 4PC6A 5FT9A 1YS9A 4E6EA 4WKGA 1GQFA 2ZI9A 4A8TA 4L15A 1ADFA 3F3MA 4J7UA 3OOYA 1R4ZA 3KYDB 4MS1B 2DYKA 2VG8A 3STXA 1RW4A 1DMSA 4HEA1 2Q3MA 1Y4AE 3GUZA 3MWDA 4KWCA 2IBSA 2DWPA 1TPYA 2WM2A 2AYZA 3PXBA 4INPA 4W4TA 4Z0HO 2ECFA 1S8NA 1XA0A 2BELA 2C5AA 4Q1DA 4BJHB 3T0GA 3GCZA 2AFRA 4FGZA 4FXPA 4LJ9A 1VHJA 3R7AA 1SBZA 1VQ1A 3NBYC 1C30A 4MB6A 3GLHE 1C3EA 1U7ZA 2FCAA 4WUTA 4ZEXA 3KPUA 1ISHA 3OPMA 2B2XA 3DNMA 5EJ2A 2XYVA 4KGVA 3ZCRA 3EXEA 2WJ4A 1HLPA 1KY3A 1YE8A 2J3MA 3HKBA 1UJ5A 4H27A 5D6OA 1BQ4A 3RWMB 1SBTA 1SVKA 2R8YA 5BVGB 1A8PA 5D1HA 5CXUA 3ZVNA 1WZEA 3A26A 3T9EA 5B7GA 3N2KA 1E7MA 5EGSA 2V96A 4C7JA 1M1XB 3TVDA 4HAOA 5JUWA 4Y9UA 5F2OA 5KMGB 4C7OB 1Q84A 5H68A 3AR5A 5ITSA 4HSEA 4Z1OA 5IX8A 1ULBA 1QORA 4MV3A 4LI3X 4CQMA 2V4ZA 4EPXA 1ESCA 3AVVA 4R3UC 4DQ0A 5BN3A 3ZPXA 2BTEA 3N2GA 4P0PB 4KNWA 1H22A 5AP9A 4FB5A 5PGMA 1W0JD 5K8VA 4R1OA 3CBQA 4D57A 1ABFA 2BDTA 3OBBA 4N3BA 4QASA 5A06A 4QDJA 5ECGC 4BVBA 5ES4B 4V1CB 2C3UA 4BTLA 3RUHA 5CA1F 2P9ZA 4ASUD 3M89A 1BRMA 3S7TA 3HJFA 5JVDB 2BAGA 3FR8A 1KJNA 1GILA 2JFUA 5HFAA 1DWOA 4JN6B 1T4CA 1Z38A 2GEKA 2I6UA 5IXJA 1L4EA 5I6DA 4C76A 1HKHA 2BI7A 4IJMA 4TKVA 4ZYXA 4O1MA 1OLXB 1RI1A 3K1AA 1U98A 3NT4A 1SB9A 3PC4A 4UREA 1A9ZA 3B6MA 3D2BA 3OD5A 3F7OA 3PI6A 3U44B 3VR6A 4NQZA 2V4MA 3M6MD 3O8CA 3QWIA 4QRDA 3MWFA 2EZTA 3A4YA 1XUOA 1IY2A 2PFSA 4JIMA 4ZTBA 4EBBA 4A82A 3C70A 2Q2NA 1D04A 5AI4A 2QGFA 2D59A 3O2SB 4O8CA 1YUMA 5D5QA 4CG1A 2QTVB 1WUJS 1X19A 5D5PA 3ESYA 3V1TC 2DC1A 4S0XA 1PJLA 4NSNA 2C8KA 1SM4A 3OAAD 5BUSA 4WOBA 3MUFA 3UK6A 1A72A 2GETA 1G66A 2VDRB 2XNKA 1ISRA 5EJ9A 3HV0A 4WTOA 3AW9A 4TMFA 1V45E 3AY7A 2JI7A 1ZAYA 2FRXA 1I2BA 4WK0B 3OIGA 5KWJA 2E5FA 5BSWA 3G0OA 3A9RA 4BGEA 3U60B 2VJCA 5H1YA 1XMQB 5AVJA 1Y7TA 4JVLA 1X7XA 3AONB 1FQWA 2OV8A 3OZIA 4C4RA 1QBKC 2A1TR 2WJYA 3AHHA 1AHPA 2B34A 4P4NA 1Z16A 4EL5A 1IM8A 4URHA 5TLSA 3NNDA 3V9AA 3AHFA 3F5FA 3E5RA 4S04A 5TGTA 2OPBA 2I65A 3E0XA 2PPVA 3HA7A 4JLBA 3I8SA 4H4CA 3V4LA 3R9WA 4K81B 4ZCLA 4JT8A 2N46A 4UTRA 2CFOA 2QJTA 1NVBA 2YFYA 3EAFA 3EWNA 3P9YA 5EJ8A 2HM7A 5ESXA 1MT3A 1KKMA 2HU2A 1QTQA 4E14A 4FE7A 1S2OA 3A6DA 3E1SA 5C80A 1UFRA 1WG8A 3MAGA 2P6MA 3K9GA 3IHWA 4U00A 5DN6D 3S1AA 3K9WA 3EQ6A 4OYHA 2NZWA 5CPFA 1N9GB 2CFCA 1X7ZA 5BQPA 4DGSA 5DNCA 4LE0A 5EXSA 1Q50A 1LUAA 2C57A 2P2GA 4OHMA 4PONA 4QIHA 4YPOA 5B7QA 5BYAA 1YI8A 2VH2A 4CQLA 3WYBA 4MKFA 5INTA 4LF6B 4N48A 2C84A 3JWHA 4D9BA 1L5LA 4LJLA 4GSKA 4CETA 3BS4A 4NYMQ 2KLHA 2HQBA 4G09A 2C0CA 5FA5A 1I0IA 1SG0A 3RK4A 5EJEA 3VSAA 5ALGA 3IFSA 1OGJA 2Z2XA 4KIFA 4QUBA 4PCAA 5KJFA 3WV4A 3P0EA 3ROKA 3DNFA 3H8VA 4BVKA 1R64A 4EDHA 1XCGB 2C78A 1R10A 1QX4A 1RKUA 1CFZA 4BO8A 3UWSA 3O91A 4J0HA 5KSYA 1T1JA 3OX4A 2VKTA 1IG0A 3TNJA 3V7FA 3GLIB 2Q9AA 1VI2A 4Q03A 3WA7A 1GZ4A 2ZE8A 3BTUA 4WGFA 1EXMA 1NNSA 1X1CA 1J49A 3QU9A 4FYMA 4IVQA 2RI1A 2PBZA 3W79A 4HLDA 3T9CA 3NYWA 4KITB 4J4TA 2WWXA 5YASA 5KDDA 1I7QB 4A3SA 1ZN7A 5KYGA 3K2QA 2YWRA 1H8EA 1XPOA 2VYNA 2ES4A 2QU8A 1TC1A 3K6SA 2BFAA 1EK1A 3ZQ4A 1C0PA 3W5AA 4C88A 1Z6TA 2JCBA 4J7AA 3B2QA 4MLZA 4PPGA 1V16A 3NO4A 3HA2A 4BNDA 3EIWA 3K5IA 4RQTA 4EKIA 3BZWA 2G82A 5EL0A 1IMJA 3GPCA 1BJRE 1QOZA 2BHRA 2BISA 2WMDA 2QW0X 4MW0A 4ARAA 1UMDA 3TOXA 1OLSB 5F9HA 3V4OA 5TRTA 4YALA 4X94A 1WUKS 1H0KA 3K9LA 3ANNA 1GGEA 1AK1A 1CB7A 3INYA 1HNZB 2VRCD 1H6BA 2WJPA 2X2OA 1L5MA 1ISFA 2LW7A 3CX7A 5HIKA 4IKEA 1T3HA 4I1SA 1P17A 1XZLA 2FFQA 3DOEA 3KLMX 2X22A 4MULA 3LXRA 4RIFA 5AYVA 1JKJA 4CHTA 2H5IA 4H08A 1B0ZA 4M0FA 4QAQA 3NU1A 3QVGA 1K7XB 1W49A 1Z4QA 4XIGS 3WX0A 3ZDXB 3DW1X 1ULTA 3CZ9A 1VG9B 2HRQA 3E53A 3FPJA 4XEHA 5AI9A 4MCAA 5ALRA 4OAQA 1UOPA 4YRRA 4BFTA 1U63A 2YHIB 4WNCA 1KMHB 3UMVA 1JFLA 5CB4B 5EHIA 3L7IA 1WXXA 2W70A 3SY8A 5AVVA 4PFJA 1Z4OA 3MMXA 3L0ZA 2JF0A 3B12A 2X8LA 3FCYA 3WB0A 4NG5A 1REQA 2CUTA 1SA0A 3EVDA 3V6MA 4M0CA 2Q9CA 3OIFA 3MTGA 4N47A 3O7WA 3DMRA 2QXUA 2QSUA 2H5LA 1YNSA 3FPHA 1EFVB 1FSSA 2BSAA 5AHXA 1PUIA 1K86A 2ERXA 3B9BA 2XE6A 1XDGA 4N3AA 3BERA 3WYEA 2H1WA 3NS7A 2H7YA 4LTMA 4EVSA 1SHKA 2AZXA 3CM0A 1Z47A 3NBXX 4WX2B 3TRKA 4BJ5A 4Q19A 4CKCB 1JV2B 3VBEA 2EGUA 3RV3A 5SYAA 1M10A 4KV7A 2QRUA 3DV0B 2NU9A 3G5LA 4R01A 4YI5A 1R6UA 2PSJA 2XZDA 3L6BA 4LZAA 4DYVA 1P3Y1 3H5RA 4FEEA 2WWHA 4E46A 4GPBA 4M8IA 1P1BA 4OX9B 3T5MA 1HI9A 1ARZA 3V3TA 1JIXA 1NR5A 2P90A 5TPZD 3TTUA 1II8B 4WESA 5EMJA 3OWHA 4QEKA 2QE7D 5F2KA 5AK4A 1FX1A 1RM4A 2PKCA 3HM9A 4B7XA 2GEDA 2ZDGA 5CT4A 2QRMA 2YKGA 4JITA 4F60A 2AI1A 3HNPA 3W5BA 3SS7X 4HFNA 3ONEA 3TSWA 3HBLA 1Z22A 1AA6A 2XPCA 1NFFA 1X1TA 5FNVA 2UU9B 1N6KA 1TZBA 4LTNA 4DT1B 1LVHA 3G7SA 3U62A 2NXWA 2VJYA 3CO0S 1XCBA 2ZYSA 2Q8QA 3K4PA 1E0KA 1WPRA 2WP8J 1OWMA 4XM1A 4CDNA 4DHWA 1YCHA 2DEUA 3NC0C 4MEAA 4BLWA 5IAAA 2AUNA 1JYEA 2HA5A 3BIWA 5AOVA 1SXGA 1A77A 5CD9A 4PGMA 1DKMA 2IIQA 2Z58A 1OTHA 2DLDA 2Q1SA 5DTQA 1ZICA 1Z34A 1IK4A 2BTQA 4FJ2A 4HSGA 4IF4A 4RPKA 3W9BA 3UGQA 3EDQA 1H6DA 1KIAA 1YRQA 2OD2A 3E82A 4GKKB 3GNQA 3PHLA 3VZQA 3IQDB 2NQ2C 2IXEA 2EIXA 2FX2A 3GLTA 3RTBA 1VMAA 2VHCA 3RU3A 4PIVA 1ZEJA 3E23A 1CQJB 1DIRA 3C6MA 3MVEA 2A1IA 3S2FA 4AF6A 2EOAA 3O9MA 2YW9A 2OQVA 4N5MA 4DCPA 1DINA 1DHRA 1SXJD 2JAXA 3A10A 4I4LA 4L28A 1L4UA 2BEUA 2ZJOA 1Y81A 3KJFA 5DW0A 3CB4A 2B7LA 4JHLA 4QD3A 1VOTA 1RXSA 2P6PA 4HLUC 1EXNA 1C0KA 1RCFA 4OHBA 2K5UA 2NZVG 2UVPA 3PDUA 1OT5A 1QE0A 2GERA 2W58A 4IV5A 3OX2A 4KQIA 2JLBA 2J5QA 2H57A 2MSLA 3BWMA 1KDZA 3GVHA 5I01A 3HCPA 2P7IA 1EUZA 2HX1A 1LLCA 2GS9A 3TSAA 2G08A 2ZUUA 4LMRA 3ZKWB 5COAA 3I2HA 1YRHA 3HL0A 2CCKA 3KVRA 4RH1A 5FOWA 1JPNA 2QN8A 4WDQA 2ZPTX 4EZEA 2VBFA 3BD8A 3H3FA 2PEZA 2RBEA 3DVLA 1C7IA 3K9NA 3NTRA 5KYXB 2X8BA 4BNUA 2O5CA 3VISA 1G7CA 2JHCA 1E5TA 3FUWA 3VI3B 3KSUA 4B6GA 3C7AA 1CEXA 1GL9B 2PPLA 4KLZA 3GJ7A 1QOPB 4BLTA 5EJ4A 2J6CA 1AGRA 4W63A 1DRWA 2G7ZA 2WHEA 1I4EB 1Y6RA 1QHNA 1P1CA 4K3UA 4KW7A 5TJHA 2FEXA 2LPMA 4Q3DA 4ZVPA 4AICA 1SQFA 2OOSA 3AM3A 3CW9A 3EPRA 1L4KA 4UBJA 5C0OE 3SMQA 3UO8B 4K2AA 4A36A 3VPHA 4YJGB 4GGPA 5JAZA 3K3PA 1R0XA 3QP9A 3JCZA 5F4BA 5K8UA 2B5WA 3D8BA 1EVLA 4PFQA 2RARA 4NNPA 1EJ6A 2GCIA 2JFWA 3AWDA 4RZUA 4P54A 1VBMA 3WYAA 1E4VA 5KTPA 1OBOA 1KEWA 4PZAA 1STOA 2ABWA 1X1QA 2FYTA 2R7KA 4X00A 1N8NA 3IKMB 5D7BA 4O0MA 3OFNA 3FETA 1VBFA 3O26A 4QQRA 3IULA 4DV7B 4I19A 4PG4A 2GFIA 4Z4HA 3UJHA 1P9OA 4MWDA 4S1PA 5T3YA 1MFZA 1CV2A 2PWYA 4R4JA 5TXGA 5A2QA 1JVNA 3AY3A 4L4UA 1E6WA 3OPQA 5FJJA 1KY2A 2AMYA 3SPXA 3EQ9A 4KMOA 2XLCA 5JXWA 1WSAA 1YZNA 3BGIA 4N5HX 2B5OA 2R0QC 5JC8A 3H8WA 1SIOA 4CIYA 1N8TA 1YJQA 2BJVA 4MB2A 3T0IA 1JN0A 1EZZA 3QEKA 4ZT5A 5BW6B 4B6QA 1FIUA 3ADDA 4M88A 5JJLA 4MAFA 3I1JA 5B55A 1FNNA 1D6MA 2I6XA 3LZCA 3HM2A 3FOEC 3X2EA 2BFDA 1C0LA 4K9QA 2B8WA 3AP1A 1V9SA 3L0CA 4PW0A 1ZK3A 2ASEA 1UMCA 3HPQA 1MGOA 4PLFA 2D54A 1WW3A 1HH4A 3A4TA 4G8BA 2YOGA 3G2OA 4JOCA 2TMDA 3GR6A 3OSZA 3PA8A 3VGPA 5AQ1A 3NRJA 2ZRFA 3CLSD 4GSLA 2HU7A 1E4OA 4D0LB 1WDTA 2H4HA 3IT3A 4A8JC 1RJEA 1VLHA 4PM4A 2AMLA 5AHWA 4W8HA 1RMTA 1RXYA 3DONA 3BULA 3G89A 2Q4DA 3H9JA 1SQSA 1S7GA 3ISVA 2RHJA 3NAQA 2WTXA 5FTJA 2HPZA 5ENZA 3FWKA 2PZMA