1Z7YA

Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVADRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Molecular Basis of Cysteine Biosynthesis in Plants: STRUCTURAL AND FUNCTIONAL ANALYSIS OF O-ACETYLSERINE SULFHYDRYLASE FROM ARABIDOPSIS THALIANA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 108
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7yA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7yA02
1J0EA 2ISQA 1JBQA 1O58A 5B3AA 4KKXB 4D8WA 5I7AA 3T4PA 3FGPA 3VSDA 2EFYA 1VE1A 3DWGA 5CGQB 1QOQB 1RQXA 3VBEA 5J43A 2JC3A 1WBJB 2J9XB 4JBNA 2DH5A 2PQMA 2BHSA 2ZPUA 3PC3A 4L3VA 5KINB 3R0XA 1V8ZA 3PC2A 4I1YA 3R0ZA 5D85A 3CEPB 1A5BB 1Z7WA 3IAUA 4LMAA 4D9KA 1TTQB 4AIRA 1J0BA 1PWHA 2CLHB 1CW2B 1TTPB 2CLFB 2RH9B 1J0AA 1CX9B 1FUYB 5DW0A 5I7RA 5EY5B 1TDJA 5DBEX 1K7EB 4NEGA 1PWEA 1WTCA 1KFJB 2CLMB 2CLIB 1TYZA 5IXJA 5DW3A 3VSAA 1WDWB 2Q3BA 3PR2B 5C3UA 3L6BA 2D1FA 4OFXA 4LI3X 4COOA 5IWCA 4ZU6X 1KFBB 4D9FA 3BM5A 4D9IA 4D9GA 1K3UB 1P5JA 1FCJA 4D92A 5I7OA 4IL5A 5I7WA 4LMBA 4ZU1X 1KFCB 4D9EA 1TZMA 1TJPB 4L27A 4PCUA 1TZJA 3IQHX 3PC4A 1UIMA 5B53A 1KL7A 1K7FB 3DWIA 4D9MA 4D8TA 5B55A 2GN2A 5CVCA 3SS9X 3SS7X 5D86A 4HT3B 1K7XB 2RHGB 3V7NA 5DBHX 3L6CA 4L28A 5D87A 4XUGB 4ZQCB 2TYSB 2C2GA 5DVZA 1BEUB 2CLLB 1V7CA 3HMKA 2RKBA 1C9DB 4HO1X 3AEXA 5HBGA 1Y7LA 4HN4B 3VSCA 4D97A 1C29B 2ECQA 3VC3A 1K8ZB 4D99A 3IQIX 4D9CA 2EGUA 3TBHA 1K8XB 3AEYA 1V71A 1BKSB 4NU8X 3IQGX 2GN0A 4QYSA 1M54A 1TZ2A 2CLOB 5B1IA 4D8UA 4Y6GB 3ZEIA 5D84A 2ECOA 4D96A 1OASA 1J0CA 1A5AB 4D9NA 5J5VA 1QOPB 3RR2A 2ZSJA 5IW8A 2V03A 5I7HA 2CLEB 4OREX 5JISA 5BW6B 3X43A 2DH6A 4L0DA 2CLKB 1F2DA 3L6RA 5T6MA 1E5XA 1VE5A 5B36A 2TSYB 5E0KB 5B1HA 1X1QA 4JBLA 5JJCA 2Q3CA 2Q3DA 3SPXA 2O2EA 1J0DA 1KFEB 4HPJB 5KZMB 3DKIA 2WSYB 1KFKB 2J9ZB 2ZR8A 1K8YB 1UINA 2O2JA 1A50B 1UBSB 4HPXB 5I6DA 1TZKA 1VB3A 3FCAA 4H27A 4D9BA 2BHTA 2C2BA 2TRSB 1Z7YA 1C8VB 4WX2B 1A5SB 3X44A 1WKVA 4AECA 2GN1A 1D6SA 4F4FA 2J9YB
chains in the Genus database with same CATH superfamily
1L5FA 3GY0A 1XAIA 1JAXA 2Q4EA 2W2NA 2ZYRA 1K2VN 3HVUA 1ZIYA 4JQZA 2A0FA 1FFCA 1JKFA 3KVOA 5C5CA 4I1PA 3HUUA 4QO8A 1GLGA 1GO2A 4ARZB 3JQQA 1DVRA 2C7PA 4N1AA 4K87A 4GG1A 2H11A 4ACBA 1KI1A 5A5EA 4RZHA 1NC3A 3BHIA 4EGAA 2VDUE 3AUXA 3MBOA 1ZIPA 3A3NA 4MRPA 3JWHA 3QP9A 1NI4B 1WZ2A 5BRJA 2FUG1 3GV0A 2XNCA 5AR1A 3SR4A 3BBPA 2GZMA 3B36A 1HTWA 3CSSA 2RE8A 2JHFA 2CK3D 3BL6A 5CLHA 1U5CA 2QU8A 2ET6A 1V3VA 2HQBA 5JH7B 5BMOA 2ASVA 2O52A 4Q3CA 1A04A 4OG2A 1L5GB 3GCDA 2HYDA 3IDZA 4DZRA 1ULHA 5A06A 5D00A 1MQ9A 5A4DA 4Q6WA 3OIDA 1WP9A 5BO5A 1QZUA 3IBTA 4J6FA 2LDXA 1WKBA 4IW3B 4E2ZA 5LDHA 3QJGA 3X1WA 2YNMA 3TOVA 2UV8A 3SC2A 2IBTA 5HZMA 1X14A 3ECAA 2HPAA 3LPMA 3NIGB 2UVDA 2WNHA 4YS6A 1Z37A 2FW7A 1IIRA 2QNBA 3D54D 3M5DA 1E1CB 2HCFA 1M9NA 5IUKC 3CZQA 1GA6A 3OZRA 4N4AA 4WXMA 2O8CB 2P4HX 4JZYA 5I8ZA 1B0PA 4OIFA 1EBFA 1N75A 1V8OA 1GFWA 1GGJA 1QGUB 5COBA 1GTJ1 4G4SO 3TF5A 3IEMA 1JL3A 3COVA 5KKNB 2HC9A 3ZWWA 4DVJA 1D6MA 2HFKA 4XWWA 1E1RA 4K28A 3GRVA 3TRIA 1E7RA 1P60A 1Z68A 2CVOA 2CZCA 2OB1A 4PFQA 4IHAA 4QBKA 5TC4A 3V4FA 1V3QE 1UJ6A 3WLLA 4AJOA 3SG0A 1WDKA 5I4KA 1XFAA 4BCBA 3A37A 3HWX1 5FOWA 3K0FB 2ZJ3A 4GDMA 1E3SA 3C7AA 1L5HB 1WEKA 1MB2A 2Q45A 3BXHA 3KJZA 4XQ9A 1J2TA 2VHCA 2WVJA 3NTVA 5FRDA 1R5OA 2GKGA 2WM3A 3ESBA 5DWQA 3WADA 3KJIA 4ACAA 4DIMA 4JB2A 3R9WA 1ZONA 3OAAD 1BHSA 1R37A 4H1TA 5I7HA 4G1EB 2JLXA 2NQ2C 3SI7A 1OFUX 2FGKA 3PG5A 3L0OA 4WUVA 1U0LA 4DC0A 1E9VA 3KB2A 1UXJA 1YJAA 3HLTA 1BOFA 3H0CA 4UXJA 3KV3O 1W85B 6LDHA 4IPTA 2DFNA 5FNVA 2VBFA 3K70C 2ZJYA 4UBOA 2CUNA 4W9NA 2RHOA 1VE9A 2ZRCA 1Z28A 3ROKA 3TD2A 2A9PA 1IAVA 2QGFA 1ILWA 1M7HA 5EWLB 2I2BA 1IPHA 2Z8XA 1IHUA 5KTMA 4ENUA 2HLDA 2GTPA 3H4MA 1CQWA 5AKEA 2OXTA 2Y1WA 1F4VA 3GWGA 3F6EX 2H92A 2WKSA 4K9QA 4DUGD 4CMKA 5ESRA 4I66A 2ZCJA 1BROA 3GZNA 3KLPX 3C3XA 3H7AA 3BGVA 3EEQA 3FPGA 1GCOA 3KJNA 3C5CA 5E3IA 4PRYA 1JA9A 3QEMB 5TVGA 4MQLA 3U3KA 1YA8A 1GCUA 2WAMA 1ZH4A 2FF7A 4G36A 1PQYA 2W2MA 1Q1BA 1ZKDA 4KDEA 1YACA 2PQ6A 4OGFA 1FB5A 1XRMA 1ZAKA 2Q0XA 1ENYA 3QVOA 5SZKB 4K1XA 4MRAA 2PUGA 3QV2A 4DCSA 1DGQA 3D2CA 4H7DA 4ALMA 4PHCA 5IANA 5J4HA 4PM4A 4Q16A 4E4YA 2E6KA 1AV6A 4JU9A 5JRJA 3HGMA 2WPNA 4G5OA 4RC9A 3IO5A 1B16A 5FBQB 3JPWA 3ASZA 1NVVR 3VVCA 4C3ZA 4I9FA 5HVNA 4Q39A 5BSTA 4AMZA 4DSUA 3P9PA 1XZLA 2GGSA 3DAPA 1KEVA 1KQOA 4KXXA 1PYOA 5KTRA 1X1EA 4KQ6A 4HGRA 1KMHB 4HAYA 2DX7A 1T2AA 4BE9A 3ESCA 1YBMA 4BJHB 1TK9A 3UZUA 2JD1A 4YCBA 3GG2A 2Q3BA 4IIVA 1U3DA 1T2EA 1DQSA 2BCGY 3CBQA 4FW8A 1OGJA 2Q41A 3GH1A 4BXOB 3U09A 4AY2A 1ZEJA 1S96A 2F9FA 2PRSA 3WTBA 3HCEA 5CNJA 5K3SA 1U8ZA 3C5VA 3SAJA 2OL4A 2PBFA 3WRYA 5L6LB 3WP1B 3O4HA 4E3WA 1C9JA 3OY2A 3PZBA 3H8JA 4JS0A 4K0KB 1PSDA 3HJCA 2RARA 3LI2A 3E2PA 5AQEA 4CIXA 1VGVA 1FBNA 1AKUA 1KL7A 2E55A 2QLFA 3L7KA 4II7A 4KO3S 2WBLC 4UBJA 3STHA 5I4CA 1KMNA 3L7YA 4UUAA 5JNVA 4D3YA 3FOZA 1UOPA 2JH8A 1JFFB 2WTAA 2RHGB 1WABA 2ZPTX 1SUAA 3AHEA 3EEBA 3E3NA 3H0KA 3HJAA 1KY4A 1ZIDA 4HCJA 2QRLA 3V8PA 3VNAA 3O4VA 4JGIA 5F77A 5IAAA 5D1HA 3TOXA 1E5TA 1MEJA 2CNNA 2VNIA 4FCCA 1WUTA 5HBGA 5E0OA 2Y1XA 3HNPA 3B78A 4YACA 3TD9A 2W2OA 2VG8A 2V7VA 4LGVA 1L7DA 3U60B 4MQEA 1ZFNA 3MB5A 4ZTUB 2IHTA 2AMFA 2AQIA 1T6BY 1YRAA 1GPLA 2VUUA 1TUGA 3H5AA 3IE2A 1CUDA 2FSSA 4PNPA 3AM3A 4YT4A 3NBXX 1YRQA 3OEED 3SVZA 4JXKA 1EK0A 2FEPA 3ZJYA 1HNZB 4X3CA 1TVMA 2H31A 1UODA 2Q0HA 3D3KA 4KE7A 4QU0A 1TZBA 3NOVA 2HRQA 2FI1A 1HOXA 3DOUA 4GAEA 4K26A 4HQNA 4KV7A 4IUBS 1L8QA 4YVFA 5DASA 5HCNA 4B6OA 4EITA 3OZ7A 5BPFA 4FZVA 1JWBB 3E5HA 2P6PA 4TKLA 4XFJA 3RJMA 4DR5B 2X4LA 2F1KA 2QZ9A 1EXMA 2QX8A 2B92A 1I4EB 3BMQA 4J91A 4MRSA 4Q3KA 2Q3CA 1CC1S 1U8AA 5AUNB 1YQDA 3RHTA 4K3UA 3I9LA 3RUIA 1ORWA 5K05A 4YRTA 4KXFB 3N8GA 4WPGA 2Z6VA 3ZBUA 2DBRA 3WOVA 2WEKA 3CJRA 4XFKA 1NWHA 2I1VB 3QXSA 1YVPA 1R16A 5FOVA 2BBWA 3WYEA 4M8KA 1V8DA 1XCOA 1ZGBA 3A4YA 4BATA 1F12A 4L2IA 1YQTA 4GE3A 1V6CA 4CT0A 2J1LA 2C9MA 1VSUA 4EDFA 3RU2A 2P35A 2Z83A 4UM7A 1GHTA 4C21A 1XSEA 4MWCA 4W1SA 4UPVA 4DN6A 3PLAE 2X6RA 1AQNA 3H2IA 1VYUA 5YASA 3G0HA 1P8JA 2BDTA 1SC9A 1R8SA 2LUOA 1M0WA 3P4YA 4HLCA 2O2SA 4U2GA 2KMLA 2P9TA 1RAIA 5EWMA 3SSMA 3V2IA 3B9QA 4DNOA 1N2SA 4E2YA 4YRGA 2BHNA 1L4EA 1PFYA 4OHOA 1UAAA 1ZOIA 2PIDA 3E27A 1SU7A 4W5JA 1M75A 2VJLA 4ZYXA 4FE4A 3FTCA 2IPXA 1E3WB 2W98A 2ZB2A 2R44A 3T7DA 3UJ7A 5JYDA 1QDEA 2RGNC 3AUSA 4LECA 3CH4B 3NTQA 1W5AA 3E9DA 1GD1O 3G2LA 5C1OA 4U7WA 3QOFA 5A4MS 2OP0A 3P8ZA 5TQ2A 1E3TA 1ETHA 1TTPB 2C9YA 4XUDA 4RZ3A 4Q9DA 3ELYA 1XZAA 4A8PA 1U1EA 1VI5A 4RWZA 3L79A 2FNAA 1AKYA 2Y0PA 1ORVA 1J00A 1TX4B 3KG2A 4HFJA 1ZVJA 4HQKA 4KXQA 4JC0A 3T7CA 3LQKA 4LSZA 3HU2A 2QW0X 1PNTA 4INAA 1EQ2A 3C3PA 4C5CA 2EWMA 3VYRB 4V0SA 1QP4A 3YASA 3D7KA 4UOZA 2HWYA 2GAAA 2YNMD 3B70A 3I37X 1G5TA 3RHFA 2OUKA 3B5IA 3ZXIA 5BQXA 1EK2A 1ZD8A 4CETA 1TECE 3L4BC 1ZL0A 1LPSA 5ICSA 3COJA 2PNFA 5DI3A 2AK2A 3NV7A 2D5IA 4CEHB 3L7JA 2XV1A 4RCVA 1NNI1 2ZYGA 2OQVA 1XCJA 1JW9B 4AJHA 1DBWA 1QIEA 3QNUA 3IEXA 3K20A 1G0OA 3U7IA 1WNTA 4HEQA 4OY3A 2HCTA 4JLJA 1N1GA 4RM3A 5DBFA 4ENSA 1X7XB 5KREA 2I66A 1T4MA 3KK0A 2NUAB 2OQRA 3WA7A 1FSPA 3ES9A 3R3HA 4MCHA 1E1RD 4X62B 1SK9A 3OLVA 2W42A 1QIJA 1W36D 3M3DA 3SFVA 2AI2A 2H2DA 4EM6A 3K0KA 4DR4B 1FX0B 1XZPA 2JGAA 4ZOBA 3ICCA 1H93A 4C4OA 1L4YA 4LF7B 2P9JA 3KALA 4QOEA 4BNKA 2PSHA 8ABPA 3T0FA 5KTYA 4A1OA 4N0EA 5JDIA 3HJNA 4M9SA 2J5RA 3KQPA 2OV2A 3UGKA 2PO5A 1BW9B 1W30A 4K7JA 3N2ZB 1E69A 2HTEA 5REQB 3ZD7A 2XTJA 1G6Q1 5BW6B 3B1JA 5H82A 5FBWB 3S4YA 1O6GA 2BR4A 3H65A 3BG5A 1A9QA 2ZQ5A 3K9GA 4IDEA 4YRDA 3LP6A 1XBTA 2BI8A 2JFYA 4IICA 4DARA 4MUEA 3GQVA 1T3TA 5DDIP 3GA5A 2D4HA 4LS3A 1RYFA 1E1LA 3KQMA 2PEYA 3AUAA 4L9AA 3GLQA 1Y5IA 3EXIB 1T9KA 1T9CA 2YN4A 1TGVA 1QX4A 2W5UA 4IDFA 3TVYA 1U7WA 3V2HA 3W4KA 5AO9A 3ZCRA 3HRKA 2IRWA 3LO5A 2PWBA 2HLDD 2ZUVA 4HHEA 4S04A 1SOUA 4LF9B 3GGOA 3UPTA 2TRSB 1W96A 2Z3ZA 5TS2A 2DFDA 1SR8A 2FSHA 3FYUB 3GVCA 4YGXB 3R8CA 3TXXA 5JDCA 2JD2A 2HV8A 1J07A 2ZJZA 1F2UB 4OA5A 3GBVA 3PWTA 4HEA6 1QO9A 2WV7A 4FTWA 5KQLA 5DHPA 3O8OA 1F6BA 4MB0A 3HXOA 4ZO8A 1E3EA 3B60A 1M2OB 5I7AA 4MAFA 1HG1A 1MEOA 4MROA 1GV1A 2AW5A 1IYZA 2HLNA 2X0RA 3N59A 4HDKA 5ECGC 1XRQA 4NH4A 4M1YA 3U2QA 1TVKB 4YJ2A 4WAUA 2Z5FA 3EY4A 5IKOA 5EKDA 3JTEA 4R54A 5K0JA 4J43A 4GOXA 3BFPA 3GT0A 5TV2A 4ER0A 1NJFA 3GLFB 4ZVNA 4MDFA 3CLUD 5IMSA 2EFGA 1H05A 1AKMA 1JFRA 5JAHA 2WD7B 1UXKA 1IIBA 1WZUA 4ZEWA 3A6ZA 2HO4A 3LXMA 3T1OA 4BRUA 3EDCA 4H3KB 5AFSA 5IYZF 2QMEA 1XZCA 2NVUB 2IKQA 5AOAA 3GFTA 2FH5B 4G8JA 3UW1A 1J97A 1TDJA 1MT3A 1QGAA 2WMYA 3AMVA 4JP1A 3IGFA 4Q47A 1W4ZA 4RXUA 3QZUA 3TSOA 2VNJA 1EYZA 1Y89A 2X2PA 5GMOA 1QKJA 5IAOA 1P31A 1JI0A 3UJCA 1NSTA 4WKPA 1WM1A 4HNVA 4CQNA 1FLDA 1JS1X 3ZBTA 4OSOA 5I4IA 1V43A 2SCUB 4JD5A 3U48A 4NXNB 1A7KA 2IKSA 1SCBA 4L07A 4YJ3A 5LB4A 1VSBA 1DLJA 2QMQA 3B1YA 3D64A 3GJ4A 5H0IA 4E15A 4QRIA 3WISA 3R20A 3WSWA 4X44A 4NE7A 4DZZA 3PD1A 1JLLA 4Q02A 3L05A 3E5RA 4MCAA 4X66B 1EX7A 2I9PA 5TY0A 3ANTA 4V39A 3HYSA 2AUTA 5JVDF 1S6YA 3RVSA 3W1EA 2A1UB 1XCGB 2AJLI 1M6YA 2I29A 3IEIA 3OE1A 3P32A 1TUEA 1STOA 2ZWMA 3JSAA 3TNLA 3U4QB 2VZ0A 1RCFA 3STWA 3ER8A 2LW7A 5B4TA 3BRCA 2B6HA 4JL5A 4ATNA 1GNTA 2HRRA 3MRTA 1GZ7A 3FOFC 1JQEA 5CA1A 2HRDA 3M4YA 2PTGA 4ZEVA 2Q1YA 2GRUA 3CR8A 3G7UA 4Q9IA 4HDRA 3MELA 4NNPA 4HWPA 4GVLA 2NWQA 4EX7A 1O87A 1LZKA 5FADA 5C7OO 1WSDA 2FVXA 3WNBA 1K5HA 4UUOA 1Q57A 3ZY4A 3C70A 1P0FA 1RQGA 2R4UA 1BJTA 3ZTTA 1NM5C 5F5NA 2ZUBA 3RREA 1ZUNA 3QVTA 3NGLA 4BUZA 3KWJA 1KWKA 2H4FA 3HS3A 1B1AA 4XB1A 4B2PA 4B3XA 2Z4SA 5LOVA 4HWGA 4BNMA 4WEOA 1SVIA 3EGXB 3P20A 3UMBA 4JWTA 4ECAA 2AJTA 1E5QA 1E7SA 1MBZA 5CYOA 5KZMB 2XZDA 5JNTA 1MB4A 1US8A 2HSGA 3TI7A 3OKAA 4JX8A 4A27A 3LCJA 1JALA 4LYFA 2W11A 4G0PA 1W5SA 2BZGA 2Q4RA 2V7XA 1ZD2P 1T9GR 2VXCA 2WKQA 4OI1A 1GG2A 1HORA 4X97A 1X8LA 5HMMA 3SDSA 1RKUA 4I8XA 5JI3E 1EGQA 4ZVLA 2MR6A 4OUDA 4L0QA 3OFSA 3RNOA 3CRQA 1ZD3A 4TMVA 5FWXA 3CNLA 5CB0A 1I7PA 1BMDA 2P41A 2BPOA 1A8PA 1X7ZB 4DMUB 3EIEA 3PFWO 2R7NA 4O4JF 4TXMA 2CVHA 1O96B 1O6FA 4U6NA 5ALNA 3T1NA 3VX4A 3G9ZA 4E88A 1KPGA 3L8FA 4I8IA 5LN1A 2DBQA 4UAVA 3JV7A 4WN9A 2V9ZA 1UKVY 3WQBA 3CLRD 4QA9A 4B76A 1I3MA 3I52A 4CMEC 3SN6A 5KNBH 3A1EA 1MOSA 2TECE 3KFXA 4LRTB 3STXA 2ZRGA 4U2FA 4FFOA 2Q21A 3B2EA 2NZ8A 3BE8A 3NWEA 1QTRA 3PC2A 3QOYA 4UKDA 4LY6A 4J16A 4WBXC 1K4YA 3DOIA 1A9SA 1SZJG 3TZ6A 3KQSA 3RADC 4OHRA 3ZIUA 4KZKA 1ENPA 5FJJA 3VKGA 5D3MA 1GQOA 3VPDA 2GBLC 4MITA 3IV7A 2ZSBA 3E3AA 3O3OB 2VJNA 4JB3A 1SJ9A 1TYCA 5A0TA 3GRFA 3HYTA 4LRYA 4UD6A 4NEGA 5LZ8A 4XD2A 3A1DA 1ZNQO 3OI7A 2FPMA 3O74A 2B61A 1SCIA 2XVMA 4HRXA 3UV6A 3VTKA 1M2GA 4CNQA 1O95C 4ZYTA 5FIUA 3AR7A 1LJ8A 3ABIA 4XSHA 1XTZA 3MJ4A 4H0NA 3PE4A 4EI7A 4AQYB 1YK0A 2CMGA 4PYIA 3VTFA 1SU8A 1HT0A 2R8BA 5E38A 2FZCA 2FK7A 5EJAA 1Q1ZA 3ADKA 1N1DA 2WKWA 3CZ9A 3F9RA 1O97D 1H9CA 2QN9A 1AVTA 4TWRA 1N5RA 4EY6A 2FG7C 2OG1A 3F6PA 4ZIRA 2NVWA 2D13A 2QV0A 4GUAA 1KEEA 2Z1MA 1PS8A 3WY9A 5AM3A 2FWRA 2V74B 4LCBA 1XU4A 1VFPA 4QPNA 1A82A 2BFCA 2XUFA 4PAGA 2HCBA 4US0R 2M6KA 1C0LA 3EC7A 1LBSA 1XD2B 4LYGA 1BXGA 1VXOA 4N6NA 5JLAA 1DV2A 3INGA 2HK7A 1F8UA 3FMIA 1SBIA 5FPYA 4B17A 4HZUA 4B6JA 2PUEA 2X13A 3QWAA 3N8HA 3HB7A 1E9BA 2O06A 4HLQB 4GM4A 1B0AA 4W1PA 1MJGM 3V6MA 3AHIA 2ECPA 3I6MA 5T6BA 2JAQA 5DGHA 3WXMA 3WTCA 2XMSA 2P3SA 1M54A 1TZ2A 1VI6A 2QL9A 1B15A 2OVFA 2JZOA 3QX9A 4OU5A 3BZBA 4I4IA 4WXHA 3MYRA 3T4UA 4I1UA 3W4IA 2GCOB 2YV3A 1WV0A 3QWHA 3OC6A 2VPQA 4RZQA 2OHFA 1OE0A 2VDWB 4QASA 1W88A 4UHDA 1E3LA 1KYQA 1YS9A 1PNQA 1WPXA 5D6NA 1K2WA 3SOPA 4MWTA 1XQWA 4U63A 4JJGA 5EPOA 2IU4A 2CXTA 4HAIA 3OQIB 4P4SB 4Q1CA 3FHOA 3H4TA 4R69A 4L75A 1M2FA 1CUYA 2BWJA 3S0JA 4NBUA 4DY4A 4PO9A 1KGDA 2P1RA 5ICCA 3OZIA 1KZ7B 2FX2A 3WB9A 1R0YA 4QYIB 1N2CA 4M0MA 2NXCA 3DVSX 5BN3A 4HPXB 3UWSA 3UK0A 3N8KA 4KE6A 5DI9A 3DEKA 3C8MA 1U2GC 4RZXA 4RCZA 3A1WA 3T7AA 4QARA 1Z2CA 3NDIA 1HF3A 1VGQA 3C1OA 3B1ZA 1VYVA 3IUYA 4H16A 5HIMA 1MC8A 3RUHA 5KINB 4BN0A 5B7GA 1MRSA 3IAS1 4X0EA 1MOQA 4ENVA 3MGCA 2QPTA 4G9GA 3PC8C 4GXNA 4YMIA 2XAUA 3TCKA 4AN0A 4CQJA 2H63A 4RX1A 2QF7A 3QBTA 3RJ5A 2B69A 3TIFA 3OJWA 1LVHA 4MQBA 4EB8A 2YQ5A 1HOTA 2C58A 3X1ZA 1HE3A 5FLEX 3KOUA 4KUHA 3P27A 3BGOS 4C43A 1G7SA 1R4MB 5AW2A 1B6SA 1V6SA 2GUWA 1P4JA 2CSXA 1FDOA 2RKWA 1XZNA 3BA1A 3OP4A 1N78A 4KH0A 1NFFA 2MINA 2Q1TA 1J90A 5DM2A 4YN3A 2W8BB 2UZ1B 3GFSA 3UPUA 1BCSB 1JEJA 1BSVA 1OILA 3RIHA 1ZIOA 2BFEB 4G23A 4YCMA 1MQAA 4U3JB 3D31A 4W8HA 4I1SA 2VJKA 2QUBA 5EQJB 3IPYA 1M0TA 1NXPA 1AGNA 3V3TA 5AW7A 3EF0A 2NVOA 2X9NA 4XB6B 4ZAYA 5JWOA 2HK6A 5A05A 5ECWA 2B1JA 3D1JA 2VYQA 3FMGA 3KDSE 1IUPA 4KWEA 5LDGA 1MR3F 1IK6A 1C3OA 2EGGA 3E15A 3LX8A 4S1VA 1EU1A 1T3SA 2KSQA 1H2FA 3PDIB 1DKPA 1QQTA 2HU2A 3CW8X 3TKLA 4XA8A 4CFZA 5JXWA 4RTMA 4KR2A 3OKPA 1HQDA 1JIXA 1J9EA 2QN8A 4FHGA 2GPYA 2Z5GA 1NATA 3BTOA 3CBGA 4D4GA 4EATA 5D7BA 4CKYA 5A2QA 3LXXA 2QUJA 3CUYA 2C5EA 4YMSA 1O2DA 4EJFA 1GN8A 3K0CC 3KO8A 4MVXA 3LP5A 5I3CA 1X7DA 1PWZA 2CXUA 2ZIFA 3GELA 3NDPA 4GSLA 4MRNA 1Q21A 5LZ2A 1TEXA 1WLSA 1ZI9A 3DDWA 3HK2A 2IQIA 4GLJA 2OPHA 2P1DA 4KPFC 3OO1A 4ZAXA 3NYQA 3UA3A 4E30A 2Y0BA 4C2BA 1KQNA 3LKVA 2J9FB 1EFVA 1XKQA 3U1BA 2E49A 2O8BB 1ACMA 4OYRA 1R4ZA 1U4NA 2ZFUA 4IIHA 1C1DA 1FPMA 121PA 1NBOA 2VWPA 4KQGA 3WBBA 5AVRA 3UKJA 1HMPA 2SNIE 3B3FA 4Y2XA 5L7WA 3LTEA 2D1YA 3MW8A 4DXDA 3A25A 2ZUEA 3JVVA 2EBFX 5TIIA 1Z07A 3F2IA 3ZLUA 1Z63A 4A26A 3I04A 5B3LA 2ETVA 3L5OA 3SZGA 1Y33E 2FSIA 3QKSA 3NT4A 1MQSA 4L1KA 2D59A 1IWPB 4LQLA 4QQKA 3KUDA 4B35A 1YDGA 2RC5A 2XX3A 3HJHA 10MHA 1DQPA 1FRZA 2I4RA 1T9BA 1P5HA 1EGMB 5FP0A 4X95A 4LXHA 4W5OA 1DAEA 2MR5A 1S2LA 4EGQA 2G9RA 4TMFA 5CT4A 2CXSA 4FCWA 3S2GA 4CM5A 4BQIA 4PYRA 2FA9A 5A2GA 1SHLA 4B3MB 4JI2B 5K3CA 2NTNA 3ACBA 2DAPA 5HF9A 4P0TA 3SXUA 2ZZMA 5JC8A 2FPSA 1AU9A 4MWGA 1ODTC 1XVUA 2FPKA 2Z58A 4RK6A 1F6DA 4TQAA 5F76A 2B1GA 4B85A 1Z2AA 4RIEA 4EKIA 5EWJA 2XTAA 4EBBA 4OHZA 1T3LA 5IX8A 4U2EA 1V96A 2XZTA 3GAFA 3E4DA 2WUDA 4AYTA 3IOMA 5EEGA 3FPBA 4LAFA 3QA3E 4JBNA 2BIFA 3TNJA 3ZGOA 1JLMA 4XTCS 1ATIA 1XVIA 2QN6A 3PC3A 2PHZA 4OAOA 1WE2A 5B3JA 4J6EA 4EK9A 1N7IA 4RDCA 2AFIB 2JNWA 4YPFA 4NMMA 1Q11A 1ENOA 2BHLA 5BN5B 3WHLA 4N18A 4JA2A 4ZTBA 2HZBA 2L69A 4CUJA 5JECA 4D5EA 4A0SA 2DKOA 3R7LA 3CTPA 2C2XA 3HCCA 3CE9A 3DP7A 2NU6B 5A7GA 3O94A 1O9BA 3RSGA 4ETWA 4DR7B 3K8YA 3LSYA 4Q3NA 4RWEA 3OP1A 1KY2A 3N0TA 3OJCA 5AJUA 4ID9A 4KXUA 2JI9A 4PY2A 1SKMA 1Y3HA 4UMFA 5HKAA 3BFVA 3T1YB 3VUFA 1S3FA 1EG7A 2F7SA 3PHCA 4LKRA 4H59A 3S2EA 4MULA 3TW8B 2JFWA 2O23A 1RI3A 4RSHA 3U5ZB 1F5SA 1OLUB 1QUEA 5DTRA 1GNRA 2X4IA 3CGGA 3HEAA 1UMBB 2ZE5A 3MEQA 4DLXA 1Q0LA 3I1IA 3FDXA 4AZ3B 2PYDA 4EOGA 5T5QA 5FX2A 4RZSA 3J7AC 1PEDA 3DT9A 3NKFA 2GN4A 4UVDA 5I3ZA 1NI4A 2BH2A 1RT9A 4M83A 1DMRA 2QXUA 4N65A 4BO5A 5F98A 4G01B 3NC4A 4QXRA 1Y63A 1FS5A 1EJ6A 1AHPA 3W8EA 4RV5A 1HRKA 3IKMB 1YQUA 2P2GA 1U0BB 3ZW9A 3WNZA 1NUHA 4C7KA 1R0WA 3ET4A 3HPQA 1GGMA 3CJTA 4Y6QA 5EFZA 5K3AA 3HKBB 4ZVQA 2PGAA 4IG4A 1CEYA 1AM4D 1WIWA 2O1WA 5HF5A 4IWYA 2VHXA 3QEBZ 1N5LA 4WN3A 5KYYA 1UBNA 1P8AA 3Q8KA 2ZUSA 5EJ7A 2AC7A 4C29A 2FKAA 1UWCA 1I3LA 1TT7A 3GLSA 2YINC 4X6UA 4C7XA 1IN6A 2ORYA 1PT5A 1RXIA 2L0XA 3DTTA 3IYLW 3NTLA 3M3PA 3WE7A 1D2NA 5GJWC 3T99A 1N6RA 3B53X 2GJ8A 2O6HA 4OJKA 4P81A 2O7QA 3PQCA 1QGUA 3FFWA 4YJHA 1JKIA 5DNUA 2Q3DA 1W8IA 1JBKA 2ZREA 3ADOA 4GNKA 5FD8A 1A7JA 3I53A 3K8ZA 4I4TF 3T9BA 3V4ZA 3U3MA 5FTLA 1J9ZA 1V1RB 2R1ZA 4YQYA 5CLGA 2I1QA 3TOZA 5BYBA 3OHSX 2YN2A 3RC8A 2DETA 1GPUA 4UQLA 5I7SA 4HRYA 2P2SA 4BVLA 1P2TA 3QE2A 1PR2A 4B84A 3K0FA 2F90A 4DHWA 3AUFA 5KYGA 1C14A 3U3RA 4BWGA 1L5HA 1KZYC 3FH0A 2FFRA 3MTJA 4YUAA 4ZXPA 4NZZA 1PJRA 2PKQO 5T4EA 3RS0A 3TQRA 3WMWA 2ZI4A 4IAOA 1DG1G 4IP0A 3X0DA 1ARZA 3N6VA 5LUAA 1W5EA 1KVSA 3DO5A 5SV2A 1BE8A 4FX5A 4TUYB 2XNDA 1XO1A 2W90A 1YQQA 3PEUA 4LPSA 4G07A 2HHAA 5J23A 4JIMA 3T4XA 2K2QB 3WLNA 4DR1B 1W85A 3AR2A 3CV3A 1J99A 3AKDA 1N5JA 3B85A 1TM5E 1TCUA 2QN7A 4OQFA 1SXJC 2HI0A 2PPVA 3DLPX 5CTJA 3AYZB 2X9QA 1I4DD 1ZJYA 1JNYA 2Y71A 1Q6YA 4MJ3A 3UAWA 1YJCA 3AG5A 4R68A 2C9CA 4XOIA 4MRMB 4WA7A 3K6KA 3VAAA 3Q10A 4BFTA 2GBIA 3KQWA 4ESHA 3PNPA 1I3NA 5EJ6A 3Q41A 4UUPA 1U3TA 3SC4A 4YRAA 1T5OA 3CNQS 4P54A 4ND8B 3HZOA 3P9QA 2VNKA 1EUCB 1RBQA 2JS7A 4BQNA 3EF3A 3LY5A 1HDYA 3QEMA 1SM4A 4LE2A 1RYMA 1P1BA 1W44A 2FEAA 1KFBB 1JFTA 4JFAA 2Q3FA 1N92A 2C4VA 2JEOA 3CONA 1Z4IA 4RVFA 5CB4B 3C3WA 4Y18A 2R1TB 2COKA 4XJSA 4EVSA 5KU7A 2GEUA 4KEAA 4ZQFA 4HBGA 3IAHA 1VOTA 5G1NA 5FUWA 4KK3A 3GEPA 1TTHA 3PL5A 4GR9A 5ENZA 1GQ2A 1SHTX 2B20A 1L3IA 1WP4A 4EY4A 2NQTA 1OI4A 1BS2A 3LK7A 5G0VA 5BN4B 5C8ZA 1AA9A 2PGXA 3MAJA 5EESA 4FS3A 4KLAA 1Y5MA 2E82A 4FCVA 1XZMA 2XDQB 4YGYA 1P1RA 3EIUA 1PEAA 3D0KA 3JZFA 5AK3A 1KQ3A 1U81A 5CFPA 2MWMA 4YAJA 1V26A 1WXQA 3ISVA 4R2LA 1EVQA 1BGXT 1JIQA 1U11A 2JHAA 2QAGC 3GUVA 3TRJA 2QTHA 3K09A 3O1LA 1FA9A 4HUQA 1HKUA 2ECQA 2VHJA 1JR3E 2DYKA 3C3KA 3SJBA 4BNDB 3AHDA 4ZRDA 1GFIA 2CJPA 2OSVA 1AO3A 4PBRA 4KQCA 3WQHA 5FV7A 4A5SA 1WQ4A 4BXOA 4QPDA 4BLPA 4Y7CA 2CLOB 2H5JA 4RMGA 4B8WA 1CB7A 5BMVF 4D96A 4DF3A 4EGFA 4DTIA 2Q3JA 5AHKA 1QHFA 5TR9A 1FP4B 1K3TA 4GR5A 4TT8A 2BHRA 3V4VB 3GEBA 1E9DA 2HJVA 4RANA 1YQEA 1L4BA 4NPCA 2GPTA 5JZBA 1BN6A 1DNPA 1SG6A 1I36A 1DAIA 4O08A 4FB4A 3ECSA 3NBFA 3LPAA 4MUGA 4GT1A 4L4SA 2YZMA 3TLBA 1ECPA 4S1NA 1JSRA 4E21A 4J49A 1P62B 5JI2E 1HYEA 2JW5A 1X70A 3R74A 2F8SA 1E18A 3H9JA 1KQPA 2ORWA 3O8QA 4B6PA 3HYCA 1CS0A 5TT0A 3SBDA 1V9SA 2Z9BA 3VMMA 1JE0A 3VYWA 2AN9A 3C8HA 3QKIA 4BV8A 3AF1A 3I2KA 3LSTA 1ZRSA 3K4PA 4IJ6A 3WIEA 4ANFA 4DMKA 6REQA 2RMKA 4N5HX 3E5MA 4DQLA 3C15C 4KXMA 3N58A 3RODA 5CDGA 1XZGA 5TB5A 1KBQA 1AN9A 1KU6A 3PEFA 3ZWCA 5LMNB 1ZXXA 1JXMA 3IBGA 3LX4A 3LHIA 3BERA 3QTLA 3M70A 1N8SA 3ZE2B 3L4JA 5LQNA 5HUJA 4K6FA 3W77A 1OTHA 1EUYA 5EP2A 2HK9A 2K4MA 2R4TA 1E2FA 3H3JA 4YJDA 1OWMA 3GT3A 4EHHA 1D2HA 3PGXA 2G63A 3MJHA 4ITRC 1F48A 2INGX 3A1VA 3NIBA 5F2OA 3AJ8A 1LWNA 1G4UR 3N76A 5T4FA 4B4KA 3ZYZA 4GLLA 1GPMA 1Q3TA 3F49S 5AKXA 3NNDA 5FHRA 2HSJA 2IH2A 2Q7DA 5JUWA 5HCUA 2QORA 4LXUA 1KYYA 5TEWA 3NUQA 4DLPA 3PC7A 1JAIA 2XE8A 4I14A 3C87A 3W2FA 5LQMA 4NJOA 1DUIA 2E4YA 1JVNA 3HR7A 3DDZX 5HS6A 2PT7A 3OQJA 5CDTA 4G63A 3RJ9A 2OZPA 3L8CA 3TQTA 1VE6A 3NAQA 1IBRA 4NEQA 3AC0A 3WK4A 1JVBA 4F3TA 4HC4A 2CHGA 3FKJA 1E3QA 5K8VA 1G4AE 1ULAA 1Y4AE 2OAGA 3EWIA 4KH1A 2X2FA 2VNSA 4JUIA 5JG7A 2PUCA 1RYZA 5HR5A 1VE3A 3H9BA 5LUBA 3W7VA 1K7FB 1DAHA 5JO9A 1H2EA 5H3CA 2PKEA 3ETHA 1ZVMA 2WFAA 4A0QA 1KMQA 1AKQA 1D1TA 2IEIA 3KZ1E 3D8TA 3OHMA 2N46A 1PZGA 3I23A 5C0OE 3MWLA 4JB8A 3BT7A 1E2MA 2IYQA 1WVGA 1JQLB 3HLYA 4IIJA 4HMOA 4JEIA 4YLGA 2GKSA 1COWA 1SIBE 2BM9A 5L53A 3CO5A 3LVQE 1UPXA 2FE1A 2VZ8A 3PC6A 2OAEA 4OX9Y 1FW6A 3UB2A 4F11A 5EA2A 4ZCPA 3ESDA 1E6UA 3A32A 3UUWA 4AWXA 3AEYA 3NYRA 5A3QA 5KS2A 4I9UA 2A0UA 3AFGA 3LOPA 4C6HA 1VP9A 1IK4A 2ZDQA 2IUSA 4OV6B 5MN6A 4IKOA 1OASA 3TD6A 2JBAA 4Z8YA 4XIFA 4C6TB 1Z8FA 3RSSA 3KT0A 3IQWA 5AJTA 4H1VA 2OLKA 1B3RA 2FPXA 2HYIC 3B3JA 1EJ2A 3ED5A 4ZQGA 3AUJB 1USIA 3M4XA 4EPYA 3ONFA 3ROPA 5KC8A 1KEKA 1LQUA 1YR8A 1HT2E 3IP9A 1I1QB 5CX1A 4ADSG 5HQ3A 3Q2IA 1Y98A 4H1UA 5F3DA 1K63A 1NNUA 4GWLA 1T2FA 3B20A 5CR9A 4QXMA 1SVSA 2WLTA 3IOBA 4FEGA 3IEVA 2O3UA 1PQUA 1UADA 1G5QA 2HNAA 1UC5B 2X6QA 3R3XA 4WK0B 3UMRA 4L4RA 1EB9A 3U19A 4PPQA 1H5UA 2DTDA 3LUKA 3OT1B 4RK4A 5AW9A 2V0GA 2YZGA 1JA1A 4IY1A 3UC9A 1QG2A 3H8WA 3MN1A 4P4UA 1RIIA 3N3BC 4UQOA 3M1AA 4U0KA 1ONSA 1YRWA 1BHO1 2IXFA 2R47A 3M9WA 3EFBA 3GEDA 4TLCA 4RABA 3UYKA 2G9NA 3EGIA 4B87A 3T7SA 1Q14A 2QTMA 4N01A 4LHWA 4Q6BA 1KYVA 1ZRNA 4M8NE 3WB1A 3IT0A 3ORSA 1TADA 1HZZA 5K6RA 1C0EA 2FLKA 2PX0A 4US1R 1PYDA 3GLVA 4GIBA 1RAEA 3BB4A 3OJEA 4P4LA 2KYRA 1ZU5A 3S55A 1GQSA 3OIWA 4LV8B 5C1PA 1V1MB 2XNDD 1W25A 2JC3A 1A7AA 1TO2E 4HYQA 1V45E 3VOAA 1MNAA 1G19A 4F2PA 1BKDR 4TWJA 1OFIA 1GA4A 3EGDA 3H5OA 4B31A 4DPLA 4WFJA 2MJLA 3A4IA 3EFHA 3VDNB 5TEVA 2E1PA 1FYEA 4BO9A 1OVMA 1LA2A 1Y9EA 2YVKA 3RGWS 4I5GA 5K6AA 4DV1B 4LF8B 5HK8A 4F0JA 1LLUA 1KK2A 3KR1A 2WT9A 1PQWA 5EY5B 3VR0A 4ARVA 2GJAA 2IVZA 2YZNA 3HFSA 3PJGA 4OTZA 5KVCA 3F7TA 3B7PA 4KWTA 4UTPA 1MAUA 1HG0A 3JQ9C 1O94A 5AVYA 1IEVA 4JC8A 5DNYB 2ID9A 1CZLA 2YHUA 3GVHA 3EVEA 1JAHA 1K5PA 2W48A 1E7WA 1G20E 3A0UA 2IPLA 3CR3C 3KZNA 5IAGA 1N2XA 2WM8A 3DF9A 5LYJF 3TAHA 1RAAA 1GQYA 2EFEB 4J1QA 4LZJA 4XGKA 1T5DX 1E63A 4BX8A 4CF5A 2FHSA 1T6NA 2ZRIA 3FOWA 4NWIA 1LDBA 1NP7A 2O4CA 1I3OA 5HMLA 2M98A 4YQFA 2VQFB 4UM9B 3LF1A 4DEYA 1ADGA 4BBAA 4OI0A 1BC5A 4GVXA 2WHRA 1LGYA 4IKPA 2ZYUX 2WWGA 2JRCA 1CY0A 1XTVA 2HBRA 3NDJA 2DRIA 3TZLA 2DUJA 1QFSA 2H6EA 4MJXA 4BP9A 4NBRA 4AF6A 4NOKA 5BR1A 4QXPA 3I32A 4HDCA 1NONA 3LUCA 1F8FA 2QZPA 4YPVA 1VDMA 3ZZ0A 2J6BA 4X3PA 4L73A 4YP5A 2W0MA 1GFZA 1M1XB 2LP4Y 4BBJA 5B12A 1N2IA 1X19A 3DMPA 1TXGA 3S68A 1M34E 3CG0A 3Q7PA 4MP8A 4XWGA 3S2SA 4WVFA 2G9UA 1JHMA 1K4MA 2V96A 2XAAA 5KB3A 3GLRA 1G3QA 2ZJFA 2IV3A 2BMWA 4Z5XA 5ESXA 1SD1A 1Z5GA 5EZ5A 4TKVA 1NPTO 1Q7TA 4E3ZA 2X6TA 3P0RA 1L7EA 1MO3A 3CUWA 3VO2A 4KMRA 2VUIB 1G4HA 1I7NA 1PI3A 1RWQA 2JDIA 4K9SA 4BFUA 2PFKA 2KLHA 5DE3A 1NXVA 4RVUA 3LC2O 2B8WA 1YB2A 3BJRA 3T6KA 4BLSA 4C0AC 3L6UA 3VHXB 4EHLA 3AFOA 4ZKDA 1YBHA 2A1UA 1LEHA 1T6YA 2R86A 3SHTA 4I55B 4C5BA 1XPJA 2VHZA 4BJ6A 1SCJA 4YUYA 4LK2A 1TT5B 4M60A 4MKXA 4EEZA 5BT8A 1M8JA 5KYKA 3WYDA 4IIGA 4OLFA 1KI3A 4R05A 2Q4BA 2XMQA 5HGJA 1PD1A 5M29A 4BCCA 5EIWA 4MQ4A 3Q8MA 3O90A 4L16A 5AK0A 2FEKA 4E08A 4WX2B 4FGJA 4GKJB 4K6CA 2I03A 3RBAA 1G7RA 3LLMA 3PB3A 4B7AA 1DCKA 2A7XA 2OO5C 3IJPA 4XGNA 4C2TA 4FMDF 5LP6B 4G25A 3F5QA 3LQ2A 1KJYA 3DV0A 2PUDA 3EZYA 1UK7A 2BUAA 3IJEB 2BGNA 1RPAA 4IGEA 2PA0A 1EI9A 3S2FA 3TL3A 5JD6A 1GKYA 1VIDA 2P67A 2PD6A 4JXJA 2FRVA 3ZE0B 3GNSA 2J9XB 4MJ7A 1VPDA 3KUUA 1TM3E 1VG8A 3MIZA 4D4KA 1H0HA 3NR2A 1NXSA 3UTDA 4FMPA 1YZKA 1P19A 3OCZA 1F0YA 3R0ZA 1XZHA 4WLOA 2ZR7A 4OBBA 3ZE8A 1TTQB 1HLPA 1AQJA 1XD8A 3MLBA 3MOIA 1X1AA 4RY9A 4WJZA 5CB6A 5FYDA 3MG9A 2Z2KA 3ZE1B 2ZWAA 5JS2A 1P9RA 3CX6A 1U65A 1KYWA 3K1JA 3ON5A 3TTTA 1JU9A 1X3SA 2ZSIA 3TEJA 2QJWA 3ADBA 3WYAA 5FUYA 1M8FA 4DG8A 2OZLB 1Y4SA 2EF1A 5IDVA 2FMXA 2PS3A 2WJVA 1GU0A 2G4CA 5F1OA 2ARKA 3RNLA 3FTEA 1D3AA 3R6TA 4D92A 1L5VA 2DTXA 2PIAA 3GCZA 1Z6XA 2J6CA 4D9EA 4MHSA 3DCIA 3IQHX 3SIWA 2HQRA 3VR5D 5IZCA 2BJWA 1ZGHA 3QYPA 3NU1A 4JR0A 4RLFA 2IY8A 5KDDA 3CVOA 4G0YA 4V1CB 4RDIA 2G25A 1M6NA 1I2ZA 3BXEA 1IHOA 2BZ0A 2IYSA 2PU7A 3NCHA 2P40A 3Q5GA 3QQ5A 2E4VA 4HJXA 4X63A 2F3PA 3AIOA 3OZFA 3EDMA 1SQFA 4H7IA 5LKRA 4BNJA 4O1IA 5JRDS 1FUEA 4IF4A 3H18A 3WP0A 2RCNA 4ZO9A 2JFXA 2P9CA 2AYXA 3DT6A 3PGJA 4I36A 4KWHA 1TF7A 1COWD 3BSFA 2LDBA 5EP1A 1IBSA 4ZEMA 5KOYA 4L6IA 5JALA 5M04A 2EJUA 2G0TA 1SC3A 3SZMA 1NZJA 2ZKIA 3LYUA 4HQOA 1BVUA 1WVIA 4G0MA 5GIOE 1F6WA 1EHCA 1IZZA 2EQ5A 1D7AA 3DYBA 2H4JA 3FVQA 3QVLA 2IZ5A 1SCUA 5AI0A 1X77A 3R7BA 4LJYA 4X84A 3GPDG 2WIGA 3EAQA 1T8UA 2GSWA 1KXJA 3OZCA 3P19A 1JZTA 2HJHA 2PSJA 3LO8A 1CNFA 4KIFA 3A1CA 4IQ4A 4QUKA 5TGZA 1X94A 2PSEA 1C3EA 5CGZA 3RVDA 1QONA 3PUVA 5IAKA 3BJEA 1WXIA 4ON9A 1PV4A 1T5IA 5IVHA 2HHLA 3QV1A 1QVZA 4UU0A 1R88A 2PGNA 1R74A 2QY9A 1HH4A 1WD7A 2HIMA 1NF8A 3AWIA 4OJMX 2W2VA 5THQA 1RE0A 4M0CA 3KSMA 1EZ1A 5G2OA 1Z17A 2X7HA 4Y0NA 4G6ZA 1U7UA 3FUUA 4IDGA 1XD2A 3V4PB 1F14A 5E2AA 1U1IA 4FMCB 3QPBA 4LNUA 1A72A 1J2EA 2R8YA 4V0ME 3L77A 3M6AA 4ZOLB 13PKA 3BSSA 2HQ1A 5J63A 1M6VB 1L6IA 4QJ4A 4ZYYA 3UPDA 5J2TB 2ZBUA 3GRUA 4UCWA 1TEHA 4L72A 2Q2NA 3W2EA 4B4VA 4PTYA 1CUZA 1C9MA 3KHTA 3H11A 1JU3A 3VNSA 1X9HA 1OW3B 2CXXA 3BC1A 4IYRA 4M99A 4MW0A 2AG5A 1MVLA 2ZYAA 3C3MA 3HB1A 2MTBA 2Y9PB 3SLGA 3BIFA 2X86A 4R8SA 2GCOA 4FDUA 4NQRA 3SOZA 1E59A 3D7NA 3FB1A 2R6GA 4FOSA 4NK4A 2JGKA 3IIKA 4QIHA 3SLKA 3WYFA 4ZQEA 3KHUA 2VDWA 2HIHA 5ARBA 2EJTA 1T26A 1IEXA 4IF6A 3TW6A 2I2DA 5AHOA 3COPA 4P4SA 3PRYA 4WCFB 3UHFA 1IRIA 2O05A 1XA3A 4WBSA 5DLPA 3SEFA 4D74A 4G8BA 5D51S 4CIWA 4YIHA 4BC0A 1P61B 2Q2OA 4IJVA 4M0FA 1GTL1 2CFRA 1MPXA 4EJSC 1ZZEA 1SQ6A 2I4OA 2NZJA 1JAYA 2W93A 3K1TA 2E89A 5E6UA 2V7QA 3FCXA 4TTTS 3QU5A 4ZI2A 1JZSA 5ES4B 1RW4A 4NNJA 1UJMA 3CWCA 5B4UA 4N3AA 4XUCA 5FWDA 2PQ2A 3DLAA 1O94D 3GROA 1ZJJA 1X8JA 2D1FA 3NHKA 5K3DA 5IWCA 1L1FA 2ZK7A 2HSWA 2R8RA 1JEQB 2C8KA 3HNOA 4ZXFA 1RYBA 5L3SB 1DB3A 3PHIA 5JS1A 3DCNA 3MVEA 5BYAA 3FKSA 3D6VA 1F9AA 2JKYA 2OZKA 3C14C 3F8TA 3HBNA 4F7DA 4W99A 1TMOA 1VPVA 2PR7A 4KVFA 4B83A 2ZTSA 2O8FB 3PJDA 1ZK4A 2GF9A 3ZQ6A 4EJ0A 1UKYA 3ZD8A 1R4MA 1UWLA 5HUHA 5JS7A 1A5TA 1DTWA 4OP3A 1DCTA 4FYYA 2QLBA 3H86A 2OMKA 3UKDA 5FLXA 1E2DA 4BASA 3ILHA 3O1HB 1N33B 2HNKA 3A28A 4X8HA 1W1WA 3EH1A 4GGPA 5EE1A 1BCSA 3LC7O 4UULA 3LIIA 3WL8A 4EZIA 2D62A 4PSKA 2V45A 4MUHA 4ZC1A 3WO0A 4JSYA 2AHRA 1M1NA 2FUKA 3NHPA 4FFWA 3CUKA 3FDZB 3P9ZA 1P74A 5MF6A 4J1NA 1ES9A 2KM1A 2YWXA 3GGJA 3RS3A 1F38A 2GZ2A 5L9AA 2J08A 2WE8A 3E9RA 3TYXA 4TKMA 1J22A 2M6LA 3EX7C 4B6EA 4US2R 3DHEA 3EVBA 3PDCA 4FYPA 1SC1A 3SHVA 4XWOA 4KITB 1G8KA 2PNJA 1WUHS 2B35A 2JDID 2KS6A 3RIMA 3C7TA 3R3UA 1NR1A 2XYRA 5B1SA 1U1DA 4LYYA 2NT4A 4RNDB 3W6PA 2I8LA 1R64A 3R6LA 2JJYA 1IOVA 2R85A 2HFJA 4JVOA 5IBQA 3UY4A 4DXAA 1R8YA 1HZJA 1V9CA 2OAP1 1KYZA 3EDOA 4K9RA 2R751 3QLTA 1YVUA 3RTBA 3THYB 3JR3A 1IG3A 4KGXA 2UYYA 1CRPA 2WAXA 4J7CA 4JLMA 2XMDA 5CW2A 1GAXA 3TVTA 4DBVO 1I9GA 3NHLA 5E4FA 1O54A 1ZYUA 1IBLB 3E23A 1QC5B 3Q7TA 3CSUA 3HKCB 3ONVA 4RIGA 2O8BA 4BU0A 4B3CA 5JQWA 1AXEA 2EX1A 4QNNA 1I6LA 3WK9A 4GD3Q 3PQ7A 2VLBA 3RAPR 3AUKA 1QYCA 3UMGA 4DVGA 2J0SA 4FKBA 4KO1S 4WNCA 3X2FA 4GZLA 5JEDA 3RRYA 2XUZA 3EMKA 1DC7A 4RACA 3EG9A 3FMFA 1UKEA 2IZOA 5IKEA 1VLZA 4M76B 3IHKA 4XSVA 2PLRA 3GW8A 4JT4A 4Q4LA 1M83A 1JSLA 1PN3A 2ISCA 2ANBA 3JAWB 4JEHA 3BWVA 4OGLA 1XRJA 3AILA 1QAOA 1JEDA 1QZTA 2CBXA 3JQFA 1KPIA 3CNHA 1T0PA 1E1NA 4O4HF 3CX8A 4O2BB 4QPZA 5TQJA 2XNHA 1H3FA 2O2DA 3EJWA 3R0JA 1Q0RA 1ORRA 4V0LA 2OZVA 4PRKA 4WXYB 3L8MA 1IH8A 3PFFA 2A14A 4MYSA 4TRNA 4F71A 1VCIA 2WT8A 4ERXA 3DDHA 4CUZA 2PUFA 2BMEA 2AH5A 4IQ8A 4FBGA 3BMNA 3CPEA 3AV3A 1KAHA 5DU2A 1N1EA 1P17A 4WIAA 4XM0A 3QHPA 2AFRA 4P36A 3UAZA 2GPJA 2GEFA 2XUJA 1ND6A 3I9NA 3KTDA 1ZGCA 3A3PA 4R16A 3LBAA 4LTDA 3SIXA 1OV4A 3ULKA 2CKDA 1NVKA 4RJTA 2HMYB 2QT0A 3NDRA 3EXEB 4N76A 4GPZA 4TZTA 1FSFA 3FA2A 3VKWA 4I08A 3WNDA 1ISIA 1YQWA 2NO7A 1MGOA 2J8ZA 1DS6A 2MHCA 2QP4A 3INTA 3NM4A 2WPDA 3PC4A 3Q8XB 1JXQA 2GLUA 4KQ1A 3L9WA 3KOXA 5GWXA 3S7TA 3B48A 3I2GA 1WSWA 3EOBI 4PGAA 3C2QA 5IYZA 3GLIB 1LUAA 3H5VA 5KAPA 3WWDA 5AKLA 3EE6A 2D4AA 3TXAA 4QQNA 5K4AA 5L7TA 3VR6D 4DSAA 2PZKA 3EXFA 3FIJA 3OOEA 5DBHX 3SX0A 4AJKA 1JYSA 3QXXA 3ZWNA 2IVFA 4PNZA 1ZC4A 3F7OA 1RJ9B 1S7GA 2EXXA 1KERA 3WSTA 2NAPA 4WZBA 1XRPA 2NU6A 2NU7B 1CERA 1EQUA 1NKSA 3Q7IA 3BK1A 3PPYA 1AKWA 3LUPA 5HNKA 4HLUC 1IONA 2NUPA 4AULA 5ITVA 1CU1A 3U1TA 4O3MA 2V5AA 1FFGA 1ZNXA 3GP3A 3GYGA 3R40A 5FTMA 3CEAA 3KUKA 3N8IA 2I65A 5KYWB 1QRDA 3LUHA 2AF3C 4E5VA 4C7BA 2WP0A 1E94E 3C48A 4BWFB 1OLUA 1W0KA 1E61A 1L7NA 3VC7A 1H42A 5JVDA 1ESDA 2FG5A 1H6AA 5ICFA 4RZUA 5UKDA 2GNAA 2MSEB 4JOBA 4LY9A 2R6HA 4U2BA 4EAQA 4INPA 3ROFA 1IAQA 3AEKB 4QYXA 3SK0A 1GKIA 4JLNA 5F5LA 1JIJA 2QJRA 3BL8A 1RAGA 5DHSA 5JJCA 3LQ1A 1GTG1 4HH4A 4QT0A 4HNQA 5IC5A 3VISA 3VPFA 1DZIA 3SPXA 4A82A 2H3HA 4S0ZA 2W00A 1ETUA 1JR6A 1XEWX 2EBUA 1C9YA 3RVMA 4BGDA 2JARA 1WUKS 3FVWA 2QSUA 2WSBA 2JGDB 2EEZA 3NEAA 4ZQIA 4E4TA 1ADYA 4FYWA 4YAKA 4MI9A 1G9SA 3OX3A 4H6PA 2AC2A 1OT5A 2GPAA 4C9BA 4TXJA 4D9BA 4KFTA 2E4ZA 4TMTA 1YRHA 1F0KA 1S02A 2XOKA 1DT5A 3AVQA 5EYPA 5JCPA 4JYBA 1BGWA 3A6HA 4Z2YA 3IL2A 3UMCA 2R9VA 1IB0A 4FZJA 1ISFA 1BDBA 3ROQA 3L43A 5DGXA 3U3JA 3I4FA 4D4LA 3N0RA 1P0MA 4RJIA 4KPEC 4OMCA 1HA3A 4MKIA 4FGSA 2CNKA 1E3DA 3GBSA 3ZHSA 4BMNA 4Q3OA 3GLHB 4XD7A 4ZVKA 4BVKA 2IEGA 3D2BA 4PXSA 3GJ7A 5E9JA 1DBPA 1U2ZA 3FHLA 4XVUA 3OECA 1G18A 3HB0A 1Q83A 3ICPA 4KN8A 4MR9A 5CH8A 4ZV9A 2OYCA 1VBKA 2EZ4A 3EVFA 3G8DA 4L5AA 4N8EA 1WQ3A 1FFXB 4NVRA 2NLOA 3H5WA 3DSRA 1QKKA 5LU9A 4KTTE 1HE4A 4GKVA 2N42A 1A9ZA 1DZ3A 1YB5A 1MG0A 1V1RA 2B30A 1XHLA 2R4QA 3MMSA 2SBTA 3AL0C 2F2TA 4I5IA 4O4JA 3E7PA 1TJ4A 2O0HA 2V7QD 2IHJA 2IXBA 3S5UA 4E32A 3TI9A 3VZCA 2VUHB 1YOVB 4PZ9A 5JNRA 3M6LA 1SUBA 1GWNA 4DDWA 2I7TA 4MHOA 1UP7A 3MQ4A 4PAOA 4DPMA 2NM0A 2WSSA 1TQ4A 2H1FA 3NONA 3QVWA 5AVSA 5H8WA 1GPDG 3V2UA 4Y6PA 1P7VA 2BM1A 4RKEA 5FAKA 5K8LA 1QE5A 5LA6F 1PUIA 4L9RA 4RLSA 3C3DA 1KZ9A 5B53A 1H5NA 3FKSD 3TSZA 2A9OA 3BZWA 2XB6A 2WJWA 4PFKA 4YALA 2VSFA 3TSCA 3WL3A 2JFFA 2YMMA 3C7DB 2ZVJA 2ZITA 4KDRA 2P11A 3KKLA 3UT5A 3JD3A 3FCOA 5LWHA 4ZREA 1DKMA 3R3VA 2PUBA 4IGFA 4QXOA 3D8NA 1WXEA 4L28A 2JI8A 4JUCA 4QSHA 4CODB 4C0QC 2H5EA 1D9ZA 4MRMA 5EOVA 2O5RA 1M7GA 2G77B 3GX1A 1X92A 3JZMA 3LPNA 1QZXA 2AV6A 4H1HA 1MH9A 4EW2A 2QWXA 3JQDA 4F5ZA 1AQ6A 2DM6A 1I2AA 2J0VA 3A9UA 3DUFA 4GM0A 5BVGB 1X39A 3MOGA 4NJMB 2EGUA 2Z1DA 2Z5VA 2F62A 3Q2OA 1KMIY 1V71A 3TEMA 2ETXA 2B7CA 1IRXA 1DIBA 4DCUA 5C8DA 1YDWA 1RXCA 4YMLA 2ZRBA 3PL1A 2AQ8A 2X5XA 2C03A 3HBMA 1U3CA 3LLSA 2A9VA 2AKEA 1ECBA 1I2BA 4JCCA 5CB4A 1HFKA 2GEJA 1FU7A 2K6GA 2R1TA 4NS4A 4HRVA 2JIOA 1QIHA 4F3CA 4Y8VA 3W1VA 4V0QA 1WHSA 2IEBA 2B4RO 3FYCA 5CURA 4ZVOA 4JP8A 5C32A 2IHKA 4PC7A 4FEYA 2H1SA 2BP7B 2Z8ZA 5T6MA 1Y4UA 3U6KA 1RYEA 2HF7A 4KUEA 2LD4A 1G17A 1V7QA 4YLYA 3R77A 3S7ZA 3DZKA 1KFEB 1J42A 4PANA 3RQIA 4Z4HA 2OV8A 4KXYA 1SPBS 3EGEA 4KWIA 2A94A 3WYGA 1Z6PA 5HGXA 1RJFA 2WNIA 1YVDA 5L51A 3MRSA 2JFZA 5DHRA 3ZV6A 1B8UA 1MNQA 3NP9A 2FXVA 2IX3A 2CVQA 2Q50A 2Z2IA 3E4CA 1USGA 3H19A 5EZSA 1SXIA 1D9XA 4G0XA 4B7ZA 1PLLA 1MEEA 4DRZA 1QGZA 4Q1AA 3JAKA 1MF7A 3L04A 4TWZA 3FHCB 2H06A 2D7DA 4TYWA 5CT5A 3A6PC 2Y9MB 1F1JA 1OI3A 3MGAA 4D4MA 1F8YA 1MZPA 5ELMA 2GR9A 1L7QA 1PSWA 3KLNA 3LY8A 1LDYA 3CNOA 3IPAA 5B30A 4OVKA 3EXAA 3ZIDA 1Q0TA 3LCRA 3BL5A 3HJUA 4BP8A 2NU9B 3A2LA 3ELBA 1B00A 3ZGNA 1U3FA 2IOHA 3OU6A 3QFSA 4TMWA 2OM2A 2YWDA 2HX1A 5KQPA 3T12A 4Z86A 4JNCA 5HUQA 1W76A 3D1LA 3IXQA 4ZCSA 5GZ1A 3D2AA 3TWOA 3S1AB 3EPHA 4FQ5A 3SKXA 3U4CA 4A2CA 2GM9A 3HY3A 1KORA 1C5KA 1U1CA 2P5UA 2ZVPX 3FPHA 4C05A 3WYCA 3ZNNA 2GCNA 4GI2A 4B40A 4FDMA 1YI1A 4MUAA 5FPPA 1XDDA 4CNBA 8AT1A 4A3SA 1J9GA 1MPTA 2C5GA 5JXIA 3KFVA 3LWDA 4IHJB 5DGDA 2WR8A 4XGIA 2OILA 3OQMA 1CNMA 1OD6A 1EHIA 1SUDA 4JLWA 1SCAA 1KPHA 3M34A 3N70A 3O95A 2X0DA 4ZHSA 2VHQA 3DNMA 3WBFA 2V59A 3WO1A 3MMZA 4BKOA 3QEKA 3N6XA 4B4OA 1MDBA 1Z6TA 4LFAB 2VDRB 3BXXA 4IIEA 1LRJA 4M1OA 3SMQA 4GOND 4RPGA 3CURA 1AE1A 5HE8A 1UC8A 3ETEA 4X7PA 3IMFA 5C37A 1R8QA 4BVFA 5FBRB 2WPDD 5D1NA 2QM8A 2V6BA 2YV1A 3I8OA 1UOEA 3W5IA 2VDMB 3R7WA 2XCOA 2OHXA 4Q18A 3RG8A 4FHZA 5KNDH 2G1AA 1S4MA 4RULA 1XTJA 4H7FA 4LWOA 3GOHA 2P30A 2XQKA 3GNTA 3N8NA 4XWAA 4L22A 2HCRA 2YWEA 5DBOA 3BORA 1F20A 4WE3A 2Y67A 5KPDA 1ST2A 5IVKA 1C7FA 4QUEA 5IS2A 2FPWA 3IP5A 1FYWA 4NESA 5TSDA 3WGGA 4JUDX 1W2WB 1ABFA 4G5QA 4QGFA 5A4AA 2W6QA 2GWRA 1ZBDA 5JPDA 1JQJC 1F06A 3DWFA 4ZCTA 3EZLA 2IUTA 1YJ5A 4PYJA 2GF2A 1E0JA 3Q3VA 3TM5A 1JTEA 4UHHA 3FBWA 1T5TA 4X9XA 2AD1A 3TQOA 4B2YA 4ENRA 1A4RA 3DMFA 4Z49A 1DWOA 1PYGA 1WCIB 1J8FA 3Q1LA 4LV6A 4GMGA 4TUYF 4MCJA 3L41A 3RWOA 4DBZA 2FX3A 1W0KD 4PYOA 3JYNA 4MGHA 2R11A 1X7HA 2G83A 4IRUB 1RACA 1WXXA 3HCDA 4LOHA 2GAFA 4O2LA 2QR2A 3K1YA 4X94A 4CV2A 2FFAA 1PUXA 4I3FA 3OOWA 2EKQA 1YHYA 2J3IA 3TW4A 2BY4A 4WVLA 4LJ9A 2XZLA 3GLUA 4HGPA 2XOEA 4OL9A 3H2HA 1ADBA 2FTKE 2VAPA 1CUVA 2ILVA 3O26A 2DF8A 1XLWA 3PU6A 1DIAA 2EKPA 3RC3A 4XJXA 5KWIA 4XRGA 3Q3EA 4Z1OA 4BMVA 4OA8A 1VLJA 4KQIA 4L15A 3ID6C 4ARCA 1TQDA 1ISJA 1M2EA 2YXBA 4BEBA 4ZMRA 1NUQA 2VA8A 2XOKD 4A36A 1UJ4A 4BWVA 4DV4B 2AMLA 1L5OA 4XTRA 3VH2A 5A5GA 2AXQA 5DNAA 2PTHA 3WGVA 3JARB 1YZUA 3VPSA 3K35A 4C6TA 4FFVA 1Z34A 2ZYWX 2AXPA 3UKOA 3CF2A 1DJNA 2D06A 2FSUA 1EM8B 2QLMA 3O21A 4R8VA 3FOEC 1MFPA 2WTXA 1OXVA 3PEWA 1G38A 1HTTA 4XD7D 5BYKA 2HTFA 1S2MA 4CKWB 2AOTB 1DIOB 4HYTA 4ZRMA 3DBOB 1XNJA 3NIFB 4MQ5A 2OV1A 5F21A 1Z12A 3DZBA 1BA3A 3T3NA 5D3KA 4ZZ1A 2IZ7A 3PPWA 2GAJA 3M0EA 1MTOA 4OI2A 2ZVDA 3AH8A 2DLDA 3JWPA 4KFSA 4MLPA 5A71A 1I33A 1PW7A 1YQXA 2Y1FA 2AI3A 4RXTA 3EK2A 3O2JA 2W6CX 3OZXA 4G1MB 3F67A 4E7PA 4EVRA 4G0OA 4XQCA 3QPCA 1YS6A 1RWBA 1CRWG 1N5MA 1CWUA 3I5XA 4F46A 4EL5A 3R23A 4H08A 4YMTA 4AP9A 1MX1A 3WGTA 4EF6A 2QUHA 3BTSA 2QEQA 2ZI5A 5DSXA 1USWA 1G7TA 3PQ4A 3H97A 4RO0A 2HXGA 2VQSA 2SKCA 3OIGA 4TS9A 2I62A 5DIZA 4YI5A 5E1MA 1TO1E 3E1SA 1WUIS 3RB8A 3TSYA 3TZQA 2WSSD 5JPCA 1P0QA 1YZTA 4UPEA 5DSTA 4Z7JA 2W2TA 3K2QA 4C1NA 1DXOA 2P7IA 4DUPA 2XCIA 1AS2A 5K20A 3QU9A 2V8BA 3RFTA 4PLTA 3LNTA 1GVHA 4COKA 3W5SA 1PGQA 4FKZA 4CL8A 4WNIA 3E35A 3I5UA 3MXOA 3NO4A 4GSKA 3VV2A 4E5SA 5IC4A 1ZD4A 4LFBB 4B0OA 1TYBE 4KO2S 1XKTA 2FRXA 4UEKA 2RCYA 2ZXFA 2DPLA 2UAGA 1IWOA 4NE2A 1PJSA 1GDHA 3UAXA 3U9TA 4BFWA 3N9IA 2DGDA 3RYHB 1FQKA 1A2OA 1QYDA 4KNYA 3VPAA 3ZQKA 4ZRNA 4QEDA 5IK2A 2X2OA 4KE9A 2AIRA 1P3JA 1W6RA 1BFDA 1PL6A 3D0OA 3C39A 2X9LA 1H6CA 3R75A 3ROEA 3LCMA 1RJWA 1O5TA 1YDFA 5PGMA 3STYA 4D8UA 2ZJ1A 5JXGA 2H29A 2JFPA 3DE4X 4BVEA 1EGAA 1KS9A 1PS9A 3GRPA 1GGEA 2ES4A 3FHJA 3GZ4A 3QWIA 4UTOA 2ZT8A 3FSGA 4EPXA 3ZKAA 4EF5A 5C8YF 1VQ1A 3RK0A 2MSCB 4IVQA 2EKLA 5FPKA 3GRRA 3TLGB 2Q3MA 3QLUC 1CR4A 4RM2A 5KC9A 2ODWA 1YFJA 2PUAA 4W5WA 3CLSD 1XTRA 4EQ6A 1X1QA 4HF7A 1A9XB 1BDHA 1U6JA 1WZCA 5LQRA 1XVAA 3DLHA 1H23A 5GGXA 4CIBA 4Y6RA 5C5EA 2H2GA 4HXFB 1JFSA 1L8XA 4PLPA 3ZXXA 3TAUA 4GICA 3NBQA 4IDPA 3C6MA 4J07A 1CQZA 1ODLA 2XF8A 2ZB3A 4J0CA 3BWYA 2QPLA 1R66A 2BFFB 4KWCA 2BFBB 3IAM1 3PXAA 3MINB 3QNWA 3QPWA 5LFAA 1UMCB 3I3OA 2RI0A 2I6FA 3BE5A 1N2CE 2ON6A 1KZHA 1P6XA 2VVTA 4UNQA 5TXGA 3V48A 4P98A 2CHVA 4EHIA 2XR1A 5B6IA 4DWOA 2BI7A 5FI5A 1AHHA 1ESZA 3I5AA 4OO3A 5EZYA 2J87A 2B8TA 4LXTA 1YJQA 4AWAA 1W5BA 4WJKB 3ABZA 1ZP6A 2HEIA 3RWBA 5AVTA 4MYHA 1IM8A 1H8HA 4W9MC 4HFRA 16PKA 1FU4A 3KAJA 4EWLA 5I7FA 1A5BB 2B21A 1UK6A 4BEWA 8OHMA 2B4TO 4EHAA 2HHJA 2VCEA 1TT5A 2CLHB 4FILA 5GP1A 4MUNA 3WB0A 4QBTA 1AKRA 3E22A 2UXBB 4K9MA 1FEZA 4J0QA 3N86A 1GUBA 3PR3A 2XD9A 3MWEB 1V11A 5EZ6B 2APJA 1NF2A 4NCAA 2JEZA 1APBA 1RRVA 2GRAA 1BXZA 1N4AA 5IXJA 1WO8A 3WIBA 4CIDA 4IDOA 3F3KA 1WU7A 3AHJA 2A5GA 3DAOA 3GG9A 4MWOA 5LP6A 2YQZA 4M4SA 4MMXB 3PTAA 1FOEB 1K3UB 4YYEA 4A1FA 4B1FA 1U4OA 3UCXA 2OXIA 2GZ1A 3DJFA 4D79A 1G5HA 3NOXA 1OSNA 4JHLA 1VHWA 1MAWA 2FFHA 4HNAB 4MQMA 3V42A 5EIXA 1R6BX 1A8UA 5IUNC 3GGDA 2OESA 4ZDWA 4TZ0A 2EEPA 3L8YA 3E9CA 2P6NA 5EUMA 4DIDA 4XEUA 4LHZA 6ABPA 1O0CA 5HKLA 1BMFA 3R7FA 3RUFA 4AROA 4IJ5A 1A8HA 4RVHA 3FNQA 2P6RA 1Q7RA 2XTMA 3ZHXA 1WW3A 2PUVA 3IAXA 4OHCA 3SXPA 4MVJF 1QYRA 1QE3A 2G6BA 3IR7A 3Q6NA 2ROQA 4XW2A 3L84A 1NMEA 3JVIA 4FR0A 2Y1OA 5EVJA 5BNFA 1IU9A 1P9LA 2VJPA 3G23A 4AN1A 1HM5A 1WW8A 3EYAA 1VL6A 1V48A 1VG0B 4ZJPA 5BR7A 2V0CA 4JOSA 2H51A 4M9UA 4TZKA 5KX5A 1KF0A 1NAIA 1ZJ5A 3BXGA 3EXHC 4BTLA 4Q01A 3LIPA 1JKMA 1JJVA 3EGCA 4CKCB 3HDQA 2CL6X 2P68A 1RRPA 1K89A 3FR7A 4L0DA 3RUCA 5GQSA 1XMJA 1HETA 5CT9A 5BR8B 4URUR 1SCQA 4V1CA 1SUSA 3I39X 3QKTA 5CT8A 4ZCIA 2Y92A 4JSRA 5E0KB 3VYTB 5KYXB 4G2NA 3WJ2A 1MFZA 3ZLTA 2PCLA 4HPJB 2CEAA 4HY3A 3DKIA 2ZSHA 1UMKA 4MZDA 1TJYA 3O91A 1EHYA 4KN6A 4P3PA 4MS1A 4W5TA 5IF3A 3NNNA 4HH1A 3GFBA 1WCWA 1Y9AA 4NAUA 3GUUA 1AUPA 4JLKA 2I33A 1II0A 3AESA 3C6ZA 4DIFA 3ZD6A 3W5VA 2C8JA 3QVXA 2XBMA 3PDWA 4DYDA 5KEIA 1FMCA 1L5QA 3L6EA 3TH5A 2XMPA 1O7JA 1AKEA 2JL1A 3N74A 1T8YA 2UZ3A 2J9YB 1EZ4A 3FWPA 3OD5A 1PT6A 3AR6A 2WB4A 4Q4HB 2D1SA 3K96A 3Q3IA 2A2ZA 1WPGA 1JU4A 2HRCA 1VECA 2ID4A 2RGWA 1KSJA 1BVRA 2JFNA 3FCEA 1Z2DA 3L8HA 1D2GA 4FEEA 4MQ6A 3WLAA 2EG5A 4YY3B 1Q44A 5JSYA 3HJFA 1OZFA 1QG0A 1CR0A 5K09A 1NLFA 2RB4A 1Y6FA 4OH7A 4EUSA 1IOWA 2D2IA 4L7QA 4ND7A 4Y7DA 3WKDA 4KN9S 2HT1A 1G41A 1IM5A 4QDZA 5AP9A 2ZCUA 3ZHZA 3N07A 1P2UA 3F5SA 4RA6A 1VJ5A 4QBFA 2GFIA 2CNDA 5CCXA 3G8YA 2XTZA 2J3EA 2PL3A 5A3SA 2C77A 1M6VA 1JG4A 1DJLA 5T8KC 3IEPA 2CLMB 4RD3A 3SHFA 4LWQA 3RH0A 3LVFO 3EPPA 4CI0B 4AZSA 4DCGA 3BFXA 1TU4A 4HB2A 1KSHA 1MO4A 3SJ7A 1RPTA 3BF8A 1NLMA 1Z62A 4NS1A 5KNBA 2LCQA 1GLNA 1TCCA 4KRXA 4R41A 4TL9A 1JB9A 5CYPA 5HTOA 4P3OA 2CDRA 4HAXA 2ANCA 5BT9A 1NWCA 3OO0A 2X5KO 5DCWA 1XYVA 4WBNF 2VJQA 2YWHA 1GGNA 2G4LA 3CM0A 1I4LD 3QELA 4FUTA 3DZJA 4GI3A 4I55F 4IFIA 4LHVA 1C9KA 4NL4H 2FZKA 4P84A 4QHTA 4UNPA 4BO4A 5K9ZA 1E3MA 3JX9A 2QVLA 4R9RA 2GF0A 4XXHA 3HTXA 3H1BA 3H9GA 4U7DA 3ENWA 1UZMA 2WJ4A 3R3SA 1OLXA 1VIAA 2AMVA 1YC5A 1GAQA 1RQRA 2B1IA 1O8BA 1P4SA 2ILTA 2OBFA 1RE1A 2WUWE 1TW3A 3AY7A 3N0XA 3PUZA 5TMPA 3CEMA 1XMSA 1DX9A 1YL5A 1XZEA 1Q17A 2IDKA 2IYWA 2RK4A 3CW9A 3D5EA 3EASA 3OPMA 1T6ZA 4TLMB 1MA3A 3RS9A 3QNMA 3O3NB 1RAFA 4Q9LA 5IK2D 4AMVA 4IQ0A 4PHFA 3UOAB 1GPWB 2GB4A 1S8AA 3EHDA 1AH2A 4OH1A 2FU5C 4B7CA 4J1SA 3IHTA 2ZLBA 2XSZA 3CKMA 5L3SA 1NZDA 4J4BA 4XLLA 3PPVA 3FSGD 1NU6A 1QYXA 2VWQA 3R7AA 2VK4A 1U8FO 4FNGA 3QE0A 5FAXA 1FP6A 1E5XA 3FNEA 1KU0A 4MUBA 2DUMA 3KOZA 3ONEA 1GTSA 3LDHA 5JJLA 5J9FA 4N5MA 1ZY2A 4U7TB 1NVBA 3BQ9A 4FS8A 2J4CA 3HFRA 5CK4A 3FNBA 3U4HA 1TGYA 3AR3A 2V6IA 4ZAVA 1QOZA 4Z0HO 4Y2JA 2EG9A 1AHIA 3NC0C 5BUSA 3TEFA 3O9MA 2VO1A 1C7ZA 3T3GA 2IK8A 4P1ZA 2OCPA 3U5TA 4P82A 3GFGA 2QTAA 4BMCA 3AW9A 4L8WB 3TNDA 4RH3A 3NTXA 4HX9A 4RQBA 4X6YA 5JDCC 4BQOA 1WJGA 4LFCB 1V95A 3B5EA 3HSKA 1T9GS 1PG0A 2OFXA 3HPRA 3I1JA 3I28A 5F12A 1JEYB 1NKVA 4WWHA 1LXCA 4N3GA 1C41A 1UMDA 3B8EA 1NYQA 2ZQZA 3TZKA 2ZRPA 5DCLA 3LPLA 3PWKA 4MKGA 1QP7A 4B3BA 2E5LB 2J0QA 1U2EA 3CX4A 2NZWA 4ENWA 1UEJA 2YVAA 2A0YA 5IN5A 2Z2ZA 2P2DA 3B13B 1H8HD 4ZU3A 1DCMA 5LKAA 2NT3A 4LVNA 5AT1A 4JI0B 5DJ5A 2HPVA 4MO9A 5AI9A 9LDBA 1CP3A 1OZGA 1Q19A 3B89A 3DTVB 3WC4A 3ENNA 1LLDA 3BGWA 3ZWMA 4ETIA 2VN8A 4MB6A 5IVIA 4NEHB 5J4KA 1CEQA 4AAYA 5J2UB 5AKGA 2ZDGA 5F4BA 1Q77A 1HEIA 1SOWA 1UANA 2L82A 3A4NA 3OVMA 4MVWA 1UM8A 4Q00A 5H3LA 5DTEA 4WJLA 5A3JA 3AB8A 1QZ3A 2H5LA 2M2IA 1QPBA 3G8CA 3WGKA 5DM0A 3WX0A 2XBLA 3GFPA 3MD9A 3PR2B 1CQXA 1EP1B 2DECA 1TIBA 3MB8A 4FMBB 1EK5A 2H1IA 4PCLA 1OH7A 1N5KA 2VL7A 2D8AA 4LYJA 4Q19A 4UEQA 1T36B 4Y2UA 5JZSA 2Y0DA 1JG2A 2XZPA 3Q98A 4UZSA 4Y6LA 1NN1A 5EIBD 2VP2A 3KLOA 3EIOA 4LC0A 2FJPA 3T9CA 3KRTA 1YZFA 5ARCA 3VV3A 1FDTA 2GYYA 3IESA 3WLOA 2JPDA 2NO0A 1EZZA 1EE2A 3ABRB 1P3Y1 1C4KA 4IWNA 4CGYA 2JJ2A 4L3OA 3SQOA 3SS9X 4CMAA 3L93A 2Y76A 4H7JA 4EI9A 3ILSA 2JAXA 3GI1A 2EX4A 2WUVA 3E82A 3ZK8A 2AL7A 1EFPA 1A88A 4DMGA 1NLYA 2XMBA 2FDXA 1ZOOA 4JL6A 1YAHA 1BMFD 5G41A 3RLIA 3ZKWA 4OLJA 4AB1A 1BCRA 5BOSB 1CPYA 2ZUUA 1Y0BA 3GBPA 2B8JA 4HMPA 2HA2A 3GVIA 4AUNA 5E4JA 5FFFA 3U4MA 1GKLA 3NTOA 1ZH0A 4QUDA 4F86A 3DNPA 3GHHA 3C6QA 3O5AA 3GP5A 1ZICA 1NL3A 4EY5A 3L8ZA 2EIHA 3RSLA 4DDMA 2REQA 4K5QA 1QQ7A 4KB5A 3RK4A 1V2GA 1PHRA 3UJDA 4QECA 4GBMA 3V1LA 4N3CA 3DC2A 3FPCA 1G5PA 3U7QA 2QN3A 1ZNYA 1S01A 4NMLA 3ENZA 1YBVA 3FCYA 3HR4A 4ZT3A 3ZUPA 4F85A 3FMOB 2ERYA 2ATVA 3LKDA 4Y6OA 3SYRA 1IATA 2D8MA 3GD7A 4LSWA 1EGHA 3BX1A 4EYEA 1AF7A 3BH0A 4ALKA 4PG8A 2GHQA 1WY7A 4FC6A 2ZJ0A 3LQQA 4KSCA 1ANKA 3H9CA 3JQBA 5FQOA 3S2YA 2QRNA 1DAGA 5A4IS 1FNMA 3GPBA 3GJ6A 4P7KA 4CF6A 2A92A 3GFVA 1SBNE 4BB5A 1UKBA 3CKYA 3LK6A 4MV7A 1C9NA 3ZY5A 3K15A 3LBYA 1CUSA 1SUWA 2RGYA 5CHEA 5AVVA 1PNOA 5KWVA 4AJ2A 4DLKA 4PZCA 2NU7A 4A8JB 1CF2O 1IL0A 2XMZA 3HCRA 4YMWA 3TDNA 4YR9A 5BQ3A 2QX4A 2NV6A 3R1IA 2Q5IA 3OPXA 3UHPA 1J2UA 3UNXA 1M34B 3OMLA 2C0QA 2AG1A 3H84A 2DSTA 2SKDA 5ED0A 3PS9A 3W5JA 1EA7A 1OX5A 1U8XX 2HPHA 2WUGA 3SMVA 1PW5A 1QR2A 3RS7A 4PC2A 3IPRA 4EJ6A 1DKOA 2OO7A 3V8RA 3RV4A 4P3XA 1S8OA 1SA0A 1I4WA 1KDRA 2OWEA 4PTZA 5KDLA 3AHHA 5JNSA 5A0FA 4NBTA 4KR6A 3EVZA 3LUAA 3W90A 4CLHA 1OXBB 4KV9A 2X3FA 4UXIA 3KTAA 1T9DA 3MF4A 1NRJB 4BNZA 3AEKA 5HF6A 3PYXA 3TCNA 2F9MA 4WADA 3QE9Y 2Z56A 2OCGA 3ZK7A 5KCZA 4Q3LA 4AUKA 2CKMA 2JFHA 4DLYA 2IOFK 3AFHA 2DWOA 3HV0A 1XKXA 4C14A 4F8EA 3A9RA 1DEXA 2PBRA 1VA5A 4AG6A 4GYYA 2OBNA 4MUFA 1WXHA 2IPOA 4BU1A 2PGIA 1Z4LA 4CR6A 5HSGA 1H6DA 3E05A 3UJ6A 2PMWB 1I7SB 3WJ7A 3VZDA 2ECKA 1CUHA 2FZWA 4U4AA 1QB7A 3PUXA 2YWRA 5KSPA 4OFXA 4B6GA 2OHOA 5E2BA 4COOA 1HDRA 3CKLA 3OM9A 3JD1A 2QZZA 5KNBD 3IUNA 1TAHA 4UW9A 2YY6A 3OCJA 4B8YA 1TJPB 5GV8A 2ZR0A 1EESA 3GLHA 4OB6A 4FLEA 4LK3A 4WH0A 5K0EA 1NTOA 4FK8A 4QLAA 2QZ4A 3JRNA 1DI0A 3ZU4A 3RC1A 5HTKA 4H6WA 3VU3A 4HGQA 1LPOA 2FF5A 2WUFA 4OGWA 4TX1A 2UVPB 1HMYA 3D8HA 4TRMA 1OH5A 3A6KA 3THWA 1X86B 2B82A 2OLJA 4NV1A 1ISMA 3RBZA 2XUGA 3DH0A 3ENQA 1O0SA 2J6HA 2VI5A 1JDTA 4ITVA 4JVLA 4ZO6A 4OLAA 3Q0IA 4QDUA 3SBXA 5C4IA 5FT9A 1Y3BE 2WSIA 1T34A 3HP4A 1PJTA 3I9V6 4Z4QA 1NVVQ 4KIJA 5H7XA 1ZR4A 4XM2A 2H4WA 3KQNA 5ELXA 3QW4B 4O8CA 3LL7A 5LC1A 4BAUA 4F6LA 2GETA 3RVPA 1F2TA 1AKVA 1VLVA 2CXPA 2XH8A 3O9ZA 1AKNA 3JQ7A 3KPVA 4KZPA 2ID8A 1ZM2A 3DEYX 2AN3A 2O2IA 3LW8A 4DFDA 2XSZD 5BQOA 5LM3A 1MJGA 3R9IA 1RHKA 3KOOA 3AERA 4CM4B 2GWHA 1YMQA 3RIEA 4OQMA 1XJCA 3LUBA 4J0EA 3RFFA 5FA6A 3WK5A 4RSGA 4YECA 2BMFA 4O2BF 3WGZA 5CCBA 2AFHA 3PKIA 5EJ2A 4N9WA 1FC0A 3OA2A 2B37A 3PQFA 4JQSA 4EENA 3CJQA 4WECA 3T5AA 1JDPA 3ISJA 1L1QA 2OOSA 5G0WA 3NFRA 1NYLA 1P2BA 2AS0A 3C5EA 3S28A 3IV9A 2I76A 5E7MA 3BTVA 1C30B 3MJRA 3RRXA 4RF3A 1ELOA 1I5EA 1I7LA 2C4WA 2I99A 3ZNOA 1I7QB 1DC8A 2I6QA 2CN1A 4PONA 4NJMA 1FDSA 3PHBE 3JQEA 3NRJA 3O0TA 5F9MA 1FRNA 2VZLA 3NWPA 4CCYB 5ITZA 2A9QA 1SEPA 1GEGA 2FKNA 3OTIA 2XB2A 1IN5A 2Q6IA 2C4MA 1J0EA 2FFBA 5L6MB 1UOOA 1E1KA 3FVTA 5EG5A 1U3GA 4OXYA 5BYJA 4TRJA 3K9HA 5TGTA 3ZE7A 1SG9A 4FDAA 1GL9B</