1Z7YA

Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVADRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Molecular Basis of Cysteine Biosynthesis in Plants: STRUCTURAL AND FUNCTIONAL ANALYSIS OF O-ACETYLSERINE SULFHYDRYLASE FROM ARABIDOPSIS THALIANA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 108
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7yA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7yA02
3R0XA 3VSCA 3PR2B 1J0AA 4ZU6X 5B36A 1TDJA 1J0CA 5DVZA 2ECQA 4L3VA 2Q3CA 2ZSJA 3IQIX 4JBNA 4F4FA 1VE5A 4AIRA 2EGUA 3IAUA 1D6SA 4D9EA 2TSYB 3VSDA 3L6BA 4WX2B 1C29B 2D1FA 2GN1A 1UBSB 5J43A 5B1IA 1K8XB 5HBGA 4I1YA 3X43A 1J0EA 1J0DA 1UINA 2DH5A 3TBHA 5JISA 1WBJB 2CLIB 5KINB 4L0DA 1A5BB 2CLKB 2ISQA 1Z7YA 1TYZA 3FCAA 1JBQA 3DKIA 2WSYB 5EY5B 1BEUB 5JJCA 4HPJB 1WKVA 3FGPA 5B1HA 4D9NA 2CLOB 4D8UA 2PQMA 2ZPUA 4LI3X 1VE1A 5CVCA 2GN0A 1A5SB 5IWCA 1QOPB 2O2EA 1QOQB 4L28A 1C8VB 2V03A 4D8WA 5I6DA 2DH6A 5BW6B 1A5AB 5B55A 2C2GA 4D99A 1O58A 5CGQB 3DWIA 1KFCB 2ECOA 4D9FA 2TRSB 2JC3A 4LMAA 1KFEB 5D84A 2J9ZB 3AEXA 4QYSA 5I7RA 5I7AA 1TZJA 5IW8A 1WTCA 3AEYA 2Q3DA 5I7OA 3PC2A 5DBHX 4D96A 3IQHX 3IQGX 1KFJB 2GN2A 4H27A 5I7HA 3V7NA 1V71A 1UIMA 1KL7A 1CX9B 3PC3A 3SPXA 2J9XB 4D9KA 4HPXB 5DBEX 2ZR8A 1K8YB 4ZQCB 4D9IA 1J0BA 4D8TA 1M54A 4D9BA 1VB3A 4HT3B 2BHTA 1FCJA 3SS9X 1V8ZA 4HO1X 1PWHA 3DWGA 4L27A 1K3UB 4XUGB 1K8ZB 1PWEA 5C3UA 1KFBB 3VC3A 4D92A 2Q3BA 1V7CA 2CLFB 3L6RA 4IL5A 2RKBA 4KKXB 4JBLA 1P5JA 1WDWB 1E5XA 2C2BA 1Y7LA 1BKSB 2J9YB 4LMBA 3BM5A 5B53A 1K7EB 3VSAA 1K7XB 2EFYA 1RQXA 5E0KB 4NU8X 3SS7X 1K7FB 4HN4B 4D9CA 5DW0A 4ZU1X 1F2DA 4Y6GB 5D85A 1X1QA 3VBEA 3T4PA 3X44A 4COOA 4D9GA 5I7WA 5IXJA 1C9DB 1KFKB 1CW2B 1TZKA 4NEGA 1TTPB 1FUYB 1Z7WA 5B3AA 2CLEB 2RH9B 5T6MA 4OFXA 4PCUA 4D9MA 5J5VA 3CEPB 2CLLB 2O2JA 1TJPB 1TZMA 3RR2A 4AECA 2CLHB 2CLMB 5D86A 5KZMB 1TTQB 5DW3A 3R0ZA 1TZ2A 2TYSB 3L6CA 5D87A 1OASA 3HMKA 4D97A 2BHSA 1A50B 2RHGB 3PC4A 3ZEIA 4OREX
chains in the Genus database with same CATH superfamily
3MWDB 1E63A 4UZEA 2JCVA 3UM9A 5LZ9A 3ZVMA 1ZIPA 1AM4D 1E6EA 3L9XA 4KYIB 5BVGB 3ZVKA 4P7KA 2QUJA 2OD9A 2I6XA 3EXFB 3MINA 2B35A 3HJGA 4ARCA 4ZVMA 1Z4MA 1CS0B 1OU0A 3B1YA 3HKBA 3AHHA 3K1AA 3PQ2A 4IH1A 5GZ1A 1X15A 3TXAA 2ZRAA 2AD1A 4DEYA 1WZNA 2Y1FA 2COUA 2NZ8A 4XPIB 3OQMA 1GDHA 4FQ7A 4Q12A 3T5PA 2D4AA 3WNZA 1TAGA 3AM4A 3IPXA 4JLSA 4TN5A 1A1VA 4EGSA 1H2FA 1FTGA 5LC1A 3Q6IA 3K9WA 4MS1A 2B30A 3V42A 4Q4HB 3K5PA 2JAUA 1L1EA 3I2HA 3GJQA 4GE3A 1A9YA 4YMGA 1KVSA 2WWFA 3OKFA 1AQYA 1G60A 2G8NA 5ERXA 1I9CA 5F64A 2FYTA 3BHJA 4DA9A 1AHPA 4JSYA 3OF2A 1CUIA 2ZRNA 5CVCA 3U61B 4EPRA 2R6R1 2YZ7A 4F8YA 1CEEA 3G8CA 4PX5A 1UQUA 4RD3A 1P77A 1WAMA 2C2OA 1J90A 4Q3BA 4DUYB 5IDYA 2VP2A 4QX6A 3PICA 1YFKA 2OMEA 4ZQBA 1FU4A 1I1QB 2W6CX 4O4HB 2XWPA 3WK5A 3SYLA 4I4TF 4WN9B 4UOZA 1XVUA 1L7NA 4MV1A 2QTMA 1B8UA 2J9ZB 3BN3A 2ORED 1DXHA 1KGDA 1YE8A 2YJ4A 2XHEA 5F51A 2C03A 3IQHX 2OXEA 4F56A 4ZVVA 3JWHA 4Z7QB 2XQGA 4GX0A 3X1MA 4Q7QA 1FOEB 1NRXA 1TM5E 2NYAA 3JQRA 1NZDA 1W9HA 1FXSA 3GLUA 3R3XA 1QWOA 1OXXK 4E70A 2OO3A 1OKKA 5INTA 4DDUA 4IJQA 4B2YA 1UK6A 1QMGA 4G0NA 1RAAA 5CDFE 1W4AA 3P52A 1B2LA 3ZC3A 3HCAA 1C2YA 1CCWA 5BNTA 2G8LA 1Q6YA 4RGQA 5JNRA 1B41A 3OE5A 1PFGA 4F7DA 2IHNA 4MUEA 2R8YA 3CH5A 1X7YB 4TMWA 3ESDA 2AZTA 1E4VA 2ST1A 5JSQA 4FE7A 1CQWA 2VT6A 3DAFA 3JQGB 3OC0A 4GHWA 1RZRA 4MS4B 4LGVA 5FAXA 4OBXA 1PUJA 5TLSA 1NUPA 2VH5R 4BLWA 2IS2A 4NYMR 3P97A 4US0R 3MJFA 3ILXA 4AZVA 3OZ7A 1VDMA 1RFLA 2OGZA 1RWQA 5CNIA 1CFZA 3IHTA 2HN9A 3NBZC 5FWAA 3FCUB 1JR3E 4LZZA 4BFUA 1YRBA 1VYTA 4XWOA 1YHNA 3GP3A 3BJMA 3HN6A 1F0YA 1PR4A 4YRNA 1OFGA 4YA6A 3NPAA 5BSFA 4R1SA 4RWEA 3T1VA 3SVLA 4RLHA 2FG5A 5B4UA 3ETNA 1Q0LA 2PCJA 2AMVA 1YU9A 1WHSB 1QF7A 2ZS9A 3B3FA 3G3EA 1VHDA 4KO2S 5IT5A 3RS8A 4OJKA 1ZOLA 4RQTA 3X1ZA 3GBPA 3KOWA 4HRYA 2Z04A 4LQDA 3ES9A 2IGTA 1AUXA 5K3CA 1KMQA 2HA2A 1YQ9A 1TC2A 2H7CA 2O5RA 2P6MA 1G5FA 2QRUA 4FGLA 4P2GA 4EI8A 1IQUA 3H5LA 3PD0A 1FFCA 1Z4JA 4UDOA 1F20A 1FLAA 3L1IA 2EKLA 2UZ1B 3P9QA 4XX0A 4EFKA 2AVNA 3IHLA 3E6AA 4KFTA 1NXTA 2AFVA 2BJWA 1OB2A 3BMQB 4RIIA 1JIVA 2VXYA 3SKVA 3L8MA 3VR4D 2BMJA 4QBKA 4G4IA 5KBYA 3TZKA 4DNFA 2ZTLA 4B9AA 1NF9A 2X1VA 3AG6A 4K9QA 4NDNE 5TMEA 2Q7DA 2VZ8A 2IUTA 1LA2A 2Q2VA 1R0ZA 5DDIP 1AD2A 2D1RA 5ALJA 5E8JA 1ODIA 3RE1A 3T5CA 3UWDA 1NLUA 3KNZA 2WTMA 3PWKA 3ZWWA 3K9FC 1U28A 4OYLA 2BEJA 4C01A 2R3SA 2J9RA 2PHZA 2FW7A 2ZAYA 2A4KA 5F2KA 4YVFA 4ZK2A 3GLGE 2A0WA 1N2EA 3LYUA 1L7XA 3IUSA 5C4IA 5FBKA 5KOIA 4URYR 5GIPE 1XTJA 5ALUA 5FIUA 1W73A 3WIUA 2PVSA 4QGSA 4KOEC 2VDNB 4CETA 4Y6OA 1MRNA 2JJ2A 3EGDA 4H7HA 1X3LA 2VDWA 3EUWA 3T5BA 5ALMA 4DQDA 1KMHB 4QECA 4HUJA 4MCHA 1IL0A 4L5CA 4BASA 2ZVJA 4EITA 4ENVA 2ZM6B 3ZYZA 3VX3A 1T1GA 2FVXA 1ES9A 3LPAA 1A8UA 3OZRA 1SCDA 1DHTA 1GNVA 2D4HA 3FR8A 4BB0A 4UAGA 1RXVA 4KKVA 2XGGA 4L0CA 2QQGA 1YDWA 1N9GA 4F4HA 4CEJA 4UASA 521PA 3JASA 2PVPA 2WPNA 1D4FA 2Q9CA 1ZVVA 2B92A 3K7EA 4WY8A 5LOVA 4FW9A 3RC3A 1AH2A 1Y6ZA 3NHMA 4LXTA 4ARZB 4NCBA 1D09A 4QU9A 1PNTA 1RXUA 2ZTUA 1I32A 4K9RA 1DX6A 3Q5EA 4MVJD 3RS0A 2FH5B 4MGEA 5AK0A 3FVQA 3WL7A 3I2GA 1J09A 2DHCA 5JCJD 2XCSB 2Z2YA 1X94A 3EW9A 5EMMA 4Q7MB 2YWFA 2WTUA 5T41A 4WZ6A 2FEAA 3AMVA 3PGVA 1N8SA 4U2EA 1XP8A 3AVWA 3AJ8A 3PUXA 4GPEA 3F71A 1P0IA 4D9CA 4GYJA 1LPMA 1C4KA 3BWDD 4NTZA 1NI4B 2R0QC 4DWWA 3MM4A 4IMJB 2XNDD 3WGHA 2X8AA 2ZQYA 2HDNB 3CNBA 2ZFUA 1JW9B 3GCXA 3I53A 4ZANA 5AW5A 4GOXA 3K9LA 1N2JA 5ESXA 4B2PA 1HLGA 1X0VA 2GZAA 2X15A 3B6KA 4LGMA 5IEBA 3K1JA 1RMTA 4J9UE 5BT9A 1F51E 1SVOA 2Z30A 4W1PA 3CM0A 4E2FA 3RTGA 4IEIA 1KOLA 2CLMB 2GPYA 5BN3B 3QTLA 4ODIA 1TTQB 5JO9A 3HB1A 3HV0A 3IQWA 3JD3A 4K40A 5FORA 5YASA 3VR5D 4BGIA 4CN9A 4TMZA 2X2OA 3T7KA 5BW4A 1U63A 1JJAA 1A96A 1NT4A 1E79A 3GT0A 4E88A 1DTSA 2G04A 3IIEA 5K0BA 4HNQA 4O0MA 2XR1A 5DO9A 1UBMS 4W5OA 2XCTB 1QMPA 3ZZMA 1OA0A 3HJTA 5IAOA 1QV7A 3V00A 4P36A 2I2CA 5SYAA 3KQLA 2DJIA 1LLCA 5DYIA 3U62A 4B80A 4NCAA 3W5JA 1K6IA 4LG1A 1P2FA 2XF8A 1PT5A 3ZWMA 4MRRA 4RY9A 2R6DA 3DAYA 3DUWA 3L6BA 2VSOA 4M9SA 5K3BA 2B94A 2FEKA 4HNRA 2PQ2A 4O4LA 3I9LA 4I2NA 1CZOA 2GZMA 4HEJA 4PC2A 2RCYA 2HCJB 2LVBA 3W77A 1LBSA 2ZRMA 1ZK0A 4CM9D 1CY0A 3NOVA 1DAPA 1JSRA 3SN6A 3LHDA 1NZJA 4QJ4A 1S4MA 2JFPA 3OPQA 1TCCA 2Z09A 1F1JA 4MMYB 1JEYB 3T3MB 3JQAA 5FKJA 2C9YA 2ZBDA 3FRHA 4DVJA 5CYGA 3QU4A 2Y1OA 1B42A 1E1QA 1FYDA 1HMYA 1LSSA 1ZJ4A 2B7LA 2Y4OA 1VJRA 3LQ2A 5AI6A 3IRVA 3T7DA 3TINA 3HRKA 4QJ3A 1GA1A 1NP7A 3RYCA 4UATA 1LVGA 1YRYE 2RGWA 2YNMC 3DFZA 3EA5A 2F9MA 2SKDA 1XBTA 4TXHA 1SUIA 4C7XA 5IJZA 1RLTA 2WKSA 1RYZA 3EZLA 3F6SA 2YJTD 1NUAA 3THOA 4D3YA 3BG5A 1HMPA 4ABTA 1EMDA 3U3ZA 3C3XA 3I3OA 3OCXA 3OKPA 4UNPA 4LZPA 2VJAA 1GLGA 2EZ8A 3NI2A 1DEKA 1CDDA 2IA5A 3D8HA 4YJDA 4Z4QA 3VU9A 4OLHA 4MRMA 3LA8A 4OHFA 3CVYA 2HLDA 4GR4A 1N2IA 4NQRA 1KEKA 4BNFA 2IU4A 3UJHA 3F0TA 1KYTA 5IMBA 2VPWA 3FYSA 3HKEA 3MVEA 4J94A 4V24A 5GM1A 4UTNA 1C50A 5EIHA 1HDZA 4KN8A 4ZOAA 2JGMA 4FNMA 1M83A 1O6CA 3EXEB 2WJHA 1H9AA 5BWCA 5C8ZA 4PC3A 3S1SA 1VCMA 4OEHA 5HQ3A 1J56A 3V8MA 4L15A 5DI3A 2AWNA 3E2PA 4YIKA 6PFKA 4PLGA 1R0CA 1VJ1A 4WQMA 1C7ZA 3OQNA 2C78A 1NQAO 1A4RA 3T7RA 3OD5A 3NQ41 1D2AA 4FHGA 4J1TC 2ADMA 5E3HA 1C2TA 5E9AA 3WYNA 5JWRA 1L4UA 4LOIA 4D2IA 4N3NA 3VGJA 3QP9A 4UTZA 5I7WA 2P9TA 4HNAB 1DFGA 3FCEA 3OPYA 3AQIA 4ACBA 1KI1A 1NN1A 4FD2A 3I8XA 3QXHA 4MX8A 4N8EA 4WZBA 4N8SA 5A9RA 3A2KA 5IJ9A 4I1VA 3BJIC 1MFPA 3FUXA 3S8EA 2R1VA 4F3KA 4JI2B 2OHOA 1YA8A 4IRMA 3IPLA 1CF9A 4HD8A 4RHXA 3F4BA 1E2NA 1Q50A 1KC1A 3WGNA 4LKRA 1QS0B 2P5SA 2PMCA 3PA8A 4QO7A 2F55A 2KI5A 2R6GA 2WYIA 4BTEA 2FSHA 2GAIA 2WUGA 4GLFA 4QOJA 2EL7A 3S81A 1DOZA 1JKXA 2ICAA 3ELUA 1KRXA 2VOJA 3BD8A 1V8FA 4J7AA 1JH8A 2RC5A 4LYAA 4U0JA 1ZICA 4DAEA 2ODPA 2BWJA 4EG6A 1NXWA 2OZPA 1VMDA 3OT4A 4MYDA 3CCBA 2ZKIA 4UBNA 2A5DA 3EF3A 4PZEA 3SLRA 5TE9A 3SQXA 1CDEA 3Q7RA 4DPLA 3CBQA 4N5DA 2DBZA 3RYIA 4TSKA 3K71B 1SQ5A 5EIAA 2BMEA 4G4SO 4ZOBA 1FC0A 5EYPA 1ULTA 1FNBA 1BJKA 1Q1NA 3D3NA 3EXHC 3ZWPA 5CFNA 3ITKA 1LQTA 5IJAA 2HIMA 3RWBA 3FXAA 3CKKA 1C80A 1VJGA 1SHZA 4HPJB 2CLOB 1C81A 3JPWA 3Q9SA 3VXKA 2I34A 4E32A 2NG1A 3D81A 3QI2A 3RREA 4EYGA 2I7CA 1QP7A 3LOUA 3ETCA 4ZXFA 1XLTC 4MB6A 4R9RA 3T06B 4L85A 1TJ5A 2R4UA 2RHCA 2JBWA 1GT91 3LNTA 1XDDA 1RAHA 1Z3CA 5HVNA 3L8GA 1O95D 1QYDA 5CBKA 1SPXA 1EU1A 1GPYA 4S3MA 1B8NA 3BGSA 5IVHA 4IXTA 3WLPA 2OQRA 1QKIA 3L0DA 1TYBE 3ZKAA 3JQ9C 3BFVA 4K3UA 4NV1A 4AJLA 5HR5A 3GJRA 4RZUA 5H16A 3IAXA 1HNWB 1UMCA 4LF4B 1KAQA 2VAXA 4JFAA 4NEHB 1DDIA 3AHEA 4Y9RA 4HPXB 1Y1RA 1K8YB 2EJUA 4DNQA 2Q29A 4CV1A 2ORVA 4E14A 3GI1A 3EIHA 4EJ2A 3VJLA 2QU7A 3ILYA 3K0AB 1RRVA 2J3MA 1M2VB 3U4AA 1G3RA 3IQFA 2WF6A 3FE2A 3GPIA 3T7EA 4A0QA 4P92A 4OKNA 1V7CA 2RCNA 3CRMA 4KE7A 4QDTA 2WT8A 2DHDA 1EFCA 4RMNA 3WY9A 3UXEA 1C0KA 3O92A 3RANA 1IG3A 5JJBA 2WJWA 3D3WA 4NZOA 1ENPA 1H42A 4XASA 3JX9A 1T5BA 2UXDB 2O8DB 4LJ5A 2HAEA 4CKZA 1S2LA 1KMNA 1DKPA 2VHWA 1V1JA 3OECA 4ZDWA 1I8TA 5K8JB 3BK7A 3GELA 3OUTA 1QDEA 3PE4A 4L5IA 4OJMX 1DJOA 4OV6B 5D85A 5GVRA 2EQBA 4ND8B 2XUOA 4JJZA 5AOAA 2JRLA 1GA4A 4AURA 4B4OA 3K0KA 3VR6A 1ODCA 4MUYA 5P21A 2XHZA 3LH5A 1DCTA 5L6LB 2D5IA 2QVBA 2IKSA 4MAAA 4DR4B 3OE7D 1NNUA 3P1JA 2XE8A 3QPCA 4LBYA 2O0MA 1FFYA 1UMBB 2XAAA 4EG1A 5C8YB 1Y1QA 5FFMA 1HE1C 1CD5A 3EBOA 2CLHB 5BSWA 1NHGA 1L5KA 3C48A 1KWKA 2XV1A 3NTQA 1BVHA 3V1TC 1U9JA 1JR2A 1UKVY 4X3OA 4YJGA 1JLMA 2ZS7A 4P7GA 3BHMA 5E3IA 1A2BA 4NYIR 4EHAA 4ZO7A 2EWMA 3F6YA 3AJDA 4O5OA 2ZXEA 3OM8A 4OREX 2C98A 3LXMA 1K97A 2IY7A 1IMOA 2ZB7A 2IP2A 4OK6A 4CF5A 2X1MA 2P3SA 3R3WA 3UJBA 1EE2A 2F7SA 3Q0TA 3WP0A 3KRTA 4PYLA 3ZVNA 4R1UA 3PDWA 4FYMA 2PS1A 3C87A 1R00A 2DBQA 4ZAVA 1TD1A 1J8VA 4Q9NA 4X64B 1GUBA 1XYVA 1WMFA 2N3ZA 2QMUA 1HQKA 3A2MA 1FRFS 1MAVA 4CUJA 1Z8DA 3OIWA 4ZI7A 2GBPA 3CF0A 1SUPA 2DGDA 1OI7A 4QLBA 4OHKA 5BRNA 2V3CC 4PYOA 1DO0A 3AY0A 3AKZA 4QFBA 3TTSA 4GKAA 5CH5A 4AP5A 1WUJS 1L4FA 3A9WA 1SOAA 3TYXA 2H0QA 5FA5A 4UBKA 4B2LA 1UZNA 5LD2B 3UJ9A 5IXSA 1NI3A 3B2EA 1A8SA 4PAQA 1YDMA 3EG9B 3ZCUA 2IBMA 3EK2A 1EUCA 4JB8A 4DUZB 2PKCA 2N75A 3MPOA 2FMTA 1Q83A 2YIMA 4URUR 4ZYLA 2H7VA 4PQEA 1XQ6A 3HVUA 1NVVQ 1U0BB 3RHTA 1XJCA 4D99A 2X0FA 4G1CA 2P30A 4JU8A 3Q41A 4UVHA 1NIPA 1YR3A 4NBRA 1T0HB 1QYWA 2DFPA 1GPLA 2Z5VA 3H86A 4YN3A 1HQCA 3NHSA 3DMNA 1YKFA 5LXTA 1ECJA 1ARZA 3UT5A 4YCJA 3PT5A 4ZA2A 4RIGA 2MJLA 4HAIA 3AEYA 3WWYA 1BRTA 1GCIA 3ZOKA 1QGDA 4CMIA 4FIDA 4HMOA 3NHAA 3QXGA 3TSOA 1PLJA 2WFAA 1TO2E 2O0KA 1QB7A 3GP5A 4QUGA 1HDRA 4YRAA 1SAYA 5B30A 1JDVA 1SA0B 4IRXA 1EUZA 3H0CA 5B2ZA 5B6IA 2FPGB 1FW6A 4C88A 1C7RA 1P2SA 1ZRHA 2HA7A 3GUVA 2DR2A 4B7CA 1BMFD 1OU4A 1P19A 2B8EA 3I6YA 3NOOA 1IEXA 4F3RA 3EXAA 4JEHA 3VVLA 4KXUA 4MIEA 4TTTS 1PWHA 3QVOA 1GGJA 4FMCF 4BMSA 2XCLA 3RYFA 5FH9A 1MEOA 4CZ2A 3RSLA 3R3VA 2HY7A 2YH2A 4CF6A 3M49A 5CT8A 5EQJB 1RM4A 4DQLA 4Z1MD 4ECAA 5JATA 4RVUA 1RBQA 1DQPA 2VZLA 3DLCA 1BJRE 3BM5A 1WR8A 4BB6A 2QAIA 2XMZA 3U40A 4E03A 3QFRA 2VP9A 3OLVA 3CZQA 3AKDA 4EA8A 4OQNA 1ADGA 4P08A 3EYWA 4M76B 3OUZA 1S1CA 4K46A 4WNCA 1GHTA 3AW8A 4PYRA 5DGIA 5EESA 2FZKA 4FE4A 3UUEA 3H2YA 2HJRA 3HCPA 3E05A 2CLEB 1H05A 1N6RA 5FB3A 4DSNA 1BH2A 3DBRA 4CNQA 5C37A 5K9ZA 3Q0EA 4UTRA 2HR1A 4P34A 5A0TA 2OKCA 5EZYA 5FPTA 4YFYA 4J8PA 3G88A 3RFVA 2VHTA 4YDQA 2H1LA 2BRUC 2OB1A 4LWOA 3K6RA 4K26A 1JZQA 4R9UC 5L3RA 4DMCA 3DKVA 5ED4A 4MWDA 5JNTA 5BMOA 5KC9A 1CJSA 1H22A 2WE8A 4RDCA 3JTEA 4PNZA 4IGEA 2FW6A 3G9TA 3HB0A 5F78A 2FUKA 4Y2PA 5H83A 3G2KA 1VOTA 1JYSA 2ZSKA 3RIHA 3EXIB 4A73A 1WW2A 1CF4A 2DSNA 1E6WA 1Q92A 2QUAA 3O1JC 1GEGA 1FB5A 1O6GA 3GNTA 2C9OA 4GOKA 4LZAA 4WPGA 4FYPA 1E59A 3D4LA 1YU6A 1VCHA 4B3TB 5JC1A 3FSGD 4ASUD 3DP7A 3PLAE 3WBJA 3HU3A 3WYCA 1J1ZA 3R9XB 3LF1A 3M1IA 1T1EA 1T0JB 2VA8A 3D6VA 5KWSA 4CIXA 2COEA 3N2YA 4EB6A 5EJAA 5AW8A 5CB6A 2JHGA 4CLHA 1PF7E 1DRUA 2GEVA 3BXZA 3C85A 3EWAA 1NBOA 1P1BA 3RIEA 4DW8A 4ARSA 3AI2A 3RCBA 4FYVA 3NGMA 4TKUB 1KZHA 1J70A 4DL9A 4Q3KA 1F60A 3MT9A 4RYDA 2Q1SA 2JH8A 4B3HA 3OEHD 4ROSA 4HSEA 1L5OA 1AF4A 2CBGA 2XTMA 1U8YA 3D8BA 1LW7A 1ULBA 3BSSA 4OSPA 4RQBA 4U9HS 4F9GA 3DYVA 3H18A 5AVXA 2QZ4A 4Q7LA 5DGTA 1Q0HA 4RTPA 2P79A 3KWMA 3LFUA 1U6IA 4H6WA 5CM2Z 1OSNA 3SBOA 2DETA 4TYQA 2A59A 1JP7A 2DBVO 3GLHE 4IS3A 4KACA 2YZKA 4C2UA 3L02A 1BXKA 2NU7B 2J08A 5DT2A 1QRDA 1KAOA 3GLHB 4TS4A 1FYFA 1XIVA 4BMDA 1CS0A 421PA 3MILA 5ALSA 4TMXA 1AQJA 1Z75A 2NTVA 4ECEA 3PD1A 4XPIA 3AIOA 1EBFA 1LI4A 2I7DA 4OFWA 3EIOA 5A6SB 2IV7A 1Y8QA 3R0JA 1JDZA 5E2AA 2QVLA 3TLGB 1OHHA 3KLMX 1E5LA 2ZJ4A 1J99A 3S1LA 3VZPA 2WZQA 5F4ZA 1U2TA 2QTNA 3SJBA 4BYMA 3RVQA 4Q4HA 1X7ZB 4YJFA 5KNLA 5EP1A 3OAAA 3VOTA 1ZR2A 2JZOA 1RQ2A 4B71A 2NTEA 1U5AA 4G23A 2QV7A 1SXJE 5AVOA 1T3SA 2E1PA 3AC0A 3AV0B 2YY7A 1NN3A 3DE7X 2LIPA 3B2NA 4QREA 4CIVA 3AERB 1SXJB 4OQ4A 1WMAA 1JU3A 2UVDA 4WN3A 1S96A 3RS5A 5JANA 2BAGA 4OM8A 3H13A 1QHYA 1I10A 5JARA 4HLDA 2PWBA 4XFKA 5CG1A 3R3YA 9ATCA 2HWYA 3R5TA 2P5TB 3EMDA 4WOJA 4REQA 2P2CA 3HS3A 5EVCA 3E5NA 1IK6A 1YR9A 4XVCA 3EQZA 2CFOA 1LQ2A 3FBTA 2GM3A 4B6RA 1JE1A 3ODGA 2AC4A 1TO1E 4JLPA 1VRVA 1JG4A 1DEOA 3MJRA 3MSCA 3CS3A 2PUVA 5LA6B 3LUHA 1YHYA 3SX4A 4BBZA 3G2IA 4ZEXA 2II6A 4JKOA 3F7MA 1UBRS 3VHXB 5LMCA 4C87A 3RUFA 1Z62A 4FZ5A 4DDMA 1KHHA 4Q3NA 2B8WA 5KQGA 1HE3A 5D1HA 3ZE2B 3WKDA 4ROTA 3OOEA 2TECE 4HH1A 3T38A 1N5MA 5LCXA 2BMFA 4I9HA 5HPYB 1MMFB 3QZUA 3SJCA 4KQ2A 4K9SA 1VHWA 3MUFA 1IZZA 1L1QA 1N2XA 4DV4B 2RHRA 5ALKA 2YWXA 4E5DA 3OZXA 2FU5C 3T7JA 3O9MA 1UQTA 2REXB 2ZJ0A 5CDFA 4F4JA 3FNGA 3GJXC 4XD2A 4YJ2A 3GFFA 5CU7A 2GFQA 4GICA 4TVSA 1TQ8A 1I33A 1PR2A 5DSZA 4W7HA 3ZTTA 4CIBA 4JVOA 2XMDA 3JQGA 1POXA 3CGWA 4BX8A 1Y6FA 5EQTA 5B1IA 4L2IB 1OWOA 2VPYA 1V47A 1F38A 1CDOA 2O23A 1B2RA 3KFXA 3E53A 1MQ8B 3QVSA 4ZV4A 3I76A 3N75A 2GO1A 2L0XA 3IEXA 4UU8A 5K8LA 4TL8A 1BXGB 3DKIA 4D0NA 4KQMA 2GBLC 4QOHA 1ZFNA 3NT5A 4FCVA 1DSSG 1T13A 1T6NA 3SYNA 1EFDN 2GJ8A 4IVRA 1JR3A 3QVGB 1KQOA 5CX1A 3CF4G 3M5WA 1CUGA 1OWNA 4IMIB 2VTKA 1XMJA 3O21A 4NP6A 4TRMA 4WI1A 5DBOA 3EJWA 2Q5HA 2C2GA 1EFUA 1RYEA 3S2IA 1CQPA 3O1IC 4IV8A 2CUKA 2ATCA 3PJGA 4JR2A 3THYB 4NHEA 5AHXA 1JGTA 1WULS 4C0SA 3CUTA 3NT2A 4MSUA 2Q3DA 3OX2A 4KGZA 1UBHS 2V7XA 1Z6YA 3BERA 2WSMA 3PA6A 3WYEA 4CPDA 4EW2A 4Y2VA 1W34A 5F1KA 2FX3A 4KRYA 5IZCA 4NZPA 4CV0A 1R0BA 1RJDA 4HGQA 5DN6A 4Z86A 5CYPA 4TRRA 1X9GA 3PDHA 4B17A 4DIDA 5FEUA 3OQOA 1SZCA 2ZZMA 2JLBA 3ZU2A 4ME6A 4MCAA 4TWRA 3VYVA 4TM7A 1XCPA 1LC3A 5FBZA 1Z74A 2PR2A 2GZRA 3KKKA 3NJRA 2RJOA 5JOQA 4BGVA 3E9RA 4Q24A 2VATA 3H9QA 4GXQA 1NW3A 3GUCA 3TL3A 2QX8A 1CUJA 1RQNA 1QFMA 1JBKA 2V6BA 2P9YA 2Z2IA 5JD4A 1K7YA 4LJ6A 2ZIXB 3KUXA 1C1HA 3A1FA 3HE3A 3U6BA 1IBCA 4U6QA 3KZVA 4Q37A 4K9PA 3NM4A 2IH4A 1ZGGA 3GQVA 4XVHA 4CKCA 3T7CA 2ERXA 2OB2A 3GJSA 4NNPA 4Q4LA 3WAGA 2QN8A 3PTAA 2FFHA 3WNCA 2Q6TA 3NCHA 3ASZA 2GESA 3QU9A 1LPOA 3NXKA 1YR8A 1KAHA 1XZEA 2YHSA 1PW7A 3IOCA 1VMEA 1C3LA 2D6FA 4U4AA 1LRLA 5K0GA 5JR3A 1WZEA 4UHCA 2YWDA 2B4YA 4YXWD 3VV3A 3UCEA 2MYNA 3IJ5A 4IDDA 2ZBUA 3WV4A 1YB7A 2OXTA 2XOEA 4CQLA 1N7HA 3WYBA 5KZMB 4W5RA 1VFNA 1G9TA 2AMYA 1TZ2A 2V54A 3WRYC 3R09A 3PEWA 2XMGA 3VAYA 1Y4UA 1UDRA 3P5SA 4BKMA 2Q3EA 1QHEA 4N0PA 1N57A 3FAZA 1IQ0A 3WV5A 3KJGA 4DLZA 2GK4A 3W4KA 4XCXA 3AM1A 3DBHB 3O8OB 3V1UA 1HY3A 3AB3A 4M1WA 2RB4A 4YT5A 4B7UA 3R77A 4EJFA 3PJRA 6YASA 1R6DA 1N2ZA 3ZBTA 4C07A 5JRJA 1GNTA 5EG5A 1OMOA 1YQWA 3NALA 3BL5A 1FQKA 4BN4A 2LE0A 2UYGA 2H9YA 1U99A 2WV9A 4CKEB 4UHFA 2DMRA 3IAEA 3TQCA 5KNDA 4QD3A 4LNUA 3WA6A 2HSJA 3JVDA 1C7EA 4DPKA 3M2TA 3EARA 2IP4A 3IJPA 3UAZA 3ZDFA 4CM4A 5KINB 2I78A 3TQQA 3FI0A 2WU3A 2XYQA 4AKEA 5ITVA 2D62A 5E9JA 4BRSA 4L57A 2J31A 3K0HA 5E4FA 1NQTA 3GT4A 3MTAA 1DUVG 1O94D 4LZWA 3SOZA 4BWYA 4K0KB 1FYVA 4PG5A 4F84A 3O95A 1E2GA 3ANMA 3OQVA 3QEOA 1NJFA 3A4YA 3EQ9A 3U13A 1BA2A 2Q4EA 4ZVSA 2OCXA 1T2VA 3KB6A 3VISA 3GLIE 1CIVA 2GPSA 3NAQA 3QH4A 3LXXA 1K08A 4XDYA 1QHHB 4E5UA 1WO8A 4X24A 3JD2A 1I3CA 1VL1A 5IK2A 3KV1A 3ON5A 3GLIB 1W6UA 2ZRFA 1GXSB 1KH1A 1QNLA 4JA2A 4P4SB 2GLXA 2IXFA 4NBUA 2X9VA 1P1IA 2YWRA 1N3YA 2QHXA 1LJ8A 4YRCA 4BNNA 2YR0A 2UUPA 4FLFA 5FQOA 2NVUB 3Q9NA 4TWZA 2OBNA 3VPHA 3GFTA 3TDMA 5AMXA 1EM8B 4O4JA 4JGIA 5EHGA 2QTVB 4B5KA 4IIBA 4YRSA 1YWGO 1UBUS 2UZ0A 2WU1A 3MHPA 1Z6TA 2WM9B 3ECCA 1QCYA 3AQ4A 3H7IA 4M7OA 5FNVF 2J9FB 1U2DC 2C57A 4PPNA 5LBIA 1GO2A 4MV5A 4Y8VA 1KDZA 2W2MA 3S7TA 4W9MC 3UHPA 4S0ZA 1AIPA 1T6XA 2O7QA 1L5NA 3EOBI 3N2NA 1VSVA 3VMFA 3CNOA 4UHDA 3KSAC 1K8ZB 2IHBA 1X1BA 3H1FA 5JSZB 4RVDA 4DA8A 5KVCA 3LUAA 2G70A 4Y2RA 4KREA 3CW2A 5TB5A 3SQWA 4KLAA 2DQSA 3D0QA 1UPTA 2GLTA 4TV9B 1IVYA 2JS7A 1TUIA 2N47A 4IKOA 4D81A 5IU6A 1JR6A 2YXEA 1GR0A 1L7DA 2VK8A 2EEZA 2W2LA 3KSZO 4MZXA 1FYEA 2VYFA 5LIPA 3IKTA 3AEKB 3ZY3A 4NCIA 3NM5A 2HK8A 2BEVA 4ZU1X 1FP6A 2JZNA 5CVUA 2ECKA 4S1PA 4LGCA 2BVNA 3RU7A 2WHXA 4J0DA 4RY0A 3GMTA 4E31A 5CB4B 1X80B 2QX6A 1QFZA 3V97A 1BD3A 2Q3MA 4AJIA 2ACEA 4HNTA 4FGZA 3Q3JB 4OFXA 3ZWDA 4U2CA 2YNMA 3DC2A 3FNFA 1DRKA 3ZTWA 4BY9E 1Z15A 3QE2A 5I9TA 3RS7A 4IDOA 4A23A 2C5BA 1IBKB 1U2GC 2OLEA 4JBHA 2O20A 5KYXA 2C58A 1BTOA 3D9QX 3EFOB 4GL4A 3ZKWB 3E84A 1XQ1A 4BWVA 4L76A 2DTDA 3WJAA 2B4RO 2OHXA 2WY2D 2FF7A 1B15A 5EKTA 2AOXA 3FMIA 3SG0A 5C2JB 1WVGA 3A6DA 2M6KA 3EIWA 4DFDA 2QT0A 4XD7A 3O84A 4CCWA 1Q1BA 3EIFA 1E98A 1QYXA 1VHTA 2BI8A 1TADA 3R41A 5CNMA 2PUBA 3RRFA 3Q72A 4QTYA 3GLQA 4ENWA 1UBTS 3H8JA 4FFBB 3W05A 4QDZA 2WWVD 4MULA 1HE8B 3CUYA 4MDEA 2RMKA 3Q3GE 3ET5A 4D9EA 4P0QB 4CIWA 3R9WA 2KE5A 3VRHA 5DSXA 5CLJA 1TT5B 5TPZD 1EEXB 4FMBB 3D3KA 1DQSA 1JFFA 3ESZA 4X8MA 1SC3A 4B46A 1DTWB 1HV8A 4AULA 3O82A 1WQ3A 2Q4BA 1PV1A 5KTOA 2Q62A 4J1TA 4EUNA 5BPHA 3KQYA 1TKCA 1O6FA 2C07A 2WAMA 4JCOA 2CBXA 3VKGA 1Z4QA 2O3SA 3KQVA 1KEWA 4FFDA 5JE8A 4QNNA 2C82A 3LG2A 3TW8A 1WP9A 3VZSA 4B32A 3ADKA 1D0IA 2VHQA 2VP4A 2EJVA 4FGJA 2AMLA 2B7CA 4C7BA 4CLRB 4RZ2A 4NXMB 2X4IA 2ID9A 4TZ0A 1OI4A 4RJTA 1RC1A 5TMBA 1NTOA 5IYZF 1T1RA 3TPZA 1S8AA 5AVTA 2NQ8A 3HCDA 4TWBA 5AW2A 2GFHA 2WHRA 3UMMA 4MUAA 1ONNA 1KOFA 1SWWA 3CSUA 5KO2A 5CLQA 1Z0IA 3F5MA 1WD5A 1TEXA 4UZSA 3CT4A 5K09A 2RGXA 3KP1A 7YASA 3SI7A 2YN0A 3EG5A 4W5WA 3TIVA 4RULA 3ADDA 3C5VA 4DLWA 5BRAA 3U19A 1G1AA 3LY7A 1M67A 1DXQA 4BUCA 1F14A 2ZXUA 3NWJA 2FPLA 4F6RB 1QIIA 1EGMB 4HAZA 4ZQCB 4POOA 1RCFA 4TVKA 1ZO8A 4BTLA 1L0BA 1JG3A 3RU2A 3EX7C 2PSHA 3C2QA 1RYBA 1SK8A 3JZIA 4C1BA 2IY8A 2X4LA 3C16C 4I6JA 1MN6A 5LKRA 3VKVA 3P9NA 3F46A 3O75A 4KBYA 4RTSA 2IH5A 4IHAA 4LRSB 1IJEA 3PDJA 3TN7A 3RRJA 2O14A 1IULA 4W6ZA 5KCMA 3RYHB 1XZLA 2BM1A 1O5TA 3KKEA 1HDOA 4GPZA 1EZZA 2EC5A 3KK0A 2Q5CA 2GBGA 1EM6A 2JD0A 3OE1A 5DYTA 4I8XA 3EXHA 4BQNA 1ZXXA 2I65A 3B3GA 2OCIA 3PD7A 2ZITA 1K7XB 5DTJA 4OP3A 3TGWA 3I42A 1L8AA 1RIFA 2VAVA 2WIFA 3PI6A 1FFBA 2G9QA 3H9UA 3GRVA 3T3NA 5JQWA 2OOSA 2CNKA 4DOMA 1A5ZA 1OBFO 8ATCA 2C20A 3K6SA 4FYWA 1XLTA 1US8A 1NMZA 2QM0A 2ZJOA 2ZJ1A 3ICPA 4WOPA 1VL6A 2I4RA 5CCDA 4ZCRA 2PUFA 5CK5A 5ENDA 4F2DA 4D45A 4UDXX 1O8BA 2OHHA 2WWIA 5EQFA 1GNSA 1YFZA 3LCCA 1RRFA 4OI2A 3GG2A 4MAFA 2QRZA 4N54A 3AF1A 4IJ6A 3HI4A 1BROA 3ZTYA 2PD4A 1E4YA 1MB0A 1UKBA 3QNWA 1XEXA 4AMUA 1ZM3A 3WE7A 1K9VF 1OIWA 4RAOA 4NOKA 2Z08A 1M1NB 3C70A 1IVSA 1H2EA 2VEDA 2VJYA 3BDVA 1KAGA 3H5WA 5U9CA 1H2WA 3KHKA 1YBVA 2CCGA 3A2NA 4XA8A 2ID8A 1JI0A 2COKA 4NAVA 2O8DA 3WQRA 2PX6A 1OAKA 3DT9A 4XRRA 1X8JA 4FDAA 2EKPA 4O33A 3W8DA 3FNEA 4UHEA 5KJCA 1IHOA 3CX4A 4R5HA 3IXMA 2CZQA 4ND8A 4AWAA 3OJLA 3CUSA 2UXBB 3GFSA 4J16C 4F93B 5I45A 4QHTA 2QJWA 4ZHQF 4XYMA 4GUAA 2V96A 1SIUA 4H16A 4RANA 1ND5A 3R0QA 5LJLA 2WQ6A 1JE0A 1F3OA 4MK4A 4RFSB 2ROQA 1GTRA 5KOHA 1WV0A 3VR0A 1C4XA 2CDAA 4LOAA 3BSFA 4PXSA 2XTZA 3RFFA 2CJPA 4S2UA 3WI7A 2QN2A 4AZWA 3A37A 3AKYA 4HDOB 1Z5NA 2E4YA 3AEUB 3WNBA 1VPDA 3NEAA 4O1MA 4BO0A 4EYQA 2WQ7A 1TW3A 2XMPA 3DW1X 2H2DA 4JLWA 2O6LA 2Q6OA 2DE0X 1GRQA 2OQIA 4FFLA 4N3AA 2EZ4A 4TT3D 4ETIA 1TGVA 5HMLA 4EELA 1MJGA 1W0JA 3BK2A 3RVDA 2C04A 4LBZA 3ICCA 5FBLB 3ZDEA 2OOKA 1OYVA 4HNUA 4QQ8A 3P5BA 3RVNA 3ZGNA 2NACA 1M2GA 1ZI6A 3P2KA 4RA9B 2FPIB 1CR0A 1T2UA 1Q74A 5TJ9A 2OZLA 3W6NA 2VBGA 1ISRA 1NBME 1RYDA 2BGMA 2C95A 2QM7A 1YVUA 1QG0A 2AJLI 2VA9A 2AH5A 5ESRA 4ZJPA 4W1SA 3P2EA 1GL7A 1BCRA 2OAP1 1CE8B 1ZHHA 4M9XA 4C0AC 3WXMA 1EFVA 1SBHA 2H8GA 4UMEA 5M2QA 2B4TO 1MNQA 3ICOA 4IL5A 5BOSA 5FRDA 1ZKDA 2IFTA 3NTRA 2FUNB 3UBMA 3GMIA 3L6OO 1YVRA 2N46A 3T4EA 4PGFA 1Z9BA 5DSTA 4R05A 5JRZA 1R37A 5FWDA 4HQNA 1ZSYA 5HFJA 3V4ZA 1IXKA 2RI6A 3F8TA 5FUXA 3WNQA 2A0XA 4MWTA 3OJWA 1W1IA 4F4DA 5I3CA 2CJFA 1A2KC 1AVTA 3BFJA 1QAOA 5JRDS 1XKTA 2QLNA 3E58A 3NTXA 1CRPA 1U3UA 1SMKA 4EX6A 1T2FA 4PCAA 1ZA1A 2Q41A 3MUNA 3SZLA 2AKEA 4Z8XA 1QX3A 2H1HA 5IT0A 1GPJA 3FPAA 1SXIA 2C4TA 4CMAA 2QJOA 1FS4A 1QR2A 2QI9C 3TWOA 2IHYA 2O7SA 2QXUA 4OHYA 2IQ5A 1EZ1A 4Z9FA 3OFNA 2XI4A 4OH7A 4CXMA 1V35A 4EFDA 2Z9DA 1UFOA 4JOBA 2R751 5HIIA 3IEMA 4GOLD 3DL4A 3CW8X 4NMLA 1B6RA 1RJ9B 4JH0A 5LQCA 4WVFA 3EPLA 1SXJD 1NF8A 4XZ3A 2JIZA 3EVEA 4NS1A 2VSNA 2O2DA 3JD4A 2HPZA 2NSLA 3NW9A 4E0BA 4PYJA 5I8PA 2VHCA 1DBSA 1LLUA 1THMA 2CHEA 2I80A 2RAUA 3KKZA 3IHKA 4KO8A 3X2SA 1GAJA 3MT0A 4PLWA 2D74A 4RDXA 1QGOA 4TLBA 1QO0D 4BBAA 5LSAA 3S27A 2BYTA 4HXYA 1CG6A 2FP3A 5K8CA 1C0LA 3RSSA 1E3SA 3UH1A 2QZPA 5D3MB 1G4UR 1MJFA 5CYOA 2XBLA 1KSGA 4KRFA 2J3DA 5IVIA 3ER6A 2X5XA 1A8HA 1VE1A 2PX3A 3BGIA 4FD3A 4AG3A 2ZUDA 3C1UA 4MW2A 3RFXA 1WQ4A 1MO5A 3O8RA 4MHOA 3BMNA 3GHHA 5JASA 4OQQA 5H82A 3UMYA 2GDJA 2JGIA 3DWIA 4D6YA 4ZQEA 3MRXA 4EGCB 3PRKE 2G9VA 2BRUA 4QAQA 1J2UA 1KARA 1AX9A 1HDYA 2IUYA 3AI7A 2ZZNA 1ZU5A 2VJMA 3EXIA 3MERA 2QRJA 1XJWA 3ANNA 4JOCA 5LLTA 4B73A 3TZBA 3IE1A 1P45A 1R15A 4WCFB 3DP9A 1C9MA 1T6ZA 1Z56C 4FPXA 3W5AA 2JAPA 5EP3A 5HE8A 4O2AF 3UENA 2QR2A 4C2AA 4TMFA 4R31A 4BLVA 2CLSA 3L46A 5AI5A 3WBFA 4EK9A 3DEJA 1LNSA 4FEEA 4TWJA 2QTCA 4I4LA 5CA0F 1F1BA 4U39A 5A3VA 3DJFA 4BFXA 3L92A 4DUGA 4EHKA 5KAMA 1GV1A 5AW9A 2H08A 3PS9A 4CT0A 3I5XA 1QVRA 5JQGF 2ZGVA 1YONA 4YV7A 1ULAA 5BV2P 2XB9A 3RBZA 5A6VA 3EF0A 1Y3AA 4GO1A 4A16A 2AK3A 3K30A 4RWZA 1MB9A 2E4VA 3L0CA 4KL8S 1IHUA 4YP1A 5F9MA 2BOVA 4KWCA 3ZH2A 3SJUA 3GGDA 3KYCA 3QLJA 1V3UA 4PRYA 5ELMA 3REOA 3RVJA 2WNHA 2WPDA 3OEEA 1U0TA 4TXMA 3TX6A 5DNVA 4NZMA 3PNVA 2Q28A 3HLKA 2YL2A 3D3EA 4RKYA 1KEUA 1U3FA 1ZJZA 2JVIA 2R25B 5EKXA 1WX1A 4JKIA 5NULA 1CY7A 2DPYA 1V1RB 4MQMA 1EQ2A 1LTHR 3L82B 4L9RA 5E6SA 2H4YA 3FTCA 3R9IA 1DC6A 3NMUF 2VF2A 1GEEA 1PU2A 1SHLA 5KNBD 2VCYA 2DR0A 1KEVA 4YDHB 3IQXA 3U56A 5KSYA 1IM2A 3H9JA 2GM5A 2WHEA 1ZUIA 5BN5B 2QPOA 4K6HA 4N1AA 1KWGA 2GILA 5C5DA 2X4GA 4B0OA 1PNQA 1XCGB 2P4EA 1RKBA 5J5CA 1PZXA 1RHJA 5JWHA 4RPCA 5D2CA 1U4SA 2C2KA 4G1MB 4DRXB 5A4IS 1D5CA 2JGJA 2QU8A 5JCZA 1FLVA 3ZHUA 3C43A 1BE6A 1LXCA 1JEAA 1NOIA 5JMPA 2ZRHA 1N8NA 1U81A 2PGNA 3SSMA 3ZHOA 2BL4A 2HRZA 2XT9A 2IXAA 3HBAA 4M21A 3RFTA 3SEAA 1QB8A 1UJBA 1EINA 3VO1A 5HTOA 3DZCA 4A2QA 4B3SB 3LK7A 4OQXA 3Q6MA 3FUVA 5HCIA 1LC0A 2IEIA 1G6KA 2RKOA 2XKJE 3GVCA 5ALVA 1BGWA 3B3AA 4HQOA 1ORDA 1Q1GA 4DA4A 2G25A 3UHAA 1XRNA 2H17A 5A5DA 2A1TS 5AVUA 4YJKA 4ZMSA 3BRWD 4IHKA 3WLFA 2RHBA 3CT6A 3UYKA 1RRPA 3LUDA 1MC1A 5DOZA 3RGGA 2IBTA 1QKJA 4B9EA 3V1MA 5CG2A 3N8GA 4OHXA 8AT1A 3OICA 4N5LA 1W46A 3QLUC 5JYCA 2B3DA 1N2HA 1BC5A 1S02A 2H5LA 1JU9A 2HA3A 2IF2A 1WF6A 1SU7A 2AE1A 2JDID 1SOMA 1WY5A 3D6JA 4M88A 4RNDB 1XD8A 5CUQA 3RT1A 1ZDMA 5J2TA 4FSXA 1GNLA 2H1CA 3FBWA 3WLSA 1PEYA 4MQFB 4OIMA 4AJ2A 1T9DA 1V8PA 5ALFA 1LWNA 4DEVA 5JXWA 2GMWA 2PU5A 2ZKLA 1FLDA 1LS1A 1BJTA 1LU9A 1OYWA 1V4BA 2G72A 3PC8C 1QCDA 3IULA 3PHBE 4GYWA 4LY9A 5SYNA 5LL6P 4FBMA 3UMJA 2XKAA 2CXOA 2CSXA 4KOAA 4YPVA 3D6MA 4MAMA 2BM8A 1KPGA 4ZJZA 3KVRA 4IX9A 3U3MA 4YAGA 3B1XA 2EL9A 3LL7A 5AHWA 3LZCA 2YVUA 1SU6A 2XAUA 4MYUA 4PR3A 4W8HA 1WUTA 1XJQA 3UK7A 4EMTA 2OVBA 2JLUA 3RADC 1QNFA 2DG2A 2V8OA 4O1IA 2C8VA 5TQ0A 4J2HA 4GP6A 5KI6A 5LP6F 4DB4A 4DWJA 3Q5DA 1OILA 5T57A 3RAEC 3GJ3A 2BTEA 1H4TA 2W42A 4MW6A 4F11A 1R6BX 2UU9B 2BELA 3ONVA 2P2DA 3AP2A 1PK7A 5CLIA 1EP9A 1R1DA 1X1TA 2JBAB 2O7RA 4XQCA 4AY6A 1XXHE 1B16A 1BKYA 3SC4A 1PGJA 4KFRA 4OX9B 1QDLB 2VPXA 5KC8A 1XXHB 2LCIA 2ZI5A 4HDNA 4HX9A 1YTLA 5UKDA 5JUWA 1TYAE 1ENYA 3FNQA 3VSAA 2EW1A 2FEPA 2B20A 4JUFA 1FDRA 1QH0A 5CJJA 5FI5A 4CTJA 2JHCA 1PR9A 4OYHA 4XKJA 3U4HA 4BO7A 4WBNF 2E85A 4L3WA 4Y2JA 5B4TA 3FSEA 4F12A 3THYA 1M6VB 1NLYA 3KTAA 3MTDA 2F1HA 5BUSA 4RELA 1BN6A 1XF9A 3PENA 1ANKA 3S2FA 4YAIA 1Z0ZA 1E2QA 3S4YA 3N2EA 2JCXA 1JYFA 3KJEA 3TZCA 4M60A 2X5JO 4H7PA 2RGBA 1ETHA 1E0DA 1T43A 3BDIA 4I3GA 4Q9KA 1LVHA 4JP5A 4F6CA 1B74A 4QUHA 1NW8A 5C80A 4C4PA 1LPAB 2A0KA 4V0RA 1CJUC 1W85A 3UAXA 3WKEA 2ZAOA 5B36A 3IKMB 1XCJA 4YWHA 5JDIA 2BKUA 5HRCA 3GC6A 3O93A 1RKUA 5BNFA 3VH4A 3ZGVA 4RLFA 3SLKA 3JVVA 3ZS9A 1JDSA 3I28A 1R8XA 1RWBA 3H5VA 2O1XA 3N2KB 3OFSA 3UUGA 3DLIA 3ORRA 2KBEA 3LQKA 4PN3A 4ZHSA 3U44B 3EZNA 1DRVA 3R0VA 3SM3A 1T24A 2GD6A 3D2AA 3VH1A 3QLVC 4I9UA 4H9GA 1DRWA 1EP3B 5K03A 1ECPA 4UMVA 4NMWA 1HDIA 3M9LA 3U3RA 1NMSA 2XVYA 3RM3A 1N77A 1H3NA 1Z7YA 3B36A 4RK7A 3SEQA 3MJEA 4FT4A 4RADA 2QN3A 3OIDA 3DTVA 3QMMA 1YR2A 2F62A 3WFJA 5LVAA 1BCSB 1DPGA 1J9EA 2YHUA 3RUDA 2REQA 2BFEB 4ZO8A 4QYWA 4Z0NA 3HFSA 4YV0A 1JTEA 3EASA 1GV0A 1X2EA 4R7ZA 4UVEA 4ESVA 3HLYA 1F5SA 1KO4A 2GHIA 1T91A 5IAJA 4Z51A 2PQ0A 2EU8A 4GRAA 1XL1A 1UEJA 3VR3A 4DIOA 2OMKA 4UJ3A 3WRYA 3UW1A 4LCEA 1ULHA 2AN3A 3W5BA 2XD4A 1HYGA 3NC1C 4LMPA 2WUVA 3KVNA 5G53C 5JAZA 2FQWA 1ZHOA 4GGPA 5A1JA 3L43A 1E9FA 2WA1A 1PSZA 2R6AA 3I23A 3B9RA 3IP3A 2ZIEA 1CPYA 2PTGA 3E22B 2PXHA 1L5SA 2OESA 5AVJA 5HW0A 1E0JA 4A3SA 4Y2YA 1GQRA 2YBDA 3IDQA 3L49A 2BBWA 4WASA 1OC2A 5CFMA 2QRKA 3BXHA 2QROA 3VJMA 4EGQA 3A1CA 1W581 2QUKA 3AFGA 3N5CA 4J0CA 4ZOQI 1O6ZA 1ACLA 1KO7A 1IB0A 2P9FA 3CLRD 4ZOLF 5BWOA 3P96A 1UOQA 4GKJB 2GTPA 5FD8A 1F6WA 2OD7A 5DB4A 5B53A 3QEMB 3VR4A 1R6VA 3WNVA 2FEWB 4WHMA 3RV4A 3ZHCA 2X0EA 3WMFA 2PBRA 3SFTA 4EBFA 1QHHA 2AZ4A 1U65A 3TD2A 1JF8A 1AZLA 3M33A 4MP8A 4OI0A 3GLIA 3IL2A 5A71A 2I71A 2HBZA 3M8KA 3FNHA 3MS2A 2WIJA 4KE8A 2VUIB 2ZUTA 4X6XA 5KX5B 2PN1A 1ZQ9A 2H3EA 3EGWA 3CSSA 2DP4E 4RM3A 5DYWA 5EUCA 4C5BA 4OX9Y 3PYXA 1VSQA 4ZV7A 1N32B 2QTVA 2AT1A 4BQOA 4ZDIA 3O8DA 3FYDA 4HN9A 5K0FA 2G4VA 4ND1A 3W1EA 2J9FA 1XKLA 3V4PB 3E9YA 2BFPA 4KSYA 1P6XA 2ZE7A 1JDBB 1PSDA 3CZPA 4XOUA 1V11A 2P4SA 2CE2X 2FPSA 2W2KA 1JU4A 2XJ4A 3L7AA 3U3XA 1NR1A 1W87A 3QLTA 5DK6A 5EWLA 2XE4A 5EE1A 2PFGA 2UVPB 3QHAA 5TPWB 1U2DA 2WTBA 1S3IA 2FQQA 4I81A 4D8VA 3VUEA 4WA8A 2I7VA 3VPCA 5E6UB 4WLUA 1Z18A 1OZFA 2FPMA 3B1VA 3AR9A 1UBOS 4FNGA 2QKYA 5F2NA 3BB1A 1RI5A 2HF9A 5IVPA 3AEKA 2VUUA 4B34A 1MFZA 3NAMA 3OIVA 3BGOS 1BSVA 5AKHA 4JJKA 1FUUA 4C7VA 5AIAA 3KU1A 1GYPA 5U1PA 2J3KA 2QGNA 4OPMA 3CQ9A 3LUPA 1X80A 3WGVA 5LMUB 1TEZA 2F64A 3AR4A 3ZJUA 5CXQA 4MKIA 2NVBA 4FS3A 3ETJA 4GPTA 3H75A 2FUG1 3D5QA 2CD9A 1QZZA 3F2IA 3P19A 4N7JA 3AR2A 1XQXA 2C9BA 3E3NA 1NFFA 3BFXA 4RCYA 5F7ZA 5I9IA 1EDEA 1DIAA 1ZH0A 1LPNA 2PGDA 1P1HA 2Z9BA 3A9RA 1PL6A 2GCGA 5A2QA 1WLYA 3AVTA 1K5DA 1U2GA 3JQEA 3HNPA 1T0PA 4MITA 2X6RA 4M0UA 3DLPX 1UC9A 3QVXA 4S35A 3PTLA 1JFLA 3COYA 2JL1A 3H97A 4HFJA 3SP1A 4B76A 4DHWA 4YALA 4IIJB 4V3CA 3G9UA 3QF7A 5C8DA 5I7HA 1XAJA 3DJYA 4LYDA 1QP4A 1TT5A 4ZVPA 2ZIAA 1XU4A 3LAWA 4ZI5A 4LHXA 5EL0A 1S2NA 2FN4A 1MBZA 4Q9JA 5DM0A 2W8ZA 2X4DA 1PGNA 4EUEA 3BE6A 3JQPA 1HYBA 4B31A 1ZM7A 2OUKA 2ZBQA 5KOJA 4JL5A 3TNLA 3QU5A 2J3JA 4FUQA 2WJPA 2CY0A 1PJZA 3KYDA 2RKBA 3H9CA 4K6MA 4F5WA 1DI0A 4L4SA 1CEXA 1XZCA 4OD0A 4EJ6A 2FPWA 4LZOA 3R74A 5KYUA 2IW3A 2ZWAA 5F35A 3ZDDA 4G4JA 4EEZA 3GFBA 2DHQA 2EFYA 1RQXA 2IRWA 1R3UA 5HTKA 2G5TA 4QJIA 3KZMA 5AKEA 3QQ5A 1W7AA 1M3SA 2X86A 3IR6A 2C0QA 2RH4A 3UHJA 4X6LA 5ICMA 1N7JA 1XDWA 1WETA 4D9GA 2H4ZA 1B6SA 3SXPA 1XZGA 5B7PA 2HWUA 2ATVA 3O91A 3VJRA 1Z7BA 2NXNA 2R6JA 3IEVA 3B3QA 3V8NA 4CKBA 4O2BA 3DE0X 3LX6A 1G1MA 7AT1A 2Y6VA 5L7WA 2I2AA 2AYXA 3PFNA 5DM1A 3HV2A 4YDSA 4BFYA 2QTRA 3WLIA 3PCTA 4E6EA 1P9RA 5EZ5A 1WCXA 2BDEA 2OILA 3NIFB 2PYDA 3A70A 3NX4A 3KM0A 1PQPA 3DVQX 4F9TA 4JELA 3FN4A 1M1YE 3QVLA 1Y8RB 1F9AA 2ZULA 1PZHA 1TE2A 3BVPA 4YRQA 4V3BA 4EH1A 1RAGA 3E7XA 1EZ4A 1M1YB 1U1IA 4ZPJA 2YN2A 2Q6KA 4NJMA 4U7GA 4N3BA 1U2ZA 1VE9A 2C96A 2P7HA 3E82A 3BD6A 4MUJA 5HK8A 4OI1A 3ZE6A 4R51A 1Z2OX 1KDRA 2ZU6A 3AU8A 4HQLA 2WTEA 1A9RA 3QUSA 1XUOA 1C7JA 4H7DA 3V2HA 4HWKA 1YIAA 4KE9A 3DM5A 5AR1A 5D6NA 3R7BA 4N5HX 4QDJA 5KJFA 2R7NA 2C3PA 5L3SA 3VPSA 2OD2A 2XYHA 1P4RA 1ADYA 3WWZA 2FZGA 3OPNA 2XMCA 4PTYA 2XYPA 1QZXA 1W52X 4GWKA 4OGFA 4PF1A 2UV8A 4FXPA 5CGZA 3HK2A 1SR8A 2HIHA 1FMTA 2YV3A 5EP2A 3UJDA 4CLOB 5DJ5A 3TKAA 1XMVA 3M1LA 3NS7A 1KP9A 2VK2A 1UP6A 1MORA 4PW0A 4HH4A 4TTSA 3OSUA 5JXGA 2X7XA 5MGBA 3LC0A 4BMXA 1V16B 4OQMA 3GW8A 5F3DA 1ISGA 2FP4A 2YFYA 4DA7A 2HSDA 2X5OA 1YA6A 4JDUA 1DDGA 2QRLA 3W4IA 1YZTA 3ZIUA 4D3SA 2WJ6A 3K5WA 4RBNA 4CE6A 2XWBF 5LOVF 3O3OB 2PL1A 1L7RA 2IOQA 1POWA 1JWLA 2FRXA 2ZJ8A 1XDBA 3QTBA 1X1AA 1T2EA 4AJKA 4X1KA 2B6HA 3QBTA 1MAWA 2GXUA 1QBKC 1WZIA 3WS7A 1Z33A 4W9RA 4HEHA 1ZOPA 3S2YA 2WLSA 1HNNA 3N8HA 3NRCA 4OKIA 5H9VA 3DVSX 3FBGA 3DYBA 3SWWA 1CLUA 3OP1A 5I4CA 3L7KA 4TL9A 4NBTA 2H31A 1D0VA 2PUWA 4HZGA 4RS4A 1TW2A 1AHIA 3LGSA 3OX3A 5BNWA 3HP7A 3KPVA 4Q18A 1QHSA 2QL9A 1WDMA 3K35A 1O4WA 2C2HA 2V7UA 4C6TA 5IZ4A 4CM1A 2GXQA 2B3TA 3GNQA 2FN9A 2O7NA 3OTHA 1P7PA 3PE3A 4RHCA 2VH2A 5AP9A 3FOZA 1KI6B 4J07A 1P81A 1QXSA 2Y93A 2J67A 3F6PA 3G23A 3L6RA 1EG2A 3GDGA 3OFKA 4Y0NA 1IRIA 4RFSA 4PSAA 2R6FA 1U8CB 4J16A 4JC8A 4NU0A 1MO2A 3NTLA 4LY0A 2QZJA 3I8SA 1NULA 4Q1FA 3KL2A 3NZEA 3WDKA 3R24A 2WJAA 3U09A 1E89A 4CF3A 2PA0A 5H3HA 5DXAA 3TCKA 2H2GA 5FBQB 1IJFA 3BHIA 4N6NA 1REQA 4KWHA 2VDKB 2Q0HA 1EUYA 4G0WA 4JZKA 4ZZIA 1L5QA 5BW5A 5K3DA 4HDKB 4XQGA 1XEWX 5LQMA 3QBEA 2YV1A 1P74A 3EEIA 4JBXA 5J4YA 1G8KA 5J40A 2VHXA 3VYRB 1IOLA 4AZSA 3BMCA 2HNBA 4CTKA 5DNWA 1JKJB 1U0JA 4ZCLA 4AUMA 4EVQA 4AN4A 5COBA 4MB0A 1JWAB 4H7JA 4EUFA 3QFSA 1MPXA 2XVXA 1T36B 4O4LF 4Q03A 3WO1A 2RHJA 4R8VA 3T5MA 3QFTA 1FXWF 1K98A 3HU1A 3UJ3X 2OENG 1W36C 3RT7A 1L7BA 1NBMA 3WB2A 1YCGA 3HL0A 1UBNA 4LPSA 4P3KA 1P73A 4M0CA 4S12A 5AI0A 3T0IA 1XTPA 1Z37A 1KBOA 2DKNA 3MCTA 4QG7A 1D6JA 4RC9A 1HE5A 4TTPA 2C7OA 1WUYA 3LXRA 4I5FA 2F3SA 1RZVA 3WZ2A 1KZ4A 3WSVA 2L42A 3G5TA 2E1RA 1W36B 2FLWA 2N42A 2PRKA 1UANA 1X7HA 1YRLA 5EFOA 1TTTA 1Z6GA 2AFIA 4EBBA 4GKKB 3RIYA 4CF7A 4AJHA 4ILEA 3UTDA 2HSZA 1NR7A 2HWKA 2YXBA 1NLFA 1DO8A 3NDRA 2WAYA 3PU6A 4WBXC 1YB4A 4M1QA 3KX2A 5HRAA 1J0EA 3TIIA 1VBKA 1OBVA 3W5DA 4JHLA 4RCVA 2VDOB 4DKXA 4YMTA 5H4GA 1XYYA 1XQYA 4D57A 4PLTA 4YRGA 2WIAA 3A9TA 5EIEA 1J97A 3FZGA 4Q3OA 4OL0A 3GEIA 1W2GA 4UEJA 5LB2A 2XDYA 4AS1A 1A9QA 4MI9A 4Q9HA 3CVWA 3KT8A 1DQZA 1PJ8A 4C22A 4DEXA 3F3MA 2AI3A 3SQDA 4H3KB 3MS4A 2H1FA 1E7MA 1VI5A 3IH5A 3A6FA 2ZIFA 2PRYA 2B9VA 1XZKA 3PL5A 4YCDA 3KSBC 4WXEA 1XLVA 1PGOA 4J2TA 1CIJA 2AYYA 5EE9A 3FKQA 2PGJA 3I2FA 4L4YA 2JPDA 2C1ZA 4ZCSA 3UEOA 2GR9A 2EARA 1JNYA 3QKSB 3URKA 1CB0A 4PQRA 1SK9A 5JZMA 5E7MA 3W3AA 3KJQA 4I5IA 1WP4A 5DLQC 3BFKA 1E32A 1YJQA 1CXZA 4CG3A 1G64A 4DANA 2BHTA 3NOXA 1CB7A 3IDSA 3FPJA 4ZRDA 3DWGA 1YS7A 5EINA 1UP4A 4TOIA 3ZVRA 3IA2A 1NASA 1ZEJA 2QUHA 1B1AA 3LFHA 4RD2A 2PSDA 1ENOA 8GPBA 1VCOA 5IAKA 5H80A 1XPJA 3UV3A 3KUKA 2FKNA 1YVPA 4RE6A 4TMVA 1RJGA 3UOGA 4DA0A 3FZYA 3X1XA 2MSCB 3O4JA 1MXHA 4LE0A 3KDSE 3K0FA 4IUYA 3KLPX 1Y3FE 2E6KA 1W0KA 3MUEA 3N28A 4LQLA 4NENA 3AUUA 1VP9A 1G63A 3KT0A 1OB5A 2IS6A 2FRVA 2BJVA 3GZ4A 3FCYA 2FTKE 4MB2A 5IXJA 3NFYA 5F76A 1CLEA 4YJ3B 2JGKA 3KJIA 4A5SA 5HJEA 2RH9B 1M5RA 1AE1A 4MLDA 3W5SA 1DCMA 4M1OA 1IZ0A 3CEHA 2HSWA 3GVPA 4PSDA 1IYZA 1QHGA 1TK9A 3AR8A 1J49A 3QE3A 2CXUA 2BP7A 4I36A 3EPKA 2O2XA 3QUAA 4CWAA 3MBOA 4XJSA 4IGFA 2AFHA 2C2YA 1YZLA 1VLJA 1M73E 2AVDA 5IAGA 3R0ZA 5EJ8A 4CIYA 5LP1A 1R8YA 2KBFA 4D4MA 1A4XA 1XZMA 2V7QD 3IB6A 3PZRA 1IY0A 1NVUQ 1HUQA 1XJ5A 5E0OA 4M0DA 1S8NA 3EY4A 2G82A 2V59A 2GVZC 4KAFA 4DV3B 3FPBA 5NLLA 2XGJA 3QX7A 2P1RA 4ZALA 2FQXA 3U2QA 4XSVA 3RGWS 1N6PA 4B35A 1GKLA 5JYBA 1R9NA 1SUBA 3HDGA 1N7IA 3BHNA 3V6LA 1AV6A 1YH3A 3AWDA 1Z25A 3ZX5A 2JLSA 2Y9MB 3ID6C 4G25A 1ICEA 1QH1B 1T5SA 3OCCA 2I87A 1IG0A 2D2XA 3RRZA 1JAZA 1TKRA 3I1YA 1AZTA 3HJUA 4KVGA 4M8NE 1FSGA 3SVTA 2JJYA 3X2FA 5JD5A 4RSGA 5I7UA 4BZZA 3ZXYA 2CD7A 3LBFA 6AT1A 1IONA 1JQDA 1OZGA 1YA4A 2W22A 3A0UA 3OIUA 3QVTA 5IH7A 1EDZA 4JEIA 4GEGA 1PTKA 3Q3VA 2JAWA 4JVNA 3W8RA 2DTEA 5BMVA 1OXUA 2WSYB 1ZC3A 2A9QA 3DAHA 3I0ZA 4F4IA 9MHTA 2R2GA 2PUHA 3GMDA 4LK3A 2BLLA 3PFWO 3WYAA 1OWLA 3ZWBA 2R00C 1LKZA 5BN4B 2BKXA 4C05A 4XWTA 2HF2A 2IL1A 3JQ6A 2R68A 2J3QA 1SUCA 2KLHA 2WVHA 2YX1A 4PPYA 2V0NA 1M8GA 2QUZA 3ELBA 5KQRA 3CUUA 1TF5A 3G9QA 3ONFA 2UZ3A 3V46A 1JEDA 2DTXA 4IP0A 4U1RA 3AUSA 1D1PA 1BGVA 1OLSB 3TIGA 1C3XA 4JLMA 5KHAA 2HHAA 2VNJA 4RYLA 1SXQA 1WUHS 3BREA 1U7XA 1HRDA 3WDLA 4E5PA 4OUDB 2FPRA 2X2PA 1N9ZA 2XT0A 2Z58A 4M9UA 2C5HA 3AF6A 4D80A 4RF3A 4JS0A 1WU7A 1KERA 3KFLA 3LS2A 2GI4A 2H00A 2R6ZA 3KE8A 3T7IA 5G4LA 1TVKB 4TZTA 5DN9A 2GRJA 5K4HA 2J4FA 4IICA 4PZ0A 1FL9A 4AZ0A 5LM3A 4P4GA 4LI0A 1FY2A 1UOEA 4WT7A 3F47A 4I99A 4ISBA 3V4LA 1M54A 1KSHA 1M10A 2ZETA 1U9IC 2C9CA 3SU8A 4AM8A 3TSZA 1WSDA 1C9KA 1CQXA 3QBVA 1TM7E 3OZIA 3M6UA 3AJRA 4HLCA 3FKJA 6ADHA 3CG4A 4CEIA 1CSEE 4YUZA 4V0SA 3P71T 1GSAA 4XIFA 1JQBA 1XVIA 1IBMB 3MJ4A 2GAAA 5FTMA 4C4TA 5BQ3A 2ZR0A 8LDHA 1Z38A 3LL4A 4HK4A 3ABZA 3FCXA 3JZFA 1A9XA 4QTXA 2J33A 4A6DA 4EATA 5AXBA 3A6KA 2C9DA 3NDPA 1PO7A 2O9JA 4P3PA 1T5TA 2XSZD 5HZHA 4HNVA 5K1ZA 3GZNA 2A1IA 2B36A 5ARBA 1CR6A 4JJAA 2I3ZA 1KYXA 1MW9X 2QW0X 3QLUA 4K86A 3S2EA 2FPPB 3P0FA 3OU6A 1Z0DA 1C9DB 2ZU0C 4INOA 1DKRA 1KPIA 3RRMA 3L3BA 3MMPA 3EULA 5G0TA 5B2FA 3K1YA 3E1GA 4HAXA 2P65A 2XD9A 4CCYB 1OJ7A 3IS3A 3ELWA 5HEKA 5JZBA 1X14A 4Z54A 3OEHA 2J8ZA 5IYZB 1T3ZA 2C2MA 1GZ4A 1D2CA 2JGAA 3GL9A 5FLXA 1SC1A 2HUNA 3COVA 1QK3A 3EGXB 3PC8A 2PX5A 1BXRB 4DWVA 4ZI7F 3UTCA 2DC1A 1IVNA 3C4VA 1BN7A 5LFAA 4K9OA 1EUQA 4QOGA 3ZEIA 5BV1A 2IPXA 3L79A 3KTDA 5ECYA 1WXIA 2GCOA 3HEBA 1F0NA 1DJPA 1MR3F 4AJ1A 3GFQA 4I55B 4BYGA 5AK6A 4KNYA 3PSHA 2NGRA 5KNCD 2OG2A 4BV9A 4GLLA 3L1UA 3I05A 2WWTA 2BTOA 2LDBA 4FI3C 4W5JA 3IUEA 2H6EA 5J23A 1VMAA 2ZSEA 3F8SA 3V3TA 3WHLA 4BN5A 1NVDA 1OBCA 1GUDA 1N5DA 2BDUA 2CKDA 4QU8A 4Z6KA 4M7RA 4BX2A 4URXR 2G07A 4M1TA 4CL2A 2D1FA 1V9LA 2YMLA 4HEA1 2A33A 5DMXA 1VKHA 4CVNA 5IKMA 1UPXA 2IHJA 4MVJG 5T64A 4C6HA 1QX4A 4FB4A 4YROA 4ENPA 2C83A 4K6CA 5LQRA 4DMHA 3QY9A 2B69A 1SFRA 1GWNA 1S0UA 3UT0A 3RS9A 2GM4A 5BV8A 1UEIA 5LXTF 4DY4A 3IP8A 5CDGA 5FDFA 1H65A 3EGEA 1VJCA 3MWYW 5ES4B 3DEFA 2DRIA 2QTWB 2R97A 4KQHA 5B2EA 3UAWA 1T6YA 4WNYA 3V33A 4EHDA 3OZEA 5KS2A 2PXAA 2DPMA 4MROA 3JS5A 2HIGA 1SOUA 4C0KA 3VKFA 3FLAA 3URMA 4AJNA 2CNLA 1DJLA 3TLAA 3ICEA 4DIUA 1VHLA 3TFOA 3D31A 4Q9DA 3THXB 4OQYA 3K72B 5JAIA 1X1RA 2F3UA 3L4BC 3R0IA 3USZA 4MGKR 2ZP1A 3ZIAD 4MTCA 4M1MA 3EMVA 3H2KA 3JARB 1G8MA 2LGJA 1UDXA 2RAPA 2A1TR 2Q1XA 4MI6A 4A27A 1TCAA 2IH2A 4EGFA 1XNHA 3ROTA 4A0RA 1IUOA 4JY7A 1RBMA 1U8EA 3PF9A 2YWGA 4ZVTA 3HG7A 2L18A 4IFEA 3NORA 4J7XA 1RBYA 2PZKA 2OXCA 2CEKA 4QBTA 2GYVA 3C7KA 4ZCTA 4FM9A 1N0UA 4ZYZA 3U4IA 2FOIA 3RVMA 4H1HA 4PIMA 2XCOA 3NV9A 4GVLA 1HH4A 4BNLA 1SGWA 2Z0MA 2X8LA 3D5EA 2AX3A 2Q7OE 4I7EA 3QLVA 1BDJA 4TKZA 1LBHA 4NKRA 5EZYF 1X7WA 4PX3A 3ZNNA 1BZYA 3Q2IA 3O5AA 5EMJA 4QGGA 4KITB 3LVBA 5JS1A 4L6IA 2BFEA 2XE6A 5A5EA 3WB9A 2RGYA 1SUWA 4HUQB 4C0WA 4D3XA 4NU8X 3KBOA 2IPLA 5ITZB 1M1XB 1NWHA 5DV9A 1EXVA 1WXDA 1SHJA 3WVNA 2WD7B 3A6JA 4MRSA 5FTWA 4BEVA 4EFLA 3O90A 4LOHA 4OCZA 5FAKA 1XQ9A 3FYHA 4P84A 3UJ7A 3V4VB 2QZ9A 3D5TA 3FVTA 3VO2A 2D0IA 5K8UA 5J47A 1KQGA 4HP8A 2A7XA 4G9EA 4DV5B 3HUFA 3ZDAA 3UOAB 2VQSA 2P6RA 3P4UA 4BNZA 5EPEA 2V3WA 2W5UA 4R9NA 5REQB 5JAMA 2I66A 621PA 1FRZA 4FKBA 3LLVA 3DA8A 2OXFA 3DKRA 2KSQA 4LF8B 1LNQA 1N1MA 3DR3A 1UF9A 2BI7A 3HMKA 2AF3C 1IIBA 2ATIA 4Q16A 4HB4A 1DARA 3D7MA 3INRA 2ZUVA 1Z16A 4W7IA 3MTEA 1E3IA 1XZPA 4KDFA 1YAHA 6LDHA 3V9AA 1AMNA 4LF7B 5J9FA 1V1MA 5TS3A 3T41A 4L3VA 4RO0A 1UJNA 2IXTA 2WIBA 5MDHA 1FFXB 4BO9A 1MJ5A 4QTZA 2B61A 3LIPA 1UJ4A 1WM1A 2IYWA 3NJ4A 1YB2A 1RW4A 2DOKA 4Z0TA 5A5FA 1JQKA 4KDEA 4GMFA 5AOVA 4BFTA 2O8CB 5GPBA 2H52A 5AW4A 2PZFA 2EATA 5LMZA 1ZLXA 2P0YA 3H5AA 3I6ZA 1FK8A 3QEMA 4HAOA 4Y2HA 1FDIA 3PFHA 4NONA 4AW9A 3VFDA 4TYMA 5JIBA 4R2KA 1KK1A 2G1AA 5P8WA 1RCUA 1UINA 4X3PA 5DU2A 2HTFA 3F5DA 3TLCA 3DL2A 2ETVA 4KXWA 4HNSA 4WV3A 3VNBA 2FWJA 5MGNA 1M0EA 4UFOA 4ZPXA 3RVSA 4A03A 2J59A 3EEBA 4F8EA 2GN6A 1G8HA 1N2BA 1CUYA 2OCLA 4FYHA 4EB3A 4F46A 3ZDRA 1RLJA 5CNKA 1R27A 2YMPA 4LGYA 3DOHA 3KQKA 4CR8A 2W70A 3WMRA 2VRCA 1MTZA 2O2EA 4E15A 3DMPA 3I12A 1GKUB 3H8SA 1H1LB 1UK8A 2OQ2A 4ZZ0A 4TROA 2NUPA 3H0KA 5DLYA 4AMGA 1DKMA 4ARAA 4WSOA 1JXQA 4BTVA 5L53A 3N2GB 4P5EA 4IUDS 4AXXA 2IEGA 1M1ZA 2X19A 4W5QA 1MH9A 2Q07A 3GRFA 3WJ1A 2UVPA 1I2CA 2XUQA 3PUVA 3LHSA 4KQEA 3BE4A 4ZD6A 1DV1A 3AILA 2PUJA 4MP3A 3IMEA 3P9RA 5E6UA 3S2GA 3DFFA 3KSUA 4E51A 3Q7IA 1YS4A 5DBEX 3LHFA 4EY4A 2IHVA 1PDVA 3N6RA 1AO0A 3VNVA 2WLTA 1M2KA 2Q5QA 5BNIA 2J4CA 2X0JA 1U9YA 3H05A 2CF6A 2AW3A 4UQPA 5KVVA 1KJNA 4UCXA 3AR6A 1S1MA 2F48A 5EKSA 4CV3A 3LRTA 2PMFA 2GCEA 2AJDA 3HKDA 3AOGA 3NBMA 4K9KA 4ZVRA 3U6KA 1X92A 3Q7PA 4BNYA 4EVIA 1M2OA 1XAIA 4NS4A 3UB2A 3IIIA 2QMEA 2WMYA 4QPJC 1IXSB 2EFDB 4BCCA 4D7AA 4ARUA 4H3SA 4IY1A 5A3SA 1H8ED 1K7EB 1JDTA 2NSYA 2OWEA 3WL5A 2QRVA 2RARA 3GRKA 3JQ8A 3PFFA 4FWIB 1SCUA 4P4UA 4Q4AB 4ZGBA 1KRWA 4FLMA 1YQDA 1U0OC 1XNRB 1QQ7A 5BYJA 2I91A 1FA9A 1XTIA 1N0IA 4I6GA 3PVCA 1OFUA 2WT4A 2XW6A 3O9VA 1S2OA 4NNOA 5LYJA 4ZYXA 2NSJA 3EZFA 3MTQA 4OAOA 4UVGA 4DCTA 5JH7A 3AXTA 4P4LA 4ZOCA 3QENA 4KHZA 2ZJAA 2ODTX 2QDXA 4J76A 3G0CA 3PV0A 4BO3A 2O2JA 1FTNA 2P1DA 3LP8A 4KXQA 1Y8AA 1N5IA 3DEYX 2X1LA 5BNZA 5FBVB 3AEQA 1EVLA 3ZU3A 5F3RA 1PFYA 3R5XA 4ZN6A 2QBYB 4JASB 1AURA 3K9QO 4KQKA 1D07A 3DMHA 3LC1O 2QPLA 2PY6A 4DJFC 1KZ9A 3PHLA 4AP9A 4BO5A 3IPCA 1ZWKA 5IF9A 1NJ5A 2IHUA 5B3KA 2V7VA 4I6EA 4C3VA 4KZKA 4R54A 3FYUC 4BQRA 1B14A 3A58B 2W2NA 3DW3X 1MO4A 1M7BA 2O3RA 5EJMA 1T9BA 1PBTA 1I5OA 3W3ZB 1KHTA 3ZN2A 3ORFA 3E3MA 3LQRA 3E27A 1XZ8A 3FH0A 2ODBA 2OY0A 4JC4A 4ZI3A 3AVXA 5JHGB 3OT1B 4HZUB 5GONA 3ZCXA 1A2QA 2Q8NA 3GFRA 3L7OA 3NT4A 3VO9A 2M32A 3ZH9B 4DSOA 4HLUC 2XB2A 1I7LA 3R3JA 4XQ0A 2NYVA 1SBNE 3RTBA 2ASEA 5JQGB 1VA5A 3TVTA 2WF7A 5KTMA 2V9CA 3O9ZA 2C4UA 1NW9B 3DCYA 2V1XA 1X8LA 1ZNYA 5DHQA 4DQKA 1MA3A 1T9CA 4HAWA 1ECGA 1E77A 5EY5B 3PNMA 2I4NA 1SY7A 2QAGC 3HDQA 3PUJA 6REQB 2AOTA 2R8PA 3OETA 1YI1A 3OOJA 1BFDA 2W2PA 1CERA 2BW0A 3GY0A 1FSFA 1O89A 2QLLA 1FPQA 2W90A 3HZOA 3IIKA 2B1GA 4HB3A 4YAEA 4Q1VA 2PH1A 2UYOA 1UM8A 4KFUA 3IBCA 3MQ2A 4WFIA 2Q27A 3EVAA 4BVKA 1SRRA 4NJOA 3FVWA 3T3DA 3BCUA 1LLQA 3MFQA 5KDOA 1TRKA 1P17A 2HF7A 3K9NA 5GJWC 2W2QA 2GCIA 3ZJ5A 1T5IA 4H08A 1FFWA 3V6MA 1V5FA 3FYTA 2R66A 1N36B 3AR7A 1HETA 2D0OB 2PGOA 4JVMA 4YCCA 1UJ6A 1KMCA 1QAMA 1SC6A 3OQ6A 4O4IB 4PQFA 3JYLA 4YI5A 5FPPA 1AQLA 1E5TA 4PHTA 5TEWA 1GYRA 2ZBFA 1MNAA 1YRAA 4B0PA 3OF5A 1JT2A 5AHOA 5F3WB 5DLPA 3OZBA 3PHHA 2QX9A 2VT7A 1SG9A 2OM6A 3PRYA 4IF4A 4IMPA 4RL6A 4O8CA 5CTAA 1E9VA 2VC2B 4P54A 2HMVA 2SHKA 2CHGA 3RIXA 4LRXA 3UV7A 3I1FA 1M2FA 1JMKC 5EKUA 3GJ4A 4Q4JB 2UYHA 2QN6A 2CMDA 1JUDA 3W5IA 1W96A 5L4NA 2A1UA 1MIHA 5K6AC 1Y5RA 2FFRA 1N2CB 2CDCA 2XQKA 3KWFA 1KI3A 1IK4A 3NHFA 3NBUA 5GY7A 4CLOA 5BY2A 4FZVA 1G4HA 1K68A 1VYHA 4BP9A 1KI2A 3NWOA 1XR3A 2ZB8A 1NP3A 3PUWA 1NMXA 4YMIA 3BL8A 4PWZA 4BJ3A 2I3BA 2FK8A 3EUFA 4LE1A 2V3VA 3CJTA 4TTQA 2X0DA 4RMHA 2EJTA 1DJNA 1ZD4A 1SBTA 3DCJA 3MJVA 4MQBA 4PO1A 2C54A 1JEJA 2GERA 3CX7A 2QE7A 4Q3EA 2PR7A 1XROA 1SNYA 1OLUA 1K63A 3JTMA 1G0OA 3NBFA 4TMKA 4WEQA 3NVMB 3SC3A 4NK4A 4ZZ2A 2EBUA 5CCBA 3G0BA 1NFRA 3C5CA 3PEEA 1QHNA 1EKXA 3DS8A 2DJ5A 2ZRGA 1JSLA 3D7LA 3NAZA 4KGVA 1ISJA 1LSJA 1CZUA 1JEOA 1TM2A 1E94E 4HH3C 4CHGA 4F85A 3ONEA 4LDRA 2IQIA 2VJPA 4QYIA 1AK1A 3THSA 1HDEA 5D01A 3IBSA 1SQSA 1PR0A 1AKNA 3DUFB 3WWPA 1VA4A 1Z0AA 2QLBA 1MF7A 3DNPA 1FU8A 3ISTA 4LHYA 4FQ8A 2Y3IA 3OKAA 3F9CA 5C8XA 4RZ3A 1YKGA 4XYBA 4L78A 1GG8A 3ICVA 4EG0A 3N58A 3FDJA 1D6NA 2AF4C 2HRDA 3W34A 2XXAA 1MQ9A 4PANA 1MCZA 2HMUA 4G1VA 4UUNA 3UFXA 5BN1A 3WXBA 2RFLA 3BTVA 3RARA 5IBQA 4OJNA 4QPPA 3IMGA 4F3TA 1Z68A 3S0JA 2DUNA 4X7PA 3CWZA 2O19A 4DMMA 4KNWA 2AV6A 3GUUA 2BFFA 4QATA 1EGQA 2P0AA 2QP4A 5EWJB 5LU9A 1RS0A 2Y1WA 3W90A 2X7HA 7REQB 2IIPA 1HLDA 5LB4A 4PCLA 4X1YA 2GSWA 2C92A 1DMSA 2FMKA 2P3OA 1CRQA 3A6GA 3GRCA 5KUTA 1GG5A 5DULA 4ES6A 5COQA 5G40A 4IGKA 5I7EA 1O9BA 4YAFA 3ZE8A 4PZAA 3RC1A 4YAOA 4HDKA 1Z36A 3U5TA 4UTOA 4AJPA 4NYJQ 1SC4A 4O4JF 2BE7A 4U7DA 2DECA 2X2FA 3CLUC 2VHYA 3ENVA 3HKCB 4RKQA 3IHWA 2DZDA 1DWPA 3Q7SA 4B79A 3BCHA 2R7KA 1QLHA 1CRWG 4KQ6A 1AS2A 4BCDA 1MX3A 3ORHA 5AUNB 2EBWA 3MOIA 4JAVC 4PCVA 3HXOA 2PD3A 5L3QB 1YT5A 3AETB 4K9NA 1TK3A 1G0NA 1NY5A 2X8BA 3GRUA 4X61A 4URFA 3J7AC 3BA6A 2WJ3A 4FNOA 4JMLA 5BYKA 2YW9A 4X92A 2BKLA 3VTZA 1JJVA 1Q22A 2ZYHA 3DLBA 3EVCA 2UUBB 3ACCA 1ZHFA 3T52A 4BXOA 3LNCA 2XNSA 5JROA 5E4JA 1NUSA 5TQ2A 4EZEA 4NARA 4AD8A 3RSGA 4LK2A 1FX0B 3TH5A 1W25A 4U7HA 5IUNC 1JG1A 3RTCA 5GZ6A 4O3MA 3G49A 3HCCA 1KU6A 4HTFA 1N1DA 5EUBA 1I36A 4HDSA 2CJYA 4DSUA 5LJIA 2R6CA 5KKNB 5EIBD 2C1EA 1E5XA 3I6BA 1I1NA 2HA6A 1U8XX 2UKDA 3QFCA 5JAQA 1Q7GA 2HT1A 4DLNA 4FLEA 2P2LA 3OPVA 4UBOA 4RF2A 1T4GA</