1Z7YA

Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVADRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cysteine synthase
publication title Molecular Basis of Cysteine Biosynthesis in Plants: STRUCTURAL AND FUNCTIONAL ANALYSIS OF O-ACETYLSERINE SULFHYDRYLASE FROM ARABIDOPSIS THALIANA.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 108
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7yA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7yA02
4D8UA 1K7FB 1QOPB 5BW6B 3T4PA 4NEGA 2GN0A 5D84A 4HPXB 5J43A 5C3UA 4HPJB 4L28A 4D8TA 2TYSB 4KKXB 2O2JA 5DW3A 1V71A 1UIMA 1KFCB 2RKBA 3ZEIA 4AECA 2TRSB 1PWEA 4LMAA 1Z7YA 1Z7WA 3DWGA 1KFKB 1WKVA 1WTCA 1C9DB 1C8VB 1Y7LA 3SS7X 3VBEA 2GN1A 1BKSB 5B36A 1QOQB 5DVZA 1TYZA 3VSDA 5T6MA 1J0DA 2RHGB 2EFYA 1KFBB 1P5JA 3PC4A 1K8XB 3AEYA 4Y6GB 1TDJA 5CVCA 5D85A 3PR2B 2J9ZB 4JBLA 3DWIA 1K8ZB 2CLEB 4ZU6X 3CEPB 2CLOB 1UBSB 5J5VA 2WSYB 2DH5A 4NU8X 2CLFB 4QYSA 1TZMA 2C2BA 1OASA 3HMKA 4D8WA 4D9KA 4ZU1X 3BM5A 1KFEB 3VSCA 1V7CA 5B3AA 1KFJB 1WDWB 3FGPA 2Q3BA 2ZPUA 1TZKA 4D96A 4D9NA 5I7WA 5JISA 4ZQCB 1JBQA 1K8YB 1VB3A 2J9YB 4H27A 5B1IA 4LI3X 4D9MA 5I7AA 1FUYB 2J9XB 5D87A 5DBHX 1VE5A 1PWHA 2CLMB 5CGQB 2ECOA 4HT3B 1J0AA 1V8ZA 2DH6A 2TSYB 4HO1X 1TTPB 2BHTA 1X1QA 2BHSA 3DKIA 5DBEX 3V7NA 2Q3CA 2EGUA 3SPXA 5JJCA 2CLKB 3IAUA 2O2EA 3RR2A 1A5AB 4OREX 1CX9B 2V03A 5B53A 3X43A 4D92A 2CLLB 5IWCA 1K7EB 2CLHB 3VSAA 1J0EA 1BEUB 3L6BA 4HN4B 5KINB 2GN2A 1F2DA 1J0BA 4WX2B 5I7RA 1A5SB 2RH9B 1VE1A 4XUGB 3VC3A 3PC2A 3SS9X 4IL5A 4COOA 3TBHA 4D9BA 4D9FA 1K7XB 3FCAA 1CW2B 3AEXA 4L3VA 4JBNA 1A50B 1TTQB 4I1YA 5EY5B 5B1HA 1WBJB 5E0KB 4D9IA 1A5BB 2ECQA 2PQMA 3PC3A 3IQGX 1KL7A 3IQIX 1O58A 2ZR8A 3L6CA 5B55A 5I7OA 1UINA 2ZSJA 1C29B 4OFXA 3R0ZA 1TZJA 4D97A 1TZ2A 2D1FA 1D6SA 4D9EA 2CLIB 1J0CA 2C2GA 1K3UB 3X44A 5I6DA 2Q3DA 4PCUA 1FCJA 3IQHX 3R0XA 5D86A 3L6RA 5HBGA 4F4FA 4D9CA 1TJPB 5DW0A 1E5XA 5IW8A 1RQXA 4D9GA 5IXJA 5KZMB 4D99A 4L0DA 2ISQA 1M54A 2JC3A 4LMBA 4AIRA 5I7HA 4L27A
chains in the Genus database with same CATH superfamily
2W6OA 2ARKA 2BAGA 4O8CA 1P77A 1QRSA 3NAMA 5TC4A 1DXOA 3BREA 3UB4A 1IN6A 3VRHA 1L4YA 4EUFA 1GUBA 1K9SA 2Q0QA 2XH8A 4OV6B 4S2UA 5DW3A 4MR9A 4C20A 4CLHA 4DV7B 2JD1A 3P9KA 3VPGA 4JQOA 2JH3A 3TO5A 2EQ5A 4XAQA 2GTIA 1XZ8A 4KPUB 1QK5A 2Z5GA 3KFVA 5E7MA 4YIHA 3BGWA 2ZYVX 4BO6A 1N2BA 5B58T 4UQPA 1Y7LA 1WOMA 3ESCA 1TNDA 4QAQA 4D3YA 5AW5A 2PU5A 1RJEA 2ZYRA 4OJMX 2G5CA 4R3UC 3L1KA 5A0TA 1L6RA 1YJQA 1O6CA 2QIOA 2UYYA 4MVJP 2E55A 5ALZA 5A3VA 3TR5A 5MGNA 3P96A 4RPCA 2IDJA 5INTA 1QFJA 2YXEA 3N2EA 1ZC4A 4ND4A 1HDXA 3OE5A 5KWVA 2GWHA 3BFKA 1KEVA 2H9IA 4YT4A 1A8QA 3A6ZA 5DCUA 3SQWA 2CXHA 1KZ1A 3C70A 4B76A 2CLFB 2V59A 1PZEA 1BE1A 4AYXA 5BMOA 4BKPA 4IJ5A 2C29D 3DT9A 1R7RA 5FTNA 4BEVA 1I7SB 1XEXB 1SXPA 1RAIA 3GNQA 1HYEA 2C2WA 3F6PA 4G4IA 1PD0A 4PO1A 3SY8A 4BKMA 1JV2B 1XELA 2DG2A 4N7MA 5J2UB 5I7WA 3EQ8A 4KE6A 4PX5A 3FNBA 2P3QA 3PUZA 1YMQA 3ZDCA 3LP5A 4NX2A 4BVBA 2W2OA 4W7HA 5JATA 3RODA 3RTBA 4DXAA 4JYCA 4TT3D 2NU6A 3K6KA 4K81B 1A77A 1CUCA 1VL6A 2R44A 1LDMA 5EJ2A 2A5YB 1E2HA 3SN6A 4AUMA 2AN4A 4K8RB 4LBZA 4OLAA 4GC5A 4CQMA 4MS4B 1X19A 2AJTA 1T6ZA 3LUPA 4FZJA 4YPOA 3DUWA 4QEZA 3BCUA 4MCAA 3FFXA 3N86A 3PQCA 3Q4GA 5AIAA 3D1VA 4B3DA 1H4QA 1J0BA 2D8MA 3ROEA 2ZUEA 2HIMA 3ZJ5A 3FF1A 3W7VA 1IN8A 2IELA 2WJGA 3MWEA 1ZAYA 4C03A 2WG1A 1ACMA 4EJSC 5B30A 1KVQA 1TZBA 4U2FA 5E6SA 4Q4JA 3VR5H 1PGQA 2OHXA 1WBJB 1V3VA 3SQXA 3SBEA 4ID3A 3S5JA 1Z5PA 3T06B 2CZCA 2ZR8A 3ADKA 2HX1A 5GV8A 5DGDA 4D9JA 5IX8A 2JJMA 3R8FA 4LVCA 4OQXA 5DP1A 2NZYA 2PS9A 1D6SA 5EIBC 5ER6A 4YRNA 3JTMA 1Q5PA 4ESEA 1CRZA 1MEJA 2PUTA 4BYGA 2V98A 4PLHA 1GPWB 5J40A 1GCGA 2R7MA 4KVGA 3TW8B 4QUAA 5HRAA 2PGXA 2FWJA 1YCFA 2MYNA 2CL7X 2RC5A 3H75A 3VX3A 2X7JA 3HYSA 2MOKA 2OFOA 3BA1A 1I2MA 3U4AA 4YYEA 4L0DA 3PEUA 1LC3A 1NDUA 2X0KA 3N8KA 5EYPB 4JFAA 2MYUA 2Y71A 3EVCA 4L27A 4MLPA 1R15A 4XCXA 5EEHA 4EMUA 4UW9A 1XL1A 2Q6VA 3AKYA 1T25A 4HRAA 5JJ5A 1VIVA 1JDNA 4RWEA 2Z98A 1L4UA 4PIVA 2Y67A 4Q7QA 4YN3A 3GAFA 1GAEO 1QH0A 4KTTE 4P6VF 1PJ8A 4YRZA 2CHGA 4I4IA 1Z45A 1V96A 2H1RA 2HWYA 5L45A 1PZFA 1JILA 1KI1A 3CZMA 1QMGA 4JXKA 1C8VB 1ZIOA 1NURA 1IUNA 2ZDHA 1FFWA 2PNFA 2R1VA 3OJFA 2O8EA 3VDRA 1TYAE 2X77A 3FMGA 2ZRBA 3AFMA 4ZQEA 2W58A 4CLRB 4BO1A 4DPLA 1P5HA 3O94A 2H63A 4MQEA 4NK4A 1T4CB 3LY9A 1NR1A 2HDOA 1E2BA 3VU3A 5A0FA 1Q57A 1TMGE 2H11A 3G2HA 4MS1B 1M6EX 1MB0A 1UIRA 1YRHA 3T3IA 4BN0A 1KWKA 4PRZA 3RS3A 1FIUA 3L7JA 2VRNA 1UC8A 1A04A 4KSCA 2CW5A 1R6VA 2VRBA 1EWYA 1K86A 2QT1A 2X8WA 4JY7A 1BGXT 4RABA 5DJ5A 4ZKEA 1GQSA 3T3GA 5EIFA 1MC8A 4NL4H 2Q2VA 4OI1A 3UK1A 1BNCA 3E9EA 5DEOA 1AQ6A 4B7XA 2J9RA 4TMWA 4ETWA 4JGIA 2BCGY 2CJWB 3U3DA 1HNWB 1RYMA 4YAFA 5CNMA 2ECKA 4E03A 3BCHA 1WB9A 3ABRB 2I6GA 4DUGA 3U5TA 4HVAA 3ED1A 2FX2A 2AZTA 3PQ2A 3NBQA 2BELA 1T9DA 1HGXA 1DRUA 4Q4DA 4WJKB 1ECBA 2A4KA 3LUCA 1E2LA 1KAMA 3FNRA 4OJYA 3V7FA 1GFIA 2CSUA 3A25A 2JVKA 1XROA 5DZSA 3VFDA 4CM6A 2CN1A 3RSQA 3MGCA 1VSUA 2D00A 1HA3A 1HG1A 1AUXA 3O8OA 3DZHA 5ARCA 1VJ1A 3ET5A 5ALOA 4ZCLA 2C3MA 4B34A 1Z2EA 5BXQC 5IWCA 2ZRGA 1CY2A 2HADA 4P33A 2VSQA 1QFSA 3H11A 4PW0A 4C4RA 3S2UA 1CRQA 4HN4B 3QNUA 4ZDJA 2ZXUA 4O4JB 3ZXUB 5HQ3A 2OQRA 5EJEA 3QG1A 1NP6A 4JKOA 1O94D 5DSXA 1FMTA 3F5SA 4D43A 4D7AA 3GGGA 2OHJA 1G2QA 4F86A 2CV0A 2E7ZA 3VAYA 1QCCA 1P9WA 1HZZC 2ZAOA 3G0CA 1PV1A 1UBEA 4M0DA 4ROSA 3KEQA 1U7TA 3GUHA 1NY6A 1X3SA 4JNCA 5DTJA 3INTA 3RNLA 5B6JA 4LFBB 3IAHA 5H82A 1ZSNA 3E1SA 1D0SA 3OD5A 3ID6C 5DTRA 3UA3A 3ZNPA 2Q1WA 3KUUA 1XEWY 4TZTA 3EULA 5JJBA 1ZG3A 4Q15A 2ZJOA 2YHBA 2I7XA 3UMSA 3NQ41 3W90A 4Y18A 1EFDN 4LNUA 4FJ2A 1JG6A 4RCYA 3WDMA 4EB0A 2XW6A 5DMXA 2J3IA 2ODAA 3UGKA 3KTOA 1RADA 4L85A 4DAEA 4MW5A 3N2LA 1NBMA 3H5LA 4KITB 3S6JA 3CW8X 4X1YB 4ZPXA 2QZPA 2YQZA 3DLCA 1KXZA 5DSZA 2V0NA 4RJJA 2FWIA 4YP1A 5FR2A 1AXRA 5BN3B 3AZOA 3R9KA 1EA7A 1U1CA 3BICA 4RKWA 2WTNA 2V7WA 3WXMA 3EJ6A 3Q5DA 5C3MA 4FE7A 4BQSA 5IK2D 3HMQA 2NZWA 3DHNA 4H77A 2PYIA 4MUMA 4B84A 4ZHQB 1GDTA 3C14C 3HA2A 2C7QA 1ZD4A 1H6AA 1ZK0A 3LUFA 3TTXA 4TLMB 1Y6QA 2NP6A 1N6RA 2AWNA 2YWDA 3IALA 4I99A 4M6WB 4FX2A 3F9CA 2P9JA 1DBVO 5BMVB 4DJEC 2I2CA 3AXSA 2GKOA 4M0CA 1SPXA 4OJNA 1NBWB 1XE3A 4OOFA 1MW8X 3AR9A 1M0WA 1XVVA 2PKYX 4KZKA 1YK1A 1OZFA 2ZRQA 4JEUA 1HYQA 5J2TB 4BNTA 4K6HA 5BWCA 4DCTA 5B57C 1U2EA 3SZMA 3OZFA 2ZUBA 2N9UA 3KEGA 3LIPA 4G5XA 4X66B 3KSAC 2D3WA 3C4VA 4FYVA 4TN1A 1KDPA 1ZIXA 4WOJA 3JQ7A 4CJXA 2I91A 3QEOA 3BHNA 3DFFA 1NDQA 1WCYA 1G5IA 2WFLA 3OZDA 4HQ0A 4O8ZA 4WLVA 3UANA 3KYDA 1EXDA 4BXOA 5LUBA 3U81A 3JYNA 1LF5A 3PDHA 2VRWA 3B3GA 4TUYB 2Q6KA 2V7XA 2R48A 2VUIB 3RUFA 2LUOA 3RGGA 1INLA 2RAUA 5FFNA 3SHWA 6PFKA 1E63A 3RUHA 1E0DA 3KU1A 1OTXA 4OBWA 2CLDX 1WE2A 2LVBA 4AF6A 3G8DA 4KVFA 3AP2A 4UOQA 4E7OA 2YV5A 1Y8QB 1OLSB 2DE0X 1WL8A 1UDAA 4CIBA 2VJLA 2B5OA 2ZYHA 2NTNA 4JB0A 3HSSA 4RELA 4BJ5A 4I3HA 2NW6A 2VHTA 1BIFA 1PCXA 2KLHA 3GDFA 4RANA 2O2IA 3TE7A 1NFRA 4DJ5X 3B3QA 4JLWA 4J94A 3X3HA 5FYDA 2O1EA 3KTFA 4HF7A 3L1HA 1E5DA 1FYEA 2H2AA 4LXIA 5IAOA 3A4VA 3LV8A 1V11A 2VHXA 1T2NA 3MMPA 3LL4A 4WXMA 3ZOZA 3OQVA 3V2HA 2C3PA 1B2RA 2H17A 3FPFA 4B0PA 2HHJA 2IEBA 4I8XA 2G6TA 3FYHA 1XZEA 1N3IA 3MMNA 4YJFA 1VKZA 1Y7TA 4X9XA 4YUZA 8ATCA 4DR1B 1SVUA 1AUOA 4UC0A 4MV8A 3THWB 3F71A 5IVKA 1KSJA 5L3SA 3UCEA 1XEWX 3Q8XB 1DG1G 1JHRA 3AF0A 1NAIA 1SXHA 3UAWA 4EO9A 1VL1A 3EEBA 5HUHA 2EEZA 3PQEA 2PZEA 2G1AA 2ECQA 4M9CA 2Z08A 4URVR 3P9ZA 2YW9A 4I14A 5LDHA 3PDUA 3DR5A 3FMFA 3Q3GE 4QBHA 4MLCA 3GDGA 1G6HA 6GPBA 1UUFA 2BWJA 4UD6A 1J0CA 4XW2A 4JLMA 4FGKA 3CVOA 4MRPA 1DDIA 2ZUTA 2GZHA 1UKCA 2FMKA 2JKYA 2VH1A 3ZVNA 4JEHA 2E82A 2OOSA 2R751 3AJRA 3I4LA 5KNCD 1FFSA 3EARA 2ORED 4ILKA 3MGKA 1XHLA 4M1MA 3VR4D 2WHEA 1L0BA 1DIHA 1RRFA 3IHKA 3KJQA 3LHIA 2ODQA 4YJHB 3QE9Y 1EE9A 4WKOA 3CO0S 4QPDA 1VHLA 5F21A 5KJ6A 3HYTA 4IVPA 3AWDA 5C8DA 2IU0A 3GGJA 1XMSA 3V4PB 3U3XA 1UT8A 4HPJB 4CLOB 4CCWA 4WECA 3FTNA 2VDMB 1XYGA 1U3DA 1R5OA 3MJEA 4PRYA 1A2OA 3NFYA 3E8XA 4D0SA 4IYJA 2WUVA 4WSOA 3P94A 1XU9A 2AFIA 5B2ZA 3RE1A 2NO6A 5AIBA 2FW6A 3R5XA 3FLAA 2PSFA 4HDRB 2XKJE 4OK3A 4TZKA 5COBA 3LOPA 2HA4A 2QTMA 1V3UA 4Y1RA 5B7NA 4AQDA 4JC0A 3QI7A 1TYZA 2PRJA 4OX9B 1L1FA 4A0QA 3AMVA 2J4FA 5EUMA 1B73A 3PK0A 2EBHX 4REQA 4UEQA 5DB4A 1XHFA 1ZVQA 3GX1A 3Q6IA 5EIOA 4MQFA 4ZVPA 2ONCA 3RVMA 3S70A 5JD4A 3GMSA 3LS2A 4RD3A 3RV4A 2R68A 1XKLA 2UZ1B 3CG0A 3I52A 1R6UA 1W36D 4ZU1X 1NJ2A 3SJZA 5T3UA 2NUBA 1U2DA 2EFEB 4EF6A 4XIIA 5LCXA 4DT1B 4K7JA 5B3AA 2QLTA 5AKZA 4FEAA 4NU6A 1WZUA 3OSUA 3ZDZB 1W93A 3WL8A 2D1TA 4BO0A 3OTHA 1F0PA 4DEXA 4RSHA 4NR0A 3CVJA 3LRTA 4INJA 4UCQA 2Z5FA 3BDIA 2ZETA 4FQ5A 1VLQA 4KDFA 1U7PA 5E4TA 3RFTA 3OO1A 2HA5A 3KZMA 3IAXA 3KZVA 2OCAA 1GKIA 2VBGA 1VLHA 4KUGA 4PHTA 1XRPA 3U5ZB 2FHPA 1U9IC 1HE5A 3EFBA 3EVDA 5LPNA 3NASA 3SIPA 4NFYA 1NUQA 1HG0A 1G4AE 1TFUA 1FY2A 5G4KA 4HKTA 4CM8A 1ZMBA 1R5JA 2FN9A 1O57A 2J5KA 4FEEA 4OAQA 4QTYA 4HH4A 4RF2A 2LBPA 4WUVA 4L6IA 1BWRA 4E3WA 1PWZA 2D1YA 3IQFA 4TLEA 3STWA 2N75A 4ZZ1A 3EE6A 2ZYDA 1BE6A 2O52A 3PTZA 5HFAA 1ZX1A 4N47A 3C74A 4MA0A 3BAZA 4LTNA 4Z1MD 3QGMA 4XWTA 1QFMA 4NBTA 5DISB 3WZLA 2HRQA 4R41A 2YZNA 2PT9A 4B2PA 3RRXA 3MMXA 4LMPA 4IJMA 4FSDA 2HLNA 2VQDA 13PKA 3O4GA 3VR6A 4C0BA 1U4SA 1XQVA 1LK0A 1E94E 1I10A 1GKUB 1NKSA 3DL2A 4MWSA 3AF3A 4UASA 2YMQA 1CZUA 4FX5A 3CW2A 5B55A 3UK6A 4BEJA 4MYDA 5AKLA 5J1TB 1HFWA 2YHAA 1TF5A 1P8AA 2Q6IA 4MJ3A 4LYAA 1SHJA 5LZ9A 3W5SA 3ND9A 1LBHA 1NW4A 3I6IA 4PLZA 5J59A 1L8LA 3ANLA 4QICA 3BRWD 4ZVLA 3UY4A 1LDGA 1F8YA 1S9DA 3W34A 3PI7A 4RU1A 1E2UA 3AR6A 5EWMA 3MUFA 3ZE8A 1IL0A 5KZMB 1M54A 4HRYA 5JR3A 3AVYA 4IDAA 4EUKA 4HTFB 2W4IA 3LWDA 1KI3A 4S1NA 3V2GA 1NFQA 2WJWA 2PVCA 3EG9B 2FSPA 1PJBA 1K2VN 1CFJA 1E2MA 2HHCA 3G9TA 5NLLA 1JXQA 3K70C 1SGWA 3D81A 5REQB 3FLMA 4UCWA 3DMGA 5GVSA 1WAMA 2GK4A 4OB8A 4TQGA 4AVYA 7GPBA 4ZYLA 1GGJA 5IS2A 2AW3A 1Q0LA 4OHUA 3AINA 1AKMA 4E0BA 2O9JA 4LF9B 2ACKA 1JAIA 2WV9A 3ORQA 4HBZA 5LZ8A 5SV2A 1QKKA 2BR3A 2HCJB 1L7MA 1OI7A 1KJQA 2GN1A 2VHVA 1E5TA 2VDWA 2BKUA 2QQFA 4ADSG 4P0QB 1VG0B 1ZY2A 2VF7A 4Q47A 2PIDA 2FMUA 1T9HA 2CV2A 1WXEA 4FYPA 2PGJA 4G07A 4LAFA 2PWBA 4AS3A 4CLDA 5DCLA 1FMCA 2O2GA 4LHVA 1Z73A 4UVGA 1F48A 2TS1A 1D9XA 2CCJA 3WFZA 2CEAA 3CEPB 1I0IA 4F4UA 2PKQO 1U9ZA 3ZD7A 1OASA 2QIPA 1K0UA 2WSLA 3PUIA 4L51A 1XMOB 5LXTF 3D8NA 3BOSA 2FKNA 1CWUA 3U4MA 2WU1A 4CV2A 4ZCTA 3K0HA 2WYVA 4V3CA 1HBJA 1P2SA 2FX5A 2LCIA 3F97A 4KFCA 2DERA 3AP3A 4EAQA 3SM3A 4AP9A 4MR7A 3TRFA 3HKDB 1ZVKA 3QYJA 5ICEA 2EDAA 3J7AC 4LMRA 5FUVA 3SDBA 721PA 4QJIA 3IPLA 1QGUA 2QX9A 3DDSA 1WQ4A 2X1VA 3QOWA 4R6XA 1AMOA 3Q0TA 4BV3A 1VL0A 1JE1A 2CLSA 5CA0F 4BJ6A 4BNWA 4A92A 4XKJA 3PSAA 4ENQA 2EBFX 1H2AS 4EPTA 2I8AA 3ORSA 5ED0A 3WMWA 2ZFUA 2Q3FA 3EAQA 3LHFA 3THYA 3WWEA 4IJUA 3THWA 4LCEA 1CY1A 3L0DA 3U4QA 3WLLA 3SZUA 3ZE0B 3MT9A 1J0EA 3WV4A 3DV0B 1XZIA 1Z2PX 2R6FA 4TTSA 3PGKA 3QH4A 3V9PA 4H3KB 4QKQA 2J0SA 1RZVA 4OP2A 1A7KA 1RBZA 5LJIA 4E2ZA 4BVEA 4G0OA 4Z3DA 1S89A 4DCNA 2FKAA 4GFDA 2VQ6A 4WVLA 3PYXA 4B32A 5FB3A 1EZZA 2AX4A 2FMHA 2HLDD 3ZDBA 2O4CA 1MC5A 2Z58A 2IYZA 5BNFA 1AO3A 1YS6A 2W2KB 5FLXA 3ZZ0A 1MJ5A 5MGBA 4DR2B 5EJ4A 1OI3A 3FDJA 5SZIA 5K0ZA 2OUIA 2EJBA 4UUPA 4KX3A 5K3OA 1A9ZA 1B76A 1P0QA 1PQ4A 1XN4A 2Q4TA 2WAOA 4J1TA 3P2YA 5JZSA 2J9FB 2DT5A 1S2MA 4GLLA 5DTQA 1J5EB 1VYVA 5A0VA 1DTEA 2NADA 3EDCA 2XMPA 3JVVA 1IHOA 1V0JA 1WDMA 1PR9A 3TMYA 2P2YA 3AJEA 2YWBA 3EQZA 1VTKA 3ZN2A 1KI6B 1NNLA 1WMFA 2OHVA 2XNHA 2EJVA 1F12A 4LY9A 1TPZA 1P4JA 2BFDA 2EFGA 4MUNA 1P6UA 3EEIA 3KC2A 4GD3Q 4J3JA 3ELBA 4X94A 1ZMXA 4DLYA 2J3DA 5LNK1 1K0FA 1N7IA 1IZ0A 1Y9AA 2G40A 2PQ0A 3C85A 1UOEA 3IUMA 4FFMA 1XNGA 4RIFA 2YJNA 2AL7A 2JBAA 3CKLA 1NOIA 3CWQA 4PC2A 4X24A 1RI3A 2H00A 4BMSA 2HH9A 3GZTB 4YFVA 5HWSA 2IYNA 4N3GA 2P11A 3RJZA 1C0LA 2AOTB 2W2LA 3H2SA 3QOXA 4L5JA 2IUEA 5FWYB 1RABA 3WRXA 4NCJA 1Y1SA 4UEKA 4QSMA 5HKOA 3HJHA 4AWBA 1YFLA 5EPUA 5TPZA 5F9MA 3HYNA 4S3MA 3ZHYA 1X92A 4AG3A 3GLFE 4TT8A 2ZBGA 4BDSA 1G63A 3B3AA 2O2SA 3BKXA 1A76A 1ACJA 2FG7C 2HDNB 4I50A 4K9MA 1KNXA 5JOQA 2VZ8A 2C92A 4U2GA 4DMFA 2Q7DA 1DB3A 1JI0A 1P5JA 3GT3A 2JLWA 4OO3A 5FWAA 3QVUA 1X94A 4UEOA 4B7UA 3NOQA 1EB9A 4IIJB 4R1OA 3ZIUA 4C14A 1KAOA 1BA3A 4L16A 3EPJA 4QDOA 3GEBA 4ARVA 1RAHA 1FE8A 2PZFA 2YHUA 4GNKA 5DM70 1F06A 3L0CA 2P4EA 2G0AA 4KQCA 4X1KB 4EPYA 2QV0A 2WOOA 5EIWA 4OQNA 2I76A 5JNUA 2C20A 2QBYB 3RTDA 3ADDA 1KERA 4MI6A 4H27A 4ZI7F 1GGMA 1QIIA 1M10A 2C03A 1Z06A 4GBJA 1GFZA 4WQMA 1Y1KE 5KDDA 3HU5A 2R6JA 3LE8A 1DQPA 1Q3HA 1I9CA 3AERB 3SC4A 3T4XA 4UAVA 4EL5A 5KWJA 4BQFA 3QSGA 4UNSA 4UBLA 4JI6B 2X5KO 4BO4A 3ADBA 4CKEB 2IYFA 3ELUA 5KBYA 4ZJUA 1ZW1A 1G4UR 3ELDA 3GJYA 3L7KA 3SJUA 1R12A 1JWLA 1RLTA 4WCVA 3K2BA 1NVVR 1F7UA 3CW9A 1RLMA 4G4SP 5CYFA 1HFJA 2DGDA 1CJVC 4V0LA 3WZ2A 1EAMA 1B0UA 2J67A 1DMSA 3FR7A 1Y6GA 3WRWA 2G08A 3QXHA 1BA2A 5JRZA 3ICOA 4G0PA 2ZJYA 4E12A 5TJHA 1RWKA 4I4NA 4O63O 4TKVA 2PH1A 4F5ZA 2I33A 3BFJA 1LWNA 4QJ4A 5L6LB 4JB8A 4GPEA 2FOIA 5ADWA 4UUQA 4JX8A 4ZC8A 2FPLA 1F1BA 2IHJA 3CUVA 4G1CA 4LCBA 3RU2A 1C2TA 1Z07A 3WADA 1PL8A 4IUYA 4M1QA 1Z0ZA 5EWLB 4C1BA 1L7BA 1U1EA 2HK7A 2Q0HA 5HQJA 3FROA 2JD2A 4L50A 1XAGA 2RJOA 1P9NA 4P9NA 4TRRA 1CK4A 2JIBA 4WK0B 5KTMA 1NSTA 2NX2A 2ZSJA 5P21A 1OXVA 3GARA 3REFA 3CH4B 1ZYUA 3QEMA 1VE7A 3K72B 2MMGA 2OXTA 4DMGA 3NBUA 4FMCB 5JQGF 1E7WA 2X8AA 2OV4A 3LBYA 3D43A 5B1EA 4UBNA 2DY1A 4XTCS 2J6CA 1QCYA 3FIUA 4UHCA 4BRUA 3QJYA 2XOXA 2BFFB 2B4QA 1NVEA 5U4XA 4BQQA 1P81A 4Z4IA 1KHHA 1P5FA 4EX7A 5BR4A 1L7VC 4IHJA 4CT4B 1KBOA 1WDTA 1O96B 2V7PA 4YONB 2UYQA 1Q0HA 5BN4B 5K99A 2GESA 1EUDA 1U0FA 4ESHA 4XUCA 5FF9A 1BHQ1 2FPWA 2XRFA 2XUPA 3LSTA 4WVFA 3TRDA 3SC6A 4JGBA 3H1BA 3OJEA 4NYIQ 3CWZA 2G4LA 1DFGA 4CIXA 4ARSA 2DF8A 2UAGA 5WRFA 1VFNA 1E1RA 3R3JA 1NYLA 4DBLE 3Q8MA 2AUTA 1UMCA 3MTQA 4LMAA 1B26A 4P7KA 3DF7A 3G9XA 1N2HA 1Q7BA 2HF8A 3K35A 4I4TF 4GM1A 4X7MA 3V34A 2ZJ1A 5ALIA 4P36A 4YXWD 1AK2A 1AF4A 2A9KA 2H1HA 4Q7EA 3KQNA 1WM1A 5JBQA 3G3EA 1PKEA 4LGMA 4JUBA 3SLGA 1BXGA 3ZCXA 4CDGA 5LDDC 3SBDA 2GK7A 3U3ZA 1QP4A 4Q3BA 1DXYA 5HF6A 5BYAA 5TQJA 5JSQA 3I92A 4DILA 4IP0A 5JCZA 1FFDA 4XTRA 1YC2A 1RXCA 2GF9A 4WFQA 1LH0A 5BURA 4US2R 1TUBB 1M9NA 4RZXA 5CURA 4ZRDA 4CCYA 4E70A 4HVCA 2F1OA 1IHDA 5JWRA 1A82A 1WSWA 3IV7A 2XWBF 3LDFA 3KKMA 4B6SA 4DWWA 5JEEA 2D7DA 3KVVA 4NXNB 2WTEA 4YWHA 1SBNE 4E15A 1B6GA 1TF7A 2DR3A 3LFUA 5AVVA 3SJ7A 1A88A 2PRZA 4DDKA 1U9CA 4OHYA 3OPMA 2OCIA 4FS8A 2N46A 4JJ6A 4XFKA 3LL7A 3AFOA 5D5HA 1P61B 4M1ZA 3LUJA 3IIMA 3EXHA 3JAKA 4BWVA 3C5WP 1NLMA 3PJEA 1ZWLA 1QZ3A 3MTDA 2GJAA 1F2UB 5KVSA 3DLPX 5ALLA 1PLLA 1DUSA 2BLLA 2ECOA 1Y1QA 2CSXA 1DFHA 3B1YA 3K0FA 5DGTA 3IKJA 3RJMA 1M2JA 2GCOB 4PV7A 5LSAA 1XWWA 1ODJA 3NH9A 4BO8A 4IS3A 1JYSA 1U2RA 1SCAA 2VA9A 5UKDA 2Z09A 1F60A 4MUBA 3UTCA 1TKRA 2XGMA 3ZY2A 4BNZA 1THMA 1YDGA 5DNDA 1XT6A 1F51E 1MRNA 2EP5A 2ZSDA 4AJOA 1JW9B 3FWPA 4R8KA 3MGBA 3HN7A 4RORA 4IOMA 4S0XA 2W4QA 1QO9A 1QFZA 3L46A 1KGDA 3GDWA 1KBZA 4O4LA 2C2MA 1O95D 3V48A 5HIIA 2ETVA 5BNWA 2FDRA 2JFNA 3E0XA 2AI2A 2EFDB 5E9WA 1BH6A 1S2IA 3CFYA 1YA8A 2JIMA 1P33A 1CW2B 1W75A 4JBHA 5DE3A 3OY2A 4GOXA 4YLGA 4PPYA 3AEZA 2QVYX 4DXHA 4RLQA 2QM8A 1GEGA 2UU9B 1YQ9A 3ZKWA 3E4DA 4HH0A 3NTUA 2BGNA 5ALPA 1W0KD 2W00A 1G1MA 1T9GS 5I7UA 1E3MA 2YJGA 4AP5A 1DIBA 1H1DA 1RPTA 1TCVA 1UFKA 2DFLA 2R6ZA 2GERA 2VYCA 3KM0A 4U9UA 1QQ6A 1YRWA 5CTJA 3JQPA 1TE2A 3RYIB 4UOEA 1I7PA 3CX4A 2AFHB 1W59A 3S0JA 3IQHX 3ZWWA 4KPYA 3EGDB 1DARA 1Z7BA 3EZFA 3P5BA 3D8BA 1JDBB 3EPPA 2A59A 3EA5A 4PGMA 5ALFA 3PFIA 4J1TC 3WIUA 1J90A 3GG2A 1SRQA 2JGFA 3H42B 3CXUA 3QBTA 2X4LA 3C5HA 4JKYA 1QK3A 3QVGB 1PR1A 4WD3A 2A1UB 3ZWMA 3SIWA 4DQXA 4NYMQ 4JLUA 4DV3B 1PBNA 3KXLA 4FC6A 1R4ZA 4RPLA 4QGSA 3M6VA 3BK7A 3OT4A 2X86A 1R37A 3T9FA 5HHTA 5I9IA 1Z6PA 5KTKA 3K0AB 2XZPA 5FIUA 3VR5D 3SYMA 2X9VA 3BF8A 3QWHA 4PYIA 4Q1CA 1WUYA 1GDHA 2O23A 3GFVA 1OAAA 2E4YA 3NOVA 1J8FA 1N3YA 3AW8A 3O91A 4KW7A 3V42A 1Y6FA 1ZUD1 1X15A 2J08A 2ZULA 3LLUA 3OU6A 2XUJA 1C1DA 5IJXA 3PQFA 4IFTA 4BNIA 2QE7A 3KZXA 3PC8A 3WRXC 3JD2A 2IV2X 5CEEA 5IJZA 4PNZA 1SVNA 1UEJA 1JR4A 1A7AA 2MINB 3UMFA 3V7WA 3WLKX 3U19A 4D44A 1TW2A 4KR0A 1PR2A 4W9NC 3UMCA 1QU3A 4N48A 1E61A 1HPLA 2IRWA 3K1AA 3TOSA 4R71A 5DYNA 5JSHA 5F64A 4EJ6A 4TTRA 2ZB8A 1TRKA 4URFA 3TAHA 3W5HA 3DVAB 5M29A 4OF4A 1AQLA 3HFSA 2DFVA 5KTSA 1HNXB 3IJEB 4FHFA 2QQEA 5L4SA 3U7IA 1GV0A 3I2IA 1QYCA 4E5SA 1FYWA 1ZA2A 3KHUA 5FWXB 5JUWA 2GBLA 4J2TA 1P1IA 4IWNA 3C97A 1Z36A 1NVAA 3UIEA 5H59A 2OB1A 2R8OA 4UTRA 3SF8A 3TLAA 2NTYC 1NNI1 3YASA 1D04A 1NJFA 4FOLA 1VE5A 1YB4A 2OV1A 3M4ZA 2X15A 2BYTA 1E3WA 1JJFA 1HLFA 3WKCA 1YACA 3PRKE 4GI7A 4H08A 5IDYA 4XD2A 5L40A 1LJ8A 1NQWA 4E14A 2AKEA 3I62A 3I1FA 1XCJA 3FB4A 1XP5A 3UOWA 4C87A 1J1ZA 1W2HA 3I0NA 3LCJA 4NE7A 3JVUA 4OHFA 3DPIA 5B53A 3RYTC 4KMRA 3TFQA 1CR4A 1F4VA 2AKAB 3G68A 1Z0IA 2V6IA 1DAPA 3L4BA 3AL3A 4PWYA 4UE3S 4X8LA 4UZEA 3HVIA 1YFJA 1LSJA 3A1EA 4AY6A 2Z8ZA 2RGEA 4FMBB 3TQSA 5B37A 4YMHA 3M9XA 4KJXA 4EYEA 1S02A 4G5FA 3E9MA 1KAQA 3FLBA 4GRDA 5F5NA 3VNUA 1T15A 4CKWB 4BTLA 3CRVA 1KVSA 4N3CA 2J3KA 4PGAA 4HAUA 1FLVA 4NJMA 1WCIB 4FILA 1YB1A 1KYIA 1TGYA 2A67A 1NVGA 1Z0SA 2H7XA 3NWPA 1A5BB 3G9QA 3TS1A 3AC0A 2VTBB 1UZLA 5IUKC 1PWXA 1G5QA 2C1XA 3R75A 1BCSA 2FPXA 3KCQA 1OLXB 4N0EA 5CT8A 1C29B 2GETA 4H6PA 5I7EA 5E95A 5M3BA 2CDBA 4E09A 1GCOA 2GAIA 4YBZA 3HUTA 3L9WA 3EPKA 1WXGA 1JB9A 2DQYA 4FW9A 2PUBA 2UUPA 3FOCA 4XLLA 3UMVA 3KD3A 1Q3TA 1X80A 5HBGA 3SEFA 5J1SB 5BUCA 1QJ4A 5CHEA 4N6OA 1F6WA 4JA2A 3RRNA 1TIPA 5DIZA 3F78A 5GZ6A 4TTVA 5FPYA 3WGHA 1XRSB 1Z4PX 5IP5A 1QYIA 1LLUA 2ISQA 3UM9A 4DIMA 5ETJA 1HUQA 5AP9A 3M3HA 1PUIA 3PC7A 1F8FA 1GL9B 1WPRA 2Q3JA 1KRWA 5FPSA 2JVJA 3L7DA 1WU7A 2NO4A 1EK1A 3GELA 4GPTA 4BB5A 5BQPA 2WHPA 2Z4TA 3I12A 4J6FA 4MKGA 3RSZA 1RRKA 5HW0A 3O74A 3P2MA 1HFEL 4F46A 2P6PA 2O2JA 4B2LA 3H65A 1PW5A 1V71A 2X23A 1QTIA 4YI3A 1V25A 1Z17A 3AQ4A 4WZAA 3PQ4A 3LQFA 4FHGA 4HAZA 5FPKA 3I9V6 2OLEA 1VLJA 2W71A 3NT4A 4FLEA 2B37A 1HM5A 4D3XA 1CETA 3CCCA 4X61A 2C5BA 3JALB 5FNVF 1CZRA 4CL2A 1V9CA 2NZUG 3L0YA 1SXGA 4PSDA 3UT5A 4DDWA 4YI5A 3NLLA 1CT9A 3I53A 4E13A 3VU9B 4TYNA 4YAJA 3PXBA 3LGAA 1LFDB 2WPNA 3AHJA 3O8QB 3JXEA 3ZZNA 1EQAA 3FOFC 2A6PA 1X7GA 2BFWA 4F12A 4K5QA 2W70A 3IHLA 3PDJA 1GSOA 4KX5A 4DNQA 5IYZF 3RLFA 4BBAA 3TLJA 4F2DA 2VO1A 4L76A 3BXFA 3E4CA 3SE7A 3OCYA 1EGQA 2H7CA 2YIVX 3DE3X 3DF9A 4FUQA 4G63A 1OHHA 4IVQA 3OIDA 3FCSB 3VZQA 2HPAA 3SAJA 2HSDA 2HCTA 5LL6P 1KDTA 4D9NA 1X9IA 2F67A 5JISA 3WGZA 2YL2A 1VB3A 1K08A 3EYWA 1RZRD 1G3UA 1Z37A 3DE0X 3WB9A 2B20A 1IYZA 3PDIB 4S12A 1PTJA 1M1XB 2B69A 1G21E 4L72A 4WGFA 2REQA 2X9GA 3KJZA 4H7EA 4L4SA 4OJTA 4JI2B 3CURA 2JGLA 4MV9A 2WAAA 2WF7A 2WMNB 3ZLBA 4UUBA 5EQJB 4BLPA 5JPCA 5KIAA 3GLFA 2OBMA 2IVFA 1CJKC 3HCBA 5FUWA 4X64B 4JI4B 2GEVA 2XXAB 4C7OA 2K7FA 3WGIA 3KR9A 3F8SA 4TM8A 1THTA 1G2IA 4L9RA 4QDKA 3K1ZA 2VJKA 2X5OA 3BTUA 4EB6B 2NSJA 3AHCA 2WYUA 3I39X 3LGXA 5CA1A 4ZN6A 4HUQB 1JWAB 3E8SA 3VSAA 5FH9A 3IJ5A 3PXCX 3PJDA 4RGVA 4A9AA 2NPOA 2SKEA 1N6HA 5DX0A 3T3NA 1EX6A 2RH9B 2Q6OA 4EQZA 3C6ZA 2V7VA 3FSEA 1NKVA 2COEA 2G80A 3B6MA 4XQGA 2IEIA 2YWJA 3RUIA 2R11A 3MQ2A 2AJDA 4URZR 3ZDYB 5EHNA 1B2LA 3K1YA 3MBIA 2E4WA 3B48A 5AVXA 2EYUA 2O0KA 2OC9A 2PKQP 3ULKA 3IUQA 1O7JA 2H2GA 1GUDA 3U48A 2AJ8A 2IVZA 3KPYA 4EGCB 3L8CA 5G1NA 4FINA 2JGMA 1FEZA 4BWYA 3I34X 4CEJB 2O05A 4F3TA 2O8FB 1KOLA 1RKXA 4DCVA 5D86A 4WBNB 1Z9BA 5CBPA 1PL7A 5ICCA 1P1BA 1P62B 2F9FA 4HXYA 3KKNA 2A4MA 3IPXA 1JZQA 3JQAA 3SHOA 4KQMA 2VPPA 4LF4B 1U7OA 1LTKA 3GVIA 2MIIA 4ZCRA 1U3TA 4Z0TA 1ZN7A 1U0HC 2VT2A 3BGSA 1CQJB 3EVNA 4C0JA 1GL7A 5BUQA 3HZOA 5BR1A 4ND7A 5LYJA 2Z6AA 1CUSA 3DTVB 5IUNC 2WQ7A 2DBVO 2IE8A 3NANA 1GN9A 1NC3A 3LRPA 1IG3A 3GJ0A 4Y2GA 1N4AA 3OQ6A 1N1MA 3GRVA 3TNLA 1AS0A 1LRJA 1GYQA 2DQZA 4U5XA 5JG7A 3T5TA 4EA7A 1NP7A 2I4TA 3U62A 5JYDA 4OXYA 4U7GA 3ZTWA 1MIHA 2WA2A 4GL4A 4JU8A 1P0MA 1ABFA 1U31A 3T12A 1PT5A 4WZ6A 1SK8A 4OHWA 4JMPA 1SHTX 3TNJA 4NJEB 4G5QA 1X1EA 1EFKA 1HT1E 4HAWA 2BTQB 4BX2A 1YS2X 2ILTA 1E6WA 2GA9A 3ZD9A 4B47A 5CLGA 4F38A 4QXPA 4U7PB 1T36A 2GSDA 3LPNA 2C88A 4X44A 2NLOA 3CEHA 1COWA 2C2OA 4WK6A 3W4IA 5CFQA 3PPIA 1N33B 1Y1TA 4P3YA 4RTRA 1KK3A 4AT1A 1Z6TA 5HVNA 4MB2A 4FMDF 4GWKA 5A71A 2DMRA 2G4VA 2QTLA 3QVSA 2FPIB 1DO8A 2YJ5A 3DL7A 4PPNA 4Q05A 4QDZA 3KOMA 3A1DA 5F4ZA 1C7JA 1P74A 3ROFA 2UUOA 2I22A 2V3WA 3N2GA 4ZVOA 1MW9X 5C0OE 1MX5A 3GHHA 5E9AA 1NN1A 4N0MA 1I4TD 1Z88A 1OZ0A 2QKYA 5JTTA 2PKEA 5I51A 2HGZA 2IYLD 4B7AA 4AKGA 1MJHA 4G0YA 3WSVA 1M6WA 1XDBA 2FN8A 4G65A 1KVUA 2F2TA 1SXQA 1E18A 1GTL1 2HJVA 3IT1A 1E7SA 1NNEA 3WXBA 3OE7D 2PWYA 3KR0A 1CY8A 2FG6C 3KTAB 4RQTA 3U17A 1HR0B 4BLSA 2GBLC 3X1JA 3RS4A 5CVDA 5CB8A 1PK8A 1A5AB 5E0OA 1PDOA 2ADMA 4U1RA 3TR0A 2ZJFA 3UHPA 4ER6A 4LDQA 1OPRA 4YB8A 1IN5A 2KW5A 3LK7A 3QPAA 4RVGA 2PO7A 4MVJF 3U7QB 1G0OA 4CEHA 4PC7A 1I4EB 1SA0B 4ID9A 5KQMA 1YBVA 2GAFA 2HW8A 4WN9A 4HDMB 4US0R 3KLOA 3BA6A 4BHTA 5L4LA 2R2GA 3HDGA 1RLIA 5EHGA 2V5UA 1SOUA 4LA4A 3OIUA 3R3WA 5K2OA 5BPFA 3QSYA 4YDSA 3L4BC 3AO0B 5BVGB 3ESDA 4RUKA 4MVJM 4E5KA 4PTLA 5HZHA 1NLZA 3KLMX 4IJVA 1XRJA 4AZ3A 4CMIA 3EUFA 3OKPA 2BFMA 1ZUIA 1Z33A 1SO8A 2JNWA 1UJBA 2MMCA 4QQFA 2XBLA 2X19A 5ALDA 2HDWA 3Q6NA 4QOJA 3FUWA 4JSTA 4HH3C 4V1CA 4CM4B 3DEFA 4EOGA 2OR3A 2ZJ7A 2QRLA 5ELXA 4F3CA 4L02A 5JNTA 4LC9A 2J41A 4OSEA 3EIUA 1ML3A 1C2YA 1IY2A 1R0WA 4F6CA 1S6YA 4B4KA 1OAKA 3IOCA 3MCVA 3N9IA 4X71A 1NF3A 3KYBA 1XWIA 3B78A 5KNBA 3OQOA 2X6QA 4N5DA 4EHJA 4Z7JA 3K92A 2JFWA 1N6PA 2V7QD 3QU9A 3ZGLA 3ZWXA 4F0JA 2DPLA 2XMBA 4M86A 4NMLA 4UU7A 2D5LA 4LZJA 3M0EA 3GN1A 2DPGA 1E9EA 3A05A 2WJHA 1SUEA 1TA4A 1ZAKA 3DEIA 4H7HA 2C9MA 2AVDA 4QT0A 2Q3LA 2O8BA 5AHXA 1N9GA 2MWMA 1W87A 1VXRA 2WSMA 3LX8A 1M66A 4GBGA 2FPPB 4LVUA 3W6PA 2GCIA 4XRGA 3KETA 1NMSA 3V8NA 2DQ4A 4P83A 5HF9A 3B8EA 4Z4EA 4GPIB 2XZDA 2EZTA 2VAMA 2C8KA 2XTZA 4EGFA 1L7AA 1UM9A 1K6IA 1H2YA 3ASUA 4HAXA 3MJRA 1ZXXA 1CR0A 2DUWA 4GX0A 2DP4E 1YI8A 1M7HA 4M1OA 1G3QA 1E7RA 3R41A 4OSOA 3AIKA 1DEKA 4ALJA 4CUKA 2BC9A 5J63A 1BOFA 3KV3O 4JQZA 2IBSA 1IDN1 1TCUA 4MJ7A 3TNYA 1BFDA 1FPQA 1JG1A 2QP3A 3U9SA 1UMDB 4DLBA 4DW8A 1ZIDA 3BB1A 4CR6A 1K8ZB 4YCLA 4LXQA 5T67A 2BCEA 1TAQA 3VPCA 3HK2A 2JAXA 3QTLA 3UJNA 2FEWB 3OWXA 4EKEA 1JLKA 3RJ5A 1SULA 1XB2A 3ZHSA 3HXMA 1KY5A 1TJ5A 3PRHA 3DOHA 2Z2YA 3KQLA 3LOQA 4KVAA 4J75A 3DFZA 1O6BA 3PPWA 1W4AA 3W2GA 4A0FA 1ULHA 5EE0A 4C2UA 4KSBA 5JNRA 1W2GA 5CUQA 2NO1A 2XVZA 1E1LA 1FP4A 3P0EA 1Z2DA 3JQBC 5I48A 5AO9A 3FMVA 4Z9YA 1N1EA 1EWKA 4WFKA 3T5CA 5FAKA 4FDVA 1SR8A 2JFPA 3MB8A 3QVTA 4CG1A 1K7YA 2PX6A 4JYPA 2AMFA 2XDQB 1V8ZA 3LDGA 5SZJA 5IU6A 5A2GA 3ZWBA 3ETJA 3IEMA 3K8QA 2OO5C 1H66A 2OGUA 3PNBA 2FN4A 3KRTA 1EHIA 3GGOA 1J25A 2JGDA 5JVDF 4DHEA 4OVKA 2YJZA 4G97A 1E4EB 3IIIA 2A0WA 2JLVA 2JEZA 4NAUA 5G3ZA 3L0ZA 3GIDA 5THKA 3FPCA 4NNJA 3P7MA 3OUTA 4TV9F 4DNOA 4YK7A 3E9ZA 1TIKA 3DP7A 4Y2RA 4R81A 4WW0A 2AOWA 4N54A 1PVOA 4UM5A 4CIDA 2Z9BA 4ZDKA 1ONNA 2I6UA 3GDHA 2IU4A 4HJXA 1DMRA 4CIWA 4POAA 1JHZA 3CVVA 3A1CA 4ALKA 5HRCA 5EUCA 4FDMA 2RARA 4HYYA 1WWKA 1ZJJA 3D64A 1SCDA 4FFLA 1XRMA 2AMVA 3JWJA 3NHUA 2QQ0A 2IHBA 1U2ZA 3RD5A 1MDBA 2GAJA 5JWHA 4PF1A 5I3ZA 3M3PA 4FFWA 3DBOB 2FQXA 2A33A 2Q3DA 1U65A 1C81A 4PLVA 3CS3A 5E3JA 2RGGA 1CDDA 5EXDA 5U4QA 4ND6A 3N59A 3N8NA 5AVZA 3INRA 3KPVA 5I7SA 4RFSA 1U5BB 5EG5A 4E08A 3QLVA 4B8WA 5A6SA 5JI2E 3U7GA 4CFSA 4F4DA 1NPTO 3VUFA 1GM5A 2I6QA 4ZO7A 1UBTS 4JWKA 2V4UA 4J7XA 2F55A 1LS6A 3GOHA 4HLDA 4AY3A 3HCFA 3N53A 1AKYA 4U9HS 1G8HA 4D8XA 4MIYA 2WM3A 3LPLA 3QG5A 4QQNA 1Q1ZA 2CJYA 2R47A 4RKRA 1LVHA 3ZQ6A 1K06A 2OHHA 4EMTA 4QVIA 4TVKA 1E9DA 1MQSA 3GW8A 3N0XA 3JQFA 4N8DA 2JDIA 2TRSB 5A4JA 3A2MA 2G8NA 2GAAA 4WCDA 3H1FA 4KOEC 3L6OO 2GD1O 1M6HA 1C9DB 1JKFA 1Q6YA 4IIYA 2X0JA 2H4XA 3U60B 4D02A 1L4NA 3RS8A 4E32A 4TL7A 2ZTLA 1CZLA 4DQLA 2OQVA 3RASA 5CDSA 1KJYA 3KHTA 2Q5HA 2HWXA 4FI3C 1BRTA 1CXZA 1ZONA 3CNHA 1FF9A 4ACAA 4QXAA 1MB3A 1XCOA 3VR0A 5A1JA 1PG0A 2HBRA 2Q7XA 3QF4B 1DEOA 4KLCA 1RCFA 3FVVA 2I4OA 2WJ6A 3FOAA 3G0DA 4RV5A 3SI7A 1Y89A 5HK8A 1JTFA 1YZKA 4K9QA 5DT2A 4DIDA 4LV8B 4YRSA 1E7MA 5KTNA 1L3BA 3MWKA 4MWCA 5LIRA 2Y8EA 3AESA 3FPSA 4MDFA 5D5QA 4BYMA 1BKDR 1RHMA 2JA2A 3OVMA 3QA9A 3QHAA 4GGMX 4Z4QA 3AILA 2BI4A 2HJGA 1H8HA 2WJ3A 3BD7A 3DYVA 1TQHA 1ONPA 2RHBA 3HC7A 4Y1FA 1V8FA 1NXWA 1C9MA 2PBRA 3QVXA 1MORA 5JLAA 4D9MA 4ARBA 2FSFA 2QAGB 3R0JA 1PQYA 2G5PA 2HO5A 3LTEA 1UBJS 3R77A 3DUFA 1YUMA 3EVGA 3WGGA 4QJ3A 4Z9AA 4W5TA 3RC7A 4OQLA 5B3JC 5HZGA 5IBCA 1I9GA 1GT6A 3K94A 1LUAA 4G84A 1WXDA 3HWX1 4TLAA 1DEHA 2VYND 3QX9A 1P2UA 1Q15A 4LZZA 4EG1A 5JNVA 2JCYA 4DBLC 2OOKA 4EEKA 5DHAA 2Y6UA 1CP2A 3WGUA 1E69A 5CB4F 1EJBA 1Z26A 2GKSA 1JQKA 2M6KA 1SURA 3KYCB 4WKCA 1D2HA 3M89A 1VSQA 3C3DA 3IAEA 1DKLA 1ZIYA 4INPA 3F3KA 1UC4B 4O4IA 4Z9XA 3RRBA 3PC2A 1MGOA 1TT5B 3HBMA 2O07A 4M55A 3FPEA 1E3QA 2IXAA 3HL0A 4Q7JB 5DHUA 2VUTA 3FG9A 4QTUB 5IHPA 2ZJAA 5JH7A 4G1MB 2OEPA 3HBNA 3NVKI 2HD4A 2YVLA 1CNFA 2VF8A 4IXWA 3F3SA 4NAVA 1RYNA 4A4DA 3JPYA 4KAXA 4YJ3B 4C89A 5KYTA 4EZEA 1JA1A 2AN5A 3AUJB 4DA7A 1RPJA 2HQBA 1G21A 2BZGA 4D97A 2PZAA 2XCQA 1ZGJA 5FOXA 2DHQA 3I64A 2RGUA 4PYRA 2D3TA 4RAQA 1LNZA 3TL2A 1OU0A 5C2JB 1FJXA 1E2FA 1ODCA 1QP8A 4AZ0A 3BWVA 3ZJVA 3ETCA 4YP0A 4YRLA 3WGVA 2WJYA 5DN9A 3IOMA 821PA 4Z3OA 2IZ6A 3VO8A 3LQRA 1UQRA 2ZBVA 5JV5A 1DBRA 5AM0A 1KIAA 1KPGA 1J1IA 4I4LA 2FSGA 4OLFA 1XYYA 2PGAA 2YIDA 1JLHA 3THXA 3MT7A 1VKJA 2ON6A 4TQ9A 2Z6UA 1MAAA 4RS4A 3MINB 1ZD8A 2B21A 2HMTA 3I73A 3MQ4A 3H9QA 3MWFA 3O03A 3R0VA 4ZO6A 3RSOA 2PS1A 1F0KA 1JJVA 2DR0A 2FW7A 3T1OA 3H8WA 3IKLA 3TPCA 4ASUD 3EDYA 3ZBTA 3PHJA 4K0RA 4QHYA 4CG3A 3S3TA 2YZ7A 4GPD1 5FBZA 5JEDA 2OZVA 4JGGA 4OIFA 4KQHA 1MRSA 2J85A 2YOFA 4DDHA 1GAWA 4OMUA 4PZLA 3WGKA 2NOAA 4GOKA 3HR8A 4I3FA 1I4OA 2EP7A 2E21A 2WPDA 3LPAA 4JVNA 4EI2A 3SQOA 3K9GA 3UUFA 2AZMA 3X2EA 1KYWA 3VR2D 2P0AA 1NQXA 1T29A 2J59A 3L7BA 2RKWA 4RHXA 4CMEC 2Q8PA 5CK4A 3ESZA 2AG0A 2G9UA 4GG1A 2BD0A 4XYEA 4O08A 1DL5A 3EFHA 3RROA 2BKEA 3UBMA 2VT3A 1N2XA 1Z12A 3M1IA 3TL3A 1YOVA 5BVHA 2PHZA 3R74A 1W4ZA 5D7BA 4WACA 3F6YA 3UO8B 1N5IA 2H8KA 5CNIA 3U4GA 3F73A 2DSNA 4DMRA 4Q3DA 4FLMA 4E2WA 4E07A 1T5DX 2G67A 2C4WA 3FPAA 2BFEA 2GTPA 4H7DA 4O2BB 5AWFC 2ZUFA 1PS8A 3DH0A 3LHKA 3GLGE 3GUCA 3ETDA 5AUOB 3Q88A 3DPUA 4XEHA 3GPCA 2J3QA 5GP1A 1B8UA 3ISVA 1DC7A 4KPEC 3LT1A 1G8AA 5BSUA 1O08A 3C7TA 1RI4A 1ISPA 1MQAA 4QXQA 4RCVA 4YJGB 3ZE7A 1Q1BA 4FDAA 2C7GA 2HRRA 1W73A 4IDEA 2UYCA 3LW7A 3CF6R 4HT3B 1RZUA 2NU9A 3KSDO 2Q5EA 4MPPA 5AXAA 2NYUA 4C9BA 4ARCA 3OECA 2DH6A 4O29A 2B1RA 4IDQA 4AUKA 1X13A 2W4MA 1ZOPA 1C0KA 4XH9B 3AB7A 3FCXA 2O54A 4Q4LA 4TV8B 2G9RA 3DQPA 3LCUA 3N05A 5JU6A 1ABEA 2G28A 3EY4A 3MS7A 4HXEB 1QO0A 4ZVKA 3UJ6A 3UJ8A 3ZGZA 1VL2A 1VE1A 4NHOA 1L5FA 3HXOA 5LMNB 3WYBA 3OG9A 1EUCB 3RVJA 1YIOA 1FSSA 2WJIA 4XVRA 3GAAA 4X7BA 5KYUA 5AHKA 4AZTA 5E3HA 2C59A 3A32A 1UDWA 4S2EA 3AETB 3RVKA 1GZ3A 3UHJA 2LE0A 2F6RA 4BLWA 2D7JA 4TRJA 3V8BA 4DE5A 4I6JA 1Z5GA 2CJPA 1HEYA 3M33A 1JG7A 4BLOA 2WKQA 1M1UA 5C1OA 4XIFA 4JZYA 2VNKA 3QELA 2R3SA 2JAHA 2PLAA 5C31A 1JF8A 3MJCA 4URWR 3ANTA 3HKEB 1W1UA 2R8ZA 5ALMA 4YH1A 3SEAA 3OZVA 1PUJA 1SHKA 4RADA 3CF4A 4EKDA 4ZYUA 2J0QA 2O8CB 5EJIA 1RYFA 5HKAA 4FOTA 3GJ7A 3FMIA 1OXUA 3CUTA 1FU7A 2JAWA 2PVSA 2ZI5A 5DN6D 1NVDA 1TQ4A 3HSYA 5FADA 2NVUA 2R85A 4ML3A 1JEAA 4N49A 5I8ZA 3TBFA 1QLJA 4IMJB 3BG5A 1M6NA 1U6KA 1I6MA 1WW8A 1FFBA 2G17A 3EGEA 4J7UA 4MPRA 5DNEA 3OEHA 2PNJA 1Q0UA 1ZMTA 3ZWQA 5BNZA 1G5HA 1NG9A 3A10A 1TO6A 2FQWA 1FUKA 1V1RA 2QN6A 1J2TA 3CH5A 5EKSA 2ZSEA 1PBTA 3AF2A 3LOUA 3WLAA 2PLWA 1XZMA 4IO1A 4LJ5A 3CPHA 4MARA 1JR3E 1HOTA 2WKSA 3QLVC 1UXOA 1M83A 3WHPA 4MOWA 3KQHA 2NU7B 2QLMA 5JNLA 1CE8B 2L19A 4DMMA 1XZPA 4G41A 4OJQA 3SQLA 4QM7A 3L8ZA 1QHEA 3AKEA 3SS7X 4DG9A 2WOJA 4GKJB 4L6CA 1FX0A 1Z25A 4JR2A 5J9FA 5B36A 5EHXA 1Y9JA 2C0CA 4AXXA 1ZHOA 1WHSA 1M34A 1E2NA 5HM8A 1J8YF 1O5IA 2GRUA 3PR1A 2V6BA 3VR6H 4ARAA 4B3GA 1YZQA 3QZUA 1NUSA 2PX4A 1IG0A 3BJMA 3IUEA 1O97C 4OHXA 2F00A 2D0IA 1VCNA 4DL9A 4F1JA 2ZTSA 3ZUGA 5EP4A 2QTCA 4XE5A 1Y3IA 2D5IA 2QRQA 3B5EA 3IVAA 4K9OA 4PG4A 3Q3VA 1WD7A 5DLQC 2H2FA 3V1MA 2M9MA 1KYQA 1RAFA 2XQGA 1I2AA 1PTKA 1TJYA 2WAMA 1OA0A 1POXA 3FMPB 3OFND 4RCZA 3BWXA 1TZKA 2HU8A 4TQUS 4CKYA 1QPBA 1ZEJA 2GLXA 4F92B 1L7QA 3R5FA 2YMPA 2D2VA 1EESA 3CKKA 2QZ4A 2W6CX 1W34A 4K87A 2FA9A 4OYHA 3CLRD 4Q0MA 1E4VA 4R1MA 4Y6QA 3T0GA 4AJIA 1CYDA 1UBGA 2C9OA 3EJWA 1NMXA 4MUGA 4IG4A 4UTVA 4GM4A 2E18A 4IXMA 4U7DA 3T7IA 1G20B 1ZVMA 3T34A 3FTQA 3ADCA 2ZUVA 1BYUA 5T8KC 1EFRA 3MRSA 5LDGA 2ZRFA 3EXEA 5CB0A 3K16A 2CLKB 3ND6A 4RPIA 5JAMA 5LN1A 4M1TA 2OHGA 1CERA 3DBLA 3IVXA 1CP3A 4GZMA 4PG5A 1ZOLA 1UWVA 5ALEA 3WBBA 4MHTA 2IY7A 3KOXA 2A9RA 3LKDA 1CZKA 1XTJA 1PR3A 1Q95A 2WVHA 2GB4A 5E7QA 3RBZA 4B4WA 2J3LA 1S1MA 3VQTA 2ZIXB 2IS2A 2EKZA 1OILA 2RCNA 1Z16A 5KTRA 3UJCA 3QXJA 1YZGA 1ZH4A 3H7AA 3T1NA 4E88A 1NF2A 1CUHA 4PY2A 2OGSA 2XNKA 3PFNA 2XNDA 1D2NA 4L1KA 4LE0A 4P4SB 4ZXFA 4W63A 1NQOA 2CFCA 3AEXA 4KB5A 2BFCA 3D7LA 2YXNA 1XZGA 1MN6A 1UJ6A 2O3SA 3R5JA 2FWNA 1X7XA 2YWCA 4I1YA 3WKBA 2JHCA 3WLTA 4EBFA 2JJ1D 4RVCA 3TTWA 1FVOA 3GQBB 3UQZA 2JFHA 4RDIA 2XRZA 4GQAA 3SR3A 4G67A 5HR5A 4UHFA 4LF6B 4IWYA 5TRTA 2C2GA 3QP9A 1YCDA 1ULTA 2A2ZA 5L9AA 1HSZA 1BXRB 4KO1S 3T7JA 4G0XA 4B3CA 2JATA 5HKKD 3CISA 3GZNB 3M4JA 4XYBA 3UWSA 2QL6A 3FI9A 1JYEA 1MXFA 4G5OA 4MW9A 5C8YA 5JY6A 2BGIA 4GZLA 2W6MA 1A9PA 1JBKA 2YVUA 3TD2A 1ZDMA 2C2XA 3C6YA 2IUYA 3CB2A 3EIFA 5EXTA 3ONFA 3E05A 3R5KA 4YAUA 4JC8A 4RD1A 5AVRA 2YC2C 3OLYA 1WSDA 4AJPA 2R7LA 1YJ8A 3LMKA 2QSJA 1H1TA 3BX1A 2VCYA 1QIDA 4K1LA 3QE0A 4ILEA 4X93A 1UM8A 4IF6A 4QDUA 4RPJA 1REQA 5ERGB 2VF4X 2RGYA 4XB6B 2PUFA 2B61A 2QNBA 4Y2TA 4Z1OA 1NLUA 2XGGA 4EVSA 3VZSA 4PQRA 5JS7A 1EDOA 1L5ZA 4ETNA 3A9TA 3OMLA 4MR9B 5K5EA 1L7DA 1SUCA 3O4IA 4HAYA 3NKLA 3UHOA 4D0GA 2QW8A 2R8EA 2OAEA 1K8XB 1Z0UA 3CZPA 3V1YA 2IXGA 4UOZA 1FSZA 1M67A 4O4JA 4U7JA 4PE5B 4WXRA 5HCIA 1H8ED 1EVKA 2H2DA 1Z0DA 1U3UA 2IF0A 3CRRA 2VP6A 4JJ7A 4ZRNA 5EGNA 3W9UA 4KHPB 1QGED 3HGTA 3OBBA 4NOJA 1ZD2P 2NV2B 2FZ5A 4TX1A 5LQRA 2JL1A 1W8DA 4QO8A 2DBZA 1Z6ZA 4BMZA 1YR1A 1ZGAA 1KC3A 2WWRA 3W5UA 4PLGA 2GARA 1Z34A 3HXLA 4RZHA 1JBQA 2ZPAA 2IHVA 4TLDA 3CO5A 1XU7A 4L9SA 3HXPA 5EJ7A 3GQVA 3DW3X 4XJVA 2M2IA 5ADVA 2PL9A 3FH0A 5CGQB 4BO2A 4CF3A 1NQUA 3O2SB 1ZVVA 5EIBD 1Y7PA 3VU1A 3WGTA 2LPMA 1YBAA 2ODPA 3ZG6A 4HNAA 1BD3A 1L2TA 3LKZA 1TLTA 3AG6A 3MCZA 5GIOE 1JQLB 4CKCA 1K7EB 1NW8A 2ID7A 1RRPA 3M6IA 1PUXA 2NU6B 4GOOD 4X0EA 2O8VA 1YTUA 3UMBA 4F11A 3MJ4A 4BP3A 1IOZA 3O3OB 3R6LA 5LWHA 1GQYA 2A58A 3VO9A 3AEKA 2WWFA 1GU7A 2MR6A 4CQMB 5EKTA 2K5UA 1RKVA 1BH2A 3GFRA 1CR2A 3GGCA 3ES9A 5AJXA 2WFMA 2ZBUA 1UZMA 4YCJA 1FS6A 4G0VA 3PUWA 5HZMA 4G8JA 2FLVA 3HEMA 1ISJA 1JEJA 3UOGA 5CCEA 4H7FA 1XK7A 2D54A 2P2ZA 4RLFA 3MWEB 3UH1A 3UYKA 4BATA 1YASA 3DNFA 1QM5A 1SCUA 4N5MA 2EU8A 1Z15A 2ZB3A 5AJWA 4E5VA 1RMYA 5E6SB 4Q4JB 2ZBRA 4YJ2F 3BDVA 5JAQA 3RFCA 3CUUA 3GL9A 4CM9A 2VDUE 3EIQA 4P7FA 5JXWA 2UUBB 4P82A 4IIVA 4TLCA 2YVKA 3TCKA 1GQOA 2DTXA 2VPQA 3EQ6A 4C0HA 5EJ5A 2DFPA 4CRWB 4KYUA 4PBTA 4P7GA 1KYXA 4ZGBA 4Z2YA 2ATIA 5AW0A 1GGHA 2Y77A 5GM1A 3OH8A 3M70A 3ABQB 5KEIA 1S2GA 4URUR 1CG6A 1N6NA 2QPAA 1O4VA 3L6DA 3NHSA 3L8EA 2P9BA 4FZRA 4RF5A 3H8VA 1L5VA 3VV3A 3D4PA 4NV1A 3E5MA 3L41A 4ZT6A 1Z8NA 4W8GA 3CNEA 5CRIA 3DMDA 1ZD1A 4RA9A 1ZUNA 2SHKA 4E4YA 1ZK3A 2Q1YA 4RE5A 1IZ9A 2PJZA 4RHYA 1P1RA 1KKMA 2RGAA 4GW3A 4BV2A 4ZYZA 1W52X 3ZY3A 2DKFA 4II7A 3E27A 4PX9A 4UZFA 3ZH2A 4BRSA 5JIBA 1NI4A 1JKXA 3T1TA 3G6KA 2MSEB 1TYEB 4IQ8A 3PC4A 3KV1A 3BXOA 4NVRA 5FOWA 4B73A 5HGXA 3WR5A 1LK5A 4J90A 2G77B 3JARA 3KL4A 2R1VB 3ZJ4A 2O8EB 4HAVA 2PD6A 4BZPA 1VMDA 1LRKA 1KOFA 2IGBA 3IR6A 4AKEA 4MQEB 2ZIGA 2FWRA 3NATA 3S1AA 4JXXA 3W8NA 5EIEA 4E4TA 4IS2A 2HQOA 1AM4D 1TCAA 2LKCA 1D2RA 3IAFA 2PAFA 4YPFA 3EW7A 3CX7A 3SEQA 3TQFA 4R5MA 1DAHA 1YAHA 3WAKA 3A1TA 3UNXA 1U2TA 1E7QA 2Y1GA 4R7GA 4ABTA 3UENA 1KMIY 1QLHA 5CLHA 3VPBA 4BKOA 1L5HA 3EA0A 4KO3S 1EIWA 3DZFA 4EHAA 1IJBA 4KQIA 1NIJA 1ARZA 1KMMA 2EZ9A 2VEDA 3GNTA 3RFVA 1Q3KA 1G55A 2JD0A 3PICA 1FUIA 1NBIA 1V7ZA 2E49A 3W5CA 1EKXA 3NKVA 4JJFA 4O3FA 1Z56C 4ETMA 5MFZA 2O2EA 2OZLA 2Y9MB 3V6MA 1N7GA 3WAGA 3V3TA 2EW8A 4UMFA 1QF6A 3WLSA 2C3YA 4XXHA 1VE6A 1XDUA 2Y2UA 2H48A 2FRXA 2YWFA 4AMBA 3O1JC 1ZSVA 4R69A 4MQUA 1NKTA 1V9LA 2ZJ4A 4LX0A 1KZGB 2WE8A 3KZ1E 4IQ0A 4JOCA 1Q83A 2VC2B 3GB9A 3O8OB 2DRIA 4KO2S 2LIVA 3BK1A 1IUKA 4KL8S 4W8OA 5K7SA 4WY8A 2IX3A 2DJIA 2ODNA 2BEVA 3H11B 5B4VA 3GLGA 1VRCA 2ZRDA 4XRRA 4M83A 5HQ3B 1A7JA 4QATA 2XLCA 4BE7B 1P5ZB 2J5BA 3TINA 3UHFA 4OX9Y 4MUHA 5FUBA 3OZAA 4O1HA 2QN1A 5A7FA 2P9TA 3W5JA 4D0NA 1YHYA 4DLWA 1P17A 3OPYA 4WADA 3H4TA 4PCAA 3GJQA 3G2IA 2G5TA 4KDCA 2IYQA 4AS1A 4Y2SA 5AJUA 1E9SA 4OA5A 4JVSB 2FSSA 4OHBA 4WA8A 2UYOA 5H80A 3HZRA 3PVSA 3W3ZB 5A4FS 1EWQA 2R7NA 2PQ2A 1DC5A 1YZVA 3FJOA 4LDZA 5KJEA 3AKZA 3DEKA 2BGWA 2IHUA 2GZ1A 3TUJC 2IC5A 1X1DA 1BHO1 4OK6A 4CUJA 2HAEA 1J07A 1ENPA 1R9GA 4AQYB 3K70B 4HRXA 1B42A 4JL6A 4LNUB 3KSUA 1NFFA 1JKMA 2QR2A 3DHWC 3OIVA 4JL8A 4PYMA 1K75A 1POWA 1YL7A 3OM9A 3PHCA 3PIRA 4GPBA 1UZAA 4K9RA 3ZGVA 5IULC 1TGVA 2REOA 3A8TA 4OQPA 3A3OA 5AM1A 4CTKA 1IE3A 5TMPA 4DV0B 1KI2A 1NVWQ 2I80A 3SE0A 1XAIA 3TTYA 3VMMA 2BEJA 3C0KA 2AFHE 5KX5A 3T7EA 1QOQB 3Q9UA 3UG7A 3VSDA 3IVGA 3GA5A 4ED9A 3MK31 2RK4A 4NYJQ 3KR1A 1JEDA 4B3TB 3DCIA 3EEYA 3HZZA 4DSOA 5IWAB 1VBMA 1X42A 4HGNA 3IP5A 3MT0A 3PCTA 1C7QA 5FQOA 3ST7A 3TLCA 3KQTA 4ZXPA 3TOVA 1V45E 2FG5A 3MHPA 2GCNA 5GADl 3NDPA 1DG9A 5IM5A 1U1FA 2BGRA 4F4CA 2WT9A 1OIWA 1P7WA 4G8DA 7ADHA 2NXEA 2ZBEA 1JR3A 1W4LA 1OFTA 3R3ZA 4A73A 4PZYA 1VJCA 3CLSC 1WHTA 2FAXA 2JHPA 2QD2A 2ZYUX 1L8XA 4GMKA 4RY0A 3JQ7B 4Y2PA 1A5ZA 6YASA 4II3A 2WFLB 1B3RA 3ZS9A 3ZZTA 3KYDB 5ILGA 4BXOB 2FEPA 3CRMA 2P62A 4UAUA 2CDNA 5LVAA 2NZXA 4C0AC 3VM6A 2A94A 3V1KA 1GQRA 2OXCA 4H4DA 4KXLA 2VJMB 3R5HA 3EHEA 2R66A 3GJXC 4IKEA 1MQ9A 3SX0A 4PPGA 4RXUA 4EA9A 1IHXA 4ZICA 3LLCA 2YHIA 5DM60 1E59A 1Q7CA 1CUIA 4Q1AA 1UKYA 1DAEA 1UBCA 3OWOA 4PR0A 5E38A 4Q19A 4L73A 1Z28A 3BWEA 5T4HA 3DZIA 2AK3A 1N34B 4OFBA 1PG5A 2I9KA 3KDSE 5AVOA 2QTFA 1V11B 1BQ4A 2I2DA 1Z63A 1D07A 2MDTA 3ESAA 1WDLA 4B3SB 4DYVA 2OGWA 5J47A 2XQVA 3HUUA 5EVCA 1YS7A 1X3LA 4QU5A 3NAQA 3KKQA 4BVHA 2Y1OA 5HILA 4YJFB 1PT7A 3V55A 2E1RA 2O5EA 2QT9A 1TQ6A 4R2WA 3VR3D 1QJCA 1V47A 1X7WA 4G0WA 4PYOA 3OCJA 4QL3A 3PXUA 2PUCA 1KAGA 3CJQA 5L3SB 3ZWAA 4ZD6A 3B5JA 4MW2A 1DWQA 5JWOA 4FM9A 2F8SA 2VPYA 2OKGA 3K0CA 1CU1A 4M76B 3U4HA 4DGSA 3CVYA 1VOTA 2MU1A 5H3HA 2QSZA 2VUHB 1GNQA 2XCOA 5JW6A 4V1CI 2X4GA 2IGTA 1N78A 2KQUA 2LDBA 1YBMA 3ZHVA 5DM4A 2B4AA 3C1TA 1I3OA 4HGYA 4M0LA 4W5NA 3L79A 1P2TA 3Q1KA 5F1YA 1M0SA 1IM5A 1EK0A 2G76A 4BFXA 4DNPA 1Z75A 1U7DA 5TT1A 3M6LA 1M5UA 1ZRNA 4Q1BA 2CXPA 1GNLA 1L4HA 1RS0A 4PN7A 1RXEA 2OBBA 1R0CA 1I3KA 1CJCA 3MILA 2RI6A 4OUDA 2P7IA 1BW9A 1U8ZA 4YRFA 3WA7A 1E89A 1NR5A 4YRPA 4XWOA 4A8PA 4PSUA 2I65A 3DWGA 3WNCA 4HNUA 4V0NA 2BI8A 2O7RA 1PRYA 1LV7A 3I72A 3OX4A 4YRIA 5JDIC 1QANA 3HB1A 2NO9A 1ISMA 2Z1NA 2PUAA 4WPGA 3BRCA 3PJRA 4YAKA 1PFKA 1DKRA 1KFBB 1Y82A 2AFIB 2P41A 4QTXA 4AUEA 2VRCA 5ARDA 4ZEVA 1VPWA 2DETA 4GX1A 1XVLA 3X1ZA 2QTBA 2A5LA 5KSYA 3FHOA 3ETHA 3KJXA 3HZHA 2I7VA 2OM2A 1NI5A 3IEKA 3D4IA 4Y1RB 4AROA 1W96A 1XZHA 2VIIA 1FRNA 1U9JA 4R8LA 1AK1A 1A8HA 4DIUA 2D2XA 2OHIA 3L0SA 1NJ8A 2DLDA 4RVFA 1N2EA 3V4ZA 1Q44A 2D4AA 1YQWA 2AXNA 4UCFA 1YGYA 4Q1VA 1MAVA 1X8JA 2ZRHA 5HPYB 4NCNA 3NI2A 3V4SA 1YS1X 3WL7A 3LBIA 1NP3A 4MQFB 1OGYA 3BSWA 1QFYA 1UBRS 3ZHXA 4ENSA 1SVLA 1Z8FA 4FN5A 4PQYA 3INNA 3Q87B 3T8YA 1C1HA 2C4TA 2GFIA 4BWFB 2ZIZA 4UM9B 3HKBA 1GQQA 4J1NA 4QECA 5JZ9A 3R1IA 4FDTA 1X70A 3NAZA 5H4HA 1PFUA 3SZOA 4EUNA 4MQLA 4GRIA 4HDAA 4J07A 3AVTA 1IY1A 5AQEA 3QLTA 1X1QA 2PL3A 2WQZA 5DEIA 1A9XA 4RTQA 2QRVA 1B41A 1W5BA 1RMQA 2W6JA 2H1WA 1CUEA 1IBRA 2DU8A 2ESRA 2VFAA 3LC7O 4PSKA 4BASA 2I0FA 4JDPA 1PV4A 4ESOA 3LNTA 1P1JA 1I4DD 5G4KB 1DBIA 1EGAA 4CM8B 5IVPA 4P4GA 1G8YA 2BDUA 5GJCA 3O26A 3DVSX 3S5UA 1OWOA 3ZU2A 1IAVA 4YCDA 5JCJD 3K70D 3WE7A 1GPMA 1WA5A 2IY9A 3PNOA 2ZTHA 4IQ4A 3P9IA 5DO9A 4YAWA 2YW2A 4MGIR 4KTVE 5ENZA 3TLZA 4TL9A 4PU0A 1SBIA 2ORYA 2H9AA 1DKOA 4LJ6A 5FWDA 4C4OA 1I14A 4AJ9A 2WJVA 1E79D 3EXG1 2CD7A 1N7HA 2P35A 3LUHA 2V0GA 3O8RA 1K3TA 3EXAA 2I2BA 2C00A 2XGOA 1YQEA 4RHTA 2Q4BA 1Y8RA 5F7OA 1YRYE 4ZAFA 5KYNA 1W1IA 1V2GA 2PL5A 4YP5A 3L6UA 1ZGGA 1DO0A 2YC4C 4D9CA 1S7CA 1KMHA 4C2TA 1N5KA 2RIPA 4RNCA 4HX5A 5FA5A 4TXJA 2ZJ6A 2XWSA 5EXEA 3O4VA 4LZAA 5SY6A 2QJFA 4Q18A 5EQDA 4N8SA 3WKEA 5EMNA 3DZKA 2PMFA 2EL9A 1T1RA 3L4EA 4FOPA 3RVDA 3GF4A 3GCDA 3SCZA 1NJ1A 1HT3A 1RHUA 4BNMA 2WDPA 4OLHA 2PYZA 4KO4S 3OIWA 4JR1A 3VJKA 3U7HB 4LOLA 5DCYA 1SC1A 3FTDA 3DMYA 4E51A 1AGPA 2FGKA 3W9SA 2OVBA 5EWMB 5K0GA 2HT1A 2BCJQ 5AVWA 2RE8A 1FL9A 4IAOA 1UT5A 4MQ5A 4I81A 3NJ8A 4EJ0A 3V4RA 4ZANA 3RAJA 2PLFA 3VOAA 1BDJA 2AKYA 4FYMA 4O0LA 5EP2A 1N0WA 3AM1A 1E8NA 3W2EA 4WXHA 2VWHA 4N3NA 1G7SA 2V8BA 3EVZA 2JG3A 1SB9A 2VP9A 1T0IA 4R8SA 1M72A 5CB6A 4M1SA 4OY3A 4MVWA 4QFBA 4JUAA 4O2AA 3SZLA 1DRJA 3FYSA 4S1WA 5T7BA 1KO1A 5CDFE 2H18A 4NK5A 1KJIA 5T4BA 3MD0A 2I4LA 1K4KA 3H8JA 4U4AA 5DMHA 2IS6A 2VDWB 1WMSA 2DZDA 1RQNA 1EP2B 3VKHA 1JHUA 4PANA 3V9AA 4EG0A 3JAWA 5KOYA 1K68A 1MJFA 1CZNA 1V16A 2J4CA 3BM5A 3G5AA 4FEYA 3G1WA 4OBBA 4WHMA 3PL5A 3WP0A 3KWFA 1JA0A 2E4VA 4QUBA 1G17A 1G7CA 2GYYA 5DBGA 3FGPA 2FPSA 2HC9A 1L4KA 1DOHA 3EGCA 1XN1A 2IHNA 3EEOA 4N4AA 1K8YB 2VXCA 1KZYC 1XUOA 1R00A 3I9NA 2WJPA 2O6LA 4YMWA 3QKTA 1RD4A 3TPFA 5JC8A 4R8VA 5ISMA 2RH8A 5AUPB 3WBFA 5JXHA 5IM4A 2Y1LA 2RIRA 2XA9A 4XFJA 2OK8A 3CNNA 2A1TR 3MTGA 3WYEA 4TTPA 1LZKA 1PT6A 3NTLA 2YH2A 1XI2A 3ROMA 1QH1A 2BF7A 3KT6A 4MUYA 3DWEX 3CSUA 4MR7B 3PUKA 3QUAA 4IZ6A 2MCFA 3UAGA 4B6GA 2X7XA 3ZHUA 2BMDA 3G7UA 2P75A 3PVCA 4J4HA 1QGUB 3VTFA 3RS9A 4MPJA 2EZUA 4M1WA 4E2YA 4P0PB 5LB2A 4P4LA 1TM3E 4BNUA 1BVHA 3OMXA 4C3ZA 3DTTA 3EK2A 3TJMA 4IFIA 1PU2A 1T2FA 3T5GA 4S1PA 3VC3A 3PX3A 4DWVA 3THYB 2QM3A 2IZOA 3OTWA 5HE9A 3AYXB 3U4QB 4AFNA 5KDOA 4RJTA 2DWPA 2P5SA 4ZQBA 1J33A 2I78A 2JIZA 5EMHA 3BDAA 4K9DA 4L0MA 4CMCA 3RQIA 4CWAA 4EG7A 4GT1A 2IXDA 4EWLA 4W5OA 2IP4A 2TMYA 4EI9A 4R1NA 1RJFA 1G9SA 3B6ZA 1JA9A 2QN8A 4H7PA 1U8FO 2LZ0A 3I2GA 3DT8A 3DKVA 1SH7A 3GVHA 5BV8A 5CXUA 1G7RA 2JBWA 3VNVA 4TOIA 3FZNA 5DGHA 3OPXA 1QH9A 5FNZA 4FE3A 6AT1A 2HV8A 3VZPA 2H57A 2IOHA 5AUNB 5JMPA 3IPRA 1TUBA 4RA6A 1MIOA 1V5GA 1BFUA 2X1MA 3G49A 3NM4A 4JCOA 2VOJA 4ND2A 1NVTA 3KEMA 5BNIA 1LV8A 1VGVA 5EESA 1LB1B 1YB7A 4G86A 3B6IA 3KYJB 3ZTYA 5AVSA 1XQWA 1GUZA 2OT3B 3K0CC 1WLYA 2A9QA 2DCUA 2VWGA 3AY6A 1XNQB 2C61A 2FN3A 2H3HA 2J32A 3TRKA 3ZJYA 2HIAA 3MTAA 3E0QA 4I5EA 4LBWA 8AT1A 3C3CA 2BFDB 3K73O 4RDHA 2QYOA 1XMQB 2EVWX 2ZAGA 3IPCA 3AK4A 2YTZA 3QPBA 9MHTA 1Y7HA 3X1KA 2DLNA 5KHOC 3EZGA 4I55F 3HCPA 4JYAB 1JIQA 1TADA 2JBAB 2BHLA 5FOQA 3WQSB 3TE6A 4C0SA 5FFMA 4LECA 3GJSA 4CL8A 1PJTA 1SD5A 1EFAA 4X00A 3AVOA 2AI1A 5FBKA 2YWGA 4GMHA 5FBLB 1SCBA 1QR6A 1QZTA 1DAKA 1LKZA 3DMTC 1KH1A 4E2XA 1I1QB 1PL0A 1OXKB 1SQSA 1ZCJA 1ORVA 1ZU4A 2AJCA 3IVRA 5IKMA 3PTLA 3W3AA 2C4KA 1RRVA 1FNBA 4BGUA 1LSOA 3F96A 3GHYA 2XYHA 4I50B 4QAJA 2XB2A 1W0CA 4RVHA 1NJGA 3DZCA 2YS7A 5A4KA 2P9EA 3M9WA 3WB1A 1MEEA 1AUQA 1V39A 3WWOA 4OI4A 4MVJI 2PH5A 1Z2CA 2AHOA 3WWPA 1OIVA 4AM8A 1MOPA 1Y5IA 4MIEA 4PGGA 4FIZA 4AJLA 1W19A 4Y2QA 3F4KA 5KOJA 3WO1A 4H9GA 1RBQA 2YMMA 3FCEA 2BBWA 3N6XA 2MYPA 2CNWD 3IDSA 4B2YA 5G40A 2GDZA 2PX5A 1W4CA 2EL7A 2X0RA 1MB9A 1YMUA 3I0ZA 3SSAA 2XAAA 4HDOB 1N8TA 1ZHHA 1TEZA 1T2DA 2XZTA 1EHYA 2CLMB 2X40A 1H5UA 1S01A 4ZV7A 1FQJA 1JVNA 3R4VA 2W7TA 4ZWNA 3EGDA 1QIGA 4DUZB 5B6IA 2R0QC 1EK5A 4BNLA 3VR6D 4I08A 5BSGA 2PKXA 2BHSA 4FB4A 2QXTA 3LP6A 3TW4A 3G8YA 4OQZA 4P35A 3S2SA 3B8HA 2XITA 1C7EA 4GIBA 2V03A 4C01A 3I4CA 1RIFA 2XCLA 5SICE 2IIQA 4HWRA 5DHSA 1YR8A 2FPMA 2G72A 2BSAA 1QPGA 2HUNA 1PR0A 2CC2A 5ILQA 5D7NA 2JZNA 2VZEA 4XDYA 2OHOA 1VB5A 2YHSA 1U8UA 4COKA 1E3JA 3DOOA 2FK8A 5DWVA 5B58C 3FNHA 4HYQA 4M1EA 3KAQA 1GFSA 4NZYA 1V41E 2W6QA 2P8SA 3U3KA 5ANRB 3UFBA 1EWRA 3E2MA 4UTNA 1WVMA 3WY9A 2RG7A 4D9IA 5LA6F 4CHGA 5AM2A 3SWWA 2WB2A 4FUTA 4TKVB 3NEYA 1CY0A 2M1ZA 3LDUA 5C8ZA 1OX6A 3UMJA 4BJHB 1FRFS 1ECCA 3CH6A 3R9IA 3PP8A 3I6QA 3NETA 1M7GA 3TBKA 1U28A 1W5TA 2W48A 5JS6A 2Y1FA 5FO1A 1W6UA 4IR7A 2ATVA 1EWTA 2DFKB 4AO6A 4BWGA 2YXBA 1MH9A 2VG8A 1H0HA 3QEMB 2PUDA 2Y0PA 4R2MA 2BEUA 4F97A 1FK8A 2RC6A 3TH5A 3QVLA 1FZTA 3IXLA 1P3DA 3KJHA 3MPOA 3DTNA 4BKUA 4HX9A 3HDVA 5JAIA 1FTSA 1B6TA 4PX2A 1G8MA 4HB4A 4OK5A 5F7XA 3RHZA 3SQMA 3UGQA 3PEYA 1RQLA 1BN7A 1UMBA 1RI1A 3BMCB 3DAYA 3NYIA 4IHJB 4JL5A 3HXTA 4M38A 4NCKA 1KDVA 4YCSA 4QLAA 1EUDB 3GGPA 4INOA 1D09A 3JASA 3M1YA 1H42A 2CMGA 4MUEA 3F2IA 4NNOA 4U3JA 3BFXA 3BYZA 1R18A 5IFLA 3ZBQA 1EDBA 2WSIA 1M2OA 4YMLA 2EV9A 4F2PA 4MYSA 1UPCA 4FVTA 3BE5A 3HJRA 1UMCB 4EO7A 4EYKA 3MQFA 3ZVRA 2ONJA 1GILA 1I51A 4CL3A 4X85A 1IQRA 1XMPA 2HK8A 5D6NA 4K9KA 1SEPA 4M36A 1MT0A 4K6GA 5I9MA 3CRNA 2RHWA 4AQ7A 5EE3A 4F7DA 3PHGA 4RLHA 1BXGB 2J09A 3IR5A 5GTDA 4XDZA 5KTYA 4CGZA 2RD2A 1C5KA 4ZA2A 3ZQ4A 2AYYA 3WAJA 1QHNA 1XXLA 3WSTA 5M5BA 1DDGA 4GWGA 3NALA 4QOIA 2XIJA 4RL6A 3EIHA 1KO5A 4DABA 7REQ