1RXYA

E. coli uridine phosphorylase: type-b native
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
b'SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 90
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxyA00
1RYZA 1K27A 3NM4A 4DA6A 5B7NA 3F8WA 5F7ZA 4M3NA 1K9SA 3BJEA 4TTAA 3OOHA 1Z36A 1I80A 2A8YA 5B7QA 1PK7A 1RSZA 3SCZA 3KHSA 3E9ZA 2ISCA 1Z37A 1CG6A 1T8YA 4PR3A 1OTXA 5ETJA 4EARA 3KVVA 4JWTA 4TYMA 1T8RA 5B7GA 4TXLA 1RXCA 2OECA 5I3CA 3ENZA 1ODKA 5EPUA 4D98A 4OY3A 3PHBE 4GMHA 1Z5PA 1RCTE 4RJ2A 2QDKA 4OF4A 1NC3A 1JDTA 4MCHA 4QARA 4DABA 1OV6A 4TS3A 1Z5NA 4R31A 2OC4A 1PWYE 3T94A 3FAZA 2IQ5A 1A9OA 3MMSA 1NW4A 2A0WA 3BSFA 2HWUA 2A0YA 1Q1GA 1Z38A 1V2HE 3C74A 1YR3A 4QASA 4E1VA 1PR6A 4R2WA 4X24A 4H1TA 5EUBA 1V3QE 3FOWA 4BMXA 4L0MA 2QTGA 4OEHA 1OUMA 2QSUA 4KN5A 1ODIA 1RFGE 3EEIA 1JE1A 1SD1A 4MARA 3BGSA 4YNBA 3OOEA 4BMYA 3UAYA 4TXNA 3K8QA 1Z5OA 4WKPA 5CCDA 3UT6A 1VFNA 1LV8A 4BN0A 3OZBA 1LX7A 1YRYE 3EUFA 4TXHA 2HRDA 1JYSA 3IOMA 1YQQA 1Z34A 4L5AA 1JP7A 4DARA 4FFSA 4EB8A 1U1FA 1Y6RA 4I2VA 3E0QA 5C80A 1PR1A 2HSWA 3LBAA 1PKEA 4GLFA 1WTAA 5EFOA 1N3IA 3OPVA 1ZOSA 4WKOA 5JPCA 1Y1RA 1A9TA 1A9QA 4G41A 3U40A 1JDSA 1RXYA 5F7OA 4M7WA 3LA8A 3KUKA 1B8NA 1V45E 4L5CA 4IP0A 4DA0A 4GKAA 4F2PA 1A9PA 4M1EA 2I4TA 3DDOA 5CXSA 4NS1A 5CCEA 5F7XA 2BSXA 3OZCA 1ODLA 3GB9A 1TGYA 3FB1A 4R2XA 1A9RA 3DP9A 1XE3A 4DANA 1PR2A 3LGSA 1ZL2A 1CB0A 1JDVA 3UAWA 1U1GA 3PHCA 2H8GA 4QFBA 3DJFA 3O6VA 1OVGA 3PNPA 4LNHA 3P0EA 5CYGA 2AC7A 4YMLA 1TD1A 1PW7A 4JP5A 5IU6A 3NM6B 4F1WA 4DA7A 4DAOA 4TXMA 3FWPA 3OZEA 3ONVA 4P54A 1Y1TA 4NY1A 3BL6A 1NC1A 1V48A 3NM5A 1YQUA 5F7JA 1SJ9A 3MB8A 1U1EA 1VHWA 2QPLA 4QATA 1YBFA 1V4NA 1PR4A 5K1ZA 1Y6QA 1U1CA 4MCIA 3KU4A 4L6IA 5CXQA 5KB3A 1RR6A 3KVYA 2A0XA 1PBNA 1PR5A 3INYA 4NSNA 3EMVA 4TTJA 1OU4A 4U2KA 1RXSA 3PNSA 2B94A 4D8YA 4G8JA 4F3CA 1PF7E 2RJ3A 3DF9A 1VMKA 5F73A 2Q7OE 1Z39A 1RT9A 2XRFA 4D8VA 1ODJA 4LZWA 1VHJA 4GLJA 1K3FA 3FNQA 3OZDA 5CYFA 1U1DA 3FUCA 3UAZA 1QE5A 4LDNA 1FXUA 1JPVA 3KVRA 4TS9A 4F2WA 4QEZA 4D8XA 1Z35A 3EUEA 4F3KA 4LKRA 3IEXA 4WKBA 3E9RA 4WKCA 5F77A 4UC0A 3UAXA 4YJKA 5F76A 3QPBA 1Z33A 1B8OA 1OTYA 4L5YA 4DAEA 1LVUA 1TCUA 1ULAA 1PR0A 4D9HA 2P4SA 1SQ6A 3GGSA 2AI1A 3P0FA 1ULBA 4TTIA 4ECEA 1RXUA 1M73E 3ODGA 1V41E 3K8OE 2AI2A 1T0UA 1Y1QA 1ECPA 3O4VA 1JDZA 1JDUA 4QAQA 5F78A 2ON6A 1Y1SA 2HN9A 5B7PA 1G2OA 1A69A 1SD2A 3D1VA 4YO8A 2OXFA 1PK9A 1C3XA 3OCCA 4K6OA 4OJTA 2OC9A 1T8SA 2GUWA 4TXJA 1JE0A 4JOSA 1TCVA 4BMZA 2I8AA 1A9SA 4DA8A 5IFKA 2AI3A 2QTTA 4OGKA 4WKNA 4PNPA 3NBQA 4OGLA 1TGVA 4G89A 3UAVA 5DK6A 3DPSA 5FAKA 1T8WA 3TL6A 3OF3A 4LNAA 2PGAA
chains in the Genus database with same CATH superfamily
4X1YA 1P8AA 2BGMA 2YVKA 1ZH0A 3GRYA 4NMHA 4OK3A 1GPKA 2HWWA 3SFTA 3SICE 3NKVA 3SXJA 3UH0A 4P36A 4OLHA 4E15A 2JHPA 2Q4EA 1ZJWA 4YCLA 2I7DA 2VHCA 4J16C 4U7GA 5B7NA 2QXYA 9ATCA 1FSZA 5L7TA 1N9ZA 1D2HA 1XFAA 2NSJA 4V03A 3KXKA 2QG6A 5FBHA 3U4CA 1YVRA 2REQB 4NMWA 3L0CA 3I3OA 1OASA 5DCLA 2W6JA 4R7GA 3UJNA 2IUUA 1QQ6A 3S1LA 4Z4GA 1N33B 1E2BA 4G0ZA 4CU5A 1IIBA 1H9CA 5J63A 4ER0A 3T7EA 2QLLA 2JCGA 2I1WA 3A6GA 3LDFA 1XHFA 3HJHA 4GXRA 1T5HX 1M74A 1SIOA 5EE5B 2XGOA 1QH0A 2IOFK 3GJXC 4IH9A 4F11A 6ADHA 1ZZGA 4Q4LA 4KQEA 2L2QA 4JLKA 4UCXA 1NJGA 4ETMA 2HC9A 2VDWA 4G0YA 1SEVA 4IIFA 5DYIA 4BNUA 1UWLA 3MXTA 4QELA 2VJOA 4MJXA 4BFVA 4IX1A 5ESWA 3VO1A 2NMVA 1NSTA 4KX5A 4YAIA 3O03A 2D1QA 4XUGB 2Q2VA 4ISBA 4CV3A 3TPCA 1RI3A 4OG2A 4EKYA 4ZREA 3DTVB 3FMIA 1VYHA 1Z45A 2L18A 1EVIA 4IXDA 4E2XA 3QKSA 5LJLA 4IV5A 3IMGA 5FIUA 3RYFB 5CFPA 3ZKWB 4PC1A 3RIGA 5U9CA 1OXMA 1HFJA 3GXOA 4F1JA 4LXHA 4WCFB 2TS1A 2WU1A 2ZYTX 5DE3A 3C5CA 4HH3C 2ZE5A 2AFHA 4ZYLA 1P6XA 2Q0XA 4I55F 2QQ0A 4A6PA 3K53A 2WIJA 4OK6A 5EPUA 3H42B 3RODA 3DZFA 3FA2A 5CLJA 4BECA 2FJPA 3E7PA 4CLRA 1X80A 3EIOA 2O7VA 3P71T 5I9MA 3AY7A 3QYFA 2JIRA 2J4CA 5L45A 2XT0A 3CUKA 3F96A 4IIHA 5H5JA 2VDVE 1W36B 3QVXA 3RUEA 5CU7A 3MLEA 4M9XA 1PJZA 2GFHA 1SMKA 4N3AA 4R7TA 1NC3A 4WOKA 5ESRA 4ZK6A 3OPXA 4EG4A 2CLCX 1TYBE 1IQRA 1EGHA 1P77A 4G1MB 1E9DA 2B25A 2CXNA 2C9YA 5BYJA 4C3UA 3N59A 1TF5A 2AN5A 1ODCA 5D3KA 2O5RA 3N07A 1QF7A 4G4SO 1NDUA 3AF2A 1VKNA 3ETNA 4LMPA 4QYXA 4WWHA 4JFAA 1QYRA 1ZRHA 3T7KA 1Z4MA 1QG0A 2XSZD 2ZVQX 4RCYA 1FDOA 1W36C 5B3KA 2PUFA 4OO3A 4QIHA 4AT1A 4CM9A 3FAZA 3LD9A 1FK8A 2HGZA 2IZZA 1X7GA 5G40A 2FPPB 4ILEA 1YRQA 4WOBA 4ACAA 4YRMA 3BH6A 3RB8A 3V1NA 3OY7A 1FS5A 2LRHA 2HWUA 1QYXA 1B0AA 1A2KC 4UNIA 3T8YA 2ECOA 4GOMD 2IWHA 1KRWA 2CVZA 5KX5B 1FNSA 4DV1B 1QM5A 3ANSA 3F8TA 3GT3A 4HMPA 3RLIA 4NX2A 4KO1S 2GN4A 2YJ4A 1W1WA 5KTNA 4H1TA 1Q7EA 2V1UA 1GFWA 2O0JA 3SJ7A 3ZCVA 1CJTC 2J0QA 4GMDA 4U2DA 1FUKA 1PCXA 3DTYA 3U2QA 4F2GA 5LYYA 4C88A 4ENUA 4HB0A 4QOEA 5K6AA 3AK4A 2WM3A 2D4AA 2ZUCA 2MYNA 3AM5A 3AVOA 1EH5A 4LYDA 3A1UA 3RTCA 2B0CA 2QGZA 2YOGA 3MWEA 5COAA 3M6AA 4URFA 1SZCA 1W88B 2XIJA 2XCLA 1YS4A 5ILGA 1Y5MA 5GV7A 4AQDA 3G0IA 4E5UA 1HURA 2JJMA 3TIFA 1RFGE 3SEZA 4HXYA 1XB2A 4OBWA 4EGCB 2QXTA 4N65A 3KE9A 3RFUA 3IR6A 3W2HA 3WDSA 1EK1A 1I24A 4KE7A 5B6PA 4BMYA 2K2QB 2OMEA 4R8RA 2XXJA 5BYAA 3I6MA 1IBLB 4OB8A 1CUZA 5BMVF 4R6WA 4LBYA 2G9QA 4K46A 1JDNA 2OG2A 2X4GA 3WIBA 2SICE 2A9JA 5CPBA 3TUIC 2QAJA 3EULA 3QU4A 3WYEA 2FMXA 5JZSA 1T0HB 3C7DB 3EBLA 3JWGA 3DMDA 2ZANA 1P1HA 3GJ8A 4QXOA 2XCOA 3IL2A 4BN4A 3UC9A 4L27A 3ROZA 1QH1B 1U2TA 3OQNA 4RDXA 3IUMA 1CR1A 3WBFA 3ML1A 2HUNA 1SBQA 4I5FA 4R51A 1P1BA 2WSSA 3LT1A 3O8BA 2J5XA 3WWOA 1JEEA 4KZKA 3H05A 5ALGA 3PFFA 4W7HA 1J8FA 4FFSA 2FXVA 1PQPA 2B1JA 3DMTA 5H70A 2JLRA 1DIOB 2WM2A 5JSFA 1G8SA 1QPZA 3OSZA 2E87A 2RHMA 2AOUB 3NOQA 3P9IA 4HAOA 4NYIQ 4LSGA 3LFUA 5FUXA 4CODB 5LIPA 3NUZA 1UK9A 3NWOA 3BIXA 2P30A 4C3OB 4P5EA 1DFIA 4A73A 1FVFA 1PYDA 2ETVA 3V7UA 3SIWA 2ORWA 3E9NA 4FMBB 4KIJA 4J0EA 4AIRA 4QVKA 4DMFA 2E18A 1YR8A 4I4TB 4LV6A 4DLVA 2NG1A 4MV4A 5KOYA 2XVZA 1XWIA 3NONA 4MUBA 3K9FC 3N2EA 4D3SA 1KVTA 3Q87B 1A9QA 1B3RA 4H4EA 4HLDA 4B6RA 1VA5A 4PAQA 3F3MA 3R6TA 3NNNA 2WAOA 2NNLD 4RKQA 2WA2A 2C0PA 2GKSA 3G7NA 2NACA 3MS7A 1R66A 2HY7A 3CEJA 1YDMA 1EVKA 1FUUA 2AS0A 4TOIA 3HKBA 1U9CA 3IP8A 5FOVA 1MCZA 1XZDA 2NPOA 2XBMA 2QMUA 1WUIS 1BS2A 2G9RA 2J7PA 5BV1A 2IKQA 4L8YA 2XDQA 2H5EA 4HK4A 5CXSA 5DNWA 4JOBA 1SU4A 4DRXA 2PJUA 4KN6A 4P8RA 2QPOA 2B5WA 1P1RA 2CFCA 1HE3A 3IAS6 4FHGA 3R7NA 3TX2A 1S6YA 3UAOA 2N46A 3OZXA 2OHGA 1EK2A 4KLZA 5DMHA 5CHEA 1P9OA 4DNPA 4RSMA 5C1OA 4AJOA 1B76A 4DF3A 2OP1A 4CT5A 4RZHA 3PUKA 4DZZA 1W5AA 4P7GA 1ZRNA 3C0KA 3ETCA 1NXSA 1TL7C 5DW0A 3V4RA 2XD9A 1TT5B 3G02A 3EZ9A 4DQKA 5G0VA 2F8TA 1IY9A 3HEBA 2JARA 1Z6XA 2WJPA 3HA2A 3MCUA 3DLHA 3L8FA 4ZVNA 4YWHA 3I5YA 4K8OA 1EJBA 2KQUA 5IX8A 5BN5A 3OM8A 2G28A 2C83A 4NENB 3O6VA 4ZCIA 1KPHA 4L02A 4AI6A 3GA5A 4MIOA 5AKJA 3V8BA 1R5OA 1LLCA 1WUJS 1RXIA 2R8BA 1XXLA 3EHDA 2JFQA 4JV5B 1LPMA 3AWDA 3PRHA 4ZHQB 3NASA 4DKXA 1P91A 3HL4A 3A4IA 3BJIC 2Q3BA 1XMVA 3NTVA 3UWPA 5CURA 1F9AA 1P4SA 2FF7A 1IJEA 1CDEA 3FWPA 2O23A 1OC4A 2DHRA 3TR5A 3LYLA 1D4OA 1ISHA 2YYSA 3HA3A 4OI4A 2IZ6A 3VTZA 3LT4A 2BHSA 3I62A 2PEZA 3VTFA 2NLOA 4PZ0A 4C0KA 2P1ZA 3CSDA 3U4IA 4PINA 3W4KA 2PS9A 5KBYA 3AUTA 5IVHA 2V97A 2Q46A 3A2LA 3D3QA 2B36A 1NURA 4D81A 2V4ZA 2QG4A 4TN5A 1CT9A 4JJIA 5BW5A 1DKNA 3C7KA 1IY0A 1N3YA 3LOQA 1WSWA 4FFRA 2CHEA 1XRNA 1GV1A 4FYMA 4V1CA 5CH8A 4IY1A 3ZGYA 4IDQA 2Q0SA 3QQ5A 2Y66A 4BJ5A 2ORED 3BXHA 3FDZB 2ZXFA 4A2WA 5AESA 3UMYA 1SKMA 1EFRA 1TQ8A 5BOSB 4B4DA 5ADUS 2QUAA 1RTTA 3LY9A 1G60A 1UAYA 1L9KA 5KB3A 2JFXA 1A71A 4WE3A 4CW7A 2Z5VA 5J43A 3LP8A 3LRPA 1ZVMA 3ZWWA 3ICOA 2W2VA 3M4ZA 5E3IA 1AS3A 2QNIA 1RVDA 2FSUA 2I0FA 1CUHA 3CEHA 4EUNA 3OEWA 1JB1A 1WZUA 3L77A 1EEXB 4DCJA 2QRMA 1TA4A 1G8AA 1UM9B 1G5PA 1ZUNB 4C2TA 3CLHA 1X1SA 1ZM3A 1IUOA 4OFBA 2O59A 1WZEA 1IPEA 2D00A 1K7FB 2R6R1 2WHPA 2FCRA 2ZIFA 3AIIA 3FHJA 4XDGA 2NVUA 3CZRA 2FQYA 5HIMA 1D04A 3KPYA 5SY4A 1UJ4A 2WWYA 1XTUA 3SZUA 2QYHA 4GRAA 4NOMA 4N1AA 1VMKA 3NB0A 1RQNA 4OXYA 3OBBA 4MUYA 2WILA 2PZJA 4XUDA 5D85A 2HW8A 2QQEA 1DV1A 2FE1A 4IQ0A 4NPHA 3L4BC 5JD5A 3P32A 2ZWMA 4TS4A 1NYRA 4G5GA 1WMEA 2P1RA 2MOKA 3S2UA 4RU1A 1JA0A 4KHZA 5TT0A 3T7RA 4GKVA 3GFTA 5K05A 4MVJA 2D1YA 2ZW9A 1XEAA 4PW0A 4B45A 1R4ZA 2ODWA 1E2DA 3V33A 3VZSA 1NTOA 1XNGA 4Z7OB 4MDFA 1V6SA 3EC2A 2QT1A 3PQ4A 3WP0A 1JLSA 1COWD 3LW7A 1J33A 5DHPA 3VYUB 5DM1A 2PUGA 4H7IA 1ADBA 1CY2A 1YS9A 3FH0A 3O7MA 3OFKA 2D1TA 3AYZB 1E6CA 3ZWPA 4GXNA 2XB4A 1M8GA 1KI1A 4WASA 1VECA 4D8XA 4KO3S 1PLKA 2ISSD 5C8YB 5I7UA 1GXSB 2NV6A 1GUYA 3B82A 5BSGA 4L72A 2ZTSA 2CJYA 2NYUA 1FFWA 2ZS7A 3K92A 4LEIA 2I8LA 2QTBA 3ZZ0A 2G82A 3WNCA 4DRYA 4C9BA 1M7HA 2C2XA 3C87A 4QU5A 4KG7A 4D9JA 5E0KB 4EY4A 3DFIA 3DV2A 3B8HA 1GHTA 1ORVA 4LHZA 1P0QA 3RR2A 3ZS8A 2H7CA 2SKEA 2YV5A 1WB5A 2CDRA 621PA 4B7AA 1JI3A 3FWYA 3BE6A 1U7OA 2GK4A 1RM3A 3H2YA 3VM6A 1V26A 2A0FA 4JVNA 3QPBA 1MV5A 2W2LA 3OHMA 4M1TA 3VU1A 1ESNA 2SNIE 2O2EA 1YIOA 2P7IA 3J80A 4M1MA 4A6DA 4DAEA 3FCAA 3HDTA 5EHZA 4HH0A 3Q1KA 1I1QB 2Q6VA 1PR0A 2CLSA 3FPLA 3NHPA 2CFIA 2P4SA 4HZUA 5AICA 4YHBA 1A8UA 1QCZA 1TJYA 2QP4A 5BQOA 2UKDA 1LBHA 3U3XA 4ZO7A 5HOEA 1C3EA 4KJXA 5KQPA 2DPMA 1EFHA 1KY4A 3IPRA 4LBWA 2OKCA 2YXLA 4GDMA 4FZRA 2H1RA 4MI1A 2ADMA 1YTUA 2E82A 2A33A 1RRPA 2QZPA 2EQ5A 3ZDCA 4PCLA 2JHAA 3KTDA 2X0NA 5LZ2A 4GU5A 4L5JA 4CLOA 1NDHA 2WZCA 2XCQA 1GR0A 1II0A 3DEJA 4MAFA 2YNMD 1JHOA 4MMYB 4L2IB 2P27A 2PQ6A 1L5LA 3CB2A 3PDCA 1NU8A 4ZAWA 3WHKA 4HAVA 1NHGA 5KNBH 3KXLA 3OAAD 3G0GA 4QFMA 5C51B 5KYUA 2QTRA 1LDMA 2BMWA 5HM6A 1XIVA 1UK6A 3OTHA 1PEAA 1LC0A 3LUPA 3D1VA 2D7CA 2Q41A 4B4VA 1XN4A 2G70A 3PE3A 3STYA 3LK7A 3ENNA 4G09A 3SLGA 5ARBA 5EINA 4D8UA 3L0OA 3PD7A 5CB4A 1FQJA 2X22A 3EW9A 3TF5A 3EXFB 5JY6A 1V1RA 2GLTA 4LV5B 3PPXA 2Q0QA 1AZSC 4QODA 2IIVA 2R65A 2FPIA 2XQFA 3PGJA 4LHXA 1RC0A 4GZ5A 5ALLA 4J4HA 4C0LA 5KTRA 1QYWA 4MUXA 4MVJH 3E84A 3EFHA 3KIPA 4MWZA 2RHDA 1JFTA 1B26A 1SVNA 1CDOA 2X2OA 3QNUA 3N9IA 3PSHA 5IAKA 1CD5A 2JIBA 1MW9X 2YZNA 4FEGA 1E18A 4MYTA 1T0BA 3OOWA 2WABA 5I7WA 3RBZA 4OGLA 4E3ZA 3BE8A 5T6MA 5AH0A 1EFTA 1V9CA 4LWZA 3H2HA 2OUIA 3FKSD 2HKIA 4FMDF 4QX6A 3PFIA 4R81A 1MT0A 2PS3A 1U8XX 3LDGA 4CMJA 2R25B 1NW6A 5DK6A 1RQXA 2RGNA 1CU1A 4A5OA 3AM1A 4BJ6A 1Y82A 2XHEA 1RCUA 1JFRA 1S8OA 3F49S 3W8NA 1S8NA 3BDAA 4B5LA 4IIDA 5K0FA 3F97A 2P4UA 2I03A 1YQXA 2X7JA 3JAWB 2W6ID 3TPFA 4I1OA 4O2AA 2Q3CA 1S1CA 4URZR 1CUJA 5D8DA 1A27A 5F1YA 3X3HA 1O5TA 4GX5A 3HYCA 2LPMA 3F4BA 1PJCA 1MOSA 2O2IA 3BTOA 3OT4A 2CFSA 4MQLA 2HRCA 4KDRA 4WY8A 3W2EA 3KPJA 5I3ZA 5DM60 1CTQA 4B3MB 1Y8CA 4WVFA 3L8YA 1JQAA 2X9QA 1I80A 3WGJA 4GM1A 1YZNA 2E49A 3HUUA 5DBOA 2WTAA 5D87A 5AWFC 4NK4A 2NZWA 3P9YA 4NJEB 4AKIA 3B70A 1DRJA 3I2HA 1WV1A 3MCAA 1T5BA 1QHIA 1YZVA 3ISJA 3KC2A 4DQUA 3TG8A 4UM7A 3EWSA 1UBGA 1A5BB 2H00A 1JKIA 1YNSA 1JJBA 2R4UA 4FT4A 4I8XA 3RFTA 2M98A 3WGNA 3TECE 1B0UA 1B41A 3M9WA 1Q91A 4NVRA 2P69A 4EPWA 5IYZB 3MWFA 5IC5A 4FZ5A 2X5KO 2CHGA 4OJNA 4DXAA 4ZOEA 3JZDA 1N8KA 1KMIY 3CEPB 4S1WA 1MJGM 3P9RA 5HWSA 4PO8A 3HDGA 3ZN2A 1TF7A 3OLYA 2OLJA 5DGDA 5IT0A 4UVHA 4PPYA 5E9QA 5FLXA 1UC5B 3CPJB 5DWVA 2IPOA 5ANRB 3ESDA 3HHEA 4B2IA 1K3TA 3ZBPA 2ZYSA 2J5KA 5EIOA 4UUPA 1EHCA 2HA6A 3EN0A 4EW3A 3KJNA 4E13A 8OHMA 3EF1A 3ENZA 3ESAA 1WV0A 4UHBA 5FOSA 3REQB 1VKZA 3ZD8A 5JSYA 4OD0A 3H04A 3N8DA 3SKVA 1SU6A 4E2ZA 2UXBB 3OC0A 4GMHA 2OZEA 1HTWA 2H2AA 2QV7A 3AGPA 5LBIA 5D3QA 3JX9A 5CTAA 4X60A 5A3JA 5KVSA 3NT4A 1TYCA 4BO5A 4MCJA 1JX6A 3BYZA 1WF3A 3OJFA 1CUVA 3KFLA 3G5MA 4J0CA 3WB9A 4HMOA 4A8JC 4DMHA 2ZJ0A 4CM8B 2P3QA 4ZT2A 1UWKA 1ZKMA 4GYYA 3VO8A 1T1JA 4NARA 4BWVA 3UMMA 2H07A 3HCDA 3U6BA 4B6JA 3AVVA 1NQAO 1S3FA 2GRJA 1LSOA 5JATA 2L0XA 4EGFA 1OQAA 1Q22A 1Z68A 3AETB 4JU9A 3IULA 3A31A 3EX7C 1ZI6A 2OZLB 4TUYF 2WT4A 2B61A 3LQ4A 1E96A 3N6VA 4NCAA 5KAPA 1KO4A 1OZ0A 1T4MA 1SCQA 1Z2AA 3NRBA 4RVSA 5ENZA 1MIOA 1ONNA 4FD2A 4NKRA 5HBGA 2PFGA 1NMSA 4ZQGA 3LYUA 5HRUA 2HMWA 2P8JA 3OQIB 3TCKA 8ADHA 1NW4A 2YRXA 5HHTA 1K8ZB 2HHHB 1QZZA 3GGPA 3ZUGA 3SC3A 1VZ3A 1T2VA 1BO6A 4N0PA 3BF7A 2YRWA 3EISA 3JQDA 4U6QA 2P3SA 1OX6A 1GVNB 3DUFB 4CUJA 1M1XB 3Q11A 4KIGA 1IJFA 1SG9A 3D6VA 2AQHA 3LJKA 4LOHA 4E1VA 2B5OA 1AKWA 3PUIA 2YASA 3TLXA 4ALIA 4AZWA 1C7QA 2IOFA 1ETHA 2IRWA 5IXSA 2QK4A 4AICA 3LYHA 5AIAA 1NY6A 3E7DA 4Q9KA 3R24A 1D9ZA 1EB9A 2NOAA 2VPXA 4TQGA 5ERYA 3GHYA 3COSA 5ULLA 1VHQA 3K1AA 4IIYA 1U8TA 5T3YA 2DERA 3O73A 5B3AA 4B2LA 3E1SA 3HNPA 3PGA1 4H59A 1EQAA 4FEEA 4Y7CA 5FNVB 5J47A 1Y4DE 4RTQA 4BRUA 3LIIA 2IPMA 5JS2A 1VRVA 4OI0A 5ALWA 2XNKA 1PGOA 1UFRA 4X6YA 3PLNA 1VLHA 4FOPA 2UYQA 3NEAA 3QZUA 5EA2A 2GTIA 2RONA 2WUVA 2X3UA 4YDSA 1C8LA 3DHYA 3BD8A 4FCTA 1XJWA 3DG9A 1SG0A 1GPJA 2OAP1 4LISA 4BE7B 4S3MA 2ZM5A 4R5HA 2ZOSA 4RH3A 3PNMA 1FY2A 4R2MA 4YUXA 4K0KB 2ANCA 4H2DA 1U2DC 3FVQA 4K9LA 1H6CA 3T1VA 3FWZA 3HACA 4QTZA 1LV8A 1L5QA 3TZBA 3N39C 3TLAA 5I9LA 4NDZA 5J59A 3IBGA 3EUFA 1YRYE 1Z7GA 3BVPA 2FMHA 4FHEA 4D3FA 2XT9A 1NUQA 3HJCA 1CUBA 4AMZA 4B8ZA 1DZIA 2AKYA 1NJ2A 1VP3A 3E5MA 2ZITA 4UBIA 3ZKAA 2HD4A 2WMYA 1VLVA 3A25A 3HWX1 5ICSA 1QU2A 3RTAA 2Z6AA 3VNBA 3VISA 3IYLW 4NBVA 1ZPDA 1E9FA 4AJLA 1KY5A 4CKZA 2E4UA 1Z07A 1XF1A 1UBJS 1GSOA 1P0IA 1AG9A 1V9SA 2XI4A 3LUJA 4O0LA 4O2LA 2YDYA 1Y6RA 4XE5A 5JW6A 2YFQA 2VUHB 3LZCA 3R5HA 4ZPXA 2QJFA 4ZGBA 3EGIA 1ABEA 2P91A 3MYYA 3ZTYA 2QUZA 5F5LA 5L40A 4OHVA 4GP9A 1MN6A 1U6IA 3PIRA 4FFDA 2ZDQA 1EIWA 4FGWA 4NBKA 4MHSA 2B2XA 2EP7A 2VQDA 4CKWA 3IODA 1IWOA 3HY4A 3JU3A 1PNQA 2XMBA 1NDQA 3X0DA 4YBRA 3GZTB 1EP9A 3CRZA 3OQOA 5DTIA 1XLTC 3EF0A 2FRDC 3JQ6A 4F92B 2XNSA 3Q3VA 4AKGA 4HQ0A 1NVBA 1ONOA 5HCUA 1MU0A 3ZJVA 2GN9A 2IYXA 4HOYA 5MN6A 1GUFA 1ZJJA 3AZOA 3GJ5A 3HZRA 3DCYA 2QD2A 2ZVPX 1L7VC 4DREA 2V7BA 4U3JA 3VZCA 3ZE1B 4ZQFA 1PSZA 2G0TA 2VF2A 3I4LA 1S3SA 1JMKC 3JR7A 1WPXA 3KLBA 5FL3A 3UXEA 5D01A 1NT2A 3MIZA 3WXMA 1ZD2P 3VDRA 1O9GA 2EJUA 2PMBA 2QORA 3WAGA 1WMFA 4D3YA 5LA6A 4B6QA 3HDVA 4D42A 1FW6A 1IZ7A 2RI1A 3UXMA 2PNFA 3SHOA 4HNSA 1B4DA 3VSBA 2FSVC 1N34B 3U9LA 3E8SA 5EJFA 1J9ZA 3A6LA 3F7OA 2BM0A 2VHQA 1VPVA 4EF5A 1XZPA 2Z30A 2P2CA 4Q7EA 4LJYA 1E64A 5KU1A 3WLFA 1I2ZA 4M9QA 4AJ2A 4DZRA 1EIZA 3LKZA 2GI4A 1EAYA 1KI9A 2VH5R 2OQVA 4I1VA 5FEUA 1KTIA 1WMDA 4EI7A 1L9XA 1ZSVA 2GJSA 1NAIA 1VIYA 3PHCA 1W73A 1X19A 2I6UA 4AROA 1GN9A 2BSAA 3KSUA 4C7OA 3H9CA 4BKMA 3PNPA 4XWAA 4LNHA 4EUFA 3AF6A 2X9NA 1TD1A 2JVJA 2NQ8A 2FZ4A 1NF2A 3PCXA 4UZFA 3ZWDA 2PRZA 2WJIA 3DFFA 1RBQA 5GMOA 3JRWA 1F2UA 4JBXA 4PTZA 5FV4A 4OUDA 1KEUA 13PKA 4TXMA 5AM0A 4W5WA 3ZE8A 1UT5A 4BRSA 3H8WA 4J2OA 3PJDA 1TO2E 2Z2JA 3PEYA 3GD7A 3I61A 1NBIA 1IBMB 4LK3A 1F14A 4RW0A 2WB2A 2B34A 1KOLA 1RLIA 1CJSA 2PZGA 2ZIGA 4JROA 3ROQA 4CQMB 1F9EA 4EY8A 1KWGA 4GPBA 1IZYA 1R3UA 3VJKA 4N8DA 3V9PA 2OOSA 2HAEA 3F7NA 3C8ZA 2WOOA 4BJ3A 5JXGA 1USIA 1GKIA 1O95C 2PXHA 1MO2A 2QZ9A 3KKZA 3LL4A 1F8XA 1LLFA 4FOLA 2GRAA 3O91A 3Q7EA 4RESA 4M8LA 2OT3B 2V7TA 5GZ3A 2JJ8A 2HF8A 5LYJF 1YHNA 1V7PC 1NV8A 1ZAKA 1QB8A 2FWMX 3AL0C 1JMYA 1SPBS 1E1KA 5EP2A 4YUAA 1GL7A 5DRTA 5JDIC 3QVKA 5EE1A 1E2HA 1HQDA 2QGFA 1D1SA 3EDCA 3OMLA 4M8KA 5IVDA 2QI9C 1NXTA 1Q0HA 3AEYA 2A0XA 2RHGB 1JB9A 1PR5A 5AVUA 1VJGA 1AO0A 1TM3E 3IMEA 4IMPA 1H0HA 4H0FA 3PC7A 2FP4A 4BQRA 4JYZA 1L5FA 4BO6A 1Z3IX 4EYGA 2UXDB 4GYKA 4TMXA 5F33A 1Z06A 3CWQA 1XNQB 3OSUA 3D3KA 2O2XA 3MQ4A 4FSDA 3S1SA 2LWIA 2AHOA 5G4KA 5K4GA 5TMBA 1R7RA 3ZIAA 1CR4A 1KJ8A 1FBTA 1OU0A 4PO1A 3WL5A 1SUPA 5IBQA 2OAGA 4XUEA 2PPVA 2Q4TA 2QIPA 4MOWA 1RI4A 3K9WA 4MW4A 2CLEB 3L6BA 3NYIA 2W2OA 1HNWB 1P1KA 1OHHD 1Z39A 1M1ZA 3BE5A 4WH0A 3OUZA 2QTZA 2XGMA 4MA4A 2ZG6A 3P2JA 2JGJA 4RABA 1N32B 2VWQA 4IXNA 4GLJA 4GUAA 3UK0A 4HWKA 1TZCA 4GE0A 1WHSB 3FMGA 1GUDA 1TM2A 3WV5A 3ANMA 5BUQA 5LOVB 1NXPA 3N0TA 3LUFA 5LZ5A 3LKBA 1QE5A 3V7YA 2V0CA 2BGWA 2O07A 1H1TA 1C9YA 1NSYA 4Q3DA 1UBFA 3OECA 4PXAA 1RI2A 3ZDZB 1II9A 1NLMA 2RARA 2WBLC 3AMVA 4NQRA 2VHEA 3OU6A 3NCTA 5TGZA 1JFFA 1Y5RA 1GNVA 2EP8A 1G17A 1Z0SA 1G9TA 1ZU4A 3BHMA 4JMPA 2IU3A 4WK0B 1OIWA 1G1AA 4LKRA 4BDTA 2GNPA 2YR0A 3KB2A 3CC8A 4WKBA 2WPDD 1AX9A 2C0QA 1PT7A 4YMIA 3SM9A 4BHTA 1YKGA 3E9RA 4MW9A 4ZCPA 3KOYA 2C4KA 3ACBA 1JLLB 3EQ2A 4HGNA 4RF3A 4CFYA 3I45A 1R6XA 3IA7A 4JQCA 1RQLA 1S7GA 1P1IA 4HFMA 4OLJA 2ZEJA 4QYSA 2R8XA 3ER9A 3QELA 4PSKA 4E6PA 1L5NA 3KKNA 1RHMA 3UANA 3R9XB 1NOJA 1DX6A 4LQDA 2ZR7A 2BZ1A 5BPFA 1KKLA 1Z33A 2VH1A 4YCMA 2I6SA 1TF2A 4B3XA 2G1UA 1CV2A 1EWYA 3S0JA 4QTYA 2EF1A 2OGUA 4KFCA 5IAOA 1KC3A 3ENQA 4CMIA 4ZHSA 4YRPA 4ZKDA 2XA2A 2ZRKA 1BXRA 1KA9H 1ULBA 3CH7A 3PXEA 4BX8A 4GOJA 4XVCA 2CUKA 3KE8A 7ADHA 2PIAA 3TLGB 3TW8B 1X7ZB 2MSCB 3VC7A 5JI3E 4BXOA 4FGLA 5AHRA 2ZR0A 3WQSB 1JZSA 5T8KC 4BGDA 2I6XA 1WVIA 2D0IA 3NTRA 4DCVA 4MV6A 3VDMA 1JKMA 3QPWA 4E12A 1VL5A 3FPCA 1A50B 3RRZA 1UXHA 4V38A 3WGMA 4QAQA 1UINA 1QOQB 3T1NA 1M34A 2P0AA 3G5UA 1STOA 1CQIB 4LMBA 3P2KA 4OSEA 3MJTA 1MB9A 4H7PA 2I4RA 2QTNA 4UW9A 4B81A 1QG2A 3M2PA 3CVWA 4L28A 2MYPA 1SXJB 3Q0EA 2ANBA 3O26A 4MLDA 1DRWA 1OXKB 2WSLA 2FMFA 2H4ZA 1SD2A 2XDWA 3EVFA 3HWRA 3P19A 1VM6A 2BKVA 1NY5A 4OB6A 1M6VB 1J2TA 1NQUA 1KU6A 2I33A 2QQ5A 3DKPA 5AK5A 3GR6A 2BR3A 4YMSA 3Q3EA 1JVBA 1VXRA 3VHLB 2V8OA 4A10A 4DZTA 4F3CA 1XPUA 1LQTA 1B15A 2PKQP 5FB3A 3FVRA 2P9CA 5JAZA 3COWA 3W3AA 5EESA 1OA1A 1Q1ZA 3B36A 3A1VA 1XTIA 2GUWA 4PSVA 5TPWB 1BVHA 1A88A 1E92A 1N2CB 2A5LA 4OKIA 3TTXA 1ZSNA 3QVMA 4DWJA 1AQUA 5A3VA 1SXJC 2G7MC 1RYMA 1RZUA 2ONJA 1D1PA 4ZVRA 4TM8A 2BT4A 3W7VA 1XA0A 3N7AA 1PQYA 1D5WA 1TAUA 1K97A 1U7DA 4KFSA 2Q5HA 2EFEB 2IH5A 4WKNA 3FG9A 3FY4A 3R8CA 5K0GA 2DSTA 3NHFA 1MD9A 2Y4OA 4I81A 3C5WP 4P7JA 1KU0A 3HWWA 4JSYA 4JLDA 5EJGA 5FOTA 2VYNA 3QU7A 2BMEA 3BGWA 2QE7D 3IKMB 5LQRA 2CD9A 3LVRE 5JCJA 1KDTA 1NN0A 2P1DA 2IYAA 3BWXA 5AMXA 2FEPA 1V35A 1PLJA 2B4AA 2ZRCA 5JD3A 3U17A 2BI8A 2G67A 1GPYA 2CN1A 1QFSA 2FW8A 3AXTA 3NPMA 2HQRA 1L1QA 2IV3A 1ZIDA 2PRJA 1Z17A 1HBJA 4CMEA 2VJBA 4JL6A 1Q0LA 1UODA 2CLDX 2HNAA 3H5NA 2WJGA 3LAWA 4HH1A 4UHKA 1YR1A 5EJ8A 4DA6A 1VLJA 2ECKA 3WQRA 2LR0A 4Q3BA 1SBHA 4YEDA 2ZBPA 1BW9A 2I3DA 3KPUA 3OOHA 1L4KA 4GX0A 4YP0A 2AFIB 1SBIA 1QTIA 1F6BA 4QWWA 4CM4B 4PBSA 1PS9A 5KTMA 3P2YA 2XXAB 2QN6A 1JQEA 2Z04A 3GCZA 3LU1A 1IXZA 4IOKA 1NSFA 2NUPA 4N7RA 1QFXA 4XUCA 5J9FA 2BGLA 3FSJX 2I2FA 2JIZA 4FI3F 3DL2A 2ISCA 4PQEA 1YDGA 5JZBA 1MGOA 1ZGGA 5C0OE 2B4YA 1UXOA 2I78A 3A3KA 3GRAA 5IVIA 4BKOA 1YRLA 3IUQA 2VKTA 2C2OA 5I5GA 1W47A 2B99A 2WFLB 4RD3A 5KINB 3TZEA 1CK4A 3IBFA 2PJDA 1XP5A 2DRIA 2J33A 4AJHA 5ITVA 4C1BA 4P4TA 2YN2A 1L2TA 1OREA 2H2IA 3F1KA 3H86A 3P45A 4HN4B 4RQAA 4Y2RA 2QTHA 5EHNA 4Y0VA 3U49A 1DAEA 4XTCS 2WDZA 3O2SB 5B5SA 2Y0EA 2Y27A 2O7RA 1VE1A 2RGEA 2UYHA 3PYXA 1TZMA 3EASA 3ZQ6A 3TQSA 4KMOA 3TL2A 1UBOS 1UWCA 2JAHA 2WI8A 2FUEA 1EA7A 2H9AA 3V7FA 3MMZA 3VOSA 4URXR 3RUFA 1WBBA 4V24A 4UTZA 3ORHA 3R09A 4AF8A 3WK4A 3REGA 3H18A 1NM5C 4EJSA 2MDTA 2ADOA 3T1YB 3B1FA 4OF4A 2GA8A 2R6GA 2F1OA 5DSTA 1B2RA 1MV8A 5KJCA 3K9LA 3K1TA 5G0SA 2PUBA 3TDNA 4HGZA 4UULA 3DWFA 5TB5A 1XYVA 3QYAA 5KNCA 2X19A 2ZQZA 1ZLYA 4B31A 4RY9A 4HLNA 4QDJA 4G67A 4RENA 4KL8S 4NZ9A 2QW8A 4WLNA 4ZAGA 3HVJA 1WSDA 1QDEA 1YE8A 1GP2A 1BU5A 3LCVB 5CB0A 1OTHA 1YD7A 3D8UA 1RPNA 5KWVA 3BWDD 4MI6A 1D2RA 2D0OB 4JHXA 3PVCA 1Q0QA 4UEJA 1NU6A 5LLSA 1X1QA 5GONB 5TQ2A 2JHGA 1L5MA 3HB7A 3W5BA 3CYFA 3NOXA 3SK0A 4I08A 2Y0BA 1LFDB 3JSAA 4R9NA 2F3SA 4EL5A 4ROTA 4FFWA 4BNVA 4KWTA 3RRBA 1E8DA 2ZUTA 1XQYA 3VX3A 2GLUA 1KI6B 5GWXA 2F9MA 2FEWB 2QJTA 3PNKA 4RZXA 1JHQA 5HYVA 5TNXA 2X9VA 4FFMA 4NZMA 5JDCA 1PJTA 3WG9A 1XTSA 4RJLA 4ZAZA 1VPTA 3Q0IA 5FAKA 1BFUA 2ECQA 5BWLA 3CU5A 1O0CA 5L3VA 4R9UC 1NE2A 1K06A 1Q1AA 2VP9A 4PPGA 4TKUA 2YHIA 5EE3A 3BILA 1EGMB 3GQBB 4QT0A 2CJWB 3T4UA 1NZDA 3AI3A 4AUKA 3SR3A 1Y63A 1QG6A 1TLTA 3AQ4A 2GNAA 1DIAA 5AFSA 3CX8A 3RNOA 4MB2A 4Y2GA 2XTMA 2Q3DA 3FCEA 1AB5A 1GG5A 3CNEA 3QVGB 4BLRA 4ZU6X 4FMCF 2P5UA 4YUWA 4INOA 1WY7A 4G5OA 2JGDA 1A8IA 5CVUA 3P7MA 4MVYA 1C1XB 5JRZA 2PA0A 1L4EA 4DWVA 2HU5A 1TC1A 1SELA 4GOKA 4JI5B 1U0NA 4PS1A 4V3BA 3AKDA 1YJXA 4ZALA 5BWCA 2II6A 4ZIRB 1Z5OA 4U7HA 4CVNA 2R00A 1TU3A 2AUTA 3AESB 4EKGA 3G8DA 5B58T 1TADA 2R44A 1OX4B 1QANA 3KHTA 1O58A 3BMCB 4MYDA 4RD6A 4L73A 2DQYA 4JIGA 4KN9S 4OFXA 4RHUA 4I9GA 3A10A 2RE8A 1R0KA 4MR7A 4PZPA 4MV3A 2HRDA 4ZZIA 4WERA 4WZZA 4CIWA 3FBWA 1XDSA 4P4LA 5KMGA 1G6HA 1WIWA 3DW1X 3CKLA 1UEJA 4ZMSA 1XR3A 5CFRA 1QTNA 2XX3A 3KAQA 3FX2A 2CUNA 3H5OA 4K86A 5CTJA 4CG2A 3FGZA 5A9RA 3A2NA 2O3JA 5D2CA 3BH0A 5FPHA 2FSIA 1EA5A 1O9HA 2R8OA 5FI0B 4XX0A 3BGDA 4BEBA 3DMFA 3IAUA 2AG8A 1MBZA 3HPQA 2GJKA 2O8VA 4HGOA 1PR1A 4NE9A 4XB1A 4OQLA 3OF5A 4ZVKA 4HUQA 1QQAA 4W5TA 2QAIA 1XPRA 4G23A 3GCWA 2H51A 2PV0A 2RGAA 4IGKA 2FA9A 1V4VA 1MJGA 1ZHFA 2Q1SA 4CTKA 2JLUA 3B3AA 5DNYB 2H4JA 4J1TA 3ZX4A 4EH1A 1B23P 1Q0RA 1G55A 1G8PA 4Z8YA 5ALEA 2ZS8A 2F3PA 2QX8A 5EZ5A 3T5GA 1QPBA 3K5IA 1KS2A 1S96A 1T4BA 1L4FA 2DE0X 3IX7A 3KJQA 1OCEA 2IU0A 2I67A 1X7XB 2CEAA 1NYQA 4IMIB 4ZOLF 3T52A 2PO5A 1PG2A 3QHAA 4ND2A 4FCCA 1XCGB 5E2BA 3UA3A 3BEDA 1N2BA 1QCDA 4A26A 1E3WB 1TO6A 5GAJA 4F2PA 2FMKA 3D6UA 3E9EA 3IUSA 2OAEA 3VUEA 1PFQA 4X8MA 4YPFA 3R5XA 5LQNA 3L4KA 3WSVA 2AYYA 5B4UA 5DASA 3NVKI 4E11A 2PKYX 4D4JA 1JQLB 3WLSA 4DXHA 1XDUA 3KWFA 2HO4A 2ZSAA 3O8NA 4Q4JA 1XZFA 4DNQA 1KH3A 1UMKA 2AZXA 1FCJA 2C4HA 3O38A 4BPBA 3VR5H 4DHEA 3QXJA 5I48A 5EJMA 2HCTA 1G18A 3LX5A 3HTXA 1MNAA 5L3ZA 3OD5A 4BKUA 2P4QA 2HMSA 1MQ9A 2ZBVA 1IHXA 4BNTA 3H13A 5ISMA 3A9VA 2BAGA 4U39A 3RVNA 2PHZA 3IPXA 2GPYA 1E4YA 3BPSA 2HIGA 3LGSA 3GRVA 1MDBA 4HLUA 2QB5A 5KJ6A 3FTPA 2O2JA 1Q12A 4XPIB 4WBNA 1KI7A 4XCVA 3VNSA 3L0IB 3RO7A 1DEKA 2X40A 1Y5IA 1EUDB 4KDCA 4QNNA 2WSYB 3P0HA 3CMMA 3ZH2A 5HE9A 1QRAA 1CF9A 1PX0A 2MR6A 3FYTA 4YCCA 1ZA1A 4BO3A 3A1SA 4WK2B 2ONZA 3RC7A 4YP5A 1NJFA 2GD0A 3SYKA 5CK5A 5IKXA 1EWKA 2QYSA 3AHIA 5KQSA 1QR2A 3NKLA 1J0CA 2ACEA 4YAEA 3ZIUA 4RLQA 2GHRA 2AK3A 2BFDB 3UK7A 3T9FA 4UU0A 1DUVG 1GG9A 4ANFA 4RIHA 3E3MA 2PQMA 4M22A 3AJDA 3LVFO 3DKKA 1CZHA 4P2GA 4QGBA 4YPVA 1Z2CA 4LRQA 1Z6YA 2AG1A 1PR9A 2D74A 1OAOC 1FE8A 1N5MA 2NYVA 4BX3A 5C7IO 2A1UA 3HKCA 3MF4A 3QEJA 5CLIA 1G5FA 3WICA 5AUQA 2WWHA 3NU1A 2HYIC 3RJTA 3N75A 4YCNA 1ONBA 2Z2IA 3E22B 3P5SA 2ATCA 3F9CA 3TZHA 4WY5A 1XAGA 1QB7A 2Y0PA 2IPXA 2Z2XA 3E1GA 5F7JA 3W6OA 5TF4A 3S2FA 1KZ1A 3JASB 1SHJA 2IE0A 2RGRA 2QX6A 3RGWS 1G20E 4B85A 5ERXA 3VR4D 1BCRA 1QHYA 1FJGB 3KAJA 4XYMA 2XWPA 1W25A 2FFBA 3OQHA 2BFFB 1N5DA 1Y6QA 3DV0B 2AH5A 2R47A 3OZWA 4ZEOA 1ISMA 3FXAA 1XZEA 1XZKA 3OA0A 4P4GA 1LEHA 1JKJB 2PH7A 5DXFA 4HDNA 1JHMA 4Q66C 3EXIB 2ZTMA 1GO2A 4KV9A 4QWMA 3TTVA 1SC9A 3EG9A 4F6RA 3I42A 1OAAA 5DT9A 5MFZA 3G2QA 3Q7PA 3TW6A 2PZFA 1XCMA 3K6RA 2XGGA 4YJ3B 2BF4A 1XDGA 4POOA 5CEJA 4TTQA 4XYEA 1B00A 1W4RA 5EIEA 2G09A 1O03A 3FTNA 3AI7A 5IDQA 5K3SA 1RHKA 3LLSA 4ND1A 2OGWA 3FVVA 4LF6B 1A7AA 2IA5A 1U2PA 1XWFA 1X92A 3PQ5A 1SBYA 4KYIB 4NBLA 4WZAA 1I3OA 2IE8A 3HFJA 3HSKA 4K9NA 1X2EA 1W1IA 3G7SA 2XY4A 2X4DA 2NXEA 3EGWA 2VJPA 1EFPB 3QTBA 1J2JA 3QX3A 1NHWA 1H5QA 3T34A 2FJUA 3RFXA 5IJ0A 3CVOA 2Q1UA 1M2WA 2J9GA 1ZK1A 1NV9A 1B8PA 2PS1A 3I01M 3IPCA 4Y3UA 3SAJA 3C41J 4RUKA 4B4UA 1CEYA 2M2IA 3TIIA 1D4AA 3DCNA 4CTOA 4YJ2F 5B6IA 3O75A 1J00A 3FOCA 4O4IB 3KYJB 3D1JA 4EW2A 2Y9MB 1CR0A 2AQIA 3W1WA 4YRSA 5KIAA 1O8CA 1U1DA 2IF0A 3MAGA 1OLXA 4OGFA 3NAMA 3QXGA 2XECA 2PN1A 3K8YA 4IIVA 4FPXA 1TJNA 4RZIA 2BTQA 1XXHB 4CG0A 3AV3A 4O4JA 4AUMA 4LF7B 3RVRA 1P19A 1Z47A 5AM5A 1VLMA 4KUHA 3ZHRA 2V65A 4HGPA 2W5UA 3FR8A 4E3WA 2GPAA 4I8DA 3U3RA 2TRSB 3H6KA 3WB2A 4EGAA 4ZZ0A 1BQ3A 1CQPA 3B38A 3WWEA 3OFND 4ZAVA 5A5DA 5KEIA 1ZNWA 1Z35A 2P9JA 3C3DA 3IUEA 3JD4A 3M34A 3NAQA 4QQFA 2ZT5A 1FTYA 1ZW6A 2BR4A 2Z9CA 3UMJA 3FWHA 3A14A 4AN1A 2NTYC 1OI7A 3H7AA 3LC2O 5KSOA 2Z98A 1OT3A 2CYCA 2JFUA 1QMGA 3C70A 4UBLA 5COBA 5BNFA 1OWPA 3UOGA 4RVCA 4WOPA 4PGAA 1UPTA 3BRWD 4NZYA 2H57A 1MVLA 2WF6A 2XYPA 4LTDA 3UAXA 1VGQA 2V8BA 3IV7A 2MCFA 3ZGLA 1UXGA 3ZOZA 4WDQA 4XVRA 3LS2A 1G7CA 2EX0A 2WHRA 2XTJA 4FD3A 2GZAA 2WUGA 4PQGA 4BO1A 2IP4A 1DAMA 1ZGCA 2I87A 1VJ0A 1O4WA 1YJ8A 4NL4H 3QU5A 5BSTA 1PUIA 4CF6A 4KR2A 2NT4A 2IX9A 1XL0A 2XZTA 1H0KA 2FQ1A 1R16A 4P34A 3PFNA 2WHYA 1ESDA 3EFBA 4TTIA 3MJCA 4DGSA 2YICA 3EGOA 3ZCSA 1M75A 1P39A 3HRHA 4MZDA 3R76A 4DB4A 1EBBA 2KI5A 2VNJA 3ZW8A 4I50B 2NXNA 3GDHA 1GNLA 2GO1A 3A6FA 4OP2A 6NULA 1IB6A 1CDDA 1RYBA 4JR2A 1JHRA 1L1FA 1DQNA 3AOEA 4H1VA 1DFGA 3L6OO 4YK7A 2BC9A 3AV0B 2BP7B 2DBQA 1JDZA 3PPIA 4ZVTA 4RY8A 1JDUA 3BXGA 3DKIA 1S89A 3NXKA 1VOTA 3K0AA 4KB5A 3VGPA 3DAFA 4V0NA 3ZR4B 4GO1A 1RP1A 4BBAA 2AE2A 1X7DA 5DGIA 4IHJF 4DDUA 3TTWA 3LI2A 3O95A 1CUAA 4PHGA 5AT1A 4M7RA 5F5NA 1VSUA 3NTLA 2WT8A 4WFQA 2W48A 1V2GA 1KJZA 2Q29A 4W8GA 4ZVMA 1TM7E 1MF7A 5BOVA 5AK3A 3WADA 2GBCA 1JALA 3CQ9A 4DWOA 1RC8A 5HW0A 1G5TA 4KFRA 4DXDA 3M8KA 3QX8A 4I5EA 1MX9A 4IYRA 4OGWA 5KVCA 3WK8A 1T2CA 4B7XA 3T7TA 4Y98A 1APBA 2AC4A 1H1LB 3WP1B 5TGDA 3OX3A 3RIYA 3O3OB 2IU6A 4LGVA 2C5BA 1CZKA 1E60A 1UADA 1WB4A 3FFXA 3OZGA 5PNTA 5C5EA 1N0UA 5HG0A 4KITB 1FOEB 5DLYA 2NX2A 4L07A 1WG8A 5GZ6A 1A9SA 4EFMA 5LPNA 1P75A 2QBYA 4O3MA 1FIUA 1RWVA 4L8FA 3KJGA 2P0YA 2QUKA 2W2PA 2F3RA 3TMKA 3FCYA 3FDJA 3TTSA 4MZXA 3KXDA 4R40A 4YCBA 1TEZA 1MDFA 2GEBA 3K0FB 4YAGA 4HWGA 3NUGA 4YUVA 3W77A 2VF5X 3CIOA 3ZU6A 3K70B 4CFSA 2DHDA 2CBGA 1ZGBA 5L6MB 1P7PA 3WNVA 1BZYA 3NIBA 2TMYA 3NWJA 1XROA 5KDLA 3ADPA 3OJOA 1F8UA 4WNAA 1JZTA 4EVRA 3JQAB 2Y6UA 3DFUA 4FW9A 3LQFA 4MGEA 1F0PA 3P9NA 4D9NA 5AXAA 5KO2A 1R12A 4YRKA 3K70C 1T36B 3ZJ5A 2GPSA 1JH9A 1X2BA 1RWKA 2Z2KA 4AY2A 4RSGA 2YIDA 1V7ZA 2VNSA 3WLOA 4WNYA 2AXEA 4EL0A 3WFIA 2PANA 3JQ7B 4Y9DA 1AKNA 1YZUA 4BEJA 5B58C 1E3EA 1NVGA 1CLEA 1FTNA 2R1VB 4CTNA 4ZRDA 2B30A 4ND8B 5I47A 1NPYA 3AO0B 3DLPX 3N8HA 3ZEIA 2ZYWX 2D5CA 3JALB 3ZWAA 3B89A 3UJAA 1SQ5A 1ZOOA 5JASA 1Z4LA 2AOUA 4XOUA 3TBHA 2G1JA 2OVBA 4BV3A 4DFDA 2HJWA 3BBPA 2GMWA 4WLOA 1C8BA 1FFBA 3QF7A 4FZVA 2I9PA 3GA7A 3I2YX 8ABPA 2J0SA 3WWPA 2BFMA 4O3FA 4CL3A 1Z4QA 4EKDA 4KRYA 5AM1A 4CMBA 2BUBA 4N47A 1FRQA 2PL1A 4PN7A 4I4TA 1E2FA 1QZXA 2WKWA 5ETJA 4L8LA 5LXTF 4I6JA 4BGEA 4NDAA 3KOMA 4RVDA 2ZZMA 2XKBA 1I30A 3H9JA 3PBKA 5ES4B 2IUTA 3KQVA 4Y18A 2C61A 3GXBA 4TSFA 5F23A 3EVNA 1CEXA 3KUXA 2AN3A 1T8RA 1ZHHA 2TMKA 2ZSBA 2C4TA 3HS3A 1YMQA 1RXCA 1LSUA 3K7EA 2ZKLA 3EDOA 4QVGA 4Z9YA 2IS2A 3HQ4O 1C5KA 1DBWA 3PQ2A 3R3SA 4J0JA 4UFOA 4HEA6 4R3UC 1CB7A 1X3LA 4U2FA 5TGTA 1UKAA 4HWSA 3RPEA 3TQHA 3ZI7A 5ES3A 3G2KA 2GPWA 3DE0X 3WMXA 3WLMA 1JEJA 1USWA 3CX6A 3OPQA 3Q10A 3U0BA 5K6RA 5CGQB 1CY6A 1TU0A 2IEIA 5EE9A 3O8OB 4R84A 4WESB 3VZPA 4JXXA 2AUMA 1R0BA 1CHNA 4DIOA 2F8SA 5J2UA 2VPPA 1YHZA 3G7UA 3WBBA 2QDKA 3HCPA 1JPUA 4BGVA 4JYAB 3Q2KA 2C3YA 5L3QB 3ZV5A 2D59A 2Y1OA 5GV8A 2HSZA 3R3WA 4L0QA 2AWOA 4DWWA 2ZU6A 1M2FA 1NN5A 3PPVA 3QSYA 1YI0A 4R9RA 4ER3A 1OV6A 5F1PA 2IHZA 2OYSA 4NMMA 3VVLA 2FF5A 5B1DA 4Q4AA 2Q4OA 3AXSA 4Q1AA 4RJKA 1L5SA 5AM2A 4IL5A 4PAGA 2RH8A 5A3RA 1FNDA 5TPZD 4HKTA 4BVHA 1QX4A 1ZN9A 4TV8B 4Q7LA 2VYFA 1KOGA 1UFVA 3PENA 1H4QA 2GYVA 3PV0A 5FO1A 4D0SA 4UVGA 1XMQB 2ZRPA 3BGVA 4NMLA 1NBEA 2R751 4NULA 5DIZA 2ZYHA 1E1YA 3JWHA 3QM1A 3AJ9A 2TMDA 3GMSA 1USVA 3BMOB 3RRFA 4HGQA 2A92A 1W0CA 3BIWA 4LUCA 1E98A 4YP6A 1MO5A 4C4AA 3PXCX 1LB1B 3CTMA 1JA1A 2HIAA 3WRYA 3VPGA 1WUHS 2JLZA 2R7AA 3NVAA 2DR3A 1JHDA 5K3FB 4BO8A 2CMFA 4JAVC 4YI5A 4A5SA 1W4CA 3ZHTA 4JGIA 1MLDA 3IOCA 5LBTA 3I2KA 1WVGA 4M0LA 4OHYA 1PKXA 3NBZC 4BMXA 1ANKA 1RPJA 3OFJA 1JIVA 3UGTA 1L7DA 1VI6A 4QBFA 4EA6A 1AS0A 2PIDA 2V6JA 1IL0A 3LQ1A 1AMOA 3JY6A 3IDFA 1W0KD 4RSHA 2DHQA 2O5EA 1ORIA 3KQTA 3FMPB 1IG3A 4M9ZA 2I3GA 2EW8A 4DLSA 3WBJA 4ETIA 1P29A 1Y7LA 1EFVB 1YZQA 3PGVA 1Q6ZA 4Y6OA 5BSFA 3BULA 4P82A 5GVSA 1KHTA 5K8CA 3V8QA 2XPCA 2O05A 4DQVA 4B3TB 1RIIA 2JZNA 3EWIA 3BB1A 5ICGA 1GGNA 1SUSA 3AH8A 2V6GA 3FDZA 1ID1A 2H4XA 2YNMC 3V8MA 3ZQKA 4OHOA 3UQZA 1G4UR 4UDOA 5DNCA 4MQFB 1KI2A 3BCSA 4RDHA 1NW3A 3R4CA 1OXUA 4MRNA 1E59A 1E0DA 2V4MA 1QV7A 4GQBA 5C53B 2B35A 3H2SA 3L7KA 3LC7O 3DHWC 1XEWX 3KSRA 3IFSA 3TSCA 4YUYA 1XT6A 2A57A 2ZE6A 3PZBA 3RI3A 2A30A 4TXHA 3AR2A 1WSBA 4HB2A 4RHYA 1DAGA 1E79A 4KWEA 2HX1A 3SF8A 3T15A 4RYDA 1ZUNA 3GMTA 4GECA 2AHRA 4MK4A 2R0QC 1FYFA 1QZTA 3KSDO 1E9VA 1KJQA 3OIUA 5LB4A 4I4NA 1R0XA 4K0RA 4E0BA 1WB6A 2JIPA 1FSFA 1H2RS 3SIPA 4AKSA 1ECBA 1JGTA 2YV1A 4PO9A 5G1NA 3T0FA 2CYBA 4AWBA 4XWKA 2EKBA 4EB8A 5EC8A 4LCBA 3HJFA 4DJEC 2HT6A 5J2UF 1TKAA 1UR5A 1ZAYA 2GTPA 2XB6A 2QIOA 1T3SA 4PLGA 1U02A 4PRKA 4N7BA 2DAPA 3EIWA 1TJ4A 2JD2A 2B78A 3FSGA 5EFOA 2FW9A 1PS8A 3UENA 3DQPA 4LN1A 2PUAA 2MSLA 2PUJA 3CUVA 4KRXA 1U5AA 1GPNA 5IM5A 3S99A 4JJZA 4RPCA 5BT9A 2ASVA 3KPVA 4HDKA 2VVTA 3KQQA 1Z83A 4WXPA 2D5AA 4BWFB 3STXA 1PZNA 2G0AA 2DFNA 2ATXA 4G41A 3QE0A 2D7DA 1E0KA 4KKXB 3CO0S 3H1EA 2B7BA 1J2YA 2QX7A 3F98A 3G13A 1ULTA 3H3FA 3IUNA 3PVSA 4M99A 3SZOA 5FUQA 2ZPTX 1OXBB 2ONYA 4CKCB 3QIAA 1JAYA 4CM5A 4DDTA 1NVWQ 4ILKA 2VYVD 4JL8A 1OWOA 2EATA 4LA4A 2XADA 2PUDA 1PIWA 2O14A 3GQVA 2XW6A 3SBOA 3LO8A 5C8YA 3EGDB 5BYKA 1GXSA 2XB8A 1YRAA 2Z5GA 3D5EA 1Z88A 5IK2A 2YVLA 4OHZA 2J0UB 1WBJB 1J2RA 5EWJA 5D6OA 4NS1A 2EBWA 1POWA 2DWOA 4DSTA 5CDFA 2QW0X 4TZKA 5AQEA 2EJBA 4JP8A 3ZU3A 3GJZA 3IKTA 1HZZC 2IHVA 1DELA 1T1SA 2DKFA 3DXXA 3O4RA 4OL0A 4TROA 5H81A 4F5YA 4C2BA 4DM7A 2GCEA 2PD6A 1U3DA 1T0JB 2OA0A 1IZ8A 3TLEA 1PX2A 3FLMA 2QRGA 2DQ4A 1E4OA 1MH1A 5GJWC 4E5MA 3UBMA 4DILA 4Q9IA 1WQ4A 3Q98A 2QRNA 4JKIA 3Q2IA 5JFOA 4EHBA 1GGEA 4XWGA 4R16A 5CM8B 2VP3A 2W7TA 4NH0A 4EBBA 1JQ5A 1C1YA 1N2HA 1V9LA 4QPZA 2CV1A 3R9WA 1ZIXA 3LTNC 4E33A 3F8SA 3GCDA 1QTQA 3GT4A 3UPUA 3LA6A 1BXGA 1NLFA 2VP5A 1YUBA 4HSEA 4Q05A 5KDOA 2HSJA 1C3JA 2ODTX 3FMFA 3AG5A 2AJCA 1EYZA 1OVGA 1K89A 3LO5A 2QJOA 3DB1A 4OBBA 2XKJE 1NYTA 1U2RA 3P9ZA 2C9DA 1LBQA 3PX2A 2QENA 3PICA 4WZBE 1EWRA 4X6XA 4CJXA 2FPMA 1WR8A 5E7IA 5I7OA 5A0FA 2XZLA 1XAJA 1SRRA 2F64A 4X20B 1GGKA 2IHUA 1E2JA 1I4OA 1J06A 1SEPA 3U7RA 4ICIA 2CZCA 1XPJA 3KO8A 3W8FA 5KREA 4CQLB 3ONVA 2VDOB 5FJIA 1H2FA 4RD1A 4AG3A 2AKEA 2C03A 4LZOA 4G26A 4M0UA 2GCIA 4P54A 1FVHA 1MB2A 1FFSA 2DC1A 4HFNA 4TRMA 4C4PA 3ICVA 4AQYB 2PUCA 1BHO1 3ND6A 2ZRFA 4NV3A 4B6FA 1G2QA 1HT1E 4TV9F 5LQDA 2W8BB 1QV6A 4LE0A 2D2XA 4X6UA 3CINA 4I2NA 3RABA 3KWJA 3DGEC 5FYQA 1U7ZA 1SJ9A 3QY9A 1NVFA 4JQZA 3B7GA 3TSAA 3PXDA 5HS6A 4DQLA 1N2XA 1VHWA 4MV9A 1JBEA 1YBFA 3ELWA 3IUJA 3MW8A 4NFLA 4K26A 4OQNA 3OOJA 3PDWA 3VTAA 1WMBA 4DUZB 3N6XA 4NP6A 2YC2C 3T5BA 3IEVA 1J8VA 4HPJB 4MCIA 3VDNB 5FWYA 3F5DA 3PRJA 1QQ5A 3CNBA 3UUEA 5CNMA 4YV1A 2BCGY 1Y3DE 1IPFA 2ZDGA 1VLQA 4RD4A 1VBMA 1YR2A 4G1FA 4HPXB 3URMA 2FLKA 1Z6TA 2I80A 3OZSA 1QO0A 1JQBA 4BKQA 5FBVB 4W6QA 5FWNA 1VYVA 3V4SA 5KC9A 2WWWA 3AY6A 4P0PB 2R87A 3PNSA 4GVPA 2EGUA 3ZLUA 3KB1A 5D7NA 4EUKA 2G4VA 4U2EA 1UMCA 1Y1KE 4UXJA 2OVFA 2F6RA 5P21A 2OHJA 3UB2A 5JS1A 1H2EA 2E4ZA 2IGBA 3HVKA 1JFLA 1QQ7A 2D13A 2NW6A 4FFOA 5BVHB 4QJ5A 1SVLA 2O9JA 3LH5A 3DEKA 3VPSA 5ECGC 2Y71A 2QMQA 2YVUA 4QTXA 1UPFA 1XO1A 2AV6A 3OU7A 4IJQA 2YVQA 1ZL0A 4XIFA 3KJZA 1ZR2A 4K3UA 3T1QA 4QGGA 1LSJA 1T2UA 3QBDA 4RKFA 4E1AA 2LE0A 4NQZA 4LNUB 2Q5CA 3MRXA 3WLNA 1H3EA 4Y1RB 4MR9A 4X63A 5B4TA 3G2OA 2DCMA 4YRFA 1KDOA 3GWZA 4QUEA 3B51X 3EZ6A 2FJ0A 4HY3A 1FPQA 2G6BA 2Q45A 3FNQA 3F6CA 3D3WB 3SLKA 2XRZA 3B6KA 4F71A 3ZGOA 4MGHA 1G38A 1SZJG 3KLNA 3IQHX 5SY6A 2QN7A 1Y8AA 2AN4A 4JC5A 4BUJA 4NJEA 5AJWA 3LLVA 4EY5A 2ZIEA 3LGXA 4FN5A 2G9ZA 2OPBA 1P8JA 2XQIA 1OGJA 5KDDA 1CZLA 1I0IA 2RHRA 4JY7A 3GFBA 3SQMA 121PA 2BBWA 1NVKA 4MQEB 1YJCA 5MFPA 5IYZA 4JUFA 1LBEA 2I3BA 3VX4A 1G8MA 1U98A 2AUNA 1U0TA 3W5AA 4CR7A 3A9TA 1I1OA 2AMYA 2RHLA 4EX7A 3FF4A 3BCUA 4I9UA 4YCAA 2PNJA 3S40A 2IK8A 4UAGA 3IE1A 2QR2A 4ITVA 3OCJA 1JXQA 4GOXA 3SHVA 3WLAA 3UB4A 3GCGA 3IALA 1P61B 3OURA 3WFZA 3WK5A 1ZI8A 1DBVO 3K0CC 3DB2A 1B6SA 5FD8A 3UWMA 2NO4A 2ORYA 4UE2A 3G82C 4A8JA 4XVUA 3E8MA 3GEBA 1QGDA 2WJVA 5FULA 4FFBA 1KMHB 4PFSA 2QYOA 4J49A 1TXGA 1S4QA 4YACA 1E2IA 1LF0A 3AONB 1EFAA 3ZD9A 4U1RA 5CBPB 5HQ3B 1KEZA 1OYVA 1P4HA 1HSZA 4OU5A 1KFJB 3OICA 3TD2A 2CNDA 1B1CA 1VGRA 2NTJA 4X7MA 2BW0A 4GWKA 2AI1A 3A2MA 3E9YA 3L0PA 4CM8A 3K2EA 3OM0A 4QXPA 2R1TA 5K0NA 1ZJYA 5TEVA 3R74A 2FUG6 3AYXB 3P9CA 2I6GA 3A32A 3M9LA 1W5SA 1GQOA 4Q9AA 4CG1A 5DYTA 4D9CA 2IV2X 2JF0A 3QU9A 5EXTA 3TW4A 1ARZA 4GM4A 1IMOA 2OZLA 5G3ZA 3AINA 1SHUX 3PA6A 1FTSA 1PJBA 1KJIA 2I3AA 1LRLA 3OX4A 1DWPA 2Z6VA 2HBRA 1C30A 2YJNA 1UJCA 1Q7GA 3UMSA 4NPCA 4V1CI 2IEAA 2E5WA 3VV2A 4ARVA 3OQIA 2ZRLA 1TFRA 4C4SA 4MRVA 3BC1A 4BCDA 3FOFC 1N8SA 4QOHA 5F3DA 2WFAA 2C07A 2CNNA 1QYCA 2RK3A 3GG2A 2WPNA 4TTVA 3BFKA 5BN3B 5EJ5A 1HLPA 1KBQA 3A26A 5A4AA 4BQEA 5JR3A 1QHSA 2X2EA 1ZISA 4OBEA 3TMYA 3U16A 2HA4A 4EAQA 4CCWA 3G0HA 3LXMA 4G85A 5EJ4A 3COJA 4OJTA 2CGEA 1ZWKA 3RJMA 3LPCA 5BMVA 2VT3A 1FFAA 3UWDA 1QNFA 4MICA 2I3ZA 3JYOA 4RNCA 2NZXA 2Z9BA 3EDRA 2BD0A 1SKBA 3L7CA 3GO4A 4DL9A 2I1VB 2Z8ZA 2P11A 1HE1C 3PS9A 3T3OA 1Z0AA 4JLSA 1AKMA 4EECA 1U2DA 2ZJYA 3HUTA 1JU4A 3DLIA 2YZKA 2ZYAA 1QAQA 4OGKA 1V8FA 1FMCA 2PGOA 1OAKA 3IKLA 1O08A 4TUYA 4UNNA 2Z3ZA 4C0JA 1KAOA 2W0SA 4LFCB 2NU8B 2Y6VA 3R77A 5DTQA 1XEWY 3QXXA 1MAUA 2X4IA 2CF6A 4CGYA 1T4DA 2JCYA 2ODEA 2PD4A 1GQYA 1XD8A 4GMGA 1UBSB 3KTOA 5L3RA 3D5TA 4MVJI 3LUKA 1T8WA 5D6NA 5K01A 1W30A 2W9XA 1RRKA 5C1BA 4MQ4A 5JEDA 1HZJA 1J99A 1V7QA 1UBNA 3THXB 5FPYA 3UK1A 5CD1A 4DE5A 1N36B 3EODA 3P2IA 3Q4GA 5DNAA 1BH2A 1E3QA 1Y3AA 1B43A 1OSNA 2B37A 2O48X 2OV1A 2WUFA 4M46A 4NU0A 4O59O 5JALA 1W49A 5KSYA 3O2JA 3HM2A 3LT2A 3GNQA 3VVMA 3GJYA 2VRNA 2GM3A 4PQYA 3WK9A 1V5GA 4CBVA 1EFDN 5AI6A 1NULA 4K9PA 3L1VA 4D9EA 1SUAA 4ARIA 4OHPA 3QWHA 1XI2A 5A06A 2FW1A 1QFZA 4KDEA 1F20A 4MNTA 5JWHA 2B2NA 3SC6A 2OCPA 3CLKA 2NUTB 5HVNA 5IJ9A 4FFNA 4LJSA 4NEGA 2CL0X 2FRDA 3IBCA 4G0OA 3I04A 2NSHA 2GARA 2OQ2A 2PWBA 3TLZA 2EKLA 1GKLA 3MJSA 3RU3A 2WQ6A 3KHSA 4CF5A 4WVLA 3KD3A 3QHQA 3HGTA 3HXLA 4BFZA 2ZTVA 4XZ3A 1HT3A 2IYTA 5CH3A 2GD1O 4JXZA 2ZUDA 3NRCA 2PGXA 4ZQEA 4BASA 3HYLA 4CL2A 3SU8A 4YQEA 3EJWA 2X1VA 3NS7A 1BVUA 1MQ8B 3RCBA 2MT9A 5AW1A 2Z57A 3M2TA 4KNWA 3SZLA 3CRMA 4C43A 4US2R 1CUDA 3K9QO 3VKHA 1PL6A 1MB3A 2W6CX 1R8QA 1VSVA 5DTEA 3U4GA 2FSHA 5DEOA 3H1GA 4PICA 3SJCA 4RTOA 3NBAA 5ED4A 1QHNA 3QIVA 4D25A 2AZTA 3O1LA 1I1NA 2XNCA 3Q8MA 2GAJA 1H42A 2EZ8A 4TX1A 2DLCX 3KBOA 5CX1B 4Y1FA 2PYZA 2QMOA 4YAJA 1GGHA 1ODFA 1Y8QB 2VCHA 4RTMA 3KEFA 1AXGA 1I4LD 2FSVA 3IXLA 1RJ9B 5BN1A 2Y1XA 5MN5A 3T1TA 2C7GA 4D98A 3OTIA 2XXBA 3HVIA 4OY3A 3KTAB 1X14A 5C1PA 4AUNA 2VAWA 1XDZA 3H4MA 1CLUA 3G2IA 3N0XA 4J3JA 4L3VA 4KSBA 4UPDA 2OBYA 2D0PB 5C81A 1RS0A 2E4YA 4Z7JA 4OFWA 3F4KA 1H6DA 2G3YA 4DR7B 5EQFA 4ZQBA 4FKBA 5FEMA 3ZE6A 3T5AA 4GWGA 2CBXA 3TNJA 5JQGB 3L04A 2IELA 1NLYA 3VVCA 3WL8A 3WDMA 1AURA 1MO3A 3BH7A 3E27A 1YB2A 1YMVA 2H5IA 3JR3A 2FP3A 3Q72A 4MS4B 3U4DA 3UW3A 3ZV3A 1Z9BA 4EMBA 5JPDA 5K3CA 1A8HA 1JSRA 4YRLA 2GXUA 3KR2A 4FILA 1KDVA 4F3TA 1ZYUA 1JJFA 3D1LA 3ZY4A 2QTWB 4HTFB 5C8XA 3AR8A 3P4UA 2SECE 1S0UA 2PXAA 2XEXA 3KSMA 1E6LA 3JQBC 5KNDD 2IFTA 3W1VA 1M0WA 3QWAA 2YW2A 4FINA 3ESYA 3K5PA 4WFJA 1ZR4A 2HRBA 1ORHA 1UQRA 1SQFA 3ZLTA 4BB6A 2A0YA 2ZVDA 4QBGB 3RYCA 2J9YB 3GJ7A 1J2EA 3N87A 3DNPA 2J7KA 4XJTA 2RBEA 4BNWA 3P0RA 1MA0A 3FNBA 3HMKA 1O95A 3PF8A 3Q6NA 4ZRNA 1BU8A 4MIEA 1HLFA 2BFWA 4AS1A 4UPEA 3AFNA 3MAAC 2O3UA 1RMQA 4HAWA 4NABA 5EUBA 4BGIA 1KQFA 4FSXA 3FYDA 3M49A 1RYFA 3VR6A 5TIIA 4IZIA 1IB0A 2W11A 3KUUA 1U0JA 4H6XA 4WBSA 4YC7A 5T67A 4C5BA 2ZRJA 3A11A 1DC7A 3AVTA 1Z4PX 4Q03A 1GAXA 2WLSA 3PWKA 1HR0B 1QV9A 1SOUA 3FZQA 3UMVA 2OBFA 3WO0A 2VP2A 4FHCA 3OQ1A 4K9DA 4I3HA 3HVUA 3R3ZA 4Q1EA 1R00A 2QSUA 2RB5A 3L79A 4R54A 1ESMA 3GH3A 4QAJA 5GOZA 1TVKA 3R75A 3QLUC 5TJ9A 3G6WA 1VPDA 2JGNA 3N2KA 4B40A 2OGTA 3C3PA 3CBQA 1Z8HA 5AUNB 1Q11A 3QMMA 4J75A 4AJ4A 3HRIA 1J42A 3HKDA 2J85A 4QOJA 1V16A 4DDVA 1E5QA 4DBVO 3F3KA 2BI7A 1XRSB 1BMFA 4LX8A 1PYOA 4C0BA 2C3OA 1T5IA 2FK8A 1M33A 1XVUA 4EHIA 4EZEA 1WKVA 1E1MA 2IDKA 1JJ7A 2PKCA 4IV8A 4YJFB 1FLAA 1YR6A 3NDJA 4KX3A 4BNHA 3JQ8B 4BB9A 3ELYA 1LS1A 2BFEB 4DBZA 4JB2A 4LVCA 3C4JA 3D4BA 4CPDA 1DEXA 2R4QA 4JHLA 4HAIA 4KK3A 4DN6A 4EK9A 3WS7A 2V96A 2GXQA 1AKRA 1JYSA 1IY2A 4MGIR 5DYGA 3OPYB 3L18A 2G5PA 2G1AA 3DWEX 4O8ZA 1Z34A 2XAAA 5H3LA 3X1MA 2Q6TA 1DB3A 3DBRA 3I1JA 1B7GO 4YJGB 1CCWA 4BP9A 4YPOA 3SVTA 2PJRA 1XZJA 1CP2A 1GT6A 3VKUA 2F1KA 3EZNA 4JLAA 5FUMA 4WXEA 2YOFA 3C8UA 2AT1A 3LW8A 3TOXA 2E6KA 4OYLA 4L9WA 3PJGA 3ENKA 3ETEA 5TEWA 1CNFA 2XOKA 3MT9A 4J03A 4R5MA 5K3BA 2OCBA 5CVJA 3QLVA 1DOZA 1XQ9A 2GBPA 5ED0A 1JBQA 1PGJA 4NK5A 5LYJA 4CFZA 2VSFA 4U5QA 5BSUA 1WHSA 5JH7B 4HXGA 3DTVD 2QT0A 1EAMA 3NVMB 4D9MA 5LOVA 5JPCA 4X66B 2WAYA 4LDRA 1I33A 1WL8A 1M83A 2HBQA 2Q1WA 3U40A 2Z1NA 4ZU3A 3ZNOA 5CEEA 2FWPA 1IZ9A 2FXIA 2I4OA 3GRUA 1RXYA 4ZANA 1RI1A 4TLDA 2B8WA 4FKMA 2Y9PB 4AO8A 4HQKA 3TLKA 2ZK7A 3UMRA 2PT7A 3B85A 3ABIA 3L82B 4MDEA 2I4LA 1BCSA 2LIVA 1XJQA 1YL6A 4IILA 4J6EA 4US1R 3KG2A 1OKKD 2D62A 3DOIA 5B30A 2YJ3A 3DWGA 4CDGA 1MJNA 1V37A 2C59A 4TVBA 2JD1A 4CDRA 2DJ5A 2PMEA 3TM4A 3G0DA 4BMCA 1O9BA 1ZDMA 2ZSKA 3N2ZB 5LDHA 5B1SA 1PN3A 1U3UA 4G25A 3O9MA 1VJRA 1PJ4A 2FDRA 3ZU2A 2LCFA 2OY0A 1UAAA 2OO5A 1RE0A 2Y4NA 4Y30A 3FYUA 2XCSB 3LYAA 3R9XA 2WJWA 1RFLA 4REOA 4MRMB 3I53A 1MAWA 4ZO6A 2YH2A 2HWYA 2YJ6A 5FTKA 1AGNA 4YLEA 3R7AA 1J1UA 5M3BA 1N0HA 2HL6A 3SIXA 3AJRA 4QU9A 3D81A 3A9CA 2YWDA 4OQFA 3Q3CA 4S24A 1NZJA 3I05A 1DC5A 1JDVA 5JYCA 2X5NA 3UAWA 16PKA 1G9XA 4JUDX 4ESEA 2WVAA 1PS0A 2V58A 5JNLA 2YWRA 3IQGX 2BN4A 1PK8A 2POCA 4Z9AA 5H83A 2PVSA 4UNPA 2AJTA 5LNK6 1PZGA 1BSVA 1N75A 5DBGA 2IY7A 4NCHA 2UUOA 4DTCA 2FAXA 3IMKA 1MO4A 3TFWA 5E1DA 1GZ5A 2VJMB 4IOLA 4R0VA 5IC6A 5LSAA 2E21A 2Z8XA 3D43A 1P72A 4Z4CA 1LBIA 3IGFA 4L4XA 5ALOA 4G0MA 1W1UA 1BGXT 3KQWA 2H18A 1T5TA 4F4JA 2DWPA 1NXVA 3QH4A 5I01A 1FP7A 3SR0A 1TLLA 3HO6A 4C14A 3QOXA 1SXJA 2YV4A 3IUBA 3RS9A 4DLLA 2M1ZA 4HFJA 1RLUA 2MMCA 4UU8A 4CEIB 3G2PA 1RE1A 2HJRA 2VRBA 1ISIA 1V4BA 2GXSA 1N2CE 3CRNA 3PHGA 4MWTA 4HF7A 2BMVA 4W7SA 4JLVA 2VOJA 3DQZA 3A4VA 1V6AA 3RRJA 1E4VA 1ND5A 1PVVA 2PMKA 3IMCA 3PA8A 2JGEA 4RIIA 1GU0A 4WUTA 5J5CA 3MMPA 1B73A 1EZZA 3DLTA 3QW4B 5SICE 3TDKA 4I7EA 2HQSA 4QJ4A 3T7SA 2H7YA 2ILTA 5K1ZA 4JUIA 1M2KA 2NUBA 1E2KA 2BFNA 4LBVA 4AF6A 4GI2A 4LYGA 1I7NA 5KTTA 2JK0A 4HAXA 4E46A 3S29A 1M1NB 5JMPA 2BGTA 3V00A 4RCZA 5LN1A 2E85A 4KPUB 1CUEA 3C8MA 4IWYA 3RVMA 3B13B 4RF5A 4TTJA 3TINA 1P0PA 1F0NA 3T99A 3M5CA 3W90A 2G0NA 4NU5A 2AOTB 3U6KA 1FPMA 5T7BA 2DYKA 2WTUA 1YHYA 3IUYA 4IEFB 4L74A 1ZINA 4IDBA 1PLLA 5CA0F 3BKXA 3DKRA 3VKGA 3FGOA 3PI7A 1NN1A 3KCNA 4N5IX 3U7QA 3AWIA 5K0SA 5K6TA 4QTUB 1NVVR 2ZI3A 3DF9A 4UM5A 1PO7A 2BKXA 3PSAA 4KIUA 3MJDA 1Z15A 4K9OA 1C9NA 4V0SA 1Z7EA 2Q21A 2AFIE 1ZXXA 2DWUA 2WHQA 1RWNA 3NLLA 1PT8A 4S2EA 3L46A 5BR1A 3HYNA 3NH9A 4HAYA 5B64A 3QF4B 1N1EA 1ECCA 4KFTA 3WYCA 2QQGA 1YI1A 4B3RB 1OA0A 1XEFA 2R9VA 1W5TA 4CM4A 4IINA 4DJFC 2XXAA 2ERXA 2FOXA 3QVWA 5EJ9A 2GBIA 2ID4A 2Z2ZA 4XDZA 2CVQA 4B73A 1IN5A 3C3XA 3JYNA 2VRCD 4KJZA 4CG3A 1DXOA 2FW6A 3S2EA 1ISSA 4H60A 1HE2A 3SBEA 3MRTA 1H22A 1KMCA 1SHTX 1NONA 1ZMXA 3OZRA 4E31A 2XMZA 4PLPA 2QX4A 5AW3A 1P0MA 2I6QA 1JR6A 1RKUA 2PL5A 1Q0SA 3HJTA 2VF8A 3I5AA 4P4SB 1S02A 5CFOA 3R44A 5CA1B 3F46A 2V7QD 1A9ZA 4OQ4A 4BYMA 5LQAA 1D8AA 2P6OA 5BSKA 5LWQA 5FBRB 5LP6F 3PQ8A 5KWEA 3DT8A 4EHLA 1TCBA 3ZYZA 1QH8B 1I8TA 3RAJA 3QXHA 2ET6A 1XL1A 2AMVA 4HSGA 5B12A 3BMQB 2LDBA 3D4OA 1P5ZB 3N2GB 1N3BA 1ZGZA 1NM5A 1QH9A 3QLEA 4UC0A 5G1OA 1AZWA 1ZUIA 4FEYA 3NZEA 4HP8A 2DPXA 5H3HA 1T6NA 4B32A 3E15A 3KXIA 1PJ8A 2C2ZA 4A8TA 2V7WA 5F76A 3E2IA 2PX6A 2X8WA 3I3SR 4I4LA 1PU2A 3NT5A 5HFJA 3ICCA 5BN4A 3G49A 2Q8NA 3S4YA 4NE2A 1U9JA 5WRFA 1DT5A 1KFKB 1A76A 1WHTB 3VPCA 4YAKA 3EIHA 4MIKA 5AI0A 1ZRSA 3V1LA 2YN4A 2RC6A 1N6LA 3HNRA 3MT0A 4RWEA 5LBUA 5CB4F 5E4TA 2FFRA 4WEQA 4E4TA 3KR1A 5TLSA 4DR6B 2VT7A 3JYLA 1N25A 1LUAA 3M5PA 3L0DA 1RXUA 3G2LA 2JIDA 3I34X 1E1CA 4XDYA 4F3YA 3ZGZA 2P6MA 4D45A 1DX4A 3HU3A 1E69A 1AV7A 2B0JA 2CLHB 1Y8ZA 1W44A 1CVIA 3OJEA 4K6CA 5DM0A 2AI2A 1MTZA 2JAWA 2JLCA 5EKDA 5HKAA 5ALQA 1AV6A 2KX7A 2QGNA 2DETA 3F6BX 3RSFA 3M6LA 3O4VA 3M4JA 1C7JA 2ZAIA 4YY3B 3PKIA 4XCXA 4UMVA 3ZDDA 1HRDA 3M6WA 2DQSA 2OCGA 1RDFA 1L5KA 3LQYA 2YIVX 3RU9A 5A03A 4HNVA 1E3MA 4ARAA 4JGGA 2GNOA 5GONA 3WDKA 5E1BA 3BWVA 1AD2A 1HL7A 1VLLA 3AIKA 3VKWA 1ZK0A 5DXAA 1JL3A 4FXPA 1PTJC 2B6NA 1ITZA 2P8SA 1HQYE 4JA2A 4B6OA 4C0SA 1BRMA 1E7WA 3D7KA 4PC2A 3G5AA 4AYXA 3C3MA 3HY3A 3JCZA 1LNZA 1U9IC 2EKZA 2C4UA 3CZPA 4G84A 4QXMA 4W6ZA 4N5DA 5LCXA 4Q4CA 3K35A 4KQXA 3RAGA 2UUAB 1O6CA 1DEHA 1OYOA 2WEKA 2C94A 1MOZA 2WHXA 3OCCA 4BVBA 1FZTA 4RK0A 4EPTA 1AKTA 3GZJA 2YL2A 3ZDXB 1AHHA 2V3VA 1G3UA 2V7PA 2JGFA 1E9SA 3EUAA 4ZI5A 5BR4A 4GPZA 3VR2D 2I22A 3GQBA 3L7AA 4XJXA 1OXXK 1IUPA 3D6HA 5JVDB 1FMLA 1TUBB 1FU4A 1SVWA 2P5SA 4KQIA 1IK6A 4ZOBA 4BTLA 1W7AA 4N39A 3ZC3A 4BNKA 3ESZA 3TUZC 2C78A 1Q6YA 1NMEA 3CEMA 1IBCA 1EVYA 2XQGA 2N3ZA 3QVGA 5DI9A 1KYIA 2NXCA 3BM5A 4XJVA 3WGLA 1IDOA 3NX4A 3OLWA 4WN9B 2NQTA 2GZ2A 3GAZA 4H1HA 4LKOA 4X90A 5AW2A 2QY9A 2C8JA 3IT0A 3K6JA 5K9ZA 2XH8A 4OIMA 2JFGA 1LLDA 4XW2A 5EXDA 3NW9A 1E1NA 3F90A 1MNQA 5CFMA 2H8KA 1I32A 2POQX 4PCVA