1RXYA

E. coli uridine phosphorylase: type-b native
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxyA00
3UAZA 4OGKA 3UAXA 1ODIA 4UC0A 4BN0A 4D8VA 4F3CA 3ODGA 1PR5A 1Z34A 3DPSA 3OOEA 1Z5OA 5CXQA 5JPCA 1ODJA 4D98A 3DDOA 1FXUA 4F1WA 1RYZA 1U1DA 2QTTA 3UAYA 5IFKA 3IEXA 4DA8A 4GLFA 1K27A 2I4TA 1XE3A 1B8NA 5I3CA 1Z33A 1ECPA 3KUKA 3IOMA 2QTGA 4K6OA 4L5YA 4TS9A 3KHSA 3FB1A 4LZWA 4OY3A 1JDTA 1V3QE 2GUWA 4JWTA 1NC1A 1T8RA 2HSWA 5CYFA 1Z36A 3U40A 4D8XA 5IU6A 1PW7A 4E1VA 1VFNA 4TXMA 1U1EA 1A9SA 5CXSA 4L0MA 4LNHA 3PHCA 1ZOSA 3E9ZA 1V2HE 4KN5A 4GMHA 4LDNA 4MCHA 3K8OE 4TYMA 1K9SA 1PR2A 2P4SA 1OUMA 3FAZA 5K1ZA 3NM4A 1Z5NA 1T8SA 2AC7A 3DP9A 5F73A 5EUBA 3UAWA 5F77A 4NY1A 1Z37A 3DF9A 4TXHA 1V41E 1Y1RA 1ZL2A 2AI3A 3BL6A 1OTXA 1SJ9A 4GLJA 1B8OA 5B7NA 4M3NA 3BSFA 1V4NA 1YR3A 1RCTE 3OPVA 3PNSA 1ULBA 1CB0A 4DA7A 4OGLA 1A69A 2OC4A 1LX7A 4BMXA 4YO8A 3GB9A 1JPVA 4DARA 3KVVA 2AI1A 2QPLA 1JE1A 1SD2A 5EPUA 5F78A 2A0YA 1RXSA 4R2WA 3UAVA 3PHBE 1RXYA 2A0WA 3P0EA 5B7PA 1YQQA 1SQ6A 2B94A 1A9OA 4MARA 1LVUA 1TCUA 5F7ZA 2I8AA 1WTAA 3P0FA 3ONVA 4WKOA 1RFGE 1TGYA 3T94A 4H1TA 1YBFA 1G2OA 4I2VA 4NS1A 1ODKA 3LGSA 1PF7E 1TD1A 1Y1QA 3EUEA 1K3FA 3OZDA 4DA6A 4OF4A 4OEHA 5C80A 4JOSA 1NW4A 5CCEA 2OXFA 1A9TA 4L6IA 3OCCA 4DA0A 3EMVA 4LNAA 1PR4A 1U1CA 5ETJA 4EB8A 1PKEA 2AI2A 4TS3A 4YMLA 3MMSA 2IQ5A 3OOHA 3OZEA 1Z5PA 4QATA 4D9HA 4NSNA 1QE5A 4MCIA 3SCZA 4WKNA 4G8JA 3BJEA 2RJ3A 5EFOA 4DAOA 1VMKA 1OV6A 1RXCA 1Z38A 4G89A 4R31A 4YNBA 3FUCA 3D1VA 4DANA 1A9QA 1OU4A 4QFBA 4F2PA 4BMZA 4X24A 4D8YA 5F76A 1Y6RA 3NM5A 1ULAA 5FAKA 1YRYE 1YQUA 1Y1TA 4JP5A 3OF3A 4M7WA 1SD1A 4FFSA 1C3XA 3KU4A 1LV8A 4G41A 1JDZA 1JE0A 2HWUA 2QSUA 1OTYA 1PR1A 5DK6A 4YJKA 5CYGA 1M73E 2H8GA 1TCVA 1RR6A 4F3KA 4QARA 4OJTA 1PBNA 3O6VA 1JDSA 1Y6QA 2A8YA 1PR0A 2A0XA 3ENZA 4QASA 3K8QA 1N3IA 1T0UA 4PNPA 2PGAA 1RT9A 5CCDA 4BMYA 3FOWA 1Q1GA 1RSZA 5F7XA 2ISCA 4TXJA 1JYSA 5B7QA 5B7GA 4R2XA 4RJ2A 4QEZA 3FWPA 2Q7OE 4P54A 3GGSA 5KB3A 3E9RA 3NBQA 3PNPA 4DABA 4L5CA 3OZBA 1V45E 1Z35A 1VHWA 2HRDA 3EEIA 4PR3A 5F7OA 3C74A 1U1GA 4L5AA 1PWYE 3FNQA 1Z39A 3EUFA 1A9RA 5F7JA 4WKCA 1TGVA 3DJFA 1NC3A 3LBAA 4TTAA 1VHJA 1JDVA 3OZCA 3TL6A 1JP7A 2BSXA 3UT6A 1PK7A 1PK9A 1U1FA 4GKAA 4U2KA 4TXLA 3F8WA 1CG6A 3E0QA 4TTJA 1A9PA 4M1EA 4TTIA 3KVYA 1JDUA 3LA8A 1Y1SA 2OECA 4DAEA 2HN9A 4QAQA 3KVRA 3O4VA 1OVGA 1V48A 1RXUA 1PR6A 2XRFA 2OC9A 2ON6A 4WKBA 2QDKA 3NM6B 4EARA 1ODLA 4IP0A 1I80A 4LKRA 4TXNA 4WKPA 3BGSA 3MB8A 3QPBA 1T8WA 1T8YA 3INYA 4ECEA 4F2WA
chains in the Genus database with same CATH superfamily
1XMIA 5P21A 4L2IA 3EDYA 3DE7X 1UBGA 1QHXA 2JFVA 3NKLA 2P35A 3Q7RA 3IMCA 3DMTC 2CT8A 3EPLA 3P45A 3L4BA 3I9V1 4GVPA 1PBTA 1OXSC 4UEQA 4JXXA 4ZV7A 4PRLA 4FHDA 3IDOA 3SDBA 3H3JA 1Z4JA 4QECA 3IMKA 2YN4A 3I5AA 2BIFA 3GJ0A 1QHEA 1L3IA 2DERA 4I1IA 1CUDA 3VR3D 4BE9A 5B1EA 2QTTA 3T0FA 2V7VA 3IC5A 4YBZA 1T4DA 3UAYA 2QP3A 5EEHA 4P6VF 1A77A 4TGLA 5KNBD 1RZRD 3E8XA 3JQEA 4DA8A 1YCHA 2QPAA 3QKRA 3SC6A 3LOQA 2I67A 5SY9A 2PVSA 1I1QB 1AB5A 1MO3A 2WUWE 1DCKA 1EVLA 1LI5A 5LZ5A 3NIDB 1U7PA 4FJ1A 1ECPA 3HB9A 3TOXA 4U1RA 3PVCA 2QRLA 1CR0A 4EEKA 4ZRDA 1Q0PA 5A0TA 2XNDD 3QYJA 4KXYA 5ABPA 4EVQA 1DKOA 2JHGA 3IPXA 3RSSA 1HETA 2V0GA 3UMGA 1YVUA 4KN6A 2PX2A 2NTVA 2ZU6A 2JLVA 3EIOA 2HSWA 1C29B 1E3TA 1ZZGA 3V32A 3N5KA 3Q87B 4L7QA 2AV6A 4M0PA 1ZGBA 4Q7KA 4QEDA 3QE9Y 2GRAA 3SOZA 2BY4A 3GRVA 2X22A 3HG7A 3G2IA 4KQCA 4IIXA 4XJVA 1GAEO 4Z51A 4JLJA 2XDAA 4YTEA 5AW4A 1NX6A 4QFDA 2Q2NA 3IULA 3K5IA 1KP2A 5F33A 1MJNA 4KAJA 3TCKA 2QRZA 4A8JB 1ZJZA 2V8BA 4HUQB 2P0AA 4JT4A 4YEDA 3BCHA 3H97A 2P30A 4MR9A 2J3IA 3SOPA 3VR5H 1NSTA 1OYVA 4DCNA 1T2NA 4MMYB 3W2EA 4ENSA 1CUEA 1YASA 2D8AA 2P9EA 2Y66A 1ZCJA 4ICIA 1KJQA 2QRQA 4TYMA 2QT1A 1J4AA 3ZWWA 2OBMA 4M0EA 2PRJA 3GLIA 3KZVA 2VDOB 4M0UA 4IZ6A 2E37A 2BTQB 2IBMA 3KT8A 2FF7A 3PXEA 3DP9A 1RU3A 4MRAA 1T36B 2YWXA 1VHTA 4MUIA 3WL6A 4AJIA 2WUFA 3JYNA 4RK0A 5F77A 4GI1A 2ZSAA 1O9GA 5B64A 3R7LA 3LXUX 3VMMA 4R81A 3SIPA 4LECA 4QBKA 5AVYA 5LMZA 1D2CA 4B40A 3DNFA 2NV0A 4B0OA 5FD8A 1WBBA 5E6UB 2JGIA 2FPUA 4YMHA 1UDXA 2GXQA 1FXSA 1T8UA 2Z5FA 3M6VA 3WQRA 5CDTA 1FC0A 5ADHA 2V7WA 1C8VB 4N0PA 3ZJVA 5IXYA 1G6HA 4TMXA 3AETB 5DZSA 4A91A 1YR3A 4COOA 4QD3A 5GJCA 3O2QB 5BW5A 1VL8A 3GLGE 2EL9A 4AJEA 3OPVA 1GKUB 1U02A 2XHZA 4IUBS 4DA7A 1SUWA 5AVUA 4X84A 2IUUA 5LKAA 5ITZB 3C85A 1H9AA 2FSPA 2L18A 4EHNA 9MHTA 3LBFA 4DMRA 3QU5A 4FNGA 4MGHA 5IJXA 1VPTA 2CC2A 3DAFA 3I42A 1U3WA 4IZOA 4EKIA 3T1TA 5EMMA 3SI7A 2Z30A 3OM0A 1KAEA 2BJVA 5BQXA 3ZXXA 1TL7C 1R6AA 2AI1A 4RKEA 1CQJA 4F45A 1BRMA 3E9DA 4MQLA 3HA5A 4LXUA 4RKYA 4ZDIA 2PIAA 4G9GA 4OQFA 3P9IA 1RZUA 2XGGA 4BNJA 4Z4QA 3NHFA 5ED4A 3HN6A 2ZB4A 1LH0A 4EYQA 3TD2A 2I7XA 2A0YA 1JWLA 2Q3LA 1ADGA 4GM1A 1Q57A 4XQEA 1O94A 2FZ4A 2HKIA 1T34A 1N5DA 2VSXA 4CM4B 3RF7A 2CVFA 3A70A 3T5TA 1SUEA 3C6KA 4E2XA 4LFCB 1PWHA 2J3LA 5JFTA 4TS1A 1SBTA 4R2WA 3JRWA 3QKSB 3F6SA 3X1ZA 5A9SA 1LDGA 3G2OA 5B3JA 2XV1A 3E3AA 2QF7A 1NXQA 4RHCA 5FTWA 1DKUA 3EC2A 4JLMA 1WSWA 13PKA 2R7NA 5DP1A 2YBEA 4UZSA 4G5HA 2WUGA 1OD6A 2HADA 1P77A 2D5CA 4GMGA 5CA0A 5TR9A 2MOKA 2F1OA 3SHQA 3FMPB 3H6GA 4MVJM 3UK7A 5INTA 5LL6P 5COAA 1A7UA 3MAAC 5SZHB 2FN7A 3VOBA 4FP9A 1KZ1A 4FMDB 2W5UA 4LXGA 3VYWA 4I50A 2X8WA 2EZTA 4JB8A 2IW1A 4I2VA 4UAVA 1XMXA 3EAQA 1L6IA 3N2YA 1KERA 4HFMA 1TF7A 1UKBA 1P4JA 3JQGB 5CFMA 1TIKA 1MEJA 5JS1A 3CH7A 1XALA 2YV4A 4HBGA 4HDAA 2EL7A 1ZXXA 2O3TA 3O8OB 1HG0A 3RYCA 4MYUA 4MI3A 1NKSA 3CQ9A 3OZDA 1SEVA 4F7DA 2W42A 5IKMA 1J2TA 1HQYE 2VVTA 4JCOA 5BR4A 2YUTA 4DCJA 1U2GA 1H8HD 2HY7A 4W4TA 4WN9B 2Q2QA 2LXNA 4HDCA 4NL4H 4Z6KA 5ECDA 1K8QA 1MAHA 3R23A 4CKXA 1DS6A 2Q46A 5EHQA 2P7HA 4QUHA 1RPNA 1XNHA 2OXFA 1MP0A 2J67A 2CK3D 3DM5A 1V2GA 1ZWKA 4LNUA 5JV5A 1NDUA 2F43B 3HXTA 2OVFA 1UBTS 2D54A 3EEQA 4Q7MB 4LYAA 1PSDA 3VUEA 3ZHRA 1I6KA 2ZR7A 4DLXA 1WUIS 4R8MA 5D87A 3GHHA 2CLKB 1HDCA 1G8YA 2BSQA 1YQWA 1QR6A 4M4SA 2CJYA 3HR7A 1DX4A 2PTHA 1G42A 2PZMA 3IR5A 4PSVA 3CX7A 5IM5A 5IDWA 3D3WA 4G4SO 2I3DA 5FR2A 2BMEA 4Q16A 2E5WA 1E3LA 4RBNA 4YFYA 2X6TA 3GDHA 3RG2A 3RHSA 3FVWA 1EB9A 1AO0A 2ZUFA 3OFSA 4CUJA 4K8RB 1HURA 5BUSA 4F9FA 4EJSC 1E1QD 3AM1A 3WL8A 3N58A 2V7QD 4M1MA 3KJQA 3R9KA 2NNLD 3I0MA 4EUFA 3PE4A 5IRCD 1WZNA 2DCUA 2LNDA 1PDOA 2JIBA 1L8XA 1CUSA 2FRXA 4AUMA 4EY3A 5DNWA 4WXMA 4Y18A 5BV2P 1RIFA 2IYWA 4K9LA 1U3TA 4KMRA 5EFOA 4C4RA 4RV4A 4MJLA 2P4EA 2H4WA 3QPAA 1FY2A 3EXHA 4ZT7A 1DIGA 1X1BA 2NXCA 1L4BA 5DGTA 2F9FA 3JARB 1NI4A 1OMOA 5E6SB 1HL3A 5LBIA 2ZXFA 3SR4A 4E2ZA 3QHQA 4K86A 3U4MA 4YNBA 1JJFA 3ZWYA 1A2QA 1BMTA 3C3YA 4KAXA 1K86A 1XZNA 5K45A 1GADO 2ZIXA 1QU3A 1CRWG 5IC6A 1T15A 1N2JA 1TZJA 3H9GA 2RBGA 2XYVA 1EXDA 4PIVA 3OTGA 5CFLA 1EU1A 1QIIA 2PKEA 2XITA 3H83A 3HCFA 1CX9B 5JOQA 2RH4A 2XA9A 3GG2A 1AKWA 1Z83A 3D2BA 3ZZTA 1KBQA 4BB6A 3N0WA 3PZRA 3ZJYA 3CF4G 2P6RA 1FSSA 1I30A 3G13A 3UN1A 4GSLA 3EPPA 3DGFC 1N8NA 4D9KA 2DR0A 1T6XA 2PD6A 5FB3A 3ZVLA 3HB4X 4M6WA 1HKHA 1DP4A 2EF1A 3I2YX 2HXYA 3CLRD 1NBIA 3B5IA 2I6UA 5DWDA 3COPA 2P6MA 3G82C 2XTNA 1G5QA 2Z98A 1P29A 2C7GA 5EE1A 3NBXX 1ONNA 1YQDA 5HOQA 2N1BA 4ZN6A 1H2RS 5CVUA 3ZHTA 3OLWA 3TCXB 4BAUA 4DEYA 5K09A 2YIDA 3P26A 2HF8A 4I6EA 4F6CA 4G0ZA 1Z6AA 5JARA 5HTKA 1PNRA 5LXTA 1G16A 3IERA 2O1XA 5C1BA 3BD8A 3TPFA 4OHVA 1V1RA 1ATIA 3T5BA 3ELDA 5EJ8A 1Y8QB 1DQNA 3D3JA 2EGUA 1QOPB 4AJNA 4ZO7A 1VE3A 4KXQA 4MQ4A 1SC9A 1M1NB 3ANYB 1MVNA 5LMNB 1SXJE 4DM4A 2TMYA 3DOJA 5DULA 1OILA 5LP6F 4JJ7A 1I1OA 5CT8A 2NQTA 4LYJA 5HK8A 1C1DB 3TUZC 3PWZA 4LXTA 3SEZA 3ZLVA 4QUDA 4RTKA 3HWWA 4KX5A 2E4ZA 3MF4A 2JEZA 3OY7A 3SIWA 1QH8B 2IIPA 4NXNB 1P1HA 2EJUA 4GRAA 2K4MA 3HWX1 3PEUA 4QFCA 3PIDA 3SLGA 4AF7A 2XCLA 1GTJ1 3FHCB 1PHRA 1L4MA 4KOEC 3ZS9A 4UQOA 3NTLA 4K3VA 1JYEA 2H7XA 4E4TA 4UCWA 4OGWA 1YCGA 1P2DA 4Z4GA 1D3AA 2QM0A 1LLQA 1IZ9A 2QRVA 2R79A 2OHXA 3AXTA 3GJRA 3OLVA 3EGDB 1JKJA 1IK6A 3FZGA 4LVNA 4LV5B 4NMWA 4WESB 4PC2A 5ES4B 4M8LA 2AQ8A 1GQFA 2FPGB 4RY8A 4TM8A 4EY8A 1JEYB 4C2UA 1YVPA 3F74A 3H2ZA 4HNGA 5DTEA 3LD9A 2P6OA 4GX1A 2AN3A 2GN8A 1Y4SA 2C3PA 4KPGA 4X7PA 5AK3A 1U9IC 3OVMA 2FSIA 3ESXA 1OX6A 1A5TA 1F2VA 3INRA 4KYUA 3BERA 4WZAA 2ZUEA 1MJFA 1UH5A 2C2WA 3E1GA 3GFRA 1NN5A 1SO8A 2DZDA 2GD2A 2GM9A 3EZ2A 2R3SA 3L41A 3OE5A 5KNDH 2V1UA 2X2PA 5LXTF 4KFUA 1EUZA 1D2GA 2ORYA 2XKBA 3L6BA 1NBAA 4MB6A 5CRIA 2SICE 3LCJA 3OH8A 3JQAD 4D99A 4D96A 1IQ0A 1NW6A 4PX9A 4YQZA 4DG9A 4W5JA 2BGNA 1Y98A 3FDZA 4ATNA 2ABWA 1GP2A 1PQ4A 3PEEA 1WV1A 1EDEA 1G2PA 1DC8A 2VK8A 1F9AA 4ALMA 1JPNA 2QMUA 2ZULA 3B6EA 3PJEA 2HHCA 4RVCA 2DMRA 2O1WA 2IUYA 2XAUA 3EPKA 3WWOA 1UXKA 2IU3A 1ZFNA 4GM4A 5F7JA 1VG8A 4XGIA 1QH1B 1RBMA 2IDJA 1I7PA 2JJ8A 4DS3A 4KPUB 4OI2A 2JAUA 4UW9A 1P73A 1VLHA 2EYUA 1OLUB 4EMSA 1Z0AA 4W1QA 3ESBA 3IRVA 5C9ZA 4BO6A 2XUKA 3GH1A 4UCXA 3EWIA 5AOCA 3W5VA 5DX0A 3COZA 2VI5A 2J5RA 1NIJA 3WL3A 1ISHA 2VNHA 5EXXA 2PQMA 3OCUA 2OCLA 2J5BA 3S5JA 5K6TA 3BWMA 1JL3A 1XZFA 1HX7A 3BXZA 3REQA 3ZQKA 1FFHA 1G55A 1U8ZA 5HDQA 4DA4A 2PKWA 2SECE 5LQSA 3VHXB 2ZFUA 4HYQA 4BMNA 1FUEA 1R00A 3TN7A 1X7DA 1BAPA 2V7XA 2NV6A 3JATB 1OFIA 4IAOA 2ZIEA 2VHCA 3D2AA 1SVOA 1Z9BA 2QQGA 5EMLA 4C2BA 4GIBA 4TXLA 5CNKA 3KFXA 1WMAA 2FMUA 2V5AA 2NXJA 1NJ6A 1A7AA 1VL1A 3HZRA 3OY2A 3B9QA 2F3RA 1WD5A 2XMBA 3WLTA 3HXLA 1LDEA 2NTJA 4IWNA 5JAUA 4OQXA 3U61B 3LTNC 3H1AA 4ZOLF 4S35A 1XKQA 2G0TA 2G1AA 2YQ4A 3O73A 2EATA 1XQ6A 2OECA 3G2LA 3VR4A 4A3SA 3W9UA 1IYZA 3GJ3A 3MFYA 3AR6A 3V00A 1UBNA 5HQTA 5B3AA 1PN3A 1TI7A 3GMSA 5A5DA 1VP9A 3O83A 2PUGA 3TNLA 1M66A 2A14A 3DZGA 1E3WA 1SKAA 1JLMA 1GZ5A 1RADA 1NBEA 2HBQA 2VSQA 1SXGA 1U9CA 1ZOLA 3CGGA 4JLKA 4NQRA 3PHIA 4FE7A 4AJ1A 3O3CA 2A5LA 5T6MA 4BVGA 4DHEA 4FR2A 4OSPA 1PYGA 4DJAA 1IBMB 1TVEA 4ZAXA 2BHRA 2J46A 2Q3DA 4Z4FA 1ZUHA 1E6UA 4BKPA 1Y80A 4YA6A 3ELUA 5JSHA 2FG5A 3KQTA 1DRKA 4D9GA 4RQUA 4XM2A 3W5BA 4GUAA 1QYWA 4DV6B 2IP4A 4IP0A 3PXUA 3M6AA 2B25A 1UBRS 1RLMA 4QUAA 3T06B 3ZIDA 1Y7HA 3EEOA 5F12A 1E1CB 2OGZA 5H81A 2YMPA 2CZQA 5K0ZA 1WCV1 3TKLA 4RPCA 3D6TB 1PLKA 5HE8A 1E6EA 2HQSA 1PFKA 2QAGC 3DBVO 1OX5A 3I05A 3KKLA 3HGTA 4FZRA 4HVTA 3WDLA 3N2KA 1BCSA 1EGMB 2WIGA 5FFNA 4K9QA 3URMA 2GCOB 4BAZA 2JFPA 2ADOA 1W2HA 5CA1B 1EFKA 4IXDA 4KVFA 4MEBA 1FMFA 4G5RA 4PQRA 2OYCA 4UTPA 4CKWA 2FPOA 1HTTA 1SUAA 1ESCA 1EH5A 3WGNA 4DJJA 1ADCA 1T8PA 4S1NA 2IXGA 3FRIA 3ZBPA 5A06A 2JCBA 3ENKA 1IBSA 5JPCA 3GXBA 1NJ8A 1SBQA 3RWBA 3ORQA 3QUAA 5BXQC 4MUJA 5CD1A 1E6KA 3FYHA 1CUHA 3SFZA 3OBIA 1JQDA 4BDSA 3MMNA 3PP8A 4MRMB 4MUNA 2W6ID 3PL1A 2X0IA 4ZEXA 4BKQA 2JVJA 3I61A 5EIHA 4MP3A 4CNQA 1E3DA 3HCWA 4JT8A 2ADMA 2HHJA 1D0IA 3AB7A 1JA1A 2TRSB 4BUCA 1ZSVA 4MS3B 3N6XA 3LOUA 3TZLA 3R6GA 3PFHA 4JJKA 4UNNA 4YMUA 1M34E 1XHEA 4BX3A 1BU8A 4I99A 3ROFA 4ND3A 2D5IA 5JPIA 3OWOA 3WIVA 3RC1A 2IELA 3HH8A 3JQ9C 4TS9A 4OM7A 3MLAA 1UJMA 1J8FA 1N7IA 4ZDWA 5KX5B 2WAMA 4INJA 4FGSA 5CH3A 5EL0A 5J63A 3RIGA 2C04A 3E23A 5DXJA 5T4EA 1Q6ZA 5THXA 3PC8A 1EXVA 4DBLC 2O23A 5EKUA 4W7IA 3IAUA 3V1TC 1MGPA 3C3PA 1RZ3A 3UT5B 1P45A 2Y68A 1YU6A 4Q37A 1X1TA 1W2GA 5IU6A 2WG1A 3LDGA 1M2HA 5T64A 1U1EA 4EHDA 4RF3A 4CIXA 4DCGA 1KZ4A 5J2UF 1YIOA 5HCNA 1M0SA 4BMDA 3KWFA 1LNZA 4N03A 5CYOA 2XIJA 3SC4A 4CF7A 3OC0A 3O1LA 2ZUTA 3ANNA 5AHRA 5FAXA 3UC5A 3E6AA 4E5SA 1KJ8A 2IPMA 3E9ZA 3TZ6A 4E5KA 4R1OA 4U6NA 4MGIR 2A58A 3L46A 2JDIA 4N3AA 4PCLA 4ZVPA 1TYDE 2W2MA 3BTVA 3DD5A 3T7AA 3EFHA 2XWQA 4B3HA 1PR2A 2NO4A 2VDQB 3QU4A 3G0BA 4WH0A 4X7RA 5IULC 1VPWA 3OAAA 4JJ6A 3T5CA 2MINB 3AEYA 1TZCA 3FHOA 1PU2A 2FSFA 4GBGA 3ZJ4A 1OHHA 5CJJA 4AF6A 3D7NA 1NDQA 3HYNA 3IOBA 2GM5A 2XNJA 5EUBA 5KVQA 1NJFA 3ILVA 3EG9A 4NY1A 3AKZA 4OLAA 3UGKA 2ERXA 1E6LA 4AK9A 3D6JA 3FUTA 3KHUA 2GPYA 1Q17A 2IYSA 5IVDA 3TKAA 4FMPA 3RKUA 4ZU1X 4Q34A 3WLRA 4ZKDA 5I47A 4DV2B 4WCFC 1FJ2A 1VP3A 1XCLA 4J3FA 4L57A 4TVSA 5A3RA 5KREA 4JOCA 3AESA 4RO0A 1KK1A 1XTBA 3PYLA 4WFJA 4N7RA 4RULA 3UK1A 1F17A 3BKXA 3RLFA 5CW1A 3NHSA 5JO9A 3FTFA 4XJSA 4J16C 3AKDA 1UINA 3DEYX 2IUTA 1XLVA 3C3KA 2QW1A 4Z0PA 3AHJA 4G5XA 4K6CA 4MS1B 4YC7A 1A69A 2CJFA 4ZQEA 1P60A 3V8MA 2HK8A 3VPSA 1WX1A 1DO0A 3OEYA 2ICAA 2RIRA 5DI9A 5EUMA 1U3UA 2YMQA 1QANA 4TRNA 1T0BA 1X0XA 1XZLA 1FLNA 1EVZA 3I64A 3O95A 4PONA 2A88A 3EY4A 4OX9Y 1XTJA 1DDGA 2Z4SA 4TT8A 1CHNA 2F4NA 1XBTA 3BXFA 1H4QA 3IURA 1W4ZA 1NUPA 1VKHA 1WCIA 2QPLA 2WYVA 3CG0A 4L73A 4OIFA 5CVDA 5K9ZA 1T1RA 1Z15A 4DHWA 3THXB 1QQBA 3QFRA 1NOIA 4WJLA 3HVUA 2R66A 1Y9ZA 1SU8A 4BXOB 4XFDA 1FRQA 3QXXA 2JGNA 3E05A 3T5AA 4HI0E 4PZLA 4IIDA 5D7NA 3AM5A 3PNYA 5TS2A 5HF9A 4Y6PA 1FLVA 2CEAA 2CZCA 4RPGA 3WQQA 3KPJA 4B6PA 4CQMA 4A23A 4TYYA 1WXFA 5L7YA 3MK31 5CB8A 4YECA 4A10A 1XN4A 3CLRC 1D5CA 3B7WA 1IUNA 1UBLS 4O1IA 4OBBA 5TPWA 4J0GA 3QE4A 3RC8A 2O0MA 3SQOA 2AJCA 2HMAA 4XYMA 4B48A 5LYYA 5BSHA 2WM8A 2MSLA 1VSVA 3O8BA 2HIHA 4JWKA 1DC3A 4I1PA 4PYJA 2D0PB 1B3RA 1R9MA 1G5IA 2OCXA 4OUKX 5EIAA 1XLTC 3DMYA 2C2XA 4B71A 3HJNA 1IU9A 1DEHA 3KBOA 4MVJA 4OJQA 4AG5A 2ETXA 2H63A 3OZIA 1HTWA 2ZIUB 4BCBA 2VG8A 2J3KA 2WM9B 4HQFA 1N2CB 1ODKA 3UUFA 2Q6TA 4OYHA 2B4QA 2H9YA 4MKGA 4CF6A 5BNZA 3P5SA 5BWOA 4LW8A 4UXIA 4ND5A 1U0NA 2R2GA 4E7PA 1DXOA 1Y33E 3DWFA 4OH1A 1FVXA 3KR0A 4V0QA 4PGAA 2QUHA 3I1FA 2CD7A 2ZQ5A 1BFKA 1UPCA 3OU6A 4DCCA 3OSUA 3S8MA 3K0KA 2RK6A 3ZNQA 2J9FA 1ONSA 3G5TA 3OKAA 5HBGA 1XDDA 1GXSB 5LQJA 1V11B 2QTAA 3O9MA 2CV1A 2HR1A 4QRHA 3PHJA 1V5WA 5CCEA 4EW3A 2NVWA 3WAJA 3CW8X 2FUG1 2ZTUA 5TB5A 3X1JA 3AJ9A 3E58A 5FKJA 6REQB 5L53A 1UDRA 3MB5A 4BJ3A 4ENVA 2XB8A 4RD4A 2PT7A 4YV0A 4J6FA 3H0EA 3O8RA 3PA8A 3AUYA 2ZWPA 3T95A 2P7IA 1SIUA 1PK8A 4KV7A 4XIJA 1OGYA 4ZV9A 5EWLA 1HL7A 2RGNC 3FAKA 3GRPA 3H8VA 4DILA 4R1UA 3U09A 4UU8A 3OJEA 4KFTA 5A3VA 3TW6A 4DSUA 2R68A 3GA7A 3LRTA 1QO0A 1QG0A 2IH2A 3H9JA 2C7PA 1DAPA 2CLCX 1L5GB 4ARIA 1VL5A 3ABZA 4QT0A 2H1CA 3GZ4A 3M6FA 1AE1A 1JSRA 3U7QB 1XJCA 3KJGA 1O08A 3NHPA 1EX7A 3LAWA 3HUEA 4LK2A 4CCWA 4EGAA 1P6UA 1UM9B 5J2TA 1HSZA 1SXPA 2PS3A 2WKPA 4OL0A 3ZWBA 4BOYA 3RRMA 1B7GO 5K3EA 1WPGA 4FXPA 4UTXA 1ZI9A 3SPXA 3ER6A 2JI7A 1CJKC 3LW8A 4UU1A 3OFNA 3D43A 4CTOA 1SZJG 4DV7B 2ZKLA 3ICPA 5DHSA 3QVXA 3SJUA 2W2PA 3EA0A 3GELA 2GDZA 1O2DA 2ZYTX 3QUCA 4MV7A 4ZU3A 3MWFA 3VPFA 1ELOA 4XWOA 1N1MA 3WK8A 1PGQA 1SMKA 5DXAA 2Y1LA 1BX3A 4NYIR 5CHYA 2XMCA 5F3DA 3CKMA 4GPBA 4HDMB 3NBUA 4O4IB 4EJSB 1MV5A 4G1BA 4KQ6A 4IH1A 2V58A 1CLEA 1E0JA 4BO3A 1NDHA 2VH1A 3U4QA 3NPAA 4IJQA 2VXBA 1GGHA 2ZT7A 3EHDA 4GLLA 4AMYA 4B6GA 4U9IS 4XA8A 5AIAA 4RABA 5CXXA 3BJZA 2IPAB 4O33A 1NBWB 2NP6A 1QCYA 1UZUA 3G7NA 1PR9A 2YOFA 4J0EA 2IYZA 1E1NA 2I87A 1T9HA 2CXHA 5JZVA 1Y8RA 1H5QA 2X2OA 2NZWA 3GI1A 3KLOA 3MIIA 3O0DA 3VJKA 3DNPA 3RUCA 1CUZA 2B61A 3HWSA 3MERA 4FGUA 1FP2A 2F90A 3IQFA 4JP5A 3T7DA 1D8AA 4DYVA 4M7WA 2OZPA 2JAOA 5AJUA 1EP3B 4JYCA 4I55B 3MGAA 3QUTA 4X00A 5GONB 1RS0A 2ID8A 3OHPA 3IIJA 3PDHA 1EI9A 3VTAA 1OA1A 1P7CA 3BIFA 4HNAA 4OI4A 4I3GA 1QDLB 4M8SA 2VDJA 4XWYA 1T2FA 2GGSA 4MLPA 2WQ7A 2YFHA 4XQ0A 3COYA 5B6PA 2Q9UA 2JEOA 1OBHA 2WOOA 3A0UA 4YAWA 1FP4A 1M8JA 4RJKA 1DC5A 5LM3A 1VIDA 2GPWA 4OHPA 3ZCUA 4HBZA 3F4KA 1J7KA 4I4TF 4Y2RA 2HSEA 5FOUA 4LMRA 3UUEA 4I9HA 5DHAA 2A8YA 2PUBA 1R27A 4XPZA 4ZDKA 1XO1A 1PVVA 2OHIA 2DHCA 5I9NA 5CT5A 3ZGXA 2BGUA 4QZVA 3CH6A 2W93A 4XWTA 4A8JA 1XRNA 4EZBA 4ZCSA 3JQ6A 4WA7A 4C3ZA 1GLGA 1S2NA 3CH5A 1JU9A 1DWUA 4B87A 5LB4A 3B3JA 4RKWA 2AH5A 2HO5A 4U7FA 3U62A 3QF4B 5GWXA 1FBNA 4ZALA 2JJ1D 2VJKA 2BKAA 4GXQA 3RAJA 3F1KA 3TOCA 4PSCA 1G19A 2O4CA 4Q0MA 1Q0HA 4BPBA 4FOPA 4JDPA 3IR7A 1T36A 4CMKA 4RY2A 3CUWA 1ZU5A 3N0TA 4DMMA 5D7BA 3AF4A 2IFTA 5ALTA 5IT9A 1G20A 4E22A 1N4DA 4HQ0A 5G53C 1L4EA 2V6GA 4YACA 1SVUA 4C2TA 2OV2A 4P4GA 4XFKA 4MDFA 5B7GA 1HTBA 3WGOA 4WBNA 3QE3A 2D7CA 4YR9A 4J2OA 3D6VA 2GCPA 4MUMA 4KR6A 4JEMA 4TMVA 4HOYA 4FYJA 3WOVA 4PVCA 5LOVB 4KR3A 4Q6BA 4AT1A 3K0FA 3Q2OA 3SX2A 1LF0A 2RKWA 1R6XA 4O2BB 1JHDA 4BO8A 5L45A 3IAAA 1ZM4A 2XA1A 3OQ1A 5ICSA 1IB6A 2VAVA 3K1JA 3W77A 4DT1B 1QU2A 3IS3A 1DBRA 1AX9A 2HK9A 1G8HA 2PZBA 5JJ5A 5DYTA 2NQ8A 1Z35A 5ITZA 4JA0A 1YZ3A 3LUFA 1OJLA 3JD1A 3AY3A 2XSZA 1BDBA 1F3OA 1QJCA 1R1DA 3H4VA 4WFKA 1UXIA 2GYYA 2EKBA 1DL5A 1VSTA 3HU3A 1K97A 3LHDA 3ZWKA 1XZMA 2P8SA 1AQYA 1IDN1 3QX7A 3EF3A 4W99A 1WKBA 1QOQB 2GZ2A 5AK5A 5ADUS 1TGVA 3FIJA 4HUJA 4GXNA 1Q14A 2WE7A 1NC3A 2P4UA 4GG1A 4JT9A 4K28A 2OFFA 1YVRA 4U2GA 1OB5A 4LGMA 3G9ZA 4QIHA 5EE0A 1HPLA 2R11A 3CVVA 2OSVA 3MCZA 4M9UA 1LQ2A 3RDPA 3LYUA 2EJVA 2VTKA 4LBYA 3WNZA 1CVIA 1NRWA 4RK6A 3W2TA 1W52X 3LXMA 3ME5A 4B7CA 4BFXA 2VJDA 1JIKA 2PKQP 3PA6A 1JX6A 3V4RA 2V96A 1JP7A 3FJOA 4HJXA 4PZUA 2VFAA 1M2EA 2V3VA 4B6SA 1CQPA 3MJTA 4GVLA 4FBLA 4CM4A 4DF3A 3L3BA 4AF8A 2QT0A 4NCBA 4DNXA 4QSHA 3PJDA 4GKAA 3QKSA 4Q4HB 2GBLA 3FPLA 4P8RA 4J7CA 3VR4H 1X7HA 1PNOA 3K09C 1N1DA 2BHTA 1G1AA 4JGBA 5EIWA 1F0YA 1Z0FA 2R65A 4FB4A 1MZVA 4TLEA 1ORDA 3KT3A 5K3OA 1QCDA 2OHFA 1NYRA 2OKCA 4J0CA 2FG7C 2ODAA 5JYDA 3DO5A 4WASA 3CZCA 4RLFA 1SQGA 3LUHA 3G1UA 3WQHA 5A5GA 3CCCA 4FQ5A 4CEIB 2REOA 4JP1A 3EF1A 3OZAA 1KNXA 1V0JA 1KE2A 2RGXA 2Q5IA 3FPKA 3JZAA 4JP8A 4MWGA 3SG0A 2AG1A 4C7JA 2VP3A 3DFUA 3ENVA 2WNIA 3RD5A 1QP7A 1NHGA 4EW2A 3M6LA 4O2AF 1ULZA 4CIVA 3FOBA 4ABTA 2COKA 1TMKA 3ENQA 2YYAA 3I2IA 2C94A 1EINA 2AFRA 1CQIB 1LLCA 2X9NA 3JQGA 4MUEA 3I2FA 4NZMA 4ALNA 4UUOA 2M9MA 1W0KA 2CKMA 2PH7A 1A88A 1Y9JA 2B99A 3O4VA 1XF1A 2E4VA 2XTMA 3DCYA 1ZVQA 2QTFA 4PICA 1U3DA 4PYNA 4XSVA 5T8KC 2Q3JA 2FSVC 3OU2A 1LX6A 4ANFA 4ZJPA 5CB4B 5KYNA 3BRSA 2AFIB 1K4KA 1N5RA 3LX5A 2JCXA 1XXHE 7YASA 5JSUA 3QVKA 4WN9A 1KOJA 4WKBA 1MXHA 2G5PA 3QVUA 2DBQA 2O54A 3C3BA 5KO2A 1XZGA 2Q8QA 3PFFA 2ZUWA 1QRTA 1NVAA 3ICOA 5IBCA 4PLTA 4Q47A 5K8CA 2DEUA 2NP7A 4GSKA 4S2EA 2ASVA 2H52A 2YWHA 1DCMA 2Z08A 4G4SP 2ZVQX 3ZV4A 4DCSA 1U2PA 3IUEA 4EJ0A 4C14A 1A3CA 4JL5A 3QKIA 1WE2A 1KSJA 2ZJOA 3PFGA 3WA6A 5BP7A 1EFRA 3O26A 4KGDA 2FZ5A 1UJ6A 2VZ8A 1QLHA 1E2QA 1L5VA 1BJTA 4WY8A 2M6LA 4ECEA 4H27A 1ZOOA 5G4KA 2VF4X 5KWIA 4EPYA 5KBYA 3U6KA 4RWZA 3F6YA 2Q3BA 3LDFA 2V5VA 3IEVA 2B36A 4KIFA 2CHUA 3EEFA 3KFLA 4J1TC 3ZNNA 4Z7NB 1FNSA 3LQFA 3P9RA 5J4HA 4D8VA 5FBWB 1EFTA 4IDDA 5FOQA 4LF6B 4LOJA 4Q3KA 4DV0B 2J9RA 3ZE0B 4JC4A 2B20A 3MTIA 3BK1A 5AVRA 2ZYDA 5FPPA 3SM9A 5CT4A 3BYZA 2OV1A 1ODJA 3GFVA 5PGMA 3I4FA 1PUIA 2I4LA 2BZSA 2JH3A 3RS5A 4MITA 3EK2A 4B74A 3VJRA 2QSYA 1XVTA 1MJ5A 2QAGB 4YJ3B 4I5GA 3QV2A 4R3UC 2MSDB 4IGAA 2C2GA 3RYHA 4EG0A 3UBTA 2BDUA 2FRDC 2HFKA 2QX8A 3R20A 3R5JA 1TC2A 4IWXA 5E6SA 1TOAA 3CNQS 1NXWA 2YRXA 4FI3C 3JVUA 1IY0A 2AFVA 3G0CA 1Q7RA 2G1UA 4CM5A 2IS2A 4L15A 5KC8A 5JD6A 2DQ4A 1QZTA 2R8ZA 5JCOA 1EDZA 4HK4A 3K32A 2GZ3A 3L0DA 3ORHA 3S2EA 3UHAA 1E66A 3JWEA 4N3CA 1J0DA 5HK9A 1QNFA 4KE6A 2WJZB 1U6KA 4Z9AA 4N9WA 4RZHA 3G8CA 1UZMA 3VO9A 1QHSA 4TUYB 2IH5A 2Z9CA 3KE8A 3P97A 2AHRA 2JHAA 4MVYA 2BFDA 1CUFA 4MIYA 3SEAA 3C8UA 4DMHA 5KJFA 4LYFA 1MAWA 2C9OA 2MIIA 2NO6A 4BU1A 4IJ6A 5A4IS 2Z2YA 4Z7QB 3CW9A 4WFIA 4IVNA 1GYRA 5FUXA 5GZ3A 4E09A 6ABPA 2QG6A 1ZUWA 1A4XA 3PDCA 1H2AS 1URPA 2AOUB 3TECE 2GPJA 4A0GA 1K5HA 1EVYA 4PN7A 2NOAA 3ND9A 4CHTA 4M9ZA 4FWTA 2A0UA 2J3EA 4GOXA 1WCWA 1JLKA 4KN5A 2HDNB 5J4LA 4R2MA 3EWAA 1A0OA 1JTEA 1QTIA 2IXTA 3S5UA 4BFYA 3B3GA 4L5IA 5G1OA 2HTEA 2GZSA 2ZWIA 4EI8A 3R9WA 5F2OA 3PUWA 1IBLB 2C0CA 2Q8PA 3ZH2A 1Q1ZA 1MCZA 2EVWX 4F0JA 3NBKA 1FA9A 4AMVA 2HBRA 4U02A 3VYVA 4ZQIA 4DM3A 5BWLA 3TRHA 5HCIA 1IG0A 5T7BA 2CWWA 2OT3B 5DM0A 4WVLA 4EPVA 3OKPA 1TO2E 2ZIZA 3SIXA 4ESOA 5KTKA 5FJJA 1V8BA 2HRCA 1Y8QA 1GNTA 3FRJA 5DNEA 5L3QB 5LVAA 2OXRA 3DBOB 3H5OA 3NJ4A 1Z37A 2PUHA 3FNEA 4BQRA 1M1NA 5E95A 5JYBA 2JH9A 2VSFA 1VKRA 3LPMA 1XDSA 2OB1A 2Q6LA 3OJOA 1ODCA 3WAGA 1M2NA 1QO9A 1DADA 4QA9A 3UWPA 3COJA 4Q3AA 3TUJC 2FX2A 1X70A 2WMNB 2AW5A 4Q9HA 4I5EA 1KR2A 3AEXA 4OTZA 4PFJA 3QM1A 2H4YA 3GY0A 3ZJ5A 1FRZA 2VKTA 3A05A 4GLJA 4M1KA 3VDMA 4LUCA 3V1MA 4M3NA 4Q19A 1RKQA 1MX9A 3HUFA 4OHRA 4TTVA 3TM4A 4TSFA 2H11A 1E6WA 2O2GA 4AJHA 3PNSA 4V0KA 4D9JA 4LSZA 4A73A 2FUNB 1GPJA 1UMKA 2J30A 1NTRA 3ER8A 4WUTA 3PEYA 2VP6A 2WKQA 2CMGA 2FZLA 2G4VA 3HJFA 3UMJA 1V16A 2RHHA 3EGDA 1O8BA 3CXRA 3EVGA 2ATCA 3CW2A 3KYIB 4WCFB 2O57A 4WESA 3H5NA 3KS9A 1IPEA 1JEYA 1FTYA 2D0IA 2O3UA 3P71T 4ZEVA 4C4OA 2ECPA 2SKDA 1CUVA 2IEAA 2REQB 2I4IA 4DJFC 4K2AA 1NL3A 1IY2A 1A5SB 3L7NA 3N8IA 3SS7X 5L9AA 1JIUA 4F5DA 2AGVA 3MEQA 4MTCA 5EY5B 5LDHA 5LQDA 2ILTA 4BGDA 2PO5A 4ZI7F 1AKEA 2NU8B 3E9YA 2NT4A 4L9WA 4R71A 3GT3A 1Z2PX 2Y1OA 3EVAA 3ISVA 2VNJA 5FO0A 4Q7QA 1WXIA 2Q3CA 5IMBA 3T5PA 2B6NA 1L4LA 2W6JA 3DMGA 3FCAA 3M4JA 3PB3A 2VDNB 4KWTA 5JAIA 1SG0A 1MRNA 5D00A 2FW7A 1U8CB 3E9QA 4LS3A 5AO9A 1ZGGA 1HDYA 3SX0A 4BX9A 2Z3VA 1ZIDA 4LAFA 2WYIA 1YQQA 1DKLA 5EXPA 1XELA 4EY6A 3FCYA 3TL3A 3TI7A 1D4AA 2IXBA 4MARA 1JSZA 2JFZA 3ZHVA 3DMRA 3KOYA 1NN0A 1TF2A 2QN8A 4ERNA 1MGOA 4I1RA 4JQYA 2CDNA 2RHDA 3QVGB 3ID6C 1QH1A 3P0FA 1QH0A 1JV2B 5ER6A 4BVEA 5FUQA 3OOWA 1K9VF 1NR1A 2J3JA 4KPUA 4ZAFA 3EA5A 3KQSA 1KE1A 2HBZA 4IMIB 4PHHA 5LZ2A 2NZUG 1UBUS 3FFBA 1C0PA 4A8HA 1JSXA 4EKNB 1N3LA 4RVHA 3NTOA 2ZI7A 4KFCA 1BFDA 3BRWD 4CV2A 5IJZA 2TS1A 3IJRA 4QPCA 3VH1A 1JHMA 3FWKA 4CMCA 4E12A 5KSOA 1S3GA 4YUWA 1RE1A 3LTEA 2PS9A 4FDLA 2QXUA 4DWJA 2PY6A 2WPNA 3KTFA 1S4QA 2VRCD 1BKYA 1Y1QA 3NP9A 1FTGA 1AG9A 1RM0A 3FN4A 3QKWA 4PYRA 2JFGA 3X1YA 4D43A 3I5UA 5B5SA 5DBFA 4HKTA 5JRZA 1RWNA 4UBJA 3ZH9B 3Q88A 3ZGZA 2E48A 1FTWA 3HNPA 5JWHA 5C1DA 2OMEA 3JATA 1ND5A 3KTAB 3KT0A 4ZU6X 1GTZA 2FTKE 3SY8A 2O20A 3I34X 4LKOA 1XTSA 3OQVA 4CM8A 4QYTA 1X7GA 5I7HA 4JIMA 4P7KA 3CVYA 1E63A 2GRUA 2V4MA 4KQHA 4TTPA 4U00A 5K6RA 1XJ0A 2QTCA 1F2UB 3BF7A 2G6BA 4GP6A 4Y0AA 4OXRA 5AP9A 5TE9A 4DLLA 4EYEA 1I10A 2CFSA 3DWIA 1P1IA 2O7RA 2C99A 1HFWA 2ZK7A 1N2BA 1L4KA 3PUXA 4W1SA 1ABBA 1YGPA 5A5VA 2ZSFA 1AKUA 3SEQA 4P7GA 5DTMA 3OPYI 4YIKA 3AUXA 4LYYA 2X77A 1HZZA 4BGIA 4BNXA 4D5GA 3QMVA 4IVQA 5KYYB 4BTEA 3F6RA 5M3BA 2VQFB 2QE7A 3GFSA 2EKPA 1U28C 2WEKA 2OEPA 4BMOB 1SVMA 4NSNA 4H77A 4YDSA 2GZRA 2AXQA 4GPTA 4KIWA 5FBKA 1X15A 3FWNA 4LSWA 4CFYA 2H2FA 2DPMA 5J5VA 3WRWA 4AM8A 4JJ8A 4MV9A 4G8JA 4CKCA 3DE1X 2VPQA 2JFUA 1IULA 3JD0A 5EZYA 1QHNA 4DAOA 2D1SA 5BMVF 1Q91A 1H6AA 1E1CA 1BO6A 1RACA 1FPQA 3M0EA 1OI3A 2XXJA 4DUGA 5J9FA 4WZBB 2JZNA 3B2EA 4RH3A 4Y9UA 5TPZA 2GEFA 1DV2A 1XA3A 2YJNA 4PLWA 3HABA 2G7MC 2WSMA 1NP3A 3CX3A 4PBTA 3L1IA 1ZEJA 2BFWA 1U90A 2R25B 4ARZB 3GEEA 4CL3A 2GCOA 1F3LA 2GCNA 3K4QA 2RI1A 3HI4A 4PPFA 2AUNA 3VR2D 1II9A 2Y1CA 5CA1A 3AVXA 3N2NA 1XZBA 1JMVA 3QU2A 2ENUA 4KUGA 2ZJ1A 5BQ5A 3BM5A 2PR2A 2XQVA 4RIFA 4LJRA 3GV0A 1EFPB 2OG1A 2HRBA 3GD5A 1VDMA 3JQAB 2CNDA 1WD7A 4NV3A 5TS3A 4PIMA 4RD1A 2JATA 3J7AC 1D0SA 1PQYA 4O1MA 1WV0A 3L7IA 4ROTA 3VAZA 1JHZA 2W2VA 3DONA 3ONNA 1SXHA 4QDTA 1ZJWA 1LY1A 2HSJA 2X6RA 3B78A 2QTVB 4JZYA 3EH1A 4PCVA 1W4CA 2G08A 4Q93A 2HWYA 1BQEA 4OFZA 1U8XX 3U7RA 4LJYA 4X8OA 4FUQA 3TB4A 4QM6A 4FFBA 2GVZC 5JJKA 3GJ5A 3VPDA 5FWNA 1WDKA 2JC3A 4MS3A 4P3KA 2J4CA 3PD7A 5ALRA 2QKYA 3DMTA 2YUIA 5KVVA 2RC5A 1RLOA 3KU4A 5AVWA 2ST1A 4RVGA 1ZRHA 3ECCA 3LDAA 3C7AA 3VX3A 4NBNA 5HUJA 2QTWB 3R6LA 1P3Y1 4BJ1A 3KYDB 1KRXA 1KMHB 3QVWA 3IIMA 1Z74A 4A6PA 5KX5A 5IVKA 2Q1UA 2ZTMA 2BUBA 4CXMA 4II3A 4CCAA 4F4CA 4MQBA 4YLEA 1PBNA 1YQTA 2QN7A 3OJWA 5JVDB 2PJDA 2Q8NA 1T9AA 4Q1FA 4EKDA 1UDAA 1Y37A 2D1FA 3S2YA 2ZBGA 3KSRA 4LA4A 2X86A 5I8ZA 5JHHB 1G0OA 3DGEC 4GFDA 2A1UB 3G2QA 4F56A 1EK0A 4ES6A 3HA7A 3ER9A 3ENZA 3RS4A 3A14A 2FPXA 5FOXA 1LQTA 1QX3A 1ADBA 1LVGA 3MD9A 4IFEA 4ID9A 1E8NA 3E5HA 3CZ9A 4JNCA 5BYBA 5JQGB 4P83A 5I7RA 1QK4A 5AICA 4BV3A 2WG0A 3CNLA 3KOMA 2PZJA 1LLUA 2OFWA 3WWZA 5F4ZA 4P58A 2I91A 3WB9A 3TNJA 4NEGA 1G7CA 1IN6A 1LDYA 4GE0A 4ESVA 3U31A 4LWQA 1CETA 4NV0A 2V55B 3FNBA 4CV0A 1ABEA 1EWTA 1QTQA 2WF8A 3AHFA 3L05A 3CC8A 5AI9A 4ZQFA 4N6NA 1BZYA 5F7XA 1IL0A 2EIXA 3EGVA 3QE0A 4IHAA 4FC6A 2IGBA 2XQIA 4PEVA 1T9BA 1OT5A 1T6BY 3FWPA 1KZ6A 2R62A 3VV2A 3WSWA 5BN3A 2GN6A 2WWTA 4BYMA 1D07A 1MD9A 1NZFA 2EIHA 3STHA 3C8ZA 3K35A 4UDOA 5JY1A 1CCWA 3P2MA 1K1EA 3GJTA 5DM2A 3LDHA 2BONA 2JLUA 1T2CA 2I55A 1BXRA 5EMJA 4C29A 3WGQA 2IITA 3E9RA 4AJJA 5BV8A 3ZZ0A 1UPFA 5JD5A 1GPH1 2AOVA 1PDWA 3E8SA 3PNPA 2HSDA 1XCBA 2WUVA 2YDXA 3B1XA 2BZ0A 2GA9A 2EOAA 2OR3A 3NBMA 4JI2B 1DJLA 4MS1A 3GBVA 1DHRA 1YZNA 3KKOA 4PIPA 1IZ0A 4EL0A 4YCAA 5BSTA 5BUZA 1R0XA 8LDHA 1XZJA 4L5AA 3JALB 5ENDA 4TQ9A 1NI5A 1PWEA 2H51A 3ET4A 3FYSA 4WXEA 4BP3A 5IXJA 3WLFA 5EHXA 2FX3A 1NIPA 3NOXA 4GUDA 2ZB2A 1SKBA 4GQAA 5KJEA 3U3RA 3BKWA 1MC1A 1SXQA 3THXA 1L3BA 1IFXA 4G6ZA 5CM2Z 4YV7A 3E15A 4O3FA 2H16A 3F9IA 5DBGA 4DIOA 1DT5A 4BRUA 2JS7A 3UOWA 3GQVA 1OFHA 2G9NA 1G8AA 1BQ3A 1FK8A 1XTZA 1Y8AA 3SM3A 1ZGHA 3HKCB 4M1TA 4L5BA 4O02B 1J97A 1H9BA 3IJEB 4JX8A 1GUYA 3X2SA 2X5XA 1X94A 5AK0A 3I52A 4CLEA 2CKDA 1C4KA 4H3HB 4XQCA 4UMFA 3GT7A 3K8ZA 4D4MA 4KG7A 4N8SA 1LD3A 2N47A 4RIGA 3LBIA 4HWOA 4B3DA 5GVSA 3EMKA 3OZGA 4B80A 1JHUA 1KIAA 1SH7A 1BH2A 1OV4A 2Q49A 1MIOB 1HOXA 1KFEB 4AUEA 1VGQA 5AJHA 4UMEA 3W8FA 4OAQA 4EHAA 3EQ2A 3PD1A 2HEIA 3JWPA 1RBYA 4JR1A 2A9PA 4B43A 1QSGA 1C9KA 1V35A 3TMKA 4EZIA 4PXYA 5T67A 1NNSA 1P9LA 3IE0A 4CIBA 4KQFA 4HF7A 1ZQ1A 1RCUA 3HJTA 2XVMA 3PFCA 1YHYA 3DVQX 2PUFA 2NU9B 2FQWA 1JFFB 5DJ5A 3UJ8A 2XB4A 3EIFA 4E5UA 1JI3A 4EG3A 4KKVA 4RVSA 1JXOA 1A8PA 2ZRNA 1UXJA 2Z2XA 5KTPA 3S27A 4AJLA 8GPBA 2FMFA 2XE8A 1U2RA 2CXRA 3AEKA 1JKXA 1WOYA 4B82A 3FR8A 1J70A 3N87A 4WZAE 4W1RA 3RQIA 1GA4A 4QO7A 3AVYA 5EJ7A 1RQPA 1ZK0A 5LYJB 4GYJA 2EX1A 3ISJA 1GXSA 4FB5A 2R8BA 2ZR9A 5IJAA 1V11A 3JQQA 4OV6B 3UV7A 1M74A 4EA8A 4F2GA 2NGRA 1Z18A 2AEMA 1PSZA 4WHMA 3RUIA 1PJRA 1T4GA 2ECFA 3HSSA 4X20B 6REQA 1OI2A 3HCRA 1TADA 4P4SB 2EZ4A 2IK8A 2MSEB 1TUIA 2OHGA 1E6CA 2Q6IA 2WJGA 3KR1A 1P5JA 2GPBA 2XRMA 4IDGA 2HIGA 4HR7A 3SC2B 3UPDA 4P0PB 2PXHA 4AIIA 5BOSB 1FSPA 3NUGA 2ZJFA 4FZVA 3CRRA 5MDHA 3EPHA 5TGTA 4EFLA 3DLHA 2PUWA 1WLSA 2DKFA 1ZMRA 1EVJA 1UPTA 2VJNA 4MWBA 1X8KA 4Q9KA 3WQBA 3GO4A 4QOIA 5IPFA 3IT3A 4KEAA 2CNOA 1YNOA 2FHPA 4UMVA 1OFVA 4CYMA 2V0CA 1NATA 2F48A 2FAXA 1S6YA 2V5UA 2RHLA 3KXDA 1CP3A 3MN1A 2AD1A 4G26A 2OTCA 5CB4A 3CX8A 3B3FA 1VTKA 1YCFA 3X2FA 1T0JB 3A3YA 3PXCX 1NF2A 4U9UA 1E4VA 3ZHUA 4O6VA 5CIYA 1UM9A 1FXUA 2FWRA 2WHXA 4HL6A 2YYSA 3CSSA 4KMMA 4N1AA 1V25A 4NU6A 2HMWA 2QRUA 1OKKD 4Y2XA 5FL7A 2A57A 2VRWA 2JLZA 2C57A 2Y0BA 4K3UA 4FBMA 5CG2A 1D5WA 3BWYA 2EKZA 3DE6X 3NMUF 5E3IA 1I4EB 4JXJA 4WLVA 4TT3D 3DZDA 3FNIA 2FGJA 1Y5LA 1WTCA 3GJYA 4GZ3A 8OHMA 3RNLA 4NBRA 5KSPA 1Z4QA 4ZVNA 4EEXA 2QRNA 2WHPB 1R5BA 2WJAA 2WJYA 3PT5A 3R6WA 4BLUA 1ZUD1 3IP8A 3LRPA 3HFGA 3TSYA 4Y7DA 3ZE8A 4EJSA 4O4IA 3NYIA 1DHTA 1MA3A 2WPDD 4UVEA 4E6EA 4AXXA 1JDTA 2PMKA 3FPGA 4US2R 3FSGD 3H86A 1EGVB 1E9SA 2X4IA 3IR6A 4BNNA 3QX8A 4BZXA 1WEKA 5AUOB 5CD9A 3QNUA 5DOVA 3LRXA 4EPTA 1E4EB 5F52A 1EKXA 2ILVA 4Y0VA 3NV9A 1BMFD 1J1IA 4Q1CA 4CZ2A 4RJTA 3AIMA 1R0RE 1NTOA 2GKOA 5ELMA 4TOIA 4MVXA 5JH7B 4CKZA 3NWBA 4Q15A 5FTMA 4EJ6A 1JEOA 2HLDD 1QLJA 2EZ9A 3NC4A 3OMWA 1HEIA 4U2DA 3HCPA 1K88A 5HA5A 1TKAA 5LB2A 1XJ5A 2B8NA 1JECA 1N8SA 3DZJA 2VBFA 4GQIA 5T6BA 4UBMA 3IV7A 4DRYA 5A0VA 1ZG3A 4UUNA 3FZEA 2J3DA 3BREA 3SJCA 2DU8A 2HB6A 4DGQA 2X7HA 5H80A 2KPOA 1H2WA 4ZCQA 1XMVA 4LDNA 5GONA 3HCAA 3VI3B 5LA6F 1WEHA 4KWIA 4ZEWA 2WABA 3C24A 3FMOB 4CFZA 3DVLA 1E77A 3L7DA 4YBRA 4BYGA 1W0CA 4YWJA 1QCZA 1B42A 3LNCA 3IL2A 1PJ4A 3O21A 1RWOA 2JEYA 1KJZA 1WVMA 1PFYA 4L8LA 1Z7GA 5K4AA 2K7FA 1K4YA 1O6GA 1ZHHA 2VJAA 3FBTA 3H65A 1HE4A 2JFXA 2H1HA 1R66A 2JB9A 5DEOA 1SBZA 4ZVUA 4DNFA 4NARA 3DXYA 2V3CC 4TV9F 3GOHA 3FYCA 4PG6A 5DYNA 2G83A 2AR9A 3KO8A 1A7JA 3BWDD 3PXBA 1YDWA 2J7PA 2OCPA 1MFZA 3WYBA 2J09A 4UOEA 1KTIA 4B6EA 5HMLA 3DOCA 1FRVA 1V4NA 3JWGA 1S2LA 3SQLA 3E53A 3QXJA 4B4OA 4ZIRB 3D59A 4AKIA 3QF4A 1L5SA 4I66A 4WBXC 5HUHA 2ZYHA 3LJKA 1DOZA 4M89A 1KH3A 1VDZA 2RGGA 3GLKA 3WMFA 3AKEA 2XEXA 1ZLXA 2OC4A 2Y1KA 3PU6A 3ZLBA 2VK1A 1AC5A 1LX7A 3A4IA 4NZNA 2PCLA 1W7AA 1IHYA 4FYWA 1BS2A 3BICA 1U8AA 1E2PA 2QS9A 3EFOA 3HBFA 3PNMA 4MI6A 3IEUA 3ZDBA 3OX2A 1NUHA 3D9QX 4BEVA 3R1IA 1TMGE 2WB2A 1HFKA 1NZJA 1O77A 2PYZA 2N1MA 1USWA 3C48A 4IH9A 4LE0A 2J0VA 4WMLA 2QRPA 5HRCA 1PVOA 4ZDJA 1ZAKA 1UPBA 1KO4A 3D8BA 5JNTA 2ZSHA 1DWQA 1Z4MA 3I1YA 3IVAA 4IY1A 1HYQA 3D81A 2BI8A 3GLHB 1PZFA 1G8KA 2PFSA 3Q4GA 4M0LA 3N28A 3NX4A 2V0NA 5C8VA 4QRDA 5IAEA 1EM6A 5G0TA 3TOSA 2I33A 2GNAA 1RPTA 4WL0A 2K7ZA 4WJZA 4HQOA 4L50A 4XE5A 1MRZA 2I6XA 2C61A 4MV1A 4BIIA 1Z4PX 3P52A 3QBDA 5H9VA 1B0AA 1WNTA 5F3RA 1NMXA 4FGKA 3U4DA 2P77A 1U9IA 3JQ8B 3HBLA 3NO4A 3PXGA 5MN6A 2IHUA 1XAJA 3CLUD 4BGUA 1P62B 2CMKA 4E7OA 4KO2S 4IXMA 2UYYA 3LUCA 1VHLA 1SULA 3TEMA 1XZKA 1OAOC 3ONVA 4NJMB 4P0TA 3TNFA 2HMSA 3VZRA 4NAVA 3H17A 4TZ6A 1Z2DA 4JKOA 3QMWA 1POWA 1YB2A 2XZDA 3L4SO 3T9BA 2IYLD 1I4TD 3UMRA 5G4LA 1UBFA 1JQJC 1PG2A 4WOCA 2OAEA 1M5TA 3FOZA 1R0CA 1XLUA 3TSAA 5KIAA 4JU9A 2H48A 5FP0A 1PG5A 2HMVA 3P0IA 5KTRA 1GNSA 3D8HA 4Y2TA 4MQEB 2NPOA 3ESDA 4FYYA 5DTRA 1CR1A 1DX6A 1KDYA 1TM5E 3AYZB 3LT4A 3O4IA 3GP8A 2CB9A 3H16A 3KOUA 3UV3A 2XNDA 4NOMA 4Q4HA 4CE6A 4RGQA 2FRVA 2CNKA 5J3JA 4JLUA 5AM1A 2V4UA 2R87A 2WT8A 1VYUA 3NHLA 4B3XA 1ORHA 2YWJA 1YSCA 4EAQA 2CLLB 1U2EA 1IZZA 4CEIA 3NHAA 1J23A 1CTQA 4AP6A 1HDGO 3M2PA 1XPJA 3FMFA 3PICA 1CEYA 3QLVC 1ZRSA 4G0MA 2WYWA 4XEHA 3MUEA 3NC1C 2FQQA 4HH1A 4HT3B 4ZOAA 2O0HA 4LNAA 4TMYA 3VNQA 7MHTA 2O2DA 5L3SB 1Q92A 3Q6NA 4YCLA 5F2KA 1JH9A 2PPLA 4GPEA 2ZIAA 3O82A 4HDOB 1HLPA 2XNCA 2J0EA 1TKCA 1ZWLA 1PLLA 3JASB 1IHOA 4IZHA 1N6OA 3FJ1A 3LLCA 2CHFA 1JJIA 1CQIA 4FCVA 4OQEA 1G66A 1Y4AE 4JI0B 3T99A 3LUGA 1P75A 3GQBB 1RXIA 4LWZA 1GRCA 3HQ4O 3AJ8A 3BMQB 3DBIA 3L5KA 1C9EA 3LGAA 4UD2A 4UE2A 2AFIA 3KD3A 4CIDA 5D85A 2YOHA 4F5EA 5L7TA 4O08A 3IV6A 5KWJA 3QX3A 2CHGA 1I6LA 2OILA 4HZUA 2DKOA 1KEUA 4YN3A 4ENRA 4KQWA 4B5KA 3L40A 2DPHA 3TH5A 3D4NA 3DVAA 4URXR 3KQKA 2JKYA 4MSUA 3CJTA 4ZVQA 1TAUA 1UKEA 2AHOA 5ALQA 1GIAA 4PBSA 2WTUA 2DETA 1RI5A 3F78A 1KI6B 2FR8C 3GGCA 1KSGA 1PP4A 1EZZA 4CLOB 4CEJA 3UHJA 1Y6JA 4N5IX 3CNEA 4G85A 1OU4A 3MGCA 5DN6D 3L7KA 2Q3FA 2ZAGA 2WNHA 3C1OA 4UVHA 5TVKA 1W36D 4I9UA 3S1AA 3ZGLA 2ZJ8A 2WNSA 3NKVA 4QO8A 4F2PA 2NSYA 1V1JA 2WV7A 1SFRA 2GTIA 1WKCA 3GUUA 4OXXA 2UV8A 5IP5A 4CT0A 3FUUA 3HDJA 4MVJE 3DWGA 3PI6A 2PGNA 3T0GA 3CR3C 4DV5B 5KMGB 1X1AA 2GAOA 3G2PA 3BWVA 3GMTA 4RPJA 5FLKA 1M72A 2VYFA 4F4UA 1H8ED 1I51A 4PLZA 3EZNA 4C7OB 1XU4A 4XSGA 4FR5A 3A1VA 3BAFA 1O6ZA 1ZN2A 1RC0A 1PFWA 1V26A 2QAGA 3KCQA 4KYVA 4WVFA 1TQ4A 4YJ3A 2P69A 5BYJA 4RA9B 1I0LA 1TJ3A 3D2CA 2I2BA 4X44A 3GF4A 5WRFA 1T9KA 2HI0A 3L0PA 4LF7B 3A26A 5FL3A 4X54A 5EGNA 2C5BA 4REOA 3SR0A 3EDOA 2QV0A 4PM4A 5LLSA 1PL8A 1FZQA 4I3HA 4D3XA 2PV0A 1XEWX 4MRSA 4OD0A 4QXOA 3NTUA 5AJVB 1Z6PA 2HWUA 3EASA 2FZWA 2C1ZA 2VP2A 4TYWA 1GGNA 2OK8A 5JZOA 1W0JA 4YRRA 3DULA 4ZZ1A 4P7JA 4B17A 1NUAA 1ECJA 1WXHA 3JVIA 4MV3A 4NFLA 4R2KA 3HB7A 3ADPA 3TMAA 1O57A 1QFZA 4TUYA 1MMFB 5IFLA 5JBIA 2H18A 3HO6A 1LSOA 2P5TB 1OSNA 1VGVA 3AEUB 5J5CA 4GZMA 4CM3A 2Z1DA 1A95A 5G0SA 2KLBA 1TUEA 4GU5A 3HP7A 2Q2OA 3UFBA 2ZOSA 4PPNA 2O0JA 1PD0A 3RS2A 1YOVB 1HM5A 1IHXA 1UK7A 2I1VB 1N9GB 1JDSA 1Q15A 1PJCA 2P1DA 1CERA 2QN1A 3HHEA 4RMGA 1WKVA 4Y2QA 1LPMA 2QL9A 1NFFA 4BLOA 1YKSA 1QDEA 3IDZA 4EW1A 4HTAA 2IYPA 1ZJJA 3LQYA 1QS0B 4R1SA 4N54A 3KAQA 4EVSA 1H65A 1TYEB 3NEAA 1HQCA 1EEHA 3GDOA 1DEXA 3JQ9A 4RLQA 3T3NA 2P3SA 2AF4C 1K8XB 4I08A 4FOOA 4CKEB 1E58A 5FI1B 5KU1A 1GT91 4KWEA 2J45A 2OXCA 2YKGA 4HMPA 4IGIA 3CN9A 2FMKA 4HX9A 2FZGA 1DG1G 1L5OA 2YJZA 4ILEA 2UUPA 4X65B 3O47A 1FVFA 3B85A 3QOXA 3RSOA 1Z0KA 4ZAZA 4AWBA 1EBUA 3OESA 1QP4A 3SJZA 1BX1A 2PBFA 1EJBA 2ZIGA 3B7GA 5CCDA 3K9QO 3P2OA 3VPGA 1RAFA 3D6AA 4DQLA 3U1VA 5IF3A 1MQ9A 3P0RA 2QAIA 4IIBA 2AJDA 2FZEA 2KWIA 4FXOA 4GEKA 4UOZA 1DKQA 5L3QA 4LZAA 1YAJA 5HKOA 2YFYA 2ISCA 5BN5B 2XZTA 2NZVG 3PC3A 3MT7A 4MRNA 3Q3GE 1GL3A 1A8QA 3WL4A 3HYRA 4BFCA 2CJXA 3O0TA 5J5AA 4ACAA 1OPXA 4ZRMA 2YS6A 4AZTA 1MBZA 2CK3A 3FPHA 1RHMA 1J8QA 4NCNA 4PO1A 2MCFA 5MN4A 1MABA 3LWDA 1EIZA 3B2QA 3GAZA 3HWRA 4OXNA 5ER9A 5EWMB 3G1TA 5EXDA 1KO8A 1IM8A 3TO5A 3Q9LA 2A9OA 2QNRA 2RAVA 4LVOA 3QWBA 5F2NA 4KLNA 1K8RA 3LHKA 3FDIA 1W85B 4RF2A 4KWHA 2IOHA 3TRDA 4MW7A 4BWFB 3HVRA 4PXSA 1RHKA 2AFHB 4ZTZB 2GAJA 1JHQA 2YWRA 2Q5HA 3LSTA 1W48A 2ZE7A 1JVBA 4ZHQB 2Q5OA 2REXB 4YY3B 1KMCA 3HB0A 1U1GA 3H8WA 1VKZA 4MI1A 4G56A 4IM7A 2QEQA 3JAKB 2VTBB 3TB6A 4WEQA 4WCFA 1UP7A 1J2JA 2UXDB 4LDQA 1JIIA 1DOAA 2V7QA 4RXUA 2G1KA 4TKLA 3RROA 1A9RA 3FGZA 3L9XA 5ALGA 3WK7A 1G7TA 4WERA 1EWKA 5M04A 3L4JA 3IVMA 5AD1A 2O19A 4YS6A 3KNZA 2VQDA 3G0GA 2BR4A 1T2AA 3VVCA 2BSAA 1TB4A 5EIBD 4I4LA 5F3WB 1R6UA 4J16A 1L7AA 1KMIY 2Q1XA 3DCJA 3GNSA 2WQZA 3AY7A 5L7WA 2QRJA 2NU8A 5BW6B 3OZCA 4K40A 4X91A 4E0BA 5C7LO 3S2SA 3ROTA 2O8CB 1LC3A 3CURA 5I9SA 5FV4A 2J31A 2FMXA 2IX9A 3NHBA 2IXAA 1K06A 4OPMA 3ZGYA 3UJ6A 4E3ZA 4F5ZA 2OCKA 3BHMA 1YTUA 1SCIA 2AZ4A 1LCIA 1Y3AA 3UJ7A 2CCKA 1SK9A 2BFNA 1FMCA 1V7PC 3O91A 3OEHD 4TN1A 4B85A 3DDZX 3AGPA 4Q03A 3I53A 4U2KA 3WR5A 2EFEB 3RANA 1A2OA 1AQ6A 2W98A 4A16A 1YBVA 2LE0A 2XE4A 4RELA 3ZTTA 2EDAA 3HMKA 1NQXA 1TEHA 5JEEA 1T9CA 4IIJB 1HO3A 2X3FA 3IIIA 3QVGA 4MR8A 1BRTA 1VPDA 4OQMA 3UH1A 4WBNF 3FTCA 2PU5A 1X86B 2QUBA 1Q11A 1P2UA 2C4NA 1QWOA 4CG1A 5ALKA 2I7TA 4YAIA 4A0RA 3DE0X 4E5NA 5HR5A 1G20E 3TLGB 4CWAA 2DQKA 1D1SA 3H3XA 2YN0A 3K5HA 1SELA 2C4MA 5AVSA 4EO9A 1Y63A 3H1BA 4ALLA 2LDBA 1ONBA 2FDXA 2E4AA 3CX4A 3KVRA 5ALPA 1S8OA 4QU9A 4E5PA 1M7GA 3NVDA 4X1YB 2MYTA 2VH2A 4Z9XA 4EGCB 1FMJA 2C7BA 4ZGWA 4AAYA 3O1JC 1E5QA 3KKKA 4UHFA 1QHHA 4E5VA 3HJHA 1NQOA 1UT6A 2AMJA 3AILA 3HUUA 3KTAA 4WBSA 3O03A 3UKJA 4EPXA 4RM2A 2QJTA 3DOEA 3GDGA 1I80A 1L5MA 1QIHA 2IXFA 4JELA 3IFSA 4ZYLA 1XRJA 3BL8A 2CD9A 4RCZA 3C6ZA 4Y2UA 1D1TA 3EWNA 3VYSB 1JGTA 4Y67A 3RTBA 4DDUA 1NR7A 3D0QA 1JVSA 2YY6A 5DW0A 3Q9NA 3HJCA 3CLSD 3G2KA 1ZUNB 3AUTA 1HI9A 2QDXA 1NONA 3INYA 1ECLA 1O4VA 3H11B 4OLFA 4QHSA 1CP2A 3RBAA 3SF8B 3ZLJA 1QOZA 1G2IA 3KJXA 1C7FA 1Y6GA 2P6PA 4OI0A 4J90A 2QJRA 5EOVA 3C8HA 1BOOA 5DEIA 5AUPB 2P9HA 3DHYA 5DSTA 5KYYA 1ODIA 1VL0A 3FHJA 4UC0A 3O1HB 1RAIA 4EJFA 2D06A 2Z5LA 4JL8A 2B3DA 5BV1A 4LEIA 1Z13A 3P9YA 4RAQA 2FSSA 1GEEA 2V9CA 3DVRX 3JPWA 4K1XA 4V0NA 3WBJA 3NOVA 4YMSA 4PHGA 5K3SA 4MW2A 1UKVY 4BNDB 3ITDA 3KWJA 4UUBA 1HYBA 3ELBA 5EQTA 2Y9PB 2CJWA 1DDOA 3CUTA 3UHPA 2DULA 2EJTA 4U3JB 2I8LA 1E5VA 2W0SA 3UJNA 1N5OX 4JKIA 1PW5A 4Q1EA 3ZV6A 3PHGA 3FGPA 4FEYA 4KFSA 4LV6A 2EHJA 4WZBA 4XVHA 2ID7A 3AF1A 4FHEA 3WLMA 3CLUC 4CM1A 4DR7B 1Q1EA 4KZKA 4RZIA 2DUNA 2FX5A 3WRYC 5H9WA 1O1YA 4ARZA 4BEWA 3W04A 2XMGA 4B3BA 3RASA 3FCXA 1F0KA 4C4AA 3FB1A 3FUVA 3O4RA 4HYYA 3QIAA 1THZA 1EFPA 1Q1QA 3JQAA 5CLHA 2O5VA 4LPKA 4F6LA 4C87A 4YP0A 1NXSA 1X7ZA 4ABYA 4E13A 3ACCA 1DT3A 1K3TA 4II7A 2CN1A 3VPBA 3WVNA 2QTVA 4QNRA 3Q10A 4Q1VA 3VR3A 4XGRA 1AMUA 1L5HB 3NV7A 4DREA 2HA3A 1Z88A 1GUZA 2QVYX 3KQQA 4X1IB 1OREA 2X3UA 4JSTA 4OHBA 5EJFA 5T3UA 5CXSA 1TAGA 3TFOA 3TW8B 3EPJA 1QC5B 1DV1A 1NY6A 1PDVA 2PMDA 4F4JA 5B30A 3OOSA 5JZ9A 1KVUA 2RDMA 4R0NA 2O6HA 4Q1AA 1RVDA 1FXWA 1BN6A 4DDWA 2Q3EA 1BHSA 2CF6A 3FWHA 3P2JA 3TRKA 2MSWA 5JXHA 1MHTA 2C8VA 3KOOA 4Z1MD 3VR1A 2Q6VA 3DDNA 5ALFA 5SYNA 3EC1A 4BNUA 6Q21A 2RH8A 5LIRA 3KYDA 4H7JA 1KMHA 3DTYA 3CVOA 1N2XA 2N3ZA 4PX5A 5L4LA 2WZQA 3S1LA 3MQ2A 4F8YA 1E8MA 1SC4A 2A67A 2JRLA 3H5LA 5F73A 1NLYA 4LRWA 3Q8KA 2A4KA 5AXCA 3SLRA 5CVCA 4GECA 4UDYX 5HKKA 1YT5A 3STXA 5JVDA 4DIKA 5AKEA 5JMOA 1YZKA 3FH0A 3QQ5A 1V41E 2ZJBA 1Z5ZA 2OYSA 3UJHA 2GMWA 4OB8A 3RU7A 1ECCA 2JIZD 2A86A 2I6TA 3BH0A 3RTCA 3L5OA 3EZGA 3TJMA 3ZW9A 4Z53A 2ZM5A 1E3JA 1KRHA 2P4HX 4QODA 4KB5A 1E1KA 1MNAA 4FK8A 4U0JA 1Z3IX 4FQ7A 4MR7B 4FDTA 3DNMA 1SPXA 5B7NA 3M2TA 3QA3E 2A6PA 5JQGA 3OCXA 3UYKA 1RAHA 2C9DA 3UF0A 4Z4IA 3V80A 4H18A 5C18A 2Y0DA 4XWKA 2Z56A 3ZVMA 1P1RA 1G8PA 3K0AB 2ORVA 2V8OA 2ZRMA 1COZA 3T52A 3E03A 4RQTA 2WF5A 3SZOA 1RQ2A 4EUSA 3U44B 1XPRA 3CY6A 1CK4A 3IKTA 1W36C 2FG6C 3MIZA 5EMHA 4AECA 4UQLA 1GAQA 4PYOA 1OY1A 1NLMA 2XUIA 3T1VA 1DMRA 1KU6A 4GOND 2KLHA 3AUUA 2QUZA 3L8FA 3IMGA 2JHPA 2ZE6A 4O4HB 1V96A 4Q9LA 5FF9A 2F1RA 1U2DC 1VE5A 3CUKA 4MHOA 3PGVA 4MX8A 3EQ7A 1LZKA 1TLFA 1R0LA 1OH6A 3ICWA 5F1YA 2HJGA 4DTCA 2IXDA 2O3JA 3OQHA 5DNDA 1GZDA 4P08A 1QIGA 4NS4A 1AGPA 1BHQ1 4Y6QA 3CLVA 1WW3A 1G21B 1TTTA 3SGLA 4CLXA 5F4BA 1P3DA 3ZE9A 4QT4A 4FKBA 4W9MC 2BLLA 3TDKA 4WEOA 5EYPB 1H22A 2ECQA 4PC1A 3VQTA 4BY9E 2PGXA 1CS0B 3FY4A 1GZVA 4C4PA 2J5XA 3EARA 3M49A 4CMEC 4DTIA 4R3WA 2X3YA 2VYND 1JLLA 3LPLA 4Y1GA 5L8VA 3T35A 2ZUSA 1DGQA 1B41A 1E5LA 2H5JA 4GO1A 3WIBA 2ZM6B 3NHZA 1F4VA 2KSQA 4F60A 1E9AA 1PT9A 5KQLA 4JLWA 1UOEA 5M29A 3A37A 4NESA 3RJZA 5EP4A 3CJRA 1YIAA 3W5IA 3G5MA 4P2GA 1YBFA 2W6IA 2HPAA 3Q7IA 5BW8A 4MB2A 2QR3A 1KF0A 3N8KA 2H7VA 4ZODA 4BN4A 3H2GA 1GZ6A 4IOLA 4J9UE 3FNFA 1FFGA 4ZT5A 3HKCA 4HQLA 2CVPA 1O96B 3S2UA 2DQZA 5JSQA 4AD8A 1MX3A 3C87A 4DBZA 3VVMA 4S0XA 1AKVA 5EESA 2E6KA 1TAQA 2Z2JA 1QP0A 2Y2UA 2HIAA 2Q9AA 2C31A 2APJA 4NHEA 5EAIA 4O25A 1QZXA 3A36A 5C80A 2YHIB 8AT1A 1NW4A 2UZAA 4L4RA 4CQLA 1KO5A 4ON9A 3FNGA 3RRNA 3DB2A 4D97A 3SE7A 2PHZA 4RZ3A 5U9CA 3EE6A 3WGKA 2BMVA 1Y7PA 1JG7A 16PKA 1ECBA 2MMGA 5F21A 2NU9A 3JCZA 3PQ5A 3F7TA 4HN2A 2G9ZA 3D2LA 2WJ4A 3QXGA 1BYIA 1YH3A 3WZMA 1VB3A 4I1UA 2LPMA 3AUAA 4WIAA 5CFQA 4DADA 3HP4A 2HJWA 4I81A 5AI8A 2LRHA 3ZCXA 2B6HA 1E2HA 3F67A 4D7AA 4E5MA 4OHZA 3QG1A 4R1PA 2NZXA 1CYDA 1Z06A 1NT2A 5TJHA 3TRJA 5JNLA 1C8BA 3DBRB 4EUHA 2DH5A 2P3QA 2MYUA 1E98A 1YDHA 2O2JA 3C16C 3QEOA 4MYTA 4XPIB 3FTQA 2AX3A 1FFWA 1SC3A 2DPYA 2I2WA 3MJHA 3R40A 5LYJA 2IV7A 5D51S 1TLLA 4DLBA 5JUWA 3FXAA 1CPYA 2NTNA 4C4ZA 3QVVA 1G18A 3B1WA 1J21A 2OXTA 4I3FA 2H4FA 3OF5A 4MMXB 2Q41A 3DC2A 2VT3A 4AKSA 2VO1A 3I58A 4X20A 2NO0A 4GDFA 3HKEB 2YFKA 5E9JA 5KHAA 1N1GA 1BG6A 2B1QA 2JLAA 4FKZA 2GTPA 1KDOA 1U5BA 3LZCA 1NVGA 2NACA 1XEFA 3H42B 3N8DA 4J91A 1WP4A 4L51A 3X2EA 3WLQA 3F46A 4XCXA 1MR3F 2EW2A 1BOFA 2R5FA 1FS6A 4HAYA 3UJDA 4BQNA 3I3SR 3JD4A 2AT1A 1Z28A 2XTAA 1R5JA 4X85A 5EIBC 2ZYAA 5JSZB 1BKSB 2EJCA 1VMAA 1ZA2A 2Z43A 4HAZA 3QFHA 1LXCA 2NU6A 2YTZA 4R6WA 2IUEA 1ZIYA 2GN4A 5DFAA 3ZWCA 3D6FA 1HT1E 5C0OE 3BORA 4BEBA 1C2YA 4CV3A 4LCJA 4G5YA 4R9VA 3SYTA 3TIGA 2O0KA 3E48A 1HRKA 4M9XA 3WWCA 3UUWA 1ZQ9A 4CF5A 4D4KA 2QL7A 2PTGA 2RGUA 5K99A 3GXOA 2HPHA 5KCZA 1KO7A 4J9VA 2PO7A 1A9XA 5A6SB 3TQSA 1YQUA 2LDXA 3DZ8A 3FBWA 2AN1A 1C41A 2A9QA 4PG5A 3FLEA 3UK0A 1RWKA 4Y6RA 3HCDA 4DCVA 1GU0A 3R09A 1ZSYA 3W8NA 3BULA 4XSHA 3QRWA 1UR5A 3C5EA 4GBED 4MH0R 2XB6A 4J1TA 4XD2A 4TMTA 1KEVA 1WCXA 1LV8A 1Q5PA 4G41A 3M89A 4DDTA 2QQ0A 2YVLA 5IT5A 2X0NA 1A7KA 1V9LA 1ZH0A 3D3QA 1JQ3A 3WG9A 3CH4B 2QB5A 5KOJA 4NE7A 3DL4A 1WMSA 3K9LA 1L7XA 3DQPA 4P82A 2VYQA 5HIJA 3KJNA 3HM9A 2H8GA 1EVIA 2WF6A 3HKDA 4MYDA 1UEXC 4P53A 2D4HA 1S2IA 3HVHA 4GZLA 4CCYB 4M87A 1QV7A 1Z08A 4JN6B 4RYDA 1UDCA 3M83A 4G09A 4ZO9A 3T5MA 1RQ7A 4Y2YA 2X8BA 4U5QA 4BFWA 4HNQA 1LFAA 1KY3A 4WJKB 4OQQA 4ZCRA 4QUIA 1KK2A 3STUA 3FTPA 4KR7A 2W2TA 3HNRA 9ABPA 3FTEA 4LF8B 3WB0A 2V1XA 1PRYA 1C2TA 1ZW6A 3FVQA 3Q8MA 3NWPA 4RLSA 4LGYA 2QZ9A 1UPXA 2HX1A 2KYRA 3T9DA 2WKWA 1ISFA 1NJSA 2AYZA 2JI8A 1PO7A 2XMPA 3E9EA 2BGTA 2BPOA 2VUHB 4IOKA 4ML3A 4F4HA 2IBSA 3CLSC 5F23A 3BCUA 3FW1A 3LUJA 1P0CA 1Q12A 2CDAA 2BMDA 2DH6A 8ABPA 4PZDA 3IE1A 1P5ZB 3FOWA 2PMFA 3NETA 5AFSA 1Q44A 1OGJA 1OBOA 4IDCA 5HFJA 2VCHA 4QBTA 4ZGBA 4TXJA 1C7RA 2GS9A 5HZMA 5L4NA 4B84A 1HFEL 5JAOA 3N6RA 1VSQA 4EWLA 3JVDA 4G36A 1PKXA 3DSRA 4LHSA 3A0RB 2JRCA 4UVGA 1EX6A 2IUFA 3T4XA 3DTNA 1O54A 2XCQA 5CT9A 3OE1A 1J9EA 4ZZ2A 3HXPA 1RRKA 3GGSA 3AXSA 3EULA 4PSDA 3SBEA 5HJEA 1M2VB 1MQSA 1KARA 1EBBA 2JGMA 1YAHA 4A0QA 4KHPB 4ZIRA 1N32B 4HDRB 2YJ6A 2P4QA 1T91A 4V3BA 1ZCAA 1N57A 4PLVA 2BM0A 4KRGA 4TLAA 3KB6A 3U13A 2WK1A 4C6RA 2ORED 1HNZB 3AZPA 3EEIA 4FDAA 1U04A 3ZDFA 3R3SA 3IO5A 4ZREA 2WFMA 5F7OA 5JEDA 4C22A 1W9MA 3SMVA 1B93A 1VCOA 1PWYE 3FSEA 5T4HA 1KJIA 4D9HA 2G67A 4INOA 4N3NA 1QQ7A 3CIFA 3AFGA 3ST7A 2O8DB 2XPCA 2LZ0A 4IEEA 5GV8A 2FY8A 1U7OA 2DFTA 2OXEA 4RPIA 5ALNA 3PNQA 2ONZA 3OA2A 1N5LA 4GOLD 2JCVA 5K0GA 3M6IA 2Y8EA 1CY1A 1QK3A 4YUVA 3IMFA 1IIBA 5IANA 2OGUA 2C2MA 4K9MA 5GGXA 5LSAA 1DC7A 2J07A 4NYJR 1VG9B 3MWLA 3P9PA 3JD2A 1TK2A 4RE5A 4U39A 3C43A 3WLLA 2ZJ0A 3B5EA 2FWAA 3ONFA 5AM0A 3WLOA 3TLXA 1UBMS 1LK7A 3AJDA 3I83A 3E81A 4BO9A 1Y9DA 3QW2A 2F7SA 2H2WA 3I2KA 4QGHA 1DBPA 3ZNOA 2MMCA 1YFZA 4HAOA 4CPDA 4YV2A 2XDYA 2Z5VA 4YUYA 1RTTA 3FCEA 4JP3A 3TAXA 2RKBA 5J1SB 4P7FA 2QLTA 3JQ8A 1ZM7A 1VJRA 4J0DA 5TMDA 3RU3A 4DPLA 1KETA 2O3SA 1X9HA 3F8WA 3L1UA 4ND6A 4W6QA 1BJRE 4JHXA 3ASVA 3CU5A 4NJMA 2R6JA 1V8FA 1NM5C 3QQPA 4BQSA 1N33B 4LI0A 1JWBB 1RWMA 5H3HA 1OASA 4R51A 3TLBA 5MFZA 3FB4A 2R8YA 2R6GA 4XYGA 3WK4A 2YR0A 2HCJB 1F9EA 4C0SA 4B6QA 3BEDA 3T9AA 2HQ1A 3B3QA 3LO8A 3L6DA 2H2IA 4HPJB 4JLSA 2FN4A 4YXWA 4M7OA 3A1UA 3LKVA 1Z45A 2HN9A 3NTVA 4NYJQ 4WWHA 2WIKA 4KV9A 3DM9B 4M7RA 4QTYA 4A92A 4PZEA 1ZGZA 2NUPB 2G9RA 1XTRA 1XKXA 2EERA 4MYHA 2P2SA 1N9ZA 4INZA 5HVNA 5I9LA 5JYCA 1FP7A 3U16A 3CUUA 1NXXA 2QR2A 3ZHBA 3O94A 2V4ZA 3EQ6A