1RXYA

E. coli uridine phosphorylase: type-b native
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 90
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxyA00
3EMVA 3FB1A 1CG6A 3UAVA 3EEIA 1Z36A 3BSFA 3OOHA 1OUMA 4P54A 1RSZA 1JDUA 1ZL2A 5CYGA 4L5YA 3P0EA 5IU6A 1U1GA 1PR2A 1FXUA 4M7WA 4TS3A 3BGSA 3OZBA 4EB8A 4QEZA 4TTAA 3C74A 1T8WA 5CCEA 1WTAA 4QARA 4BMZA 4NY1A 1U1DA 2IQ5A 2B94A 4L0MA 1K3FA 1K9SA 1K27A 2PGAA 4QAQA 5F78A 1A9SA 1YQQA 4L5CA 4YNBA 1SD1A 4IP0A 3UAYA 4E1VA 1V2HE 3NM4A 1B8NA 1PR4A 2QTTA 4WKOA 2AI2A 2HRDA 1YR3A 4DA7A 4BMYA 4WKCA 1T0UA 1V48A 4G8JA 2I8AA 3EUEA 2QDKA 4TS9A 3KUKA 1C3XA 2I4TA 4MARA 1JYSA 4DA6A 1TGVA 4DAOA 2AI3A 1PR0A 4WKPA 3UAWA 4K6OA 3GB9A 3QPBA 3U40A 5F73A 3LGSA 1Z5PA 5C80A 3FWPA 1SD2A 4G89A 4TXHA 5F7OA 4MCHA 1JP7A 1VMKA 2HWUA 1Y1SA 1T8RA 1Z39A 3KVVA 4TXMA 3UAZA 1U1FA 3OZEA 1JE1A 1OTYA 2Q7OE 1A9OA 1TCVA 3PHBE 1OVGA 1YRYE 5EUBA 1T8YA 4YJKA 3LBAA 4F2PA 2HN9A 4QASA 1PBNA 3LA8A 4R2WA 2XRFA 3GGSA 4TYMA 2GUWA 1JE0A 5EFOA 1RYZA 1V45E 4DABA 5F77A 1OTXA 4BMXA 1JDVA 1Y6QA 3P0FA 3NBQA 5B7PA 4GLJA 1V41E 3DDOA 3DF9A 2BSXA 3NM5A 4GLFA 3UT6A 1LVUA 2RJ3A 2QTGA 5F7ZA 1Y1TA 3NM6B 3INYA 4DA8A 4D9HA 3FOWA 5CXSA 2ON6A 1Z37A 3PNPA 3DJFA 1ULAA 1T8SA 3IEXA 3IOMA 3O4VA 1LV8A 4FFSA 4R31A 1A9TA 3OCCA 4PNPA 5DK6A 1XE3A 1ECPA 4TXNA 2OECA 4RJ2A 1RXSA 1PWYE 1VHWA 3T94A 4D8YA 1A69A 4M1EA 3OF3A 1PK7A 4G41A 3UAXA 1Z34A 3ODGA 4KN5A 3DP9A 1SQ6A 3TL6A 5JPCA 1V3QE 4L5AA 1Z5OA 3F8WA 4NSNA 2A0XA 3FUCA 5B7NA 1Z38A 5FAKA 1NC1A 3MB8A 4DA0A 4TTJA 1RXYA 5CXQA 4NS1A 1Y1QA 4QATA 1RXUA 4JWTA 4LNAA 1A9PA 1Y6RA 4QFBA 2OC4A 3PHCA 2ISCA 5F7XA 1RXCA 3PNSA 5F76A 1YBFA 3DPSA 3BJEA 1JDSA 1QE5A 2P4SA 4GKAA 2H8GA 4BN0A 4LDNA 4I2VA 4F3CA 3OZCA 5CCDA 1JDTA 3D1VA 4D8VA 4OJTA 4OGKA 3E9ZA 4TTIA 4YMLA 1ODIA 2OXFA 2OC9A 4JP5A 4DARA 4L6IA 1M73E 2QSUA 3OZDA 3E0QA 4EARA 1PR6A 3OPVA 4OEHA 1I80A 1Q1GA 3ONVA 1V4NA 4LZWA 1PW7A 4M3NA 3KVYA 1U1EA 3EUFA 1Z33A 1VHJA 1ODLA 4H1TA 1ODKA 1Z5NA 4JOSA 4WKNA 1YQUA 3SCZA 4DAEA 5KB3A 4X24A 1SJ9A 4U2KA 1N3IA 1JDZA 3K8QA 4PR3A 4F3KA 1U1CA 4YO8A 4OGLA 5F7JA 2AI1A 1Y1RA 1PF7E 4R2XA 3E9RA 5ETJA 5IFKA 3KVRA 3O6VA 3FNQA 1RT9A 4ECEA 1PR5A 3KU4A 1NW4A 4GMHA 5I3CA 2A0YA 1RFGE 1A9RA 1RR6A 2QPLA 3K8OE 4LKRA 4MCIA 3OOEA 1JPVA 3KHSA 2HSWA 5B7QA 1ULBA 1Z35A 1LX7A 4LNHA 4OY3A 5EPUA 1B8OA 2A0WA 4TXJA 2A8YA 3FAZA 4F1WA 4DANA 1RCTE 5K1ZA 5B7GA 1TCUA 1A9QA 1TGYA 5CYFA 1ZOSA 4D8XA 4OF4A 4D98A 1PKEA 1OU4A 1PK9A 1PR1A 1ODJA 4TXLA 3MMSA 4WKBA 1G2OA 3ENZA 1TD1A 4F2WA 1NC3A 1CB0A 3BL6A 4UC0A 1VFNA 1OV6A 2AC7A
chains in the Genus database with same CATH superfamily
4Y6LA 1YB1A 4N3BA 2B99A 3SIPA 1BGVA 4AJ1A 2Q21A 3D0QA 1A8HA 3NAMA 3FOEC 1VG8A 3L0YA 1QSGA 5EQDA 5D3MA 3VXKA 3BF7A 3HA5A 1FW6A 3M4XA 4GAEA 1PV4A 2XKKA 1WF6A 4PLYA 3SIRA 2ERXA 1R12A 3QBEA 2YWEA 2PSEA 4LMPA 3L6RA 3BRCA 1SUFA 5GONF 5DM4A 2HQOA 1HNXB 3E61A 2WTUA 4Z6KA 4L9SA 1FOEB 5JNRA 1U4OA 2GNPA 2ZZKA 3NJ8A 4LBZA 3UZUA 2GSWA 3OU7A 1VJ5A 1YIAA 4C21A 3PDCA 1E77A 4IDBA 1WJGA 5CR9A 3LZCA 4MUFA 4NEGA 2OCBA 4K28A 1XZMA 3KJQA 3P0IA 4YPVA 4N76A 3L6EA 4LYHA 3KBOA 4FHGA 3PE4A 4LK3A 4RA9A 4CFYA 4D4HA 1DELA 1T8WA 2ATVA 4J43A 3AP2A 3TUZC 1R8YA 3CLRC 3N75A 4E5UA 3WQQA 4X6UA 1KC1A 1DXYA 2FLWA 5EZ5A 3FOZA 3UK0A 3FSGA 3I37X 2O2DA 1KI6B 1N2CE 4NYJQ 2WU8A 3CYFA 1RNLA 2G82A 2H3HA 3G8DA 1DJQA 1IL0A 4LDAA 5AMXA 1XPUA 5AVWA 4C2BA 3UCEA 3E7WA 3MHPA 5IDYA 1K3UB 1G5TA 2I1LA 3PIIA 3T1QA 5HYVA 4RH1A 3IL2A 1NUHA 3IJRA 3R9XB 3WA6A 4UMEA 4FIDA 1TL7C 5DV9A 1GA1A 2CVHA 1JEOA 3U44B 2VEDA 1K7FB 4E6EA 3CCCA 3STTA 3WYBA 4A27A 1VIAA 3O4RA 4RLFA 4D8TA 1GQSA 1QR6A 2YZKA 3U0BA 3B6ZA 1I3OA 1PR4A 4RHYA 5IEJA 3N2GB 1G21B 2QTTA 3OT1B 5DHQA 2P7HA 2VTKA 3L06A 3MYYA 3QW4B 4H6VA 4QYSA 4PYKA 4G0OA 5FR1A 1N34B 4G5XA 1XZAA 1RI3A 3C7AA 4LZPA 3WMXA 3A58B 1QDUA 3IUNA 3BAFA 4NCJA 4P3YA 3GLFB 4G0UA 3B7GA 3CZRA 4PXYA 1U2ZA 2J32A 3WDMA 1CUCA 1HL3A 4ENQA 3K6SB 3OQNA 4G8JA 1U9IA 4PPGA 3D7LA 5TE9A 4Y3UA 5BV7A 4UHKA 1NFQA 2P3OA 2A1TR 2UZIR 2BJVA 1AUQA 4MYDA 1KYXA 4P2GA 1JFLA 2UUOA 5CMLA 3WJ7A 1T4BA 4DR4B 2PDAA 1QO0A 3HBFA 4JT2A 1NVAA 5FHQA 5CK5A 3GPLA 2BGLA 2P62A 3K6KA 5ALEA 3DFKA 2PHZA 2HIMA 4M8LA 4GZMA 4KJXA 5KI6A 4EJ6A 5JC8A 1Z4PX 4QHTA 3QG1A 2QX8A 4O2BA 3DE2X 4Y0AA 1DAGA 2AI3A 3MRVA 4O25A 4KHZA 3ZY4A 1RLJA 4HVLA 3ZGZA 5CW1A 4JBHA 2YYZA 1FQWA 1L4YA 4URXR 1O97D 5IEBA 4M1KA 5JAHA 2X40A 3FNEA 1Y9EA 4WEOA 1PTJC 1KO5A 2FW9A 5HM8A 1QNLA 1XZFA 5E9QA 4TKVA 4PYMA 4R98A 5DOVA 4UFPA 1EWRA 3P9ZA 5HMMA 3CUUA 3M6IA 1DIRA 4EO4A 2GCEA 3A26A 4ND1A 5SZIA 3N76A 4LZNA 5JECA 3LO5A 3PUIA 1P44A 4GECA 4ZAWA 2EFJA 3HUTA 4Q93A 3JQAA 3WK7A 3I2FA 3VPSA 4XFJA 3I8XA 4PYOA 5H16A 1L9XA 1T8RA 4R1UA 4ZEVA 4B3JA 2OHOA 2D00A 4X20B 5HKBA 5JBNA 2IX9A 2DULA 5D5HA 2VOJA 4DM7A 1R9MA 1TYAE 1M2NA 1RM5A 1VIMA 1JG4A 3CRVA 1PZXA 3PIDA 1L8QA 1L1RA 4X65B 4N48A 1DTEA 3AEXA 2ID7A 1J49A 4BP1A 5C2JB 1KRWA 2NQ2C 2G8NA 4G0ZA 2FUEA 4EF5A 2HF8A 3GO4A 4FFBA 2GJ8A 5BUSA 1HNZB 2ZU6A 3ADDA 2Q7DA 3GMSA 2AOUA 3GJ3A 1XT6A 5EESA 4KHPB 1T9ZA 1QS0B 3GZNB 1UEIA 2WAXA 3BILA 3FGOA 1OAAA 4I5FA 4JXZA 2Q3DA 4BNGA 2ODTX 3TR6A 2IDZA 3OE5A 1IDOA 5LMZA 3V9AA 4XRGA 5F2NA 3GT4A 4JELA 1GVNB 1VA5A 1X0VA 3B9QA 3Q7IA 4OJNA 3CR7A 4RZIA 5ALUA 4BQQA 4BJ1A 3ABIA 4K9DA 4YAKA 4AX4A 2Q2QA 1W9HA 2FG7C 3WQRA 4QASA 5KVSA 3X1XA 2BFMA 2C84A 3ZX4A 2QY9A 1S9HA 5LLTA 1P2UA 2RHLA 1U80A 3QTBA 3IKJA 5HVNA 5LQKA 5CVTA 2Z2KA 1UPBA 1E8DA 2ZCJA 1E8NA 1P2BA 4GEGA 3AF5A 4WN9B 5HX7A 3R4CA 2V3WA 4JUIA 2FZ4A 4A0SA 4UBNA 1K0FA 4I3FA 3QVXA 3WL8A 2D2IA 1DZIA 1SB8A 2PWYA 2XVXA 3K0FB 5E1OA 4DB4A 2SBTA 3FBTA 1WB4A 1OLSA 2C29D 4KJZA 2J6BA 4PG8A 1ID8A 1KF0A 2PGOA 1DRUA 3AEZA 3ZKWA 5B36A 2UU9B 3ZJVA 1LTKA 1JAZA 1P74A 4NCNA 2PD6A 1TM1E 5GV7A 4AT1A 3K6RA 1SG0A 1VCOA 3TQOA 3NBQA 1YS9A 1FFHA 2R751 3LCCA 1UIRA 1U0GA 3NXKA 2ZJZA 1GTVA 3E3MA 5FUQA 3NFRA 2QR5A 4GD3Q 1NATA 2W6ID 4N6NA 2O8EA 2Y1GA 5K0LA 3ABQB 2YXPX 4LXGA 3G17A 5IWCA 4MUKA 3K5HA 5B1YA 4RK7A 1E2FA 2H4ZA 4TM8A 4EENA 1E7WA 1OHHD 4O0MA 1SZCA 1E0DA 2P9BA 3IV6A 2OT3B 4KMSA 4B3BA 4EYGA 1O6BA 4TOIA 3P4YA 5AVJA 3V4LA 3DQQA 1EUQA 1J9ZA 1Q1QA 1ISGA 3ND8A 3KFVA 2VJBA 5H3LA 4CG2A 3GW8A 5JU6A 1RJFA 2WINI 4OB6A 2GYVA 4DNQA 3ZU2A 2YZ2A 1RABA 4BNMA 1Z37A 2C00A 1R0SA 5L4NA 1JXQA 2ZJ3A 4HD8A 1ESMA 4UTRA 5BP7A 2IF2A 1DC5A 3MSCA 2PGDA 1U0OC 3DWIA 1LPAB 4UVGA 4MH0R 3IKMB 4MKFA 4YB8A 5ITSA 4AQ7A 3QUSA 5B4VA 1DG9A 1Y37A 2C2GA 1XVLA 1N2CA 3CX7A 1P31A 2FFBA 4PCAA 4G0YA 5JNWA 2WVJA 5HP4A 4EF4A 2HREA 4Z3DA 4EO9A 1AK9A 1VC2A 5DM70 3DGEC 5CA1B 1SHTX 4WZAB 1M66A 4KFTA 3VH1A 2VG8A 2YVLA 5A0FA 1MJNA 2R62A 4DJEC 4BKUA 1AQNA 2GF0A 1EDDA 1X9IA 5ALVA 1AE1A 4H31A 2WTNA 1GNSA 1AF7A 1ZJ4A 3VKVA 4BB5A 4RHEA 4QTZA 4IFBA 2ORYA 2M6LA 2WF8A 1RZRA 1NLYA 2G1AA 4B43A 1EX7A 4R68A 4B6PA 4JI5B 1ZN9A 1RP1A 3CZQA 4ECAA 1WCIB 5SYNA 1E6LA 1ZNZA 1EB8A 2R1UA 3WI7A 4RLSA 1APBA 4MHTA 2J9GA 3M3PA 4DSAA 1KYIA 1JPJA 5CA0A 1JG7A 5AICA 1V8BA 1XQ6A 2ANCA 2PMFA 3DZCA 3W7BA 4BB6A 4JYZA 4MJLA 2V6JA 3UQYS 1E2QA 3N8GA 1E1DA 4HAVA 4RY0A 4D92A 2B83A 1GQOA 1P1IA 4NEHB 4ND8A 4O1MA 2BEWA 5G3ZA 5GM2A 2OZKA 1FY2A 2ZIGA 4P22A 5FORA 5DW3A 4R9SA 3C1UA 3RIXA 3T5CA 3ZNOA 4L6CA 4RD1A 2G77B 1FP4A 1HDEA 2RDMA 3AZOA 5JYDA 2QBYB 4MUJA 1IN5A 3DNFA 4DUGD 4BNTA 1KMQA 2JIDA 2ZRBA 2A9RA 4FGSA 1BHJA 4Z5XA 3W5AA 3N2NA 1P0PA 3DL7A 3KALA 2CFOA 4PSCA 3TZEA 4RTJA 5CA0F 1H2AS 5K05A 2C7OA 4YH1A 1L5HA 1GTJ1 1IPEA 2D62A 1SKAA 3EYAA 2A84A 1TM5E 3KQPA 1UC4B 2NOAA 2K87A 1FL9A 1E6WA 2JD2A 3VZRA 1TUBA 3ROFA 1U31A 1V26A 1AGNA 1QB8A 1V35A 1X80B 3GNLA 1QHIA 5LJLA 1IU9A 1PBTA 1JIQA 5CFNA 4L3OA 3ZDDA 3K70B 4ZZ2A 2WLTA 2RGUA 3L6UA 3ZWOA 3DULA 2WU1A 1G4UR 4RLQA 4J1TC 5AVUA 4CUZA 1LW7A 1M33A 4TN5A 2DJIA 4WBNB 1TM2A 1A2KC 3SEAA 1PE0A 4WXYB 5CNJA 3E9ZA 1RACA 1Q16A 4QFMA 1UFQA 3EQ9A 2EBFX 3PPWA 3L7OA 4QFDA 4RW0A 3LL7A 5KJCA 2OXFA 1DEXA 1K08A 2O9JA 1NBWB 1V16A 1IJBA 1TD9A 2EP8A 2C8KA 2W6IA 5HA5A 1XA4A 2QSUA 3B13B 3OZDA 4LX0A 2ZBPA 4RNDB 3RTAA 1Q14A 3EX7C 3TRFA 2J3MA 1PR6A 1UKVY 1DKLA 4OPMA 3L0DA 3OIFA 5B2EA 1W0CA 2WG1A 1Q1GA 3O2JA 2CSUA 3LOUA 2FLVA 4R8KA 1A77A 2POQX 4C6HA 5EJMA 3AHDA 4LZWA 1DFGA 4GPTA 5SYAA 2DFPA 1U1EA 1MB2A 1ZNYA 5C5DA 1IK6A 4TN1A 4LMAA 2Q4DA 3ADKA 1N1EA 4WCDA 3LT2A 3PGVA 5KBYA 4D96A 2NZVG 1ODLA 3GEPA 2GLTA 2ZJ8A 4M86A 3TCNA 1GPH1 3I1YA 4OBXA 1OXSC 4RJKA 2PSDA 4TLAA 4C08A 3JY6A 4GVLA 1IYZA 3K1AA 1C3OB 3OECA 4G6ZA 4TQAA 1V0JA 3W2TA 1XTKA 2ZWOA 4EVSA 3UHAA 3D5TA 4JX9A 3GDWA 1T0JB 3ZV7A 5IX8A 1I0IA 4X24A 1QNFA 1R0KA 2AN5A 3KJXA 4UBOA 2G5CA 3W3AH 2H11A 2VI5A 3U9TA 1MFPA 1WP4A 5I7AA 2GPBA 2PSHA 3LPLA 4YFVA 1NNEA 1IMJA 1W0KA 2BN4A 2ZBVA 4J4BA 4Z0TA 2W2MA 2NP6A 3DJYA 2P91A 2XWPA 5JSFA 1QLWA 1SUSA 5JHGB 1KJ8A 1ZCBA 1VLHA 4QDZA 5IARA 5C5IA 1E32A 1DPGA 5LYJB 4IQGA 4QULA 2C7GA 3AKZA 4HF7A 2WIGA 2AC4A 3CH6A 5EN4A 3I5AA 1RQGA 4ZCIA 4BAGA 1Z4OA 3U4GA 3PBKA 1VJRA 2WBLC 4KWCA 1LWOA 3TE7A 2O48X 5JJ5A 2PLFA 3VU9B 2Y1WA 3EXEB 1NPTO 1PNVA 1GPMA 3ZDFA 1U2SA 2BHRA 1JMVA 2Z2ZA 4TLEA 3TNYA 4RMJA 1EFHA 1M1YB 3BMOB 4YP1A 3MM4A 5JXJA 8MHTA 4Q1EA 1JJVA 1VG0B 1DARA 2CNKA 1RHKA 1G42A 2R6HA 1RTTA 1VHDA 1XEAA 1K7CA 1UC9A 3IMGA 4DYDA 2DTEA 1WPGA 1X39A 2IYLD 1G55A 3OF5A 5D6OA 4IZ6A 5F2OA 2A0YA 3JPYA 1XMXA 3GT3A 3NVAA 1L5NA 5TMPA 3RV3A 1AUVA 3A6JA 4E94A 2HIAA 4DIEA 3GCGA 1DNPA 1LF0A 1EDEA 3RFXA 2HNAA 1I51A 1MAHA 5IC5A 1N2OA 3N8KA 2WHRA 1KDZA 2VVTA 2I6SA 3UV6A 3E9EA 5CFLA 1XZJA 2ZR9A 1LLCA 1RQPA 4NZZA 1B8OA 2DKFA 1GQFA 3A14A 5CH5A 5BSUA 4KU4A 3H1FA 1E1CA 3U26A 4I5GA 2NZ2A 3IODA 3IJEB 4H3KB 4MSUA 4KTVE 4HDNB 2PKRA 1Q7TA 2GARA 3KQTA 5BYJA 1RCTE 2VHTA 1A8UA 2NXCA 4IJUA 4PVDA 3RK0A 3HXKA 1L8OA 4TM7A 4U2GA 3QXGA 5HILA 3SXJA 3KDSE 2QPTA 3WNZA 2WKWA 3CE6A 2VXYA 3NNNA 5FBZA 3UMSA 3GA5A 4RZHA 3VYWA 1XBTA 1PKEA 3DKPA 3U17A 5JD4A 5GMOA 3PT5A 2O8BB 3CE9A 4OXIA 4PLGA 1RI2A 1KRHA 2QX7A 3AILA 4ZVUA 5AW9A 4A0RA 3BC1A 2RJNA 5TF4A 3HHEA 4QE3A 4KP7A 4B75A 4QZVA 1M2JA 1HNWB 3OVMA 4CEHA 3PUYA 3RYCA 2C1XA 5I4CA 5KNLA 4GM1A 3NYRA 3VSCA 5LUBA 1PVOA 5HGJA 4CIDA 3KD2A 3FWNA 1KDTA 2QOEA 3TLGB 3F6CA 3GMIA 1RLOA 4QBTA 2VH2A 2V9ZA 2W8BB 1S4QA 2XNKA 3AKDA 3HM2A 2XPCA 2HBRA 3EAQA 4KVAA 5GQSA 1THTA 3ZWBA 1BD3A 2AVDA 4YRDA 4BO4A 4CKWA 1NX6A 2QA5A 3HVUA 4DM4A 5EJ5A 3R7NA 1TKCA 1H4VB 2VJYA 4GMXA 1CRZA 4ZREA 2ZSUA 3N2IA 3KQLA 2P4UA 2PUBA 3VV2A 4BYGA 3CF0A 1UOQA 2JRCA 4NONA 5DDIP 1ZR4A 5J2TA 2XZDA 1AIPA 1V4BA 2G76A 1ZL2A 5L45A 2ZCUA 5AVSA 4D4MA 1MO6A 2PX0A 4QPDA 4I4NA 3OJFA 3TXXA 1E4OA 1PS9A 1Q0UA 1DOHA 2HJWA 3UTDA 4DMUB 1KEPA 3FMIA 4HMQA 4LK2A 4EF6A 1OW3B 4ME6A 5F5XA 3IVGA 5C34B 3ZD9A 3AT1A 1HURA 4KYVA 4Q7JB 2PZFA 3CWCA 5A9TA 3SDZA 3TBFA 4EG3A 1RZRD 2ZI4A 3IP3A 5G4KA 1OZFA 1DTWB 1TQ8A 4X3OA 5HXAA 3AM1A 2XXAA 1M2VA 1HF3A 1YNOA 4J7XA 2KJQA 5CXXA 3AEKA 2PU5A 3GR6A 1YA4A 3Q7EA 4YMHA 3SJBA 4F9EA 3G5MA 1XPJA 3AVOA 1XNGA 3DE1X 3IS3A 3C74A 2FW7A 5K3FA 4R5HA 1MV8A 2XT9A 5BWLA 1IPFA 2FGKA 2IUEA 3H16A 3OKFA 2WIKA 1T9AA 3MCUA 3PGJA 4BNVA 4BMZA 3THRA 5CU7A 1BH6A 3VHLB 3F71A 1TKBA 1ZIDA 4BXOA 4M0DA 4ODIA 2IQ5A 2DX7A 1XPOA 2VYQA 2P1DA 2TS1A 1FB5A 3LP6A 4DNOA 4AUNA 4ZT3A 5HJEA 4BE9A 5FBWB 2SHKA 1NMYA 4UBMA 5IJ0A 3OBBA 1JQ3A 3DMYA 4JFRA 4CEJB 3ZD8A 3R7LA 2FJ0A 2J59A 4YNBA 4C03A 3VTFA 1SD1A 1NUSA 3W34A 1Y5MA 4O5OA 2JNWA 1KXJA 2ABWA 2VWPA 1U9JA 4I6GA 1CUAA 4RADA 4WZBE 5IXSA 5IKMA 3EPHA 5FTLA 4G8CA 5BURA 1B8NA 1MIHA 1Y5IA 2OTCA 1KEVA 3NORA 1VGRA 4R7TA 4RZSA 4HCJA 2OG1A 4IF4A 1MEJA 1V8FA 3G3EA 2CUNA 5E9WA 1UXKA 1W1UA 2NQ8A 1O58A 3H18A 4WKOA 4E1AA 5DXJA 1O1YA 4UDOA 2I22A 3F7NA 4UNPA 1C0EA 3N3AC 1G20E 4JODA 5G1OA 3W8NA 2G17A 1VP9A 4QKQA 5JZVA 3EHDA 4LG1A 5D00A 1R88A 1ZJWA 3IR7A 1RLMA 3ISJA 2GZRA 2HU7A 4B4UA 1HMPA 2YOHA 3NHJA 3R5KA 1S4MA 4FYWA 4DA4A 1CY0A 1RKBA 4KBGA 1W49A 1QYXA 1ZBQA 2QROA 4X44A 5EE9A 1F3LA 4ARAA 4MARA 3EW7A 2MIIA 2J3EA 1JVBA 3ESBA 4K5QA 4UHDA 4C7OA 2Q3CA 1Q50A 3GGOA 3GRFA 4RVCA 1IQRA 2ACEA 5CURA 2WJHA 3HP7A 3OZUA 4BJHB 3LUJA 1X1CA 2CHGA 2W71A 3AONB 1SBZA 2HJRA 2VCEA 2I76A 2V4ZA 4OQZA 4KO3S 2QTFA 3VTAA 2PL5A 1A7UA 1I4DD 3NBKA 5EQJB 4OJMX 2NVUA 2YWGA 4ZKEA 4FSXA 1S8OA 4G23A 4NCKA 3WGHA 1M67A 1GPUA 4MIYA 1YCHA 3GLIA 1KNXA 2V7XA 3CVVA 3A1SA 1XIVA 3EXHC 4UQOA 3BKWA 4IOLA 3OQPA 1GRVA 1FNCA 2WFMA 3J7AC 2P2SA 2R48A 3B9PA 3WZLA 5JJIA 2YV2A 4IMRA 5LDGA 4XDYA 3R0QA 3M7IA 4MULA 2WQZA 3HCAA 5TT0A 2OXTA 1P1JA 4G1EB 1A1VA 4IDFA 5M04A 4RPHA 2NUAA 5CVVA 10MHA 2NV0A 4Z0HO 1GCGA 4G0XA 1IJKA 3FPJA 3ZNQA 1T4CB 4L76A 2PT5A 2ZBUA 2DPMA 4MWOA 4G4SP 4ZV7A 3H5IA 1BD4A 5DEIA 3SC2A 1GN8A 4D74A 1KSJA 1L3CA 3TL3A 3E70C 4B5LA 1E3WB 1SCUA 3K30A 3WO0A 3EQ2A 1R0CA 4BMPB 4LVOA 4I4TB 2B9EA 5ALRA 2VT3A 4NBWA 5BQ3A 5JAIA 2WD7B 2GBGA 3IOYA 4X93A 3BS4A 2GO7A 1N78A 1HX7A 1GV0A 3I9V1 1JWLA 1D2MA 1JGTA 1FTGA 1UZMA 1E3LA 2QTBA 2WC1A 3EIUA 1LS1A 1XX6A 1LBSA 3LBYA 3QU5A 3TLZA 4EPXA 1CDOA 2Q1XA 1C1XA 1XTSA 2IHUA 3QMPA 5H3CA 1GCOA 1RQNA 2F17A 2JFOA 3BL5A 4LZJA 4MLDA 1PYOA 1BJRE 4Z7QB 1OPXA 4RFSB 4CMIA 3FI9A 4UMDA 4EMUA 1I3CA 3AFGA 5FOWA 4EHHA 3GLGA 3ZVMA 2AFRA 2QPAA 2EXXA 2ZROA 5I7UA 1DCTA 5E1MA 4FX2A 4BNIA 4NOJA 4UBLA 1PBNA 2X1VA 2XE4A 1VI2A 2ARKA 4RCYA 1J5EB 2RHBA 3QE0A 4YCAA 3LI2A 4QPCA 5HIKA 4LXYA 1GAXA 1VE7A 4AY5A 4TLDA 2EZTA 3WGNA 5KWVA 1KVSA 4N0PA 4CLRB 3LUCA 4QOHA 4O8ZA 4G85A 2GWRA 4UNIA 1F2TA 1KK0A 2ODQA 2OORA 4YP6A 2EKDA 5SZKB 5BYKA 1AX9A 2FK8A 2PLWA 2PRJA 1HBJA 2Z6AA 1A4IA 1B0PA 4LS3A 4AJNA 1AK2A 1HLPA 2WJIA 2IH4A 3KYBA 2LCIA 2RAPA 3QSGA 4WUTA 3LM8A 3I72A 1N8NA 3KXIA 3GFRA 4UHHA 5B2ZA 3BMCA 3WLRA 4R8MA 3QI7A 1TNDA 4B17A 2GBFA 3N7UA 1CNMA 2JA2A 2H1VA 2X7HA 1M8FA 4HYTA 5LNK6 1WOYA 4QYWA 2BAGA 2JFWA 3IB3A 4HH3C 2IGTA 5JCZA 1XB2A 2XVAA 1E3JA 1WHSA 2V9CA 3BGWA 4ID9A 4Y18A 2XQFA 5G53C 2V65A 1FLVA 3MMPA 1R27A 1XHEA 4DC0A 6LDHA 4LSWA 2J48A 3QY0A 5CDTA 4C7KA 1H4QA 5FFMA 4WCFC 3INYA 3OLCX 1PUJA 1CV2A 1FTSA 3E2IA 3U37A 3FOWA 3SM3A 2X14A 4RVDA 5C5CA 1CS4C 1J7JA 2CE2X 2XX3A 1BA2A 1VE1A 3WIBA 5CJJA 3L8ZA 1XDBA 2CDBA 2LWIA 4IDPA 4ACBA 1ULAA 1GUZA 2V6MA 3QXHA 3IEXA 5ALZA 1PG5A 2W2QA 4H7PA 4AP5A 2YY5A 3K92A 3R20A 2QTAA 3VNBA 4BAZA 4BP8A 5BOSA 4BLPA 4DA9A 4EG6A 4M0KA 1YCFA 3ZN2A 3OEWA 1Z0KA 4NH0A 3GEDA 2WUWE 3WHIA 2Y0BA 1FZQA 4R7GA 2Z5FA 2C1EA 1FDRA 1C2YA 2FH5B 3TCXB 3ZI7A 1I30A 2GK7A 3LCJA 4PYLA 4HADA 2X0DA 3PR1A 5KTYA 3G2NA 5M2QA 4FHFA 1PWYE 1OCEA 2OCYC 4IEFB 3KQNA 3R0VA 1UK6A 3HU5A 1P7PA 1PK7A 2ZRFA 4BUJA 2YMLA 4RBNA 3FYSA 4KKVA 3VSDA 2MT9A 1RQRA 2FQWA 2BGRA 1GRRA 5DNUA 4X9XA 4KPGA 4NG5A 5BWCA 2W5UA 4OQFA 5E8JA 3M6AA 2FDRA 3WGQA 3ZWDA 1WLSA 1AV7A 2XTMA 3A6DA 5TC4A 1VE5A 1BW9B 1NXOA 1ST3A 2DCUA 1QKJA 4N6OA 5SY4A 3K15A 3F8WA 1O89A 3L4SO 3RS9A 1C7QA 3EBLA 2XOEA 4I6JA 1U4SA 4P6VF 2WJYA 1G21E 1PV1A 1LXCA 2FHPA 4RX1A 3OEHA 4E14A 4RJIA 2X0KA 3DDNA 2FPIA 3GUVA 4W7HA 5KOHA 4J16A 1U0TA 2X5OA 1M2VB 5KYVA 1LVGA 4D6PA 5BUCA 1KO8A 5FNVA 4KO8A 1TC2A 1QZUA 2NV6A 3I32A 4MAMA 4CHTA 1SHLA 1SMKA 1Z4KA 2HXYA 3KHTA 5GP1A 4MRMB 3AEUA 1U0SY 4W1QA 2HHAA 3N86A 1ZGAA 4LVNA 2G1PA 1A9PA 3A6HA 2BFCB 5C8YA 4DLLA 3A36A 3NHLA 4WA8A 1YA6A 4NBSA 4POOA 4DBVO 2BONA 4IM7A 1C0LA 3JQFA 3PQ3A 4KI7A 3ZGLA 2IXGA 4HAWA 2A5FA 2D5LA 2O8FB 2OGUA 2ZRAA 3K5IA 1DKOA 3BZBA 4UEOA 4NU8X 4NYIR 1KYWA 2C4VA 3RIEA 3F96A 1FYEA 2QF7A 2P4SA 5LP6F 5CLIA 2I0FA 4J2HA 4DB2A 1RHQA 3SC3A 4J1TA 1WUTA 2G0NA 2QNRA 2QYSA 4EUSA 3NP7A 4LXTA 2VYFA 1EX6A 4WXRA 3TLGA 4U5QA 2WAYA 3OZCA 3K0AA 4OHMA 1NN0A 4JCOA 4CQMD 4QRIA 3HA2A 4MW6A 5B58T 4ETIA 2HIHA 3IP6A 3PVCA 4GX0A 4MO2A 1TRKA 2OENG 3F7OA 4J9VA 4X54A 3NHAA 2XE7A 1IMOA 1NVEA 3OKCA 3CLUC 3RFUA 2ZCVA 4GHWA 4QYMA 2EZ4A 4M8KA 2IV7A 3H9GA 2C8JA 2R87A 5B4TA 3JZMA 2KWIA 4G5RA 2G04A 2ZYWX 5D5QA 1I80A 3DFMA 3LY7A 5FYDA 1YQWA 4A4DA 3MWDA 4I9HA 5DM2A 3DCIA 4CF4A 1UJ2A 5A04A 4GNKA 1IZZA 2GI4A 2W9XA 1BE0A 4MUYA 3SG0A 1J7KA 2YWBA 4M1WA 4CYMA 2NVWA 2QRQA 2DM6A 2PG3A 2XE6A 4OHXA 2XZLA 3B1FA 1IOVA 1VHJA 4OHZA 5CFOA 3DBRB 3CH5A 4HK4A 3DKIA 1CR1A 3AF0A 3TTSA 4LVCA 2HQSA 3C3CA 4DLYA 2B2NA 4QU5A 2P6OA 3OOYA 3A2NA 1FSGA 2AX4A 3MWLA 4R3NA 3EVAA 4P3KA 3MTIA 4NP6A 1SQSA 3O8QB 1SKBA 2V7VA 2O3UA 4NFLA 3V7UA 4R2MA 1WDKA 4FMDF 4LI0A 4PZCA 5A7FA 3GXOA 2P27A 3V9PA 3E2PA 5EIBC 3BB4A 2Y9MB 3UFXB 2IOYA 4RHCA 3F3KA 4AY6A 3CVYA 4X7RA 2H31A 1EZ1A 3WJ2A 2O0JA 4EW6A 2QSJA 2O8CB 5B1HA 1Z7EA 2L2QA 5JAOA 1L5SA 4NJEA 1HDGO 4RF3A 1SQFA 1H93A 2IHZA 2ISSD 1P1RA 1E2UA 5ETJA 1RYHA 3NGMA 4ZMRA 5C8DA 3JTMA 2HK8A 3KVRA 4RTQA 5BSRA 1SBYA 1YZVA 3V1MA 4JLJA 3BICA 1M6EX 4LIPD 5CBPB 3R6DA 4PX3A 1Q0ZA 3D0RA 1B41A 3HB4X 3QU7A 4PXSA 4TUYA 3WGZA 1E2LA 1Y9AA 1K1EA 4ERNA 2J6HA 4KSBA 3MPUA 4UFNA 3W3ZB 4A8JA 3TQHA 1IZ7A 3FOCA 2VXCA 2Q6OA 3EMKA 2PTHA 3KU4A 1W8IA 5LYJA 4E5NA 4GMHA 4EY7A 3EEBA 3RAFC 1JZSA 4Q47A 4L8YA 5I3CA 3A6PC 4MQLA 3FRHA 3G0CA 3GVHA 2DH6A 4RD2A 3USCS 3ZZ0A 2II6A 2VJMA 2JGFA 3DE4X 4IIXA 1ZO8A 1TK3A 4PPFA 3K9NA 2FEKA 3QVGA 1SA0B 2BJHA 4BP3A 4HNQA 1MIOA 1SXJA 3N1UA 4EQ6B 4ZI7F 3BH0A 5AHKA 3MVEA 5A5FA 3U61B 3EMDA 3SYMA 1A27A 2GZHA 2Q29A 3LDGA 1RE1A 2HAEA 3FPAA 4Q16A 2W6PA 3KE8A 2EGGA 2Q5EA 3CWZA 4L1KA 5LA6F 5IHXA 1DVRA 1D2GA 3OAAA 2QLFA 3LLCA 1BG6A 4AM8A 3HI6A 4K9KA 4LNUB 4Q7QA 1XROA 4IKPA 3BXZA 4DANA 4F04A 2JJYA 2G0TA 4NXNB 2OVFA 4P36A 3N87A 2BFDA 4BKMA 4ZGGA 3NP9A 2QLTA 1MORA 2HA0A 2QV0A 4OQYA 4PU0A 1CZRA 2IWHA 3UB4A 2P5YA 4CM4B 3T34A 3TOZA 4MKRA 4M55A 3CVWA 3EXAA 4AL4A 3F6PA 2FLKA 3LYAA 3UW1A 5E0OA 1T9BA 2FQYA 4KIJA 1TAUA 3D4LA 1YE8A 2MINB 3O2NA 1I5OA 3B89A 2HOQA 1PR1A 1PRYA 2PMBA 3E23A 4L5BA 4MW7A 3IQIX 1W19A 4BO2A 3TKYA 1XTPA 4JJ8A 4KN9S 1SKYB 2JH8A 4ZK6A 1V5IA 1W35A 5C18A 5WRFA 4PRLA 2JIZD 1F8XA 1JG2A 3DTVA 5FKJA 5SZJA 3ZXUB 5CB0A 5LOVF 2AXPA 4CKEB 4B7UA 3EXG1 2MSCB 3M5DA 4C22A 4CG1A 2IYUA 5DJ5A 3SK0A 1JBEA 2V6GA 3GRCA 2KSQA 4HX5A 1U28A 2R85A 2W2OA 5B30A 2A0FA 1LTQA 1E2IA 3HY4A 5BVHA 1DBVO 1VZ2A 3BRWA 3OH8A 5EEGA 3RRNA 5GIPE 1XZEA 3DXFA 1A2QA 1U2DC 4R54A 5I48A 1C4WA 1DE0A 3E7XA 3L7DA 1CG6A 2DFKB 5I7EA 1X80A 4W5NA 3NTUA 4HDCA 2LZ0A 1JIUA 3E7PA 3JW8A 2ZEJA 3QUTA 3JQ8B 2QM8A 1NP7A 4HSGA 1NI5A 1HT2E 3IIEA 3DA8A 4RPLA 2X5XA 4R1TA 4NX2A 3NS7A 4DXHA 3U4QA 1AKYA 2ETXA 5A02A 3UJNA 4HJRA 2GHTA 1KS2A 2CXHA 5A7GA 3L8DA 3LQ2A 1KPGA 1G291 3DV0B 2I4LA 3OX2A 1SA0A 1E3IA 1EFTA 2AL7A 4R2JA 3UC5A 3H13A 3MQ4A 1EH5A 2P6UA 4QEKA 4ZPJA 5CDYA 2RI1A 4BO0A 3WTCA 3CB2A 2PR2A 2C4UA 4D9BA 4H6PA 5EKSA 3LKDA 4A8JB 3DZFA 2NADA 3GLHA 3VH4A 1OT3A 1EZ4A 3FB4A 3FTDA 1ESNA 5DU2A 4MDFA 1EU1A 1HYBA 1W0KD 3CUTA 5K0CA 5T7BA 4HLUA 1X1QA 3ITEA 4F5YA 2C2XA 1TZ2A 4KWIA 1JIIA 2GAAA 4WCVA 1TFUA 4Y8VA 4CTJA 2VK8A 4RK4A 4J2TA 1R0YA 2WHPA 4MUXA 3RCBA 3TNLA 4B87A 2C5GA 4DCMA 2JGKA 4D9JA 1TTTA 3WGIA 1XRSB 2DUNA 4BNLA 1E6MA 3E4CA 3UT5B 1PEKE 3WLEA 2NU6B 3VKGA 1K27A 4OBWA 1W93A 4FYXA 4N0QA 4PRKA 4K05A 2XUHA 4WNCA 2UDPA 4ZZ0A 4R9NA 2ZAOA 2YNMA 3NBYC 4R51A 3LPCA 1NSTA 4IP0A 3KTFA 2P6PA 2YWFA 4N8EA 2XYGA 1CUUA 4MWCA 2QT1A 3IOEA 3KKMA 1MJHA 4HWRA 2H7YA 5BNFA 3D7MA 3UFXA 3NM4A 3I76A 1I8TA 3W9UA 4CIYA 1O3YA 1T1EA 5B1DA 3WL5A 1TU4A 1QH8A 4GIBA 2XKJE 1NURA 1FDOA 3TGPA 1JAXA 1P45A 4DV4B 1SCJA 2PUEA 1ADFA 3KPVA 3VZBA 1P2GA 1R6VA 4UQLA 3I6YA 4BECA 3D4IA 1EWTA 1N1GA 4HWPA 2QR2A 5DZSA 4AJLA 1QIDA 2W2LA 3HLYA 1T2AA 2C5LA 2CVPA 1WZCA 1YZTA 4ZARA 2X23A 1G0OA 1XTUA 5DBGA 4NK5A 3AI1A 3I2JA 3UJ9A 1IUPA 1R66A 1A8SA 3U4IA 1NW9B 4O4HA 1IBKB 4UEJA 2BM9A 2QUKA 1OIWA 2X19A 3IDAA 3K6JA 4X5OA 1MABB 2C42A 2QMHA 1TGVA 3FYTA 3U9SA 3IT3A 3ZBUA 3DTYA 5CDSA 3QHPA 3GFBA 3QVWA 4F9GA 2DFVA 1DJNA 2HMSA 2O2XA 2G3YA 3PNBA 4WKPA 5DISB 4X8HA 4EELA 1S2DA 1SC4A 5CITA 1NNSA 2ZU0C 1LBEA 3KNZA 4H3VA 1BTOA 3MCTA 4MPPA 2O14A 4KIGA 3BIFA 5CT9A 3WL3A 4BQRA 5FPPA 3E3AA 2RGWA 1ULUA 3JQCA 2ADOA 5C80A 1JLLA 3EC7A 4GL2A 3ABRB 1IM5A 5EEHA 4EEKA 2OOSA 5IJ9A 5FA5A 6CHYA 3ZW7A 1MW8X 3K0AB 1IH8A 4OGGA 5EIXA 1EFPA 3PGLA 4ZDJA 4TMWA 3M3DA 5J4LA 4FFPA 1RRMA 1ZRMA 3LAWA 1X1RA 2VRWA 3AHFA 4WN9A 1UBJS 2ZTVA 1Y7TA 4BLQA 4CCAA 1E92A 1ZA1A 1G9TA 3WK5A 4TKUB 2GNAA 1VDZA 3T5BA 4ISBA 2VHEA 3PL1A 5A4FS 5ICMA 3C16C 3T5PA 4O63O 1V6AA 4A92A 4N7JA 4Z0NA 3GP5A 4EHDA 3HDQA 5F9MA 5CDGA 2HDWA 2YV1A 1E2GA 2W22A 1U3CA 4RE5A 4JT8A 9MHTA 1BEEA 1T34A 1YRYE 3F73A 1QP0A 4L8VA 4N18A 3F74A 1EUYA 1KU6A 4L02A 5IM4F 1CW2B 4A2QA 3S2IA 3HKDA 2G6BA 5CX4A 1QS0A 2ZJFA 4NJOA 1GKYA 5T5QA 4YCCA 3T7AA 3ER9A 1P6QA 4YV0A 2QE7D 4YXWA 2VNJA 2J33A 1L4UA 4FFBB 1EXVA 3K2QA 4XQ9A 4LOIA 4YJKA 2G6TA 5JZOA 1YTLA 1ZX1A 3B5EA 1I36A 1TK2A 2XUOA 2ZYSA 2JHPA 4O4LB 4BFUA 1Z17A 2RONA 3OFJA 4FD2A 3AB3A 4EHKA 3R3HA 4ZANA 2AJTA 2E85A 4MLPA 4YT4A 2D8AA 3HRKA 4N3CA 1S2GA 2Y71A 4X20A 3REQB 1WU7A 2FX2A 4DLUA 2ORED 2XI4A 3TB4A 4MIKA 4LCEA 1IQUA 1BW9A 3ACDA 5KEIA 1JHVA 2RAVA 1B14A 1XNJA 2JGMA 1DLIA 1BC5A 2C0PA 2XB4A 3LRTA 5ALHA 4BOYA 3UWDA 1N3BA 3MJVA 3HGQA 4P5EA 3BB3A 1V8OA 1UPUA 1NM5C 4QBIA 1A7AA 3VPDA 3PDIB 4AZ3A 1R00A 2NT3A 1C4OA 1XDDA 4Z86A 2OR3A 2G1KA 5IBQA 2VA9A 5KYUB 5BMOA 2I7XA 4FNGA 3D54D 1T25A 4YROA 2BI4A 4C05A 3VUEA 3DBLA 4KLZA 1GR1A 1WIWA 3AC0A 3ZJUA 3IE0A 2OAP1 1XA0A 3QBDA 4QVIA 1CEYA 1DQPA 2BSXA 3WWDA 1TAGA 1FTYA 1QG6A 1QMPA 4TZKA 3RH0A 2B5VA 2EBWA 2GBCA 3CLTD 4Q00A 3FE2A 1H0HA 4RK5A 3FDZA 4MTLA 2WKQA 1R5OA 4GICA 3E22B 3O73A 2FWMX 2QUBA 4JSTA 4ND7A 2B1RA 3QE9Y 2COKA 1YF3A 1R50A 3ZZUA 4UM7A 3L4KA 2HFKA 2YFYA 4QAJA 5BOSB 1LSOA 2GAJA 1S7GA 4R2IA 3AL0C 1JV2B 5ECDA 5IYZF 3DD5A 3F49S 1GFIA 4PICA 1YB2A 1M6YA 3IPCA 4JEHA 4H15A 2C7VA 2DWQA 4O2LA 1OBFO 1OB5A 2B69A 2K7ZA 4HLCA 5DCUA 2ZUWA 2F1HA 4NYIQ 1T4DA 4Z3OA 1ENZA 4AP6A 3ICCA 3UYKA 4C07A 1I0LA 1QIMA 2AK3A 1A9TA 1GPDG 2XT6A 4BTLA 5FR2A 4KIUA 1F4VA 1RXIA 1US8B 2YDYA 1IY8A 1JTFA 1ZI6A 1YB7A 1J8MF 3FZEA 2FRVA 3SQWA 1VRCA 5EJAA 3U44A 4RLHA 2OECA 4DCUA 3OJ0A 2GASA 2O0MA 3HNPA 3KV1A 4QTUB 3EBOA 4M1TA 3MT9A 3BMCB 3E8XA 4Y1FA 3RUDA 1FSPA 1QLJA 1LPSA 2XF2A 3AIOA 1DDGA 3UAXA 2F3RA 2OKGA 4N47A 1BN7A 4P3PA 5CA1F 4QM6A 3T6KA 1QPBA 4P7GA 3Q41A 3I30X 4BWFB 5DX8A 3TL6A 4F06A 1F0NA 3QXXA 4U6QA 4J6FA 1U7HA 2F1KA 3LQ4A 3PWTA 2GXSA 4UUAA 1VCIA 4JA2A 4MLZA 4F38A 4IVRA 4M8NE 3W8RA 3K8ZA 1TW2A 1DBQA 4MUEA 4FYHA 5CDFA 2D3WA 3W0LB 4J1NA 4CM1A 5J3JA 4JJKA 5ESDA 5D3KA 5H8WA 3IDZA 3OLXA 2EKZA 5HK8A 4B6RA 2PLAA 1H2WA 1RXYA 2PKQP 3LPAA 1H85A 1GGNA 3HP1A 1LZLA 1PVVA 3AGPA 3CUYA 5LUAA 2EERA 5KX5A 5DM60 5EHIA 2FQQA 4M98A 2A5YB 1ZICA 4GZ3A 5FEMA 1S3FA 3TS1A 5BNZA 3KLMX 3S81A 3H2HA 4AICA 3JQBA 2BKXA 1VPTA 1Y6RA 3IT2A 3LZ6A 3KSUA 3M34A 3NGLA 5CFQA 3K70C 1B0AA 2ZRLA 3U5TA 5HRAA 1M2OB 1U28C 4QUJA 3IHLA 1W46A 1O9GA 1A82A 5L6MB 3QEJA 2CBXA 2X4GA 1X74A 2D0OB 2F67A 1JHAA 1JEYA 1YZQA 2AHRA 3BTUA 2HQBA 1BFUA 4XFKA 4CETA 4JKYA 1SKMA 4HY3A 3DM5A 1RE0A 1X3SA 3EXFB 3ROEA 4EQZA 1NMQA 2H1RA 3W6OA 2V97A 3PR2B 4XWWA 4INAA 4P58A 1PQUA 3PQ6A 4NATA 3TXAA 4C0QC 1TI7A 3I9V6 3H3XA 3PI7A 4YQYA 4F3CA 3WYDA 3A06A 2C2BA 3NHZA 4FYVA 2X58A 3PD1A 3HCFA 4GX5A 4IEIA 2JIRA 1SC1A 3CS3A 2FCAA 1NXVA 1U3UA 2G4VA 4UASA 1YASA 1JHQA 4DR6B 4F4CA 2ROQA 5GJCA 5THKA 1DIOB 1ECLA 5LB4A 4RZ2A 3ORSA 1GLGA 4FI3F 4WJZA 4BY9E 3NTLA 4MDHA 5AIBA 1MOSA 3VHQA 1FX0A 2V54A 2YVAA 3QLUC 3BULA 3QE2A 1SVOA 2FSPA 1J22A 1XP8A 1KI4A 2G09A 2NAFA 3AJ8A 5DGIA 3ZE2B 4LYDA 4EBBA 4ER6A 3ITNA 2IYQA 1T5LA 4H4DA 5FA8A 3EPJA 1Q21A 2E82A 4U02A 5M7EA 3LYLA 3GVPA 4YBZA 4BFZA 1CJMA 2CHUA 2AW3A 2Q41A 2XAUA 5CEEA 3U6KA 3L49A 4I6EA 4E2ZA 1W4LA 5BN3A 2X6QA 3H6KA 3G2JA 3JCZA 4QOSA 1OZAA 3TNDA 2ZR8A 1NMZA 3VUFA 3ZY2A 4YK7A 3GVIA 4WINA 1ZHOA 1A95A 4XJSA 2HWWA 3M1YA 1D0VA 2OBBA 3O3CA 2V5AA 5IAKA 3OLWA 1Y8QA 4AJJA 4LF8B 2FVXA 3R41A 5G3YA 7GPBA 4PFJA 5BWBA 1CJBA 1TZBA 3FI0A 3H84A 5EUCA 821PA 4PG6A 1K6IA 2XZOA 1E9VA 4RY8A 3HDHA 2D5BA 4AK9A 2QYTA 3E2MA 5KB3A 1TVEA 4L78A 1INLA 3A4MA 1UBKS 4N6GA 4Q39A 4D3SA 1CIVA 4FKBA 1M2EA 3R3UA 1H65A 3D7RA 1VL6A 3CWQA 4MQFA 2FZWA 2H63A 3LF1A 4IHKA 2VWHA 3SC6A 4B47A 1LVHA 1U1CA 4UM5A 1CR6A 2KX7A 3W7AA 4U00A 4E30A 1QHEA 4AKEA 1YQTA 5DX1A 4WSOA 4CI9A 1RHRA 3IDOA 3IHKA 4JBXA 5HFJA 1G8PA 1O95A 1VHQA 2FUNB 3JWHA 4JASB 4S1PA 4EX6A 2JFPA 1IE3A 4IL5A 4G63A 3Q9SA 4JOCA 1Y9ZA 4WDQA 3D0KA 3HFGA 5ENZA 2GD1O 3T5GA 3LTNC 3PNQA 3EBPA 3NRBA 1WKBA 1E6EA 3MTGA 3UT0A 4TL6A 3VSBA 4ALNA 4XOUA 3T12A 4BXOB 1CVIA 3TW8B 3PD0A 1Y6GA 2NPFA 2ZQ5A 1C7ZA 1RWMA 3MT8A 2A33A 2FRDA 2SICE 5DBHX 2WWIA 1RAHA 3HNOA 2INGX 1GPLA 4Q01A 5K3FB 1UDRA 4PAGA 1M75A 1JHRA 1DI0A 1PWEA 2H0QA 2NTNA 3AEKB 4MROA 3RRMA 1M2HA 5TLSA 2BGMA 5I7SA 2EF1A 4YY3B 1NQAO 3ZVKA 1VFPA 3FSEA 5TQ0B 2HA7A 3BXHA 4HATA 4DLBA 4EDHA 4Q9KA 3K8OE 5JG7A 1X7ZB 2BE9A 2QB5A 1NM5A 3M8KA 4EJFA 1Z75A 3ANLA 5C7YA 5CEFA 1UBEA 5B4UA 1K8XB 6REQB 4IJKA 1B3RA 4P4GA 1MAAA 3RUHA 2AD1A 3EWIA 4FFDA 2XVZA 1V8ZA 2O2IA 3D6JA 1TEHA 1GKKA 2BZSA 1Y8RB 2XTNA 4L4UA 1J5XA 1BOFA 4M9CA 1M6VB 3RADC 2O3TA 3KQSA 3EWAA 3LHKA 2CVQA 3MJSA 2XHZA 3PCXA 2IHNA 5AXCA 5JFTA 4HTFB 5L8VA 1HG0A 4TPKA 1G1MA 3EFOA 5K03A 3ILHA 3WLMA 2J5BA 4INJA 1FLAA 4G5GA 1SURA 1A9QA 1UOPA 3BJMA 3EGWA 2ZTSA 2CFIA 2XADA 3D6TB 1N8KA 4IS3A 2C59A 4JNKA 1RYDA 3VH3A 7ABPA 5LFAA 1XDWA 3U3JA 3WIEA 4BCDA 5K0BA 1DEOA 1PJTA 4NL4H 4RDIA 1X1DA 1DRKA 3HS3A 3BRSA 5C53B 2XYPA 2Q5CA 1GG9A 2GZMA 4HRXA 3BJIC 2VF7A 4L6AA 2G9NA 2C31A 5MDHA 1LQUA 4DV3B 1ZIXA 1H8EA 2XCOA 4PG7A 2WU3A 4DQVA 3D3WA 4CMEA 1Q2UA 4XSVA 3ZV3A 3UC9A 2UYHA 2O8BA 3BN3A 1RRKA 1SU8A 2X9GA 1NXQA 1VECA 4Q3CA 5AKXA 1EXMA 2HPZA 2P65A 2RHGB 2FOIA 1DBWA 1UXJA 3OUUA 4JJGA 3QPDA 3ISTA 3RB8A 5HEKA 4Q9DA 1SFRA 1RM3A 1WMFA 4WVLA 2QRGA 3UJ7A 2XIQA 4F96A 1NY5A 1PN3A 2HCTA 3I6ZA 4XVUA 2H4JA 3BSFA 2XB6A 4Z49A 4D02A 5KAPA 1JXAA 3RYHB 2DT5A 1K86A 2Y1CA 3PRYA 2RK4A 1E1CB 3EDOA 2QJRA 4BV3A 2BSAA 3RSFA 3BXPA 5IVPA 5LZ7A 3WGJA 1FMLA 3AW8A 4JKIA 4MV8A 5DPMA 4CMCA 3P0EA 1MAVA 3GPIA 1T0IA 2YFHA 1E64A 4BRWA 3NI2A 2OM2A 4Q0MA 5EZ6B 2PGIA 2EOAA 4IDEA 1J33A 4CV2A 3HWSA 1Y8QB 2XQKA 3UHOA 4U6NA 1HH4A 1WL8A 3GGDA 1A8QA 4M9SA 4C0KA 1GL9B 1E4YA 1WCV1 2JB9A 3CHYA 1FX1A 1WB6A 1M8KA 3EPRA 3GPDG 5TXGA 5I9LA 2RD2A 3QNUA 5TMDA 1GQRA 4HYEA 1E63A 2Z98A 3OZBA 2I6GA 4OHUA 4OHKA 3RS0A 5I9IA 2RHMA 5LYJF 1EHIA 2F62A 3CNNA 4MRNA 2IH5A 4I9UA 5DHAA 2GF2A 3KSZO 3H3JA 2XD9A 2BCEA 2PMEA 1EK5A 3LLMA 3KZNA 5LQNA 5KCZA 5FV4A 4A23A 2PS0A 1XZPA 2R6AA 3TQTA 2NXNA 1JKJB 3AF3A 1PJBA 5IW8A 3ROPA 1XJ5A 3Q5EA 3QPWA 3AR4A 3VU9A 3C43A 2B6HA 4KL8S 5AYVA 3FPGA 1NVUQ 3DPIA 3R5FA 4H77A 3HM9A 3FTCA 4M1OA 4A26A 1RMTA 2RGNC 2QAIA 4AXXA 3LE8A 1D3AA 4KUGA 4RTNA 1PTKA 2Q3BA 3DBVO 2VT2A 1OLXA 3G2PA 4TWJA 3PFHA 1GTMA 3ETDA 1W47A 3PXCX 3RDPA 5KVVA 5FI1B 3AUUA 1C9YA 4CXMA 2ZXUA 2UUAB 4DGQA 3JXEA 1TMGE 2HQ1A 3CNEA 3OLYA 5ARCA 5TGDA 2HSDA 3EC1A 1SCQA 3I4CA 1P7WA 4MXDA 2QTVA 4Q7LA 3NWEA 3V8EA 4Q4JB 3VZDA 5BV2P 5LMCA 1N33B 3EWNA 1QH0A 2ZRIA 2ZITA 2C0CA 2QD2A 2HO4A 3V8BA 4PGAA 3ON5A 4R2KA 2R25B 5DTQA 5HCUA 2EWMA 6Q21A 2WVAA 3UCFA 1P80A 1K88A 1PG2A 4UKDA 2RBGA 4AO8A 1JEYB 3VR3A 5DHSA 4IIHA 3QQPA 2X0NA 1IG3A 3KV3O 1F38A 3WAGA 1L5MA 1T2NA 1TJYA 4RCVA 1YQEA 3A28A 3ODPA 4FLMA 3E35A 5BVGA 3EZYA 1QYIA 4X3CA 3UO8B 1IXKA 4X41A 3MMXA 4Q3DA 3Q3CA 3ZGOA 1C9EA 1LDGA 1NVKA 2D5IA 8AT1A 1TO1E 1TUGA 1OYVA 4CF7A 1U63A 1ODSA 1P2VA 2I8AA 4IIJA 2CMDA 3C6ZA 4OAOA 4OIFA 1KAQA 4IHJB 1VL0A 4TS9A 1YXMA 1YB6A 5AHXA 5LKRA 3NDPA 2BEVB 3NDIA 4RD6A 1NN3A 1YZKA 4M22A 4RMHA 4RFLA 1HZJA 1MGOA 4Q3LA 2B7LA 2PT7A 2GEDA 3AI3A 1MRSA 1S7CA 2YHAA 2JGIA 1WB9A 3FR7A 4A5SA 2V1XA 3N8NA 4BIMA 1WETA 3D5QA 4ZPXA 1PR0A 2QJOA 1K6XA 3AR5A 3I4LA 2P41A 1PZEA 2WU0A 3MRXA 3P45A 4IILA 3RVMA 3HZZA 4GM4A 4KQEA 1CF4A 3JVEA 4LWZA 5FFNA 1XQVA 2YY7A 5C7LO 2EARA 3Q8KA 4DRYA 2ODBA 3KOYA 4EATA 5I01A 3AETB 2YWDA 3HWWA 3VC1A 4G0VA 1SU7A 3NETA 3LQ1A 1CVRA 1JP7A 1VMKA 3FUWA 4PVCA 3AU9A 1UJNA 1GJRA 4KYTA 1QK3A 2AOXA 4CUKA 1GFSA 2ZE8A 4ZOBA 1KZ6A 5CGZA 4YRKA 3HO1A 4TXMA 1YI0A 1TYCA 2BJWA 4NWIA 5JD6A 3ZDBA 1OTYA 2XDYA 3IBCA 1RHJA 1YT5A 3WWPA 5TVGA 1TUBB 2VPWA 2IHJA 1QV6A 2FPLA 4W9NC 2B4YA 3NHSA 2Q7OE 3ZIDA 3DZIA 5LQUA 3SBXA 4NCBA 4KSCA 2QN9A 4MWBA 4FS3A 5G0VA 5FWXA 2XY4A 1I1HA 3KOOA 4D3XA 2Q45A 4Y2JA 3TPCA 2UVPA 1DV1A 4XYEA 4ZCSA 2PAFA 4MUAA 3VDQA 1NVVQ 2CDAA 3HJUA 4BMDA 4L57A 4KFSA 5TQ2A 2QBYA 5CLLA 1H9BA 3TR5A 3NBXX 4N3NA 1UJ6A 2QGFA 4FBLA 1C9DB 1WMEA 3MINB 3RU9A 4F2PA 3TOCA 2I91A 2OL4A 3HU2A 4B3MB 2J3HA 1TK9A 3BWEA 4ND8B 2OO3A 2Q1TA 3ZY5A 3R6WA 3HADA 1OIVA 1P1CA 4XTCS 3ICQB 1F48A 2AG0A 4R40A 3USES 4Q7MB 4RENA 3H1GA 1KYQA 1UBUS 2X4IA 3C5CA 3GGSA 3U1VA 2IODA 3OFKA 3TWOA 1D9ZA 4B85A 1EA5A 3OKPA 4M0FA 2YJTD 1HQCA 3O94A 5ERYA 4LRQA 5JBQA 3MTEA 1L9KA 4GEKA 1BMQA 1OC4A 3R40A 3O03A 1PZFA 1WCYA 1G3UA 4I19A 3AOEC 4TTRA 3ZE8A 1Q7GA 3UFBA 2O8DB 5I45A 5FYQA 3AUJB 1SM4A 1E2MA 3CM0A 4UTZA 4CIXA 2WM2A 5B7PA 4QIHA 3EPLA 1YGYA 1Z4NA 3OCJA 1OB2A 4WNAB 1M76A 2OXRA 2CXSA 3CONA 1U2RA 1YS4A 2YYAA 1V41E 2OD2A 2QTHA 2LNDA 2SKEA 4LXHA 6PFKA 1OWPA 1NN5A 3DF9A 4L2IA 4MUNA 5JC1A 1CUIA 1F7VA 2W00A 1O0BA 1QIKA 3UHJA 4EFKA 4M7OA 2ZR0A 4WZAA 2VYNA 3D7KA 3OTWA 5I9NA 3NQ41 4UQPA 4PPYA 1YQGA 4NABA 3O8OA 2GVDC 4M6WA 1EFUA 4JEMA 1NDQA 4JIGA 4AURA 4B81A 1FUEA 1TEZA 3X2EA 3S2ZA 2JK1A 3T99A 2EEPA 3AR3A 2F8MA 1R4AA 4D9HA 5KNCD 3I9OA 2GN6A 3EZFA 5LL6P 2WABA 2B30A 3IAUA 4X92A 5GTDA 2ZWAA 4X71A 2ID8A 4M21A 5DASA 4FBGA 2QZJA 2XCTB 2XMSA 3MN1A 5J2TF 2R60A 1ACLA 4PBRA 1CRWG 1RYEA 3B36A 3OWXA 4NKRA 4QGBA 1E1QD 1V6CA 4ER0A 4HDOB 4BNNA 3ZE6A 1OX5A 4YRCA 4LDRA 1Y3HA 2GNOA 2DSTA 3EAGA 1D1TA 2FEXA 2I33A 3NH6A 4OH7A 2GCOA 2YBEA 1Q1EA 1U8FO 2RSLA 1ZDMA 2W0SA 3PHHA 4X84A 4UMFA 4DTIA 5BOVA 2IZOA 1VKNA 1A2OA 2DWOA 3DNPA 3MA0A 3P0JA 4QBHA 3RLFA 1YOBA 4BZWA 3H2SA 4G4GA 3G8BA 1EJ0A 1SUCA 2H2IA 2VDPB 3VPBA 2VP3A 4F3TA 5A4AA 4ZJZA 4YUWA 2G07A 1L7VC 2XTAA 3D6UA 3ZU4A 1OZGA 4L72A 4H1HA 2YYYA 1NBAA 4BKRA 3WWOA 2Z8XA 4FOPA 3KXKA 2R9VA 4AN1A 4E07A 4WL0A 3BHJA 3QOXA 5EKDA 4X66B 3GH1A 4M8SA 3KE9A 4MWGA 3TDNA 5LD2B 5ICCA 3TL2A 2JATA 2QR3A 4FGJA 4GOOD 4CLDA 2J5KA 2H2FA 3E9CA 4J07A 1XEFA 3A6KA 5J4YA 2WK1A 2HSEA 3EVCA 4OJQA 3BT7A 4W5QA 3EGCA 2GVZC 7REQA 4BNHA 1X9HA 4HAZA 3PC4A 4CMKA 3OM0A 4F91B 3NANA 3AHEA 1CUZA 4CU5A 4DLNA 2EQBA 3M6VA 3B9BA 4BVEA 5F4BA 4F93B 2IYNA 3OQHA 4O4HB 4EA7A 1U0RA 3L1VA 4CEIB 3W5UA 1PLJA 2NU9B 4A1OA 1E98A 3IXQA 4M9QA 2A14A 2ESRA 4HUJA 4GR5A 1KEUA 4U9IS 2GPSA 2AVNA 5ER9A 1SBCA 1QRRA 5EXPA 1RYMA 2F64A 2RE8A 2CLIB 2QL5A 3WLLA 1B93A 1W4RA 5DNWA 2HLDA 1YS1X 4GFDA 1TVKB 2CCJA 1QH8B 4Q9LA 4RPIA 4Q1CA 1RRVA 4L4SA 3CBGA 1VDMA 3S2SA 2ZJYA 5IJXA 1K7YA 1C3LA 1UZLA 2J9FB 1A9ZA 3WS7A 4XYMA 4FT2A 2I78A 3KKQA 2VYCA 1DCKA 1YSCA 5EJ2A 1CCWA 1C14A 3FDIA 3M6UA 5FPSA 2D7DA 3B5IA 1GYQA 5AQEA 2D1QA 2V7QA 2ZRMA 4JEIA 3PIRA 2IYPA 2B36A 2PGLA 2VKTA 3BM5A 2AOVA 4GP6A 1BX3A 2PEZA 5AI6A 2H85A 1ZD1A 3VR4H 4IIDA 2DYKA 1EPUA 3IAXA 3TD2A 4RORA 3OIYA 4EHLA 5HJ5A 2NVBA 3DOIA 1B8UA 2P0AA 1QG2A 2C5BA 2Y27A 1QIIA 2ZR7A 2ZI3A 2DBQA 4DARA 2DETA 4LJ7A 3ZJTA 4OGWA 4IIEA 2I54A 4MZDA 5JT1A 3VR3D 3RD5A 4EARA 4UUOA 3KTAA 3B7PA 4M0EA 1N2BA 2C99A 2D4AA 3T3PB 5AKKA 1E0JA 5AKJA 2GHQA 5DTMA 2HKIA 4ZYZA 4V1CB 1JKFA 3C48A 2GS9A 4RZUA 1EFDN 3TSZA 2DMRA 5ULLA 4ETMA 3LRPA 2PLNA 2PRKA 2M6RA 1W29A 4DLZA 2CNLA 1RHUA 4KQCA 1QFXA 1DSSG 2DVMA 4OKNA 4XB1A 1GGMA 3BSWA 1PS0A 3FNBA 4RPKA 4BP9A 3NALA 4YMWA 3M33A 4M0CA 5FXMA 3ENKA 4HDQB 5L9AA 2DTDA 1IUNA 1EBUA 2W6JA 3EVNA 4E22A 3IOBA 5IN5A 5DX0A 5IMBA 1D09A 1X1EA 2GA9A 3EMBA 1Y3CE 2QAGC 2D1RA 4RIEA 5LMNB 1UK9A 4PYRA 1O8CA 1CJKC 3HGTA 5I4BA 2V5VA 4CLOB 1QOZA 3PA8A 3RJTA 3AX6A 2YUTA 1VKZA 1QX4A 2E4ZA 1D2AA 1EJBA 1UWCA 3FMPB 3LVRE 4GR4A 4MO9A 5CT5A 3SSOA 2JCYA 3ETCA 3HWRA 4MI1A 1G5IA 1Q3HA 1DS6A 1WZEA 1BOOA 2QRVB 4MWZA 5E6UB 4JI3B 2IS6A 1Q15A 3AWDA 3JYPA 1L6IA 4X97A 4JK3A 1KP2A 4INZA 4ND6A 4R6XA 4D8WA 2IS2A 1QGDA 1ZK4A 2YIVX 5IFKA 3HN2A 5FWYB 1Y1LA 1GXSA 5ARBA 1R74A 1N6KA 2Q8NA 1HMYA 2JLBA 2W11A 4JI4B 4WCFA 2YV5A 4BX3A 4BJ6A 3BGDA 1Q0LA 2RH9B 1NV9A 3VM6A 4CKXA 5I51A 2YOFA 2IRWA 5DI3B 1UC8A 3GLQA 4DQLA 5LA6A 3GZTB 1SELA 5KKNB 2NXEA 1H0KA 3JVVA 3SHFA 4O4IB 3L05A 3ZEAA 3C8ZA 2W4IA 2GJAA 2BFFA 2XMDA 3H5AA 2DBZA 4K9NA 3MJEA 5ISMA 1QQ7A 1BCSA 3OZ7A 3ASZA 4PO8A 4WGGA 4CM4A 4DWWA 2ILTA 4PFSA 2JIOA 4MQ6A 2NO1A 1NXSA 3SHOA 1ULZA 2AXQA 4B3GA 3D0OA 3GGJA 4D4KA 4JP1A 5H0IA 4LHWA 4TQGA 2F6RA 3LHDA 4QICA 3W2FA 4EY8A 3HVJA 1FMFA 5AK4A 3BQMB 4MW9A 3CLUD 3E5MA 5KTMA 2GN9A 3DEIA 4X61A 4O4HF 1ZN7A 4KLAA 2OORC 4BBAA 4QU8A 2A8YA 1ZSNA 3L8YA 4F1WA 3RFCA 3VDNB 3ZD6A 2QW1A 2EZ8A 1MIOB 1TJPB 4Q9NA 1ADGA 5IABA 1UJMA 4F85A 4ZN6A 5L53A 1XYVA 3UV3A 5AP9A 5AR1A 5JW6A 3IPAA 1QE3A 2BUCA 3I34X 2FUG1 3I2IA 2O0LA 3L01A 4RGYA 4FFWA 3C39A 4LHZA 2YHIA 3QWIA 4MYSA 1GRCA 5T3YA 5DM0A 3ZWAA 2WJGA 2OAQ1 4ZFNA 2VEOA 5BYAA 4OBBA 2VAXA 4YMSA 1OU4A 2WUFA 3AJDA 3OM8A 3U19A 2EHDA 3GGCA 3RC7A 3GGGA 1IEVA 2ZULA 3RSZA 3VDMA 4TUYB 4WKBA 5CBPA 1CRPA 2QV7A 3DEKA 2XCSB 4XJXA 4IGEA 4JVLA 1S96A 1EFVA 5I5GA 1UJBA 5DLEA 2PXXA 2P3SA 3TQIA 4DPLA 1ZM9A 3RFVA 3CRNA 2WWFA 1WMSA 2XEDA 1A5BB 1H5NA 2QQ5A 3EZ6A 4W63A 1O8BA 2D59A 4HH1A 4RPJA 2P2LA 2JDID 4IWYA 1QX3A 2WJWA 5E7JA 2IZZA 4ENVA 3NTVA 3BD9A 1E3MA 4UNQA 2ZRHA 5CB4B 1G8KA 1H42A 4NMXB 5FOVA 5GY7A 1RMQA 4QGHA 5J63A 2BEKA 3O47A 3T0GA 1PZHA 5A5DA 1I14A 1QQBA 3DT6A 1V4VA 2BFPA 1LS6A 2Q6LA 1VJCA 1CQXA 2BP7A 5JNUA 3ESQA 2HLHA 2YZGA 5ALYA 1W1IA 3AG5A 2V58A 3HCDA 5BWOA 5CLJA 1E5XA 1T0PA 2SKCA 3GEMA 3MTQA 3LWDA 3A9WA 4QVGA 5IC4A 2OO5C 5CYGA 1SIWA 2BBSA 2M6SA 1GLVA 3PENA 5M3BA 2QM0A 2QVZX 2YVQA 4TTTS 1V1RA 4DSZA 2HK6A 2Z9CA 1EEHA 4V3CA 3PX3A 1HNNA 2WFLA 3B8EA 3HJHA 1ZITA 2Z3ZA 2AJDA 3RT1A 1WXGA 4OQXA 3HHPA 3ZPXA 3SF8A 1U65A 1RYYA 1ZRHA 2F48A 2YH2A 3A6FA 3A9UA 4RCZA 4DEYA 4FYPA 4US0R 2PT9A 3VSAA 2IY7A 4KITB 2BFWA 5KYXB 3IQGX 2WYHA 4RSMA 3N59A 2JD0A 6AT1A 5K09A 1IXSB 5FF9A 3TAHA 4P0TA 1TJNA 3MAJA 4ZO4A 4C4OA 2OSBA 4GPEA 2VAPA 2YWJA 2YOGA 1YJCA 3I28A 3R76A 1QQTA 5LP6A 1UPCA 1W75A 2HC9A 2P0YA 2XKBA 3K72B 4FZ5A 4HAYA 3LOQA 3IQDB 3LV8A 4R81A 5CH8A 4ZU1X 4IAOA 2B94A 4B35A 4F4HA 2B0CA 3C24A 1RWWA 3BSSA 1B2LA 3C4JA 3D3KA 1DG1G 3QWBA 2FW1A 4X63A 1KI7A 1UZAA 1WO8A 2PGAA 2GFQA 5HG0A 3TDKA 1T29A 4BBZA 2XMQA 2ZIUB 4WASA 1V71A 3UGTA 1I10A 3QKTA 2C8LA 3EAFA 3P9QA 4CMHA 1U11A 1YR9A 4ZQEA 3H9UA 4MICA 1OPRA 5LCXA 3VX3A 1VGVA 2I4IA 4EGCB 3HBNA 4LY6A 3W6PA 4MS3B 3G82C 2OV3A 4FFRA 1A5TA 4U3JA 1U2QA 4PLFA 1DJOA 3M9LA 4CDMA 4EEXA 1SO8A 4ZYTA 3B70A 1S3SA 3GJRA 2ECKA 5LDHA 2C9OA 3CO0S 3IKVA 4IQ4A 4LOAA 1TT7A 1LUAA 4R05A 1QYDA 2XZTA 4I4TF 5AUOB 6NULA 3IUQA 1XQWA 4JLWA 4CN9A 2XB8A 3O3OB 2RK3A 2LDXA 1T9CA 4HDSB 1T2FA 3A9VA 1N0IA 1HRDA 1VLLA 2N9UA 3CLSC 1EX1A 4HGYA 3JS5A 4K46A 4BL5A 4URFA 2ZSDA 1W4CA 3EUEA 1MPTA 1EGQA 2ZI7A 4FGZA 5FV7A 3G02A 4Q9HA 4GI2A 2G9RA 5ALTA 1S01A 2WG2A 5BW6B 3TJZA 2FPMA 1CUGA 1STOA 2G5TA 2QVCA 2AIRA 2JGAA 3KL4A 2P90A 2Z9BA 3SE0A 1FSSA 5FX2A 1R4ZA 3EXIB 5ESXA 1KQ3A 4DA6A 2WP8J 4NMHA 1I1OA 1MO5A 2IZ1A 2VK4A 4NV1A 4ZZ3A 1I7SB 1NIPA 2PV7A 3BE8A 3NR2A 7MHTA 4U2FA 2W6CX 2ZUDA 5A5EA 1G8SA 1L1QA 4FS8A 4IGIA 5JV5A 3GB9A 4Q12A 1V7ZA 1TJ3A 4ESVA 4QTXA 3X2SA 5JSHA 2JASA 4MVWA 5CM9C 1R0WA 2GFIA 1JDNA 3P4XA 4YRFA 2JIQA 4O02B 3VAYA 1SUAA 3WRWA 2P9QA 3LBFA 1RADA 4FQ8A 4MMZB 4PFQA 2HMUA 2FFQA 4YUYA 2DEUA 4WGFA 4JUFA 1Y33E 1CYEA 3C45A 5IJZA 2Z2YA 2IYWA 4FDTA 1X2EA 1KH2A 2QUJA 4PX2A 1AG9A 4LOLA 3AP1A 3UCXA 1ISHA 5T8KC 3DE0X 1BHSA 1VLVA 1I4LD 3PB3A 1JE1A 3RKRA 4B7ZA 2HTEA 4C4TA 5B53A 5KWJA 4GKJB 3LWZA 3PYXA 4E5YA 1SUBA 2A1UB 4JEUA 2PH1A 2X0EA 3NHPA 1MEEA 3T9BA 2VO1A 4FFNA 4LTDA 2C4HA 3O8BA 1ODTC 2Q9AA 2ZYHA 3JQ7B 1X6VA 3PEFA 2AMJA 1WCWA 1DADA 1KIFA 4MVJI 4FWBA 4MQ4A 3W4KA 5HQ3B 1J8YF 3FYUB 4AU1A 4ZGBA 3NNSA 3IJ5A 2WJ4A 5HZHA 3TKAA 5C3UA 4B2LA 1KY4A 1SUPA 1USKA 3K05A 3NIGB 4LMRA 3H3FA 1JEJA 2FZEA 3ETGA 3DDSA 3L2OB 4HQ6A 4F5WA 4U8GA 1QR2A 4P7KA 1NVMB 2NO4A 4IRMA 4RY9A 3RTBA 3SZLA 3GCXA 4BTEA 1BVHA 3TINA 1J21A 2B8TA 2GEFA 1ATZA 4RXMA 2H1HA 1IWBB 2EQ5A 2YFQA 3NWJA 4IIJB 5EXXA 3BFPA 1IIBA 2CXTA 2X5KO 1BHO1 1T6YA 1W2GA 1E94E 3H8JA 4FVTA 4PX9A 2WSYB 3OX3A 2DQZA 1VKJA 1ORTA 3RYIB 3EG5A 5I8PA 3IPRA 1C1DB 1WG8A 2ODNA 3NBZC 4HGZA 5I9MA 1B1AA 5IVIA 4GKKB 3CZ5A 4GGPA 3O9MA 1JE0A 3OPYI 5EFOA 5F51A 1ZJ6A 4IJ6A 2CL5A 2CXRA 4KREA 4NAHA 2XD4A 1MT3A 3H1EA 3GJ0A 3HFJA 3LW7A 3MELA 4ML3A 3X1ZA 5J47A 5PNTA 4DKJA 1MA0A 2YW9A 3Q2OA 1N0VC 1OTXA 2YW2A 1F8FA 3VPXA 4XVCA 4ZCTA 2ICAA 2OPHA 3UPTA 4N03A 1V5FA 2WJZB 3KSAC 5JYBA 3GAFA 2FPKA 2J3QA 2RKWA 4YJGA 3ZHSA 1M2WA 2DLNA 1Q7RA 4Q7EA 4AJ4A 4JR1A 2IYFA 5PGMA 1KKMA 3T61A 1YB4A 1PFGA 1PSWA 2ZATA 4NQZA 4KRFA 3P71T 1C8KA 1XTIA 1E2JA 1NRJB 2CBZA 2V7EA 3KKZA 2VYND 2P79A 4BMSA 3VVCA 4PSUA 4H59A 1NTOA 2G08A 3IUSA 3LXUX 4M8IA 5D7NA 2C94A 2X9NA 1GTL1 3UWKA 3V4OA 4DUZB 1U7ZA 1WUJS 2ZE5A 3FUTA 2EDCA 3HRIA 5DGCA 4TLLB 1TQ4A 3CKMA 1Q92A 4L27A 1CZHA 1U99A 1XDZA 5HRCA 4CMIB 3LVFO 1XFAA 2RGNA 1JAHA 3ZIAD 4YRRA 4H0CA 1EQ2A 3Q87B 2XW6A 5AJWA 3B1VA 5JROA 5KC9A 3H2JA 3C3YA 2BFOA 1YQXA 2C0QA 4O2RA 4ZCRA 2QYOA 5M34A 3WGOA 3ZDEA 1HQDA 1A97A 3OMWA 4RELA 1MR3F 4OCZA 1FS5A 3TFQA 1Z0ZA 1OI2A 4HZUB 1E3WA 3KAJA 3W77A 4II2A 1Z68A 3NOXA 1B3BA 2QD4A 3IBYA 3TM4A 3UK7A 4FN5A 1CWUA 1FVHA 3PQDA 2G71A 4F8EA 5JNLA 3F98A 4K9RA 4UUBA 4E11A 5C35A 3BUSA 4G41A 2F7SA 3NYIA 1XEWY 1AS0A 1Y9JA 1KQOA 1A98A 3TZ6A 2I4RA 1L5YA 1D4ZA 1D6MA 1KJNA 2B4KA 5JQGB 2ANBA 1XRQA 3DP9A 2K5UA 4GWKA 4KGXA 1EHCA 3CRZA 3MXOA 2I65A 3OMXA 3GF4A 1NMEA 3FWKA 4NK4A 4QREA 5E2AA 1JKMA 4JLKA 3N58A 1DIGA 1RAEA 4RAQA 1N5RA 5D85A 5LYYA 1SK9A 3N39C 1CHDA 3I3SR 1ZLXA 1K8YB 4UVHA 5AOAA 4URVR 2VQ6A 3IAEA 4GSKA 4CLHA 1OFTA 1GWNA 4LW8A 4BX8A 5IAEA 2XUKA 2V96A 3LCVB 2AXNA 2QRHA 3G59A 4D26A 1VXOA 4OFWA 2QTNA 3O5AA 4N5DA 2QM3A 1M34A 3UWSA 1W85A 4C7VA 4FB4A 1YKFA 1J5PA 5JTUA 4QT4A 1ZOLA 2WV7A 4RGVA 1BGWA 3U7EB 1SG6A 4NOLA 1UBRS 2CLLB 3L7NA 4FEAA 5F76A 2VP9A 3VO9A 4FCWA 4ALLA 3IVCA 3WKAA 3GEEA 1ZEMA 4XM2A 5LP6C 2WIJA 3C3BA 2FVYA 2OMKA 2G88A 3Q6MA 4Q1BA 4CL8A 4HT3B 3S4YA 5DK4A 4OI0A 2FCRA 1EUDA 1IRIA 3L7AA 1XVTA 2PVPA 3I0NA 4LKOA 4O1IA 1KTVA 5CCDA 3WK6A 1VTKA 3B20A 4BO8A 3ZNNA 3ZUGA 4C3VA 6REQA 2I7DA 4YV1A 1OA0A 4F6LA 2W83A 3WO1A 4KH0A 3TO5A 1N6LA 3OJLA 1Q44A 2PRZA 1BX1A 1A04A 2GD0A 3LFHA 5F1OA 3JRNA 1H05A 2TMDA 2COEA 2AQKA 3ESZA 3II6X 4UFOA 5DT2A 3F6RA 3SQNA 2YXEA 4L5IA 4YJ3F 5JTTA 1XAHA 2C4WA 1BFKA 2Y67A 3ORRA 3VBEA 4Q6WA 3THWA 3S2EA 1OLUA 2Y1XA 5HRUA 1P1KA 5DKFA 5BW8A 1X15A 3EEOA 3PNVA 3GNSA 2WOJA 3W5IA 4URYR 2B1JA 1WMAA 5D6NA 4CF6A 3ROKA 3SY8A 4A0HA 1V4NA 2CE7A 3AIMA 3E3OA 3IIMA 3LCRA 4F92B 1HYGA 4YRQA 1RJEA 2V6FA 2JH9A 1GAWA 1N6NA 1O7JA 1PT5A 4ALMA 4AUKA 5IVDA 1AB5A 1SC9A 2VSFA 4K9LA 3CLSD 4MVJA 2RGAA 4H1TA 1RTKA 1ELOA 1V8PA 1JZTA 721PA 4W5OA 2KPOA 3IAM1 4L3WA 4D46A 5BNTA 1W44A 4QQFA 5TQVA 2VRCD 2CMKA 1P60A 4G9GA 4HQLA 1ZH6A 2XCIA 1NT2A 4M76B 4IO0A 1EUDB 1X86B 4U6SA 4GI1A 1EGMB 3VVBA 1B15A 4DIOA 5JASA 3KKLA 5H02A 2HPAA 2WAMA 4Y6OA 4KIWA 2BZ0A 3FZQA 1S5PA 4R8VA 3RS7A 4M38A 2HBYA 3IBGA 5EY5B 3V1KA 3NVMB 4LJ5A 4OQ4A 2BGIA 3IGFA 4HZIA 1I6LA 3E3LA 3K3PA 4OJKA 3KDPA 3K1TA 1NMSA 3Q3GE 2GZDA 1Y4AE 1GQ2A 1R0XA 3PQ7A 1YZYA 4I4LA 2ZYIA 3HBMA 2GN8A 2BKEA 4GOMD 2GVNA 2CJYA 3KETA 1IG0A 3BGVA 5FDFA 2XNCA 3RTDA 3EFHA 5FBVB 4IVNA 2AE2A 5D87A 4RK6A 3MWKA 2XWQA 1LJUA 1PGJA 1U7TA 4HFRA 9GPBA 5J4KA 2PKWA 1QZXA 3EZ7A 4W99A 3NKLA 3ENVA 1PL7A 2VBIA 4KE8A 2HX1A 1L4KA 1F3OA 4YRMA 5JCJD 1L7DA 2W8ZA 2CSXA 2Q1YA 2XMRA 3URKA 3PKIA 1Q7CA 5K4GA 2I8CA 3R5XA 4LFCB 2N1MA 3NPAA 1L4MA 3VPHA 4AZWA 1IHUA 2J6CA 2VDWB 4ARUA 4DMFA 1TZMA 5AVRA 3HQ4O 1QV7A 2Z1DA 4MQEB 3SEQA 3IULA 4A91A 5HOEA 4LF6B 2XA9A 2ZTUA 4PWZA 5JQGA 3EVTA 1SOAA 1ZUD1 3TLMA 1Z35A 3BCHA 3LPMA 1XK7A 4UJ5A 3TCKA 3WIVA 1TUEA 4EG7A 4B31A 2I29A 4QBGB 1XCLA 4LZLA 5F1PA 5AHOA 5C81A 2PUTA 3A1NA 3DBOB 5F23A 4UHEA 2RBKA 3EXFA 4DILA 4KXFB 3KEGA 4GDFA 3KLOA 3FCUB 4DT1A 1E18A 4FDMA 3FTEA 2C4TA 3A3KA 4RTRA 2OCKA 1NY6A 4QUBA 1IY2A 3FPEA 4BQOA 3H4TA 3QEBZ 4IJWA 1CQWA 3OSUA 1M2OA 3IPLA 4BN5A 3DOCA 4LZOA 3QA3E 3FH0A 2NPOA 3GI1A 3N2YA 5IH3A 3I45A 3KQWA 5JCOA 3QVOA 3FTPA 3SJAA 3T7RA 1QRUA 2N0SA 4NU0A 3E1SA 2JI9A 2Q5JA 3EOBI 2IE8A 3UJ3X 3T3OA 3N70A 2ZOSA 1C8LA 3R77A 3TMAA 5CDHA 4TXLA 4JLDA 1H2RS 4BMOB 1A8IA 1ZZEA 2QZZA 3CRRA 5KX5B 1WXQA 1OI4A 3R3WA 3QSYA 1PLLA 1JQBA 2G40A 3L82B 1QGAA 2ZUSA 1EP2B 1VBKA 3HLKA 4FGUA 1GKLA 2POCA 3PXBA 4KXUA 2LRHA 3RQSA 4YJ2F 4L08A 5EQFA 5EZSA 4B7CA 3S2YA 4R0MA 4LSMA 4N5IX 3EW9A 4GRAA 1A88A 4DC9A 3JD3A 4LECA 5A6SB 3AYXB 2A57A 2A2ZA 4FWIB 4DUPA 4XXHA 1P9LA 1CS0A 2CV1A 2RG7A 5CLQA 3DUFB 3NOOA 2ZXFA 3ZWKA 1JFSA 1W25A 4QQKA 1FUYB 2PX5A 3D4NA 4RJLA 3WOHA 3KVOA 4K6FA 5JRJA 4OM8A 3GQBA 1S3IA 2ZSAA 3GLFE 2C9MA 4E32A 4LJYA 3EARA 4JDPA 1FFCA 4H6XA 1URPA 3CF4G 3COSA 5FWDA 1ESDA 2ODEA 1W2WB 2DFTA 3V1NA 3KR2A 4LJAA 4GWGA 1C3OA 3QV2A 4IMJB 3TE6A 2O2SA 3EF0A 3K2IA 1TT5A 3D8TA 1HYEA 1BEZA 2DTXA 5ALDA 1RI5A 1SCDA 4PIPA 3T1VA 1T26A 2ZI6A 2F55A 1NQUA 3NT5A 3QUCA 2Q3JA 2XDAA 3HU1A 4GP7A 3KL2A 4MUBA 1CUHA 3KM0A 4YR9A 1FXUA 4XR4A 2WE8A 4Q4DA 2F8TA 4Q34A 2OHHA 3KQKA 4B4WA 1RKXA 4GRIA 4YV2A 2H6EA 4MR8B 2H29A 1EUCB