1KDVA

Pseudomonas serine-carboxyl proteinase complexed with the inhibitor aiaf (this enzyme renamed "sedolisin" in 2003)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
368
structure length
368
Chain Sequence
GTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor complexes of the Pseudomonas serine-carboxyl proteinase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SERINE-CARBOXYL PROTEINASE
total genus 134
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1kdvA00
1SH7A 4K8RB 5CW1A 5FBZA 2B6NA 3VYVA 3VV2A 1AV7A 2SICE 1AF4A 3TI9A 1P7VA 2Z2ZA 2ZRQA 1ZVKA 2PKCA 4C3VA 1KDYA 2P4EA 1SIBE 2W2OA 3LXUX 5JXJA 3DE2X 1XF1A 4BWGA 1ZVJA 1HT3A 2E1PA 1GNVA 4NE9A 1DBIA 3GCWA 1MPTA 5AMXA 1A2QA 3SICE 4DJ5X 4NE7A 1GA4A 1SCDA 2W2MA 4M1ZA 1R6VA 4WOCA 1Y3FE 3BPSA 3WIUA 3WIVA 1C9MA 1CNMA 1V6CA 3EE6A 1CSEE 1Y48E 2V8BA 1BFUA 1SUEA 1P8JA 1YJBA 1R0RE 3QFHA 3AFGA 3D43A 2XTJA 5AQEA 1SBCA 3SQOA 3A3OA 1SPBS 5JMOA 1WMEA 1C9NA 2WUWE 2WUVA 2X8JA 3DE6X 4Z2AA 1PEKE 3WQBA 5JXGA 5AVJA 3HJRA 1GTJ1 1AK9A 1Q5PA 5AVKA 1TM7E 1Y1KE 3DE7X 4H6VA 1AVTA 5ARCA 3D9QX 1TM4E 5ARDA 2PWBA 1Y4AE 1Y3CE 4RYDA 1TO2E 5ARBA 3DW1X 2XRMA 1EA7A 2PYZA 3A3NA 1SBIA 2W2QA 3DVQX 2G4VA 5B1EA 1TK2A 1LW6E 1ST2A 1SELA 1NDQA 2WV7A 4AKSA 1SBNE 3Q40A 2ZWOA 5I9SA 2DP4E 1SUCA 2SECE 5SICE 4LVOA 1KE2A 3F7OA 4H6WA 1SUAA 1GA1A 2WWTA 3GT3A 4YN3A 1Y33E 3I2YX 3VV3A 2X8JB 2QTWB 1SUPA 2W2PA 1BE8A 3EIFA 2DUJA 2PRKA 1SBTA 1AU9A 4OV6B 1EGQA 1Y9ZA 2IXTA 4LVNA 3DE4X 3ZXYA 3DDZX 2Z57A 3UNXA 4CG0A 1SCJA 4AKTA 1NLUA 5K7SA 1WVMA 4H6XA 3T41A 4C3UA 1R64A 1SCNE 2Z2YA 4DZTA 4CFYA 1BFKA 4DWWA 1GA6A 3DE5X 4I0WB 4KPGA 2PMWB 1TM3E 1YJCA 2Z2XA 3GCXA 1SCBA 1UBNA 4MZDA 3VSBA 4B5LA 1JEAA 3LPCA 1SVNA 1NDUA 3PTLA 1C3LA 1TO1E 1WSDA 1BH6A 1C9JA 1S2NA 1T1IA 3A3PA 1GNSA 3AJ9A 3ZXXA 5JXHA 1WMFA 3EDYA 3F49S 4J94A 3AJ8A 3L1KA 4CFZA 4GI3A 3TECE 1SIOA 2W2NA 3LPDA 4WOBA 2Z58A 1KDZA 2TECE 1TMGE 1S02A 2Z30A 3Q5GA 3TI7A 1Y3DE 1YJAA 1Y3BE 3VHQA 4HVLA 2IY9A 3DE1X 3LPAA 1OYVA 2SNIE 1TM5E 1ST3A 1TM1E 2ID4A 3QTLA 3DVSX 1YU6A 2PQ2A 1PJ8A 5B1DA 1OT5A 1GCIA 2Z56A 3GT4A 3PRKE 3I37X 3DVRX 1T1EA 4HX2A 2HD4A 5JXIA 3VTAA 5FAXA 1GTG1 1SUDA 1THMA 4OMCA 2GKOA 3OSZA 4ZOQI 2ID8A 3WHIA 3I34X 1KE1A 1Y34E 2DQKA 4NMXB 3CNQS 1BE6A 1PFGA 4FONA 3DE0X 4KG7A 1VSBA 1OYOA 1MEEA 1Y4DE 3CO0S 1AH2A 1V5IA 2SBTA 3QMPA 1GT91 4JP8A 4OMDA 3BGOS 1IC6A 1BJRE 3DE3X 1DUIA 1SCAA 1T1GA 3BX1A 1SUBA 3DW3X 4KB5A 3DWEX 3DYBA 2HPZA 1KDVA 3H42B 1GTL1 3F7MA 2PWAA 1P7WA 5FFNA 1PTKA 2ST1A 2ZWPA 1TECE 1AQNA 3P5BA 1SBHA 4ZARA 1SIUA 1IAVA 3I30X 1SN7A 1WMDA 1S01A
chains in the Genus database with same CATH superfamily
2RHLA 1W4AA 2FWBA 3IPAA 4EF4A 1DXOA 1DQSA 4BU0A 3KAQA 3ZU6A 2ZRHA 1RQNA 3PR2B 4QQFA 2B20A 3THYB 2OV4A 2IEDA 2I87A 2N9UA 2FSHA 4D0GA 3GL9A 3IUEA 5CM9C 3G2OA 1KSGA 4F2PA 5EY5B 2OHOA 2W43A 3JYPA 3LHIA 5FD8A 2NTVA 1KGSA 2JHAA 2VXYA 1W36B 1E3MA 5GM1A 5COQA 5I7WA 4ZCTA 2XDQB 1NNUA 2H2FA 5JJBA 4QASA 1UR5A 2CLIB 1R0WA 3E0XA 2EXXA 5AXBA 3FMIA 4BKOA 1E0JA 1TCVA 4R2WA 5AM0A 1XMJA 2AN5A 3D8RA 2H2DA 5GVRA 2ZPAA 3IQFA 4B6SA 2LUOA 2AJBA 3N6RA 3W2HA 3SXPA 2CLOB 1WZCA 2FGJA 4EVQA 5EJEA 4Z8XA 5E7JA 1ZX1A 2RBEA 3V7WA 2NTJA 2V54A 5CIQA 5K4GA 2XT6A 1ZH0A 1E60A 1TK2A 1FS5A 1EFCA 2M32A 4KDFA 3D7LA 5BMVA 2W93A 4OOFA 5A7HA 2HAEA 4ZRMA 2F64A 4LJ4A 3DAGA 3IURA 1ZRMA 4DTCA 4ZGGA 3GT3A 3MBIA 5CT8A 4B4DA 1FJ2A 2PU5A 3ICEA 1DQZA 3HEBA 2FGKA 1CX9B 1PG0A 1QHEA 2ZJ2A 2G9UA 3UV7A 1JJ7A 1RQPA 3TEMA 1P77A 3VTKA 9LDTA 3CVXA 4ZI7A 3PXAA 1JH9A 5TVGA 1FU7A 1RWVA 1KAQA 2D06A 1E7MA 4U7HA 1OREA 5LJIA 1XR3A 4WY5A 2JG3A 2R25B 5BRAA 1T3ZA 1G42A 1UKVY 1PYDA 4PC3A 2W48A 2O14A 1LDEA 2H9AA 1V4BA 3HUDA 3FZEA 4IXDA 4QECA 1N0UA 5DSTA 4M2LA 3FCYA 5FUVA 4AJ1A 4BFCA 1F8YA 4G5HA 2Y1FA 3OJWA 4X6XA 4RA9A 4ZQGA 2CXUA 4HJXA 4WV3A 4BNXA 3HYTA 2XD9A 2R8XA 2VTBA 1UM9B 3PS9A 1ONPA 3DBIA 2ZR8A 4HVTA 3UT6A 1P80A 3RRJA 1ZR2A 1RM0A 3T52A 2J9XB 5H0IA 4I50F 3P4XA 1WHSA 5AT1A 1IZZA 2OV6A 2YFKA 4D8UA 4TVOA 1AHIA 3SF8A 2PLRA 3ZS8A 4M1EA 1EVJA 4LXGA 4ZOCA 1ZNZA 5GONB 4GDMA 4FOTA 2VR1A 1E79A 3OHPA 1NM5A 2DRIA 2R8RA 2D59A 3ZQUA 4YCSA 4E6PA 1TPYA 3KLBA 1HZJA 4KQFA 3PXXA 1I3KA 1IIRA 3KZMA 5TGZA 4OQ4A 1EG2A 5TGDA 1JBQA 2J9ZB 2WW8A 3IULA 2B8EA 3PQ6A 1T13A 4BNGA 4E11A 4I4IA 1YS6A 3CURA 1G2QA 5CGZA 3CW9A 4HTAA 3D3JA 3WNQA 1JDJA 3QEKA 2DH6A 4KE6A 1VYUA 5IM4F 1V71A 4XWKA 1HUQA 3Q8LA 4QGAA 1ZUHA 4YT5A 4V1CI 1J21A 1WBJB 1ISPA 2C59A 5FUWA 5HG0A 3W05A 4L4ZA 5K8CA 3QWBA 5BNTA 1Z8NA 2YIMA 3LRTA 5T5QA 2K4MA 1Q19A 2XGSA 3P97A 3TGWA 1YAHA 3SKYA 1OILA 4LIPD 1U0RA 1S3IA 3U62A 3CINA 1BXZA 4R1MA 2O4CA 1WCV1 3ZZNA 2RARA 2QMEA 2WT4A 1A9RA 1VI6A 3EDQA 1VCIA 2ECQA 4PVCA 3RT7A 3ZD8A 1NI5A 4GRIA 5EYPA 4QFDA 2V7BA 1P5HA 1W47A 1N4AA 4CQMD 3PWZA 1G5PA 3FVWA 3K4PA 5K8VA 1T8WA 3AWDA 1GN9A 3L8FA 4KIGA 2Z3WA 1S2GA 3R7FA 3LTEA 2MSDB 2WIAA 3OIGA 1SC3A 1MH9A 2R6GA 2XAUA 1R4MB 2AJ8A 3SZ3A 3RC8A 4IQ4A 3T0FA 4ETMA 3MTDA 1W2GA 5JSUA 2ZSDA 4E3ZA 1WB6A 4XVQA 4E08A 1YZYA 4LNUA 4JXXA 3PT9A 5YASA 1B8NA 1OXKB 1Z8FA 1L4NA 3LT5A 1L8LA 4TTTS 5AW9A 4R9SA 4YHHB 1EKXA 3V8RA 2A0KA 4UASA 2VPWA 5SYNA 1Z4QA 4H7KA 3AM3A 3IP8A 5DTQA 3C5CA 5I9IA 2PYDA 3GA0A 3N8DA 1NLZA 1MOQA 1V2GA 2F8MA 4KH0A 3WBKA 4ALNA 1DAIA 2YWDA 4H6XA 4UVIA 2QX7A 3KQPA 4P36A 5G4KA 3NRCA 3IAFA 3EFEA 1O95C 3BDAA 4HAVA 3RFCA 3WWDA 5D85A 1R8JA 5ADVA 1Z2NX 3QUBA 2LWIA 1E32A 1X1CA 4JENA 4OQNA 5AI8A 1YIDA 1NDUA 3L0CA 4P82A 4F60A 2Y05A 1K6MA 5EZ6B 5T8KC 1XRQA 3NATA 1HSZA 2QZJA 3JAKB 4XM1A 2XTAA 1O95D 3GQBB 5HVNA 3VYRB 1WOMA 4CDNA 1DJPA 2EW2A 5JNVA 1VGRA 2P0EA 1GZHB 1PWXA 1OYVA 1YZFA 3PNQA 3TINA 1TM5E 3WWOA 1XXLA 4DNQA 5DCWA 2I33A 3BG5A 3ZDYB 2RC6A 3JQRA 4G1CA 2CFOA 1PD1A 2O3QA 1S89A 3GUZA 3R3WA 4UATA 4ZDWA 1OASA 3DGFC 2QMUA 1EP3B 2G4LA 2WFLB 4EI2A 1FA9A 4Y0NA 4KODA 1H69A 2X5JO 2QL5A 1ZGJA 4DW8A 1HFKA 4U7TB 2XMGA 1N6KA 1CQIA 3GEPA 5LU9A 1CVIA 2OC4A 2PVCA 1XDGA 1M1XB 1TZMA 2G04A 2Z98A 4MCHA 3JY6A 2OHIA 2VQ6A 3RLFA 4DIUA 2OLJA 5CLLA 2XMCA 1A97A 3R3UA 5FYDA 1ZNXA 1JLLB 2MJLA 1W75A 4UQLA 4TVSA 4X24A 3TGLA 5DM0A 3FOWA 1T9KA 1V3UA 2PWAA 3NM5A 4C21A 3BHIA 1KVUA 5DIZA 3S55A 3S28A 2M6RA 3VSDA 1XIVA 3WYGA 1CULC 4ZAXA 3CSUA 1XV5A 4MMYB 3B78A 1R6DA 4ETNA 1VL8A 5HM8A 3ZN2A 2A5YB 5FBZA 5BVGA 1O77A 4QYXA 4TS3A 2W58A 2PEZA 2VJLA 4UW9A 2ZI7A 4EA6A 4PV7A 1SXJE 3ROGA 3VX4A 4EECA 1Z25A 4LV8B 1UDCA 2ZBQA 3GRAA 1G7RA 3PSAA 2BMAA 3LRXA 3O2NA 4JX9A 3QEOA 4BNVA 1C50A 4L74A 4P35A 4Y6OA 1L9XA 1HE1C 1G16A 1YJBA 2PH3A 3N28A 5HQTA 3L05A 2WYWA 5U4XA 4AULA 1PJ3A 4N0QA 4PLFA 1TYEB 3OZIA 1KJ8A 5AJHA 4AN4A 2W8BB 2FSPA 3CLUC 4LJ8A 3EVEA 1SUIA 1LS6A 2HJRA 2VA8A 4IO1A 5HRCA 5KIAA 2VDUE 1TM7E 3HVKA 3AOGA 3BCSA 4ZOLF 3TF5A 3H19A 3OTQA 4TQAA 1RTTA 1E20A 1M2EA 2PL3A 3OP4A 3EC2A 3F97A 4KEAA 1OX5A 1W4LA 4WXHA 3KVVA 3U49A 2B4QA 1UPXA 4XI9A 1HYGA 1TU3A 3IC5A 4BFZA 1NDQA 3B53X 5JT1A 1C8LA 1NXTA 1M2GA 5JD3A 4WBNF 1W49A 3CLVA 5AJZA 4YTEA 5A4DA 5JAHA 3URKA 3O90A 2VT3A 2PS3A 4PE5B 4A2WA 4QNMA 1FZTA 2RHOA 1YR8A 2X8JB 2W2PA 5IP5A 4B71A 1M2JA 3V55A 4X84A 4ALJA 2AMLA 2WSBA 4LW8A 1NSYA 3ZY3A 4EFDA 4G23A 4JUIA 2BMFA 4U9IS 3D6VA 4UREA 3FY4A 1NC3A 3MAGA 4QOHA 1BFKA 2BEWB 4CM4A 2DEUA 3FPAA 1E4YA 1KK2A 2UVPB 5KTOA 3IBYA 1OVGA 4UU0A 4ZPJA 3RC7A 5JXWA 1XMQB 2Q29A 2Q3MA 3B9QA 3ZKWA 1ZYUA 1A5AB 1KY4A 4OP1A 3KEGA 4RS3A 2NTNA 3P1JA 1VZ2A 4IIUA 2RGCA 2XMRA 3D1LA 4P93A 2EZUA 2WU1A 4EVSA 3UMSA 1CY7A 5CXQA 5A0TA 4TTJA 1IN6A 4DV0B 5LUAA 1AS3A 2EW1A 1S02A 4Y9SA 5BYBA 3W2EA 1ZOIA 2B8TA 2WUDA 2FZEA 1XP8A 3EC1A 1SXIA 2QRJA 4KXUA 3GCGA 4U2EA 5J2TB 3QSYA 3UG7A 3AFHA 3CRNA 2BEVA 4BATA 1TDJA 2I2BA 3FTEA 1UPUA 4FSDA 3DQZA 4R5MA 5FOQA 4Q5IA 2GB4A 1RWKA 4C4TA 1G17A 1Y8QA 4KPUB 4XASA 1LTQA 2WUEA 3IILA 3R5FA 3V8QA 1HTWA 2QIPA 3IKMB 1JR2A 3KTDA 4O2AF 4MI3A 4EARA 4EHHA 5K20A 3HMKA 5BQ5A 1RHJA 2PVSA 3VH4A 2QX9A 1G0NA 2OGUA 1M3SA 3R9XB 2J3EA 2O0MA 3P96A 3R8FA 5KSYA 2ECPA 2CNDA 3BQNB 5JADA 5CA1A 1LQTA 2O8VA 3T9DA 3QVGB 1Y9AA 1QORA 4UUQA 5FWAA 1G8MA 3VBEA 3WO0A 4C4PA 2VTVA 4EEZA 1XPOA 3G2JA 3LW7A 1VA5A 1ACJA 1NUTA 2EF1A 2YBDA 3RIGA 4BUCA 2JI8A 2BTEA 3AU8A 1YTLA 4NKRA 2COEA 3IEUA 4HDKA 1T25A 1YDFA 1MBZA 4DJEC 4CIWA 3D6NB 4HDNA 1D9ZA 1JLKA 3ND7A 4JS0A 2ZUFA 3PSHA 4N6GA 3LZDA 5A3VA 4D7AA 1W1UA 2VNHA 3ZC3A 4NPHA 3ROXA 3UWKA 4ENRA 4Z7QB 2H00A 1KK0A 2Z3VA 3TLKA 2RI0A 1KF0A 3ASUA 3KJZA 3T3OA 4Y6SA 4Y9UA 5KC8A 4MVXA 5THKA 3WWCA 4AX4A 3D1VA 1XKQA 4CG2A 1A5ZA 1S0UA 3KKEA 3L02A 2PJDA 2ANCA 1NVVR 1V6CA 1A8QA 4PLPA 3NG1A 2FSUA 1I6KA 5AHWA 4LOIA 1KYZA 1BH2A 2PS1A 1X9HA 3JVVA 2AFRA 5DP1A 3DM9B 1U7XA 3WADA 4TV9A 3WLPA 2VUSA 5IASA 3B6JA 5FUQA 4HVCA 4OU5A 3B1KA 4FGWA 2FWPA 2ASVA 3P26A 4WNYA 4G97A 2WHEA 1E3JA 5BOSB 2IEZA 4BFLA 4H0NA 1YWGO 1IHPA 1JDUA 1VE9A 4H9GA 2J4CA 1N7HA 3IP7A 4C6TA 1L8QA 4J16A 1GKYA 4MITA 4LV5B 2Q49A 4HQKA 1BE0A 1Q3KA 3DNFA 1AKQA 2VRWA 2PGIA 1JSCA 1RHUA 2ZI9A 2YINC 3NV9A 3LUGA 1B14A 3OPYB 4CYMA 4J0FA 1GQRA 1M67A 5TMDA 1QHNA 1HE5A 1AGXA 3D7SA 1IBKB 4FOPA 3ZHZA 3LLVA 1QQBA 3RVPA 4RORA 1O6CA 1Q6ZA 2C9YA 2I67A 3GD5A 3PWSA 2FFJA 3ML1A 4LBWA 2IS2A 4YS6A 1B42A 1RCFA 1EDBA 2PFGA 4ES6A 5FJJA 5BYAA 2REXB 1DSSG 1CR4A 2X0EA 4KQ9A 1QH9A 5ESRA 1I6WA 2P4QA 2QJFA 4LI0A 4ZODA 2W6NA 3MGBA 1GG2A 4LE2A 4ZK2A 1ENYA 5A5EA 4S1VA 3EDYA 4IWYA 5DT2A 3P0FA 2FN4A 2ZYGA 1GTSA 2QG9A 3A70A 2W2NA 3TLZA 5KC9A 5C4IA 4JZYA 2DLCX 2GH1A 3GLHE 3C3WA 1EB8A 3AVQA 1YFLA 1EVQA 4EJ2A 2FZCA 1Y8QB 4FIZA 4BCBA 4RA6B 3N87A 1Z08A 2W2KB 2XE7A 3DL7A 5A02A 1MT0A 1M2NA 2CZCA 1UOPA 5FUBA 4K2AA 1O5OA 2CB9A 3IIJA 2QK4A 3DVSX 2GK3A 3ETJA 4KLNA 4OQMA 4Q19A 4YDRA 4F4JA 5KMGB 2WMOB 3B1FA 4MWSA 5K2OA 4MGEA 1HZZC 4CKWB 3WRYA 1YBMA 2ZT5A 3RUDA 4G81A 1R1DA 4EELA 4UBLA 4WX2B 4JMPA 1WVIA 2XOXA 2QTCA 3VZPA 4TTSA 1CERA 2W6ID 3Q3GE 4Q12A 2QUIA 4ZVVA 3W6PA 3PXDA 2I03A 3LY8A 4FUQA 1E89A 4HPJB 4RK6A 1WDLA 3MJTA 2C5FA 2IVZA 4R8KA 2EKPA 4F2HA 5HQ3B 2P6OA 2P9YA 4AAYA 3CVYA 1U5AA 2Q3LA 1KFJB 4HDNB 1DUIA 4N3BA 5TPZA 3UWMA 2VC2B 2XOKA 3ORFA 3TIVA 1KEWA 3CEJA 3DYBA 4X20B 1PZFA 5DLQC 4JP5A 2JJ8A 1F7VA 4GM1A 3FMOB 3VAAA 2QTVA 3PA8A 5CVCA 3OFNA 5MFZA 2ZAYA 5KHAA 3WGQA 1WP9A 4FHGA 4Q3EA 4BBJA 3KL2A 2WWYA 2XY4A 1BGVA 1KAOA 5ALUA 1CEYA 1C3OA 1CVLA 1OLOA 2EKDA 1AV7A 2OGZA 2W11A 3B8EA 2BP7A 4HQLA 2O23A 1NL3A 4KX3A 4BRWA 2O8DA 2MHCA 1M33A 2IGTA 4FX2A 4MR9B 4BMSA 1M8FA 1NJ5A 2CMGA 1JQDA 4EPTA 2NZ2A 1XEWY 4K3UA 4KR0A 4LRYA 2XUZA 1KBQA 1Y3FE 2IYWA 4IIBA 1QC5B 2PL5A 2FDCA 2FPIB 1AGPA 1SIWA 2HSGA 4TKZA 3P9XA 1ABFA 1ZU4A 2ZS7A 3AFGA 5A7FA 4PC7A 1ELOA 3WK7A 2R1TA 1ZHOA 3IAS6 3N7AA 5DO9A 2VSXA 1KJ9A 4PLTA 4L8YA 5IZCA 3NEYA 3IUBA 5IZCC 4CM8B 1XVIA 4QOFA 5FJIA 3A26A 4F3NA 1P3DA 1B26A 2EKLA 2VDLB 4UBMA 1S3FA 2BMWA 5KQPA 3LDAA 1R4AA 4ASUD 1XVAA 2V3VA 3LGAA 1EAYA 4ZAZA 2C2KA 2HA2A 4M60A 2Z0MA 3L0ZA 2EARA 1XZBA 1QVZA 1O97C 4PGHA 4R7GA 4GG1A 2J87A 3L06A 5FUXA 2WQ6A 2I91A 5LB4A 4QUJA 4YMIA 4G8BA 4YRKA 4EENA 1DCTA 3CWQA 3GROA 1COZA 4M37A 2H1WA 4Q1CA 3G1WA 4PSCA 4DDHA 1DG9A 4OHCA 1G55A 2LIVA 4ZZIA 1Y9ZA 5H81A 5JY1A 2UU9B 3LLMA 4B3MB 3QPVA 5EG5A 5KX5B 5EKDA 3G89A 3ME5A 3RS8A 4XAQA 5IAAA 2HMWA 3Q3EA 3PUIA 1TLFA 3WYDA 5AW1A 5BSUA 4EW6A 4WINA 1KZ6A 3VDQA 4YXWD 5CDSA 3KOWA 4I1YA 1E98A 4KFCA 3MD9A 3WLQA 3NWEA 4Y1RB 1YMUA 3N53A 4J94A 1K7FB 4LPKA 2C57A 1ZRSA 2J6HA 1JDPA 3E4CA 4J29A 4JH0A 4PONA 3WK6A 4AKHA 1TVMA 5IKOA 4TKUB 4NULA 5K0EA 2VATA 3D1JA 4URZR 2AG8A 3UWDA 4B6JA 4HMQA 2OCXA 4N7RA 1OI3A 4XJTA 2V6FA 2X0KA 4PHFA 5AUPB 3Q12A 4LF8B 2XGOA 4I6GA 2HD4A 1N1GA 5TLSA 4NS1A 1GRQA 1Y37A 2BMJA 2XSZD 4YUYA 2QLLA 1QCYA 4DQ0A 3B9PA 4HNHA 1KE1A 2JD1A 3OM8A 3MWJA 3SX4A 4UM8B 4LZJA 1YJ8A 5F4ZA 3RJ9A 5A4FS 1IMOA 4KG7A 1SB8A 2DHRA 1EGHA 3C7TA 1ZVVA 4PXSA 1G5RA 1PX2A 1V48A 2Z8ZA 2ZSFA 4PRZA 4EKYA 2J9FB 4ND1A 2PUAA 4BLQA 2XA2A 4X91A 2P2GA 3LYHA 1XLVA 4XR4A 3MWFA 4REQB 1XZKA 1P29A 3NASA 3TBKA 4DXHA 2JHGA 3AF3A 4AY2A 5KTYA 1CDZA 2P1RA 2F67A 2HIHA 2J7PD 1YRQA 1YZLA 1WABA 1X1RA 4G1MB 4BZQA 2GM4A 1K0UA 1XJWA 4GAEA 3GP5A 5FPPA 3I42A 4S0ZA 3CPJB 5I9BA 2H4XA 1TQ4A 3K5PA 3R3ZA 2Q1WA 5KYXB 3DCNA 4AO7A 4DNPA 4CU2A 3P8ZA 2CJWB 5D1NA 1E4EA 1FTYA 3HKCB 1L5NA 4D9GA 4N3GA 1QPGA 5HK8A 4HYQA 2A92A 3HFJA 1U04A 4HEHA 1IPEA 4EABA 1EJBA 1U9IC 1SCDA 4A0HA 1P1BA 2FWRA 3BTSA 4Y1GA 3LP5A 3GGCA 4DV4B 4UDYX 3DV9A 2WYVA 1U5BA 1V45E 2AVNA 3AJAA 4LCBA 5E1DA 4UJ5A 4KHZA 3H75A 1NOIA 1FQKA 5FORA 2P2LA 2HPHA 1ESEA 1WPRA 3LXMA 2ISQA 2ZSIA 1VMKA 4UEWA 1W4BA 4TRJA 1MT3A 2YMMA 3EXHC 1HTTA 2PTGA 3MTAA 4BNWA 3QP9A 5K6AC 2NUBA 1FDUA 2F4VB 3I09A 5FI3A 2GBIA 5FTWA 1PGJA 4M49A 2ZCVA 5FI0B 3C3AA 5IWCA 4N4AA 4QAQA 3DGEC 4O5AA 3VFDA 2HX1A 3T5TA 3ZE0B 1G291 4U7WA 4F9GA 1V3QE 4C6HA 2OY0A 1YI0A 2IYYA 2WINI 1HLDA 3NHSA 2BTQB 2ZWAA 1E9VA 1A2BA 3LWDA 4JT9A 4Q0MA 1DBWA 1BXRA 4QQNA 5HSGA 1OUMA 1ZW6A 1USVA 2JW5A 1EE9A 5KAMA 4CIYA 1YTUA 3OZBA 2WVHA 2DH5A 3OE1A 2C9MA 5HJ2A 3WBBA 2YQZA 3FBGA 4C7JA 4QFCA 3CNEA 5KKNB 1IXYA 1R88A 4L15A 4EY6A 1ZR4A 1ZP6A 4ZMBA 2IDZA 2QGNA 1EWTA 4L51A 5HJEA 1XK7A 4GOLD 3MK31 3O21A 4NATA 1EWYA 2WJGA 3OX2A 2I54A 2RJ3A 3K8OE 3WYNA 2Z2XA 3K2BA 4OI0A 3CCFA 3T4XA 3AR6A 4ZTBA 1FBNA 4F2GA 3EVGA 4JJ8A 3ZG6A 2ZE8A 4AYWA 3QUTA 4RE5A 2A33A 5BVHB 3OEEA 4PQRA 4ILEA 2ZRCA 2OLEA 4JLMA 2AUMA 1OBFO 1NUSA 4KFRA 2ZYAA 4Y67A 5I9NA 4QULA 2B82A 4GYWA 2G3YA 4Y7DA 1YDGA 4BASA 1R8QA 1OLSA 1Q6YA 1L4BA 1M6VA 2ENWA 3QU5A 3HKDA 4JLBA 1NXWA 1T8PA 3DB1A 4DMFA 1QFZA 3MTBA 1UAYA 1XKTA 3W5JA 2V7VA 1F2DA 1T2EA 3JQ6A 5CPFA 4DGQA 4LF6B 2VH1A 1JLLA 2MR5A 3B5JA 5EIFA 1F6DA 1XD2A 4O4JB 3ED1A 3VAYA 3WB1A 4BYGA 2NQ2C 1LBHA 1PQPA 1E1NA 1N5DA 1Q16A 2GEDA 3CUEF 3PXBA 3QPAA 4R84A 3S8MA 4EJFA 5BMVB 4KXFB 2HCTA 1E9BA 1LPBB 1NV9A 1QG0A 2AOXA 3UFBA 3CSDA 3U6KA 4D8VA 5AI6A 3UN1A 3KJQA 1QGOA 1BA2A 3QELA 2B4YA 3STHA 1MC1A 1SG9A 3JPYA 5E9WA 2IUUA 2EOAA 3JW8A 2AXNA 4JBNA 5FL7D 3U80A 4D45A 4PN3A 4MGYR 4ZQFA 3TSYA 1L8XA 2OM2A 1EBUA 4BN0A 4EB6B 3KKQA 4YCNA 2KE5A 2FJ0A 3L0DA 4NV1A 2QMOA 4QBGB 2IZ1A 3FSGA 3W6ZA 3HCOA 4MTLA 5LDDC 2CZQA 2R7KA 4HQFA 4D6PA 2L69A 1OH8A 3E9QA 2QF7A 3FUTA 4HQ0A 1WPGA 3RUAA 4CT5A 1L7RA 1WF3A 4I4CA 2W2LA 2W6JA 1XL1A 1ZVKA 1PUJA 2BGUA 1H1LB 3QELB 1GFIA 1TC1A 1VGQA 2BUAA 2QRLA 3ITDA 4NZOA 4Z0PA 3RIMA 3ZWKA 4ZZ1A 3U16A 1I4OA 2DQYA 5DTRA 2V74B 3MCVA 2JFPA 5LYJA 5TC4A 4B0OA 2GPJA 2RHDA 4D4GA 2JFBA 3FZYA 2W2MA 3HVHA 4G09A 3N2KA 4L50A 1PFUA 4AKEA 5ALWA 3L82B 5CFPA 2L82A 4LVUA 2QMYA 3D4PA 4RJLA 3EVTA 4PAOA 3ZE9A 1LV8A 4BP1A 2FAXA 3BHNA 1YU9A 2H07A 3F96A 2XVMA 4LZPA 1SOWA 4BP8A 1H8HA 3GN1A 4L72A 4ALMA 2RE8A 3RUHA 1JALA 2FCAA 3AI3A 2M6KA 5C8ZA 4CKCB 1DAOA 2YWHA 4GLBA 1Y8CA 1DT5A 1I24A 1E2IA 1YOVA 5JFGA 5KYTA 1YVDA 5ARDA 4X8MA 2JAOA 3OFKA 3OOSA 1XTBA 2YQ5A 1I36A 1R5BA 4OQLA 1XQVA 2FMHA 4J07A 1AA9A 1ULBA 2TS1A 2QYHA 1O95A 3P9ZA 2O7RA 1AUVA 4AKSA 4BFYA 3TS1A 3BUSA 2A3NA 5B2FA 5INTA 2CNOA 1FVXA 3O1IC 3QXGA 3ADBA 1EP9A 3H5RA 3R77A 1N78A 3RTCA 2GERA 3H6GA 1HY3A 3VYSB 1Q0HA 4GKVA 4DREA 2GD0A 3PWKA 3EIFA 4B6QA 4ZYXA 3TM5A 4EYEA 1R0LA 5DM70 1X7ZB 4CM7A 2JFNA 1M66A 2QLMA 4JJEA 4TSFD 4WN3A 2ACWA 1AQLA 4ZVQA 2H4JA 4CFYA 1JILA 4XWYA 5DASA 3L6UA 5F51A 3PFGA 2HW8A 5EUBA 4TLMB 2I3ZA 4Q1AA 7MHTA 2L19A 4KAFA 2ZB3A 1J23A 3L4BA 4X71A 1TO1E 2PZFA 2MMGA 4G9BA 3QEAZ 1E61A 3I4FA 1CIJA 5BN4A 2OTCA 4DEYA 5EE5B 4U7FA 5ALPA 3K20A 1UKEA 1MO6A 2IIVA 3RSOA 3CRQA 1NMZA 2JLQA 4LRXA 3SFTA 4UTPA 5KTNA 1UXIA 3HU1A 3LX6A 2CDBA 4I5DA 2PQ2A 5GGYA 4F4UA 1FYVA 5DYTA 1ZG3A 4HUQB 3AL2A 1I32A 4WXRA 5C8DA 2QTFA 4Y1EA 2XUHA 4K6KA 4L8GA 2NO0A 1L9KA 4TLBA 3TRFA 2JLZA 4O3MA 1F0YA 2VHTA 1YDEA 2RHJA 3TTWA 1XNQB 3HCPA 2IZZA 3UXEA 3ZLJA 4KBFA 4Y9TA 5IJZA 1O4VA 2GZHA 4DV2B 1E1RA 1JJFA 1ZZEA 3Q8MA 1N0IA 4CR7A 1S2MA 2OWEA 3H0EA 3I92A 1BKSB 2VPXA 1HG1A 1QV9A 2DCMA 4XDGA 2H8KA 4JT8A 1UBGA 2ZUWA 4YAEA 1TKCA 2IOFK 2WE7A 3O4IA 2SCUB 3X3HA 3ZNOA 2CFTA 1UBKS 1UMDA 2PH1A 3KJNA 4ESHA 3QKTA 1VLVA 4LBVA 4QATA 2GKSA 4FILA 1S6YA 1U0OC 2PSEA 4G5FA 4E5YA 4BECA 3S40A 2PAAA 3D4NA 5IUNC 1BMDA 4P81A 4NEQA 1PIWA 4IDGA 2A1TS 5IDWA 3DONA 4JI3B 1P5RA 2QM0A 3KPJA 1JVBA 2H1VA 3OZCA 1SZCA 4YP6A 1RFGE 3RAGA 2FRDA 4J0GA 4FLMA 1WOYA 1K88A 1OAOC 3DBRB 2EKQA 1Z4KA 1GKUB 3K0KA 5ED0A 4S0XA 2HEGA 1ETUA 1R6XA 1JL3A 3MF4A 4C2TA 2B78A 4DBZA 3HYSA 4TL8A 5LBIA 4PN7A 4UTNA 2J4FA 2Z6VA 4XQ9A 2VQEB 3FHJA 1EGVB 1I0ZA 1N2JA 5G4LA 4NXNB 4KVGA 1RJDA 5FNVB 3NC4A 2CXOA 3A2MA 3EGWA 1O6GA 3OO1A 1VZ3A 2QD1A 4YRAA 3OC0A 5LNK6 1TW3A 1PT8A 3P9SA 3QF4A 2ZR9A 3HL4A 4ZV9A 3OJFA 4FDVA 1AT1A 1VRWA 1OX4B 2IYRA 5J5VA 3SBXA 4V0SA 2EWMA 3L01A 2VNAA 2Q45A 4WLEA 3A3NA 4D4IA 5CDYA 4BNFA 4I4TA 1MU0A 1Z6QA 3QITA 4G4SO 1F20A 4TQUS 3O1JC 4UE3S 3UC9A 3PQDA 4DSUA 5ITSA 5L3SB 1CDDA 5FO1A 3CXUA 4BMYA 2OAQ1 3I28A 3ZJ5A 3RJZA 3G0OA 5M04A 2J5KA 3A4MA 5CT9A 2AOVA 4FNGA 1RMQA 2B94A 1LPMA 1IJEA 1LLDA 3C5VA 3JVUA 5SYAA 2HQSA 1M1NA 1CUIA 4QHSA 2EU8A 4JC4A 2AHOA 3HXTA 4L6AA 4KZKA 2ZRMA 4DCGA 4A2QA 4I1SA 4I2NA 4XH9B 2OCIA 4FJ2A 3H9JA 1U3CA 1BIFA 4G5QA 4R1TA 4YO7A 1O0SA 1Q3TA 2QJTA 4MVJH 4W7IA 4ALLA 3NDPA 8ATCA 4R1OA 3LTNC 1FRQA 4KRXA 5E9AA 1RKQA 1P3Y1 1Y3AA 2X7HA 2RCNA 1YE8A 1M83A 3C70A 3G8DA 1H05A 1Z28A 3O8QA 4L5JA 3HM9A 2PBRA 2R8EA 2AFHB 2IPAB 5AVXA 2E5FA 2FE1A 4TMYA 5AHRA 1V37A 2IZ0A 2ZIXB 3Q5GA 3FPHA 3WE7A 3X43A 2DMRA 3COSA 1FFGA 1QFMA 2HO5A 1N6RA 3Q9UA 5ITZB 3QRWA 5FNVF 2EBUA 2ID4A 2JBAB 7GPBA 4COOA 2ORED 2H1LA 3QWHA 3PFIA 5SZKB 5HCUA 3U7GA 1FCJA 2YY6A 1LNQA 1WHTA 5E2BA 2BGRA 3V1TC 3HBMA 3E7XA 1RP7A 1VFNA 2VAVA 4KN6A 4GI5A 3L8GA 4MR9A 2GAIA 3JQBA 2VEOA 3E1SA 2Q0XA 1VSBA 2WU0A 1GGFA 1JU4A 4PZPA 4Q9LA 1KMCA 1JG1A 3ESCA 1BJRE 1TMYA 1CKEA 1OX6A 4MQFB 2ZJ0A 1M1UA 3ONFA 3BWMA 3MD0A 4JUBA 4RGBA 5K3SA 3X2FA 1B8OA 1FE8A 1GJRA 2UVQA 1M0WA 3PK0A 3V00A 4TZTA 5K4HA 2G25A 2NO7A 4TUYB 3RJ5A 3TLCA 4AUNA 4BNYA 4DLWA 3K6SB 3C6BA 1E69A 2ODBA 2ATCA 3D3NA 3HCBA 4YCBA 3UO8B 2WF6A 2B0CA 3W3AA 4CF3A 1A9TA 1LI7A 2Z9DA 3MWEB 2W6OA 1RM4A 3AY7A 1WDMA 4R4JA 1RKBA 5DYWA 4WCDA 3DYVA 1PJZA 3JQGB 1T10A 2DQSA 4P7GA 3D3KA 4KLZA 4B44A 5AKEA 4DQVA 1E2PA 1CY2A 1NF8A 2XI4A 2FN9A 4GMHA 3RRBA 3IV6A 4FZJA 3VZQA 4JSRA 2WVAA 1MO5A 5JUWA 1U6JA 4WOCA 2NUTB 3IPYA 4BE7B 3WS7A 4UU1A 3FVVA 4YJFB 1A8PA 1TCUA 3S1AA 1SZPA 1X74A 1I5OA 2CJPA 5JJLA 2CC2A 3L6CA 4A6DA 2ROQA 3WA6A 3ZGNA 1CY8A 1Z0DA 2MMCA 1PF7E 4XUDA 1RRGA 4H15A 4TSFA 1QG4A 3HYCA 3RYHB 1WSAA 1NFRA 3FOBA 1D4OA 4Z49A 3F67A 4MUIA 3M1AA 4EX7A 1P4JA 2WWGA 3T9FA 4A2PA 5JISA 3L0YA 3N7TA 1KQGA 1QDEA 4NBUA 3EA0A 4K6HA 2O5VA 1YC5A 2ZXEA 3QXSA 5HPYB 1U5CA 4MP8A 3O8QB 1LF5A 3V1KA 3BMCA 1GAWA 4EY8A 4GZ5A 4CL8A 1RR6A 2ISSD 1Z5GA 2YYSA 4RPLA 4XD7A 4Y2VA 5L8VA 4D3FA 4B3FX 4W5WA 2I9KA 4B3JA 4HWKA 4RVHA 4EMTA 2CY0A 4FBLA 3EOZA 1RWQA 4LFCB 1N8SA 1PZEA 5F3DA 4FEYA 4A73A 3AETA 5BSGA 4CCWA 3CZAA 4JKOA 5HM6A 1R64A 3RU9A 2JAQA 1RXYA 1R9NA 3L5KA 3TQCA 3C85A 4BFTA 1Q1BA 3G3EA 5EWJA 3X1JA 1E7YA 3TLGB 3LS2A 3IVXA 3FYSA 3GELA 3VPHA 4DLTA 3CLRD 4L5YA 3SEQA 3IOEA 1DKPA 3FCUB 4H7JA 3IRUA 2HMYB 2VIIA 5CGQB 2OK8A 5EP1A 5B3JA 3S68A 4NZZA 1YJAA 5JS8A 3ZI7A 4RZHA 2QPLA 1SG6A 3BL8A 3LPAA 3MWEA 1UWLA 3LVBA 3P45A 5H9WA 3AG5A 5DK6A 1RPJA 1KNQA 1TYCA 3E22B 3MB5A 4JV5B 1GU0A 1ULHA 1TW2A 4Q4HA 1VP9A 3EDOA 3MWDA 5FTJA 1ADBA 1YACA 2X9QA 4ER7A 3PGLA 1JBKA 2Q5JA 3VR5H 4EGCB 1T6XA 1AXRA 4IQFA 4V2UA 3PKIA 3A2NA 3RJMA 2OZKA 4CMJA 4GWKA 2KBFA 2FHPA 4B75A 4OX9Y 1E2EA 4MV4A 2HBYA 3QI2A 1N9ZA 2H8GA 4D9MA 1XDDA 2RJOA 1FXSA 4KFSA 3W5BA 4AVYA 4AC9A 1PV1A 2M1ZA 1YV9A 2W4MA 2GHQA 5FRDA 5AUNB 3F4LA 3H1PA 4DL9A 4HEQA 2CB0A 5EHXA 4Z51A 4BCCA 1WMBA 2R86A 1WCIB 1XDUA 1PV4A 1AO3A 2VHYA 2FMTA 3N2ZB 3SZGA 2HIGA 4Z0TA 1AF7A 1E9DA 4ZP1A 4IJVA 1FFXA 5KBYA 1K66A 3BXPA 5KHOC 5AJUA 1Z82A 1UADA 1B0AA 4P4LA 1DKQA 4UM7A 3EY4A 5KNBD 1T5IA 4FXOA 3ZJUA 1X7DA 4H35A 2ZQYA 5B4TA 1JI0A 1SK9A 4BEWA 3ZWCA 4DJ5X 2ZUUA 3IQGX 5FHRA 1EUZA 3CRW1 3VH1A 2WSSD 3ILVA 3GWGA 2CK3A 5CURA 5F1YA 5KNCH 2VYVA 4HS9A 3FJYA 1PLLA 1CUWA 2R8OA 1XTVA 4X3CA 1QHXA 3OQJA 1H2XA 2E9SA 4GS5A 3DTTA 3WGIA 5I9LA 1YJXA 3SQDA 1Y89A 1BFDA 3E3LA 4MDYA 1Y8RA 1GAQA 4Y6RA 3RTAA 4LHZA 3O4RA 1RKXA 4UDOA 3AEUA 2KHZA 3K5HA 5E8JA 3RVBA 2Q3DA 1OROA 2Y2UA 3TAUA 1E1CA 4QPNA 3G2MA 4NOKA 3RAPR 1ES9A 3DT6A 3DVQX 1OVMA 4IG4A 2GZ2A 3RUIA 4WDRA 2JAUA 3MEQA 3PLRA 5KVSA 4RMNA 2XUAA 5T4BA 2JA1A 3U9TA 4YCLA 1SUCA 4GKAA 1XWIA 1NU8A 3VDNB 1JQ3A 4LVOA 1ZMXA 2CEAA 3CGWA 1SUAA 3NYWA 3T61A 2GXUA 2IDKA 1G9TA 1D8AA 1ZN7A 1KVQA 3ZWXA 2J0QA 1XHFA 1GPAA 3OM1A 1Q2XA 3M4YA 1CB7A 3C5HA 1NP3A 3FFTA 1NBEA 4KAXA 1VBFA 1SRQA 1W5FA 3L9WA 1TFRA 4AU1A 5CH3A 4B1FA 1DRVA 3TFWA 3MC1A 3TOXA 2B1GA 3M0EA 3TNYA 1M9NA 1H0HA 3M3PA 2OYRA 1JEAA 4OFWA 4BPRA 1YDMA 3SC4A 4CV1A 2C4WA 2JAPA 4LV6A 2YMQA 1E2UA 5IAGA 2YRXA 5SV2A 2NU8A 2ORVA 3K96A 4FP9A 5HIMA 5LZ5A 3KKOA 4BTEA 4GPD1 2J3KA 2XKJE 3DLPX 4TWIA 5JSKA 5ELMA 4UFPA 5IBQA 3LFHA 3WYBA 1PW7A 4ZU3A 1DOAA 3PA6A 3QTLA 3KWLA 4O5OA 3P2IA 5E6RA 4BTVA 4PYRA 2P1DA 4RBNA 5JNTA 4Q7QA 3DZFA 3DFFA 3KXKA 1NVVQ 1SXGA 1RJWA 1X8JA 4HDMA 4IGFA 5CBPB 1US8A 1WP4A 3RYFB 3HJHA 1HNZB 2IEYA 5EKSA 3EZYA 1O8BA 1MDFA 2WIFA 1TEXA 4DM4A 4HQNA 3RE1A 2PUBA 1YB1A 4NLLA 3TUJC 4ERXA 4R1UA 1KXZA 3UH1A 2X41A 1R9MA 1NG1A 3D6AA 4YRZA 2OAGA 4XSGA 3L1JA 2W22A 2BZ1A 4OYHA 1XEXA 4B85A 2BEVB 2C98A 3DWEX 4C4XA 1M0SA 5B36A 2GKGA 3L07A 1A88A 4Y98A 4JBWA 3KQOA 4MGHA 1GRRA 3HJUA 1IAVA 4YUVA 2QENA 2I9PA 2OQVA 1U3GA 5JAUA 3JATA 4RD6A 1T2VA 3O26A 3KJHA 5EIEA 4ZEOA 1YONA 4FJ0A 3G9TA 3WB9A 3I72A 1N6HA 2OM6A 2YCLA 4DQDA 1CJTC 4W5JA 4GE3A 1HK7A 3W5VA 2FOLA 4LHYA 4ZVTA 1X0VA 2HRCA 1ENPA 3A9RA 3SQXA 4QU9A 2WFLA 2HTEA 2DSTA 2ALJA 3R4VA 4G5OA 1EZ4A 4BRUA 2NMVA 4IWNA 3EE6A 4BX9A 4WUVA 2D1FA 4Z54A 2Y92A 5A5GA 1SKYB 2LDBA 1L5RA 2P9BA 4A91A 2ZYUX 4G84A 3KCQA 3WKCA 4U8HA 5G2OA 1PRYA 2CVQA 3RTBA 1QGZA 4XYMA 3ZWDA 1HTBA 1A7AA 1OLUA 1I13A 3RARA 5AW3A 5CAEA 1YCHA 2ZOSA 4ZHQA 1XRPA 1PZXA 1YR3A 2PM8A 2QROA 2HA0A 3MBKA 3FWHA 3UJHA 1JWAB 2IKQA 1H2HA 2Z6QA 4CQMA 4Q39A 4LYYA 4RYDA 1YRAA 1GYPA 1P5JA 1V16B 2JFVA 2X4DA 4A8JB 4GR5A 1MVNA 3BC1A 4IMIB 2WEKA 1O7JA 3ZV5A 1M2HA 3B7PA 4RDXA 1Y6GA 1PJCA 4KE7A 1QWSA 1N5LA 3AONB 5H5JA 1PNOA 3H6KA 2VHCA 3KR1A 4H18A 2EZ9A 4E2FA 4KQ6A 2EQBA 2G0TA 2XEDA 3BORA 1NBAA 3KZOA 4YJHA 2XOEA 4ZXFA 3RV4A 4DQKA 1QTNA 1TAQA 3RFXA 4A03A 1KAEA 4X7PA 1N5OX 4M9RA 2DUJA 4C0LA 1JDBB 3B60A 2EC5A 3BMNA 1QAQA 3A6HA 2JGMA 3K70B 5BN5A 1USUA 4CM9D 2OVBA 3IDFA 3BKWA 2FZ5A 1USIA 2H4WA 5HGJA 5P8WA 1FS4A 5DJ5A 4B3SB 4MZDA 3AQ4A 4EDFA 1LK0A 1U80A 2SCUA 6GPBA 4LMRA 4RV4A 3PP8A 3BWXA 4C08A 2JHCA 4Y2SA 5EP2A 1S2NA 3V6LA 1Z4OA 3BJRA 3G82C 4W7SA 1UKZA 1LC3A 4LMBA 2JJ1D 2QVGA 4AWAA 4GL2A 2PX3A 2I80A 1O9HA 2P9JA 5BR4A 1VBNA 5BWCA 1R8YA 3FUUA 3ACBA 2D62A 2O7SA 4LXYA 4DS3A 1CR1A 4E30A 4IRUB 4U8GA 4OM7A 1UP7A 4G41A 1A98A 7REQA 3LPLA 2I2XB 4LHEA 1PR0A 4M99A 4EQ6B 2H7VA 5NULA 3BFVA 2X9LA 4JWTA 4UVDA 2Q7OE 1K68A 2FF7A 3AR3A 3IE0A 4MWOA 4WADA 2Z6UA 2FEWB 2IEBA 4JLJA 4N01A 1VJ1A 1UOQA 1CDEA 4JLSA 1U9IA 3VSAA 1DNPA 4W7HA 4BV9A 4YI5A 3RS5A 4YCCA 4NFYA 5KNDD 5KNBA 1OBOA 4JEHA 1JG6A 3L1UA 2HQOA 3FPJA 4PC2A 3BT7A 1S9HA 2QMZA 4M8SA 2SKCA 3IBCA 2XOKD 4L4UA 3T7CA 3GW8A 4HDQB 521PA 2JEOA 2HA7A 3HCRA 3R8XA 4HN9A 2OHVA 3TLBA 4OHOA 2QZPA 1JTVA 3FMFA 3L0SA 4WVLA 2GPNA 2DPMA 3ABIA 4QELA 5AK3A 1J90A 2LD4A 2YZMA 2NO9A 3R0QA 5FA6A 10MHA 4MRAA 3OIWA 4DV5B 3IIMA 2J9RA 1KZ1A 3AJDA 4C5CA 3QE2A 2WPNA 5KNDH 5FTMA 3OZSA 2M9MA 1II0A 3BCHA 3LK6A 2QN1A 2B6HA 2XUKA 4ROSA 5JCZA 4URVR 4KIUA 3CJTA 4Z9XA 2RKBA 1VTKA 1OH5A 1AKUA 4L9SA 4FB4A 5COAA 1CWUA 2RGRA 3Q7TA 4FDAA 4JBXA 2C7GA 5LM3A 4L9WA 1JVSA 4W1RA 3VNQA 4DXDA 2HJ9A 3NHMA 3DBRA 3GFPA 1OLUB 2EDCA 2GOYA 3S29A 1GIAA 4AY3A 2IXEA 2WJJA 1IWPB 1XTQA 1WD7A 5CEEA 5HUHA 4XXHA 5I9TA 1KQFA 1K5HA 2OT3B 2W8ZA 4EY3A 1Q44A 3QVJA 4ZREA 4A0SA 1F4PA 4HEJA 3RSHA 1IUKA 5JSQA 4XFDA 2Q7DA 2TSYB 3WI7A 3D3EA 4AS3A 3KUUA 3HXPA 2ZIFA 2BKLA 1KDRA 2C9DA 3ZKAA 1HNWB 4K6FA 4C89A 3H1AA 4QNNA 4REOA 1ST2A 4MA0A 3U56A 3DEIA 1MTZA 1T2UA 2X2OA 4KYTA 5CUQA 3GJ7A 3GX1A 3HB9A 3LRPA 4YJ3B 1SUFA 1ZI6A 4QTXA 4CCSA 3Q6MA 3ASVA 3FPBA 4RJIA 3BWDD 2CZGA 2JGAA 2X0DA 3KPVA 4FJ1A 2OSVA 2RK3A 3KV1A 1PR1A 4J3FA 3ZTYA 4RPKA 1NA5A 3VNRA 2FSIA 5KX5A 3IAUA 3W8FA 1N36B 1YS4A 2UZIR 3S2FA 3TQFA 4QRIA 1DRKA 2ZUDA 1T2NA 2IF0A 1AK2A 1AK1A 3HV0A 2HL6A 4HG2A 5EJ9A 2IDMA 4HDSA 2P67A 3BZWA 3NBYC 3G8AA 4Z5XA 4YLEA 5KPDA 5HTOA 2DT8A 3ROMA 1KERA 3AZPA 3IXMA 2BHSA 1P0CA 4MIKA 5BUQA 2D0PB 3THRA 2CHEA 5BN5B 2QW0X 4HVLA 4KPFC 3G8BA 4C4SA 2HRDA 4I9HA 2HMVA 4URYR 2BONA 2YVQA 4JJAA 3V7YA 4ARCA 2V03A 1N7JA 4DCUA 1Q0SA 1HDOA 1Z4NA 3PC3A 3W90A 4ARZB 5I4CA 3AVYA 1WUJS 3I12A 4J1QA 4R2IA 1Y3HA 1I33A 3F90A 4Z4CA 4ZK6A 3I6MA 2QY9A 4DANA 1NN1A 5IDYA 2WOJA 2VAXA 3LGXA 2ZI6A 2ZJ5A 5DGXA 2JCBA 1ZBDA 2BN4A 3DCYA 3I58A 3HCCA 1JQ5A 3OE7D 1MEEA 2QPTA 2WE8A 2YS7A 4EGAA 2J31A 3KRTA 1JZSA 4TWBA 4M0CA 4NG4A 2VL7A 1JI3A 2OHFA 5TRTA 4YB8A 4BX0A 1MB9A 1J0EA 4YRBA 1H3EA 1V5EA 4TT3A 5K0LA 4X66B 2AG6A 1CR0A 4AMGA 2ZWPA 4QDUA 4EBBA 1NVKA 4WY8A 3P9NA 2GZRA 1HORA 2MYTA 4UARA 5KSWB 4EFKA 5K0FA 2Y71A 4JP3A 3I0NA 1WCWA 1VECA 1Z36A 1XLTA 2I8AA 3HFRA 4K0RA 1HH4A 2CBZA 4PCVA 4F56A 3SHTA 4O0MA 5H83A 4HNQA 4KXLA 5F21A 5BO5A 1J0AA 2MU1A 4UHBA 1XDSA 5A5FA 2GN2A 2FSVC 3BD7A 3G9XA 4LE1A 4Q16A 2FV8A 3DDUA 4WJZA 4P2GA 3OOWA 2WDZA 5AXDA 1G2IA 1YA8A 2H17A 2JANA 3ZLUA 1OXXK 1NXOA 2C00A 3BGDA 4HXFB 4JR0A 2YHSA 4G0UA 1RI3A 1H3FA 2DFDA 1YB5A 4WZAE 3IMCA 4DR1B 1XZGA 4B40A 2VYFA 4HK4A 4MWBA 1FVHA 4PYMA 1A77A 5ALDA 5KNCD 5D3KA 2AN1A 2K7FA 1F8UA 1G3UA 5AHXA 3V9PA 1WAMA 3G0IA 1T3LA 1RXEA 4XPZA 5EMNA 2WNHA 4Z7OB 3H5IA 5ERYA 2GDZA 1U11A 1PZMA 2E82A 1TJNA 2A4KA 4Q4JA 1RRVA 2ERYA 3AUYA 4I36A 4INAA 4GWGA 4N0DA 4G36A 2GCOB 1N2BA 3NNNA 1HLFA 1P1HA 2PMBA 4ZAWA 4WUTA 5IG2A 2DSNA 2Z4TA 2A1UA 3M89A 4J2HA 4KWTA 5DNUA 4UZFA 1U2EA 1VG9B 4E03A 4G07A 2GSDA 2I4NA 1KJWA 2NQTA 3C6QA 3TQTA 2NACA 2WDPA 3ZVNA 1LB1B 3P0JA 4I9GA 3KT6A 4LZAA 4MA4A 1BE8A 4OY3A 2XCRB 2QTLA 3FR8A 1FXWA 1T9AA 4MW6A 2A5LA 4OHKA 1RC1A 5DI3B 3UNXA 3KZVA 3L92A 1D0SA 2FUG6 3OAAA 4JU8A 5E1OA 5K7SA 3U60B 1QRUA 4HATA 4PZUA 2AT1A 3P4UA 2WVGA 4TTVA 4UPEA 3RSQA 4XB1A 4QOIA 5ERGB 4YRGA 4KYIB 1XZDA 4QBTA 3CH4B 1V16A 1RYBA 3A1EA 3SQNA 3L0BA 1P2DA 1DIHA 3I5XA 4XUGB 4DIDA 2E49A 5AW4A 4GLLA 3IUPA 3I5AA 2HSDA 1Y82A 4ZOLB 1T0HB 2RI1A 2CDRA 1B0ZA 3K32A 3PXUA 4JA2A 4RF5A 3RG2A 2AV6A 4UBIA 3PCXA 4XTCS 3RS4A 1NW9B 1WXGA 1LDNA 3D0OA 3MT9A 4CG3A 1UZLA 4P7BA 1XZPA 5DNAA 1CPYA 5T4EA 3BDIA 2BEUB 1QRRA 3P94A 4PPGA 4LRSB 3V7UA 4CW7A 1Y7PA 3GGSA 4RZSA 1TA9A 1UP4A 4AS1A 2DWQA 1JFFA 3TB6A 5K09A 2ZJAA 1DI0A 3ENNA 1NKTA 1TJ3A 3FWNA 2WUGA 5BSEA 4V0KA 3RR2A 1AQ6A 2A86A 1H93A 3O7MA 7MDHA 3FDIA 1GT91 5AW6A 1I0LA 3HLTA 1E2DA 1E2NA 2GESA 3JWJA 2RGGA 4L3WA 3HEAA 4U7PB 4YRMA 3EEOA 5IKPA 1P75A 1KO8A 1GRCA 1Z63A 4K28A 1VJRA 4PHTA 3U4MA 2V3WA 4WPGA 4WACA 5AI4A 1C0EA 2MR6A 4F84A 3FYCA 1KEVA 1XSEA 3QXCA 3ESZA 1NVEA 1T26A 3GNTA 4Q7MB 4PX9A 3V4SA 3U4QA 2PZMA 1KZ9A 2CMDA 3UAWA 3HO1A 2PBFA 1LI5A 2R4QA 1RWXA 1WMSA 2WHRA 3IHKA 2GHIA 3PC8A 4RJJA 4DQXA 3HJCA 1BDHA 5IJ9B 3QENA 5CT4A 5AO9A 4N54A 5AWFC 4F8YA 4H3SA 3ROEA 1AGYA 2ZJ8A 1APBA 3BXOA 1F2UA 2ZXFA 4OGKA 1QIMA 5J59A 2BUBA 4TLEA 3B6KA 4U2CA 1LD3A 4OHZA 5LXTB 3FTFA 2GN8A 1MPTA 2LNDA 4C0WA 5DV9A 1U8CB 3E18A 5KTTA 4B45A 3BVPA 4NG5A 3NOQA 3VI3B 1WIWA 1ZWLA 1C9MA 2HIAA 2HQBA 3LK7A 3RS7A 1G1AA 3KDSE 4Q9JA 2OBFA 4KX5A 2VP6A 3FF1A 3LLUA 1ONNA 4L02A 4QC2A 4B0PA 2VP4A 5HJ7A 3U81A 1YRBA 4YRDA 2P6NA 5DWVA 2GXSA 4O02B 3FKSD 4UEOA 3BIFA 4PGGA 2XMZA 4OYLA 2CLFB 4M8IA 4Y9RA 3AM5A 4CM1A 4DQLA 2BELA 5EJMA 4C1NA 4WNIA 2ET6A 4YJ2F 4ZOBA 3N2GB 4N0PA 1ZMBA 1U65A 4UQPA 3LL7A 2CVHA 5AVWA 2V3CC 1ZONA 3KTFA 1QGDA 1MRNA 1ATZA 2CKMA 3DS8A 3G9QA 2OV2A 5SY6A 3U4GA 4EK9A 4HUTA 3BERA 2GJAA 5BQ3A 1C1DB 3TAHA 2Q1XA 1D6NA 1Q0QA 4F71A 1YGYA 3H99A 3NOXA 1CRQA 1DO2A 4YN3A 3ZUGA 2I4RA 2PPVA 3ZXSA 2ZLBA 3UJCA 2G76A 3L6BA 1H0RA 2I7DA 4I3FA 2DPLA 4HYTA 1OLXB 1LFAA 2YBEA 3LSYA 4LBZA 2Y27A 1J0CA 2C84A 4TTAA 2V4MA 4A6XA 2RK4A 3WLHA 1QM5A 1KEUA 4OXRA 3UCXA 5AW0A 3H1BA 4RK5A 1H2BA 3GFSA 3KPUA 4J90A 4MKXA 4XQCA 5M29A 1YS1X 2R7MA 3WGVA 3KB2A 4LYEA 5IF9A 3U7FB 3JPWA 3CZPA 3FOFC 2ZZNA 1GQFA 2VZEA 3U31A 5IVPA 1NJSA 4KOAA 4YT2A 2PD4A 5LLSA 1OFUA 2OBLA 1MJ5A 3JQBC 1KI9A 1M0TA 1TQ2A 1OYWA 4HLUC 4IS3A 2Y67A 3U3DA 2YHUA 3AKYA 3NM4A 4A4DA 1X14A 1QQTA 2NSLA 4U2GA 1WKBA 4IIXA 3COPA 2X8AA 2IP4A 2CJYA 2Y1EA 3EZ9A 4A0GA 3LDHA 2NZYA 4JLKA 1ZUWA 4TXNA 2JHPA 1P6UA 1Z0IA 2AFIA 2WJ6A 3PQ8A 3VKGA 2WTBA 4H2DA 4AROA 4RA6A 4MPPA 3AXSA 5CT6A 1NVXQ 2HH9A 2PT9A 1A1SA 1TM2A 4JSTA 2F62A 1PWHA 3K8QA 3H6HA 4RC9A 3TFOA 1BW9B 4J2TA 1D1PA 2PL1A 2Z9CA 3GY0A 1IC6A 3VR6A 3FZNA 4WZAB 3L40A 3VDMA 5DWDA 1DADA 3WKBA 1DC3A 5KYVA 4EZIA 1R16A 1X7XB 3BK7A 5FFMA 3ZGVA 3FGPA 4YWJA 1ZAKA 2G1AA 1CHDA 5JSZB 4DA4A 2BSQA 4LC0A 2C5EA 1J1IA 4U6QA 4JJGA 2C2OA 3JQDA 4JN6B 4RJ2A 2VK1A 4MRSA 3FTQA 2ZJ4A 4NMHA 2DKNA 3M4XA 2P3QA 2R1TB 1UKCA 1T1SA 2NM0A 4P1ZA 5JE8A 1KTIA 5A0VA 2A5GA 3HE3A 1RVV1 2HBRA 4DWJA 5AKHA 3SFZA 3I83A 3VTFA 1AOXA 1ZL2A 4RL4A 4YRNA 3HXQA 3L7BA 1GO2A 2C8LA 4JHLA 2GCIA 1M7HA 5G1PA 1P45A 2IYAA 1Y6ZA 2PUHA 1VG0B 3FHTA 3MT0A 1U0HC 1TT5B 3QPBA 3GLVA 4MQ5A 3ZWAA 2PIDA 2JIOA 4QX6A 4GPBA 3FJ1A 4IJQA 4F3KA 3LUHA 1K8YB 3D6UA 3UHPA 1GNTA 1UZNA 4KIJA 1IIBA 2HMSA 3SHVA 4E5SA 2MSEB 4BNKA 4YCDA 3M2TA 5FQOA 5JV5A 3NHFA 1AO0A 2X6TA 1XQ9A 4GP6A 4DOMA 1KPGA 1JW9B 1RWWA 1YB6A 1MIOA 4P7KA 2E48A 4MI6A 4OX9B 1FDWA 1RXCA 2QLJA 3FRJA 4KAJA 4K40A 4R41A 3KXPA 5D84A 2ODPA 3PUZA 4MKGA 1MPXA 4NJEB 4LEIA 4AX8A 4QOEA 4KIFA 3KYBA 1RPTA 1LX7A 5SZJA 3KYCA 3WYFA 2J6IA 4W9NC 1DARA 4U63A 2MYUA 2Q8QA 3DV0B 5A3SA 2N46A 4RM3A 1K6XA 5BNIA 1U3UA 2SECE 3AEQA 4O4LF 1QTIA 3NIDB 5F35A 1R0XA 4EUSA 1GA1A 2JJ2A 5NLLA 1KKMA 1HE2A 4YQYA 2RJNA 1AQUA 2IOFA 5FPQA 1SBTA 3RTGA 1DKRA 4CDRA 4Q7KA 1DC5A 1ND5A 2QS9A 4R0NA 1K8ZB 1KYXA 3ELUA 4YECA 4UM5A 2AVDA 1BOOA 3E70C 4DWWA 3C8UA 3LJKA 4X7BA 3WHLA 2VJPA 5HOEA 3U3XA 4YJ2A 1N8NA 3IPLA 2P35A 3DLBA 2O8BA 4MW2A 3CPHA 1XZJA 5JXHA 4Q6BA 1D09A 3O1HB 2LPMA 1MMFB 4MCJA 4WOJA 2C88A 1SXJC 2QMQA 3PC8C 1J2UA 2XUGA 2IPXA 2WYHA 4OQZA 4ZCPA 1XC7A 2JIZA 3MGKA 1AGRA 1VG8A 2HNBA 1KP2A 1UJBA 3DEAA 2O2SA 5A62A 3HDVA 1VE1A 3ZIAA 1RMYA 1ZIYA 1Q0UA 3B6IA 3EXIA 4OQEA 1EM8A 4DIBA 2RH8A 4ZC1A 3TFQA 5B3LA 2GUWA 1NHGA 3AUFA 4LTNA 3V7FA 1N2CB 3DBLB 1MDBA 3SKVA 4B09A 1AUOA 1Z16A 4BTLA 5IRCD 1PFGA 1SKBA 2ZUTA 4TLAA 3PIIA 4D9KA 1FW6A 3QVUA 4Q4JB 1JHYA 3VDRA 1ZICA 4LAFA 3X1YA 3GRCA 3KG2A 1FNBA 2OXEA 5F7JA 4DR4B 4BO8A 4HQRA 3GLHB 3QU4A 3EGVA 1QTQA 1CRZA 3OPNA 2O8CA 4AZ0B 5F64A 1TE2A 3WMWA 3AYZB 3OUUA 4FYVA 4C0JA 5T6BA 4WFQA 1TRKA 4H7IA 3BGSA 3CUUA 3ZY2A 5IJWA 4DEVA 3ENKA 4LXUA 3E84A 1AQJA 5FPTA 3LWZA 3VYVA 1VXRA 2DPYA 3TI9A 1TGVA 4H1HA 5EHNA 2WU3A 3I3OA 4Y2UA 3DJYA 2W6MA 1I4LD 4IRMA 5E6SB 3TZEA 3URMA 2C3YA 3M2PA 1DJNA 5B4VA 1TVKA 2HCRA 3O4JA 2WTMA 5KINB 4UC0A 2FW8A 5LMNB 3ZWMA 1Q7BA 2DWPA 4OGLA 2ISCA 4NSNA 1L7QA 2DJ5A 2WM8A 3RU7A 5JMOA 5LMUB 2W83A 1C9NA 1PP4A 4MIYA 3O03A 1J0XO 5EYPB 4HN4B 2ZXUA 2YIVX 3K1ZA 2PRYA 3UHAA 4E5NA 1ZQ1A 2A0UA 4HGNA 5FNVA 2ZTMA 1XPUA 3MTQA 2GF9A 3EBLA 1P33A 2EBWA 3MERA 2VJNA 3KAKA 4BO7A 2D2FA 3GEHA 5LA6A 3Q2OA 4I4TF 2O0JA 1AZTA 2CFCA 1UT8A 3HQ4O 4GMFA 2OHXA 3NEAA 3S99A 5B1EA 4Q82A 2BFNA 1FP7A 2FP4A 2I3DA 1KC3A 4G2TA 3I6BA 1ICIA 4L0CA 1NN5A 2DP4E 2PSHA 5CYOA 3ILXA 1G21B 5GJCA 4JQYA 1PS9A 3ZW8A 3R9WA 5ALRA 1K63A 2W90A 2I65A 1YHZA 1EEXB 4B81A 1IUNA 2IYUA 5TPWA 1XU7A 4II7A 2WSYB 3HCEA 3IQIX 4TV9F 1ESDA 1HO3A 4L3OA 3WWPA 5EUCA 4CKXA 2CDNA 3EG9B 2XZPA 2ZJ1A 3P9YA 4HC4A 1SHTX 1XELA 3BE8A 1GSIA 4JDUA 4BGIA 3OG9A 5JNRA 3HO8A 2ZAGA 1X7WB 1NBOA 3EXFA 1KYIA 2GETA 5TDHA 5A4KA 2JI4A 2VF2A 2C99A 2IODA 2KBEA 1C9JA 1JS1X 2X4LA 3SS9X 1FTNA 3UW3A 1I2CA 1QE5A 3L7OA 4IAOA 4MW5A 2J1LA 5TB5A 4WK2B 1RAIA 1WG8A 1XZQA 3TEJA 5DMHA 3UJDA 5TQJA 5CXSA 4LG1A 1VL2A 2VN8A 3R4CA 4FMCB 5EP4A 1OA1A 2IH5A 1M8JA 1N1DA 2J3IA 1Q0PA 3SYNA 5AI9A 2D5BA 1EM8B 2C1XA 2OILA 3TJMA 2E89A 3N39C 4B83A 4IIJB 1KY2A 4EFLA 4QZVA 2ZWMA 3R6LA 2FB9A 3BQ9A 3ECSA 4ZCSA 4E12A 1Y1PA 3PL5A 4KBYA 1TVKB 4PIPA 1TK3A 3FD8A 3KSUA 4GVXA 5AVOA 1AG9A 1SWVA 4R7ZA 1Y34E 5ES3A 1FP1D 4M1SA 3VH3A 2BSXA 1MAUA 2GMWA 2ZUVA 2XE6A 3HSKA 2PJUA 4HNRA 5EEGA 3ICCA 4BDTA 2F8LA 3B12A 4KDRA 2FP4B 2FFBA 1BMFD 3MPUA 4BWYA 1DEAA 1SG0A 4EKDA 2JFXA 4OREX 3T95A 5CFNA 5IEBA 5ICSA 4A8JA 2TMDA 2YYZA 9GPBA 1EK6A 2Q3BA 1Y42X 3GA5A 1NLYA 1T9CA 3H5OA 3M9XA 1K86A 2HRZA 3PQ2A 3IUMA 1ZKDA 3PC4A 3MGGA 4URUR 2VDWA 3DNPA 5LP1A 3K53A 1E3WA 3UV3A 1E2LA 2MTBA 4N03A 1OH7A 1KJZA 1JRLA 1GNLA 1YNSA 2HDOA 2XCOA 2A5JA 3AUAA 3PUVA 2J0UB 4WLNA 3R5KA 2OFPA 2HT6A 3C45A 4L6IA 4XGKA 3TSOA 3BWEA 1K9VF 3NVAA 1C1HA 1R0YA 3EH2A 3BSYA 4LDNA 1I10A 1K06A 1OFIA 3SYLA 2C4TA 3MMSA 3PVSA 1EM6A 2NVUA 1YRHA 2AN9A 4UZEA 1ZUNB 4TRMA 1FFHA 2C0QA 1J7KA 4D8WA 2F7SA 2RHGB 3DOFA 4BKUA 1SK8A 1TF5A 3EEBA 5TIIA 3DMGA 4ARIA 1QHYA 3IDZA 3N58A 2KB0A 1PKXA 4GHWA 4CMEA 1TKRA 5F1OA 2Z8XA 3NIGB 1NJGA 4PZAA 4JJFA 3VXKA 4YR9A 1WUYA 1IPFA 4DC1A 4JY7A 1AKVA 1WXHA 4QHTA 2ZRJA 5IZ4A 5I7HA 4MYRA 2N3ZA 4LGCA 2JD0A 1BG6A 1VKJA 2EFJA 2ZT8A 3AY0A 4OYYA 4W5HA 5DZSA 1ADCA 4UTRA 1CETA 3O0TA 5C7OO 2DWCA 3UMBA 2C1EA 1UOEA 1XWFA 2OQIA 3K72B 2CJWA 3DCJA 4HFMA 1JIJA 1O87A 4RSHA 1I01A 3ASZA 3CA8A 3EQ8A 4WN9A 5CVJA 3TMYA 3UK6A 3WR5A 1ZCAA 2ZWOA 4IDHA 4M89A 3DMNA 2PSSA 1PNVA 1FUKA 3MS4A 1TIBA 3PKZA 3B89A 4BFUA 1YZHA 4IXMA 4LQ4A 3NWPA 2DU8A 4TWAA 1OZFA 1Q57A 4PQGA 1Y1LA 4G5XA 4UNPA 4X8HA 7REQB 3MCAA 3QFRA 4GL4A 4KYUA 4REQA 2MINB 3OCYA 5EZ5A 2F9FA 4AKTA 2W6PA 3SMVA 4N0EA 2B4TO 4JXZA 1PZHA 3B1ZA 4QM6A 4HVAA 3Q85A 4L5AA 3O83A 4OLJA 3SP1A 3CT4A 4IMRA 2GEKA 3CF4A 5DTEA 5CEFA 1YL5A 2ZJYA 3H17A 1ZMTA 4XGIA 7ABPA 4JHXA 1DPFA 4A8JC 2H2AA 4RLQA 5F1KA 4F2DA 1BH6A 4ABYA 3WGTA 5B6PA 1UQTA 1IG3A 2Q50A 3HL0A 5TF4A 2XEXA 1K7EB 4NAVA 3CG0A 1OGJA 3FDZA 4IZIA 4KV9A 4BYMA 1THTA 1QYDA 2YN4A 3A9VA 3NBKA 5ALTA 3C4JA 2G82A 3I1IA 1HDGO 4OHRA 3GG2A 3KU1A 4HOYA 5CX4A 1W30A 3JD0A 3D5EA 4FQ7A 2F9LA 2IHUA 1DKNA 3IB3A 1U0EA 3HN7A 1SCKA 5K01A 4MP6A 1J2TA 1LPPA 3L1HA 3SZRA 3N0TA 5TARA 2MYNA 2JVIA 3IT1A 4PC1A 3T1YB 2GCGA 1OCEA 2WD8A 3AF6A 4LWOA 1XJQA 1JVNA 5CNIA 1GSAA 2GX6A 2DLDA 3A1CA 3FETA 2LVBA 1A4IA 3HYRA 4S3MA 1X7GA 4DLNA 2Q5EA 4UAJA 4YAKA 2DERA 1N2CA 4IDEA 4M88A 3GUVA 2IHTA 3OQVA 2XWPA 1MFZA 4MGKR 4Z1MD 4GT1A 1SBQA 3DL0A 4J03A 4Y2GA 3G7SA 5HF8A 2XT9A 4MPDA 5A5DA 2E85A 2EHJA 5KYNA 1KAHA 6YASA 1SFRA 1IVYA 4IIGA 5DBHX 3U5ZB 4V0ME 2YOHA 3SZUA 4HLDA 4P32A 3ADKA 1GQOA 2XNDA 1XO1A 1ZC3A 2UZ0A 3SBOA 4ER5A 2QTVB 4MV0A 5JVDF 2OV8A 3A4NA 4WE3A 4UXJA 3EAGA 1VPWA 1ECPA 3QWIA 4NL4H 3EZ2A 4ZDKA 1OAKA 2I99A 2EDAA 3FYDA 2XYPA 4YAFA 3VHRA 4RULA 2RK6A 4ZVPA 5ALHA 4BWGA 5I9MA 3R5TA 1CZRA 4G24A 1E6CA 2X0JA 3PL1A 4WZZA 4GI7A 4ANFA 2BCJQ 4UDXX 1V3TA 5JS2A 2F1KA 4G8CA 1GQSA 1OHHA 4NYJR 3DZKA 5BW8A 1XYVA 1LV7A 3GF4A 4DMGA 1EX6A 1QUEA 3C48A 3OEED 4DZZA 4QJ4A 1UDXA 1YR2A 3QOWA 1SZDA 2J32A 2VZ0A 4INPA 4EZBA 1O5IA 1W0KD 5GADl 1E7RA 1F2VA 5JI2E 1E2HA 4RK7A 3ZU2A 1IM5A 2A1IA 2ZETA 2PUWA 1QKIA 1N2XA 3EIOA 1U0JA 1CIVA 1EYZA 1JSXA 1XKXA 3GZNA 3OLZA 4Q4LA 4FMDB 4YMWA 3VGPA 3DMHA 1F38A 1KNXA 2O3JA 3HDQA 4WZAA 3ON5A 3WP0A 4AIIA 1UQUA 2HA4A 4FMBB 2OP1A 4IH9A 4KQ1A 1MABB 2RGBA 2XVXA 2EWWA 3EVZA 4P3KA 4ZMSA 4UMVA 1UDAA 4XGNA 4BN4A 1SB9A 2ZS8A 3A9UA 1SXPA 2PKWA 2G1PA 3OLXA 3WX0A 4TT3D 5FLYA 2B7BA 2NUAA 1J5XA 3JQFA 3QWFA 2BT4A 1TKBA 3QTTA 2VUUA 4GOJA 2X1HA 3FCAA 3EULA 4DCPA 2QBYB 3PNKA 2V7TA 2IU3A 1T1JA 3WBJA 5FX2A 4GQIA 4H1UA 3HXKA 3SC2A 5K0JA 5CB4B 2VF7A 1ORWA 3IQWA 1H8ED 2B9VA 1I7NA 2PD3A 2ZSBA 3EF0A 1QIJA 2E6KA 3HR4A 4KMOA 4ZO7A 1V39A 1C2YA 2JGKA 1TM3E 3RC1A 3ICPA 1FVOA 1SCBA 2W6IA 2XGGA 2IQIA 2O2JA 3P20A 2UVDA 1C7EA 3EDRA 3DBVO 3NONA 1UZUA 2JRCA 4S2EA 1C3EA 2X22A 5EQTA 3R24A 5I5GA 3VDXA 4BX8A 3NNDA 3EPLA 5DCYA 4DCTA 4MW9A 3S2UA 1BMFA 2QR3A 2GN1A 2KJQA 4YQFA 2VNIA 1KDZA 3QHAA 3AHDA 1IMJA 1VLLA 4HSGA 1AUQA 4XD2A 3MQFA 3SYRA 2BJWA 3T3DA 5JYCA 4Y3UA 3CLTC 4ZQEA 3DA8A 1GARA 1NI4B 1Z34A 4B9AA 3A36A 1VIYA 3VR5D 4D46A 1ISIA 5FXMA 4ER3A 9LDBA 2W2VA 2NXJA 4R5HA 5FI5A 4QDXA 4NYJQ 1VJ5A 1Z5WA 3STXA 4NE2A 1V7QA 2FPGB 4BJ5A 5B37A 4DBLC 1U0NA 2C7RA 1Q7TA 5F3RA 1VMAA 1K7YA 1L7AA 3O84A 4FONA 3AHGA 1QLWA 4KWEA 4CMHA 4AO8A 4TTRA 5JZVA 1T24A 2GJKA 3D6FA 2XIJA 3BGOS 3D5QA 3IPCA 4F5DA 3GJ3A 4IHKA 1GG5A 4MMZB 4QJ3A 2D5AA 2O9JA 1OWNA 1AUXA 1MD9A 1A72A 1YI8A 2D4HA 2XUQA 3C24A 3N2LA 3MS7A 3O9ZA 4P3OA 1EQ2A 4WFIA 2UUBB 4YEDA 3G8YA 3EA4A 3OWOA 1BQEA 3Q3CA 3NM6B 4AD8A 2C4NA 1A2OA 1RC0A 3BH6A 4K46A 5FLKA 1QFSA 2N47A 5DI3A 2CEKA 5AKJA 2FEPA 3GLUA 1Z83A 3EYWA 3EG5A 3N07A 3BRWD 3M6MD 4GVPA 5TMPA 3JQPA 5KYGA 2GCNA 1KEZA 3B3JA 5CYPA 4RDIA 1AKMA 4DAOA 1JEQA 3QJ5A 1P1IA 1KYYA 4NYIQ 5AM3A 4LF4B 2PKXA 3DMDA 3R6DA 3EZLA 5AVUA 4J0QA 2DBRA 4OLAA 3CLKA 3NP7A 4MMXB 2H57A 3VPSA 5KNBH 2CXTA 3OZWA 4FEEA 3L0PA 5HNKA 4KPEC 3KWJA 4Y2HA 4MQUA 3ADPA 2NVOA 2ZIEA 4EB8A 3LKZA 4G89A 4M4SA 5H3CA 1KEEB 4UULA 3QOYA 3N8IA 4IGEA 1NI4A 4CUZA 1H6DA 1GZ5A 4DQUA 5EEHA 4A7PA 2QTZA 3MMZA 4YHBA 4UHHA 2IDJA 4JVOA 1SBZA 5ALIA 3EVNA 1BJTA 2PD6A 3D7KA 1CLUA 4I50A 3NAQA 5C31A 3RREA 4QLBA 4BNDA 1FTWA 2OZPA 4PNHA 4CJXA 3PC7A 5IARA 4IJWA 3SIRA 3Q10A 3NXKA 4RCZA 3TAXA 3RBZA 2NO4A 1ZIPA 2PUJA 3LGSA 2BDEA 4JDPA 4KU4A 4QG7A 4QXQA 2LE0A 2WA1A 1AKRA 5EZYF 1GV1A 2XZLA 5KCZA 5J1TB 3LT4A 1LW6E 1UKBA 3AGQA 4MLCA 4R1SA 3OUTA 1P7PA 1TAGA 2R44A 3D4BA 3QVTA 3WIOA 4UCWA 5JLJA 2F43B 5CB4A 2P9TA 3U9LA 4MUKA 1PTJA 3VR5A 5IEJA 2I6SA 2BEWA 4M1OA 3WDLA 1XDZA 2GYUA 4CM4B 1HC7A 2ZDGA 5CLIA 4X8OA 2QI9C 2V45A 1H4TA 2Q4OA 1OE0A 2CWWA 2ZQZA 3CLSC 4KE9A 4KO3S 4QQRA 1X15A 2XMDA 4XYBA 5DGHA 3RWMB 4GO1A 4RFSB 2JIBA 3RAEC 4BWFB 4B9EA 3H4MA 5CFZA 1I2AA 4JASB 1VLQA 4WKGA 1QYVA 4W6ZA 5LZ9A 3O94A 1FL9A 3R44A 5JQGF 2XW6A 3EOBI 5DBFA 4WK0B 4NCHA 4HB2A 2DZDA 3G2LA 4KPUA 4RFLA 1ECGA 2YFQA 3HYLA 1ODCA 5D7BA 1WVGA 3GNQA 3DDHA 1W4CA 3PGKA 2QV7A 4CETA 1IXSB 1GFWA 5AD1A 3EGXA 3D0QA 1U63A 1DC4A 3WGJA 4IIDA 3OWHA 2VWPA 4NYIR 2ZVQX 3M34A 4FNMA 2E4WA 3W5UA 5F9MA 3QQ5A 1L6IA 3K70C 1E3QA 2ZJFA 3HA2A 4PFJA 1MQAA 2FMIA 2VBGA 5MF6A 4B7AA 3V97A 1PV2A 4PS0A 4WL0A 4R81A 3ZHBA 2R9VA 3OO0A 1FSPA 4LZNA 5K51A 2RKWA 3OOJA 5JYBA 3FNEA 4X00A 2A0WA 5C5DA 4ON9A 1JEDA 1MH1A 5FYQA 4I5FA 3OBBA 4ZAFA 1V5IA 3HDHA 3HKEA 4JIMA 4ND5A 3VU8A 5IK2A 3F2VA 2H11A 1I14A 3DE3X 3PDIB 4MR7A 4R69A 2ZIWB 2AFHE 4UM9D 4XIYA 2YL2A 4Y2YA 1AKNA 4C14A 3M6AA 2NU6A 2WD7A 3AW8A 1JKXA 3HWRA 2OEPA 1YVRA 1MORA 2HSWA 2AFIB 5A6SB 1KC1A 4KC0A 3NRBA 2D7JA 4DLVA 1B4DA 4MQ4A 1SC6A 1SH7A 3CRVA 5BN3A 1BYUA 1V8ZA 4DSNA 2MSKA 2AH5A 4GP7A 1DC6A 1V1MB 3TIXB 2FN8A 2REBA 3OPVA 3FNQA 3ZDXB 3AIKA 3ZS9A 3KFLA 3RK0A 3V9AA 5CFRA 1BQ3A 2PK3A 2FLVA 2WV9A 1ODTC 2FR8C 4KR2A 5DGCA 2P9CA 1KGDA 2QEQA 2ONJA 3M1YA 2KI5A 3TLMA 5FCDA 5KU1A 2BM0A 3PX7A 4FOSA 1R0KA 1ODIA 3TKLA 3C6YA 3CEAA 3DOOA 1E0KA 1R12A 3O2QB 4M98A 3H2YA 5E3HA 3COJA 4E70A 2F3PA 2ZE7A 5T41A 5AVJA 5KYUB 4RM2A 5EVCA 1OLXA 5EJ6A 4X1IB 1QGYA 4BQRA 2C2GA 2Q21A 2R87A 5BXQC 5MGNA 3IE1A 1VCHA 2C2MA 4B4OA 2W9XA 2XMPA 3G0BA 4ZO4A 1JG7A 4KP7A 4D9JA 2KX7A 2NU9A 3M5PA 1NW4A 4EFNA 1AB5A 3I62A 4D0LB 4ILKA 1DJLA 4JX8A 1GPUA 1VKZA 4GWLA 3FE2A 4OUKX 2J45A 3EIWA 1FNSA 2XUOA 2H63A 3IBSA 3PEFA 1GVNB 4QU8A 3C1AA 1EHCA 4HAWA 3UWSA 2P65A 3V3KA 4Y9DA 1QVAA 1GGJA 2W71A 4KUEA 1CR2A 1KI6B 1AC5A 1GDDA 1NYLA 1L3CA 3FPCA 2QLNA 3HJBA 4ZQCB 3K9QO 3QYJA 4JBIA 3ZOZA 3QE9Y 1TTPB 3L1VA 2AR0A 3IDAA 1YQQA 1Q3HA 1IHUA 3ZE2B 1BWRA 2WKPA 3PEVA 4C06A 5HCNA 3K0HA 5GV7A 2WQ7A 2HXSA 3L7KA 2FRXA 3TNJA 1JKJB 2Z2IA 2SKEA 2YRFA 2QVCA 1EE1A 1EK2A 2Q2NA 4EGQA 1PE0A 2HMAA 3IPRA 1JAZA 3ICWA 3HV2A 4JLPA 1V8BA 3CYFA 5E4YA 1CY6A 4OHVA 1E1YA 2OQRA 1JG3A 1IQRA 3BK2A 2QQ5A 3ETGA 4UNSA 3TYXA 1ZIDA 1IN5A 1E3LA 4UMDA 1YB4A 2VDKB 2GT1A 4PX3A 4D3DA 4DUYB 2QP9X 1OFTA 1ZHHA 3KP1A 2I8CA 5FOUA 5CX1B 3T35A 2OXFA 1HYHA 2CCKA 4FD2A 1A8IA 2KSQA 2HB6A 1JHQA 2GKOA 3VR6H 1BA3A 5AVYA 3JRNA 4HBGA 4U7DA 1XG5A 5F2OA 5BWMA 2GXAA 3FVTA 4R68A 2HWYA 3QG5A 3T9CA 3L7YA 3RYIA 1BX3A 1W6UA 2G1UA 1JR4A 3SF8B 4OOEA 1EG7A 1QU3A 2WD9A 5JCOA 3GEBA 1YZQA 3FPGA 3ZEIA 3ELDA 3VR4A 2W4IA 3W5DA 3MBOA 4CODB 2IBMA 1ZITA 4TTQA 3H42B 2C2HA 1AZWA 4KMRA 2C04A 3G0DA 3TVTA 2XCUA 5JDCA 3EIXA 4PO1A 1Z5VA 4CM3A 4JBHA 5FI1B 4TGLA 3GUUA 3B85A 1E6MA 4QTYA 3QFCA 1QZTA 3BEDA 3M6LA 3LT2A 3UJ6A 5EMMA 2FX2A 2WQZA 5EZYA 3TR0A 3E6AA 4YT8A 2WTXA 1D2GA 2B1RA 1WU8A 4BQEA 2RAPA 4IX1A 3HR7A 3ESRA 1D7AA 1AD2A 3H3XA 2YIDA 2Q6OA 4WZ6A 1IHYA 3ZX4A 3H4VA 5EJ7A 3K31A 1V43A 2ZPUA 2ASEA 3QNUA 3HJAA 2EZ8A 4OHMA 4B3DA 2XB8A 1ZK2A 2QYOA 2XXBA 2FUKA 3HUUA 1HOXA 5TMEA 3FYUA 3TOSA 4DLSA 1YQWA 3OTHA 5JJ5A 5DHFA 3SMQA 2ON6A 4QPCA 3BWYA 2OG1A 3C14C 2EATA 3N2NA 4UD2A 5ALFA 1QRSA 4MPRA 5DI9A 3GLHA 5JLAA 4LJYA 5IDQA 1P31A 4RFVA 3IODA 1X3SA 1E6KA 1NQVA 4RAQA 3OTGA 5IDXA 2NPOA 5CJPA 1LK5A 4RACA 3QY9A 4XJVA 5B5SA 4AM8A 1QGUB 2OO5A 3Q88A 2Q3CA 5C4GB 3RHSA 1T6BY 3FYUC 4UHDA 4B6PA 5C81A 5JRZA 4U6SA 3D3WA 4IDFA 4J3NA 1H1DA 4H0CA 4RTNA 3W2TA 1R6TA 2WLTA 2BSAA 5C4MA 1DFIA 4M6WB 5HMLA 3V2IA 4O1IA 4DMUB 3E9CA 1GQYA 2PUVA 4B7UA 3AOEA 4QXAA 3PQ7A 4JEIA 2CJXA 4LCJA 1C0KA 5JFTA 1WTCA 2JA2A 3B5IA 1JIKA 4JIGA 4O8ZA 3QKIA 5L7WA 4FSHA 2ZTVA 4IOJA 5DEIA 1ACMA 1L7MA 2BV3A 3A4IA 2PGOA 2Z2YA 3QW2A 4PGFA