3HYRA

Structural insight into g protein coupling and regulation of fe2+ membrane transport
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
253
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of GDP release and gating in G protein coupled Fe2+ transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
total genus 79
structure length 253
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hyrA01
1TAGA 2HCJB 1QG2A 4PR0A 3W90A 2J5XA 4XIGS 1BO6A 1NN0A 5KSPA 4D26A 1OT3A 4KLNA 3BK7A 2JEOA 4WVFA 3GLGE 4OQMA 4MKFA 2VHUA 4HDCA 1B23P 4JJKA 1IXRC 1DE0A 1VCIA 1E2JA 1DAEA 5LD2B 1T6NA 2CNWD 3RHFA 4RD3A 1XEXB 2H18A 3T15A 4KI0A 2Z5FA 4DCUA 1W46A 2VQSA 4D6PA 4IXMA 4EKDA 2MMCA 1SULA 3LX5A 1G64A 1YR8A 3CR8A 4P4SA 3A1VA 4L16A 1G5TA 2UZ3A 3K9NA 2OFXA 2H17A 1SZPA 3T06B 2EFCB 1US8A 1ZP6A 4P31A 5JCPA 1OIXA 1G1MA 2ZRHA 2UKDA 3CNOA 1X1RA 3QY0A 4DT1A 3FOZA 5HE8A 1XXHE 2BV3A 2CHQA 1XP8A 1YZQA 2ZS9A 2O0KA 1DAGA 4ZI3A 1UBGA 2IF0A 1II0A 1S8FA 1P4SA 3D6TB 2W2XA 1AKYA 1T3LA 3EW9A 4KV9A 3IQWA 2RH5A 4G0NA 3ZS9A 1KO5A 1DAFA 3F0TA 3OZXA 3QOFA 4TMXA 4TL9A 4Q21A 2QRZA 2CLSA 5B64A 4PPFA 4ON9A 2NPFA 1G41A 1DAHA 2FSHA 2QP3A 3HPRA 4ARZA 3FMOB 3RWMB 2XEXA 3TGPA 1R10A 1C1YA 3THWB 1ZIPA 1S4QA 2C78A 4AKGA 3I3SR 1EFTA 4EQ6B 3C16C 3RANA 1NJFA 3O8CA 1ZVQA 2VEDA 4EQ6A 3W6OA 2H8KA 4D25A 3QKUA 1KJYA 4LBYA 3H2YA 1GDDA 2EW1A 4BFVA 5FTJA 4HB3A 1DVRA 1KI9A 1N0VC 1U0JA 1XEWX 2IYLD 2JAQA 3CRQA 2AKAB 5J4HA 2JA1A 5A0FA 4OBEA 2F43A 2WWFA 4LC1A 3SR0A 2J3EA 1X8KA 3TLXA 1HT2E 1F60A 4TYQA 1ZNXA 3WNDA 2WIAA 2RAPA 1Q21A 4PC6A 1VCOA 1TL7C 1UBCA 4OHVA 1ANKA 4PAMA 5CDFA 3ZS8A 2GF9A 1P9NA 3TNFA 3GFTA 3NEYA 3QKRB 4DEYA 1E2IA 1WCV1 4ZO4A 5JWRA 2G6BA 5CJPA 2VYFA 3QKSA 1G17A 1TU3A 4ZKDA 1RZ3A 2GCNA 3QPVA 1U2RA 5F9HA 1AZSC 1E0JA 2NTYC 3HPQA 5J5CA 3Q8XB 2QM8A 3SJCA 3IO5A 1KMQA 5KDDA 4QJ3A 4YXWA 2YOHA 1HA3A 3U7EB 5EXPA 5JS7A 3TQCA 2WM9B 5FOWA 2PJZA 5KDLA 4BFZA 2IXEA 4QGHA 1FUKA 1GNQA 1R8QA 1IN4A 2ZR9A 2O0HA 3NBFA 5HE9A 1ZC3A 1XEWY 2HF9A 2LCFA 2I1QA 3EZFA 3IUYA 4IJMA 4DJTA 4C7OA 2MSEB 2ZJ8A 3C5HA 3I32A 4MGIR 5FL7D 1MT0A 3SHWA 1E2HA 5K8IA 2P6UA 1T4GA 4BE7B 2GJKA 4V0MA 5AUQA 1WB9A 4IHQA 3LA6A 4PQFA 1IBRA 4BPBA 5DLQC 2IX3A 2DHRA 4RKEA 1T3SA 5D3MA 4XWAA 5AUPB 2EFEB 1MO5A 2JATA 4XSGA 1J99A 2YNMA 2FEMA 2NO9A 2VP6A 3M0EA 2BMFA 3BXZA 3K09C 3B8HA 2BBSA 2GRJA 2D7CA 5JHGB 4L5BA 4B6FA 2RGEA 1EG7A 4MGZR 1GRRA 1KZGB 3QQ5A 4A6PA 4C0QC 1P7CA 1SKYE 2ONJA 4A36A 1P62B 2Q9BA 4F91B 3IDQA 1LS6A 1S9DA 4ZDJA 3KQNA 4JLJA 2CHVA 3W34A 4NCKA 4BFWA 4JBYA 1KHTA 4LJ9A 5HCNA 3KKMA 1E98A 4C30A 1WXQA 3IEVA 2HYDA 4RZ2A 5EZ6B 2CL0X 1JNYA 3PXGA 2D7DA 1H8HD 1QF9A 1G6HA 2D4HA 3N2EA 3LDAA 4XWOA 4V0NA 1SVOA 4OQXA 1CR1A 2BBOA 2PBRA 1FOEB 4II7A 4KFTA 4B73A 2C03A 4X8MA 4LBVA 5FTMA 1XMJA 3UIEA 2X1VA 2ANBA 1SHZA 4UJ3A 2E1RA 4I1OA 4LJ6A 3RLFA 1CTQA 4DLTA 1QZXA 4HB2A 2OAQ1 1UFQA 3A6PC 4H9GA 2BM1A 3TMKA 3EZ7A 1PUJA 4M1OA 3LW8A 3PITA 2GWHA 4BLSA 1NMZA 5CYOA 5E7IA 5CB6A 5FTNA 2FSGA 2C77A 3VMFA 1XCPA 1YZUA 1G8PA 2C9YA 1N6IA 1XPOA 3HYTA 3TW8B 2C2HA 3FKQA 1XMIA 2V7QD 5DN6A 1IY0A 3WY9A 2QPAA 2C95A 4CT5A 1KGDA 1S1MA 4WZAE 3SZRA 1M34E 2OCPA 4HATA 2CXXA 2NG1A 4RVCA 4NHOA 3W8NA 3ICQB 2IS2A 2GKSA 1DBSA 2OCAA 1OXSC 4Q7MB 1TUEA 2Q0HA 2XTZA 5EZ5A 4E22A 2P6RA 2FFBA 4TSFD 3TE6A 3FMPB 1MKYA 1GZSA 5E7MA 5FTKA 2A30A 4DLWA 1NN3A 4KXFB 4C0BA 3FDIA 2G0NA 4JVNA 3SDZA 1LF0A 4PZZA 3ADKA 4LPSA 4LYAA 3CRMA 4Q03A 1SVWA 3OF5A 4JKIA 4IRUB 2Q9CA 3MJHA 4NCJA 5FUYA 3R8CA 1XTIA 1CJVC 1ZU5A 3OESA 4QBHA 4FCTA 2PJRA 1DG1G 3OFND 2V7QA 1E9EA 3MFYA 1D9XA 1AIPA 1G16A 2P3SA 3QEJA 4M2LA 3DDCA 4FN5A 4TMWA 3QBVA 4EUNA 3FFAA 2O8BB 1BH2A 4AG5A 4GOKA 1E6CA 4GOXA 1GM5A 2O8CA 1CS4C 2DWQA 3C14C 1JB1A 4FCVA 3TUIC 3GPLA 5J47A 4OK3A 4IDQA 2F55A 2WJYA 2C9OA 4NONA 1UDWA 1Q44A 2ZM5A 3LV8A 1QHIA 1XTSA 3EIQA 2BMEA 5F2EA 3B1WA 2YKGA 3KJHA 1ZNYA 3DZ8A 1BOFA 4M21A 3VKHA 4V03A 2IS1A 1YZTA 4KCGA 5SZIA 4C0HA 2FDCA 2QAGA 4PQYA 3BAFA 3BOSA 1KZ7B 4JL5A 4NYJQ 1CR4A 1WMSA 2W2VA 3QIAA 2IUUA 4Q19A 1A82A 4B2PA 2V1XA 1E2KA 1U94A 3FGNA 2IHBA 3CPEA 1NLFA 1M1YE 2IXFA 4KYUA 3CWQA 5LDDC 2XITA 1G3UA 1UEJA 2UZIR 5AUOB 2ANCA 2J0UA 4GI7A 5FTLA 3CKLA 3CB4A 4FMCF 3BGWA 2FWRA 2GCPA 4KFUA 4CW7A 3U5ZB 2DFKB 1VG1A 1I4DD 3B60A 2HF8A 3FWYA 3PUZA 1CKEA 1HEIA 1MRSA 3DMDA 1NSTA 1BYIA 2ERXA 3SQXA 3SYKA 2VF7A 2ODBA 1OHHD 2PL3A 4RFVA 4Q4JB 1LFDB 4A92A 4G5SA 5DYGA 2PT5A 2IUTA 3T12A 1E1QA 3ASZA 4HLUA 3T5GA 1TPZA 2CCGA 2W0MA 2EYQA 2C96A 4BLQA 1T0JB 5G41A 1ETUA 1L8QA 1RIFA 3MUFA 1CBUA 3RRMA 5IHPA 2GK7A 1NI3A 5BW8A 3RS4A 3U7FB 4G3XA 2ZSFA 3KKPA 1SXJA 2YC4C 2ZI9A 2ZAOA 4Q4HA 3O47A 1ONBA 2OBMA 2R8RA 3DM5A 2ZVPX 4ESHA 1OHHA 1N6OA 4DUGA 1E69A 1HTWA 4LK2A 4I1VA 4E03A 4H1VA 4Y0VA 4A2WA 1QDEA 2O8EB 2F3TA 5JEDA 3ZIAD 4DDUA 5CIQA 1JR6A 4MKIA 4Z54A 4CVNA 1KI8A 1KO7A 2WIBA 5J4VA 5CM8B 4BLOA 2O8FA 3ZVMA 4DT1B 1YZGA 2A9KA 1R7RA 3HJNA 1G7TA 3DKPA 4KSCA 1NLYA 2QT1A 3W5JA 4Q47A 2ZYTX 1U0HC 1NVVR 2D74A 3V00A 5SZKB 1FTNA 4BLRA 1XMSA 2R9VA 2ZUDA 3CBQA 1Z83A 1JXMA 3S1AB 1XJCA 2CEAA 4DEXA 4NYMQ 4Z51A 3K70B 2AK3A 4LWZA 3PV0A 4L9WA 3RS3A 5BXQC 5K8TA 4OI0A 4UNNA 3K9GA 2JCSA 2HT6A 4Z1MA 1NIPA 3O8BA 1A2KC 3TSZA 4CRWB 1G8YA 4MYTA 1SVKA 1ZD1A 5JRZA 1I4LD 1ZUIA 2W2TA 5TMPA 2W58A 2QP4A 4WXRA 2I4IA 5JSZA 4M9ZA 1EK0A 1KO4A 1VG0B 2Q3FA 5IRCD 1KKMA 1OYWA 3QF7A 2XZOA 1G4UR 4W7SA 3KTAA 4B2IA 3H4MA 4L15A 2ZU6A 2EYUA 2YWHA 4KODA 1KI4A 3GLHB 1XNJA 2A7QA 4G1UC 1XD8A 1K6MA 3U3KA 2XNDA 4GRAA 2BKUA 3G0HA 5B57C 1E9FA 1FL9A 1H8ED 2F43B 1UKVY 1EX7A 2XJ9A 4PZYA 421PA 3WHLA 3I8XA 4GMDA 2ZI5A 5JLJA 2REOA 2CK3D 2V3CC 2AFHE 3A1UA 3ZVLA 2BIFA 1NBMA 2Z0MA 2XZPA 5JMTA 2PT7A 1W44A 4HZUB 4AKHA 4TLDA 3RSOA 2ZIAA 5EE0A 3AKEA 2IA5A 3E2IA 3REGA 2OSBA 4RZUA 1Z0DA 3GLHE 4B3XA 2RGGA 2XTNA 1G9XA 4XSHA 2VRWA 1VYVA 1OFHA 4P4UA 3NHBA 1KK0A 4EJSC 4IDPA 2HV8A 3H0KA 5L3QA 4DDTA 5CLQA 5KU1A 3HU1A 1YR9A 3TR0A 5DN6D 4N1AA 4IOMA 4Q4AA 2ZRPA 4Z8YA 4TMVA 4DUGD 2GILA 2P67A 3N2IA 3EC1A 1SKYB 1NP6A 1ZW6A 2ZRJA 3PVSA 1EFHA 2ATXA 4PZLA 4ZCLA 2PX3A 1CLUA 3X1YA 1JJVA 1NNEA 3WYFA 1G8FA 4BECA 1HH4A 2G1KA 5IK2D 2GVZC 4CT4B 3SU8A 4KVGA 1AS0A 3CX8A 3SN6A 4AURA 4OQNA 2F1HA 4JVSB 4NP6A 3DMNA 3QXHA 2ZJ5A 4H1UA 1BS1A 1QHHA 5EE1A 5EUMA 2GJ8A 1QHXA 3K70D 4W5HA 1KSGA 2R6GA 2IYWA 4RFSB 2IYZA 2V55B 1SVIA 2VHJA 3CX6A 4QC2A 5TDHA 3KQKA 1H65A 2V8OA 4XWKA 1S0UA 4O3MA 4QNRA 2PLFA 1FX0A 3LY5A 3PUYA 1CXZA 4IW3B 3LD9A 3CZPA 3UXMA 3CW2A 1SXJC 2GBLC 2ZSAA 1ZC4A 2J0QA 2O8DA 3NBXX 2UVQA 4Q1EA 2O8DB 4PO9A 1EWQA 4TYNA 2R2AA 3Q85A 2FEOA 2G1JA 4DSNA 4DCNA 3VX3A 3AUXA 2NOAA 1CU1A 1E0KA 4JIMA 3VR4A 2FPMA 3RVBA 4A1FA 1E9RA 4B71A 4OJKA 5HKKA 2QBYA 2HEIA 2NGRA 2IT1A 5KDOA 4L4UA 3QXXA 2HYIC 1VG8A 4QG7A 4ZPXA 3THOA 3MJRA 4RD6A 4DRZA 1W0KA 2KBEA 2BMJA 2OBNA 2KBFA 4HAVA 2DFLA 2NO6A 1M7HA 1WQ1R 1ZYUA 2RGDA 5KPJA 1XCGB 3VNVA 2AX4A 3AVQA 3TVDA 1E96A 1HQCA 2OG2A 2YYZA 1FNNA 2OFOA 1Q1QA 2QU8A 2FZ4A 3A4LA 4UKDA 4LJ4A 1SQ5A 3P26A 4GFDA 2IYUA 4HAYA 4D4JA 4LI0A 1G18A 5IF9A 5AJXA 3ZZTA 2N46A 5FL7A 4DCTA 1W0JA 5E95A 4BZXA 2CLCX 2WTUA 1U0LA 1IJFA 1ESMA 2JLWA 4FMDF 1IXZA 4ZDKA 1F6BA 2HJVA 1OH7A 2J0SA 1BMFD 1P6XA 3BRWD 4B3DA 1N6HA 4R7ZA 3OEHA 3V4RA 3R8FA 2E87A 2C99A 1Z0KA 1E2LA 3PUXA 3QVVA 1E4YA 5EP1A 1WRBA 2H7VA 1ZBDA 5C1BA 1KNQA 5M04A 2R6FA 1TNDA 3EZ2A 2NZ8A 3WMFA 2ZUBA 1NKTA 1TQ6A 4MGKR 2Z4RA 1JECA 3GJXC 3LXXA 4NYMR 4IEIA 2DPXA 2QPTA 4C0AC 4XTCS 1Z6TA 1AS3A 4WBSA 2C98A 4LV5B 4KHZA 3K09A 4B2LA 4NYIR 4TYPA 2NO0A 4TMZA 3U61B 3A37A 3U44B 2ZE5A 4A8JB 3NIBA 3TAUA 1PV4A 1DO0A 1U8AA 4LJAA 2W6IA 2WMOB 4M1MA 3T1TA 4QFMA 1FNMA 1R5BA 3GJ5A 4K81B 2RGXA 3KX2A 1Q3HA 5FBLB 2EU8A 3WP0A 3TW4A 1E99A 3REFA 4A2QA 1LTQA 1CRPA 3UKDA 2HXYA 1RJ9A 1XRJA 2A3RA 1SGWA 2WJVA 3Q7QA 1AN0A 5FOTA 2D2EA 2JDID 2ORIA 3DOEA 3J81k 2NMVA 4PSVA 5DO9A 4EPRA 4QBIA 1YZKA 2FSFA 3THYB 1KMHB 1ZM7A 2FOLA 4LYHA 4N0DA 3NDPA 1YZNA 2WWGA 3D31A 3OIWA 1KIMA 4M9SA 2GNOA 4PPGA 4URXR 5HR5A 4AIIA 2BBWA 4MRNA 2PZEA 5FOXA 3MWKA 5TVKA 2IWRA 3AVUA 2ZETA 2X19A 3RAPR 3AVWA 2OEPA 1ODFA 1Z5ZA 1N5JA 3ZLJA 2XSZD 3T5DA 2OLKA 4QBFA 1Q3TA 3EIEA 5HPYB 2WKRA 3GJ4A 1JQLB 4PO1A 1TF7A 2QPOA 5L3SB 1F2UB 2ZRIA 4TL7A 4Q4HB 2V4ZA 4IVQA 2CVHA 2YWEA 3EAQA 3JVUA 4G5RA 5FH9A 3BE4A 3GLIA 2YWGA 4JJZA 3VNUA 1KDTA 4TMTA 2ZRDA 5BQ5A 3SS8A 2REXB 3UMRA 1JPNA 5DISB 3ZDQA 3WXMA 1WBBA 4YMSA 1UBFA 2EQBA 3LH5A 3BFKA 4BQSA 4DCVA 1XMVA 4TSFA 1A1VA 2P5SA 3CH4B 3WYGA 4YMTA 2CCKA 4C7OB 2TMKA 4NZYA 2HT1A 1QHYA 1T91A 5KSOA 1BYUA 1M74A 4B32A 1SVMA 4D4LA 4TN1A 3TUZC 4KLZA 4XOIA 3AF0A 3IBGA 4LX0A 2XNSA 3RSLA 4GBMA 5J4YA 1RJ9B 2B7BA 2CDNA 1CR0A 3IPXA 3QG1A 4OK5A 4A0FA 4RSGA 2P6NA 3BB4A 1KSHA 4LJ7A 4DLUA 2OBLA 3QBTA 4CYMA 1DOAA 2H92A 1S9HA 1UPTA 2AWOA 2KSQA 2WJGA 1FP6A 3QF4A 4UXHA 3K0SA 2A5FA 3SQWA 2PH1A 1H8EA 4UNPA 3H1TA 3PUWA 3MWLA 1IN7A 4DXAA 1DTSA 3B85A 3JZMA 4HAWA 4AYTA 5JFGA 2IYYA 1G291 3U7GA 1XZQA 1Q1BA 3AH8A 4UJ5A 3EPLA 1T8TA 3CZQA 3P1JA 4BFXA 4N3NA 3THXA 3VX4A 2FF7A 3THXB 1HV8A 3LRPA 2JLXA 2G0TA 3OIUA 1XTQA 2ODEA 3IBYA 3B1XA 1GL6A 3WRYC 3AVXA 5SZJA 2XB2A 1OKKD 4Q18A 3LVRE 5F3WB 1EXMA 4M1TA 5FUWA 3I5YA 4HAXA 1O3YA 1OE0A 3U3OA 1FMJA 4FMBB 3CR7A 4K8OA 4Q1BA 3EWAA 1G3MA 3OIVA 1T9HA 3VAAA 3BERA 2FJUA 4BZQA 1RYFA 4BLPA 5FPSA 1T5IA 1Q1EA 2JIZD 4OQLA 4D4MA 1XXHA 2A5DA 3KKQA 2CJWB 2CLDX 1N6LA 2G88A 5TARA 2BDTA 4HUTA 2QA5A 3W6PA 4G5OA 4B47A 4R98A 1ZM2A 2EVWX 1VPLA 2O5VA 2XTMA 2GZHA 3GQBA 3K0AB 3LW7A 4ACBA 2OM2A 2ZANA 2XOKD 1R2QA 3B1YA 1P72A 4UNQA 1IONA 1ZM9A 1OLOA 4FMCB 3K0EA 1E0AA 2LKCA 4D4KA 1W7AA 3VKGA 1NBME 2ZYUX 3CX7A 2ORVA 2VP2A 2X2EA 3PIRA 4BFTA 4EFMA 1RW4A 1W2HA 2F1JA 3HDTA 3QENA 4IEEA 1YU9A 4FI3C 1CJUC 3QSYA 2B8TA 2WOOA 2GZAA 2BKEA 1GKUB 2QGZA 5KPDA 4X8HA 2VBCA 1KTVA 4QGGA 4Z8XA 1JEDA 3P4XA 1OH8A 4PC3A 2AHOA 3QJYA 4L8GA 3LFUA 3ZJYA 4KBGA 2PCJA 3WNCA 4OI2A 3NC0C 1U98A 2NPIA 2XXAA 3SBEA 3B78A 4JS0A 4MUBA 4NYJR 3WHKA 3G82C 4KFRA 3VR6A 4PANA 2VHCA 3MG9A 4JLNA 4TQ9A 1E1QD 3P20A 2PX0A 3F8TA 4OQFA 2ZVQX 5FBRB 3GLIB 4RFSA 3EG5A 4A0HA 2IS6A 1KI6B 3PUVA 4AKEA 1NMYA 4P4SB 2Z83A 1EESA 3VR2A 2F9LA 2CHGA 3IIJA 1DAKA 1Z29A 3C4JA 4DIEA 5E7JA 1Z6YA 2J87A 3EX7C 3AVPA 4LHZA 3CF0A 2FGJA 1YR7A 3ZGXA 2QRNA 4D0GA 4QHSA 1UM8A 1YZLA 1ZIOA 4Q9IA 4LUCA 1V5WA 1SVLA 4YLGA 2JLQA 3D3QA 2AN9A 3KQLA 2JLSA 1N6KA 1N5KA 4KSBA 3QEOA 1MOZA 3ND9A 3A36A 3UG7A 2C5LA 5D3MB 1OFIA 2WBLC 3CWZA 2WHXA 3K9HA 3WRXC 4CEJA 1B0UA 2QSZA 2WKPA 4MRPA 4YDSA 3TJZA 1JR3A 4AYXA 1IN5A 1II9A 4CEJB 1TTTA 1X3SA 4BRUA 2VTKA 4FCWA 3SYLA 4DKXA 2GJSA 4TLEA 5DI9A 5EP4A 3EPHA 1N3BA 3GLGA 2J9RA 5FPTA 1S3SA 3L8YA 2FMXA 1OIVA 1RKBA 2Y8EA 1KY3A 5GJCA 3A1WA 4JSYA 4B34A 2ZE6A 3ADDA 2V9PA 3KTAB 4JBWA 4Q48A 5GVRA 2QORA 3TRFA 5JBQA 1W0JD 2J45A 2YOGA 1RC8A 3RC8A 3C15C 4BWYA 2WJHA 3AGPA 3X1DA 3K1JA 4LHVA 4TL6A 1G3RA 4UXIA 2W6JA 1SHKA 3GJ6A 5EE5B 5JJIA 2DY1A 3GCGA 4JVMA 2IC5A 1Z2AA 1OB2A 1OF1A 4ACAA 4B75A 1QVAA 2ECKA 3AEZA 2X77A 2CJWA 2JJ2D 1ESNA 4JBXA 4ERNA 2JLZA 2YOFA 4DLYA 3FTQA 2QP9X 1DEKA 2YINC 5EXXA 1GRNA 1Z6GA 4IDHA 1L2TA 2VO1A 4A9AA 1Y3AA 1NJGA 4TL8A 1Q57A 4TMKA 5DH9A 4MKGA 2ZROA 5TY0A 4B3FX 3KZ1E 3DHWC 2BBTA 5H8WA 1W4AA 5H1YA 2QL6A 2C04A 2QE7A 3HWSA 4G5GA 1E2EA 1WE2A 2VHQA 3OEED 4HUQB 3SYNA 3IIMA 3GLFB 4KITB 2VLIA 4CEHA 3LBNA 3VU9A 4RJLA 4E5UA 4QM6A 3RWOA 4CEIA 3EARA 5JWOA 2A5GA 4CEIB 1G3QA 1IOZA 2B92A 3K9LA 4CF7A 3U4QA 1EWRA 2JLYA 4B6EA 2FFHA 1P2UA 2DFTA 4C9BA 1YRAA 2XSZA 3CNLA 5D3QA 4ESVA 4GNKA 3ECCA 4NE2A 5SZHB 4KU4A 2GETA 5FUXA 1MO3A 1AK2A 1FP7A 1XD9A 2QUZA 2J1LA 1RPZA 3ZVRA 2FV8A 4AY2A 1E1RD 1S3GA 1E2PA 2BM0A 3AQ4A 3TVTA 4URVR 3CH5A 2Z43A 4JYBA 1JBKA 1RRCA 1W48A 5CJ2A 2RMKA 2ZSDA 4URWR 1O87A 5IK2A 2CCJA 121PA 2B8WA 3LQQA 4NDZA 4F92B 1GOTA 4NH0A 2GAOA 2GAAA 4TYWA 4HB4A 4Q1CA 1CRQA 1TEVA 2K5UA 5CK5A 5LD2C 1Z6XA 5HZHA 3BC1A 4IOLA 2O8BA 1OH6A 2H16A 2YVUA 4G01B 5KSYA 1IJEA 3W3AA 4LHXA 1IM2A 4Q7JB 2C8VA 3AF4A 2A2ZA 3AKDA 5FBQB 1FW6A 3B1ZA 1NN5A 4DLRA 4EPVA 2QBYB 1OXTA 1BKDR 4HUQA 1GUAA 4WZBE 3I8SA 2SHKA 4B33A 2WWHA 3IILA 1ZUHA 4IVPA 1KKLA 4LBZA 4EDHA 5HKKD 3RYTC 3KXIA 4AD8A 1E94E 3BORA 3CIOA 4P0TA 2QY9A 1UF9A 2W83A 2VP9A 1W49A 2DWPA 1E2MA 1W5TA 3F3YA 3DOFA 3NEJA 4HAZA 4AYWA 1II8A 2OE2A 3RRZA 4POAA 4V0LA 2D62A 2P2LA 4M4SA 3LNCA 3WMEA 2PZFA 1Z0IA 3ZD7A 4I1SA 1Q0UA 4DHEA 1ZJ6A 3GLIE 4A0RA 1D5CA 1VYUA 1NVUQ 4I4LA 2WPDA 2P5TB 1VHTA 3PEVA 3B9PA 3EZ6A 2YV5A 3CPHA 3HU3A 4QGAA 2CBZA 2ERYA 2GXUA 4HZUA 4A0GA 2VA8A 3CO5A 3QKRA 3EPJA 2IBMA 4M0LA 3H84A 2GA8A 4KO8A 8OHMA 4P4TA 4GT1A 1IY2A 1NRJB 3LAWA 1P3JA 3DVLA 1CULC 5GADl 5HTKA 4URZR 1PLJA 1QHSA 1U9IC 2GK6A 3CUEF 4EIWA 2BOVA 3BFXA 4D82A 3IEUA 3EC2A 4PQRA 5CIWA 3O8DA 4QRHA 3TKLA 621PA 5JI3E 5FBVB 2KI5A 3BBPA 4F38A 1GVNB 2BEJA 4ILEA 1XZPA 4OKSA 2OXCA 2NZJA 4YMWA 2F1IA 4B3CA 2ZRFA 5E4FA 3RNLA 4LV8B 3FKSA 1KNXA 5DYIA 1NVVQ 5LB2A 5C18A 5L3QB 4KJZA 4Q66C 2FE4A 4UQOA 1XB2A 1ZM4A 3EIHA 3GLHA 1X86B 3VU9B 2CL6X 2PEZA 2AKYA 1JXOA 3ADBA 2ZI3A 3GEIA 4AWXA 2DR3A 5AK0A 4Q1DA 3ZQ6A 2BJWA 3R7WA 4FD2A 1G3IA 2PMDA 4O0MA 4AK9A 5DI3B 4PPNA 4DSTA 4F93B 1NBMD 1VG9B 2EWWA 3CF2A 4XH9B 1YRBA 3QNUA 4IOJA 1GAJA 2HLDD 4LCBA 2AFIE 2QQEA 1AKEA 3K53A 4ZDWA 5J4LA 3THWA 1Z47A 1FTSA 3I4LA 2IYXA 2V54A 1A2BA 3PQCA 2O8FB 3B2EA 1QRAA 3GJ7A 4FXPA 3AF2A 2QT0A 1DADA 1CJKC 4QL3A 1T3HA 2KB0A 3EA5A 4C0KA 4DC9A 1UJ2A 1T5LA 1WDTA 4JSTA 5CYPA 3LLUA 5ANRB 4Q02A 1TU4A 4NL4H 3TIFA 2WMNB 2ZE8A 1YR6A 3R9IA 1Z63A 1LVGA 4Q1AA 1KY2A 4M1SA 5CLLA 1HY3A 1XX6A 4JL8A 5EXTA 3RABA 3W8RA 3KB2A 2OLJA 5C4MA 2GXQA 2CE7A 3OE7D 2FFAA 3FHTA 1NVWQ 3W6NA 1GL9B 1GNPA 2ODNA 3BWDD 4N0EA 1M8PA 3QXCA 1KO8A 1XU4A 2IL1A 3B7GA 3B9QA 3U44A 1LY1A 2VIIA 4B74A 1JALA 1EGAA 2QSYA 1MO6A 1R8SA 2ZRCA 3OAAD 1H8HA 1A7JA 1VIYA 2ZRGA 4F4CA 3R7WB 2QMEA 3OEEA 2EWVA 3AVVA 4Q4JA 2XJ4A 5KNDA 1GWNA 2BEKA 3BH0A 1KO1A 2WICA 4M53A 1KMHA 1DAIA 1E9SA 1OXUA 1XD2B 2WZQA 4Y0AA 1G6OA 2AD5A 2X2FA 3SJZA 4PC2A 1JI0A 4QKQA 1MV5A 2YHSA 3KXKA 4TTQA 5A4JA 3KUDA 3PFIA 2CL7X 3NBZC 4B35A 1FQKA 2W6JD 2JJ2A 2RHDA 3ZZUA 1F2TA 2Q6TA 4QM7A 3UPUA 1NG9A 3B13B 1E2GA 1U90A 3T35A 4RD2A 3I73A 4MUAA 1SXJE 1HE1C 2Q9AA 1ZCAA 221PA 2Z4SA 1SKQA 3X1XA 3TAHA 5L3SA 2P65A 1JEEA 3SFVA 5EE9A 1R5OA 4DB2A 4PPQA 3KJIA 2GJ9A 3A58B 5DIFA 5AJWA 1JAHA 4TLCA 3X1WA 5BYJA 4HDQB 2RGAA 3U3RA 4DSOA 4LHWA 1S2MA 5JCZA 5F98A 2AXNA 2ZI7A 5B2ZA 4BGDA 2VPPA 2VSFA 2HLDA 4EFLA 2ZSEA 2WWWA 2FH5B 3EA0A 3LXRA 5EP2A 3KQHA 2ZRBA 2ZRLA 5JECA 2D06A 2OFWA 3BH7A 1XJQA 1Z08A 4CGZA 3KL4A 2GEVA 3N5CA 4BZPA 1UAAA 1P2SA 3IKJA 4JKYA 1ZUNB 1WA5A 1E9BA 2ZJAA 1W4BA 1E9AA 3OFNA 3GMTA 1LV7A 5KYKA 3QF4B 4U02A 4NCIA 2ATVA 3CONA 1X1SA 4ZV4A 3TH5A 4ASUD 4YMVA 2QEQA 1KYIA 5CK4A 1FUUA 4D0LB 1GRQA 1LB1B 3PCRB 4Q9HA 1WBDA 1KAOA 2WOJA 2XOKA 2J7PD 4XD7D 1E2QA 2IEYA 5FI0B 1NVXQ 4FINA 5C46F 3WBKA 5FOUA 3UMSA 3EPKA 4V02A 1KK2A 5EXSA 2ZTSA 4KBFA 4MH0R 2GCOA 4QHYA 3V4FA 2BWJA 4XJXA 5E3HA 4I81A 3D7MA 4V0OA 3NWJA 1VCMA 1FPMA 4HLUC 3UK6A 1IAQA 1YJ5A 4D80A 1TADA 2F3RA 6Q21A 3BS4A 5JRJA 2OXRA 4GP7A 2NIPA 1IXSB 2WJIA 2X8AA 3I92A 3A4NA 2IK8A 3AB3A 3I62A 5G53C 4ABYA 5L3RA 1M7GA 1J8YF 1JQJC 1XPRA 3AP1A 3BH6A 4HLQB 4YMUA 1NG1A 4OI4A 5J4KA 2R6DA 1ZU4A 2HJGA 2PCLA 5CB8A 2ORWA 1TF5A 1N25A 3I1FA 1W4CA 3BFVA 2ZRMA 4ZIRB 4HLDA 4RZ3A 4TZ0A 2QGNA 1S96A 5FPHA 4ZIRA 3ZZ0A 3ND8A 5JI2E 4DDWA 2J46A 1E9DA 3CRVA 3VR1A 2ZEJA 1VTKA 4HI0E 4JLMA 1CJTC 1LF5A 2ZS7A 2GBLA 1IN6A 1XTKA 2GEDA 2R6CA 4CDGA 1JR3D 1D9ZA 3I72A 5AWFC 1AGRA 2ONKA 4EPTA 2I3BA 3K8YA 4C0LA 2WSSA 3IGFA 4Q4LA 1L7VC 1ZD9A 5CITA 4PFSA 1VMAA 4QJ4A 3SOPA 2J41A 5F9FA 2JJ1A 1TX4B 3AUYA 4OHXA 1W5SA 4DWJA 2IS4A 2ZRKA 2EFGA 4Q5IA 1N5IA 1ZNZA 2OUKA 3FMIA 4M1WA 4BASA 4AKIA 1COWA 4X8LA 4DZZA 3E1SA 2QAGB 4IFEA 1E79D 3SI7A 1XCMA 4DLZA 4US2R 5KHOC 2RHMA 3PJRA 3FMFA 1MABB 3LVQE 3H86A 3SFZA 1C9KA 4MKHA 4W9MC 2IUSA 1UKEA 1F5NA 3B82A 1K5DA 5EJEA 2ZRAA 1OH5A 1QHNA 1IY1A 3LX8A 2HUPA 2OT3B 2OV2A 1Z2CA 3CRRA 4YC7A 1R5NA 4M1KA 1ELOA 3EASA 4U7DA 1G5RA 5JS8A 4PAOA 3A1TA 1D2MA 2FGKA 1FFHA 4LBWA 3OHMA 5GJVC 4NBSA 2FA9A 3IHLA 1JAIA 4PHHA 3QG5A 4AC9A 1W36D 1J90A 1GIAA 2QQ0A 3IPYA 4KAXA 3U3JA 4C0JA 4DDVA 4OHYA 3ETLA 4ZCIA 4JT2A 3FE2A 2JGNA 3HYRA 2HDNB 2REBA 3KUCA 3B1VA 4HB0A 1AGPA 2GVDC 2AWNA 4ITRC 4LGMA 5DSZA 2D3WA 2W00A 3KDSE 3P4YA 2WVJA 1GKYA 4EPXA 4CZ2A 2VL7A 2WWYA 1DG3A 1ZNWA 4FIDA 4Q9KA 1ZCBA 1P5ZB 2F9MA 3PR1A 1W36C 1TUIA 2CK3A 2ZUCA 3ZIAA 2QE7D 1ZINA 3L2OB 3C41J 1DELA 1HUQA 1VHLA 2ZITA 5K8UA 2IF2A 4IDOA 4E07A 1KDOA 2PMKA 3OE7A 1XEFA 4P32A 4B76A 5K8LA 1YQTA 2NO1A 4NMMA 5JHHB 3Q7PA 2IYRA 1M7BA 4PTLA 1NY6A 3K0AA 1ZAKA 1R0XA 3QPWA 1I2DA 5AJYA 1OW3B 4LOAA 3SHFA 3GEHA 4MRRA 3RS2A 4BLTA 4PX9A 4WAUA 4QHTA 2LKDA 5TXGA 2O8EA 2W0SA 2OZEA 1UADA 3MLEA 4US1R 2WWIA 1OB5A 3AF3A 3EZ9A 5TB5A 5IDVA 3VR5A 5KNBA 1JJ7A 1J7KA 2IYVA 5KNCA 2QTFA 2GEUA 3IQXA 2D2FA 4Q4AB 1ZM3A 4UXJA 4Z1MD 2DYKA 4HDOB 4OYHA 1HQYE 521PA 3TSOA 1P2VA 3RRYA 2FG5A 3Q5EA 2AL7A 1AS2A 2IYTA 2JDIA 1F48A 1P73A 3ZD6A 3LO5A 3T61A 1Q1ZA 5CDFE 1L4UA 1KI3A 1FQJA 3AGQA 3SC3A 5JWHA 1IQPA 2EFHB 4IFBA 4DVGA 2L0XA 2AXPA 3AM1A 4B44A 1UBEA 3MSXA 1WP9A 4LJYA 2ZI4A 4NCHA 4JLAA 4TLAA 4ZKEA 1GILA 1W47A 3EWSA 4W5WA 4B48A 4A15A 2ZS8A 4FWIB 1MRNA 5KTYA 4MDFA 3ICEA 2BCJQ 4FW9A 2ZYVX 5AR1A 3SE0A 2Z6VA 3RS5A 4PHTA 3X1ZA 1FX0B 3WNBA 4F4JA 1HT1E 2ZJBA 3BB3A 1GTVA 1XEXA 4QGFA 4QBGB 4Q9JA 5B30A 4RCYA 4GOJA 3I61A 5JJLA 3KFVA 4W5JA 4XTRA 2IXGA 4R71A 4LY6A 1XJ0A 2ZJZA 2YWFA 1CJMA 2MMGA 2ZJOA 4AI6A 2IYSA 3NTUA 1AQYA 3TUJC 3R9WA 5EUQB 1GG2A 3KKNA 4U5XA 2XAUA 1GSIA 2QMHA 2XNDD 3LBIA 4HLCA 2H5EA 2N42A 3QKSB 1SXJD 1TQ4A 2CE2X 5FBWB 1PZNA 3FHCB 4HEJA 3S1AA 1A4RA 2B7CA 1QBKC 3N70A 1MH1A 2WAXA 3SJBA 1FMLA 5FR1A 1PLKA 2WPDD 4OL0A 5A5GA 3K0FA 1XDBA 2I1VB 5H70A 3K0FB 4DB4A 5G3ZA 4URUR 3RRNA 3B5JA 1XWIA 3K0CC 3NXSA 4D2IA 1IHUA 2XB4A 1TF2A 1TQDA 2PLRA 3P27A 4PAQA 5DGXA 4CIDA 1KI2A 2PEYA 3U4QB 1P60A 4BEJA 3DO6A 1Z06A 1R4AA 1Z0JA 1QG4A 4WIAA 2JLVA 2BJVA 1CIPA 3U3MA 4A8JA 1N6RA 3Q72A 3CF6R 721PA 1G8GA 2AK2A 3F5FA 3CLVA 3G5UA 1P61B 2GDJA 5DHAA 1RFLA 1M2OB 1G20E 3HP1A 2FPLA 3T34A 3TBKA 1EFRD 2GTPA 1YKSA 1OV4A 1OXVA 4BFYA 1P2TA 4QXAA 5BN4A 1G8HA 3U60B 3MMPA 2CNWA 4KVAA 4M22A 2G77B 2ZAMA 2R62A 4XD7A 1T8UA 2GJAA 3Q9LA 5KOYA 3FKSD 1QHGA 3SNHA 4A6XA 2JIZA 3QKTA 4DCSA 2VSOA 1DPFA 1RE0A 1W4RA 3UWOA 3WBJA 3ZH9B 5BWMA 2QAJA 4V0KA 4XVUA 1KJWA 2V6IA 5CM9C 2GCOB 4X8OA 2ZR0A 3TR5A 4BFSA 1Q22A 2IWHA 1DS6A 1FZQA 3A1SA 2Q3MA 3ZVNA 1U81A 2MSDB 2GESA 3DM9B 3OEHD 1F3OA 4RD0A 2ZQ5A 4PC1A 4HSEA 4E09A 4P33A 1J70A 2B21A 2JASA 1F2UA 4GPTA 1C4OA 4IKEA 4ZCMA 2NO7A 1N0WA 1E2FA 4OHZA 1LW7A 4EPYA 1E1RA 2GF0A 3CNNA 3PG5A 1M6NA 4TQAA 3U2QA 2QMUA 3MWYW 2BCGY 5FOSA 3LWNA 4MITA 1E2DA 2IEZA 3GJ0A 4G5QA 4WA7A 5JJKA 3AKYA 2AD1A 4LRWA 4BFUA 4R2HA 4C2TA 5GJBA 4MGYR 2ZXUA 2QNRA 2ZE7A 2O0JA 5JEEA 5AJVB 3TSWA 4YQFA 5BN3A 1J2JA 3GEEA 1Z28A 1X6VA 1NF3A 2FNAA 2GHIA 2MSCB 2ZJ2A 3W9YA 3WMGA 1OXXK 1QHHB 4BEBA 3PENA 3KXLA 4IOKA 1XBTA 3AV0B 5J40A 1N6NA 3KJGA 3GP8A 3GFOA 4LPKA 3FVQA 2HXSA 2OHFA 3AVYA 4TYYA 3DKVA 3VTKA 1CF4A 3FFBA 1JR3E 3KB1A 4Q1FA 3B6EA 3M4YA 3ZYCA 1N2CE 1NKSA 4MYUA 4OJQA 3R9XA 3MWJA 4Q9LA 4TZ6A 3C8UA 3OAAA 3C5CA 1TEXA 2IYQA 2QROA 1NN1A 1R0ZA 4O2LA 1HYQA 4U00A 1UKZA 2Q21A 2JLUA 5KUTA 2V6JA 1XFAA 2KJQA 3TQFA 3LLMA 1Z3IX 2FSIA 1EFUA 2E9SA 4ZI2A 1KK3A 2GXAA 4EPWA 4F7WA 3V9PA 1Z07A 2QENA 5BN5A 1Z8FA 3HU2A 3GLFE 4LHYA 1BMFA 1SVSA 3U6KA 4IVRA 2J7KA 2KE5A 1DO2A 4NU0A 1OFUX 3VQTA 1CEEA 1KI7A 4CEHB 1GFIA 2WV9A 2F7SA 1U99A 2ZRNA 1N5LA 3UATA 5GVSA 3UWKA 3NBYC 1D2NA 5BYKA 4JVLA 4BUJA 2RGCA 1UKYA 4KFSA 3IO3A 3PEUA 1UDXA 2FFQA 3FB4A 5DE3A 4PHGA 2N1BA 3OIYA 4JLOA 4TT3A 1IN8A 1HE8B 4JLBA 4XVRA 3K0CA 5DNYB 1CR2A 4RD4A 1G7SA 5KO2A 2W6ID 4R9UC 2OCBA 4UNSA 2ODWA 4HAUA 4LYFA 5FI1B 4GL2A 4GP6A 3MRSA 1OYYA 1K8RA 3AP3A 3C7KA 3ADCA 3RDPA 2XGJA 1W0KD 1NLZA 1W1WA 2J7PA 4D81A 1KI1A 3GJ8A 4MQBA 4URYR 1Z22A 3D8BA 4A8JC 3DZDA 4DLSA 3GJ3A 2RGNC 1KDRA 1LNZA 4ASUA 4JLPA 4EJSA 1AJEA 1G19A 4TTRA 1E4VA 4US0R 2ZSBA 5TV2A 2YZ2A 5IT5A 2JJ8A 4IDNA 1I4TD 3BB1A 2QM7A 3AKCA 3QXJA 1Z6AA 4TT3D 4PSAA 2WJJA 4M9QA 2AR7A 1Z0FA 4Q7LA 3M6AA 3MCAA 3VHLB 3CRW1 3GFPA 4Q01A 1N6PA 2WKQA 1E0SA 4TTPA 5HCIA 1KI6A 3MD0A 1HURA 4WXPA 4ZDIA 3PEWA 3NG1A 1JPJA 4M9XA 4TQUS 5DHFA 3A4MA 4GSYA 5FFMA 1XXHB 4QJ5A 4RZXA 4WOPA 5LB4A 1US8B 1OJLA 2ZPTX 2FN4A 4ARZB 4XVQA 2DWOA 1AA9A 2JLRA 4L9SA 1XTJA 3NKVA 3P32A 3AVTA 1G21E 2RB4A 4FMDB 4OHWA 3W3ZB 1EX6A 5EE3A 2QN6A 3NDBB 4OK6A 1J8MF 2P0EA 1XF9A 2QI9C 4LC0A 2ZI6A 1PVOA 4F4IA 1Z0AA 4TLBA 1RRGA 3ZQJA 1L4YA 1ZMXA 3BJIC 3VHXA 1F2TB 3U6BA 3SBDA 2KWIA 3KQUA 3VKWA 3RS0A 2ZR7A 4I99A 2XZLA 1TMKA 1T0HB 1EFCA 2EFDB 4EJSB 1BIFA 2DFNA 1AM4D 3QUSA 4PC7A 2JJ1D 3LQRA 4R2IA 3JZAA 1D8TA 5G3YA 1XPUA 5UKDA 4OI1A 2WSSD 2R44A 4JLVA 4JLKA 2ZREA 2R6AA 2FPKA 1WF3A 5FPYA 2ZJYA 3HR8A 4Q00A 5FUVA 3AF1A 5GJWC 2CMKA 3VR3A 4QOSA 4GZMA 4QNMA 1Q20A 3L82B 3NHAA 4MYCA 4UNRA 2VH5R 2PZGA 1SXJB 2QTVB 3T1OA 1U8YA 2RGBA 3E70C 4LYJA 1X8LA 3UANA 3L0PA 3T1VA 2ASEA 4FWTA 4P3YA 1Q12A 1QVRA 2VP0A 4S2EA 4DSUA 3FHOA 4HYYA 1E32A 4B3BA 5C2JB 2GXSA 4NTZA 3CPJB 4V0ME 4LJ8A 1E3MA 3QE0A 1TQ2A 3BD9A 1KDPA 2QG6A 1G7CA 1KSFX 1X8JA 1G4AE 3AP2A 3KJEA 3FYHA 1R0WA 821PA 1A5TA 4RD1A 5DI3A 2H57A 4K46A 3L0IB 4MRVA 2BMDA 3AVOA 2QAGC 4I1UA 4PO8A 1E79A 2VP4A 4LJ5A 3THYA 4RY2A 3L0SA 3GLGB 1MR3F 1Y63A 4C0SA 2F1RA 5B58C 2H1LA 2LWIA 2YC2C 3TK1A 3M1IA 4BRWA 5L3VA 3NVAA 2BC9A 4B3GA 1PUIA 3IHWA 4JT4A 3O8RA 4C3ZA 3PEYA 4A4DA 2WSMA 2RKOA 4B43A 1E9CA 1GNRA 5AUNB 3QPUA 4O25A 3MAAC 4D0NA 4YXWD 3GLFA 3QXSA 1RRFA 4RCZA 4NCNA 1NIJA 2RCNA 5P21A 4DLVA 1NY5A 2ZU0C 2GZDA 2XXAB 3L43A 2A5YB 2J59A 4IXNA 1EFRA 1AZTA 5C4GB 1KK1A 2BVNA 3WYAA 1MO4A 1VCNA 2J0VA 4YONB 1R6BX 4LDJA 1G7RA 5EQTA 4JMPA 1V43A 4PXAA 5FPKA 1KSJA 2VF8A 2C9CA 2XX3A 4JYCA 2RGNA 1GKIA 3I5XA 1GP2A 4GMXA 2J0UB 1VIAA 4C4PA 2OCYC 4JZKA 1OSNA 4LV6A 3K70C 1OFTA 5ELXA 2VSXA 2YJTD 1U8ZA 1OKKA 4A2PA 3KKOA 1GL7A 1RYHA 1NL3A 3SEAA 2OESA 2DBYA 1P9RA 3GD7A 4M8NE 2IW3A 3JVVA 4M1YA 4WZ6A 4Q7KA 3UMFA 4GDFA 3FPAA 4PSKA 3BIFA 4MDEA 1XD2A 4LSGA 1E2NA 1RRPA 4J0QA 4LZZA 1OIWA 2ZYWX 2FU5C 4A82A 3A8TA 5H68A 3WP1B 2A78A 4PHFA 2NQ2C 1XTRA 3QI2A 4GZLA 1KJZA 2BHRA 3ASYA 1N0UA 4TWZA 5LBIA 5JSZB 1K5GA 2G9NA 1D6JA 1YE8A 3NH9A 4EFNA 1AQUA 2DB3A 3DL0A 1LS1A 3R20A 1W36B 5FR2A 1P9WA 1VYTA 1I2MA 3RC3A 2HCBA 2FZLA 2F6RA 5G40A 3LBHA 4JLDA 1G5PA 1PJRA 1PLLA 1S1CA 2G3YA 2VP5A 3DEFA 2WWXA 4MA4A 1UEIA 4MYHA 4MRSA 1OPXA 4NPHA 4NYIQ 4WW0A 5FL3A 1YVDA 2FX3A 2OAP1 4NKRA 5HZKA 3UG6A 1NSFA 2O52A 4DLXA 2QMOA 1KOFA 1NMXA 4O2RA 1YHNA 3QVUA 3W5IA 3Q3JB 2CVFA 3SJAA 2DCUA 3VFDA 2Q3HA 2OO7A 3E5HA 2QTHA 1ZRHA 4AG6A 3NC1C 2R65A 5KSZA 2QZ4A 3RS7A 4RKFA 1RVDA 5AJZA 1VECA 1MABA 1W2GA 1D2EA 3T1QA 1DAMA 4S35A 2WAYA 4KYIB 2IHYA 1ZD8A 3X2SA 3MGCA 5LPNA 5L8VA 3NH6A 1P75A 3KFXA 2G83A 5EP3A 1GITA 1KAGA 2OILA 3L0OA 2A5JA 3L8ZA 5FOVA 3U7HB 1VKJA 3EXAA 2O8CB 2B6HA 2VHTA 3DPUA 4HZIA 5JZVA 3CM0A 4YDHB 2V1UA 1II8B 4DBLC 4JL6A 3HR7A 1U9IA 3IIKA 3Q5DA 4DIDA 3ONWA 4EAQA 1VDZA 4C2UA 1R0YA 1CP2A 1COWD 1DARA
chains in the Genus database with same CATH superfamily
5L40A 1YHZA 1QG2A 5ADUS 4PR0A 4Y6QA 4R54A 1D0VA 3OLZA 3VVMA 1C81A 3WOVA 4QXOA 2J5XA 2ZDGA 1GUDA 1NN0A 2YHBA 1FFXA 3DEIA 5K5EA 1MOSA 2YUIA 1ZL0A 4IO0A 4OQMA 1Z4IA 3D5QA 1B23P 1VCIA 4RABA 1DAEA 2DEUA 4KQKA 3HDQA 1CCWA 1RWXA 3RHFA 1K63A 2YYYA 3ZXYA 2H18A 2AC7A 3HKDB 2GARA 4HGZA 2VQSA 3TLBA 4V39A 2Q45A 1V16A 2XE6A 2Q0SA 5HVNA 4TVKA 4CMGA 4D5EA 4S1NA 3ZEAA 4DADA 1HDGO 1LZKA 2AOXA 3TIXB 3T06B 1ZITA 1GT6A 2XA1A 3H4VA 4BE4A 5EMNA 1I6MA 3P9YA 4C4SA 1FFSA 5JCPA 5CEFA 5EWJA 2ZRHA 3CNOA 4KV7A 1ZXXA 1X1RA 3H0EA 4E5UA 3DJYA 3DDHA 3NS7A 4NBTA 4WSOA 3A2NA 3FOZA 3LFTA 3F74A 2YH2A 2CHQA 5EA2A 1XMXA 3I28A 4BIMA 1V4NA 1COZA 2G63A 3RS9A 1UBGA 2Q4DA 3G9QA 1JDPA 1ZH6A 1QUEA 3U80A 4AS2A 4YY3B 4ETWA 4CKCB 2WIJA 3D59A 1T8SA 2W2XA 3UJNA 4DMGA 3EW9A 4N3AA 2DOKA 4I2NA 4KV9A 2Q28A 5E3IA 2HA3A 2JFQA 3DZHA 3ZGVA 1E3DA 4G0NA 3ZS9A 5JVDF 3FGOA 2JZCA 3HE3A 4CMHA 2CKMA 5KWEA 1BHQ1 3QOFA 4N4AA 1KS9A 5FWDA 3KZCA 3ZGLA 2GCIA 5WRFA 3HSYA 3PX3A 4ON9A 2Y1CA 4WGGA 4FB5A 3C5VA 5HKBA 1AQJA 4LKRA 3GDOA 1DAHA 1IMOA 2JCBA 3FMOB 3N8HA 4O4HA 2XEXA 4UCXA 3TGPA 1LPAB 3THWB 3TG8A 1Z5NA 5U9CA 1S4QA 1TQ8A 4XRGA 4QU5A 1DP4A 1AHPA 4ZRDA 3RANA 2R1TA 4I5EA 3O8CA 5AI5A 2J09A 4ZU1X 4ETMA 1GKKA 1MIOA 4RH0A 1DEOA 5K0FA 1GDDA 1SO8A 2EW1A 1KI9A 1XEWX 2CXUA 2W4QA 4QDUA 3P5BA 2WD7B 4YTEA 5JAOA 1H3NA 3RJ5A 4EY8A 1H2HA 5BW4A 3JQPA 5HOQA 3B3GA 4NMHA 4Q3LA 2I8CA 2VZEA 4ME6A 4RULA 1EZ4A 2P91A 5K2MA 4LC1A 4GKVA 2V03A 3JPWA 1HT2E 4DBZA 3IQIX 4HDRB 4Z4IA 3TLYA 4P36A 5IYZB 4EB8A 2WIKA 1RQRA 4B4WA 1TL7C 4RVGA 1RZRA 1GARA 1PJZA 4YLYA 4M9CA 1HKHA 1EFPB 4EF6A 2JIQA 3OCYA 1BRTA 4U7FA 3CUSA 3T4EA 1P9NA 3TNFA 4O08A 1EA5A 2IPOA 2JIMA 4B4DA 1WCV1 4G8DA 5JWRA 3ENZA 1A8HA 3I9JA 3IAXA 3QKSA 5CJPA 1G17A 5HBRA 3UXHA 4AROA 4QJBA 4EB6A 4L6CA 2SECE 3QPVA 1U2RA 3PEFA 4I2VA 2EG5A 5F9HA 3LCVB 2NTYC 3KPJA 5J5CA 3U4CA 3V8PA 3BHIA 3PVZA 1SB9A 1VL1A 4HCJA 1X74A 1AQLA 4JHLA 4RJIA 4LRTB 5KDDA 3KSZO 3U7EB 4KK4A 1TUBB 2WM9B 2VRCA 4CM1A 3E0XA 1B0ZA 1R1DA 3D4LA 1IN4A 2O0HA 3NBFA 4DIOA 1Y7HA 4S0ZA 1FDSA 1ZK2A 4D44A 3KT8A 3EZFA 4IJMA 3U26A 3C5HA 3I32A 1CJSA 1D1PA 1YI1A 1C7JA 2G8LA 1NAIA 5LMCA 5IAOA 2H85A 3K0BA 4QYSA 4BE7B 5LQMA 2GJKA 2FW0A 1A50B 2I22A 2JD2A 2VHXA 1S2GA 5I9LA 4IHQA 2YJ6A 3LA6A 1L7NA 4PQFA 1E3SA 3MBIA 4UDYX 1XDUA 4UDXX 5ABPA 1JMYA 3DL2A 4PS0A 2JFGA 5DLQC 5BMVF 2IX3A 1V7PC 4RKEA 2K7ZA 1O94A 3HUFA 2EFEB 2I62A 2VQFB 3O73A 1MO5A 2QGFA 1J99A 1TCBA 2FEMA 5IYZF 5CFPA 4CL2A 3M0EA 5EWMA 3BWYA 1B14A 4BQRA 1A88A 5HJ5A 4B7ZA 1DDGA 1D5WA 1UCFA 3F90A 3CGWA 1UOEA 4HY3A 4E2WA 4ECEA 2BBSA 2GRJA 2ACVA 3E4CA 1G8KA 2WNIA 5JHGB 4B6FA 2BP7A 1M6YA 5I7SA 1GCUA 2TS1A 3IB6A 3QQ5A 4LXQA 2WUFA 5KMGA 1CR6A 4FHDA 1SKYE 4A36A 4I9HA 4F91B 2QKYA 3KQNA 3GNQA 1K2WA 1L7MA 1MV8A 2CHVA 3K9CA 1C1XA 3SMQA 3W7BA 4LJ9A 2E4ZA 2P2YA 3HB0A 2JGFA 3E53A 2Z1NA 4L5IA 4IUCS 2IPXA 2VDMB 1JU4A 4RDHA 4RZ2A 4AW9A 3D1VA 4MQFB 3EVFA 3L92A 2CL0X 1JNYA 3O2QB 4CDMA 1LLUA 3N2EA 3PXAA 4ND8B 4EATA 3GUHA 4F5WA 1SVOA 4OQXA 4EKEA 2FLKA 4ZVPA 6REQB 3FOWA 3VVBA 6NULA 1IULA 4KFTA 2QAIA 1LSJA 4FD3A 3QXGA 4LBVA 1YZ3A 3MCWA 1MQSA 3N2LA 2ANBA 4LXIA 4U2EA 3UIEA 4PVDA 4EG7A 4UJ3A 4IGKA 2ZZNA 2OENG 1RP1A 2C84A 2W6QA 3BN3A 5LUBA 3VMMA 4CG2A 4DLTA 5KAPA 2ZG6A 3ESYA 1UFQA 3AERB 4Z4GA 3A6PC 2BM1A 4ZJYA 1BE8A 3M6MD 3CUUA 4FWBA 3NTVA 3JR7A 1V3QE 2GWHA 4Q3DA 4BLSA 3I9OA 4FS8A 3U9SA 4ZI7B 4MX8A 5CB6A 3G9UA 1S4MA 3E3LA 2QPLA 4UVIA 3OECA 1EK2A 4XIFA 3ERCA 4G37A 4UTXA 4HGQA 4ARBA 2IHJA 1N6IA 2JGMA 1NRWA 2CDRA 3TW8B 3IALA 2FUNB 1AKRA 4RVSA 2PUFA 5DSTA 2QPAA 3CV3A 4Y9DA 1KGDA 4WZAE 2FZKA 3AJ8A 4XQ0A 3VNAA 4LFBB 1ADJA 1WUTA 4RVCA 4PPYA 5BSVA 2ZIGA 3WISA 4L9RA 1U1GA 2GKSA 1GPDG 1LBSA 2IPMA 2VDLB 3NETA 4B09A 1P0QA 3DLAA 2I66A 1OXSC 4OGKA 1CY1A 1TUEA 1Z2PX 2G9QA 2P3LA 3QJ5A 3S44A 3WWCA 3ZHXA 3ZCPA 5CFRA 1U7ZA 2PVSA 2FFBA 3LNTA 4TKVB 4TSFD 3FMPB 1MKYA 3P71T 3C7AA 3HTXA 1GZSA 5E7MA 5KKCA 1YRQA 1BHSA 1NJ2A 2A30A 1CY6A 3R0ZA 5JCOC 1T2DA 2G0NA 4JVNA 3KT6A 4NQRA 1SZJG 4HYQA 3IDOA 1WPXA 1UJ5A 1C1DB 2Y1WA 2VQ6A 3OVMA 3DF9A 4IRUB 3MJHA 3WBFA 5NULA 4MW5A 4NMWA 1T34A 4EJFA 1ZU5A 3HKCB 2QUJA 2H06A 4FCTA 1KP9A 3DKKA 3OFND 5ALHA 2V7QA 2PKEA 3DOUA 4M9UA 1KOLA 2FEKA 3FNEA 5CFZA 2XT0A 2ZUSA 1AIPA 3ZWWA 1RYMA 1F51E 1FDIA 1G5HA 4BNUA 4Y2GA 2AOWA 4KDCA 3DDCA 3MJ4A 3D43A 2C3UA 1S89A 1BH2A 2WWTA 2IUFA 2RH8A 1D3AA 1YS1X 3ZTYA 3IKMB 1RKVA 1J21A 1F7UA 4IDDA 3DBVO 1CS4C 1P5RA 4L76A 3TCKA 4PE5B 1QYWA 4UEWA 4FCVA 5J47A 4OK3A 1KPHA 3FCSB 4BHTA 3G8YA 2F55A 3FVWA 2CMFA 2OZPA 1Y81A 4NONA 1DWPA 1Q44A 2UZ1A 4L22A 2ZM5A 5ALGA 3Q0IA 5IM4F 2X5XA 1T36A 5F2EA 1YO6A 1ADCA 4FZVA 5A4IS 1QCCA 3NDIA 4C4RA 3JPYA 2HQSA 4ROSA 4GM1A 4IDFA 4KCGA 4C0HA 1WS6A 4KGXA 3W6ZA 3NORA 3OQOA 1WDKA 2R0QC 4EAAA 1DQPA 4NEGA 4JL5A 4ISBA 5EMKA 5KREA 3CZRA 4L27A 3ZDAA 1CR4A 2CY0A 2AEFA 1WMSA 2V7GA 3QIAA 5KNBH 2JI9A 3NTLA 4PG8A 3IAM1 1HQKA 4R01A 1I3KA 2V1XA 4UU8A 4MUFA 3RAFC 1WSBA 1J9GA 2UYGA 3MMXA 3CPEA 1KBOA 4KYUA 1M1YE 4OUKX 4X90A 3CWQA 1V16B 2GBGA 3EISA 3SWWA 4HNUA 4ZOLA 3AXSA 1UEJA 3AJDA 1JG3A 2I76A 3EGDB 3UCXA 2ZPUA 1ONOA 1FZTA 2EGGA 4HFJA 4K6FA 2XDYA 1VXRA 3ZY4A 4CW7A 2EEPA 1XDSA 2VK1A 3O8LA 1VG1A 4J29A 1SKMA 3B60A 3I5MA 2XYQA 3C7CB 5F1OA 5FCDA 4FN4A 3RSZA 1GTG1 4B0OA 5KTNA 3KS9A 1IBCA 1ECJA 1X9IA 1XYGA 5DGHA 2D5CA 5ITWA 1U5CA 1SD5A 1WXIA 2PZAA 3ECSA 3FYTA 1M8JA 1RQXA 1UBKS 1AT1A 1XZLA 3WB2A 4ER5A 1TJNA 4YJ3A 3HABA 3MW8A 3A3PA 4GBED 3TX6A 4WNCA 1LFDB 2H2HA 4FC6A 4JUDX 4C01A 2PS0A 4L50A 1VSBA 1K8ZB 3KPWA 5EIFA 4G5SA 4ALMA 2BFAA 4ZHQA 4R41A 2JBAA 4OFWA 4BCCA 1LW6E 2IUTA 1T4MA 2ZB8A 5LKRA 2XA2A 2B1JA 3T5GA 4CM8B 1O9HA 3IHKA 2JAHA 4V2IA 1TPZA 2W0MA 2GSDA 1ETHA 2EYQA 3GPIA 3GRPA 5CT8A 3TI9A 3SIRA 5L7YA 4MICA 1GXSA 5SY9A 4ZOAA 3R77A 4EO9A 4UUOA 1I2AA 2UAGA 1RIFA 2EJCA 1MU0A 3VPXA 2BHNA 1CBUA 3EUFA 1IJBA 2DPGA 4EFDA 5KTSA 1TPYA 3QY9A 3U7FB 5EMMA 3O3CA 1JQBA 3FCUB 1B42A 1PP4A 2YC4C 4KE8A 1BKYA 1FQWA 1LLDA 3K94A 5AK5A 1P7VA 2JEYA 4FGKA 4M98A 1ONBA 2OBMA 5JSYA 3W5UA 1G20B 1E5TA 2NVOA 1G6KA 1FP4A 1K2VN 3CH6A 4IIXA 4J0CA 4H1VA 4Y0VA 4EO7A 1Q11A 2F3TA 3QVLA 3BK2A 4I36A 5JEDA 1OOEA 2YDXA 1QPBA 3PR3A 5CIQA 2ZWPA 2AFIA 3GWGA 4Z54A 1KO7A 2Q6IA 3H6KA 1KRHA 1XCOA 1YK0A 3H99A 3TSYA 1RC0A 3K6SA 1RLIA 4TYMA 3ZVMA 4PGGA 3HJNA 4C3OB 1L8XA 1KR2A 3DC2A 4KSCA 2E0IA 4U6NA 2HA6A 1NLYA 2DUNA 3U0VA 3W5JA 4Q47A 1P4RA 2VZ9A 1GO2A 2PZLA 3BYZA 2BMVA 4E7PA 4L95C 3STYA 1FTNA 2LXNA 4L3WA 1H93A 1ARZA 3Q6NA 1EAYA 3H3XA 2ZUDA 2G07A 3CBQA 2WT8A 4FR0A 1PAUA 1JXMA 1M5RA 4EB6B 1BOOA 3IIIA 2C59A 4Z51A 4QNNA 4HEA1 2XZDA 2AK3A 3K70B 3PV0A 4MV7A 1O94D 5BXQC 4OI0A 4RENA 3C3BA 1NXTA 2Q50A 1BCSB 1UQTA 1Z2OX 1LQTA 2ILVA 1Z17A 3DE0X 1F0NA 3UAWA 3WIOA 3Q3CA 4CRWB 1QYCA 2NU6B 3KELA 4MYTA 5IH3A 1RIIA 3S6JA 4OA5A 1I4LD 3EEOA 2A6PA 1MC5A 1WXXA 2W58A 2QP4A 5T57A 2I4IA 5JSZA 4YV7A 1VG0B 1KO4A 4AUNA 3LY7A 3RT7A 1ORTA 2XZOA 2J6CA 1CLEA 3DT8A 4B2IA 4CJXA 4WKGA 5BT8A 3ILVA 2C7PA 1EDOA 2R25B 3AY3A 5TRTA 3I04A 4J9VA 3CUKA 3T9CA 1HEYA 1ZGGA 1ZRSA 2CBGA 2EATA 3MEQA 1KI4A 3NVDA 4G8CA 3CISA 2V7BA 1WMEA 2IY9A 1DX6A 2ID7A 3WBBA 2QRPA 1PN3A 2FSVA 5DLPA 5K51A 4TUYB 4GLBA 4EZEA 5REQB 2VAMA 5SV2A 5JALA 1NE2A 1SBZA 1EX7A 2XJ9A 3LECA 1WEHA 2OMKA 4PZYA 4S2UA 3F3SA 3IV9A 4CMBA 3JATB 5F3RA 2JRCA 2NZWA 3P9SA 3NOVA 3CY6A 1FVFA 3K0KA 3W77A 4E13A 5NLLA 1AQ6A 3LYUA 4QUHA 3T5CA 2Q99A 1C7QA 3S2ZA 4ZK6A 2APJA 3I9NA 3OH8A 3PHIA 2AFHE 3CVUA 3HFRA 5EINA 3FOCA 4ONEA 1EXDA 4MWTA 3AOEC 3BJMA 1W44A 4HZUB 1YOVA 4AKHA 3GN1A 2ZIAA 4CF3A 4D6YA 2VA9A 3AKEA 1JU9A 2O54A 2IA5A 4FFDA 4X91A 4Y2VA 4RZUA 4Z9XA 2GMWA 3ZHBA 1G9XA 2NU7A 3T9DA 4AJOA 2JFOA 4QYIB 2QRQA 2IZZA 2GZ2A 2YRXA 3KWLA 3LO8A 3NHBA 1PZMA 4P4UA 5LOVA 4NJMB 1JDNA 3ES9A 3GP3A 5L3QA 2YTZA 2L19A 5CLQA 1PNVA 4DWOA 2ZM6B 3LPCA 1T8YA 3K15A 1RLMA 4Q4AA 5DBIA 4DUGD 3VU3A 3QUQA 3TG2A 1SKYB 5IUJC 5J2TA 2YYSA 2JFWA 5SYMA 3X1YA 1USIA 4WY5A 4AXBA 5L6LB 4BECA 5IK2D 3QVOA 1DV1A 3WK6A 3B5IA 1Q77A 1A04A 1X1AA 4IIFA 2IOFK 4UM7A 3ZVKA 1AS0A 1K6XA 5IJZA 3CX8A 2FPXA 4QECA 4AURA 1ADBA 4BMNA 4CFSA 1CEYA 4OQNA 2LR0A 4JVSB 4NP6A 5KAMA 5BQXA 5LQDA 3NW9A 4CLRA 1HDRA 4J0FA 8ABPA 4BB9A 4LN1A 5EUMA 2PX5A 2DCMA 2IU3A 1QHXA 3DMGA 4BCDA 2E4VA 4R6XA 4W5HA 1Y5NA 5K6TA 3CXUA 3DQPA 3NBQA 4PX3A 1SVIA 5TDHA 3E58A 3RVNA 4D9HA 2V8OA 4J0EA 1S0UA 1ICEA 4QNRA 3O5AA 1L9XA 4ZI7F 4RA9B 1TCCA 3QIVA 4FHFA 4PWZA 5TS3A 2UYQA 4OTZA 4GQIA 4IIBA 1XAJA 3LD9A 3CZPA 2HDHA 4HZGA 1R9JA 4YGXB 2UVQA 3EZLA 4Q1EA 2OBFA 5A4FS 2VDPB 4KVZA 3O9ZA 2O8DB 4MINA 4EY6A 2FEOA 1TVKA 4K6HA 4DG5A 4DSNA 1DRVA 3U7IA 1SNYA 3DSRA 2GN2A 3JD3A 4KGVA 3VX3A 2V7XA 1E0KA 1XFDA 1YULA 2MU1A 1L7DA 3QYFA 1TVEA 2EWMA 4JIMA 4XIYA 1E9RA 1IEWA 2ZUUA 2AHRA 4OJKA 4QU0A 5BO5A 5CURA 2NGRA 3PD7A 3O2NA 3L40A 2CV2A 1T9BA 4D96A 2JW5A 3EVGA 1LK7A 3DS8A 3RK4A 2YXNA 2KYRA 4GLLA 4KH1A 3UGKA 5L4LA 4KK3A 2VJKA 3D6FA 2GKOA 5EERA 3Q11A 3BUSA 3T41A 2LP4Y 3BWCA 1Z2NX 1E4EA 5BUCA 1A7KA 2HOQA 4HNSA 4JXJA 5K0LA 3ZU3A 3GGGA 4ZT2A 1M7HA 3IAEA 2H4ZA 2YIDA 1NM5A 4CPDA 2P27A 4EI8A 5KPJA 1XCGB 1B41A 1J42A 5KEIA 13PKA 2A1UB 1JDUA 3JQAA 1A9SA 2H7YA 2OCGA 5JAIA 1EVQA 1I5OA 2NO4A 4GPZA 4Y1RA 4MTCA 4XOUA 2W2MA 2YXLA 3A4LA 4UKDA 1SQ5A 4J7XA 4NATA 1QKJA 2WZBA 3FCAA 3INYA 2V9ZA 5IDWA 4LI0A 1G18A 1KMNA 5AJXA 4DIBA 5IU6A 2O7VA 5FL7A 4DCTA 1T35A 4C89A 1W0JA 5E95A 4EL0A 5C8XA 4PFKA 4LFAB 2QW1A 2BEWB 3LI2A 4MQ6A 1MW9X 4DJJA 1IJFA 2QMQA 2W2LA 4ND5A 3WADA 1BGVA 1OLSB 1H22A 2VHVA 5KBYA 1AUVA 3FH0A 4AY6A 1K0UA 3H2BA 5LQKA 4B3DA 1N3YA 4NC9A 2FTKE 1WMBA 3PPYA 3R8FA 3JQCA 3PUXA 2Q6KA 3KKLA 3UV6A 4GSKA 3QPCA 3D3NA 4MJ3A 4H7JA 2Z95A 4R9NA 2VSNA 1UPFA 3DDZX 4K5QA 2NZ8A 3WMFA 2ZUBA 2V45A 3RD5A 3WX0A 1NKTA 4NYMR 1RI1A 4PNZA 1RADA 3L7AA 3C74A 3HVUA 4ZK2A 3PWZA 5HKAA 1Z6TA 2BISA 3RK0A 5KI6A 5ILOA 2XB6A 3WWYA 4HG2A 4AJJA 3R5TA 2KQUA 4ILKA 4TMZA 3A37A 3U61B 2ZE5A 3C3AA 2WMOB 4R51A 4M1MA 3KU1A 4BU1A 3WGUA 2DQSA 4LVCA 1KYTA 4K0RA 2RGXA 4YP9A 3WTBA 1UDBA 4F56A 3TW4A 1E99A 4A2QA 1RM0A 1LTQA 5LMUB 1GEGA 4PGMA 4B8WA 2HXYA 5IN5A 5LQNA 2A3RA 4RDCA 5FV4A 1SGWA 2ZB4A 3E2PA 3ND6A 5FAXA 1H69A 5FOTA 2HRBA 4QZVA 1J4AA 3FTPA 3JWIA 4PLCA 2RH4A 4CNQA 1LEHA 2ORIA 1QHFA 1SQ6A 2QLMA 2H1WA 3DULA 4PSVA 5ALMA 1QYVA 2FSFA 3A6FA 4LYHA 2GN0A 1WUHS 2WWGA 1JB9A 3BXPA 5H3HA 2DKNA 4TS3A 3PD1A 5JXWA 2GNOA 2ZUWA 3EGWA 4E70A 5HR5A 3D3WB 4AIIA 5EKTA 2HWKA 2BBWA 1R18A 4JJAA 4R7GA 4ZXPA 2AVNA 1R3UA 4W8OA 4WOBA 3VYTB 1EUCA 1BJTA 2IUEA 3U16A 1VL6A 3LXMA 2XSZD 4TS4A 4MROA 4KREA 3MT7A 2OMEA 2PYZA 5FDFA 4H6VA 5EHZA 2NT4A 5HPYB 1XZ8A 1F1BA 3STUA 3UC5A 1TYZA 3RSSA 2GFQA 4KIWA 5K6RA 2PANA 3U39A 3EDYA 4V1CI 1P9LA 3GZ4A 3OWHA 3FPHA 3RBZA 2GZ1A 4IVQA 3R7SA 1P3Y1 4NFYA 5DX1A 4LJSA 1LRJA 3BE4A 3DBHB 5DP2A 5G0WA 5KNLA 4JJZA 1FYEA 5IAJA 3VNUA 2PKQO 3F9IA 1TYBE 1XRSB 3ASVA 1C3OA 4NI5A 4ZOLB 3SS8A 1QIKA 3LP6A 3Q1LA 2RHOA 5K0JA 1JE0A 4QBKA 5I6DA 1SRRA 4JN6B 4JP8A 1TJYA 4BQSA 5ALLA 1H9AA 1OILA 1KDVA 1DC8A 1G2OA 3WYGA 2CCKA 2AG1A 3LHSA 3TLGB 4C7OB 3RG2A 4FYMA 1QHYA 1T91A 4B32A 4D4LA 4XOIA 1V0JA 3RSLA 2HEGA 2QR5A 1R6DA 2QX8A 4O4JF 4ZTZB 3I52A 2ZW9A 4A0QA 4KLAA 3PSAA 3ZWMA 3O82A 2IEIA 3DFUA 1TU0A 3KHKA 3KZKA 1KSHA 4LJ7A 4DLUA 4PTYA 1DOAA 2H92A 2XZTA 2KSQA 2WJGA 3GJSA 4JI1B 2A5FA 2Y0PA 3SQWA 2PH1A 3Q12A 4EVIA 3H1TA 1U31A 1YBHA 1CZOA 3R0XA 5T5QA 3I9LA 2W70A 4YDQA 2R8XA 1IN7A 4BWVA 2JKYA 1CUXA 3HO8A 4DXAA 2G4VA 2XWPA 2JFNA 4AYTA 2HQBA 5JFGA 2DBVO 4YV1A 4UUBA 4Y7DA 2BSQA 1XZQA 3LZCA 2FW1A 2G82A 5B3KA 1BS2A 5IVKA 3QEKA 1K7XB 3PQ7A 4J0KA 4ZYLA 1T8TA 3P1JA 4F3YA 1OTXA 3EPLA 2FEAA 4JI7B 1T13A 3PQ8A 2A14A 2VCYA 4N3NA 5DBFA 4ZQBA 3VX4A 3THXB 2G0TA 3OIUA 3FZGA 5IJXA 3AZOA 3HA3A 1ZO8A 1CJCA 1H3FA 3AB8A 1NX6A 4W6ZA 4N39A 3VRHA 3F71A 1CIVA 5F3WB 1EVJA 4QOIA 5EN4A 4DA6A 4B40A 3KYIB 2NYRA 4ZCSA 3UKJA 4Z4QA 1IZ9A 3KEGA 5JFTA 2TSYB 1G3MA 4XX0B 4ZD6A 3W5HA 3CVYA 1I9CA 4TVOA 3VAAA 2C0QA 1ZHHA 2FJUA 2YWRA 3OTQA 4LTNA 4BZQA 4RTJA 3H4TA 4BLPA 3DFFA 1IZ0A 4TWAA 1QAQA 5FPSA 1L4EA 1T5IA 3C8HA 3TDKA 4BVFA 1E3JA 4D4MA 2A5DA 2ZBDA 4ZVMA 3G2MA 4AN0A 4O0LA 4HUTA 1QDUA 1N7HA 4QDOA 4S1TA 4MMXB 1WXEA 3VUEA 3L1VA 1V6AA 2Q3JA 4GG1A 4DY6A 3GQBA 2GZHA 3K0AB 5I4BA 2Q1WA 3B48A 3GT3A 4FHZA 3NM5A 5SYNA 3R6GA 3TJMA 4EI9A 1N8SA 1R2QA 3B1YA 4UNQA 2PE5A 1ZX1A 1ZM9A 1OLOA 3EYAA 3TOXA 4D02A 1EFVB 4D4KA 1OBOA 1NBME 2ZYUX 2ORVA 1UJMA 4XCVA 4RA9A 4F4UA 4EFMA 1TFRA 3G17A 1RW4A 3I12A 4IG4A 2VNJA 3QELA 5HX7A 3NYIA 2YQ4A 1DEHA 1RLJA 2G6TA 2IY7A 3MTDA 1BEZA 4R0VA 3ZD8A 2YIJA 2WOOA 4CIBA 3CNEA 3C4QA 1J39A 2GZAA 4DYVA 4QUAA 2QGZA 3EHEA 2HLNA 4R9RA 3KZVA 2JFZA 1JEDA 3O8OA 1OH8A 3NV9A 2AHOA 5AKEA 4CM4A 4L8GA 4TV8A 4JC0A 1MB9A 3KBOA 1RZUA 4RTOA 1UK8A 2PCJA 3GDGA 3R1IA 5IBPA 3PNLA 3OMXA 4OI2A 3NC0C 3MYYA 5IJ0A 3ZTWA 4F8EA 3IOYA 4JS0A 4MUBA 1KWKA 3ZDBA 4FGWA 5HWSA 2VHCA 2M32A 3SY8A 2FWNA 2VDUE 5ALWA 4FLEA 2PX0A 4RL4A 1KTIA 1IBLB 4OQFA 3SJ7A 1BDBA 4P22A 3MGAA 3L4JA 4G0QA 2VWPA 4AS3A 1W4ZA 1E7WA 1Z7WA 1N2IA 3AUAA 3C6YA 1PEDA 2F9LA 2CHGA 4DIEA 3C4JA 3KPVA 5B6IA 1SXQA 3ZWOA 4PLPA 3ZNPA 2I4OA 2OQ2A 4Z4FA 2VUSA 1DI0A 5ISMA 2DQ4A 2DFDA 1DKPA 2IE0A 2E37A 4LHZA 2CSUA 3CF0A 1ITZA 3JQBC 3ZGXA 5KQPA 1P1FA 4X6XA 2JZNA 3G0OA 3O9VA 3SD7A 4K86A 1YZLA 4AZSA 1TVKB 5BR1A 4FZ3A 5FWYA 1NURA 2R6JA 1P5FA 2PUVA 3KP1A 3QX9A 4M83A 3QX8A 3AR8A 3ZCTA 5GGYA 3V8MA 2AN9A 4RTQA 4NXMB 1DU4A 2VTEA 3VH2A 4NBRA 4X7MA 1GA1A 3AIKA 3V1KA 4JC8A 2I9KA 1FSGA 1XT6A 5D3MB 1OFIA 5J9FA 4AECA 3WRXC 3PGMA 1Y3DE 4MGHA 2M6LA 3L7DA 4OBBA 1B0UA 2QSZA 2MINA 4BXOB 5J1TB 4U6SA 1I8TA 4HJXA 1TTPB 4HADA 1JQ3A 5E6SB 4BMXA 1GXSB 5CMLA 4AJ4A 4JZYA 2GJSA 2LNDA 3I2GA 3LYHA 5EP4A 4C7JA 5DCUA 3EPHA 4J2OA 3BX1A 4GQAA 5FPTA 3WJ7A 2WF5A 3ODPA 4RTSA 2GBCA 3E6AA 2X42A 2WU4A 3BJRA 1E0DA 3RCBA 3EXEA 5COBA 4QUKA 3WA7A 2ZIUB 1FC0A 1A2OA 1BEUB 1TK9A 2QXTA 2ZFUA 3FZNA 4I4IA 4WV3A 4B3IA 1JDJA 3WIVA 3N86A 1ZIYA 1W0JD 1GYPA 3IUPA 4S1OA 3ROKA 2XWSA 1U2PA 2X8JB 3ZCVA 4BWYA 4Z7OB 1S5PA 3AGPA 3X1DA 4TL6A 1AKTA 3LBFA 4KGZA 4UXIA 1FRNA 1SHKA 5FT9A 3R3YA 1Y8QA 3JALA 3WL6A 5A05A 4JVMA 2IC5A 3TCNA 4KEAA 5TQ0B 3LUFA 1Z2AA 1F2DA 2XE4A 2QLJA 5LLSA 5GM1A 5CBPB 3RROA 5M2QA 1J0DA 3H8SA 2HPZA 1GQYA 3AEZA 1IK6A 3DUFB 2X77A 5IG2A 1T29A 2JJ2D 1I7NA 1LU9A 2QD5A 3O31A 4JBXA 4LJKA 2YOFA 4B6JA 4ERNA 2BSXA 5EXXA 3V8RA 3WWOA 1VE5A 1CZRA 3K5IA 1NJGA 3L7IA 2ZT7A 5DH9A 4X6UA 4B3FX 1SEPA 4L0CA 4AXXA 5BRJA 1XZFA 2BBTA 5LQUA 4MVJE 3NTRA 4KIJA 4MRAA 2XMPA 5H1YA 1D2GA 5J5VA 2HFKA 2QE7A 5JZBA 2C1XA 1K3TA 4MKZA 1H05A 2EZ4A 1WE2A 1TRKA 1H2BA 1NQ5A 4BO7A 3IIMA 4WI1A 4OQQA 3A28A 3GLFB 5EIOA 1ODSA 1XNRB 3H17A 2H1FA 3TDNA 3V7FA 4HXFB 3FROA 4WDRA 4MUHA 1P0PA 5HJEA 4KDFA 3EARA 4CEIA 1K6EA 4GVXA 10MHA 3MT0A 3PUJA 3ZXSA 1SOMA 2C4UA 4HTFA 4CF7A 3U4QA 1XHFA 2C5FA 5HZGA 1GQFA 1P91A 4Z49A 4PCAA 4CKXA 2Z58A 1HRKA 4TRRA 3DFKA 1NVEA 2EGUA 2GAJA 5SZHB 1WLYA 4KU4A 5FUXA 1EP9A 2GD1O 1XD9A 3SR4A 4UEQA 5EJGA 4R1MA 3KR2A 4H3HB 2HU5A 2ZZKA 4XVHA 1R50A 2VYVD 1UM9B 4KUEA 4BP9A 5KVCA 2GPWA 1E1RD 1S3GA 2BM0A 3OF2A 4JBHA 3TB4A 3RFFA 5EJ6A 4KMRA 2QVXX 5LXTB 3WYDA 3SZLA 3KKEA 1PGJA 4ZOQI 2ZSDA 5IK2A 3NPAA 1O87A 3F4BA 3V42A 2FFJA 4UHBA 2Z08A 3P97A 4XUDA 3CVWA 2QM0A 1AUQA 4NDZA 3E3AA 4JODA 4NH0A 5AHXA 3RJZA 4YO8A 4HB4A 3V4SA 2K5UA 1T2UA 5LD2C 5EPEA 3WNZA 1IOVA 1L4LA 2QTGA 4IUYA 2FY8A 5B2EA 1B16A 3T54A 7AT1A 4HAIA 2RD2A 4C21A 1IM2A 3R9KA 1AF7A 2X0EA 3T9EA 4D98A 2XHZA 3UGQA 4PW0A 5FBQB 1EWYA 1FW6A 2WTMA 1QE5A 2QV7A 3SM3A 3WYBA 2QBYB 1BKDR 1H66A 1GUAA 2DHQA 4HUQA 4WZBE 1D2HA 3I8SA 2SHKA 1QS0A 2QD2A 2WWHA 5H80A 4B33A 3IILA 1ZUHA 2BGJA 4IVPA 4RFLA 3SXUB 1F1JA 3UWSA 3F6EX 2JZOA 3M2PA 1JYFA 4BO3A 1V1JA 1O77A 4DEVA 1TXGA 5K9ZA 3I0MA 3EC7A 4MWZA 2CMGA 4P0TA 4LNAA 4OLBA 2AN4A 2DWPA 1KHHA 3WAGA 3F3YA 1KMCA 1NULA 4AYWA 3ELBA 1MVNA 2OHGA 3RRZA 4RGBA 4M4SA 1VIDA 4BO8A 3ZD7A 5HQJA 2ECFA 1LCIA 1FSPA 3AHEA 1IK4A 4ZEMA 3FUWA 3VYRB 3R3JA 4NJEA 3SLKA 4BUCA 4DM3A 2XD4A 4HV4A 4RTNA 4NZPA 3JCZA 2WPDA 2P5TB 1VHTA 3OT5A 2YN0A 1Z6QA 3DP7A 4QXMA 2PZBA 4QULA 4G4GA 1CWUA 2C82A 2NQ8A 2G5PA 3HU3A 4MVJF 4IUDS 1NATA 4R1OA 2EX1A 4QT4A 1VL0A 2GSWA 3CO5A 1XKTA 5H02A 1EP1B 1Y6ZA 5BWNA 1I6KA 8OHMA 2I7VA 1R88A 2R8EA 3PRHA 1HE3A 5CU7A 3WXBA 4OQEA 3TZEA 4HWSA 1BJKA 1CX9B 1PLJA 5C35A 5LZ5A 4EIWA 3PPWA 3O7WA 4O02B 5IYZA 1RXIA 1UDAA 1DIOB 2VI5A 3O8QA 1EU1A 2QLTA 5ESWA 2G06A 2NQTA 2WI8A 3DWEX 1ZAYA 621PA 4QRHA 1LDNA 2KI5A 3CE9A 4ENPA 2BFWA 4GX2A 4DV5B 1OGJA 3GF4A 3JWGA 5IJWA 1UKAA 1XHLA 4M7RA 5HM8A 1P7YA 3PJFA 4O2BF 4GOOD 2QVBA 1JQEA 3RNLA 3FKSA 4EZIA 4CM4B 1NVVQ 2XRZA 1Q50A 4MQFA 5TR9A 1XB2A 4O2BA 1DPGA 1J2TA 2XNHA 4GHWA 4P0QB 3ZI0A 2CGEA 3HB5X 2NYVA 3SZGA 3VU9B 1QNFA 1WW8A 2PEZA 4I3HA 1JXOA 3RV4A 4BJ1A 5AM3A 1R0KA 1KQGA 3LZ6A 2H3HA 1N2CA 4AJLA 3ADBA 1L7PA 2IJGX 2DR3A 4RM2A 4UREA 5AK0A 3PRKE 4YHHB 4ARCA 4Q1DA 1OI3A 2BJWA 4PRKA 5ALOA 1G3IA 2PMDA 5LZ8A 2BCEA 2DPHA 2D59A 5EI5A 3FNGA 1HQDA 3SEZA 1NBMD 2EWWA 1RMQA 5AW7A 1GAJA 4DSAA 3MPUA 4C43A 4CF4A 1DTWB 4GBJA 2FWPA 1MB2A 2DQZA 2I2BA 2QQEA 2W5UA 4S1PA 4UU1A 3W8EA 1I7SB 5J4LA 2SNIE 4RZQA 3UMGA 3I4LA 2B1RA 1DLIA 1MQ8B 2I2CA 1GUFA 1HBJA 1P0CA 1U4OA 2CMHA 3B2EA 1SD2A 2JK1A 1PJSA 1HTBA 3GJ7A 3RU3A 1NR7A 1AK9A 3ETEA 3VVLA 3AF2A 5BWBA 2QT0A 3F5QA 2CUNA 1CJKC 2Q2NA 5AVUA 4MR9A 2G1PA 4R2LA 1FTGA 3GLRA 3EFOB 3OY2A 7GPBA 2OCXA 1JUDA 4DC9A 1U65A 1WXWA 2HA0A 3N6VA 1K4YA 1UJ2A 4JSRA 1TKBA 1WDTA 1RJFA 2CL5A 5CYPA 3LLUA 1VJ5A 5JS2A 2RE8A 4MJXA 3VNBA 3B38A 2FXIA 3W5VA 2ZE8A 3CCBA 1LVGA 2AYZA 3N1UA 2B4YA 4M1SA 5CLLA 6REQA 1ECGA 1UPAA 2CMDA 5C1OA 2VRCD 3RABA 4LDQA 4KWHA 3ENNA 3OX4A 2CE7A 1GTL1 2YN2A 1NVWQ 2D0PB 3E1GA 5G0SA 1GL9B 3W6NA 1LVUA 3G02A 3QXCA 4MQMA 2GR9A 2IL1A 4N0EA 2C8JA 4Y18A 3TPFA 3C0KA 4EX6A 2CLHB 2VTBB 5HRCA 3GV0A 3CCFA 1RC1A 4HQNA 1UBUS 2H2WA 3O74A 2COEA 3OAAD 4KJXA 1JHRA 1VIYA 1A7JA 2QQGA 4NICA 1UDCA 2HDOA 2D1TA 4F4CA 3BM5A 3T1NA 1KOJA 1MIOB 2QMEA 3KVVA 3OEEA 4X00A 3UUGA 1GU0A 4JUBA 1XLUA 5TLSA 2CJYA 3MMZA 4BWFB 1PQ4A 3BH0A 1KO1A 2QBYA 1NQTA 2FUCA 3R3HA 4MS3B 2C3OA 3OZBA 4P3NA 3LL4A 4C1BA 3QOW<