3HYRA

Structural insight into g protein coupling and regulation of fe2+ membrane transport
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
253
Chain Sequence
b'KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
molecule tags Metal transport
source organism Escherichia coli
publication title Structural basis of GDP release and gating in G protein coupled Fe2+ transport.
pubmed doi rcsb
total genus 79
structure length 253
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hyrA01
1DG1G 1GIAA 1XZQA 4R2HA 2JIZA 4ARZB 4NHOA 1VCMA 2ZJ2A 2GJSA 2UZ3A 3FTQA 1KSJA 1OH7A 4C2TA 1J8MF 4V0MA 1N6KA 2YWGA 3F0TA 4MUAA 5UKDA 4EQ6B 1M1YE 2IF2A 4M1YA 2ZRNA 4LV6A 4NU0A 1ZAKA 4ZPXA 3AVOA 3FKQA 1E4VA 3R20A 2ZRDA 3QY0A 4AK9A 5FH9A 3BFKA 4QBIA 4A1FA 1S96A 1ZUNB 2O5VA 2WJVA 2XTZA 3V4FA 2RGEA 3BERA 1JEDA 4LJ6A 2ZRGA 1ZD9A 1N0VC 5JJKA 4MKFA 1U8AA 1UBGA 2P6UA 4FW9A 4DLTA 3UWOA 1TEXA 1XD9A 1QHHA 4Q7KA 1GSIA 2DHRA 2A5JA 2A5YB 2PZEA 3LVQE 4HLQB 1ZNYA 4M9ZA 3CNOA 1GNPA 1EESA 3TSZA 2GXSA 2QT0A 3KXLA 1XD8A 4TLDA 1DAEA 3GEIA 3NBZC 1NMXA 4PC1A 2BKEA 1M6NA 4LHVA 3WMEA 2OM2A 2HUPA 4Q1AA 5LB4A 1U90A 2ZE6A 1VTKA 4MRRA 3NDBB 2CE7A 2ZVQX 2D7CA 4LYFA 2JLZA 4KFTA 2ERXA 2FSFA 4L16A 1G9XA 1S0UA 2WTUA 2ODWA 4NONA 3T5GA 4B35A 3B7GA 2KWIA 1UKEA 2QSZA 4X8OA 4O0MA 1ZM2A 4YMSA 5FOSA 4UNSA 5EP1A 2DCUA 3T61A 3LBIA 1QVAA 5BYKA 5EZ6B 3NEJA 3MG9A 3N2EA 1D8TA 1BYIA 1MV5A 5KSPA 2XB4A 3OAAA 3UWKA 2WWYA 4XD7A 3LBHA 1AGPA 3AVUA 5LDDC 1SZPA 4HAXA 4JZKA 3IILA 1VIYA 3QVVA 4RFVA 4I1VA 1WBBA 3IEUA 3ZZ0A 5CJPA 4BASA 3IGFA 1MH1A 5JECA 3PEVA 1FOEB 1KI2A 2ODBA 4IEEA 1L4YA 1E9SA 1R5BA 3C8UA 1D2MA 4X8LA 4KODA 4ZIRB 4TMKA 4D81A 4HATA 5C1BA 4DCVA 4MQBA 1AS3A 3FMFA 3W5JA 1OFTA 4M22A 3A1TA 5JWHA 2QMEA 1XTIA 4Z51A 3NBYC 4JBXA 3HPQA 3TVTA 3KZ1E 3GFTA 4U02A 1HUQA 1M34E 3AM1A 1XZPA 3HJNA 4Q47A 4CEHA 1P2VA 3EC2A 3O47A 3I5YA 5CLQA 1VYTA 1E2EA 2IHYA 5E95A 4Z8XA 3WRYC 3AVPA 1R5NA 3BK7A 5L8VA 2OILA 1PLJA 4AD8A 1RYFA 1W48A 2G0NA 3L0SA 2BMJA 3LW8A 1W7AA 2OBLA 2E1RA 2EFGA 5DSZA 2ZR7A 1JEEA 2HLDA 3GLIA 3NVAA 1GRNA 4QKQA 2AX4A 1W1WA 4GDFA 1T5IA 1DAHA 4LV8B 4D2IA 1P5ZB 4IEIA 2P5TB 4B3FX 2ZRHA 2WBLC 1BIFA 1IY0A 4XWAA 4BFTA 1NBME 1K6MA 3OIYA 1QF9A 4YONB 2HJVA 4D25A 1OB5A 4E03A 1IXRC 2J7PA 4P31A 1N5JA 4EKDA 1RZ3A 1P62B 5EP3A 1W4BA 4IVPA 1Z22A 1ZYUA 1E94E 2QP3A 1Q1EA 2EYUA 2AN9A 2ZRMA 4ZCLA 4Q4JA 3SFZA 4ZDKA 4AKGA 2O0KA 1Q3TA 5CIQA 5D3MA 4A0RA 1X8KA 4WBSA 3SZRA 4Q5IA 4DBLC 1XEFA 5FPKA 1J99A 5E7IA 1U99A 2PCJA 5A0FA 1YE8A 1YR9A 3NH6A 3D31A 4DZZA 1IAQA 3TNFA 1HV8A 2BDTA 4PPNA 3LXRA 2H16A 2B8TA 3AB3A 2ZJOA 2RHDA 1RIFA 3CWZA 3IPYA 4TTQA 3CNLA 2V1UA 2R65A 1F48A 4Q18A 1DELA 5CK4A 1KY3A 2Z5FA 3U7GA 1NI3A 3P4XA 2OXCA 4DLUA 2GJ9A 4M21A 3QKSA 2RGDA 2FPKA 2C9YA 4YLGA 3WMGA 2IXFA 2NIPA 4M9QA 1COWD 3QIAA 1S4QA 1W0KA 2P2LA 3TVDA 1M2OB 1HURA 4DDUA 1HA3A 4E09A 2FX3A 2VHJA 1E1QD 1KMHB 2YWEA 4HEJA 4C0KA 4WZBE 2EFCB 1G41A 1U0JA 3B5JA 3QKTA 1ZINA 3JZAA 1KKLA 2VBCA 1Z3IX 3GD7A 5D3QA 4RD6A 3CPEA 3H2YA 2V6JA 3PV0A 3IDQA 4KO8A 1W36C 2OCBA 1XCPA 2F3TA 4URUR 4A92A 3EPJA 3GLFA 3VR6A 3WRXC 2R6CA 4ESVA 1W0JD 3U4QA 4IFBA 5KO2A 2J7PD 2KB0A 2CK3D 5FFMA 4MUBA 3JZMA 2LCFA 3LO5A 1CJTC 1NVVR 2OAP1 4TLAA 3RANA 2W2VA 1BMFA 1GITA 5EE5B 4LGMA 4DXAA 5KPDA 1Q12A 1T4GA 3K9GA 3ZDQA 1VIAA 1KYIA 1ZD1A 4OYHA 3EAQA 1DE0A 3X1DA 3BORA 5GVSA 1E3MA 1R0WA 1F5NA 1KMQA 1IN5A 2WWHA 2ONJA 3AV0B 3B1XA 3ETLA 1QDEA 1E2QA 2GILA 5DI9A 5P21A 3TE6A 1XTKA 1N6LA 4URYR 3GJ6A 5FBLB 2LKCA 3W3ZB 3RRZA 5JS7A 1KDOA 4Y0AA 2D74A 4W5WA 1A2BA 2OG2A 1U98A 3AF1A 3NKVA 4RD0A 2WOJA 3R8CA 4DB2A 4AKEA 4C0SA 3PUXA 1XEXB 4LHYA 4G5GA 4HUQB 4R7ZA 4L8GA 4QHSA 1TEVA 2CJWA 2GXAA 3FMIA 4GFDA 5JBQA 4NZYA 4BECA 3U4QB 4R71A 5JJLA 4QM7A 1T8UA 1NP6A 4Q66C 2YYZA 1SULA 2VQSA 4IHQA 2GZHA 2EFHB 2I1VB 3A1WA 3AVWA 1TQ4A 2AK2A 4Z1MA 3EPKA 3NDPA 2WJIA 1FX0B 4FCVA 1ZMXA 2A5GA 4JIMA 4XD7D 3RAPR 4OK6A 3SI7A 3EXAA 5KDDA 5FOWA 1S1MA 2O8FB 2JCSA 4XVUA 2Q6TA 1IY2A 2DWOA 3H1TA 4EPRA 4O3MA 4V0NA 2ZS7A 1XTRA 4IW3B 2GBLA 4TTRA 3FOZA 3K09C 4E22A 3H4MA 1SVKA 1WF3A 1G16A 3LW7A 4MA4A 1R8QA 4EJSC 2C99A 4H1UA 1N5KA 1TUEA 1HT1E 4PQYA 4XTRA 1KI8A 1NF3A 2RGBA 5AK0A 1P9RA 6Q21A 2IX3A 2R2AA 3F5FA 4W9MC 4B48A 3T34A 1E32A 4NCNA 2DBYA 4PSAA 3N70A 2QROA 2ZRJA 1SXJB 4HSEA 4F4CA 3PJRA 2IUUA 5C4MA 3GEHA 1N3BA 1Q0UA 2EU8A 1KDTA 2OLKA 2HDNB 4KITB 2F6RA 3RC8A 2BIFA 1WBDA 2ZI7A 3ADDA 1E69A 2VH5R 2CNWA 2W6JD 2DY1A 3SOPA 2GJAA 3OF5A 1K5DA 2A3RA 1LVGA 3QKRB 3RRNA 4AIIA 4NL4H 4OJKA 2QA5A 1S3SA 1BMFD 2NOAA 5J4YA 3DPUA 3REFA 1AQYA 4WXPA 1SQ5A 4OKSA 1HE1C 3DMNA 4JLKA 5CM8B 3P27A 1SVSA 4Q4JB 2NO9A 3GLGB 1X86B 621PA 1G8GA 2C9OA 1KO1A 2P67A 2D2FA 2AR7A 2N46A 3SYKA 1ZUIA 3TQFA 2JJ1D 2WVJA 1AS2A 4M1MA 1JECA 2FFHA 3G0HA 2LWIA 3U44B 3VAAA 2BJVA 3I8SA 3CF6R 3CPJB 4G5OA 2BC9A 3PR1A 4D0NA 1FFHA 2VHCA 3K70B 1P6XA 2XEXA 2ZJ8A 4Q1BA 5FOXA 2E87A 4JL5A 2G3YA 2JLWA 4ERNA 2QEQA 1XX6A 4JL6A 4QGHA 2JEOA 1DBSA 2WWIA 1Q1ZA 4Q21A 4ZKDA 3MSXA 4FMDF 4D0LB 4GRAA 4PANA 3F8TA 4QHTA 1G17A 1NKSA 2JLRA 4QHYA 1DAKA 1TQ6A 2EQBA 2QORA 1JR3D 2ZUDA 1IHUA 1Q44A 2PH1A 3KXIA 4XJXA 1KJZA 3VR4A 2F7SA 2IC5A 4QNMA 4PHFA 1AN0A 5BN4A 4HLCA 3T1VA 1CJKC 1XJ0A 1Z2CA 4MYCA 1CEEA 2FPMA 4W5HA 1VDZA 4ZDJA 1KJWA 3GLHA 1E2DA 1NSFA 4Q03A 2REOA 4XSHA 5C46F 1YZGA 1E1QA 2FH5B 1II9A 1NRJB 1NY6A 4NE2A 4BFWA 4EJSA 2EWWA 1N6RA 3A4LA 4LY6A 2JLSA 1E79D 3ZH9B 4BUJA 4V0ME 1TF5A 1CJUC 1II0A 3ZVNA 2X2FA 2VP5A 1PZNA 3FVQA 5H1YA 2I1QA 5AJYA 2GK7A 4M0LA 3W34A 4EUNA 3U3RA 3LLUA 4TLBA 1E1RA 1G8YA 4ACAA 3AF0A 3WYAA 4JKIA 1Z0AA 2ZYTX 2WWGA 3OESA 2JLVA 1G8PA 4Q9KA 4ARZA 5GJWC 4HB3A 2G77B 1JI0A 3FDIA 5E7MA 1W44A 2F1JA 3K70D 5EQTA 2VP2A 2Z6VA 1W5SA 2C77A 3AP1A 2FFAA 5EXPA 3NTUA 4YMUA 1OXSC 1AS0A 2TMKA 2ZI3A 4QL3A 2C5LA 2VP9A 3QNUA 4RKFA 3MWJA 4DSTA 2H57A 1DAGA 4Q4AA 4GNKA 2FSGA 2H5EA 2ZROA 1UPTA 2ERYA 4QGFA 4JSTA 1J8YF 3RDPA 1Z6XA 2ZQ5A 4S35A 1RRGA 3N2IA 4TYQA 2R6DA 1OYYA 1ZBDA 1OFHA 1R0XA 2Y8EA 3FYHA 4LJ9A 1N6NA 1T3LA 3BB1A 1Z0KA 4MKIA 3ZYCA 3ICEA 1OE0A 4BFUA 4BE7B 2WKRA 1RE0A 2L0XA 1EFHA 1XEWY 1Y3AA 4LBYA 2CK3A 2JLQA 2OXRA 4K81B 3W8NA 1CF4A 2P5SA 3B8HA 1KO8A 4KSCA 2J0QA 1SXJD 2D62A 3PIRA 3R7WA 4LC1A 2BM1A 4LDJA 1ESMA 3L0IB 5IRCD 3LV8A 5H68A 3THOA 4Q4LA 1Z6TA 2VP4A 3FKSA 3U44A 2BKUA 2V54A 3SJZA 3W6NA 1D5CA 1E2MA 5E3HA 4ZV4A 1NVUQ 3OEHD 1YRAA 5K8IA 2ZTSA 5JCZA 5DYIA 4A2QA 2XSZD 2XB2A 5H70A 1G291 2Q3HA 2Z0MA 1X6VA 1KK0A 3CF2A 4QFMA 4US0R 2QUZA 1KOFA 1TF2A 2ZRLA 1T3HA 1P72A 4V0OA 3U60B 4D26A 4HLUA 2CE2X 3QBTA 4TYWA 3AVXA 3QVUA 1G20E 1E96A 1FMLA 1KNXA 4Q9HA 1G3UA 2B21A 1XPOA 3K09A 1MO4A 2GBLC 2QQEA 3AEZA 1K8RA 5CK5A 2AWOA 3VX3A 5KNCA 2QMOA 5JS8A 3TMKA 3GEEA 2JDIA 1K5GA 1L8QA 1AM4D 4WA7A 1OIXA 4Q1DA 3DM5A 2ZUBA 4XIGS 4B3BA 2ZSDA 2A2ZA 4LBVA 2YINC 3GJ4A 1CTQA 1ODFA 3A58B 3B1YA 3EIHA 3QBVA 4GP7A 2C2HA 3P4YA 2FZLA 4B44A 1ESNA 5TXGA 3TK1A 3K0AB 1XNJA 1Z0DA 4D4MA 4OQNA 1BKDR 3ZZTA 4GP6A 5JHHB 1RRCA 3QPUA 1BOFA 4Y0VA 2MSDB 2R8RA 4TMVA 3X1WA 2C9CA 5C4GB 1Q1BA 4JLAA 3THWB 3RRYA 1OB2A 2A78A 5BN5A 1C9KA 4GOJA 4DB4A 2XSZA 1GKYA 5KTYA 1G3IA 2PZGA 2ZI4A 5EUQB 2JIZD 2ZS9A 1M8PA 2A7QA 2Z4SA 1LS6A 1G7SA 3EWSA 3J81k 3LWNA 5HTKA 4CEJB 3SYLA 1AKEA 5LD2B 4MGZR 2NTYC 3AUXA 3KQHA 4AYTA 4EPYA 1WA5A 4LYJA 2IS4A 2OESA 3RRMA 1US8A 4YC7A 1SVOA 4Q1EA 4AWXA 4A6XA 2AK3A 2OFXA 3QENA 5E7JA 1W4CA 1FTSA 5JHGB 1Q57A 5DYGA 1SXJE 1UBCA 3GJ3A 3QG5A 1KI3A 4HAZA 3QF4B 3V00A 3RSLA 4DLSA 4HAUA 1N5IA 4NMMA 2NG1A 3M6AA 1TQDA 3B13B 1DG3A 5L3SB 1CR4A 3CO5A 1KO5A 3AF2A 4DT1B 1UAAA 2QRZA 2W6ID 2YOHA 1G5RA 4LHZA 3KTAB 4BFXA 4XVQA 4D4JA 1II8B 1QHGA 2ZU0C 4IVQA 3NWJA 3PCRB 3RWOA 3FHCB 1NN1A 3I1FA 3K8YA 4HB2A 2BBTA 5F2EA 1QVRA 4M8NE 3QKSB 1HQYE 5CJ2A 3UMSA 4J0QA 5JCPA 4CEJA 1EXMA 4DIDA 2AD5A 3U3KA 1EX7A 4Q7MB 1JXMA 2GF0A 2AKYA 3QPVA 3M4YA 4LJAA 4NCKA 3K0SA 5F98A 2WV9A 4G5QA 1ZVQA 4EDHA 1TAGA 4AG5A 3OHMA 1G8FA 1VG0B 3KUDA 4Q1FA 2GKSA 5EE9A 5TMPA 1XPUA 1LS1A 4Q7LA 5AUOB 1U94A 3U7EB 3KXKA 3IHLA 1J7KA 1Z5ZA 5SZIA 3EA0A 4DEXA 3PXGA 5B2ZA 2EWVA 2Q9BA 4A8JB 1TNDA 1MKYA 2WMOB 4EJSB 3QEOA 2R62A 3DHWC 3SBEA 5L3SA 1E2PA 1E2HA 4KVGA 5GJCA 2D3WA 2VA8A 4DUGA 1P61B 4BFZA 4AG6A 3LH5A 1YZTA 1YKSA 1R8SA 2DB3A 2PLFA 2BWJA 4O2LA 2QG6A 4GMDA 3MUFA 2JLYA 2ZSAA 2JJ8A 3EC1A 1DVRA 4QBGB 1LFDB 2CCGA 3UATA 1S9DA 5FR1A 3EARA 4MRPA 3A8TA 2NO0A 4DHEA 4UXIA 2OZEA 4G5SA 5KSYA 5JWRA 1IN7A 4US2R 2IS1A 4OK5A 2XNDD 1N6HA 3K53A 2ZSBA 221PA 2ECKA 2ORIA 1TF7A 2CJWB 1E99A 1Z0IA 4FMDB 5DGXA 1HE8B 2CHVA 2BM0A 1JR3E 4P4SB 4EIWA 4RD1A 1Z0JA 2X8AA 3THWA 2LKDA 4DLZA 2AFIE 2HEIA 3OIWA 2VP0A 1W36D 1KI6B 4LJ5A 2CNWD 2H7VA 4QXAA 4CVNA 2EYQA 2WJYA 1T0JB 3AKYA 2DR3A 4NKRA 3B1VA 2GCPA 1MOZA 5A5GA 2HT1A 3PEWA 3ZVRA 5LPNA 1P3JA 5FBQB 3ZQJA 4BZQA 2IYXA 2DWPA 1US8B 1QBKC 1KJYA 2HT6A 4UXHA 4LUCA 2GCOA 3SHFA 3F3YA 4PTLA 1SVIA 1Z28A 2GCOB 1ZCAA 4BFYA 5CYOA 1E2NA 1OKKA 1A82A 2JATA 4JLDA 2WSSA 3BC1A 3M1IA 3A36A 2IT1A 2FG5A 2XX3A 4A0FA 3QUSA 5FUXA 3BJIC 1E4YA 3KL4A 4HAWA 1ETUA 5AWFC 1OPXA 2C04A 2ATXA 1YVDA 4URZR 2QP4A 2O8DA 5EP4A 3VFDA 4D4LA 5C18A 3L8YA 1M7HA 5EXSA 3GLIB 1OIWA 1EFUA 5CIWA 4QNRA 5FOUA 4UJ3A 1WCV1 2IYWA 2UZIR 4KXFB 3PEYA 3IQXA 1Q1QA 2V7QA 2FDCA 2D2EA 2Q0HA 1DADA 2IW3A 5DO9A 5FBVB 1Z63A 4CEIA 3QXSA 2AXPA 3CR7A 4Q4HA 5FPHA 2R44A 4LBZA 3FWYA 4HB0A 1OLOA 3R8FA 2A5DA 1JPNA 4A82A 3UIEA 1H8ED 4PPFA 2QZ4A 1IBRA 2CVFA 3RNLA 3A6PC 1P4SA 4ITRC 4NDZA 2QL6A 4JYCA 1OHHD 3NH9A 3NXSA 2IK8A 2VEDA 1LY1A 2DFTA 2H92A 2OCAA 3QF4A 4PR0A 3SBDA 4AYXA 4IOLA 1PLLA 4LZZA 4MGKR 1ELOA 2EFDB 1NG1A 3GLHE 3LY5A 1FPMA 1ZJ6A 3D7MA 1YHNA 4P4UA 4HLDA 2ZETA 4V03A 1NN0A 4PQFA 1GL9B 3LX8A 3SJCA 3WBJA 3BS4A 3C41J 3CZQA 1E79A 1V43A 3C7KA 2ZPTX 4AYWA 4C0LA 4BZPA 2VPPA 5JZVA 1JR6A 2W6IA 2R6FA 5B30A 1ZNZA 1HY3A 3VHLB 3N5CA 2ZVPX 4DEYA 1GKIA 3TKLA 1J90A 2IYSA 1FL9A 4BLRA 1VYUA 1GILA 2HXSA 4M1TA 1RRPA 3AQ4A 4PC2A 2YKGA 4QOSA 5J4KA 3ZLJA 1CJVC 2WKQA 5TVKA 3EZFA 4YMWA 1WQ1R 4HYYA 1XB2A 2F3RA 3HP1A 5SZJA 2PLRA 2VRWA 2IUTA 4O2RA 2HYDA 2IXGA 1P7CA 5KSZA 3AKCA 4B74A 4IDQA 3U61B 4HAYA 4CT4B 4P4TA 3W8RA 1NVWQ 1D2EA 4PZYA 4JLJA 1SVLA 1GTVA 1H8EA 3E1SA 1E0AA 3KJHA 1Y63A 2RGNC 4B2PA 1JB1A 2QM7A 3MRSA 4FWIB 5HE8A 2OUKA 1G8HA 1N0WA 4EAQA 4RVCA 2QAJA 1MT0A 4ZCMA 2IEZA 4RZXA 2QTVB 3IO3A 4DC9A 3T1QA 2YVUA 4KCGA 3OFNA 2H17A 2ZRPA 3BAFA 1P9NA 1AKYA 1EFTA 3LFUA 1Z6AA 1OYWA 4BEJA 3RHFA 1G64A 4TMXA 3WYFA 5JJIA 3KQUA 2OBNA 2ZJ5A 4R98A 1DO2A 4KYIB 3FKSD 5JMTA 3B1WA 4JVNA 2CCJA 3CH5A 3DKVA 3OIVA 5K8LA 3MCAA 1E98A 3G5UA 1GVNB 1TU4A 2IXEA 3WBKA 2XNDA 1CRPA 3IHWA 4A2WA 3W6OA 2PJRA 4B2IA 1ZC3A 3MMPA 4GZLA 1UEIA 2HCJB 3CPHA 2J9RA 4IRUB 3T06B 1Q22A 4ACBA 5EJEA 4DLYA 1RPZA 1UKYA 1XXHB 5FUVA 2ODNA 3CRRA 4CYMA 3WXMA 2V4ZA 3LRPA 4IDOA 2ZRFA 3PFIA 1QG2A 1DAFA 4OK3A 1L2TA 2ZEJA 5FPTA 3U6KA 4PPQA 4XOIA 1RJ9B 3KFXA 1SHKA 4RD2A 2RB4A 2HCBA 4IVRA 4ZIRA 5FL7D 2W6JA 3EPLA 2NMVA 4RFSA 1ZM3A 1IOZA 3ASYA 2JDID 3P20A 3THXA 1JAHA 2AD1A 5FTMA 1V5WA 3GLGE 1VMAA 3BB3A 4RD3A 4NCHA 4D4KA 3KJEA 2CLCX 1HT2E 3REGA 2F43B 2J46A 3DZDA 3NHBA 2IYRA 1YR6A 1N2CE 3EG5A 3DVLA 3IO5A 3THYB 3TW8B 2FU5C 5LBIA 4UNRA 5J47A 5JEDA 2GXQA 4I99A 4OQMA 3T12A 2QBYA 5DHFA 3KFVA 5IHPA 5BYJA 4D82A 1WP9A 4B33A 5FOTA 4MGIR 1Z2AA 2A5FA 1G1MA 3VX4A 3P1JA 1W36B 3B85A 5LB2A 1IN6A 1KTVA 1UBEA 1JJ7A 4YQFA 2W0MA 3TSOA 4GZMA 4GMXA 1DOAA 2VHQA 1XD2A 4P33A 2ZRBA 3Q9LA 4JLMA 4E07A 3LX5A 1M74A 2QT1A 1A7JA 2QN6A 4U00A 2FA9A 4DCSA 3PUVA 3KJIA 4RCZA 4DDTA 1XMJA 3KKPA 4UQOA 3GLHB 1Q3HA 1ZCBA 2WKPA 3HU1A 4HAVA 1XTQA 2NGRA 5DLQC 5M04A 3I61A 3GJ0A 1ZNWA 1QHNA 3P32A 521PA 1JNYA 2PEZA 3IBGA 4GI7A 4L4UA 2JJ2A 1CR1A 2OAQ1 4RD4A 1EWQA 2MSEB 4I1SA 4JMPA 2GHIA 1P2SA 4ZKEA 1GP2A 3TAUA 4C3ZA 2PX0A 2ZITA 3FGNA 5KDOA 1XMVA 3FMOB 4C0QC 2GZDA 3NC1C 3HYRA 2PMDA 4A6PA 2RH5A 1E2GA 3CRMA 4E5UA 1R10A 4FCWA 5L3QA 3SFVA 3IEVA 2BMEA 1RKBA 3QXHA 5GJBA 2O52A 5G3ZA 1U8YA 5JRJA 2RGXA 2OV2A 3AUYA 3C16C 4TL6A 4TMTA 2BJWA 4QM6A 1X1RA 4QJ4A 4URWR 3NEYA 4TMWA 2FJUA 3CWQA 4CEIB 3ADBA 2O8CB 1SVWA 5EE3A 3Q8XB 2J45A 1FW6A 4HZUA 2B7CA 3VKHA 4V02A 4TZ6A 2I4IA 5JEEA 2Q3FA 3SU8A 2WAXA 4JSYA 4JJKA 4P3YA 2GNOA 3GJ7A 3Q7PA 4NH0A 1OV4A 3SS8A 3AH8A 1XTSA 2D06A 4QC2A 2HXYA 4HZUB 4EFNA 4FI3C 1KY2A 2CVHA 1LNZA 2WOOA 2QMUA 2GCNA 2YWFA 4WW0A 2EVWX 2DFKB 5CDFE 2QGZA 1JPJA 2ZAOA 5KUTA 2XZOA 1COWA 1CS4C 1M7GA 3JVVA 4PPGA 5HZHA 2BBSA 4QG7A 2NQ2C 4WAUA 3AVYA 5FPSA 2IS6A 2FSIA 3TIFA 1ZIOA 3GJ5A 3X2SA 4AKHA 1E2KA 3BBPA 2G0TA 5K8TA 3UKDA 4R2IA 5GJVC 2NZ8A 2KBEA 5AJXA 4LSGA 1A4RA 4TMZA 3QKUA 1VECA 4C0HA 3ZIAD 1Z6YA 1IN4A 4Q9LA 1NBMA 4K8OA 4KSBA 1W46A 3ZGXA 2WIAA 4UXJA 1UM8A 4B32A 4B76A 1E0KA 1ZW6A 4PC3A 4U5XA 2J0UA 1AQUA 1CR2A 1DAMA 1U9IA 2J0UB 2ZRAA 3EIQA 4Q7JB 1G6HA 2N42A 2YC2C 3NBXX 1IN8A 2QU8A 3C4JA 1EFCA 121PA 4BLOA 2IUSA 2OFWA 4KVAA 1ONBA 3OE7D 2J5XA 2ZI6A 2BBWA 2J0VA 2XZPA 3KKOA 2NO6A 5CB8A 1MR3F 1O3YA 1P2TA 2FF7A 2XTNA 1MABB 3CB4A 4OI0A 3A1VA 3VR2A 1G5PA 2W2XA 3IKJA 4HDCA 2OEPA 1FP6A 2ZRIA 2XXAA 1N5LA 3KQLA 2ZRCA 3RSOA 3G82C 1CKEA 1T8TA 2GAOA 1KK3A 2Q3MA 1XJQA 3EZ2A 5KPJA 1JXOA 1PV4A 4LC0A 2RGCA 4TL7A 1JALA 1B23P 1U0LA 3ASZA 2F55A 4N3NA 3CX8A 4MRSA 4EPXA 4CZ2A 4I4LA 2RMKA 5BW8A 3KKMA 4B43A 1NN5A 4C7OB 2OCYC 2Z83A 1KO7A 1XDBA 2CEAA 4FD2A 5SZKB 1C4OA 2ZAMA 1I2MA 3D3QA 3K0FA 5FL7A 4URVR 1NJGA 1A2KC 2O0HA 3TH5A 1XMIA 2J3EA 4L15A 2VHTA 3QQ5A 4B75A 2SHKA 1NBMD 1G3RA 4A2PA 4UNQA 5C2JB 2WM9B 4TT3A 5G53C 3SC3A 1E1RD 5HZKA 3AGPA 3TUJC 3D8BA 4LYAA 4JT4A 1E9BA 1XMSA 1W47A 2IEYA 2OFOA 3K0EA 4ZO4A 4DIEA 3ZD6A 4MDFA 3PG5A 2EW1A 3BGWA 4URXR 1YRBA 5JSZB 1NVXQ 4NTZA 1MRNA 5JSZA 1S3GA 3SQWA 4M2LA 3GJXC 1Z06A 2QM8A 1E9RA 1ZNXA 4NP6A 3DO6A 3LVRE 3LQQA 1XU4A 4BWYA 4CW7A 1FQJA 2GAAA 5LD2C 3EIEA 3KKQA 3CRVA 3THXB 1YZUA 2AFHE 1T6NA 4P32A 3GFPA 4FXPA 2WAYA 5J4VA 2FV8A 4C9BA 2PMKA 1TUIA 1G3MA 2OLJA 4POAA 3QSYA 4F4JA 2JAQA 1UADA 3L43A 5AJVB 1TMKA 3Q3JB 3W90A 4LHWA 2QRNA 3I32A 2O8EA 4OL0A 3RS4A 4GSYA 1ZUHA 1KMHA 1ZC4A 1ZM4A 4Q9IA 1DPFA 1TPZA 3CZPA 4IXNA 2QE7D 3S1AA 3EPHA 3DOFA 1AIPA 1S1CA 2B8WA 4I1UA 4FMBB 5BXQC 1P73A 2AHOA 1DO0A 5AUQA 4K46A 3C5HA 2B7BA 3BH6A 3OEHA 4H1VA 4PXAA 4QBFA 3TBKA 3EZ7A 5HCNA 3WMFA 4PHHA 5GADl 1LB1B 2ORWA 2IL1A 1SVMA 4RCYA 3U3JA 1NLFA 1NMZA 2JJ1A 3WHLA 1ZRHA 1QHHB 4LJYA 5EXTA 3WYGA 1NLYA 4BFVA 3U7FB 2IYQA 3I73A 4IDNA 3GP8A 1BS1A 1T3SA 3OIUA 4OBEA 5DH9A 4JLPA 4EPVA 4OQXA 2DWQA 2KSQA 2YWHA 3AF4A 2F9LA 3WP1B 1T5LA 4PO9A 4Q1CA 1TU3A 3E70C 4EFMA 3GPLA 4MGYR 4OHXA 1NNEA 4TYNA 1NG9A 4GOXA 3UXMA 4BRWA 2GVZC 2GXUA 4KYUA 2VP6A 1GL6A 2NZJA 1D9XA 4RKEA 4M1OA 1E2JA 1GNQA 4MYHA 3SJAA 4PX9A 3WHKA 4CDGA 3SDZA 4DSOA 2FNAA 4LI0A 1EK0A 2BHRA 4MITA 4JYBA 5CLLA 2WPDD 3VHXA 2QI9C 2ATVA 2XZLA 4LBWA 1IXSB 1XEXA 3IPXA 1OH6A 3BOSA 4B71A 1FNNA 1F2TB 1F2TA 1XFAA 3CUEF 2ANBA 2W2TA 3B2EA 4DLWA 1TL7C 2QY9A 4Q02A 1IJFA 3LA6A 1FUKA 1NLZA 2BEJA 2ZI5A 3I72A 1NSTA 2YOGA 2VO1A 1O87A 4G01B 3O8DA 4TZ0A 4BLSA 2CDNA 4TSFA 3HR7A 3ONWA 3ZS8A 1KI9A 3TR5A 3CKLA 2WICA 1KZGB 4Q4AB 4EPTA 1S2MA 4WZAE 2XGJA 1F60A 3IUYA 4NBSA 1KNQA 2ZRKA 1L4UA 2XNSA 1UFQA 3T1TA 2GRJA 5AUNB 2ZIAA 5KOYA 1Q20A 2ASEA 2FN4A 5FTKA 3MJHA 2GEVA 3AVQA 3VNVA 1MO5A 4HDQB 1OHHA 1OFIA 3ZJYA 3BD9A 4TL9A 4TLCA 3X1YA 4FIDA 5TDHA 3KDSE 1R0YA 1OXXK 3DOEA 4C7OA 1G3QA 3L0OA 1HH4A 1VCNA 1OH5A 2VF7A 2V1XA 5J5CA 1OKKD 3DZ8A 5FR2A 1IQPA 1E9DA 2A30A 5EXXA 1P9WA 4PC6A 5FUYA 4P0TA 1F2UB 1YR7A 4NYJR 4PAMA 2CHGA 3UANA 2ODEA 5G3YA 1I4LD 1SXJA 1U0HC 3CIOA 2GTPA 4TWZA 4UNPA 3HWSA 1VG1A 3A4MA 3GLIE 2P3SA 3K0CA 2FEOA 4HI0E 4BLQA 3HYTA 5SZHB 4Q4HB 4DVGA 4HB4A 1KI6A 2BCJQ 1XEWX 3PVSA 1XP8A 1FNMA 1TQ2A 1E2IA 4JKYA 2D4HA 3NIBA 4KHZA 4TSFD 4EPWA 3K1JA 2O8BA 2WWXA 1GUAA 4HZIA 5L3RA 3FHOA 1MABA 2FSHA 1XPRA 2V3CC 1KGDA 5FTLA 3ECCA 3QG1A 5J4LA 1SKYB 2VIIA 2WHXA 1TX4B 3GLGA 1LTQA 4KBFA 5FUWA 3P26A 5EUMA 3R7WB 5D3MB 1KI7A 4F91B 5DE3A 4PC7A 3VR5A 2CLDX 3QXCA 2F9MA 4HUTA 1U9IC 4R9UC 2O8EB 2QPAA 3RS5A 4DLXA 5G40A 4L5BA 1Z0FA 3FMPB 4LOAA 1KHTA 1CJMA 2ONKA 2WWWA 1G4UR 1F2UA 1N25A 3DL0A 2IHBA 1KSGA 4EFLA 3ZVLA 2FWRA 2ZE8A 4MH0R 5IF9A 5L3VA 1MRSA 2ZR9A 1S8FA 4TQUS 4A0GA 4RY2A 2VSXA 1JBKA 2CL6X 1W2GA 1D2NA 1GWNA 3X1XA 2CXXA 2BEKA 5KYKA 5EP2A 4C0BA 5DISB 2KI5A 2ANCA 4MYUA 5EE0A 3UK6A 4A8JC 3I62A 2CL0X 2VF8A 1ZP6A 2JLXA 2GJKA 4PFSA 4PO1A 5IK2A 3K0CC 2J41A 2Q9CA 3GLFE 5TV2A 3C5CA 1KAGA 2E9SA 3AP2A 3NBFA 2XJ4A 3R9IA 4GL2A 4Q01A 2BMDA 2UKDA 5AJWA 2F1IA 4JVSB 2KJQA 2GA8A 4F93B 3NC0C 1NIPA 1WB9A 1CULC 5A4JA 4BLTA 4WVFA 1H8HA 3T5DA 3BIFA 2KE5A 4ILEA 1J70A 1KSFX 2FMXA 2B6HA 1RC8A 4ZDWA 3VR3A 4M1SA 4C0JA 4F7WA 4C2UA 4ZDIA 5DNYB 3TRFA 3CX6A 1GDDA 1XTJA 5EE1A 4M1KA 3CR8A 3WY9A 4TLEA 1ZU5A 2C03A 2GEUA 3TJZA 5HE9A 4RZ2A 2V55B 4ASUD 5FBRB 1GKUB 1J2JA 4B2LA 2XOKD 4B34A 2FFQA 2PX3A 1YZQA 5E4FA 5ANRB 3Q5EA 4DKXA 3KTAA 1E9AA 1UKZA 1YZKA 3V9PA 4X8MA 2GJ8A 1NVVQ 5TB5A 2W58A 4PAQA 2DFLA 2IYUA 3I4LA 2ZU6A 4A8JA 4PHGA 1OT3A 5AJZA 1R5OA 2WJHA 1E6CA 1PUJA 4WIAA 2F1RA 4KFSA 2J59A 3CBQA 2FGJA 5HCIA 4ABYA 2AL7A 2CBZA 1SGWA 2D7DA 4CGZA 1U2RA 3QPWA 5HKKA 3C15C 1FZQA 1HTWA 2QPOA 721PA 3KX2A 4NYMR 3GMTA 1YR8A 2J7KA 4KLZA 4HDOB 4RZ3A 1NL3A 3SQXA 2FZ4A 1VPLA 2IYLD 4FWTA 5TARA 2BOVA 3B82A 1BH2A 1CP2A 1MO6A 2IYVA 4Q19A 2GESA 5JI3E 2GDJA 3AKDA 4DLRA 4MDEA 5FTNA 3TLXA 4QRHA 1GZSA 1QHIA 4LYHA 3KB2A 5K8UA 1NJFA 3ZD7A 2FGKA 3CF0A 5DI3B 3CRW1 4CIDA 2HJGA 3TR0A 1A5TA 3EW9A 3QXXA 1XBTA 3GCGA 3DEFA 4LX0A 1AGRA 3TUIC 1X1SA 4BQSA 1FX0A 2ZJAA 3MGCA 4BZXA 2YV5A 2N1BA 5JI2E 3BH0A 3QOFA 4YMTA 3RS3A 1KSHA 2PJZA 3U3OA 3ZIAA 1G21E 4FMCF 3B6EA 1B0UA 3IIKA 2NO1A 3OEEA 5CDFA 2ZS8A 3PUZA 2F43A 2DFNA 4KJZA 1Q21A 4JVMA 3BWDD 1G18A 1N6IA 1EFRD 1QHSA 3FFAA 1OF1A 2CMKA 2W0SA 2HV8A 4V0LA 3U6BA 1ANKA 3KQKA 2XTMA 1TADA 2R6GA 1EX6A 4XH9B 1SXJC 1WDTA 1P2UA 4II7A 1F6BA 4RSGA 2XXAB 2QP9X 4TT3D 1SKYE 2YNMA 4LRWA 1GRRA 3B78A 2RKOA 3LBNA 4KFRA 1UKVY 4B73A 3ND8A 1KDRA 1RVDA 2EFEB 2GETA 4NYIR 3UMFA 1ZM7A 4H9GA 1IONA 1ZU4A 1H65A 3ADCA 1PUIA 3KUCA 3U2QA 3WNBA 2HF9A 3Q72A 1PJRA 3EX7C 4DRZA 3CM0A 1E0SA 2VLIA 3A37A 2X2EA 2G83A 1WRBA 1Z8FA 4PAOA 4TN1A 4XTCS 2IYYA 1PLKA 5IDVA 2QTFA 2QBYB 1IM2A 4L9SA 1W5TA 3NHAA 4ASUA 4D6PA 1UBFA 5HPYB 2WZQA 3K0AA 1W2HA 1R7RA 2ZYUX 2BMFA 1BYUA 3OZXA 1C1YA 5G41A 4A36A 1WMSA 3W6PA 2OT3B 3JVUA 3PUYA 4A4DA 2AWNA 3E5HA 1GFIA 2W00A 3Q85A 4M4SA 4O25A 4BPBA 4AURA 4G5RA 5HKKD 3BFXA 1W4RA 2QGNA 3WNDA 1OFUX 2C78A 3DKPA 1GNRA 3AF3A 3QJYA 4DSUA 4TL8A 1LV7A 4JL8A 5KU1A 4F4IA 4TQ9A 4FMCB 1OH8A 2BV3A 1EFRA 4I1OA 2H8KA 2GZAA 4X8HA 3PITA 1S9HA 4OHVA 3LQRA 5JFGA 2ZSEA 5KNBA 3FE2A 2B92A 2VHUA 1UEJA 1VYVA 2IYTA 3E2IA 2ZI9A 4WXRA 4LJ7A 3SJBA 3RABA 5IK2D 1GRQA 2CLSA 4IJMA 2QAGA 5FI0B 3I92A 2ZE5A 4OHZA 4B3DA 3DMDA 2C8VA 4JLNA 4JBWA 2ZJYA 4QGAA 3W5IA 2PT5A 5L3QB 2ZJBA 1AK2A 4IOKA 5KHOC 1II8A 2ZYWX 3Q5DA 1EGAA 4DDVA 1MO3A 4YMVA 2MMGA 2FE4A 3K9LA 1D6JA 3TQCA 1QHYA 4KLNA 4DT1A 3W9YA 3GJ8A 2X77A 4Q9JA 3QXJA 2ZR0A 1W0KD 3MLEA 1VCIA 4KV9A 4QGGA 1VHTA 1XRJA 4JJZA 1G7TA 4NYMQ 3SHWA 4BFSA 2JJ2D 1KIMA 2FFBA 3I5XA 4OQFA 4D80A 4Z8YA 1YU9A 4US1R 3EZ6A 2V9PA 2RAPA 5BWMA 1CLUA 1RFLA 3FHTA 2P65A 2IBMA 2XOKA 4V0KA 4DSNA 4PO8A 4FN5A 3I8XA 4ZCIA 1Z83A 1CRQA 1QG4A 2VSFA 1VHLA 2V8OA 2ZANA 2G88A 5FBWB 1AZTA 1QHXA 2DPXA 3A1SA 3EWAA 8OHMA 2YHSA 2ZUCA 4N0DA 1D9ZA 1YZNA 3CRQA 4W7SA 4KAXA 2GVDC 4BGDA 3AVVA 4KBGA 1UDXA 3EA5A 4AKIA 3FB4A 3GFOA 2YZ2A 1CBUA 3AGQA 4Q48A 5HR5A 3ICQB 1ZM9A 2ZYVX 5IT5A 3T1OA 4WOPA 2HF8A 1H8HD 3BB4A 2PT7A 3VKGA 4UJ5A 2REXB 4CEHB 1N6PA 1G6OA 3T35A 2YC4C 4NCIA 5H8WA 3VKWA 4OJQA 5FTJA 4KU4A 1XF9A 3O8CA 1CIPA 4LJ4A 3RS0A 2RGAA 5DIFA 5JLJA 1KDPA 1QZXA 5B58C 2NPIA 1JR3A 2FOLA 2YJTD 4PZLA 4PSKA 3RYTC 3LD9A 1WE2A 4YXWA 3WP0A 5J4HA 1OSNA 3H84A 1NN3A 3KB1A 4RJLA 3LAWA 2HLDD 4GPTA 4NYIQ 4A9AA 4HUQA 3OFND 4HLUC 2X1VA 2AXNA 3MWLA 3UG6A 4IOJA 3VU9A 4TYPA 2C96A 2PBRA 2ZXUA 4MKHA 3VR1A 4RZUA 2QAGC 3A4NA 4PQRA 2PL3A 3A1UA 3W3AA 4M9XA 2P6RA 4KI0A 4TTPA 1FUUA 4CT5A 2PZFA 3K70C 3MAAC 3BFVA 4S2EA 4OI4A 3IBYA 1YJ5A 4KFUA 4W5JA 1R2QA 5JRZA 2GWHA 3D6TB 2R9VA 4I81A 2QSYA 4NYJQ 4B47A 2O8BB 3M0EA 1KKMA 3RC3A 2VYFA 1AZSC 1RRFA 2XAUA 1CR0A 1OW3B 2OBMA 4AC9A 1KI4A 1XCMA 2CHQA 3VTKA 2JLUA 1SHZA 5FPYA 3OE7A 3TAHA 4IXMA 2WWFA 1E9CA 1FTNA 4UKDA 4B3CA 4CRWB 3L0PA 2Q9AA 1KK1A 1I2DA 3OEED 2RGGA 3IIMA 5F9FA 1NY5A 2NPFA 1OJLA 2YOFA 1GOTA 2G6BA 3TW4A 4BEBA 4PSVA 2QNRA 3MWKA 1UF9A 4IFEA 2ZM5A 4G1UC 1DAIA 3LDAA 5TY0A 4AI6A 3TSWA 3B9PA 3S1AB 2I3BA 5DN6A 5BQ5A 3VU9B 3QI2A 4IOMA 5B64A 4QJ5A 4A0HA 1FP7A 1Z08A 3LXXA 3IQWA 4LWZA 4YXWD 4MRNA 2IA5A 4LK2A 3QKRA 3L82B 3MD0A 4F92B 2R6AA 4OI2A 3RWMB 1GL7A 3H86A 3RLFA 4XWKA 3CW2A 3UPUA 4RFSB 4LHXA 3HR8A 3ND9A 1AA9A 2ORVA 3BH7A 1T0HB 3L2OB 4LJ8A 4OQLA 1XCGB 3CNNA 3HPRA 4B6FA 4DLVA 2J0SA 1JJVA 2CCKA 3K9HA 4MRVA 4ESHA 4NPHA 1HYQA 4MYTA 4MKGA 3U3MA 2OCPA 4FINA 2WMNB 4PHTA 2OE2A 2NO7A 2V7QD 4JLOA 3ZQ6A 3HU3A 4IDPA 5AUPB 3TGPA 4B6EA 3C14C 2ZJZA 821PA 4B3GA 4XWOA 1Z07A 2DYKA 3SYNA 4NCJA 4L9WA 2WSMA 1KO4A 1Z29A 3DM9B 2H18A 3AP3A 4QBHA 3VQTA 2Z43A 4M53A 3X1ZA 3ZVMA 1WXQA 3MWYW 3RS2A 4YDSA 1EWRA 3B60A 1E9FA 2WJJA 2Z4RA 3FFBA 1N6OA 1RYHA 1W0JA 3AVTA 2IWHA 4AY2A 4ZI2A 3CLVA 1Z6GA 2WJGA 1AJEA 1GM5A 5J40A 3I3SR 2W83A 1G19A 2G1JA 1E2FA 3QF7A 2ZE7A 1OIVA 1KAOA 3B1ZA 1YQTA 1CXZA 4QJ3A 2C98A 2J1LA 1HQCA 1G4AE 1LW7A 1R0ZA 1DARA 1ZD8A 1Z47A 2PCLA 2WSSD 3ZS9A 3T15A 1TTTA 3QE0A 4G0NA 5KNDA 2O8CA 1E0JA 421PA 1XXHA 4A15A 1KZ7B 2WIBA 2IS2A 1OXUA 2K5UA 4DWJA 3IIJA 2OO7A 1JQJC 1NIJA 2P0EA 4BLPA 5FL3A 4U7DA 4PZZA 3ADKA 2O8FA 4DCNA 3BXZA 4JT2A 2GF9A 2UVQA 4Q00A 1P60A 3PENA 5DI3A 2HYIC 2P6NA 2QENA 2REBA 4UNNA 1RW4A 1JQLB 3RVBA 3AKEA 3Q7QA 4YDHB 3RS7A 1T91A 1OXVA 4ZI3A 1VG9B 1GG2A 4P4SA 3PEUA 5CM9C 3CONA 1BO6A 4N1AA 2C95A 3K0FB 5ELXA 3MFYA 4JBYA 4JLBA 1IY1A 2OHFA 2RGNA 5CYPA 4DCUA 3O8RA 4ON9A 2O0JA 1G5TA 2V6IA 1DEKA 3UMRA 2A9KA 2XJ9A 2AKAB 2J87A 2VSOA 2RHMA 2H1LA 2CL7X 3R9XA 2QE7A 1FQKA 2KBFA 4GT1A 2O8DB 3U7HB 3KKNA 1CU1A 2OSBA 3PUWA 1DTSA 1XWIA 1DS6A 3LNCA 3V4RA 3SEAA 1N0UA 3O8BA 1G7RA 1W4AA 1L7VC 1RJ9A 1IJEA 2QMHA 1EG7A 3MJRA 1R4AA 2F1HA 3H0KA 5FOVA 4Z1MD 5JWOA 2ZSFA 4D0GA 4JS0A 1I4TD 2VL7A 1XJCA 3U5ZB 4XSGA 1VKJA 5BN3A 5CB6A 3TUZC 3KJGA 1XXHE 2XITA 3FPAA 1E9EA 2RCNA 3QEJA 4LCBA 1UDWA 4DDWA 1NKTA 2Q21A 1G7CA 5GVRA 3BE4A 3K9NA 4F38A 2PEYA 4OI1A 3KQNA 2X19A 2FPLA 4WZ6A 3VMFA 1W49A 3VNUA 4C30A 2BVNA 2JGNA 3WNCA 4GOKA 1KK2A 1U81A 4B3XA 4IDHA 1LF0A 2GEDA 3CH4B 4TQAA 2JASA 1VG8A 1SKQA 5EZ5A 4C0AC 2WPDA 2BCGY 1P75A 3NG1A 3GQBA 4G3XA 2BBOA 2G1KA 1FMJA 4LPKA 3SN6A 2FEMA 1LF5A 4LPSA 1X8JA 1VCOA 3THYA 2QTHA 5DN6D 1X3SA 1F3OA 4CF7A 5B57C 5CITA 3HU2A 1QRAA 3EZ9A 3LLMA 4DUGD 4EQ6A 3PQCA 2ZREA 1GAJA 4M9SA 4M1WA 5F3WB 1ZIPA 2JA1A 2VTKA 1T9HA 4JLVA 3OAAD 1HEIA 4OHWA 3GLFB 5AR1A 2QQ0A 4Z54A 3L8ZA 4XVRA 1XD2B 2IYZA 4DCTA 2IWRA 5DHAA 3R9WA 4N0EA 1IXZA 3SE0A 5FI1B 1R6BX 4OHYA 3HDTA 1M7BA 3DDCA 4C4PA 4BRUA 1JAIA 2QAGB 3BRWD 1PVOA 3B9QA 1OXTA 5KDLA 2G9NA 2MMCA 2QPTA 4FCTA 2IF0A 3CX7A 1I4DD 1YZLA 4GBMA 3UG7A 1KI1A 4DJTA 1U8ZA 2MSCB 3EASA 1A1VA 1X8LA 5F9HA 4JVLA 4LV5B 3SR0A 4IKEA 3ZZUA 5KSOA 1UJ2A 4TYYA 2GK6A 1NMYA 1E2LA 3SNHA
chains in the Genus database with same CATH superfamily
1XZQA 3I9V6 4PSDA 4ARZB 4MWSA 2GJSA 5AHXA 1JP7A 3I5UA 1SUBA 1IEXA 3NHSA 4I6GA 1VJCA 2VJQA 1GTJ1 1VHQA 3BZWA 3KAPA 4MUAA 5UKDA 1T9AA 4GGOA 3ZKWA 5C7LO 1VJRA 4FEEA 4NU0A 3RC2A 1DHRA 1IEWA 5JAOA 1PQUA 2WJ3A 4NXMB 3AW9A 1EXVA 2Q1YA 5MHTA 4ZU1X 3G8AA 4AK9A 2RHJA 4QDZA 3VBEA 4X3OA 4ZRMA 2OYRA 2O5VA 1BGWA 2PMBA 2A92A 4UM8B 1JEDA 3N2GA 2EKZA 2ZRGA 1ZKMA 4UVDA 2YMLA 3AI2A 3S8YA 1ZD9A 3L6BA 3PNMA 1N0VC 1KZ9A 1U8AA 2QJRA 4OX9Y 1EM6A 4DLTA 1HT0A 3L6RA 2KHZA 1M2WA 3ONEA 2Q7XA 4IPTA 1P5FA 2B83A 3LVQE 4K7JA 3OIGA 2C20A 1K8YB 3QYAA 4U6QA 3ZTYA 2O3SA 1ISHA 3B52X 3ZY4A 2VWGA 3IE2A 1DAEA 2FUG6 2BR5A 3GAMA 3GEIA 3RC7A 6REQB 2XWPA 1Y4UA 4L50A 4KV7A 1O5OA 3I6QA 7REQB 5CAEB 4AAYA 3WMEA 4U63A 3GAFA 1HWYA 4Q1AA 1DIBA 4MJ3A 2FPWA 1ZVMA 2ZE6A 2DU8A 1EFPB 3VGJA 3D4BA 4FBLA 4L16A 1Q95A 1G9XA 5D5PA 5EJ7A 1QMPA 1BWRA 3PXDA 3W9UA 2Z6UA 4Z4EA 2WTUA 4B9AA 4D43A 3T5GA 1K4MA 4X8OA 2PDAA 1QQ6A 4YMSA 4OLBA 5EP1A 1MJNA 4MO2A 5K0BA 1DBRA 3LYLA 4NSNA 1QVAA 1Y33E 1PK8A 4OATA 4OQYA 1X19A 2CT8A 4HDKA 1GCIA 1D8TA 3RVSA 1Z35A 4R84A 4R1QA 1MV5A 4RS4A 1FSFA 1NWHA 2NSLA 4H3HB 4ZFNA 5K1ZA 4G0OA 4IJ6A 2XKJE 3PC3A 4NVRA 5FWNA 3ITDA 3I9MA 2DETA 2J33A 3LCMA 3IILA 2FQXA 1VIYA 3INTA 3NQ41 4NEQA 1EGQA 1VJ5A 1XRQA 4RFVA 1WNTA 1SIBE 2UZAA 1WBBA 3IEUA 2Z04A 4EHBA 2M1XA 4BNWA 1OLSA 1MH1A 1RXCA 3HKBA 4F5ZA 3CVVA 1L4YA 2VQ6A 3HSYA 1WSWA 1R16A 5CLHA 2C8KA 1Y1KE 1DXYA 2DF8A 3BXHA 1SIUA 4D81A 1RXVA 4AU1A 3MTQA 4D44A 4BL5A 4MQBA 4DCVA 5B4VA 5EERA 5K0SA 5LA6F 1Z2EA 3NTLA 3W5JA 4Z3KA 1L3BA 1ZO8A 2QMEA 3QX9A 2Y0DA 3TVTA 3HPQA 2ZQYA 4F2PA 1HX7A 3AM1A 3VYVA 4KP7A 3HJNA 3UAGA 1MJGA 3RE1A 1IULA 3JU3A 1P2VA 2JHCA 3EC2A 3O47A 3PKIA 3I5YA 5CLQA 3RC9A 1A96A 4Z49A 3V8VA 2XHEA 3ORQA 3FUUA 1N8TA 3WRYC 3V2IA 3AVPA 1R5NA 2BN4A 3P2JA 3TR6A 4BV8A 2YXNA 3QEKA 2OILA 1PLJA 1J23A 4GIBA 4X95A 4DYVA 3IE0A 3L0SA 2BMJA 2EFJA 3NKLA 2C7PA 1O6ZA 1YFLA 2HLDA 3KDPA 3QLEA 2GN9A 1GRNA 3GCDA 3N59A 2B4AA 1W1WA 4NOLA 4UHKA 1NDHA 3GA7A 4LV8B 1F0YA 1EPUA 4R8LA 3VYUB 4DMRA 1P5ZB 2HFKA 3D3JA 3PQ2A 4IEIA 2ZRHA 1UODA 2WBLC 3O4JA 5LXTA 1IY0A 4HWPA 4N4AA 2Q8QA 1WWKA 4LE1A 3OIYA 1G20A 4YONB 4PZDA 1LLUA 2DUNA 3WLOA 4MZDA 4ZU3A 1NW5A 3U4HA 4YWHA 1IXRC 4XWTA 1AH2A 3II6X 1N5JA 3FR7A 3VO8A 3WWCA 1RZ3A 4I9HA 4QNNA 4C4RA 2GAFA 5EP3A 4IVPA 4IJVA 3LFTA 3KBBA 2FPSA 2EYUA 3TL2A 3CTPA 5M29A 1R18A 1U28A 1OFVA 3TLCA 4F5EA 2MU1A 4D45A 1QP7A 4O4JB 3FN4A 4D6YA 5BMVA 2X4IA 1XEFA 1SIOA 3QFSA 2D2XA 2PCJA 1NBAA 1YE8A 2BI8A 1YR9A 2ZIFA 3B6MA 1E1DA 3KALA 3KHKA 4C6HA 4EO9A 4GX0A 3TNFA 2BDTA 4E2WA 4G8JA 3DDWA 3LXRA 3CVWA 3QU2A 1DWUA 2FLVA 1YDGA 3T7EA 1A9YA 4UMFA 1Y3IA 1FDUA 4IS3A 4L3OA 3DT6A 2AN3A 3FA2A 1M5TA 5EWMB 1UCFA 5EWMA 5GY7A 3TRDA 1U4SA 5BQXA 3BWXA 1YA6A 3KWLA 3K71B 3U7GA 2YIJA 3P4XA 1X7DA 2HZBA 2QD5A 2OXCA 1C4XA 3CKMA 2GJ9A 3PRKE 4LDZA 4YLGA 2FPKA 3D6FA 2AOWA 4P92A 1Q17A 1COWD 3EXG2 4HFJA 2CXRA 3RRXA 4KRFA 1XLTA 3TZCA 1J20A 1P6QA 2YJGA 2C54A 4Z1OA 4F9GA 1HA3A 2R6HA 1NC1A 4F97A 2YWEA 2OVBA 3G2JA 3D6HA 1C9DB 1J1IA 4NBLA 3WB1A 2EFCB 2P5UA 3EH2A 3M1AA 3WK6A 1FS6A 3OWHA 1MB0A 3KTFA 5KTPA 1ZINA 5EMMA 1ULAA 3DMYA 1Z3IX 1SKAA 3VSCA 1J9GA 1PG5A 2XB8A 3N2GB 3OCYA 2J4DA 1UQTA 1RXUA 2V6JA 4Z7OB 4KO8A 4E31A 1XCPA 2WTBA 4INZA 2C59A 1UK8A 3NYQA 4MV4A 3V80A 4A92A 3GJSA 3EPJA 4CLRA 4MVJH 1W0JD 1U7TA 1E4EA 2KB0A 4MUBA 4Y9RA 3WZMA 1HFJA 1VIVA 3BF7A 4JOCA 4TLAA 1ZOIA 1N2BA 4X64B 3IMEA 4LGMA 4EMTA 3DJFA 4HR7A 5SYNA 4Y2VA 5ULLA 2AI3A 1U11A 1WHSB 2QUIA 1VIAA 5A3JA 1ZD1A 4ZARA 1J22A 1T2FA 2YHAA 1E3MA 4JUDX 2WINI 3PFHA 1F5NA 3M34A 4X66B 3IBFA 2IHUA 5CD9A 1IN5A 3BAZA 3BFPA 3ORRA 1QVVA 3CNBA 4TWAA 1OXBB 3FUXA 1NF8A 3ENQA 2GILA 3E48A 2Q3DA 5T6BA 2VHZA 3BKWA 5BY2A 3KB6A 4WFQA 5DYNA 2LKCA 3KHUA 4Y0AA 3HSSA 2COKA 2D74A 3IEKA 2OG2A 3LVBA 3AF1A 4TS4A 5JANA 1UR5A 3GEPA 4UUMA 3T9AA 4FLMA 2WOJA 3J7AC 1JX6A 4G5FA 2NTEA 1PEKE 4K9PA 4X5OA 1I30A 4AKEA 3FX2A 4DB2A 3PUXA 4MCJA 1XEXB 3HGQA 3TEJA 4AN4A 2WNSA 7AT1A 2UYQA 1WIWA 2J3JA 3DDSA 3PC2A 4G5GA 1GEGA 4L8GA 4QHSA 4R7ZA 2CJWA 3P2EA 4BLUA 4CGYA 5KS2A 2GXAA 3DLCA 1UPBA 2Z1DA 4HFMA 5HBRA 2R60A 4EA7A 4IUDS 2HWKA 3AHGA 5D84A 4KPYA 1ZXLA 4ICIA 1RXWA 1TKRA 1M2EA 3TO5A 3F97A 2X6RA 3T4UA 4TM7A 3E03A 3TRIA 4F8JA 5I9BA 5ALPA 2I1VB 4RA6B 4YRKA 2YWDA 2NACA 1TQ4A 5L7TA 2J9GA 3V32A 4AZVA 3ZHRA 1DKQA 3ZLTA 4HXGA 4PZAA 5F73A 3ESQA 2W4IA 5T41A 3FNBA 2A5GA 4R9SA 4XD7D 4YRSA 3I61A 2DWCA 1S1MA 4YREA 2AFVA 3LE8A 4XVUA 3OO1A 5IULC 4WLFA 3QFTA 4EPRA 3D5QA 1VE3A 3DZHA 4L22A 1GCUA 4XCQA 5EHXA 1H0SA 4TTRA 3K2IA 5LDGA 2IOYA 3K09C 5F5LA 4RPLA 1WF3A 2ILTA 1NFQA 4MA4A 1I0IA 2XWSA 1N5KA 4NAVA 3U40A 1TAQA 1KI8A 2RGBA 6Q21A 4NZZA 3H5LA 5B37A 5DOZA 4H15A 1GA4A 5A02A 3ETHA 5FB3A 3LHSA 4AJIA 4C4AA 2IX3A 2JLAA 3F5FA 3SAJA 3VO9A 5AVZA 3UMMA 4B48A 4I4CA 1E32A 2WUFA 2Z8YA 4KRYA 1NWCA 3ZWQA 3N70A 4WGGA 2W7TA 1SXJB 4UMEA 3NT4A 4EA8A 3Q8MA 2V6FA 5GONB 3ECAA 5KC8A 1QYVA 5CCEA 3DO8A 2GHRA 4BWVA 1RHKA 2F6RA 3HY4A 1NW7A 1CPYA 1PX0A 2VRCA 4M89A 1W88A 4YAEA 3RREA 3TQTA 1E69A 2VH5R 2CNWA 2QSUA 4RDCA 3SM9A 3UMYA 2DY1A 5E9JA 3ZDCA 4X6XA 1K5DA 1VPDA 5HS6A 5BQPA 2CMHA 4XR4A 4TROA 4OJKA 4R05A 4AJKA 2HGZA 3SZUA 2PFSA 2J5BA 3DDNA 1G6Q1 3N75A 4KDEA 5ICEA 2V9ZA 3REFA 2MOKA 1SQ5A 1QONA 5FWYB 5CM8B 2FW7A 3ZWNA 3DBRA 4DG9A 1JB9A 2ZM6B 1KO1A 2P67A 4UHBA 5CA1F 3ZE1B 2P0AA 4LFAB 4PAWA 1B41A 4MB6A 3TQFA 4JEUA 2FAXA 2JJ1D 4HDSA 3GH1A 2JGIA 3N0VA 5KJCA 2FFHA 1J49A 3IQFA 3IQZA 3RC1A 3U26A 1XVVA 2L69A 3W2FA 4QYWA 1DC5A 3G0HA 2FXVA 2BDUA 3PC7A 1N9ZA 3CF6R 2R00A 2JFPA 4D0NA 4LJSA 5SICE 4JGIA 1ZAYA 1WSDA 1YH3A 5FOXA 4AUKA 2W8ZA 4P7JA 4MS3A 4RU1A 2NVOA 1NXXA 4BGEA 2QEQA 4E3WA 2WDPA 1K27A 2YWBA 3DFKA 4BIMA 1XX6A 3BM5A 3GPCA 1RXIA 1FUEA 2JEOA 3AOEA 1GSOA 1JVSA 1Y7HA 5T4FA 1DIHA 1Q1ZA 1T0UA 1PJCA 1J0BA 1EDDA 2YQ4A 1T4CB 3GC6A 3MSXA 3ANTA 1J0EA 5TQJA 1YE5A 3PFWO 2EHJA 3F8TA 1P45A 2F4NA 4MP3A 5BURA 3L7AA 2Y77A 1A8QA 4MHTA 1TQ6A 2EQBA 4YMHA 3A28A 3ANMA 1JR3D 3E61A 2R4UA 3R7DA 2ZUDA 4HHEA 3A7EA 3NVMB 2VT7A 3KXIA 3HB7A 3ZU4A 1JDBC 2YDYA 3DZFA 1KJZA 4Y6QA 3A9UA 3N8HA 4RV4A 3WDSA 4QNMA 4LSWA 4QVGA 4F46A 1UT8A 3GLHA 4JUFA 4BN5A 4Q03A 5DCLA 1V9SA 2REOA 4FHZA 3W2HA 1SBQA 1E1QA 2FH5B 2HBZA 5HM6A 1EIZA 4OHUA 1NRJB 1L4FA 1SA0B 8ADHA 2CHFA 4DYDA 4WDQA 5ALLA 4HVLA 2HJ9A 2B6NA 4LY6A 4GGPA 1UFKA 1GPKA 5AKEA 3T4XA 3U4AA 3ZH9B 4RTRA 3ZVNA 1NW4A 3V8MA 2DQZA 3IPRA 1YRHA 1FLNA 4OHMA 2GK7A 4M0LA 5COAA 3BGIA 3W34A 1H0HA 2WAAA 3T7RA 2YBDA 3CSUA 1G8YA 2B99A 3F3KA 1LJLA 4TKUA 2YXBA 3ZDYB 1Y4SA 3SJUA 9GPBA 4EY3A 2JLVA 1N2XA 3WR5A 3F5SA 3W5CA 4IMIB 5AI0A 2I6TA 2Q7OE 2P2YA 1JDUA 2IRWA 4OAPA 4Q9KA 3RG2A 4ARZA 5LMNB 1SEPA 3PL1A 5ALDA 4RTNA 2B25A 5E7MA 1IJKA 4A8HA 1KS9A 3NKFA 3ND5A 1IZ8A 1JQAA 1L3IA 2A9JA 3K70D 2AR9A 2Z6VA 2IVFA 5EXPA 2R97A 1BRMA 1T26A 1OXSC 2ZI3A 2TMKA 3JS5A 2C88A 2C5LA 3PDIB 4M55A 3COZA 1JHRA 3WGMA 4EHDA 5JQWA 4GVPA 1A9QA 1KYQA 2FSGA 4HQOA 4JSTA 5H02A 3RFUA 4EARA 5CCXA 1TK2A 4OLJA 3S40A 1NE7A 3DE6X 4TYQA 3RT1A 1R0XA 2JI6A 1JIKA 2H06A 1USWA 2A67A 5DCYA 4ALIA 5LUAA 4DJAA 1N6NA 2VOEA 1T3LA 5D3ZA 5HKOA 1XWWA 2VH2A 3EFOB 2OENG 2P69A 3O74A 3EFOA 4HNUA 4GUAA 4BE7B 4J0JA 1I9CA 1U2ZA 5LP6B 3JRNA 1WQ4A 1F4PA 4B7UA 2VTBA 3IJEB 1GZVA 1MG0A 2JLQA 3DW1X 1LDNA 3USCS 3ZI7A 1KO8A 3C5VA 1K7FB 2O23A 4KSCA 5FQOA 3K05A 4TX1A 4YMIA 5BYAA 4GOOD 1C7EA 1SCUB 1ESMA 5IRCD 2XQFA 1N1EA 5ECDA 4KE8A 4ZOQI 4U6NA 2OC4A 3U48A 3THOA 2P11A 2VP4A 1ARZA 3EJ6A 4KDCA 3G7SA 2YIMA 3RIGA 3W6NA 4TV9F 4RSRA 1UMCA 4R2LA 3ZIDA 5K8IA 3RKRA 4F4FA 3KEFA 2TS1A 5DYWA 4C4SA 3NHYA 2FMTA 3ITEA 2QT9A 3BWEA 1QC5A 3Q7TA 4BJHB 4O1HA 4PFKA 4BEWA 3R2JA 1KIAA 2QUZA 3FY4A 3DXFA 4MW6A 5HCUA 2B0JA 2VWQA 2JC3A 2CUNA 1YRQA 3O0DA 4HLUA 1I24A 2Y4OA 5BV0A 3P2KA 4RF2A 2Z9CA 2CE2X 1LPSA 2D00A 3QBTA 4TYWA 4U9IS 3AVXA 4QTYA 2EZUA 3MINA 1U2GA 2HK6A 4Q9HA 3U37A 1N7GA 1C41A 4WCFB 4PXSA 3K09A 2B4TO 4XFJA 3I45A 3AR5A 4J49A 2GZ3A 3ZV4A 1LVHA 5DRYA 1OC2A 1K9SA 1N2HA 3FI0A 3KR2A 2DQSA 2UAGA 3S5JA 5JS8A 1YMUA 1L5FA 3A4VA 1XCBA 1SB8A 4IGEA 1VYHA 4Q1DA 1ZH4A 3PWTA 3PGXA 3OOJA 4R1OA 5FRDA 2ZSDA 4LBVA 4B3BA 4DNFA 5K0EA 4V1CI 1CTQA 3A58B 4G1VA 5G0WA 3EIHA 4GECA 3AI7A 5CEFA 1KVQA 3RBAA 4O4HF 5P8WA 4WVLA 1EFAA 3IKLA 3B1FA 4BU0A 4EGFA 3ENVA 5CDSA 2IIPA 1J25A 1EBUA 1ESNA 1WZUA 1CE8A 1EVYA 2FP3A 2NU7A 2WVGA 1CEQA 2NUTB 2HA3A 4OQNA 4PBSA 3TK1A 4MLDA 4D4MA 4P5EA 1QZUA 3EIOA 3ULKA 2GS9A 2O2EA 4ZU6X 5JD3A 3VU8A 5JC8A 2X22A 3B12A 4TMVA 3WK8A 3THWB 4DNOA 3B48A 4F3YA 1H2ZA 1NM5A 2OK7A 3KVNA 4P8RA 3VMMA 2JH3A 2O0LA 5B3JC 1ZX1A 3WWYA 4E6EA 4HXYA 1C9KA 1KFCB 1DEHA 1PGPA 4GOJA 5JDCC 3KSBC 3NMUF 5CT8A 1CUGA 4M9CA 2JIZD 2PQ2A 1Z7WA 2EZ8A 2Z4SA 4GZ6A 3V4PB 5I9NA 5L51A 2UYYA 2FR8A 3ZGYA 4CKWB 1XKQA 2B4QA 2YTZA 4FWBA 4AYTA 1WA5A 1BA2A 1RDFA 1X94A 3PZBA 4LYJA 2C2MA 1MGOA 3COWA 2IS4A 1US8A 2F3SA 4YC7A 2JGAA 1Y3HA 3C7DB 1UM9A 4ARIA 3QLUC 2QX7A 3UCXA 2NYUA 3DC2A 3OTOB 4GSKA 1FTSA 3PDWA 2I71A 2KLBA 3MNFA 4FM9A 5I9LA 3GY0A 2B1JA 2WPNA 3FBGA 3QF4B 3ZK8A 4AS3A 1WUIS 2NT4A 2Z3WA 4BMXA 1I7LA 1N5IA 3UHJA 1SFRA 4R41A 1TQDA 3B13B 4DR5B 1MORA 1E7YA 3GVHA 4BX0A 4DQLA 5FX2A 1F0PA 1WETA 4Q16A 1JFFA 3QWBA 4YGYA 5JZ9A 2I91A 2W6ID 2WU3A 3ITNA 3URMA 2H0RA 1U8XX 1NJ6A 4JYMA 1G5RA 3ETCA 1UOEA 4ZCSA 3KRTA 4YP6A 2RD2A 1UJ4A 3EXIB 3Q2KA 5I7AA 3HXOA 5JD5A 2XIJA 2PUAA 1Y1TA 4FFDA 3PJEA 3PCRB 4LCJA 1BTOA 5AOCA 1H5QA 2IZ5A 5ERXA 3E9EA 1VLHA 3EXHA 5B4UA 2QQGA 3K8YA 2BBTA 1VLZA 1JHDA 4LCEA 1AF4A 3QKSB 4UCFA 4EITA 2Q1TA 4Y2HA 3FAKA 4KN5A 2D54A 4NG5A 1YI0A 4LYYA 1CC1S 5EQJB 4MYDA 2AD5A 3IFSA 4ZMSA 3FOWA 2JGMA 4YACA 2GF0A 3IXQA 4Y2YA 1WCXA 4LJAA 4GRDA 4NCKA 1H6CA 4G5QA 2Q2QA 1TAGA 3TLAA 4HQ0A 2GTIA 2NM0A 3PRHA 1G8FA 1VG0B 5TMPA 2GKSA 2AOVA 4RZQA 4ZAXA 4OQZA 4P2BA 1X92A 4Q7LA 2RDMA 1U94A 1DJMA 4OBWA 1OZHA 4BDTA 1WY7A 5H0IA 1J7KA 1LGYA 1M2KA 3EA0A 4RJIA 1QR6A 2Z98A 1TNDA 3IESA 4E4TA 4G1EB 2EEZA 3FFXA 3QEOA 2IX9A 4ZREA 2DBVO 3V1UA 1JYFA 5A4MS 4HF7A 2R62A 3RIYA 1I1OA 3H5TA 1MA3A 1PDOA 3DHWC 3WIVA 1DKOA 1E2HA 1B14A 1XO1A 3GEBA 1RLTA 2NVWA 2BDEA 4KVGA 4XUDA 5GJCA 4ZJZA 1B76A 4DUGA 1Y8RA 3MYYA 3IV9A 4WZBA 3UHAA 1U65A 1O89A 3AY3A 3AC0A 1RWVA 3INGA 1USVA 1JEOA 1ZHOA 3DDUA 2BWJA 4PLYA 3S2YA 1B16A 4P22A 4E1BA 2QG6A 4GMDA 2WSLA 4PE5B 3L6OO 5IW8A 4PLCA 2ZSAA 3EC1A 4GSLA 2LRHA 4WT7A 4XLTA 2L19A 1DVRA 1RM0A 1Q83A 1U28C 1ULHA 3ZE2B 1LFDB 3CZAA 5FR1A 1CY1A 1WOYA 3EARA 3ENZA 4DHEA 1ORIA 3UFXB 4OKNA 2OZEA 5C5CA 3AHEA 5C53B 1IN7A 1WCWA 4Y1RA 2IS1A 4OK5A 4GMGA 3X0DA 1E3QA 1TF7A 4JNKA 4QUEA 1HE8B 4DUZB 2CHVA 1VLVA 3HXMA 4C29A 3MYRA 1PJAA 3WGOA 4JXJA 1E5XA 3LPMA 3ONVA 1REQB 2JFWA 3WYNA 4Y1RB 1BRTA 4GBED 1D0VA 3GFFA 1L8OA 2LKDA 3MEQA 2AFIE 2HEIA 1Q0ZA 3WRVA 2XQKA 4R81A 4R9NA 3IJ5A 4FD3A 1TD9A 3QLVC 1Y8ZA 2Q49A 1G59A 3E9DA 3LCCA 1C81A 3CLRC 2H7VA 2GTHA 2EYQA 2WJYA 3NM5A 2QRKA 4YQEA 2Z2KA 1IG0A 4RVOA 5DHRA 4MV9A 3HK2A 1WMBA 3CNEA 2Y0CA 1VQ1A 3L41A 5F51A 5H5JA 2HT1A 2JVJA 1F06A 1U5BB 1TYZA 1UC9A 2EG5A 4F21A 5DM4A 4E1AA 2V7EA 3PIIA 4LXIA 1DAPA 1T0IA 2VHXA 1PGNA 1QBKC 1US8B 2JKVA 2HEGA 2V7PA 2Z2JA 3QU7A 3FMGA 3DEJA 4LUCA 3X1KA 2JLBA 3F3YA 1SC3A 2NUBA 4BC1A 3V46A 1ZCAA 2BUCA 3MMZA 2JATA 3QYJA 5KYUB 3N2YA 5CVUA 3M1IA 3FM9A 3WLAA 2FG5A 1CV2A 3P0RA 4HX5A 4ZTUB 1HE2A 1TIKA 2MR5A 4HAWA 4HRVA 3T6KA 3EVFA 1M75A 5KNCD 1E58A 4NZPA 1YVDA 5EWJA 1CUHA 1ISMA 1QO7A 1MIHA 1RLJA 3Q0TA 5B1DA 3U13A 3WTBA 4REQB 3PNVA 3I2YX 4E30A 2A0YA 2W6NA 5C18A 3L8YA 1DKLA 1WMDA 3ZWWA 1OIWA 3AEKB 4GKKB 2HBRA 1GCOA 4L5CA 2PS0A 3HKEA 3E18A 2Y93A 4I8XA 2P9BA 2IYWA 2X6TA 1NBIA 3B89A 2JCXA 2IUEA 1Q1QA 3MPOA 3KPVA 4E32A 3MWEA 1CUWA 5DO9A 3S5UA 3VISA 5FBVB 1Z63A 4RPGA 2AXPA 3FSRA 1WCIA 4MAFA 2FTKE 1OWLA 2OXFA 2QW1A 3FWYA 4HB0A 4LBZA 1XNQB 3S2FA 3UFBA 4UD6A 3DE0X 3RSCA 4KYTA 3UIEA 2YV1A 2CF6A 3DT9A 5L6MB 2QZ4A 1VPWA 1IBRA 2EQ5A 2CVFA 2FMUA 1NRXA 1JFRA 1CF2O 1SQGA 3IKMB 3JD2A 4ITRC 3LBFA 1TJ3A 3OJFA 4AQDA 2AZDA 1PWZA 3RROA 3W3AH 1VRWA 4IO0A 3IOMA 2DFTA 2H92A 3QF4A 1HOTA 4KO2S 3IRVA 3SBDA 3UJ3X 3X2FA 4LZZA 3Q98A 5JR3A 2EFDB 2IJGX 3D7MA 3TZLA 1YHNA 4O02B 5FAXA 3ZGZA 2R6R1 1CY0A 1LVUA 2FW8A 3FYSA 1UANA 3KD3A 4HNAA 3F3MA 4GG1A 1BZYA 1UWLA 3BS4A 3C41J 2F8LA 3K20A 2QL5A 3LDGA 3PC8C 4TMFA 4WHMA 1HDEA 3SBXA 4C89A 4M37A 4DGSA 2PK3A 3G8BA 4DREA 4DUYB 4N9QA 5AVJA 4YROA 2PSDA 1P5JA 2FN8A 3AETA 2PH5A 4YHBA 2I34A 5CX4A 3PHGA 2WTEA 4MQEA 4RDHA 4YQZA 5TJHA 1LDGA 2AB0A 3WGTA 3G89A 4YJ2F 4DCCA 1S2OA 2OO3A 2XCOA 1IYZA 1GKIA 2GYWA 2GOYA 3JQBC 1RQRA 3I2HA 4QU5A 3A10A 1FVOA 2EKPA 2O2JA 4MUYA 3H11B 1AMUA 1SXQA 1B74A 4I4TB 3BRQA 4WLEA 4PC2A 1HRDA 3ZLJA 2WD9A 2JD0A 5TVKA 3CZCA 1HDRA 3G0BA 3QUAA 4YMWA 3U7QB 1WQ1R 3HP1A 4RZSA 1MX3A 3RAGA 4Z7NB 4QJIA 3H0CA 4JWTA 1NI4B 3ME5A 1C7JA 2IUTA 1VC2A 1Y48E 4O2RA 2JFUA 2HYDA 2PS1A 2IXGA 2QQFA 5TX7A 3RVOA 4RPCA 5KSZA 5K3FB 5IF3A 4CT4B 5I7FA 2BGRA 4MKXA 2Q2WA 4P4TA 1MCZA 3W5BA 4GW3A 1B6TA 1XMOB 5DLYA 2G1PA 4PZYA 4Z9BA 4IDEA 1Q2UA 5KINB 4NESA 1GTVA 3E1SA 3GFRA 1E0AA 2PGXA 1QDLB 1TM2A 3KJHA 4YALA 4BO9A 1NXOA 1FFAA 4QWWA 4TWIA 5B7NA 5HE8A 3EDQA 1C3EA 3NBQA 5K3DA 4F1KA 1IY8A 4EAQA 3I39X 2QAJA 5CT4A 2IEZA 1Q77A 4CIXA 4DC9A 1Q7CA 1E3TA 2I2BA 2WIDA 4JR0A 5EZYA 3UT6A 9ATCA 5K05A 5HEKA 3ZE9A 4AXXA 1AKYA 3TTSA 3LFUA 1Z6AA 1THMA 5HDQA 1YQUA 2H3EA 3V8RA 1XTUA 4WFIA 4OYYA 3R5SA 3QFFA 3WYFA 5FF9A 2YVLA 1QWOA 4QDXA 4JI6B 3KQUA 1X77A 5CXQA 4BCDA 4YA6A 1B43A 1DO2A 2JGFA 4HH3C 2Z1NA 3FKSD 2VEOA 3BIXA 5I4KA 1PTJA 1U3FA 2V03A 4RVGA 2NV6A 1Y9EA 2CCJA 2QVZX 2WC1A 4PFJA 5E0KB 3S7TA 5JBNA 3QMWA 3MCAA 4Q9NA 3HJCA 1M83A 4LK3A 1GDHA 3F98A 4R31A 2Y99A 5IAKA 4ZT3A 2XNDA 1MAWA 5ESWA 1JFLA 1REQA 3OT5A 3TOXA 3PA8A 1IOVA 2BZ1A 2HI0A 1Q0PA 2WYWA 4IRUB 4MW5A 1YIOA 3T06B 4EY8A 5EJEA 4Q93A 5LA6B 2QRQA 3RHSA 4CU2A 1K3TA 1N1GA 2ODNA 2EF0A 1L5WA 1YQ9A 2SKCA 1U2QA 4PS1A 4BKRA 4IDOA 4EVQA 4B79A 2B9VA 4ND6A 1QG2A 1U0RA 4OK3A 2ZEJA 2QIPA 4JEIA 3OEWA 1X7XB 5JS2A 4GQIA 4PPQA 4XOIA 2OO5A 2P9GA 1RJ9B 5EUBA 1W88B 4XB1A 5HKBA 1UJNA 1BJTA 4ZIRA 1HXHA 3M49A 2FPIA 4PRLA 5BSGA 2W6JA 4YP1A 2NMVA 4RFSA 2P9HA 4LGCA 1XHLA 5F4BA 1ZM3A 3GHYA 1TGVA 1IOZA 2QDKA 4MQ5A 3ZDFA 4RK0A 2JDID 4H27A 3THXA 1RBYA 2VS1A 3CZ4A 2AD1A 1GD1O 2RGWA 2VDRB 3INRA 4QUHA 4UREA 5T7BA 4RD3A 5JZSA 2BD0A 2X0NA 2P3LA 1JJAA 4KIGA 4HMPA 5FNZA 5TIIA 5TT1A 1XRMA 3H5OA 3NIGB 4LE2A 4MW0A 2W2NA 3NHPA 2ZB4A 4EZEA 1EIWA 1KJQA 2VYND 1LBQA 2F43B 3IDAA 4KH1A 2J46A 5JNSA 5LLSA 1XA0A 1AUQA 1K8QA 1LK7A 2CYCA 4DBVO 5IT4A 1YR6A 4TTSA 1N2CE 1DCKA 4MJ7A 4HAOA 4JHLA 4ZYUA 1QRSA 4MSUA 1ID8A 3TS1A 5C8DA 4XM0A 4MWCA 3WNQA 1YZVA 2CXTA 4R16A 3F47A 2V4UA 3DD1A 3L7BA 2GXQA 4UNRA 5CDUA 5J47A 4L8LA 1H69A 1OWMA 5AJUA 4D0LB 3S8EA 4WFKA 4JA0A 1SBTA 2EAUA 4FGUA 4TT8A 2GJ4A 1N9GB 4LOIA 1Z18A 4DSZA 1O0CA 5FYDA 2C0PA 1BQEA 3I01A 1G1MA 3FYDA 4FYWA 4ARUA 1W36B 2AR0A 2RI0A 2ID9A 5LB2A 1IN6A 4C4YA 5JASA 2VJPA 1ISPA 2OD7A 4PRKA 2NP7A 4YQFA 4GZMA 1G42A 3PFFA 3HDHA 1V96A 4MWEA 3N3AC 4HDMA 4U9UA 4YCCA 2VUUA 5KOJA 3U4MA 2MYNA 6LDHA 2ZRBA 2B3TA 3F3SA 3DMFA 3MTDA 5CLFA 5IYZB 3TYXA 2F67A 1YOVB 2QN6A 2FA9A 1FLDA 4W9NC 4DCSA 1C0LA 5CXUA 3KKPA 1C1HA 4X45A 5KBYA 1OR8A 4UOZA 1GUFA 2I9KA 2WKPA 3WFJA 4K0KB 3HDJA 4HAVA 4I9FA 3BG5A 4P38A 1GY8A 1XTQA 5HA5A 5DMXA 1S5PA 4PGMA 1SC9A 3GJ0A 1ODTC 1ZNWA 1AC5A 4O2AF 4FQ5A 5EC8A 1BFUA 1NQOA 1KRHA 3E27A 1JNYA 4CKCA 1HZJA 3L8HA 3VR0A 5EWJB 1CR1A 1W85B 5F52A 2REQA 2MSEB 2WF5A 4N3AA 1HF3A 4QJBA 1CHDA 1U1EA 2NUPB 3TAUA 2PX0A 2ZITA 4GEGA 2H1CA 1JA9A 2AUMA 4C43A 1R4NB 2DT8A 2PBLA 5EIAA 5KDOA 2UXBB 5ALJA 1UDRA 2FCAA 2PMDA 3HYRA 1UINA 1E2GA 3CRMA 4LGYA 4UE2A 3UENA 1AV6A 1H22A 1AHNA 2EDCA 1F9EA 3H1FA 4X6YA 4HKTA 3ZU5A 5JCXA 1NVAA 4CMAA 5GJBA 2O52A 3PI7A 3QK7A 5G3ZA 4CKWA 2F90A 1CY6A 1FCJA 2OV2A 2VRNA 5JRJA 4NK4A 2PUWA 4ZODA 1UPXA 1X1RA 2ZUWA 1CEXA 1QFZA 3NEYA 3BWBA 1QIGA 2FJUA 5ISMA 3JQAA 3W1VA 5IBQA 1RLOA 3BGVA 3WMRA 1SUCA 2V96A 4CEIB 2AOTA 3ADBA 2PGAA 5FO0A 1LSJA 1K8ZB 1TOAA 4QELA 5ALTA 5ALSA 5EE3A 4CIYA 4RORA 1FW6A 4HZUA 4FX2A 4X1IA 3VH2A 4BKOA 2A0KA 1PJ3A 2NADA 1MRZA 3H9QA 1S4MA 2I4IA 1J2YA 2Q3FA 1SKMA 3SU8A 2WAXA 3IP5A 4JJKA 2GNOA 3GJ7A 1X7WA 5KAPA 2J3DA 5CCDA 3AH8A 1MW8X 4AN1A 2Y1DA 4OFBA 3UKOA 1BU8A 1KY2A 2JIBA 2K87A 2OXIA 2ZSIA 3G8DA 4F2DA 5C51B 4QU8A 2DFKB 1YR1A 1YDWA 1XUOA 1ZOLA 5KUTA 4A10A 4ZT7A 3QX7A 2BSAA 3KDAA 4WL0A 1UXHA 1RAFA 3F6SA 4EG3A 4HYEA 4L76A 1EBFA 1CF9A 3M8KA 3MCWA 5HZHA 4LXHA 3IDFA 1NAHA 2IS6A 1J56A 1QK3A 4MWDA 1HK7A 4DWWA 4F3CA 2VXOA 1OWPA 2QR3A 3LX4A 1PK7A 2JLCA 2QI9F 1NRWA 1PL7A 3GJ5A 3HKDA 5BMOA 1PSZA 3VDXA 3JV7A 3ERCA 2G0TA 2QL7A 1B8OA 3EQ2A 3USZA 3UKDA 4RNDB 3NCHA 1AK9A 3MZ0A 1A4RA 2LDBA 1SCBA 3G2KA 5G0TA 1UJBA 1AUVA 1VECA 3OP4A 4EZBA 1Z6YA 1W46A 1JSCA 3ZGXA 3F73A 1UM8A 1GPYA 3DZCA 3IA2A 4OUDB 1ZW6A 4DAEA 2J0UA 1DAMA 4RKQA 1P3DA 4P3OA 4EYEA 2N42A 4DNQA 1BGXT 2YC2C 5F33A 4NATA 2ZUVA 3L3BA 2RHCA 3ZU6A 3NV9A 4EHIA 3V7NA 121PA 3G0IA 2IUSA 2PWPA 4IIYA 2VT6A 2HSWA 1ONBA 3RYHA 1LDMA 1XV5A 2X1MA 1EVJA 2J5XA 3ABRB 5E6UB 3GD5A 2QYHA 3KPJA 4CU5A 2FZ5A 2BFWA 1M2HA 2NO6A 4EI2A 2HRZA 3CB4A 1EQAA 3CNQS 2G6TA 3GGGA 1TYBE 4LJLA 1Z4JA 2H4FA 4TWBA 2W2XA 4XUEA 2DGDA 1DC3A 2Q2VA 3T3IA 2HN9A 1N5LA 3UBTA 2IHZA 3KEQA 4FIZA 4DR6B 2D7JA 1NR7A 2Z9DA 2HU7A 1L5NA 3EZ2A 1T1SA 3TL6A 1PV4A 3ZJUA 3P9CA 3E0QA 4LC0A 4EGJA 1LBTA 2E1PA 1U0LA 1G0NA 1EUCB 3G17A 1PJZA 2TECE 1P5HA 1Z4PX 4HEQA 1V16B 2OHIA 2UDPA 2BFEB 2XXJA 4I4LA 4MRSA 2DEUA 2Z9BA 1SHLA 2BKLA 2QDXA 5BW8A 4I36A 3JWEA 5AVQA 5LNK1 1RC0A 1GAXA 4C7OB 2QTBA 1XDBA 3DQZA 5SZKB 4TV8A 1VJ0A 2E5LB 3WRWA 3D3QA 3K0FA 5FL7A 2X0IA 4URVR 5B3KA 2ICAA 5ITSA 1PX2A 1ZG3A 1HNWB 3OKAA 4N03A 1A2KC 2O0HA 3MS4A 5LYJF 1GNTA 2OV8A 1M8JA 4L15A 5DHPA 3QQ5A 4XYLA 1E5QA 3NNNA 3R40A 4QXMA 3NHWA 3HHEA 3ZXIA 2X2PA 1V39A 5CYGA 2WM9B 4IIEA 4L4RA 4TT3A 3LECA 5G53C 1E1RD 3R75A 3SC4A 3AGPA 4H6XA 2AGVA 1JH8A 1XQ1A 3EIUA 4JT4A 1XMSA 1FFXB 3IEXA 5ICSA 3PIDA 3QITA 4I50B 4J7CA 1Z4OA 4AL4A 3T7KA 2HWWA 2VNSA 4ZO4A 3ZD6A 2G5GX 2YVAA 3BGWA 1MJFA 1SOAA 4CI9A 2VDPB 1NVXQ 4URXR 2EERA 5JSZA 1S3GA 2O06A 3AM5A 4LF6B <