3HYRA

Structural insight into g protein coupling and regulation of fe2+ membrane transport
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
253
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis of GDP release and gating in G protein coupled Fe2+ transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 79
structure length 253
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hyrA01
2GVDC 5FPYA 1OFUX 2ZRPA 5HCIA 3PEVA 2O52A 4L15A 2QNRA 4DRZA 2QAJA 2DWQA 4RSGA 1XTKA 3BFKA 3TVDA 1EFCA 4QGAA 3GLGE 4WXRA 5J4HA 1KI7A 2C96A 1OXVA 1NVVQ 2WWXA 4TMVA 3ICEA 3C16C 4K8OA 1R2QA 2GK7A 4LWZA 3VKHA 3P20A 3TGPA 1G9XA 1E9FA 4FN5A 2CL7X 4CW7A 4G0NA 2FFQA 5IHPA 1V5WA 2R2AA 2AXNA 2PH1A 2ZANA 5LB4A 2RGNA 3NXSA 3NDPA 2Q3MA 4LSGA 1T91A 4YQFA 1E1RA 2JA1A 4QGHA 4LJ8A 5JSZA 5LPNA 1PZNA 3AGQA 1GVNB 2ZRKA 2O0KA 3NBYC 4BFTA 3AB3A 3F3YA 3QF4A 4RD4A 1NIPA 4YDSA 1PV4A 1HUQA 2HT6A 3X1XA 1OIXA 1P72A 3SE0A 2V55B 2BHRA 4ZV4A 5GVSA 3QKUA 2GETA 3K0EA 4JLNA 4G5GA 1ZCBA 1UKYA 4IDNA 2OILA 2PX3A 2YKGA 2DY1A 3U7FB 5BN5A 3QKRA 5JRZA 2QT0A 4I1UA 4G5QA 4B71A 1G3IA 5L3SB 1XCPA 1DAKA 3Q5DA 5CB6A 3L43A 1U8AA 2QRZA 1ZRHA 3JZMA 3I61A 1XNJA 4BQSA 4D2IA 4QM6A 2OAP1 3ND8A 2C78A 5ANRB 3TJZA 4I81A 2RCNA 4NP6A 4RZXA 2G0TA 1KKLA 4YC7A 3H0KA 4LJYA 4XJXA 4BFXA 1KNXA 1E4YA 3KUCA 5AJWA 5C46F 3ZQJA 3SOPA 4G5OA 3GLGB 5DH9A 1XWIA 4XVRA 1US8A 2WJVA 1TADA 2WPDA 4PPFA 2ZJ8A 2VH5R 2P5SA 2NPIA 3IDQA 1RYFA 1IAQA 2QSYA 5JEDA 3I5YA 4TZ0A 1ZIOA 4P4UA 1BMFD 3J81k 2WSSA 3I72A 4O2LA 3THYA 4RD1A 1W1WA 2O0JA 2B8TA 1IY0A 2FA9A 1MT0A 1MRNA 2VYFA 2VP5A 4UNRA 5FOSA 1OW3B 1P75A 5IK2A 3WNCA 3AVQA 1UBEA 2B8WA 5FOTA 3VX4A 3GJ4A 2J41A 1QHYA 4ARZB 1GRRA 3FKSA 3K0FA 1Z0JA 2OT3B 2ZJYA 4JLAA 3UK6A 5JCPA 3U4QB 1OKKA 3MWKA 5JEEA 3EX7C 2DFNA 4CVNA 1DAEA 2HXYA 1Z6AA 3H2YA 4OHZA 4KFSA 2PJZA 5LB2A 4AD8A 4RKEA 3QG5A 3TUJC 4OKSA 5IRCD 5BN4A 5F9HA 2J0UB 2J3EA 2QGZA 4LBWA 1AZSC 3T12A 2EU8A 2OBNA 3W3AA 2IEYA 2WHXA 3A4NA 1U0HC 2ZS8A 4NCIA 1EFTA 5B57C 1P3JA 4HZIA 5JWHA 4DLUA 1RRCA 4WBSA 1G64A 2HF8A 4KBFA 1NG1A 4GP7A 2IYRA 3NTUA 2Z4RA 2ZJBA 3MRSA 2B6HA 4EKDA 2RAPA 3BK7A 3GEEA 3V4RA 2TMKA 1R8QA 3ECCA 4HAVA 4R98A 3PVSA 4DSTA 3B8HA 3I8XA 1KO4A 1HE8B 3W34A 1VPLA 1F3OA 4B3XA 2ZETA 3TK1A 1UBGA 2FN4A 1HURA 2GXQA 3VNVA 1E69A 5DSZA 2WWHA 5FI1B 1MOZA 4Q5IA 3SFZA 5EE0A 5D3MB 3TAUA 3ZLJA 4Q1AA 1IM2A 4D80A 4TL9A 2MSEB 1NKSA 4FMCB 2LKCA 1CEEA 2Q3FA 5BWMA 2R6CA 4MA4A 2PLFA 4XTCS 5L8VA 3L0IB 1CR2A 3PITA 1KI6A 1RIFA 3KXKA 5AK0A 4EUNA 3CNLA 3X1WA 2VBCA 3NHAA 3S1AB 2IS2A 3LO5A 5JZVA 4OHYA 2FPLA 1KI3A 3EPLA 5JS8A 3FMFA 3P4YA 4A36A 3RS2A 2FNAA 2HCJB 1F48A 3L0OA 2YJTD 1L7VC 2C04A 5FPSA 3BAFA 1FPMA 1MV5A 5KOYA 3I1FA 1XRJA 4TQAA 3GCGA 1L4UA 3TQCA 1QHHB 3QNUA 3SJBA 1XJQA 2IBMA 4EPTA 4TQUS 5LBIA 2QSZA 2GZDA 5DI3B 2EW1A 4KCGA 3T34A 2G1KA 4WVFA 4PZLA 3EPKA 2FSHA 3LX8A 1W4RA 4HLDA 4MYCA 4PPGA 2WWGA 4RVCA 3CIOA 1CRQA 3ADDA 2ZI7A 2DHRA 2IYVA 2NTYC 2ZJOA 5G3YA 3KJIA 2F7SA 4LBYA 4OK6A 2NO9A 3PFIA 1YRBA 2X8AA 3I8SA 2OM2A 5EP2A 4A8JA 2BCGY 2VP2A 3LRPA 1RC8A 2MMGA 5G41A 1NBME 3ZQ6A 4ESVA 3Q8XB 4HEJA 5TY0A 4B3CA 3GD7A 1R6BX 1OIWA 1G17A 3EIHA 2ODNA 3LAWA 3NG1A 3H4MA 4CEHB 2J0QA 2NZJA 5DISB 1QHSA 2KJQA 1T0JB 2EWWA 5HR5A 3RSOA 3UKDA 3ND9A 3WRYC 3AF4A 5FOXA 1VKJA 1ZM7A 3A37A 1N6IA 4TTQA 3WHKA 4OQNA 2ZYUX 5E4FA 3I5XA 4UNNA 2RHDA 4OHWA 2CVFA 3QKTA 1ONBA 3RS5A 3FHCB 2AN9A 2ZQ5A 3O8RA 5FR2A 3AKYA 4NHOA 1GIAA 4KODA 5JJIA 3OAAD 1LF5A 3MWJA 4RD3A 3ZIAD 1XEXA 1MABB 4LHYA 4TT3D 4MYTA 1D8TA 2WIAA 4HB2A 4A92A 5KHOC 1DTSA 2IXEA 2ZRNA 2DYKA 3WBJA 2J7PA 3LXXA 3U5ZB 2OXRA 1G6HA 2IF0A 4FD2A 3SQWA 1E2NA 1W4BA 2XZOA 2AWOA 4URVR 2BVNA 3AVOA 4W5WA 1KI9A 3TRFA 1JB1A 4EAQA 5EXTA 4EFLA 3CH4B 2IYQA 1XJCA 1YR9A 2D3WA 2FJUA 4Y0AA 1E2IA 4C3ZA 1WMSA 1AIPA 2JJ2A 2N42A 3EZ9A 3KUDA 2F1JA 2GCPA 4FMDF 4EDHA 4LJ7A 4FI3C 2CK3A 5DN6D 3GLHA 1C9KA 4CT4B 1NP6A 4M9QA 4OK5A 4PPNA 1YE8A 2IL1A 2RKOA 2GCOA 1DO2A 2QM8A 3EZ2A 1YQTA 4DSOA 1Z6XA 1LNZA 3K9GA 4HLUA 4LX0A 4OJQA 1OHHA 3UMFA 4UQOA 2WJJA 2XXAB 1GM5A 4C0SA 5JHGB 3Q7PA 3CF6R 4KBGA 2AK2A 1G3QA 1HE1C 3QEOA 4CEIA 1SHKA 1YR7A 2A5JA 1TQDA 3FDIA 1OXUA 2NIPA 3HU3A 4NCNA 1XMIA 4WA7A 3NC1C 2QE7A 5CDFE 4BLQA 2WKQA 1F6BA 2VO1A 2ZSDA 1GAJA 2QQ0A 3GLFB 1NN0A 1JJ7A 2QL6A 3T35A 2F6RA 1IHUA 1VHTA 3QXXA 3VR3A 4D6PA 4HAXA 5EQTA 1WP9A 4EJSA 3CPEA 3DKPA 1PLKA 1W0JA 5CK4A 5GADl 1FL9A 1XXHE 2GJ9A 4IJMA 2F1IA 1GFIA 4GMDA 2A7QA 2QPAA 3PXGA 5JRJA 3AKEA 3M0EA 3W8NA 4HAZA 1SVKA 1R0XA 4ZO4A 3LLMA 3BGWA 4ILEA 4LHZA 2YYZA 1PUJA 4Q1CA 4C0AC 1I2MA 2RGBA 4FXPA 5FBRB 2H18A 4LHWA 4IOLA 1GSIA 8OHMA 4JLDA 3MWLA 4NH0A 2JJ1D 1KOFA 4PC3A 4PC7A 3KZ1E 3Q9LA 5C4GB 2C03A 3SHWA 1FUKA 5FBQB 1NIJA 2E87A 4US1R 4I1SA 1TAGA 3QENA 2O8CA 5CITA 3TKLA 4RD0A 2ZVPX 2GZAA 2ATXA 2Y8EA 1J8YF 2XSZD 4L9WA 1A5TA 1ZM3A 2FPMA 2ZSEA 1LS6A 1T5IA 4XSHA 1T3LA 3LVQE 5FH9A 1G8PA 1Q0UA 2OEPA 4B32A 4JLOA 2Z83A 5CJ2A 3GLIB 3CR7A 3AVVA 1K5DA 3AVTA 2EYUA 1R0ZA 5HKKA 2AFHE 2Q0HA 4ZCIA 3TR0A 2FFHA 4TTPA 1AS3A 3U6KA 2PT5A 3IQXA 3RANA 5E7IA 4Q1FA 4Y0VA 1T5LA 5EZ6B 1N6KA 1E2GA 3LDAA 4HAUA 4JYBA 4H1UA 5FPHA 2UZIR 4ASUD 2D2FA 4QBFA 3KJHA 3IIMA 3SC3A 2J0SA 3ADBA 2OV2A 1HV8A 2P67A 1SULA 4XWOA 1DPFA 4GDFA 3EIQA 3E2IA 2RGDA 2L0XA 4EPVA 1XTIA 2P6NA 4QBIA 1Z47A 4EPYA 2DPXA 1VG1A 4DCVA 2B7CA 4QGGA 4F91B 1SVSA 3DVLA 3VHLB 1IN4A 4I1VA 1S9DA 4QHTA 3JVVA 1P61B 4LYAA 2F43B 1E9DA 1YZNA 1XTRA 2O8FB 2I4IA 4P31A 1DBSA 2CHVA 1KO5A 3TIFA 3THXA 3OEHA 2BM1A 1ZVQA 4AG6A 1G4UR 3M1IA 2KBFA 2NG1A 2OG2A 1OFTA 4C0BA 3BOSA 1II0A 1JBKA 1NF3A 3E1SA 5B2ZA 4HAWA 4IXMA 4YXWA 2YC4C 3MLEA 1N0VC 4BFUA 3BB3A 3R9XA 1HT2E 1TPZA 1W4AA 4KYUA 3CH5A 1XDBA 1TU3A 2I1VB 3TUIC 2QMEA 1D2NA 1SQ5A 1WB9A 2KI5A 4B2LA 4IEEA 1CJVC 4Q48A 1N6HA 4NL4H 2J9RA 4DCTA 1ETUA 3FHTA 2R8RA 3B78A 5KSYA 3BERA 2PLRA 4NCKA 3MGCA 4NE2A 1U2RA 2C99A 2D06A 2YWFA 3IPYA 4Q1DA 4ERNA 2IX3A 3O8CA 5KU1A 4NYMQ 5JI2E 1VCIA 3PV0A 4TLBA 2CCGA 1UBFA 3FE2A 1XPOA 1ZNYA 2R9VA 1Q1QA 1UF9A 2VP6A 4LJ9A 3I92A 1Z63A 2V6JA 4GZMA 4A2PA 4GT1A 4DJTA 1IN6A 1N6RA 4OK3A 3B7GA 3NDBB 1WQ1R 1W0KD 1N6PA 1PUIA 1RKBA 1Q44A 2YZ2A 2IW3A 1SVMA 4HAYA 4KSCA 5DI9A 1YR6A 4BLRA 2IHYA 3X1YA 1KZ7B 3CW2A 1F2UA 3SHFA 3ZH9B 4HLCA 1M6NA 3TUZC 4DUGD 1ZNZA 3T1QA 4V02A 3AP2A 2RH5A 1XB2A 3RAPR 1OIVA 2VHTA 1Z83A 2UKDA 4KVAA 3QKSA 5FTMA 4B34A 4TSFA 1NJFA 3K0CC 3EAQA 3OEED 4DLRA 2F55A 3AQ4A 4Q19A 4P3YA 2QTFA 3MJHA 4W5HA 5TVKA 3U44B 2IYZA 1S3SA 4M1SA 3LV8A 1E9BA 2D2EA 1U0JA 2Q9CA 2IS4A 5JHHB 1JEEA 3QVVA 3SDZA 4LV5B 1DOAA 1G5RA 2ZSFA 1E0JA 2ZUBA 5K8TA 4QGFA 4GOKA 1D9ZA 1ZM4A 2DFKB 4AWXA 4IOKA 3V4FA 2W6IA 3PENA 3AF0A 1NVUQ 4ZDWA 2BMJA 3OIYA 4D0NA 4FWTA 3CB4A 2VA8A 3EPHA 4IOJA 2JEOA 2EQBA 4BECA 4P4SA 1GKIA 1T3SA 2DWPA 5EE1A 4IDPA 4PX9A 1J7KA 2YC2C 1GL6A 2J1LA 2WMOB 3MMPA 1OB5A 3KL4A 4MGKR 2IYUA 1QHXA 2SHKA 1JR6A 3N70A 1T8UA 2CHQA 3EIEA 3IQWA 3QF4B 4LYHA 4UJ3A 1L2TA 4NZYA 3CUEF 5SZHB 4B44A 1G3UA 2ZI9A 2CCKA 3JVUA 2QG6A 1COWD 3IBYA 3PEUA 1BMFA 1KJWA 1W46A 4NMMA 4DSNA 1GILA 1ZAKA 1ZC3A 4AKGA 4BRUA 1DAMA 3QKRB 5FBLB 4US0R 3TR5A 3U60B 4DDUA 5EJEA 4M0LA 3UWOA 1KAOA 1BKDR 2XJ4A 1SVOA 3K9LA 1GNQA 4DB4A 5KSPA 3UXMA 1SGWA 3RABA 1RRPA 1CBUA 1G8GA 4NCJA 2G6BA 2QPOA 3KJGA 1AS0A 1DG1G 2REOA 4LUCA 1S3GA 5FFMA 2ZI5A 5GJWC 2O8BA 2VHUA 3AUXA 1IN5A 1US8B 2ZU6A 1N5JA 2IF2A 5EE3A 6Q21A 2W6JA 3LQQA 2KE5A 2O8DB 4NONA 3QVUA 3V9PA 3VR2A 3THYB 4C2UA 2OHFA 5CK5A 1R4AA 4NDZA 1VMAA 4AC9A 4KYIB 3B9PA 1NBMD 3NBZC 4XVQA 3L82B 1CS4C 5DHAA 3HPQA 1XD2B 3ZDQA 2FU5C 2OSBA 4MGIR 2FEOA 5JJLA 4FCWA 5J40A 2WOJA 3K0FB 3UATA 3CX8A 4KFRA 3RS4A 2GEDA 2X77A 2ZR9A 5FOVA 3OESA 2ODWA 3W3ZB 4DC9A 4OBEA 2RGXA 1T0HB 4JLKA 1TL7C 2WBLC 4RJLA 2OCPA 4WXPA 2A3RA 4ESHA 3KQHA 2ZAMA 1KI8A 4JL5A 4V0LA 3K70C 1NRJB 1IN7A 1EG7A 1N5LA 3AGPA 4GRAA 4V0KA 3U6BA 4O25A 4W7SA 3KKOA 3WMFA 1HYQA 4KU4A 1U90A 2BJWA 1E6CA 4PAMA 5JCZA 4POAA 1QG2A 1PLJA 1ZUNB 4D4JA 3CF0A 1D9XA 2ZREA 3AH8A 3ZZTA 2JLUA 1GL7A 3MD0A 2GVZC 3DOEA 4FMBB 2IK8A 4A4DA 1YR8A 3EASA 3KQLA 1YZLA 4QRHA 4PAQA 4BE7B 1M8PA 4PQYA 3B1WA 2NO6A 1GKUB 1JEDA 3DMDA 3QXSA 4C0HA 2JLZA 2ZRAA 3IHLA 3U3JA 1AGRA 2GA8A 2VSFA 3IEUA 4QXAA 1JXMA 1G8FA 2WVJA 5AUNB 2ZS7A 4GP6A 5J4YA 2FEMA 2G1JA 4Z1MA 3T1TA 2A78A 2ZU0C 1E2FA 5HTKA 4II7A 3B1VA 3A4MA 5KDDA 5FTLA 5AUPB 1CJTC 3F8TA 3W9YA 2HXSA 2YINC 3GPLA 2EVWX 2X1VA 5DHFA 1BIFA 1OXTA 3T06B 4OYHA 1S9HA 3CPJB 1KI6B 1VG9B 1KK1A 4JLJA 1FQJA 4I99A 2GF0A 2LCFA 1KK3A 4W5JA 4E22A 3DMNA 1TEXA 5FTKA 1GUAA 2CL6X 1MO6A 2FF7A 1MH1A 4K46A 3A1VA 2VP4A 3JZAA 4LJAA 4GBMA 3QBVA 4PHFA 3PJRA 4MYUA 2JDID 3VTKA 2AKAB 3KB2A 5CLQA 221PA 3EW9A 4HDCA 1UPTA 1RYHA 1EGAA 3VMFA 3NKVA 3H1TA 2O8EA 4UNSA 4L9SA 1T9HA 4URWR 5KSOA 1ZIPA 2OLJA 4I1OA 1Q57A 1AKEA 3IIKA 3LH5A 5AJVB 2H16A 1YJ5A 2IC5A 5C18A 3QE0A 3DPUA 4ZI3A 1IXRC 4ZI2A 2WTUA 2GKSA 4XVUA 2NMVA 4LV8B 2RGNC 4G5RA 2W0SA 4L8GA 4JBXA 4WZ6A 5BYJA 4CDGA 1OT3A 3GEHA 3RWMB 4BFZA 4BPBA 3DM9B 4CT5A 1TQ4A 4JZKA 3NH9A 3EARA 4OQFA 5BW8A 4JL8A 4LZZA 1W44A 2IUTA 3O47A 4IDOA 1E3MA 2FOLA 3K9HA 5SZJA 1SXJA 3AP1A 3ONWA 4LOAA 3GLHE 1PJRA 4UNPA 4HYYA 2GEUA 1CRPA 3QXCA 3P1JA 5GJVC 3CO5A 1NN1A 2DBYA 5KYKA 3OFNA 3NBFA 2ZI6A 5H1YA 2ZROA 1WBDA 2HUPA 1XMJA 3CRRA 4KHZA 5C1BA 1UAAA 2JLVA 3AM1A 4DCUA 3FHOA 1E2DA 1W4CA 2RGAA 4DCNA 2WSMA 5FBVB 2YWEA 5TV2A 2PZEA 2IYXA 1Z5ZA 1ZBDA 4FCVA 4RKFA 5B58C 4TMKA 4DLTA 2DCUA 3V00A 3LX5A 2C77A 3FFBA 4BFVA 1DG3A 4IHQA 2CNWD 2XOKD 3THOA 5KO2A 3ASYA 3QPWA 1KSGA 1XEXB 1Y3AA 1VYTA 3GQBA 4U7DA 2G83A 2IXFA 2XITA 3CZQA 2C2HA 3AVPA 3T1VA 2YOGA 5J4LA 4HDQB 2REBA 1SVIA 2WIBA 1XPUA 2Z4SA 2F1HA 3VR5A 4CRWB 4QKQA 5AUOB 4MRRA 1G291 3AV0B 4YONB 4NBSA 1RW4A 4TL6A 1D2MA 1I4DD 2GWHA 4BUJA 1QF9A 3PUWA 3SYNA 4NU0A 2JIZD 2WJIA 3KKPA 4CZ2A 1H8ED 3H84A 3U3MA 5G53C 1UBCA 1DO0A 2QT1A 3RVBA 1E79A 1OV4A 4IVPA 2VP0A 1E1QA 1NG9A 4C9BA 1MKYA 3RWOA 1IXSB 3VNUA 2CL0X 3GLHB 4HZUA 1Z08A 1KDOA 1KI1A 4ABYA 1YZTA 3QXJA 2JLSA 2GCOB 4MUAA 5JWOA 4KLZA 1UM8A 4URZR 3U3OA 4DZZA 3PCRB 2GAAA 3WY9A 3NVAA 1YVDA 3THWA 1T6NA 1W36C 2GTPA 1E94E 2PT7A 2MMCA 1M2OB 1TUEA 3DO6A 4B35A 1ZM9A 2W0MA 4NPHA 2PX0A 3B85A 1T8TA 1QBKC 4N0DA 2GJ8A 3T61A 4XWKA 1JAIA 3SNHA 2F9MA 1H65A 3ZGXA 2P0EA 2FSFA 4AURA 2GHIA 4MUBA 5BN3A 3OIVA 5LD2C 3EZ7A 2QP4A 4EJSB 1J70A 1UDWA 4E03A 1FNNA 5KPDA 4JVMA 1GZSA 4US2R 1SZPA 1HQCA 1ZUHA 4JSTA 3T15A 4BLTA 3KQKA 1VTKA 721PA 1E1RD 1I4TD 4O3MA 1XFAA 2H7VA 2WJGA 3B5JA 4HB3A 2W00A 1HY3A 3PEYA 2AWNA 4DDTA 4JVSB 2BJVA 2WOOA 2BCJQ 3BORA 1OE0A 2ERXA 4MKIA 4S35A 4Q9KA 4X8HA 3PUXA 1U8YA 2QMHA 2FE4A 2AX4A 1VYVA 4I4LA 4YMTA 4B48A 3REGA 1G16A 3CF2A 1XEWX 2GZHA 3FFAA 4O2RA 2WWIA 4XD7D 4XWAA 2XB4A 1NSFA 3CRVA 1N0UA 2W2TA 2HDNB 4DIDA 3VU9A 1ZMXA 5TB5A 1P9WA 4D4KA 3GJ5A 4A6XA 1ODFA 4KVGA 4DEXA 1KAGA 1G5PA 4M1MA 2FPKA 1JR3A 2QPTA 1AQYA 1K5GA 3U4QA 4AKEA 4QL3A 2P5TB 3RRMA 3A6PC 3NIBA 2VF7A 4A15A 4XOIA 5AR1A 1EFRA 2V54A 2IYYA 5UKDA 2IYWA 1KHTA 1KSJA 4V03A 2H8KA 2KWIA 4AYXA 2WPDD 4PSVA 4IXNA 3CRQA 3RSLA 3TE6A 2NOAA 5FUVA 2HYDA 1FMJA 1XF9A 3LD9A 1P7CA 4YDHB 1FX0B 5JI3E 2OE2A 4Q4HB 2VLIA 1XP8A 2EYQA 3ZVRA 4KLNA 4OI1A 1KGDA 4BLSA 1WXQA 4MKHA 421PA 4UXJA 4A8JC 1LY1A 5A4JA 4RZUA 3TMKA 5IK2D 3SEAA 4MDEA 1ZU4A 4RD6A 3FWYA 3CR8A 2MSCB 1KMHB 3B1YA 2H92A 3K1JA 4MKFA 3FKSD 3CX7A 3R7WA 3X1ZA 2OESA 3FGNA 2A9KA 4JBYA 1EESA 2AL7A 3KTAA 5FBWB 1OKKD 2ZI3A 1MO4A 4R7ZA 4Z8YA 1R0WA 1M7HA 3K9NA 2GDJA 3AF3A 3ZZUA 4C0KA 2X2FA 1HTWA 3RRZA 4LJ4A 4CYMA 4DDVA 4IDHA 5FL7A 2Z6VA 4QNMA 1ZM2A 5KDLA 2F1RA 1D5CA 5FPKA 1CF4A 2HLDD 1CR4A 1KSFX 4O0MA 4PTLA 4JKIA 1WRBA 3CNNA 4M9ZA 2IUUA 3IUYA 1W0KA 3EWSA 3LA6A 3K0AA 5F2EA 4HLQB 1T4GA 2N1BA 1DS6A 3C5HA 4M1OA 5JLJA 1NN3A 1IJEA 1KZGB 2O5VA 4B3GA 1IONA 4RZ3A 2BEJA 2RGCA 5L3QA 2XNDA 4FMDB 3S1AA 1KO7A 1ZNXA 2VPPA 2YVUA 2ZIAA 3QF7A 4M21A 1NY6A 1J90A 4IVQA 1JI0A 1GDDA 5AJXA 2HEIA 2QMOA 1G5TA 1O3YA 1FNMA 2IYTA 4GSYA 3OIWA 2XX3A 1AS2A 5TARA 4JT4A 1BO6A 5L3RA 1KK2A 1QHHA 1Z22A 2PMDA 1NLYA 2HJVA 1E9CA 4M1WA 2CXXA 5F98A 4AI6A 5DI3A 3IEVA 4QNRA 2HYIC 621PA 4BZPA 3D6TB 2YHSA 2FZLA 4F4IA 2FFBA 1AK2A 2ZJ2A 1JQLB 1N2CE 2G9NA 4ZIRB 1XMSA 4Q4AB 3UWKA 4D0LB 4N3NA 3CNOA 1N5IA 1A82A 2B92A 2CVHA 1OYYA 4TLDA 1F2UB 1S4QA 4BFWA 4KAXA 3IHWA 1XD8A 3A36A 2P2LA 4HLUC 3NEJA 4BRWA 3GMTA 5HE8A 2DR3A 4DLVA 1NL3A 2EFGA 4YLGA 5G40A 4G5SA 3RC8A 3CBQA 3QKSB 4EQ6A 2OAQ1 4AK9A 2G3YA 2ZXUA 3GJXC 4B2PA 2W83A 2VHQA 4QM7A 1OF1A 1AGPA 4LRWA 5IT5A 1TMKA 4PAOA 3GFOA 5ELXA 3CRW1 4WIAA 3W6OA 2AR7A 3B1XA 5EP4A 3AVWA 2CCJA 3SS8A 2ZPTX 3DL0A 2GK6A 1M74A 4IKEA 4TN1A 5EXPA 4LI0A 3CX6A 1YZUA 3AKCA 5FPTA 4EJSC 1YKSA 1GP2A 2E9SA 2NZ8A 3RNLA 3MSXA 5EUMA 1EK0A 1ESNA 1G4AE 2ZYVX 1M7BA 1XXHB 3BC1A 1E2MA 3BXZA 4TYYA 3QPUA 4V0NA 5J4VA 4B76A 4Q9IA 1RPZA 1MABA 3I3SR 3ZVLA 2V4ZA 5JBQA 2YOHA 4P4SB 5AJYA 4NTZA 3DOFA 1MO5A 1N3BA 4IOMA 3VFDA 4QOSA 3DHWC 4PO8A 1GWNA 1IOZA 1YU9A 1X3SA 2WWYA 4P4TA 1CTQA 3VKWA 2CLSA 1H8HA 3VAAA 1WE2A 5HE9A 1Z0IA 2QROA 5HZKA 2I3BA 4A9AA 3KQUA 5TXGA 4CGZA 4WAUA 3D7MA 4RCYA 2JLXA 4DT1A 4OQLA 5FOWA 3RRNA 1GKYA 2J87A 3BD9A 3LW8A 1P5ZB 4J0QA 3TNFA 3N2IA 1G7TA 1FP7A 2ZRIA 5H68A 4C7OA 3N2EA 1KO8A 2FMXA 3K70B 4CEJB 3VQTA 1W48A 1XEWY 1XZQA 1Z6GA 1P73A 4HDOB 2QY9A 2QAGA 2GNOA 1Z3IX 3K53A 2J7PD 5EE5B 1R5NA 2J46A 3I62A 2O8BB 1GOTA 2BEKA 2H1LA 4N0EA 2DWOA 2V7QA 1XCGB 1SHZA 1G21E 3OZXA 1VCMA 5EE9A 2IEZA 4GMXA 5DGXA 4JKYA 4NCHA 3KFVA 3K09A 1OH6A 2RMKA 1KMQA 4TZ6A 3GLFA 3NH6A 1VYUA 3ZJYA 1CJMA 1OH5A 2X19A 2QTHA 4EFMA 2ZRHA 2R6GA 3Q85A 2CK3D 1OXXK 2CDNA 2ZTSA 2QQEA 1ZW6A 2GJSA 2WKRA 3CZPA 4NYIR 3UIEA 2OBLA 4BGDA 3RYTC 4URUR 2UZ3A 2BKEA 3WNDA 3FMOB 1CJKC 1OHHD 2BBTA 2ZITA 5E3HA 3U7EB 3WYGA 2A5DA 4QJ3A 1RE0A 4L4UA 5SZIA 1DVRA 5HPYB 2CEAA 5JECA 3PR1A 1U99A 4JS0A 4EIWA 3BH6A 2CBZA 3TLXA 2QE7D 3QEJA 4GOXA 3ZZ0A 1A7JA 2ZRMA 2BOVA 1ZD1A 2D74A 2PMKA 4F92B 1G19A 4B33A 4WW0A 4C0LA 1II8A 4JBWA 2ZR0A 1KY3A 4P32A 1W0JD 3F0TA 4YMVA 1HQYE 2JLWA 1I4LD 4BWYA 1ZP6A 4AKIA 4AG5A 4JLBA 2C8VA 3W6PA 1Z29A 1DARA 2HT1A 3HJNA 4M1YA 3GLIA 5KNCA 2HJGA 3ZS8A 1XZPA 3EA5A 1PLLA 3K09C 1ANKA 3SYLA 2D4HA 3FPAA 1X86B 3GJ6A 1AKYA 4PR0A 1GNRA 1P4SA 2ZUCA 4MRVA 4PSAA 3TW8B 2BMEA 4HSEA 4RY2A 5JSZB 1OH7A 1G7SA 2IA5A 4B6EA 3FTQA 1JNYA 2P65A 3FOZA 2NPFA 1J2JA 2C98A 4PQRA 2BKUA 3BIFA 1EXMA 5HCNA 1VECA 3NWJA 3QI2A 1NJGA 3R9WA 2ORWA 1WDTA 4M2LA 3A1TA 1R5BA 3C5CA 1RVDA 2JATA 1K8RA 1Q20A 1VG0B 2NGRA 1CJUC 3KXIA 1U98A 4EPWA 1XU4A 3CKLA 4DDWA 4RFSA 3QUSA 1PVOA 4LHXA 2V1UA 3CRMA 2PZGA 3CM0A 4OI4A 3ZYCA 1M1YE 1AJEA 1X1RA 4JSYA 1AN0A 4FW9A 4PHGA 5EZ5A 2V9PA 2GJKA 2F43A 4L16A 4DLYA 3NHBA 2Q9BA 5HKKD 5KNDA 2ZE8A 2GBLA 4AYWA 2ODBA 3Q7QA 2D7DA 4A2QA 2QUZA 3RHFA 3I73A 3QY0A 2RHMA 2V1XA 4QG7A 1YZKA 3L2OB 3RS7A 2D62A 3DKVA 1CLUA 2O8EB 2OBMA 3GJ7A 1KJYA 2FWRA 4Q03A 4P33A 2EFDB 3UMSA 2OXCA 2KB0A 1S8FA 4LJ6A 4LYFA 4Z54A 2ZSBA 1UKVY 4OJKA 2BBOA 4FIDA 2ZJAA 1M34E 4URYR 3U2QA 4EPRA 1TEVA 2QN6A 3VX3A 4IDQA 4Z51A 2KBEA 1KDPA 2ZJ5A 2XEXA 1WF3A 1KIMA 4JLPA 3U7HB 1E0KA 4B43A 4GOJA 1NI3A 2DFLA 1Z0DA 1E4VA 3RRYA 1HT1E 3RC3A 1QRAA 2ASEA 3B82A 1VCNA 1KTVA 2BV3A 4HATA 2YWGA 3REFA 2JLYA 5AWFC 3P4XA 2CMKA 1E32A 4R71A 3EXAA 4Z8XA 4F38A 3R20A 2VL7A 5BXQC 4UJ5A 5GJCA 4A2WA 3KXLA 1Q1EA 2VSOA 2IS6A 2IYLD 5TMPA 3W5JA 1KNQA 4PPQA 4YXWD 2FV8A 1X8KA 3BWDD 1E2KA 1GL9B 2YWHA 1WA5A 5FUYA 4Q1EA 1Q1ZA 3EG5A 4KO8A 5CIQA 1XTQA 4PC2A 1W36B 1X6VA 3MG9A 3D31A 4LDJA 1L4YA 4BEBA 1M7GA 3HR8A 3LLUA 2ZAOA 1VCOA 3C41J 4B74A 4CIDA 3KKNA 3C8UA 1QZXA 4Q4LA 3O8DA 1WCV1 2V6IA 2QGNA 1GRNA 3SJCA 4DWJA 5LD2B 4E07A 4KI0A 2Q9AA 2HF9A 1XTSA 3SN6A 3X1DA 3UPUA 4M53A 1Y63A 5JJKA 2WJHA 3WMEA 3AP3A 1B23P 2QP3A 4HUQA 3AVXA 2UVQA 4F4CA 4TL7A 4GNKA 3WYFA 1N6NA 2A5GA 4A6PA 1S1CA 4F7WA 1JALA 2H17A 4NYJR 1JXOA 3CONA 2W2XA 3D8BA 3W5IA 3EZFA 3IIJA 4HZUB 5TDHA 4M1KA 1QG4A 3HPRA 2ANCA 4BEJA 1OYWA 4DLWA 4ZDIA 1DAGA 2XB2A 2ONJA 3I32A 2BBWA 3BBPA 4TTRA 1F5NA 5M04A 4TQ9A 1DAIA 2X2EA 3WHLA 1NMXA 5KPJA 3ZS9A 3L8YA 2CE2X 4TSFD 1YHNA 4D0GA 3RS0A 4GL2A 3THWB 1G1MA 2P6RA 1E0AA 2RB4A 5DO9A 3SBEA 5EP3A 2CE7A 3GP8A 2K5UA 2VQSA 2QU8A 1RJ9A 3QXHA 4ITRC 3T1OA 3HP1A 1JR3E 4Q4JA 2Z5FA 1AM4D 3IPXA 1G7RA 3U7GA 3R8CA 3FYHA 2QP9X 4C0QC 5H8WA 4KXFB 2ZS9A 2J0VA 4LBVA 4IFEA 4PFSA 1F2TA 1FMLA 4ACAA 3KQNA 1DEKA 2W6ID 4A82A 3LBHA 4XD7A 1MR3F 2WWFA 2F3RA 2GXSA 1P9RA 3QIAA 2QBYA 3A58B 3SI7A 1RRGA 2R6AA 3HU1A 3NEYA 1KDRA 2VSXA 3OE7D 3IILA 4PANA 3OAAA 4P0TA 1P2VA 4Q21A 3GJ0A 4WZBE 3WNBA 4XSGA 3ZIAA 4A8JB 5K8UA 1Q12A 2ZYTX 2ERYA 2CJWA 1KI4A 2AKYA 4R9UC 4TT3A 2AHOA 5J5CA 5A5GA 4OI2A 1G8HA 4FINA 3M6AA 2FGJA 3AVYA 2ORVA 3QG1A 2WICA 2O8DA 2JJ8A 2FSGA 2JLRA 3IGFA 2VIIA 2ZE6A 4BLPA 5KTYA 1OSNA 4M1TA 4Q1BA 1CR1A 4DIEA 3A4LA 2VEDA 1BOFA 2GJAA 2BM0A 2ZRJA 3B2EA 3SR0A 3Q3JB 4E09A 3K70D 5DLQC 1XD2A 2XAUA 4K81B 2ZRDA 1KKMA 1G6OA 5G3ZA 1NVVR 3SQXA 3VU9B 4PC1A 3DZDA 2QRNA 3UG7A 1Z06A 4PO9A 1ELOA 4H1VA 4ZCLA 4F93B 2EFCB 4JT2A 4MITA 4X8MA 5DN6A 5EUQB 2C9CA 5AUQA 1TU4A 3FMIA 3HYRA 4C4PA 5C4MA 3H86A 1IY2A 4OQMA 2OFOA 2ZRCA 2A5YB 2XTNA 1XX6A 2O0HA 2P6UA 2W58A 1ZINA 3NBXX 5KUTA 4Q7KA 5EP1A 5EXSA 1OPXA 1Q3HA 2BMFA 3TSWA 1QVRA 1Z0KA 1DADA 4QJ5A 3PUYA 2VRWA 2ONKA 5A0FA 2HLDA 5GJBA 2W6JD 2LWIA 4Q9LA 3ETLA 4IRUB 1Z6YA 3TW4A 4W9MC 2ZYWX 1KYIA 1DELA 4FMCF 4PZYA 4DBLC 3UMRA 2MSDB 1P2SA 4BFSA 4TLEA 2PCJA 3VR4A 1LVGA 4JVLA 1KY2A 3MWYW 2WWWA 1W47A 4M9XA 3TSZA 2OLKA 4QBGB 2W2VA 2R6FA 4D4LA 1SXJC 2QZ4A 2C95A 1R8SA 3C7KA 1UEIA 1C4OA 3ZD6A 3R7WB 3R8FA 2WJYA 3TBKA 4WZAE 4V0MA 3PQCA 3KTAB 3Q72A 2XNSA 3PUZA 4OHXA 4M9SA 2FDCA 1CKEA 4S2EA 3C14C 3MJRA 5IF9A 4TMZA 3BB1A 5GVRA 821PA 3M4YA 3KB1A 5IDVA 1DE0A 2FX3A 4CEIB 2BIFA 2YOFA 2PL3A 1G41A 1IQPA 2FFAA 1NMYA 3MFYA 2G77B 2JJ1A 1NY5A 1W2HA 1U81A 1YRAA 1P2UA 3K0AB 4HI0E 4IFBA 4LC0A 521PA 4ZKDA 1Z07A 3I4LA 1R5OA 4Q7MB 5F9FA 5L3QB 2JAQA 4G1UC 1IN8A 2A5FA 2OCBA 2XSZA 5J4KA 2R6DA 4A0FA 5JWRA 5L3SA 2ANBA 4UKDA 4JVNA 4TL8A 3DEFA 3TQFA 4DLSA 1KJZA 1U9IA 4AKHA 1VIYA 2PBRA 1UJ2A 1ZJ6A 2PZFA 4PC6A 1E2QA 2F9LA 2AD5A 2CHGA 4JIMA 1W2GA 1N6LA 3GLGA 4A1FA 1KSHA 2EFHB 3WXMA 4Z1MD 2P3SA 2WV9A 3AUYA 4LCBA 2Q21A 3A8TA 1VHLA 1WBBA 4TWZA 1SKYE 2ZEJA 3R9IA 4Q47A 1ZD8A 4ASUA 1BYUA 2ZE5A 1NVWQ 3HWSA 3SFVA 3AKDA 3LY5A 3BJIC 1GITA 2O8CB 1JPNA 2BBSA 4BZXA 4A0GA 4LPSA 2FG5A 1S1MA 3WP0A 4B3FX 4RD2A 4TMTA 3SYKA 1GNPA 4D25A 4EQ6B 5BYKA 1FQKA 4MYHA 4ARZA 2C9OA 3PEWA 3AF2A 3BE4A 2H57A 2DFTA 1XEFA 2GF9A 3BB4A 1NKTA 3G5UA 2BMDA 5SZKB 5CLLA 4C2TA 3TSOA 1YZQA 2JCSA 1CXZA 1NNEA 3C4JA 3LFUA 3WMGA 1QVAA 1TUIA 1XBTA 2J0UA 3UG6A 1BS1A 1GRQA 5DNYB 2XJ9A 3LQRA 3GEIA 4D82A 2QMUA 2WSSD 1U9IC 1CIPA 3HR7A 3QBTA 1AA9A 1ZCAA 4OQXA 2RGGA 3LW7A 5FL3A 3GLFE 1QHGA 4A0HA 4TYWA 3OF5A 1E2PA 4AYTA 4DVGA 2XGJA 1NLZA 1TNDA 1A2BA 1Q21A 1SXJD 2NO1A 1JAHA 4UXIA 3T5DA 1RRFA 4TYQA 1LTQA 1E9AA 1KDTA 2OCYC 2IUSA 1F60A 1G3MA 3OHMA 1SKYB 1XTJA 3OFND 1GG2A 3HYTA 4F4JA 3THXB 2IS1A 5AJZA 1W49A 2EFEB 3KFXA 1XMVA 4X8LA 5E95A 4DLXA 4DT1B 1A2KC 1XCMA 3QJYA 1D6JA 2IXGA 1X1SA 2ZJZA 4Q02A 5CJPA 5FUXA 3IBGA 1TF2A 5D3MA 1W36D 4E5UA 3RLFA 1N0WA 1Z2CA 5E7MA 4C30A 4C7OB 2V8OA 1GTVA 2AXPA 5KSZA 5E7JA 3KKMA 3D3QA 4B3DA 3BH7A 1TQ6A 1G3RA 4JJZA 5KNBA 2QAGB 2ZRGA 2NQ2C 4QFMA 1S0UA 3E5HA 4DUGA 5CB8A 2WKPA 3W90A 4AIIA 1R0YA 2Z0MA 2PEYA 1NN5A 3LVRE 2QA5A 4V0OA 4KJZA 3DDCA 4QBHA 3L0SA 5BQ5A 3WRXC 3OEEA 3GLIE 2VHJA 4R2IA 1HA3A 3ZD7A 1VG8A 4NKRA 1FOEB 3SU8A 2QTVB 3K8YA 5CYPA 3A1UA 3EA0A 1KO1A 3LWNA 3VR1A 3X2SA 4MRNA 4ZPXA 1TF5A 3EWAA 3L0PA 3KX2A 1E79D 4PHTA 2Z43A 4B3BA 3ADCA 2B7BA 1E1QD 1E2EA 3TVTA 4DXAA 3ZVMA 1IJFA 1EFHA 2YV5A 3L8ZA 3U3RA 3BFXA 2OCAA 3A1SA 4ZCMA 1P6XA 3T5GA 2J45A 2ZI4A 1U94A 4M22A 4TLCA 1DAHA 1E9SA 2B21A 4D81A 1OFIA 4TLAA 1U0LA 1E2JA 3GJ8A 4PXAA 4PQFA 2ZE7A 3KJEA 2XZLA 3EPJA 2ZR7A 3WYAA 5CM9C 1T3HA 4MDFA 2C5LA 5EXXA 1EX7A 3IO5A 3BRWD 3HU2A 1K6MA 4CEHA 1W5TA 1O87A 2IWHA 2ZVQX 4XTRA 5B64A 1W5SA 121PA 2A30A 4KV9A 4XH9B 1C1YA 1UEJA 5P21A 3EC2A 4JYCA 2J7KA 3RS3A 1II8B 1E96A 4M4SA 1COWA 4H9GA 2AK3A 1AZTA 3KKQA 3W8RA 4NYIQ 4PSKA 1B0UA 4UXHA 4ACBA 2WZQA 2QENA 4X8OA 3UANA 4GPTA 4U00A 1XPRA 2N46A 1E98A 3CLVA 3GJ3A 1LF0A 1TTTA 1FW6A 1FUUA 1J99A 4B73A 2JGNA 4BFYA 2JASA 4N1AA 2V3CC 2YNMA 1XJ0A 3FMPB 4ZKEA 3U61B 1E2LA 4JLMA 1SVLA 4L5BA 3ADKA 2VHCA 3P32A 1UKZA 3W6NA 1CR0A 1I2DA 3G82C 2GILA 4D26A 4DSUA 1LS1A 1W7AA 4IW3B 5J47A 3WP1B 1FX0A 3B6EA 4Q4HA 2OFWA 1Z0AA 5CYOA 4LY6A 1MO3A 2R65A 2XTZA 4DB2A 1ZU5A 1D2EA 1A1VA 5DIFA 5DYIA 4RFSB 2DB3A 5FUWA 1TQ2A 1QHNA 1OFHA 2E1RA 1JJVA 1KMHA 1NBMA 2ZSAA 4G01B 1CP2A 5KDOA 3ASZA 3U3KA 2J5XA 4GI7A 1EX6A 4IEIA 1JR3D 4JJKA 2JLQA 4JL6A 4B47A 1Q1BA 1G18A 3SBDA 1FTSA 1IXZA 2WM9B 1EFRD 3MUFA 2IT1A 3BH0A 1FZQA 1P60A 2PJRA 2A2ZA 2XXAA 2ODEA 2IWRA 2IHBA 5JFGA 1SVWA 2QEQA 5FI0B 5FOUA 3B9QA 3KDSE 2Q6TA 4Q01A 4C0JA 3BFVA 5K8IA 4ZDKA 2VP9A 3P27A 3K0CA 3SJAA 1R10A 5FR1A 4LYJA 1P9NA 2GRJA 2NO0A 4YMSA 4D4MA 2GAOA 3B60A 4KSBA 1JPJA 2CLDX 1RZ3A 1N5KA 1E2HA 2JJ2D 1EFUA 3LXRA 2J59A 4Q7LA 3AVUA 2ZRLA 1FFHA 2FSIA 3VR6A 3LNCA 2KSQA 1N6OA 1Q3TA 5FTNA 1E9EA 5HZHA 4B6FA 1ZD9A 2EWVA 2D7CA 4MGZR 4PO1A 3QSYA 3F5FA 4EPXA 5FL7D 4Q7JB 4KITB 1KI2A 4LC1A 3ICQB 4U5XA 1LV7A 2PEZA 5CIWA 4PZZA 1VIAA 2XZPA 3NC0C 1IY1A 3MAAC 2PCLA 3N5CA 4FCTA 3BS4A 4ZIRA 1DAFA 2WAXA 4Q4AA 3SZRA 1U8ZA 2FZ4A 3P26A 3SJZA 3Q5EA 4M8NE 1XD9A 2QAGC 1G20E 4LGMA 1AQUA 4LHVA 1CULC 2R44A 2XNDD 4MH0R 1NVXQ 3LBIA 4LV6A 2VF8A 4OL0A 4OI0A 2ZUDA 4QHYA 2BDTA 2QI9C 1J8MF 3PG5A 4ZDJA 4Q00A 1IBRA 5FTJA 4TYPA 1N25A 1BH2A 1ZYUA 4ON9A 4B75A 2GCNA 5C2JB 4LPKA 1LW7A 2C9YA 2LKDA 2HCBA 1Z0FA 5CDFA 2WMNB 4EFNA 2IYSA 4HUTA 2JDIA 3CPHA 1X8LA 4HUQB 1OB2A 4DKXA 2FH5B 4QC2A 1SXJE 4R2HA 1E0SA 4YMUA 1V43A 3DM5A 4JMPA 3PUVA 3CWQA 1UKEA 2QORA 1JECA 3B1ZA 4PHHA 3TH5A 3VHXA 4BASA 4TMWA 5JS7A 5CM8B 4Q66C 1TF7A 1CU1A 1XXHA 4RFVA 2Q3HA 1KK0A 2HV8A 3FKQA 2OO7A 3AEZA 4A0RA 1ZNWA 1VDZA 3DZ8A 4XIGS 1E99A 1ESMA 1UFQA 3LBNA 2WAYA 3OE7A 4Q9HA 1OH8A 1JQJC 2GEVA 2OUKA 2REXB 4MRSA 2ZRBA 2FGKA 4RZ2A 1RJ9B 1X8JA 2ECKA 4LJ5A 2O8FA 4Q4JB 4YMWA 4QHSA 1NMZA 4TMXA 1OJLA 4DEYA 4NYMR 3K0SA 4LK2A 1BYIA 4NYJQ 4JLVA 4AY2A 1S2MA 1Q22A 1F2TB 2GESA 4GZLA 4KFUA 2R62A 2VTKA 1Z8FA 1MRSA 4G3XA 4B2IA 2RGEA 2G0NA 1ZC4A 1QHIA 1G7CA 2G88A 2GXUA 4CEJA 2ATVA 4RCZA 3HDTA 1Z2AA 5D3QA 4U02A 2AFIE 2QBYB 4URXR 4MQBA 3A1WA 4BLOA 1P62B 1A4RA 4KFTA 3QOFA 2CNWA 2XOKA 4MRPA 1UADA 2OZEA 2QM7A 3ZVNA 5DE3A 2CLCX 2CJWB 3TAHA 1E9RA 4MKGA 1FP6A 3B13B 1G8YA 1SXJB 3QPVA 1Z28A 2NO7A 1H8HD 2BC9A 1SKQA 2BWJA 5B30A 4V0ME 1UDXA 2GXAA 3VKGA 3GFTA 4GFDA 1OXSC 3C15C 1HH4A 3OEHD 3AF1A 5K8LA 1HEIA 1NLFA 3IKJA 4HB4A 3GFPA 2F3TA 1R7RA 1TX4B 2I1QA 3FB4A 1EWQA 2ZRFA 2H5EA 4IVRA 5H70A 5LDDC 3G0HA 4DCSA 1Z6TA 4BZQA 2AD1A 3FVQA 4Q18A 2XTMA 2ORIA 4UNQA 2JIZA 3IO3A 4LBZA 1P2TA 4DLZA 1L8QA 1H8EA 3QQ5A 3MCAA 1RFLA 5JMTA 3CWZA 4Q9JA 4MGYR 3E70C 5F3WB 2ZM5A 1NSTA 1QDEA 2GBLC 4HB0A 4DHEA 3RDPA 5L3VA 4FWIB 3EC1A 3O8BA 2OFXA 1II9A 3EZ6A 1OLOA 1S96A 1LFDB 1FTNA 2V7QD 4CF7A 4WOPA 5DYGA 4OHVA 3WBKA 3OIUA 3PIRA 1EWRA 1YZGA 4QJ4A 1ZUIA 1LB1B 3U44A 4TYNA
chains in the Genus database with same CATH superfamily
1V16A 3T5TA 3IEPA 3JQ9C 4YIHA 4P36A 2QNRA 4DRZA 4G8DA 2QAJA 2AFIB 5FJJA 3BFKA 3B8EA 4MV8A 2NYUA 1EFCA 5CXQA 2BSQA 1YA6A 1OXVA 4LRSB 1I6KA 3ICEA 3C16C 2NX2A 3PPVA 1NNLA 1VLZA 1R2QA 4K8OA 4L3WA 3MQ4A 2O5EA 7ABPA 4HGOA 5LM3A 4CI0B 3TGPA 4JJ4A 4NMXB 4OGKA 1AGXA 1E9FA 4ND5A 4LGCA 2CL7X 1PZMA 4NFLA 2ADFA 1Z5PA 3LMKA 3WLSA 2YHBA 2ZANA 4OV6B 2RGNA 4RKWA 5LB4A 3UMMA 3VJMA 1BCRA 3V7FA 4ZJZA 1Q7CA 4EO9A 1RQRA 2WJ4A 3RK4A 2PFKA 4LJ8A 3DW1X 4LTNA 3CVOA 4M6WB 3DE4X 5L7WA 3JR3A 4P0PB 2X5KO 1DCKA 1GVNB 3S3TA 3NBYC 1FC0A 1XT6A 2C92A 3G8BA 3SC4A 3ZGOA 4BU0A 1E62A 1IVNA 3TBHA 1DAPA 3QF4A 4ZEWA 1UBTS 3FBTA 1PV4A 3ZE6A 1HUQA 5CLIA 3R74A 3ICVA 1P72A 4BCDA 2V55B 4BNWA 2QRGA 5LYJF 3GLTA 4JLNA 3E9EA 3HY4A 1V8BA 1GZDA 5AXDA 3SX0A 4K2AA 2OILA 2PX3A 1XZFA 4KK3A 3WGGA 1K9SA 3UHPA 4ER0A 4UE3S 1EUYA 1B8PA 1IMOA 2ZLBA 3ZK9A 3DAHA 5FAXA 3TTYA 1G3IA 2FOIA 1XCPA 4CKBA 4CTMA 4F06A 4RZQA 5KJFA 4OX9B 1WZ2A 4F3CA 1ZRHA 5JD6A 3JZMA 3I61A 4FI3F 1XNJA 4YASA 2IY9A 1KBZA 2RB5A 5JLAA 4D2IA 1DRJA 1GZUA 2ZAGA 3DC2A 3LQ4A 1V3QE 2CY0A 1F3LA 1W4ZA 5ANRB 4NP6A 3F6RA 1M54A 4RZXA 4YC7A 3TJZA 4ZOLB 3H0KA 3ZZNA 1H0RA 4XWGA 4BFXA 1KNXA 3KUCA 5AJWA 4FDTA 3MA0A 5IJXA 5IT0A 5TE9A 2LE0A 1QVWA 1U8TA 5KJ1A 4KHPB 1B0ZA 4FUTA 3EVDA 4X7BA 3P2JA 3NVMB 4XVRA 1KP3A 1PYOA 5IS2A 2X13A 1TADA 2EZTA 1YS1X 2VWGA 3ANNA 3LBFA 3NB0A 1FUYB 2VH5R 2WYOA 3LQKA 4PPFA 4TTTS 5NLLA 1C41A 1IAQA 1RYFA 4UEOA 2LZ0A 1ZIOA 3K9BA 1J9GA 4D9IA 5AW7A 5K6RA 2ZTVA 4O2LA 4RD1A 4KH0A 4WBNB 2B8TA 4K9DA 5JZSA 3FNIA 1GGHA 3ROEA 5BNFA 3ZCPA 2VP5A 2PT9A 1C3XA 2JD2A 1IOLA 5HSGA 3DSRA 3IJ5A 3AVQA 3D7RA 5JTTA 1Q0QA 2B8WA 4N18A 5FOTA 3OM9A 3COYA 1WCIB 3GJ4A 3C85A 3DV9A 3C3YA 4MDYA 5CA1B 4U9IS 4MVJH 4YP6A 1Z0JA 1L7OA 2CDBA 2DY0A 2OT3B 1U3CA 1T5HX 3PP8A 5D1NA 4BPRA 3MWKA 4F2HA 2IZ7A 3JU3A 4OCZA 4ND8A 3IMKA 1DOHA 1YACA 2XGGA 4TV8A 1AF7A 3L0DA 5LB2A 3C1UA 3QG5A 3TUJC 5IRCD 5BN4A 1UWCA 2CT8A 3KOWA 5EMMA 6AT1A 3FPKA 1Y4SA 5HF6A 1WSBA 2HRCA 4Q0MA 3WQQA 3G9TA 1NR1A 3ER9A 5B57C 1ZGJA 1GPMA 4YREA 1G6Q1 2PANA 4RX1A 2OZPA 1LBQA 4PRKA 4DC0A 2WFAA 1E60A 2HF8A 3BCHA 1T4MA 4KBFA 5EIXA 5H81A 1EJ6A 4U7WA 1GLGA 3MTIA 2CB0A 3NTUA 2IUFA 2OQRA 2JPDA 1U02A 4K9PA 1KJIA 1NUHA 5MHTA 5BMVF 1R8QA 4CN9A 4HAVA 1PGQA 4PONA 3VZBA 1FNCA 5JAHA 1DTWA 3B8HA 3AZPA 1CT9A 2X58A 5E3IA 2OKGA 4B3XA 3QPCA 2PMCA 2ZETA 4R3NA 1BVUA 4HRXA 4OHKA 2BJHA 4WKOA 2GXQA 1FTGA 3Q98A 3NLLA 1OOEA 4K26A 1E6KA 5IUNC 1OLSB 1E69A 4Z3OA 1LDYA 2QRJA 1QH1B 3E9NA 3SFZA 2V7TA 2XH8A 1DUIA 5EVJA 3OLVA 3R5SA 5CH3A 3FMGA 2YYYA 4D80A 1YQDA 3UPTA 3PNYA 4MQ5A 2MSEB 4TL9A 5KQSA 4DTCA 1NKSA 1LU9A 2LKCA 1T36A 2Q3FA 1DWQA 2V59A 3BGSA 4F71A 4AQ7A 2Q1YA 4MA4A 4BFCA 2BYTA 4BNMA 5L8VA 2NU8B 3U17A 2GPYA 5BXYA 4KRYA 3L0IB 3OCUA 4H4CA 2M6LA 1JJFA 2H00A 3KXKA 1YQWA 4O8CA 4OP1A 1L7RA 2DHCA 2FOXA 1S4MA 2VBCA 3CNLA 3O94A 5CVEA 1E1DA 3S1AB 3ZDZB 4IIBA 2FPLA 5JZVA 1SKBA 1KI3A 3EPLA 5ADUS 1GGEA 4L3VA 3P4YA 2OV3A 1BE6A 1JLHA 2HCJB 1X70A 2Z2XA 3G3EA 4JD5A 5AHXA 5DXFA 1KARA 2C04A 3BHIA 4FFVA 5FPSA 1MW8X 4EG1A 5AM1A 1Z4JA 3I1FA 1GSHA 1XRJA 2YHIA 4L28A 4TQAA 5DMHA 4H3KB 4R1OA 2FHSA 4D4IA 1QHHB 1VDMA 3KSZO 4WUTA 4P93A 4EPTA 5IBQA 4CM9A 5ESXA 5F1PA 3B6JA 3TSCA 5DI3B 1Y8QA 3DAYA 2EW1A 3N2KA 3T34A 5CHEA 1CK4A 1QJ4A 1YNOA 1IDOA 3ED5A 3PVZA 1QLHA 1PDOA 4F2WA 4L1KA 3GFBA 1DC7A 1LJ8A 4G4JA 3HNOA 4JY7A 1EGQA 1R6VA 3HADA 5LYJA 4HLDA 5LZ4A 5I9SA 4RVCA 2WWGA 3VBEA 4GBGA 2I2WA 5BUZA 1CRQA 1TJ5A 3ND6A 1H4SA 2NTYC 3JVEA 3KJIA 2F7SA 2FW1A 3KYJB 1OX6A 2HN9A 1B73A 1XTPA 3JVDA 3OT5A 4H3HB 4OK6A 5ALUA 5FCDA 3LRPA 3Q0EA 1RC8A 3GAZA 3AZOA 4WJKB 1T9ZA 1NR7A 4ESVA 1IB0A 2JFGA 3RYIA 2EBWA 5FUBA 1N9KA 4B3CA 1PK8A 3IMGA 4CMIB 1KFJB 1R6BX 4TXHA 2W6CX 3W5HA 1XWWA 2C4VA 1X7YB 2ODNA 4PICA 1Q74A 3P8ZA 2HIAA 3NAMA 1ZSNA 1NP3A 1T0JB 2FLKA 3JQRA 2YQ5A 3RSOA 1FB5A 4OFZA 3UKDA 4QEDA 5GZ3A 3ND9A 3WRYC 4ZZ0A 1VJ0A 4FFMA 3EDYA 5FOXA 1VKJA 2BTQA 5MN5A 4TTQA 3ZHRA 4OQNA 5JDCA 3GGSA 3BD7A 5AXAA 3BMCB 1TM1E 4UNNA 1SA0B 2JAUA 4WCFC 4OHWA 5EC8A 1U28A 4BNIA 3KPYA 3LOPA 3U81A 2ZSIA 2RKBA 3DOUA 5FR2A 4Z7QB 3EJ6A 1UR5A 3BWBA 2O1XA 3H18A 4MUIA 3UW3A 4BP1A 1M1NB 1GIAA 1QDLB 4ZYVA 3G79A 1SXHA 1ZD5A 1ZXLA 2QN2A 1LF5A 3LC0A 3OAAD 4YT5A 2AKEA 4EYKA 1IQ0A 3PX7A 1D2GA 1MABB 1RLJA 3FN4A 4LHYA 4O2AB 5HK9A 1T26A 2J08A 1KWGA 4HB2A 2H1RA 1Z8DA 4CFYA 5KHOC 5CXUA 1Z0UA 2E55A 2IXEA 1NQ5A 2DYKA 2ZRNA 1FYFA 3IH5A 4K86A 1JH8A 2OXRA 1A9TA 5HK8A 1XL0A 1J0DA 1ORTA 2BF4A 3MS7A 4URVR 3AM3A 4BNVA 2BVNA 2VYND 1LPOA 3TRFA 2VJBA 2BHTA 2QTWB 2WZDA 5EXTA 1XA4A 3AEQB 1C9NA 4EFLA 2RFLA 2NSJA 2VPXA 2FJUA 2WAMA 4JXJA 4YI3A 1YFLA 1E2IA 1NI4B 1K88A 5JYBA 1KA9H 5KYUA 3IUPA 4PCAA 2HA4A 1NF2A 3PCTA 4LJ7A 2VJOA 3HBAA 1RWPA 3WLJA 4EDHA 1QF7A 3WGHA 4D1YA 5CDFE 3S8EA 4DE5A 3V7NA 1RM0A 1V7QA 3LXUX 4U39A 2VHEA 3E9ZA 1I6LA 2P9JA 1L0BA 3II6X 4GKJB 3JS5A 1XK7A 1YA4A 3DE2X 2IL1A 2RKOA 5TGZA 3N7TA 2GCOA 2BF7A 3O8NA 1DO2A 3JQFA 3EZ2A 3W5UA 1YQTA 1G5IA 1Z6XA 1EXVA 1LNZA 3K9GA 4KKVA 2BR5A 1PJAA 1OHHA 2IELA 2V45A 3W9BA 5KTOA 4WINA 4AZ0A 5FOQA 4U63A 3DDZX 2HU5A 4KPFC 3CF6R 4ZCTA 1G3QA 1OQAA 1Q15A 3QEOA 4REMA 4WE3A 1A72A 1EP2B 5BMVA 5C37A 1TQDA 2ZYIA 3PJEA 3FDIA 2XMRA 3HJCA 3Q10A 2KYRA 4J75A 5JFOA 1M2OA 3HN7A 1N8NA 3EBOA 3HV2A 3PGVA 2EHJA 1GYRA 1XMIA 2JA2A 4EKIA 1FNDA 2GAFA 3C24A 1AG9A 1A98A 5EJ8A 3W5CA 2IY7A 2DERA 2ZSDA 3HO6A 4AZTA 1JIKA 5K0GA 3ON5A 1P1FA 4O0LA 3ZHBA 4ZOQI 1N32B 1LTHR 1R0KA 2FSVC 1X38A 4QVKA 1U0BB 1PHRA 1L5MA 2WJZB 1RLTA 3MWDB 3P45A 4FEEA 4HAXA 5EQTA 3T3PB 4S24A 2P1ZA 2YRFA 4XSVA 4ZO6A 2X7HA 4TZTA 1Q1NA 3TB6A 4EABA 1ONSA 3R4VA 5LWHA 1OLXA 5J1TB 1C0IA 3DBLB 2Q1XA 3DNPA 3MPUA 4LZJA 4AKSA 1GU0A 5BSUA 1G9TA 3NORA 4HAZA 2DWUA 3GNTA 4BMZA 4ZO4A 2CLMB 3ZWBA 5I4BA 1NW9B 5J3JA 4ZYWA 4EH1A 5FBRB 2PGNA 3GNQA 1VL5A 1V6CA 13PKA 3KU1A 1NJ1A 4OFBA 1GSIA 5M7EA 2O3UA 1X1BA 3VAYA 3UGQA 5CB0A 3UJDA 1SZDA 5IXJA 1WCWA 4PNEA 3KZ1E 4PU0A 3Q9LA 3G2PA 1WAMA 4YCSA 3A2MA 3SHWA 4Y2YA 2B4YA 1NIJA 1RHMA 3UJ7A 4JNCA 3A27A 4B3JA 2GN6A 2QSJA 2AOWA 3KPJA 4BWGA 3VSBA 2FN8A 3C3KA 1PG0A 2YN2A 4F85A 2GZAA 2ATXA 1GPYA 1J8YF 2R8PA 3BJEA 3NRJA 4KQMA 3B1JA 4YNBA 3TIXB 2RARA 4Y6PA 2ZSEA 4KO2S 1LS6A 5FH9A 2A14A 3BMOB 1ZKMA 1UP6A 4B32A 2E82A 1NOIA 3VR4H 1UBRS 2Z83A 5CJ2A 4ALMA 3EGDA 3OJCA 4H7FA 4YPOA 1YI0A 1HO3A 2EYUA 4LY3A 4KQWA 2FETA 2Q0HA 1T6YA 2VNSA 4MR7A 3TLAA 1MO2A 3NHRA 2B35A 4G9GA 2G5GX 4Q1VA 4HWSA 4LYYA 5DF1A 3DL2A 1LDMA 1VIVA 4Q1FA 3L79A 4Y0VA 2QMYA 1T5LA 5AOAA 2VJKA 3JX9A 3VHXB 1UZLA 3E3MA 3IELA 2BGGA 3EAFA 2JH8A 1YDFA 3DO5A 3IIMA 1PR9A 2ICAA 2DUMA 2ZUWA 3MWEB 3L9WA 3SC3A 4KRFA 3WNZA 5DRYA 2OV2A 3ADBA 3ITKA 3PNPA 3BGDA 3LKBA 1CX9B 4J0KA 3KT0A 1S2NA 3ZI0A 4GDFA 4CTJA 4IF6A 1M3SA 1Y4AE 1F9AA 1XTIA 2P6NA 2XYQA 3VPAA 1XZLA 4EPYA 1VHWA 5DP1A 2J9FB 3VVLA 2B7CA 1D4ZA 1GA4A 4GGOA 3VHLB 4K05A 3WB0A 3M9XA 4QHTA 3HO8A 1OMOA 1R9NA 2A3NA 4M99A 4EYOA 5HIJA 4MB6A 2IUYA 2VZEA 3IPAA 1DBSA 3THXA 1KO5A 3DH0A 3HM2A 2BM1A 4I50F 5I45A 2E4XA 1P91A 2OG2A 2PUGA 2G28A 2OWEA 3AESB 5I6DA 2UUBB 4IX1A 3N6VA 4ZQCB 1PQPA 1JAXA 2FPPB 1O95C 2XVMA 1TPZA 5E2BA 3RUFA 1H4QA 3UBTA 4KYUA 1U3GA 1XDBA 4HV4A 1L6IA 1QJCA 2YV3A 3AHIA 2I1VB 3PL5A 4G84A 2GPNA 1PS9A 4KQJA 1WB9A 1PBNA 3NTRA 3LIPA 2FN3A 4KVZA 4B8WA 2R3SA 3R1IA 2AFHB 2VDKB 2J9RA 3GFSA 1J2RA 3B78A 3FCYA 3BERA 3M2TA 3MPOA 1JKXA 5SY9A 4NE2A 4XM1A 5DHQA 4WY2A 2C99A 2VRBA 2B1QA 3IPYA 3IQEA 1I51A 1PFUA 2W98A 1NONA 2B2XA 3PYXA 5H4GA 2GWRA 2OD9A 4NYMQ 3NHUA 2CCGA 1UBFA 4J0FA 4EUKA 4IWXA 5HGJA 1MAAA 2I03A 4MIOA 1ZNYA 2JI6A 1POXA 1Z33A 3MRVA 4AJ4A 4WLOA 1T9AA 3OO1A 3I92A 1ZMOA 4GZMA 2C0CA 4WMLA 1IXKA 1B00A 2IZ6A 4A2PA 2ECOA 3P9XA 4OK3A 2BEVA 5IM4A 3F47A 1J07A 1R00A 3TM5A 1Q6YA 4F6LA 1RKBA 2R7MA 2YZ2A 1T43A 1E1LA 2QD4A 3TL2A 3LPNA 1BS2A 3PNOA 2IHYA 2MSLA 3R9KA 4E5PA 4C06A 4MWTA 1KRXA 3CHYA 2EHDA 2IIBA 3IUJA 1K68A 1JXAA 4HLCA 3WMXA 5ADWA 1W8DA 2VTBA 1MNAA 2AMYA 4CU5A 3F4KA 3HHPA 2PBFA 3BCRA 1UXHA 5KOIA 3KLPX 2AQ8A 4D8TA 1CQXA 4XE5A 1X77A 1Z83A 3RHSA 2OHGA 3A9TA 4MWDA 5JU6A 2ZUTA 5IKEA 3R3UA 1B76A 3K0CC 3LRXA 3OEED 1JTFA 3OUUA 1LJLA 2CMHA 4JN6B 3TCNA 4AJ2A 4KPGA 4P3YA 1EUCA 5ICMA 1O6FA 5FWXA 1OTHA 4YV0A 5TS3A 2HGZA 4EKGA 1RAHA 1QONA 2AS0A 1X2EA 2HPHA 3VKUA 1JEEA 1UINA 2NM0A 4MO9A 4YRTA 1E0JA 4XWTA 4YRIA 3GGPA 5BVHA 4QGFA 3GDOA 2PN1A 1D9ZA 1ZM4A 4O59O 2DFKB 3E23A 4AWXA 1IVSA 3N2NA 4LDPA 3QU5A 1B8OA 1IE3A 4NZZA 4BX9A 4GMHA 1JE1A 3AF0A 4ZAWA 1XMQB 1Z2OX 1ZDMA 1JKMA 1UKBA 1YIAA 4I5DA 5AKZA 4IIXA 4U8HA 4UZSA 1CZRA 1F6WA 2MR6A 2OORA 3F46A 3PXEA 4JITA 5E0KB 3V8QA 1CY6A 1SR8A 3MOSA 4GR4A 1D6SA 2G4VA 2EQBA 2QUIA 4FFWA 4PYLA 2YUIA 3I2KA 1U7WA 4I5IA 3N7UA 3ZBQA 2BM8A 4PX9A 1J7KA 2FPGB 1GL6A 3GCZA 3DCJA 3QLUA 4LCEA 4F1KA 3KL4A 3OJOA 4XJVA 5K0LA 3T7RA 4D0SA 4C4XA 3G8AA 4AKTA 4IRMA 2HSZA 4UJ3A 4BBZA 3IQWA 3QYFA 5KNBH 2CFTA 4NZYA 4JFAA 2PT6A 1ZEJA 2CLKB 5ALTA 2R4QA 1QYXA 3BD6A 3GMSA 1U3WA 1UJ4A 1W46A 2PSSA 2V58A 3H9UA 4H15A 1JHYA 1I6WA 1GILA 2ES4A 4KQHA 4R3UC 1ZAKA 2GBFA 2H8GA 2XWQA 3UJ9A 4BRUA 5HQ3B 2AMFA 4DDUA 4CWAA 4M0LA 1X7WB 2OFFA 3I9LA 1V5EA 4R9VA 5C4IA 1KAOA 3Q7EA 4BVGA 2YFHA 1BKDR 4HGPA 1IZ7A 3K9LA 3L1IA 2QXTA 5KSPA 4DB4A 1RKUA 5FWDA 1RRPA 1CBUA 1NFRA 2PX5A 3RVRA 5LMNB 4XFDA 2ZUFA 2AG1A 2G6BA 2J8ZA 2QPOA 1CUJA 3G2HA 1QFYA 2FR8A 2V6BA 1AS0A 2YJZA 2Q27A 4LUCA 1S3GA 1I6MA 5KMGB 3ZWPA 4D45A 4EKNB 1IN5A 1US8B 1IDN1 2DPLA 3SBXA 4UTNA 3UA4A 1JTVA 3LTNC 2PGAA 2QVBA 4GECA 5F51A 2NXEA 4WH0A 2IU4A 4HYTA 1CUAA 2W6JA 4I50A 5EESA 2KE5A 3M6LA 4BDSA 4YRBA 5FA6A 5ILGA 8ATCA 3V9PA 4FIZA 2D3TA 1K5HA 1KEPA 1WU7A 4C2UA 1X42A 5AW5A 1RI3A 1A9QA 3PTZA 4KYIB 3B9PA 4NV0A 1TZKA 3H5AA 4JI6B 3S2IA 2VRCA 3E7WA 3S5UA 4QO7A 3BXHA 1C2YA 2CSXA 2JCGA 3S8YA 2JKZA 1KWKA 1O4VA 1GPH1 2FEOA 4LRQA 4F3RA 5H9WA 4C6RA 1GADO 5J40A 3K0FB 3RVKA 2VATA 1J5EB 5K6AA 4AMYA 1J4AA 4FOOA 3EGWA 3NDJA 4F6CA 3K6KA 1H2WA 2JGKA 4AW9A 2IRWA 3LE8A 3LM8A 4JP2A 4D74A 3W5DA 4JLKA 4P80A 1TL7C 2PVPA 2N47A 4COKA 4RJLA 5J5AA 1PUXA 2QZJA 1DHTA 4RQAA 2OCPA 2DXIA 2BEWB 4P2BA 3LFTA 2FXIA 2ZAMA 1TCUA 1ZAYA 1IN7A 2W48A 4DIOA 3CEAA 5CNIA 5H16A 5F1KA 3AUUA 3HWRA 4TLMB 2VF5X 2Z08A 3DDUA 1N3IA 2IXDA 3DLTA 1PL0A 3OFVA 3U6BA 6ADHA 1U90A 2BJWA 3ETEA 3Q7RA 3E8SA 3KSUA 1YJAA 4L73A 2WABA 5THQA 4WV3A 2Q6OA 3D3KA 3KQVA 3KR1A 2HTEA 3VR6D 1LW6E 2ZB4A 1SRQA 5GGYA 1V8PA 3CMCO 4EUFA 1ZJWA 3CF0A 2ZREA 1PP4A 3B53X 4QOFA 3ZZTA 2BFBB 3P2OA 1PWEA 2GVZC 1YAJA 3HKDB 4JAVC 4LEIA 4CMEA 3JQBA 1Z68A 1ULUA 4C0WA 4ZMSA 3FSGD 3CCCA 4QRHA 4BJ5A 3CTPA 4EW2A 3CLSC 5FUQA 3B1WA 1GKUB 1NMQA 2NXNA 3DMDA 2O5CA 3TW8A 1J2UA 4BUZA 3PXBA 3STUA 2ZRAA 1LRLA 3IHLA 3TO5A 2Z5VA 3IEUA 3YASA 3SZUA 1JMKC 3WLQA 4GP6A 4LXUA 4CCYA 3O4FA 1VGQA 2ZU0C 5HKLA 3HKEA 4V38A 5CVDA 4II7A 5HTKA 2BM9A 1WQ4A 3A4MA 3AZQA 4F86A 1M76A 1CJTC 4MP3A 2YINC 3E2MA 4MVJD 2O4CA 2VTDA 2X1VA 3KAPA 1GN9A 4QUBA 3T06B 3OMLA 3CPJB 3WIVA 1KL7A 4MLZA 2NACA 1LPMA 4CLEA 5HMMA 2PYZA 1VYHA 2OY0A 2LCFA 3NHSA 3KJXA 4XD2A 3IXQA 3DMNA 1TEXA 4QDJA 3R0ZA 1ULTA 1MO6A 1W75A 1VSQA 2PKWA 5EKDA 5JNLA 1NT4A 3FPCA 3JYHA 3DV2A 4ZALA 1PTJA 3QVGA 1TJYA 4H77A 5K01A 3A1FA 5B7QA 3GUYA 1MTZA 1M8GA 3KB2A 2GASA 5I7HA 3IC5A 4DYHA 1OWOA 3HJUA 3H6KA 2IW1A 4RANA 5HXAA 2F4VB 4MWSA 2JJYA 2VTVA 3H1TA 1PK9A 1V4VA 1V6AA 2GNPA 3PGA1 4MEAA 4MUYA 4OLFA 4UNSA 3JWEA 1Z37A 2OLJA 5IU6A 4NC9A 3C45A 5JZOA 2H3HA 4L02A 1QU2A 1YJ5A 2H2DA 3EXEA 1SIWA 1MZPA 1IXRC 1QK5A 1XOIA 3MRTA 1QV6A 3ES9A 4IHKA 3C6KA 5LZ8A 3VPHA 2QSUA 4HVAA 2RIRA 2V97A 3BKWA 4YRRA 4V1CI 2I34A 3E6AA 1JHDA 5BV0A 1L7AA 2JGAA 4ER5A 4PR3A 4YUZA 4BPBA 2GD6A 1YJXA 2FCRA 3AHDA 4KSYA 1AQNA 4AP6A 1CUCA 1T3GA 2QV0A 5KTKA 1UK6A 4OQFA 2JRCA 1C30B 3G0GA 4KMRA 5ITSA 3IQIX 2IUTA 3INTA 1O58A 3O47A 3VSCA 5IYZF 1N2BA 3QFHA 3BTVA 2P77A 4TWJA 1NW8A 3ONWA 4PY2A 1RDFA 1SD1A 4UAVA 3TXXA 1X9HA 3NTLA 4D3SA 4UNPA 4HDKB 1JHZA 2ECQA 3PQ3A 2W2LA 3DFKA 3ZGVA 3QXCA 1BE8A 9ATCA 2B3TA 4WZZA 4ND4A 1AOXA 2DBYA 3LG2A 5KYKA 5J2TB 3WGOA 1PFWA 3ZU6A 2ZROA 3TW6A 2HUPA 3U4AA 1UAAA 4GRDA 2WW8A 2FN9A 2VBFA 1BJRE 2JAXA 4I4CA 3AF5A 1MD9A 2ZTUA 4BKPA 1W4CA 4TXNA 1DOZA 2HBQA 5FHRA 3LUBA 3O7WA 2O3QA 3QWHA 1ZBDA 3T5AA 4RKFA 2UYCA 1XTUA 3HYLA 3LLSA 2DCUA 4OHMA 3OLQA 4DLTA 5BNTA 4MNTA 3STVA 4R51A 4YUYA 1XTVA 4OUDB 1J0BA 2IV7A 1FRVA 4TS3A 1Y7IA 2PUVA 1JL3A 6LDHA 4DN6A 5JUWA 1VE3A 3LO8A 3BN3A 3NTOA 5JVDB 2GA9A 4IZIA 4PTYA 4PE5B 3VYTB 2G83A 2XITA 3CZQA 3KJNA 4JR1A 1T8SA 3QE4A 4UUQA 4I5FA 1PSWA 5AD1A 4D3FA 1JYSA 4RWEA 4JI3B 4WECA 5HW0A 1X7HA 3QWFA 4XWYA 5LZ7A 2OA0A 1W34A 1N2OA 1NVBA 5BW4A 2D5LA 1SXGA 4H17A 4A27A 4X0EA 1SB9A 5DHUA 4NBSA 3ER8A 4CIVA 3IVCA 4TL6A 1P9LA 4KYTA 1RZRA 3G0CA 1MC4A 2C59A 2VAXA 3DGFC 3PUWA 2JIZD 2WJIA 4CZ2A 5G53C 3LK7A 4FSXA 3SSAA 1DJNA 4WNAA 2AG5A 1QPGA 1JG4A 2E4YA 3F3KA 4MULA 1E79A 4O4JB 1O9HA 4OU5A 2VP0A 3V4OA 2XNHA 3EVTA 5HKAA 3VNUA 2CL0X 3PQ7A 1KDOA 5EJIA 1KI1A 5WRFA 1HRDA 4PM4A 3QXJA 1BC5A 1ZH0A 5K0CA 4XEHA 3QFRA 5KYVA 5JWOA 1CQJA 4S1TA 2UAGA 1KAEA 3U3OA 1GV1A 4DZZA 5CDTA 1BQ4A 2G9UA 3HGTA 2UYGA 3FLMA 4M3NA 5AW3A 3WLEA 1Z0ZA 3NVAA 1KY5A 1LSUA 1N4AA 1DBQA 1T6NA 1R16A 2GTPA 3FA2A 4MAFA 4WGGA 3MWFA 1U0SY 4P3XA 4X45A 2PT7A 3P5BA 5DOVA 2ZFUA 1BG6A 3UKJA 1A77A 1QE0A 4S1WA 3OQNA 2AZTA 5EMNA 4NPHA 3B85A 4PLZA 4DCMA 5CDUA 3AR8A 4XWKA 2GJ8A 2BSAA 2Z57A 2VZ8A 3OX1A 2I8CA 2F9MA 1AV6A 1H65A 3ZGXA 2BTOA 3D8HA 2P0EA 4KMSA 4YCNA 1SCNE 1DB3A 1MUUA 3GZJA 3REQB 4CMKA 2FR1A 2UZ0A 5JPCA 1H94A 5BN3A 5DTIA 4LZWA 2QRKA 4I9HA 3ZUPA 4NCBA 1FNNA 1KMMA 3FVVA 2WIJA 4JENA 3A1NA 4JVMA 1QS0B 1GZSA 1N92A 2Q2NA 1GKLA 1JSZA 4V0RA 4US2R 1J21A 4MXDA 4A16A 1DDOA 2OK7A 2ZWIA 4TMFA 3U13A 2JFXA 2QMQA 1XXLA 4PZDA 4BTLA 5FPQA 1L9XA 1TZ2A 1XO1A 1TA9A 3EWIA 1IVYA 4X3CA 3P71T 1EVEA 3HY6A 4DDTA 4RENA 3EFEA 4MIYA 1RYZA 1UODA 2DLDA 5KREA 1WLYA 4S35A 4I8XA 4K9LA 4X8HA 1P1JA 1VI5A 2ZYDA 1IBCA 1E1CA 2A0FA 2E2WA 3AEUA 2QMHA 4CCSA 5ALVA 3RYHA 2R1ZA 2AX4A 1HG1A 2WI8A 1QAOA 3OKFA 4YMTA 4I9NA 4B48A 3IAUA 4YFYA 1TA4A 3REGA 3M49A 1TJPB 3CF2A 4MUMA 4LFBB 4YR7A 4O2RA 4ZT3A 2EX4A 2WWIA 4ZYXA 3ESCA 4XD7D 3OZSA 3HB9A 2XB4A 4RWZA 5LSAA 2X3FA 4BQRA 2NU6B 2P0AA 3BGVA 3SPXA 1TAQA 5CD1A 4OKIA 3KJFA 5TB5A 1TMOA 4MW9A 5DULA 1ONNA 1FFCA 3GZNA 3UV6A 1I4OA 4KVGA 1KAGA 1VBNA 3E9YA 2R48A 4GM4A 1AC5A 4LWOA 3TTXA 3Q9NA 1ZRMA 1RM5A 1JR3A 2E85A 1K5GA 1QLJA 4IWYA 4FOTA 4EEKA 3U4QA 3A6PC 3BMQB 4WBXC 2VF7A 3DFFA 4WEQA 3OH8A 4M55A 2HMTA 4EI9A 5AR1A 4A15A 3PB3A 5IYZA 1JHPA 4MHTA 2C2BA 1TCBA 2HAEA 1AKNA 2I9KA 3V7UA 2LVBA 4ZVLA 4R7TA 3H9CA 5JTUA 5C80A 5FQNA 3NBKA 1FMJA 4YDHB 4LVOA 5C8YB 4ITUA 2W2KA 1XP8A 2FYTA 4HDMB 1XZBA 4DRYA 2X40A 4R8LA 2I71A 4BLSA 1WXQA 3NZEA 1L5LA 5AHKA 4B7CA 5JS6A 3EDMA 2CF5A 1SU7A 4WUVA 1L5HA 4AJ1A 3EK2A 2WG1A 1LY1A 3GLVA 3NONA 4RQBA 5IAEA 1M2HA 3ELUA 3O1LA 3RT9A 5IK2D 4BQFA 1VKZA 5LA6A 4BNJA 4ER3A 2P4SA 3P0IA 2O8EA 4Q34A 1KMHB 3B1YA 2EQ5A 4DABA 2P69A 2D1FA 2WWTA 4OMFG 4URWR 2OESA 2OHOA 1I7QB 4IIHA 2A9KA 3HDHA 4JBYA 1ZMRA 1FA9A 1OKKD 1MO4A 2Q45A 3RJMA 4Z8YA 3ESYA 1ISMA 1K0FA 4DPLA 3AFGA 5FA5A 2DGDA 2GDJA 4KR0A 4P3NA 3ZZUA 2X2FA 5HCUA 4ZO7A 1SBYA 4HNAB 3M5WA 4XUGB 1ZM2A 1CUFA 4BZZA 5DCUA 1CF4A 3QWIA 3UN1A 1NM5C 4Y9DA 3JQEA 5LLSA 1WRBA 2L19A 3CNNA 1QG6A 3R9XB 2IUUA 3OCXA 1JFRA 1Z62A 2HNBA 3JAKB 3NYRA 3ZJ5A 3K0AA 3DF9A 2Y68A 1MLDA 4C88A 4QYWA 6GPBA 2H9IA 3PBKA 3UBMA 1PV2A 2WM8A 4C1NA 1E4EA 3NHZA 4M1OA 3ZDFA 1IJEA 5G1NA 3OEWA 1I14A 2F9FA 2HDOA 3HP7A 4RZ3A 3V1NA 4WA8A 1LLUA 2FPXA 3LYLA 4FMDB 4MLCA 4M21A 5LLDA 1JLSA 5F4ZA 1NY6A 2ZUVA 2X3YA 4IVQA 2HCRA 3JQ8A 1GDDA 2EV9A 4QULA 2BFWA 2H1WA 5GZ6A 1ZVVA 1RYMA 3I2JA 4Y8VA 2QAIA 2WYVA 1VZ2A 1NLMA 3OIWA 1AS2A 3GLUA 2JAOA 2ZR8A 2XMQA 1KK2A 2DQYA 1Z22A 2ZTMA 1U63A 4M1WA 3KS9A 3IIEA 2CXXA 4JA0A 1RWVA 4CCAA 5HNKA 3IJEB 2B9EA 1O96B 3RV3A 4CUKA 2HYIC 3H16A 1FXUA 4WDQA 1K98A 1ULBA 2C42A 1SBHA 2A1UB 2AH5A 1EDDA 4UHJA 2YZNA 1AK2A 1JQLB 1LBIA 1N2CE 2AN5A 2PRSA 2XWBF 4LTDA 4FEYA 2VNIA 2I7CA 3WGTA 2W4MA 1GAXA 3T0GA 2C3UA 5GGXA 1B0AA 4WJLA 5DHRA 2MTBA 4AX8A 2P2LA 2QX6A 1GT91 3NEJA 5HRCA 2PWAA 4AL4A 5HIKA 1TIPA 1UBJS 5G40A 1LH0A 1VL8A 2EFGA 3RVOA 2NU9B 1RKQA 3RC8A 3TI9A 1QFJA 3ZDYB 2OAQ1 4HQ6A 2G3YA 1EH5A 3ZBUA 4AK9A 4EQ6A 2HHJA 2YHAA 2W83A 4QM7A 1EVQA 1AGPA 2EG9A 3FR8A 5AW6A 1YQEA 1Z5GA 3GFOA 4MCAA 5EHNA 1Z4QA 3A1DA 3C3WA 3CRW1 4RVSA 5CPBA 1YDWA 3EF1A 1V71A 2AR7A 3SS8A 3D8NA 2IFTA 4WESB 4RK7A 4CMJA 1M74A 3E3NA 4IKEA 1K92A 1LI4A 2Z2KA 4HGQA 4EJSC 3OJFA 1GP2A 4UNIA 5DGDA 2E9SA 2NZ8A 4UM8B 3C7DB 1ESNA 1G4AE 3NIDB 5TEVA 1L8XA 1M7BA 3B38A 3ERCA 3BXZA 4XLTA 2JBHA 4I5EA 1QNLA 5EYPA 4V0NA 2QTAA 4RE5A 1W87A 3X0DA 5J4VA 3HVJA 3OU7A 2PU5A 4Q9IA 2B0CA 3I3SR 5AJYA 2L18A 5EJ6A 2J3LA 1FFGA 5DBOA 3V4ZA 4C08A 5JY6A 3ABIA 1N3BA 3CG0A 5DP2A 3CZCA 2PS1A 3ESRA 4G85A 3PFNA 1I4WA 4PO8A 5KTPA 1NPDA 1IOZA 4Q3BA 4L9RA 4DM3A 2OECA 2EZUA 5BQFA 1RD4A 2CLSA 3MXOA 3TZHA 4R2KA 3VHRA 4KXUA 1UJ6A 1Z0IA 3AFNA 3L18A 2A59A 3DOOA 3WL4A 5HZKA 3PA8A 3IFSA 5KI6A 4CGZA 2QX4A 4K5QA 4RCYA 5KJCA 1UM9B 2EWMA 1MQAA 1YBMA 1GKYA 1DBWA 1UBKS 2J87A 3G6WA 3RIYA 4YRJA 3U9TA 3LW8A 2BFDA 2JFPA 5ABPA 3CVYA 5FXMA 4X84A 3O8LA 1B15A 4J0QA 1IEXA 3EXFB 1G7TA 1FP7A 2ZRIA 5H68A 4DM4A 4ZTZB 4C7OA 1O8CA 5A3JA 3L8MA 1W85A 3EHDA 1L4BA 2QTMA 4ICIA 4CEJB 1E58A 2QGFA 1MX9A 3SSOA 1RXSA 2XNCA 4BLVA 3I04A 5CJJA 4JUIA 4HDOB 3DYBA 6NULA 2FUEA 1BVHA 4LXGA 3K53A 3WFJA 3AHHA 4DZTA 2D5CA 1SQSA 1J9ZA 4EF5A 9GPBA 2G25A 1NU6A 4ETNA 2OGTA 3I62A 4FGLA 1PGOA 1VB5A 3RG8A 3MERA 2O8BB 1HLGA 5JAZA 2V7QA 1T0PA 1XCGB 3GVCA 1J33A 4HSGA 4FE4A 3RNOA 4HKTA 2IEZA 4UTPA 5DGXA 4JKYA 1EM6A 1QYCA 1WHSB 3K09A 4RFLA 3H04A 3MAJA 3T94A 2RMKA 1A9XA 3BZBA 4TZ6A 3IDSA 3CWCA 3FLAA 3STHA 3GLFA 1SWVA 3T54A 3T3EA 1E5VA 3FTNA 4WK2B 4J1TA 5IM4F 3R7DA 4P38A 4TRMA 4O6VA 4EFMA 3K2EA 1U7XA 3CLUC 2EC5A 3EULA 1EFPB 2QQEA 1Z4NA 1ULSA 2FSUA 2EL7A 4MUHA 3FAKA 4CM4A 3GWGA 3H5LA 3I3OA 4B6GA 3J7AC 2BKEA 2E5WA 2VK8A 4EHAA 3FNHA 1N3LA 4HG2A 2BBTA 1UP4A 1SC4A 5E3HA 4I5GA 3TIFA 3OBBA 3ZXXA 2A5DA 1MT3A 4BMDA 4KFCA 3ROQA 4G6ZA 3FNBA 3O8OB 4M1EA 1A8SA