3HYRA

Structural insight into g protein coupling and regulation of fe2+ membrane transport
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
253
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
publication title Structural basis of GDP release and gating in G protein coupled Fe2+ transport.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 253
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hyrA01
2RAPA 3LY5A 3AKCA 1EFHA 4Q9LA 3AKDA 4QJ4A 3U4QA 2GETA 3A8TA 3CX7A 4TQUS 1II0A 3NHBA 2VP5A 1GM5A 1N6RA 1I4TD 2GCPA 3BRWD 1VTKA 2V54A 3BC1A 3LX8A 1DVRA 2VP6A 2Q9AA 4FMCF 3BAFA 2IYRA 5EJEA 2ZPTX 1N0WA 3RSLA 4G5OA 4M1TA 4E22A 2A5YB 2VA8A 5F9HA 3A4NA 1G20E 1AS3A 2PCJA 3I1FA 4BLPA 3A1TA 2XX3A 3ZLJA 1SHZA 1JECA 1VCNA 4CEHB 5E7MA 1KMQA 2RH5A 4GPTA 5LB2A 5FTLA 1KK3A 1J2JA 1IN4A 2GBLA 2FMXA 4YMUA 3RS5A 3SE0A 2OHFA 4MGYR 4QNRA 2X2FA 3W90A 4I1SA 5EE5B 2OFWA 1U94A 4FMDB 1T9HA 4Q5IA 4IXNA 1DTSA 1D6JA 1G8PA 4N1AA 2JLXA 1GFIA 1KY3A 2WJVA 5G3YA 1X1SA 1VCMA 2JATA 3VQTA 4FINA 1RPZA 2YVUA 1EX7A 2IS1A 5CITA 4TQ9A 4AKIA 1Q1QA 4XD7A 3O8DA 3R8FA 3QPWA 3K70D 5JEDA 1Z6AA 5DE3A 3ZS9A 1T4GA 1Z28A 5B57C 2WICA 4Z8YA 1G5TA 1Q44A 1RC8A 1ZUNB 1FP7A 2RGNA 4ZI3A 5FL7A 2FV8A 3WNDA 3T5GA 2P0EA 1DG1G 3NXSA 2FN4A 1DAIA 1J99A 4M9SA 2OG2A 4Y0VA 5C4GB 4CEIB 5BQ5A 3W8RA 3A58B 1UBCA 1ZD8A 4TSFD 2Z6VA 4R7ZA 5EXSA 1GG2A 3TBKA 4Q66C 1QRAA 4C2UA 2DBYA 2NTYC 2PX3A 4FXPA 1Z29A 4D0LB 2IYLD 4OQXA 4RFVA 2WJYA 4KI0A 3A4LA 5JI2E 1VCIA 4E5UA 3PEUA 3X1YA 3ND9A 3PUWA 3MAAC 1DAHA 2NO7A 1KJWA 4QGHA 2XSZA 4LJAA 1OH7A 4Q4AA 4QOSA 4O2RA 1IN7A 2WWHA 3C16C 3GJ4A 4U00A 4XOIA 1F3OA 1Z6GA 3BGWA 3SC3A 2CLCX 2FSFA 2ZJ8A 1T5IA 4X8MA 3RS2A 4BFYA 5JJIA 1G3UA 1W5TA 1Q12A 4GL2A 2OAQ1 4QGFA 3OEHD 4QM6A 4B3XA 1CULC 1M34E 3DOFA 4KSBA 1XTRA 2RGEA 1F2UB 4ESVA 2DWQA 3BK7A 2QROA 3T61A 4KYUA 1G8HA 3QSYA 5F9FA 3CNLA 2ERXA 3RABA 1QDEA 3U3OA 1KTVA 2IW3A 3QEOA 1W4CA 2MSEB 5FOWA 1W0KD 1F48A 4V02A 3H0KA 4IHQA 3UG6A 1KDOA 1Q57A 2YHSA 3QF4B 4KFRA 1OHHA 3HP1A 1NVVQ 3TSOA 4A82A 5L8VA 1FUKA 2J7KA 1Q3HA 2F3TA 1Z0DA 2XITA 1IJFA 5EZ6B 1L8QA 2OFXA 1RIFA 2QMUA 4GI7A 3FMIA 5DI3B 3S1AB 4EJSB 1SXJE 4RFSB 2GCNA 1MABA 2PJRA 4B74A 3OESA 3CIOA 4U7DA 2BOVA 4LV8B 2GHIA 2WV9A 4A2WA 4D25A 1PZNA 2ZREA 1TQ6A 4HLQB 1CXZA 4MRVA 2F55A 4H9GA 1J8YF 4TL8A 3WRXC 2YNMA 2VP9A 2ZJAA 3TAUA 4IOLA 1YR9A 4XJXA 1U8AA 3C14C 5J40A 1KSGA 2HYIC 4Q47A 4QBIA 5C46F 2O8BA 2DFNA 2ZEJA 3KKQA 3UXMA 2ZE7A 2WM9B 2E9SA 1IXZA 2DY1A 1UEJA 3MJHA 3TSWA 4TSFA 1GNQA 2K5UA 4XVRA 2NGRA 4Q1BA 1QG2A 3EW9A 4PZYA 1N5JA 4V0MA 1R0YA 3C4JA 2QGZA 1SKQA 5JEEA 5KNDA 1M6NA 2B7CA 3THXB 2AN9A 1O3YA 3WNBA 5J4KA 1G18A 2J0QA 1XX6A 4OHZA 3QOFA 4GFDA 4NCIA 1Z3IX 4A15A 4D26A 2Q6TA 3FE2A 4HB4A 4EPTA 4TLAA 3I72A 2OXCA 3NVAA 4LBWA 2AHOA 4PAQA 3N2IA 5DHAA 4B75A 5FBQB 1Z5ZA 3PR1A 4L9WA 1CJKC 3AB3A 2HF9A 2JIZD 4MRSA 1P3JA 2WWGA 1W44A 3CH4B 3LBHA 3QVUA 4EPXA 3TUIC 3LWNA 3P4XA 4HDQB 1TQDA 1MRNA 1PUIA 1ZM3A 3O47A 4PAMA 4QL3A 2JA1A 4TLDA 1QBKC 3CF6R 3OEHA 4B73A 1ZM4A 1G7SA 4P4SB 5B30A 1OXVA 2JJ1D 4TL9A 2G1JA 3ZD6A 3SJBA 1NBMA 4Z51A 5ELXA 2RB4A 1YKSA 4BRUA 1B0UA 2X2EA 2XOKA 3FPAA 3HR8A 4JLPA 4UXIA 4V0LA 3TAHA 4R2IA 1TF2A 2IYQA 3K9HA 1YRAA 4PHHA 4PQRA 2WSSA 3A1SA 3VR6A 1W0KA 3GP8A 4P4TA 2BV3A 4QJ5A 721PA 3LW7A 5B64A 3L0SA 4AC9A 1TX4B 1GP2A 3ZYCA 3B6EA 4A8JA 4Q21A 4NE2A 3AP2A 4IJMA 2UZ3A 3BFKA 3EA0A 4G5GA 5FI0B 3OE7A 2IT1A 2IUSA 2HLDA 2OV2A 3FHCB 2CVHA 1YQTA 1W36B 1IXRC 4G1UC 4IOKA 4KHZA 2C99A 3QBVA 4TYPA 4MGKR 1ZU5A 2FGJA 1CTQA 5HR5A 2BM1A 4CF7A 4CEJB 1BIFA 1Q1EA 3FTQA 4IKEA 1TUIA 1G3QA 3B8HA 4YXWA 1RFLA 1AKYA 4URXR 2AXNA 2AD5A 2JJ8A 4W5HA 5A4JA 2W2TA 3ADDA 3P26A 2OO7A 2GAOA 1CR1A 2FG5A 4BZQA 4TYYA 4JZKA 1KI7A 3ZQJA 5DGXA 3R9WA 2GJAA 1E2NA 1P2UA 1XZPA 4XH9B 2X1VA 5TVKA 2AK3A 1KDRA 4MGIR 2EFGA 4URZR 2ZANA 3W34A 4NBSA 3ZGXA 4TMVA 4DKXA 5FOUA 1SVKA 4F93B 2FPKA 2Q21A 4ARZB 3BH6A 1JR3E 2V8OA 4LI0A 1X8LA 1VIAA 5CDFE 3FHTA 1LNZA 1ZM7A 5TV2A 4DSNA 3OIUA 2AKYA 1BMFA 1N25A 2ANBA 1NP6A 1T8UA 2H5EA 4RD6A 4JLKA 4C0HA 2A5GA 2AK2A 1XTKA 2ZU6A 1N6HA 2UZIR 4HB0A 4FN5A 5L3RA 2ZRKA 3OIWA 4RD2A 1R5BA 2VHJA 3QNUA 3WY9A 4BLOA 1M2OB 3KQLA 2PMKA 2ZS9A 5BWMA 2Z4SA 5FOSA 4I1OA 4XTRA 2G9NA 5KTYA 1Z0KA 2RHMA 3OFND 1XP8A 1FNMA 2GF0A 3U3MA 1R0ZA 2ERYA 2ZJYA 821PA 3L82B 1NIJA 3AVXA 5K8IA 3DM9B 3IIJA 2Z5FA 4OQNA 1EWQA 4BLRA 3KKOA 4P4UA 4YMSA 4BFZA 4F38A 5CB8A 2P6NA 4POAA 1Z2AA 4TMWA 1E2MA 1YVDA 5AJXA 2BMJA 2J7PA 1E1QD 2QP3A 2JLUA 3DMDA 1KI9A 2YINC 2ZRBA 2W83A 2OT3B 3LQRA 4M0LA 5LBIA 5J4YA 2ZJBA 4EFLA 2QTHA 5G41A 4CZ2A 2ZI3A 1XTSA 3KJHA 4OYHA 1N0UA 3SU8A 1ZNWA 1D2NA 2PBRA 1N6PA 2ZUCA 3L43A 3NIBA 4WW0A 3TRFA 2FSHA 3IDQA 2HXYA 1RRGA 5CYPA 1U98A 3BH7A 3UMRA 5LPNA 1LY1A 4JVSB 1IN6A 4RD0A 3QPVA 4WZBE 3W6PA 1SXJD 4UKDA 5DSZA 1LV7A 3AF3A 4XSGA 2EFHB 1T3SA 1KNQA 2WWFA 4DCVA 1II8B 4IVRA 1KI6A 3GQBA 4PHFA 2OSBA 1NVUQ 5AK0A 3VNUA 2VO1A 1P9RA 3IUYA 2HCBA 2I4IA 3KQUA 4A6XA 4NZYA 4I81A 2EYUA 3VTKA 3I3SR 1E79D 4FMCB 1N6OA 1X3SA 4I4LA 1U8YA 1G41A 3SR0A 2PCLA 1KAGA 1MRSA 3A1VA 3FMPB 1QF9A 1FZQA 1ZM2A 1AQUA 4TZ6A 1UADA 2J1LA 3WP0A 1ZIOA 1SVMA 4Q1AA 5CIWA 3QF4A 2DWPA 2WSMA 2C95A 3H1TA 4ZV4A 3CNNA 2OLJA 5DI3A 4UXHA 3S1AA 1FP6A 1P61B 2NO6A 4PC3A 4RFSA 4EJSA 5JS7A 2ZRMA 5EUQB 4BZXA 2W0SA 2CCGA 3P4YA 1UDWA 3R9XA 3OEEA 3NG1A 3WXMA 1GKIA 4X8OA 2GXQA 3AVQA 3AF2A 2YJTD 1L4YA 3BOSA 3K0AB 3L8ZA 1TNDA 3NTUA 2ZM5A 3RS3A 3KX2A 3UWOA 2WKRA 2WWIA 4AKGA 4L9SA 1PUJA 1SHKA 1XF9A 3EZ7A 2QSYA 3CUEF 1CRPA 5J5CA 3VKHA 3CRMA 3BE4A 3SZRA 5FUXA 4EPYA 4R2HA 3PUYA 5F98A 3HR7A 5HKKD 1IONA 1OLOA 1KKLA 2WMNB 3HU3A 1AIPA 4JLOA 4PC7A 3KQKA 1H8ED 5KPDA 2WJHA 2O8FB 2VYFA 3GCGA 4Q9JA 2PEZA 3A6PC 2J41A 4V0OA 4DCTA 3GLHE 3TKLA 3GFPA 2ASEA 4ACAA 4DLTA 3EPLA 1E0JA 3B13B 5HZKA 2QQEA 2FF7A 3MLEA 4Q01A 4MDEA 1SXJA 5SZIA 1SKYE 2QT1A 3ONWA 1S4QA 1AGPA 3R7WA 1KO7A 4JYCA 1X86B 1ZJ6A 2J59A 1HURA 5HE8A 4WA7A 1Z0AA 5KPJA 4UNPA 3KDSE 4HLUA 2QE7D 4B2IA 4ACBA 3SEAA 1E79A 1O87A 4F91B 2PL3A 4Q1FA 1N0VC 2P67A 1SGWA 5TXGA 2KI5A 2ZAOA 5BN3A 4QG7A 1AKEA 1XJ0A 1KJYA 2W6JA 4NMMA 2ZR0A 3H2YA 4RKFA 1S3SA 4YLGA 1AM4D 2ZS8A 4DEYA 2NPFA 1E2JA 4FWIB 1TF7A 1OJLA 5CM9C 4KFUA 4YQFA 5FBVB 2JAQA 3EC1A 2Z4RA 1DADA 5C1BA 5JFGA 2G77B 3T06B 5BYKA 5IRCD 4I1UA 5SZHB 3KTAB 2CL7X 3RRZA 3MCAA 4Q4JB 3AH8A 2QUZA 3CR7A 5JS8A 1COWD 1E2PA 4W5WA 4XVQA 1NVVR 2UVQA 3Q3JB 4LC1A 4Q1CA 4W7SA 3UMSA 3VKWA 2I1VB 4LHXA 4UJ5A 3SDZA 3K0EA 2ZYUX 1SKYB 3V4FA 1GRRA 3MWJA 3VR2A 1MOZA 1YJ5A 2C96A 4F4IA 1JR3D 4EDHA 4V0ME 3VU9B 2R6GA 1E2GA 4MRNA 3UG7A 4CEJA 3NEJA 2R6AA 3ZZTA 1TF5A 4BLQA 2QNRA 1ESMA 3GLIB 4A0RA 3QKRB 4KU4A 2G1KA 4OK5A 3T1QA 1BKDR 3GJ0A 3HPRA 5HKKA 2QPTA 1YHNA 1CKEA 1XJCA 1DS6A 1Z8FA 4MYTA 4K46A 2ZTSA 2WJGA 1OIXA 3B1VA 1H8EA 3ETLA 4GP7A 1KZGB 4GP6A 1QHXA 1KMHA 4GOXA 4DDWA 1OF1A 1MH1A 1XD2B 3AKEA 3GJ3A 3Q85A 1LW7A 2BVNA 3VFDA 3IGFA 4IXMA 1AQYA 1NF3A 4Q4HB 1S8FA 4QFMA 2ZE6A 3RNLA 2ZAMA 5EXPA 2DB3A 1VIYA 2V55B 2O8EB 2PLRA 2BCGY 3RWMB 4ARZA 1MO4A 2QM8A 1VHLA 2YOGA 5EE1A 1S1CA 3CRQA 1E9FA 3BS4A 2BWJA 2ATVA 1OIWA 3REFA 3IILA 5AUOB 5FPKA 2ZRCA 2A7QA 3C15C 4M8NE 1MO3A 4D0GA 4HB2A 2C77A 4ZKEA 3IIKA 1E4YA 3IEVA 2QE7A 4C0JA 2YYZA 3HJNA 2RMKA 1N6KA 3MSXA 5EQTA 1GNRA 3RS4A 1AS2A 3WYFA 4AG6A 3VAAA 2A5DA 1VYVA 4UQOA 1P9NA 5FTMA 2F43B 4Q7KA 2BBWA 1TADA 3LAWA 4JKYA 4B3CA 4PZLA 3U61B 1GVNB 5AUQA 3Q7PA 1IY0A 2A5FA 4LPSA 4AI6A 3VX3A 5FBLB 1UBFA 2HV8A 5A5GA 3P1JA 1JB1A 3RC8A 1W36C 3ICEA 4LJYA 4WAUA 3V00A 1UKEA 4MYUA 2A30A 3IQWA 2H7VA 2RGGA 2C8VA 4BFVA 2RGBA 2IS4A 2VH5R 1GILA 1KO4A 2PZGA 3SI7A 1ONBA 1XNJA 2ZI4A 3DO6A 3PUXA 1JR3A 2EFEB 2OBLA 3X1ZA 5KUTA 2IL1A 5CDFA 1Z6YA 1E2LA 1OKKD 4OHWA 5F2EA 4HZUB 2IYZA 3WBKA 1NRJB 4XD7D 1CR0A 3KFXA 4UNRA 1CF4A 2ODBA 2VF7A 4XSHA 3TUZC 4M4SA 4A2PA 1HV8A 2QMOA 2WVJA 4MKHA 5GJBA 2VL7A 1IHUA 4AYXA 5FL7D 1NKSA 5EP2A 3T15A 1TAGA 1ZD1A 3CPHA 4IRUB 4S2EA 2ZSAA 4QRHA 4R71A 5BN4A 4V0NA 4Q4LA 4RZXA 1SVSA 2V1XA 3A36A 1VG9B 3CKLA 3FKSD 4M1OA 1XCMA 4JSYA 3ZZUA 3E1SA 3CPEA 4NH0A 3SBDA 4M1MA 1A4RA 4LYFA 1BH2A 1WBBA 4YDHB 4ILEA 5JCPA 3C8UA 5DISB 5HE9A 2QZ4A 3I92A 4JSTA 3ZQ6A 4OJKA 2XSZD 2EQBA 2MMCA 2PLFA 1NN1A 1P4SA 5TY0A 1T5LA 1R10A 3TH5A 2O5VA 3EWAA 3PUZA 1EESA 4NYMQ 4MQBA 3IIMA 2O8DA 4URYR 1YR7A 1FTSA 1Z63A 4KBFA 5L3VA 3K0AA 1OT3A 4C7OB 1ZM9A 4NONA 2NO0A 1WA5A 3LH5A 3RVBA 3O8CA 5DYGA 1G7RA 5K8LA 5E95A 2D7CA 2GJSA 1HEIA 2AWOA 2BEKA 2DFTA 2O52A 2P5TB 3B2EA 3D31A 2BEJA 4IVQA 3PVSA 4BEBA 1A82A 3DZ8A 1XMIA 2GDJA 3EARA 4OBEA 1OHHD 4BECA 1M7GA 3R8CA 1OFTA 1S0UA 2QP9X 4D81A 1OKKA 3VR3A 1DELA 3Q9LA 1UM8A 1EFTA 1K6MA 3G82C 4LUCA 2BBOA 2ORVA 2FFQA 3DVLA 1F6BA 1SVOA 3MD0A 1UBGA 3F3YA 1JEDA 2EFCB 1A2KC 1YU9A 3QEJA 3U3KA 1RKBA 3LVQE 2EWWA 5E4FA 1DPFA 4A2QA 2QEQA 2WOOA 1JR6A 4RD3A 1QHNA 4ZCIA 4BQSA 1GKYA 1AZTA 4FCVA 1WQ1R 4LJ9A 4N0DA 3U7FB 5J4VA 4A0HA 1XFAA 3QXCA 1WE2A 3FKSA 2JLSA 4KVGA 2D74A 3EX7C 3BB4A 2QTFA 3EIHA 1VG8A 3UMFA 4LX0A 4PHGA 2B8TA 2GA8A 4EUNA 4JJKA 3WMGA 5JSZB 3FWYA 3Q7QA 5M04A 4TYNA 3K0SA 1H8HD 3DOEA 1UBEA 4AD8A 2ONKA 4LYAA 5EXXA 2H57A 1Y63A 3V4RA 1KJZA 4HAYA 5D3MB 2CJWB 1OXSC 1YR8A 2P6UA 4LYJA 3LXRA 3TW4A 4UXJA 3B60A 4OHYA 5C18A 1E0AA 1KI1A 3GLHA 4C30A 4JYBA 4LYHA 4O3MA 5JWOA 2H18A 3CH5A 3JVVA 2J46A 1ETUA 4WOPA 3RHFA 1NBMD 2BCJQ 3VKGA 1XMJA 4LRWA 2KBFA 4H1UA 4PC6A 5EZ5A 3WMFA 3EZ2A 2AD1A 2XOKD 2R44A 2ZE5A 1QG4A 1XTIA 5FTKA 5HCNA 5HPYB 3ZVMA 2KB0A 2JEOA 5KDLA 2WSSD 3ZVNA 3AP1A 5KDDA 2VHTA 5SZKB 1BYIA 1MV5A 3GFOA 4KBGA 4D2IA 4DLVA 5KDOA 1RVDA 1XJQA 3T12A 1VECA 1TQ4A 4DT1B 4BGDA 4ZIRA 3MGCA 1PLJA 5JECA 2R9VA 1XD2A 3PG5A 1XCPA 4GT1A 1Z08A 1NMYA 3LDAA 1OIVA 2F1JA 2ZE8A 4DWJA 3T1OA 3OE7D 3KJGA 2DWOA 1GTVA 2BDTA 2HLDD 4Q4HA 2ZRDA 4C9BA 1HTWA 4D82A 3CO5A 5H8WA 3K9GA 4M9ZA 1W4RA 4G5RA 3HU2A 2C98A 1GSIA 4OQFA 4B6FA 4IDPA 5C4MA 4LSGA 1CJVC 2O0HA 2R6FA 1W1WA 2KJQA 4NYIQ 4B6EA 3AGQA 3BIFA 3DDCA 3QXSA 1TEXA 5J4HA 2OUKA 3CX8A 4YXWD 2IYSA 4QNMA 3U6BA 3PIRA 4KCGA 1CR4A 4QXAA 3GLGB 4TYWA 1EFRA 1K8RA 3IBGA 2QBYB 5LB4A 3F8TA 1K5DA 1KSHA 3GEHA 1SQ5A 2FOLA 5JRZA 1A7JA 1S2MA 2F9LA 3W6OA 1R8SA 3R20A 2GVZC 5JMTA 3Q5DA 1Z2CA 4PC2A 1H8HA 1OFHA 1DOAA 4HAUA 1CS4C 4HEJA 2ZRNA 3BXZA 2J45A 2HYDA 5JHGB 2P6RA 4RVCA 1US8B 2P3SA 4FIDA 3LXXA 4MYHA 5F3WB 1PLLA 2FEMA 3LO5A 4BFSA 2AWNA 1ZW6A 4A9AA 1U0JA 2LKDA 4PQFA 3GJ8A 1G21E 1W49A 1W4BA 1JPJA 4CGZA 3EIEA 1BMFD 3EZ6A 2F1RA 4IEEA 4II7A 1X8JA 4OHVA 4LC0A 2ZRAA 3ZVRA 5G53C 4MUBA 3E70C 2ZRHA 3HYTA 5DHFA 4QBFA 4HZUA 2QSZA 2AR7A 1VKJA 2C78A 2QAGB 2D2EA 3LV8A 2ZVQX 2ZRGA 3BFXA 2GEVA 3U44B 4BLSA 1L4UA 1YR6A 2JASA 1HT1E 1K5GA 2XB4A 4W9MC 1NY5A 2GZHA 3QKSB 5CK5A 3WYAA 4OI1A 2O8CB 1KI2A 2CK3A 2OCAA 1X1RA 4LCBA 4UNQA 3X1XA 3QIAA 2OM2A 4A92A 121PA 2FSGA 2OLKA 3LQQA 4OI2A 1E9EA 4YC7A 2WKQA 2J7PD 1G4UR 4EIWA 2ZR7A 1KZ7B 1NNEA 5E3HA 2A9KA 5HTKA 3ASYA 2HEIA 4E03A 2W00A 2XB2A 4Z8XA 2NZ8A 3E2IA 5P21A 1A1VA 3CF2A 1F2TB 1T0JB 1PV4A 4IVPA 4U02A 3TW8B 3K70C 3A1WA 3X2SA 4ABYA 5J4LA 1OFIA 3PEWA 2EWVA 1Q21A 1OFUX 4OI4A 221PA 5CJ2A 4B47A 3CX6A 1UAAA 3OIVA 3SN6A 1R5NA 4BRWA 1KDTA 4JLMA 4D0NA 3LNCA 3FB4A 4URVR 3E5HA 2IK8A 3EZFA 4LBYA 4X8LA 1WP9A 1CJTC 1N5KA 3AQ4A 4PR0A 4TQAA 3R9IA 1YZLA 5E7IA 2BMEA 5FBRB 1YZGA 4JJZA 1VYUA 2CHQA 4CVNA 1AN0A 4CEHA 3AM1A 3W3AA 1JAIA 1WRBA 4L4UA 2IF0A 4XIGS 1NLYA 1E2DA 4PPGA 1M7BA 2YWHA 2ZYWX 4B3BA 3PITA 4B35A 2IS6A 1P75A 4ON9A 3Q5EA 2QPOA 1MKYA 4IOMA 3KQNA 1Q3TA 2QPAA 4QJ3A 2VP2A 3KXIA 4HAXA 2JLYA 3CWQA 3OHMA 5GADl 4US2R 4P32A 1OE0A 2RCNA 1FQJA 3OEED 4HUQB 2I1QA 5EE0A 3QXHA 3QXXA 2KBEA 1OXXK 2IHYA 1E9CA 4DLSA 2C03A 4Q19A 2X19A 1P2TA 1DAGA 2GCOB 1LF5A 1T8TA 3OAAA 1E2IA 3QY0A 4S35A 3KFVA 1UPTA 1NVWQ 2YC4C 2IBMA 2KSQA 4K8OA 4C3ZA 2A3RA 4CEIA 4KITB 3GLFE 2MSDB 2F1HA 3D3QA 3UIEA 4WXPA 1GL7A 2QMEA 3VHXA 2QA5A 4DJTA 1DO2A 4TMXA 1P73A 4BLTA 4ZDJA 4NCKA 5CM8B 5BW8A 1H65A 4BFUA 1E32A 4Q00A 2D4HA 1NI3A 2V1UA 1FX0B 4WVFA 5JI3E 1E9RA 5IK2A 1ZC4A 2BBTA 5JSZA 3CZQA 3CBQA 4DBLC 3VHLB 5JZVA 3KXLA 4F4CA 4DXAA 1NN5A 4YDSA 3BWDD 4DDUA 1KO5A 1MO5A 2ZUBA 4HSEA 4WIAA 5KSPA 5D3MA 4BFTA 2CJWA 3WBJA 4ITRC 1DAFA 1BOFA 4B71A 1PLKA 3N5CA 3JZMA 1G6OA 1YZQA 3FFAA 2ZYVX 3C7KA 3J81k 2CMKA 3SFZA 1N5LA 3T35A 4BASA 4Z1MD 5EE9A 1OV4A 1SULA 1IJEA 1E0KA 1IQPA 2ORWA 1T0HB 3O8BA 1F2UA 2VSXA 3ZVLA 4CYMA 4B3GA 3WNCA 4PPNA 1SVLA 2H8KA 4NYMR 4DLWA 5AJWA 4YMVA 2W6JD 1E3MA 2HF8A 3SYKA 2X8AA 3GLFB 2GJ9A 3TLXA 4LPKA 1EK0A 2ANCA 3EXAA 1UF9A 2VSOA 3RS0A 1KK2A 4HAVA 2DCUA 1C1YA 3KJEA 1XEWY 3K0FB 4GZLA 4DT1A 4PSKA 3TR5A 421PA 3CNOA 4K81B 2J3EA 3AP3A 2OE2A 1D2MA 2XNSA 2GWHA 3WMEA 2BMDA 5FR1A 4DCSA 1W36D 4M1YA 1G5PA 2MSCB 3QENA 2DPXA 2QQ0A 3ZS8A 3NBYC 2WAYA 3CW2A 3U3JA 3U4QB 1P7CA 2PZFA 3SNHA 1KK0A 4QGAA 1GL9B 1U99A 4PHTA 3CRW1 1S9DA 4BEJA 4WBSA 4C0QC 2BM0A 1E98A 3UKDA 4OJQA 5IHPA 3EIQA 1FW6A 2QBYA 4MKIA 1E96A 1E94E 4YMTA 1Z22A 3B7GA 3THXA 1G17A 4Z54A 5K8TA 4DIEA 2ZJ5A 1CU1A 5DYIA 3I73A 5L3QA 5AUPB 2PEYA 4B43A 1EFUA 2J0VA 1T91A 4M9QA 2NOAA 4JMPA 3KUCA 4C0SA 1US8A 1Z47A 3ND8A 5CJPA 1NN0A 1E9SA 4CW7A 4A36A 3TVDA 3IO5A 1NG9A 3I62A 3H84A 3AVYA 1GAJA 4ASUD 4Z1MA 4CRWB 1HE1C 3TNFA 4P4SA 4EFNA 3PEYA 2ZRJA 3GLIE 3GFTA 4DUGA 4D4JA 3V9PA 1ZYUA 2CL6X 3MWYW 1CRQA 1U9IC 2EVWX 2QM7A 2J5XA 4MRRA 4DB4A 2FPMA 5FTJA 1TTTA 1DG3A 4TWZA 1ZIPA 2IYTA 1D9XA 3THOA 2ODWA 2AL7A 4RD1A 1D8TA 1XDBA 4O0MA 1RRCA 4B44A 1WB9A 2BIFA 1AJEA 1KI3A 4MKFA 1QZXA 2Q3FA 5JLJA 2HCJB 2QAGA 4JVNA 1ZP6A 5AWFC 4BPBA 1GOTA 1Z06A 2WOJA 3K09C 4HB3A 4ZO4A 1G5RA 3U44A 1AS0A 1ESNA 4B33A 4JBXA 4B2LA 1KK1A 2VF8A 3ADBA 4KODA 4F7WA 4RY2A 3OF5A 3PQCA 3VR1A 3MG9A 2ZITA 2AXPA 3U6KA 4RSGA 5DH9A 3BB3A 4RJLA 4V03A 4I99A 4TT3D 5CIQA 5FFMA 1LS1A 4FD2A 2J0UB 2OCBA 1QHGA 2F1IA 1GWNA 3L8YA 4IW3B 1G64A 2CLDX 2G0TA 3CZPA 2OBMA 2JLZA 3DL0A 1XXHB 4Q4AB 1E0SA 1F2TA 3K9LA 4B2PA 4JVMA 1AK2A 1QHSA 4GOJA 5A0FA 3EWSA 1V5WA 3WP1B 4B3DA 1QVRA 3HPQA 1BS1A 3SQWA 3GD7A 2ZVPX 2XXAB 2XTMA 1Q22A 1IY1A 2ODEA 3IHLA 4NYIR 1RJ9B 1T3LA 1FL9A 2EU8A 2NPIA 3KKNA 4JLBA 4MA4A 1D2EA 2MMGA 1FPMA 2GTPA 1Q0UA 4LJ7A 1R8QA 2YWFA 1OH5A 3BFVA 4TMKA 3SHFA 1R2QA 5LDDC 3LLUA 3CF0A 3QI2A 4C0KA 3A37A 3ZJYA 5L3SB 2WWWA 5D3QA 3EA5A 3DPUA 1QHYA 3IPXA 4CT5A 2PJZA 2ZRFA 5EXTA 4MDFA 3NBFA 3QKUA 3K0CC 4RZUA 3QVVA 1JBKA 4TMZA 1P72A 3AKYA 3QPUA 4AYWA 3QXJA 4ASUA 2ZJZA 1J70A 2FDCA 1G3RA 3PFIA 1IXSB 1DARA 2GKSA 1MABB 5CB6A 4IDNA 2ZU0C 4NTZA 4OK6A 4XWKA 4JL6A 2FA9A 4FCWA 5FH9A 2G83A 3GJ7A 3K70B 1EG7A 4KJZA 1VCOA 2Q3HA 1R7RA 2QAGC 2WHXA 3D7MA 3RRNA 2HJGA 5B58C 1FMJA 3EAQA 1R6BX 2KE5A 2CEAA 2J0SA 3MWKA 2NIPA 4EAQA 2I3BA 4LOAA 1UKZA 2O8BB 4IDHA 1KO8A 2Y8EA 2D2FA 4JVLA 5JRJA 4DSOA 1XBTA 2C9OA 1XPUA 3TE6A 3TGPA 2CXXA 2ZSFA 4PAOA 1M74A 2Z0MA 3NH6A 2B8WA 3Q8XB 3EPJA 1WCV1 4GMXA 4PSAA 1CR2A 4TT3A 1HYQA 3G5UA 2D62A 1EX6A 4LGMA 2WWYA 1D9ZA 2CNWA 3NH9A 1VHTA 1JNYA 2OBNA 3GEIA 2CCKA 2G0NA 1GITA 1G291 1E9AA 1KY2A 2VP4A 1ZUIA 1ZNZA 2FFBA 1HA3A 2FFHA 5TARA 3KJIA 2F3RA 3N70A 4P0TA 3C5HA 2H1LA 4AIIA 2HJVA 4GBMA 2G88A 1LFDB 2GJ8A 4NYJQ 4QBGB 2BKUA 1KAOA 3K8YA 4NL4H 4DLYA 3P32A 4Q18A 4RKEA 1BYUA 2E1RA 1DEKA 2OXRA 2IYXA 3U3RA 2IX3A 1II8A 2CCJA 1C4OA 2LCFA 3MJRA 5IDVA 2WMOB 5L3QB 3KKPA 1DAEA 4AG5A 4HDOB 1GKUB 1AA9A 2G6BA 2QL6A 2VHCA 4RD4A 4Q9KA 3TSZA 3MFYA 1G8GA 2WJJA 1TMKA 3CRVA 1WF3A 3GLFA 4A8JB 3U7EB 3B78A 1QHHB 1ZC3A 2V6IA 4DSUA 5UKDA 1GRQA 4Q03A 4QBHA 2KWIA 2REOA 3AGPA 2V9PA 1E99A 1GL6A 2EYQA 4PC1A 3TK1A 4JLVA 1OH8A 3HU1A 3K0FA 1XCGB 5G40A 1W0JA 4W5JA 4JT2A 3DM5A 1NJGA 2HUPA 4DHEA 4URUR 1WDTA 3LVRE 1NN3A 3RC3A 2J87A 4AWXA 1JJVA 1XMSA 4ZCLA 1S96A 3CONA 4EQ6B 3EASA 2GESA 1OH6A 2CHVA 4NCHA 4HUTA 4AURA 4D4LA 2W2VA 4DVGA 2HDNB 1ZMXA 1NKTA 2UKDA 2QMHA 5JBQA 1KNXA 4A0FA 1NSFA 3CM0A 5FI1B 2RGXA 2GXAA 5FPSA 4TMTA 2FFAA 1E1RD 3K9NA 4IEIA 5HCIA 3LD9A 2V4ZA 1UKVY 1ZNYA 2WJIA 2HT6A 4IDOA 2GNOA 1PVOA 2VQSA 1J90A 3I4LA 4MITA 2ZRLA 2W6ID 1R4AA 2CDNA 2WPDA 3IPYA 3RDPA 2NMVA 2O8FA 1OW3B 5AJYA 1QHIA 3AVTA 1ANKA 4DSTA 4FW9A 4DB2A 1DO0A 3RS7A 5EP3A 1G3IA 2VBCA 3NC0C 3H4MA 1UFQA 4YMWA 5EP1A 5SZJA 5TB5A 1LF0A 1P5ZB 4O2LA 4PO8A 2JDIA 1Q1BA 4GZMA 4QHTA 4LV6A 2PMDA 3TUJC 4US1R 3LX5A 1LVGA 2IEYA 4LBVA 5J47A 3ZIAA 4BE7B 2ZROA 2QENA 1FMLA 3KKMA 2AX4A 5DN6D 1M8PA 1NJFA 2VHQA 3GJ5A 3P27A 4JLDA 3AF4A 3NDBB 3N2EA 1EFRD 3I32A 5LD2B 4WXRA 5FOTA 3B1YA 3EZ9A 3QF7A 4JT4A 4HATA 2GK7A 4M21A 1G16A 1N3BA 1P60A 1VG0B 2QN6A 2Q9CA 4X8HA 4HAWA 2QU8A 2IWHA 2FNAA 3K1JA 4OQMA 3B5JA 4KAXA 4JBYA 4KFTA 2P5SA 3ZZ0A 2GXUA 3L0IB 3KTAA 3QJYA 2O0JA 3AV0B 4B32A 3NWJA 4Q4JA 4ZCMA 1G8FA 4DEXA 5FUWA 2D3WA 2YWGA 4LJ4A 1W5SA 3KZ1E 1W2GA 1XTQA 3WHKA 1FTNA 3JZAA 1RW4A 2GEUA 1G1MA 4JL8A 1KOFA 1N6NA 3CB4A 4TTPA 4L8GA 2J0UA 3GLGE 2A2ZA 3ECCA 3LBIA 4EPVA 3VU9A 4HAZA 3QQ5A 1XXHA 4Q9HA 1S3GA 2QRNA 1E1RA 1M7HA 2CE7A 2VHUA 2VIIA 3GLIA 1HY3A 4L5BA 3WRYC 4TZ0A 3QKRA 5AR1A 4TL7A 1KSFX 4TLBA 4DLRA 1DAKA 4HYYA 4DDVA 1KI6B 4GRAA 2BC9A 1NMXA 4CT4B 2XXAA 1TEVA 4JL5A 1U90A 1EFCA 4XVUA 4GMDA 1RJ9A 1HT2E 1E9DA 2W6IA 1HQYE 1ZCAA 1E2FA 2CK3D 4G3XA 2GBLC 4R98A 2QY9A 1N5IA 4PANA 3T1TA 1XEXB 5DO9A 1HUQA 1YE8A 2SHKA 3RWOA 2WZQA 1CIPA 2R8RA 2W2XA 3W5JA 1TL7C 1S9HA 2XNDD 5L3SA 2O8EA 1TU3A 3FMFA 1CJMA 4JBWA 1KO1A 3RSOA 1NVXQ 4M9XA 2ZI9A 5KNBA 1NLFA 1KKMA 3NBXX 4LJ5A 3AF1A 4DCNA 5DN6A 3VR4A 3THYB 2XEXA 1RYHA 1KHTA 4GOKA 4U5XA 3NKVA 2QAJA 3W8NA 3T5DA 1KI8A 2H16A 3TJZA 5EUMA 5AJZA 5ANRB 2RGNC 3HYRA 2FSIA 6Q21A 2XGJA 5DLQC 5IT5A 4A6PA 4BWYA 4TN1A 4TTQA 2F43A 2RHDA 2O0KA 1KIMA 1T3HA 4Q1EA 1GZSA 2BBSA 2H17A 5BXQC 4R9UC 3ADCA 3PCRB 2ZS7A 1DE0A 1U0HC 3IBYA 3AVOA 1IAQA 3MUFA 5DIFA 1W47A 3B9QA 3TMKA 1VPLA 1XTJA 1ZU4A 1MO6A 2XZPA 3L2OB 1E2QA 1JJ7A 1DBSA 3SQXA 4O25A 3B85A 4IFBA 1S1MA 2EFDB 1CBUA 2VSFA 4A1FA 1SVIA 3AVPA 4EFMA 4C2TA 4M2LA 2FZ4A 4NPHA 3IQXA 1IBRA 4TTRA 4PZZA 2VLIA 2EW1A 3ZD7A 3G0HA 2AKAB 2JLVA 1SXJB 2XZLA 3M0EA 3R7WB 3GEEA 3DKPA 1NLZA 4Q7MB 3UANA 3QBTA 1I2MA 4C0LA 1ODFA 2GRJA 5DI9A 1JQLB 3OAAD 2GILA 4G01B 2OZEA 3ZH9B 5FR2A 4PQYA 4NCJA 3PUVA 5GJVC 4DLZA 4KLZA 1XWIA 4LWZA 3T34A 4ZDWA 1ZD9A 4Y0AA 1UDXA 2X77A 3CLVA 4OK3A 4NDZA 4AKEA 4DCUA 2R6DA 2V3CC 1OB5A 2YWEA 1Z6TA 1E4VA 3NEYA 1MT0A 2XAUA 3LLMA 4HZIA 2BJVA 2XNDA 4NCNA 4BFWA 3AVWA 2FJUA 1PJRA 1XRJA 1TUEA 1MR3F 3U2QA 2WIAA 4KV9A 4LJ8A 3FVQA 4FI3C 4B3FX 4HLCA 4B76A 5GJWC 5IK2D 1QHHA 1N2CE 2B21A 4C0BA 2A5JA 3FKQA 4MYCA 4LZZA 1XU4A 2GJKA 2VRWA 3VMFA 4DRZA 3U7GA 4LDJA 2GZDA 4IFEA 1Q1ZA 1YZTA 2B92A 2CE2X 4P3YA 1OPXA 4LV5B 5CLQA 1YZUA 2ECKA 4QM7A 1GRNA 3L0OA 1G8YA 4D80A 4EQ6A 4XTCS 2PH1A 1P6XA 4KFSA 3NC1C 3X1DA 4MUAA 3KB2A 3RRMA 4C7OA 3REGA 2GF9A 4MKGA 2OCYC 1WMSA 3GJ6A 2IA5A 4M1WA 2QT0A 1RRFA 3Q72A 1FQKA 2OFOA 3EPHA 3W5IA 5EP4A 1KMHB 2FE4A 3A1UA 1KSJA 2BHRA 2JCSA 2QG6A 1JEEA 2V7QD 4AKHA 4ERNA 4MGZR 1IN8A 3AUYA 2JLQA 2N1BA 1G9XA 2P2LA 4QHSA 2ZR9A 2YOFA 1CLUA 5GVSA 3W9YA 4Q7LA 3TIFA 3KQHA 2IYVA 3KL4A 4DIDA 2F7SA 5FPHA 2JIZA 1GNPA 3QE0A 1P2VA 3M1IA 1J7KA 2GAAA 2OEPA 1Z0JA 4JLNA 3BD9A 2Q3MA 1E9BA 2ZI5A 4QC2A 2CBZA 2GK6A 4JLAA 1X6VA 2QGNA 3NBZC 3BH0A 2AFIE 2JJ1A 4B34A 1ZCBA 3PV0A 2ZRPA 5TMPA 3BB1A 1N6LA 2PT7A 4EPWA 3SS8A 4Q1DA 1W7AA 2OILA 2R65A 2WWXA 2RGDA 3SYNA 4D6PA 5KOYA 2VP0A 3WHLA 4NYJR 1L2TA 3ZDQA 2ZJOA 4MH0R 5AUNB 1W4AA 2QRZA 4DLUA 4A8JC 2E87A 4DLXA 4NHOA 3UWKA 2ZSBA 3FYHA 4E07A 3I8XA 3LRPA 1L7VC 2Z43A 2RGAA 4A0GA 2IC5A 3DHWC 4ZPXA 5FUVA 4FMDF 2ZXUA 3L0PA 4WZAE 3W3ZB 1G3MA 4PXAA 3VX4A 4GDFA 1G19A 1R0WA 2C9CA 4E09A 3OZXA 1XB2A 3FGNA 2NG1A 1DAMA 4OL0A 1ELOA 2GXSA 3QG1A 3THWB 4US0R 1KGDA 3PJRA 4XWOA 4KLNA 3QG5A 1EGAA 3RLFA 3O8RA 2W0MA 3KB1A 4KVAA 3QKTA 1LS6A 4DUGD 2L0XA 3BJIC 1NMZA 4M1SA 4N3NA 3SFVA 1E69A 4QHYA 3M6AA 3IKJA 2FH5B 2ORIA 2D7DA 2ZJ2A 1R0XA 4LHVA 1ZNXA 5KYKA 2AFHE 1CEEA 8OHMA 1U9IA 3CWZA 1I4DD 1LB1B 2R2AA 4F92B 4URWR 5JWHA 5K8UA 2IYYA 1F60A 1LTQA 2V7QA 1VDZA 2ZQ5A 4KXFB 3LBNA 2JLWA 3BBPA 4QKQA 4FWTA 2NZJA 1M1YE 1ZINA 4J0QA 2IWRA 3TVTA 4F4JA 2NO1A 4FCTA 3W6NA 3K09A 2VEDA 5TDHA 2ONJA 4DDTA 4PX9A 5BYJA 2REBA 3SYLA 1XEXA 2DR3A 3UK6A 3X1WA 4GSYA 2WTUA 1JI0A 1ZUHA 4LHWA 1CJUC 4LHZA 4AYTA 3ICQB 2J9RA 4KO8A 2IHBA 2ATXA 1FUUA 4G5SA 3M4YA 3QUSA 1UKYA 2ZSDA 4M1KA 1ZAKA 1G7TA 1HE8B 3AVVA 3D8BA 3SBEA 1G7CA 1B23P 1U0LA 5JJKA 3ADKA 3THYA 5DNYB 5LD2C 1EWRA 2DHRA 2YZ2A 5FPTA 2ODNA 3OFNA 4HDCA 3U7HB 3GLGA 1GUAA 1YZKA 3BERA 4LY6A 2O8DB 4Q02A 2WAXA 3B1XA 3C41J 5KHOC 2WBLC 4AK9A 2YV5A 1RYFA 1NL3A 4EKDA 3RYTC 3VNVA 2C9YA 3SJAA 4LK2A 1HH4A 5JHHB 3IHWA 1EXMA 2WKPA 3FMOB 4M22A 2NO9A 1QVAA 1AZSC 2FEOA 2G3YA 2ZI7A 2ZUDA 4NP6A 1E6CA 2ZYTX 3DMNA 4UNSA 1E1QA 4JS0A 3H86A 3RRYA 2BJWA 4G5QA 4N0EA 2IUTA 3D6TB 1JPNA 4C4PA 3K0CA 1XXHE 3HDTA 1XMVA 1NIPA 2TMKA 4G0NA 5E7JA 5G3ZA 1E2EA 4BUJA 1F5NA 1RRPA 4WZ6A 3P20A 3FDIA 2FZLA 2XTNA 2IS2A 1KDPA 1U8ZA 4RCYA 2JJ2D 3CPJB 1OB2A 4H1VA 2DYKA 2GVDC 1X8KA 2WIBA 4P31A 2NQ2C 3AUXA 4UNNA 1P9WA 2QP4A 1WXQA 2ZIAA 3PEVA 4TLEA 1WBDA 1SVWA 2GEDA 2OESA 3RANA 4C0AC 2ZRIA 4JIMA 3UATA 1JAHA 3QKSA 2O8CA 3IO3A 2YC2C 2XJ4A 1Q20A 5FPYA 3BORA 1D5CA 4ZKDA 4A4DA 1GDDA 3F0TA 5JWRA 2IEZA 3FHOA 2F6RA 3AEZA 4NKRA 5FOXA 5BN5A 2BKEA 2FWRA 2CNWD 3I5XA 5CK4A 1JXMA 1U81A 3F5FA 3B9PA 4EJSC 2R62A 1XD9A 4MRPA 3EPKA 3GMTA 1JALA 2P65A 4EPRA 2RKOA 2D06A 5FTNA 1RZ3A 4YONB 4OQLA 2REXB 2YOHA 5KO2A 1XPRA 2LKCA 2N42A 4HLDA 1TPZA 3GLHB 1KYIA 2PX0A 621PA 3RAPR 3DZDA 2FX3A 2PZEA 3CRRA 3U5ZB 2B7BA 5FL3A 5CLLA 1IM2A 1C9KA 1Y3AA 2Q9BA 5C2JB 3U60B 1TU4A 5KU1A 5B2ZA 4PTLA 1RE0A 1IY2A 5GVRA 1Z0FA 2DFKB 4Q9IA 4ZI2A 2BMFA 2N46A 3VR5A 3TQCA 1FFHA 3I5YA 3T1VA 2A78A 4RCZA 1VMAA 2V6JA 4TYQA 3FFBA 2IXEA 2FGKA 3UPUA 2Q0HA 1GIAA 4ZIRB 2YKGA 5KSYA 3MWLA 5H68A 1JQJC 3SJZA 4PO9A 1I2DA 4BZPA 4ESHA 3SOPA 5KSZA 2ZETA 1YZNA 4HI0E 3LW8A 1XEFA 4DC9A 4AY2A 1SXJC 3KUDA 1VG1A 2FPLA 1W0JD 4JLJA 3SJCA 1J8MF 1IOZA 2JJ2A 3B1WA 1T6NA 2PT5A 2CL0X 1FOEB 4D4KA 3HWSA 4LBZA 1NBME 2CHGA 1XEWX 1ZBDA 4NU0A 1A5TA 4HUQA 1II9A 1W2HA 5FUYA 5H70A 5KNCA 3LA6A 4HLUC 2GCOA 521PA 4BFXA 1W48A 4TLCA 2CVFA 1E2HA 1JXOA 4B48A 3EC2A 3MMPA 1XD8A 2H92A 4CDGA 3B82A 1Z6XA 4KSCA 4OHXA 2DFLA 2C5LA 1G6HA 3B1ZA 5JJLA 3AF0A 2IYUA 4L16A 5KSOA 1U2RA 2IF2A 3JVUA 2B6HA 3NDPA 3K53A 4Q48A 3I61A 3NHAA 1FNNA 4QGGA 4M53A 1HQCA 1VYTA 2R6CA 2HXSA 1P2SA 3PXGA 2OCPA 4JKIA 3SHWA 1TQ2A 3TR0A 4PPQA 1Z0IA 1NSTA 1FX0A 2IYWA 2CLSA 2WPDD 4I1VA 4RZ2A 3AVUA 3WYGA 1BO6A 2XTZA 2QORA 3DEFA 2IUUA 4ZDKA 2FU5C 2VTKA 4IDQA 4PPFA 1KI4A 1ZRHA 1NG1A 5EE3A 1COWA 3GJXC 5FBWB 1G4AE 2ZSEA 4KYIB 1Z07A 1A2BA 2GZAA 5GJCA 1Z83A 2XJ9A 3PENA 2JDID 5H1YA 5HZHA 3GPLA 4Q7JB 4RZ3A 4OKSA 3DKVA 4XWAA 3THWA 1YRBA 1SZPA 1W46A 4UJ3A 4CIDA 4PFSA 2VPPA 3TQFA 3ZIAD 2IXFA 3OIYA 1NY6A 3A4MA 1P62B 2RGCA 3EG5A 4PO1A 2OAP1 4IOJA 1UEIA 1UJ2A 2LWIA 5JCZA 4D4MA 5IF9A 1R5OA 1OXTA 2IXGA 4P33A 4FMBB 3MRSA 3C5CA 4LHYA 3ASZA 1OYYA 4PSVA 3FOZA 4GNKA 4DZZA 4LJ6A 1AGRA 2QI9C 3CR8A 5FOVA 1XZQA 4L15A 1I4LD 2ZI6A 2HT1A 1ZVQA 3KXKA 5AJVB 1V43A 1OSNA 1N6IA 2C04A 5CYOA 2QTVB 2JGNA 2XZOA 2JLRA 2W58A 2Z83A 2F9MA 1E2KA 3I8SA 2C2HA 1IN5A 4V0KA 3IEUA 1XPOA 1OYWA 3LFUA 4TL6A 1CP2A 4ZDIA 4OI0A 1OXUA
chains in the Genus database with same CATH superfamily
3DTTA 1R12A 3LY5A 2RAFA 1EFHA 1IOLA 3AKCA 4P38A 4EYOA 3UQZA 2DKNA 1T36B 2A86A 2CKMA 3CX7A 1O9BA 3NHBA 4LOLA 3HO1A 3VU3A 4ZO8A 5FF9A 4W5TA 2PIDA 2P5YA 4D3YA 1XHFA 2GCPA 5B4VA 3C97A 4CLOA 1K86A 2FZKA 2ECQA 2W93A 3EXEA 4PY2A 3RRJA 2VAWA 4PLWA 1EZZA 4Y9UA 3KQSA 2BFBB 5C1OA 5EJEA 2AFHA 3OJXA 4BKQA 3R74A 4E22A 4ND8A 1GPJA 3V1UA 2RHLA 4ZGWA 4F3KA 1DJLA 4IWYA 4OU4A 1G20E 4EKEA 3JQ7B 2IODA 3H3FA 2RHJA 1XYGA 1HDCA 4YO8A 1UFVA 3NT5A 4P6VF 2RI1A 5E7MA 3KHUA 2HK8A 1KMQA 2DQKA 2WIFA 1B6SA 3IUQA 4NI5A 4RE6A 1Q0TA 1UBOS 3VDMA 2XNHA 4YMUA 1JA9A 3SE0A 1EKXA 1M1YA 5HM8A 1RM3A 4KGZA 5A5FA 5L40A 5AW2A 2AMFA 5A71A 4I1SA 1U94A 3T6KA 3LJKA 2XHEA 4FMDB 1SBYA 2HREA 3HLTA 1RD4A 3MGAA 4G0QA 2EG5A 3IJEB 3KLPX 1QQ6A 2VQ6A 3P2MA 1MHTA 5HDBB 1EVKA 1GFIA 2ZJ0A 4B8ZA 2JATA 1ACMA 5F2KA 2BZ1A 3FVVA 4J6EA 2AH5A 3ZDZB 2RJOA 2DUMA 3H1AA 3EXG1 2Y92A 4AKIA 3E22B 4IPTA 4XD7A 4GM4A 3K70D 1Y8QA 2IUEA 3ZCPA 3UXYA 4AJ9A 2AOUB 2YHBA 4AJLA 5KIAA 5AKEA 3NEAA 1AF4A 4QUGA 1Q44A 2JS7A 3WLOA 1ZUNB 5IJXA 3MHPA 2RGNA 1NVGA 2JZNA 2BPOA 2ZBFA 2P0EA 2VUHB 2R1UA 1CE8B 1J99A 2C4KA 1E3SA 2O3QA 1IM5A 3JQQA 5AI5A 3HO8A 5BQ5A 2R00A 4CEIB 3A58B 2FZVA 4Y2TA 2Z6VA 4KO3S 5EXSA 1P9LA 2ZSKA 3A06A 3G2HA 2NTYC 3R0XA 4YUYA 5IBRA 4V2UA 1NNSA 3OU7A 5I7FA 3D7RA 4FXPA 3U0BA 4MMYB 2IYLD 1R18A 1KVSA 2XCOA 1IHXA 5KVCA 4OQXA 1HEUA 2OP1A 3GIWA 2I33A 2WJYA 4RFVA 5LKAA 4O2BF 1UM9B 5JI2E 3EGCA 4TVOA 1KPGA 1VCIA 3CLRD 1P5HA 2YIJA 3W1VA 2EXXA 1YV9A 3CS3A 3RK0A 3T41A 1F6DA 3PUWA 3MAAC 1ADBA 3CSSA 4KN8A 3ITNA 5IKOA 2W37A 1Z16A 4Q4AA 2J6IA 4M3NA 5AM5A 3C16C 3FTFA 4DILA 4TYYA 1Z6GA 3ESYA 2ZJ8A 1T5IA 4LYEA 3RS2A 2CNBA 4EUSA 4KEAA 3HA2A 1Y9JA 4HVAA 1PO7A 4N0PA 5T6BA 3VU8A 1F9AA 3OEHD 1HGXA 2GASA 4EABA 4DTCA 2XECA 4L4YA 4X62B 1M34E 3DOFA 4PNHA 4PLZA 1XTRA 2JVJA 2PD6A 3CMCO 2VWPA 2DWQA 3IKVA 1UFRA 2WP8J 4PSDA 2OKGA 3S2GA 1I2CA 2NT4A 3X44A 4CG0A 1XWFA 1P1FA 2B78A 4PSCA 2ERXA 3JWPA 4AZVA 4QX6A 3RABA 2A67A 4N3BA 3LK6A 1W4CA 3S7ZA 4OV6B 2WUFA 2VZ8A 4YJHA 1QLJA 2MSEB 2AJ8A 4LKOA 4BO6A 4ZVNA 4EJMA 1CQIB 3F7MA 3FZGA 3QF4B 3LRXA 4FUQA 1AMNA 3L18A 2V3VA 3T7RA 4NBUA 5TIIA 1FUKA 2J7KA 3KR0A 2F3TA 3S8MA 3AYZB 5KWVA 1EAMA 4NECA 1QC5B 2QMUA 3NB0A 1ONOA 2DECA 3S1AB 3KB8A 4RFSB 2GCNA 1IUNA 4GYJA 2PJRA 1VQ1A 3VNSA 2IP4A 2C0CA 1ORDA 4IF6A 1E1YA 2P3OA 4QQRA 3IUSA 4TKMA 1HTBA 2ZREA 1QR6A 3JZDA 3TSCA 5J2TF 4KWIA 3GRYA 1K2WA 2O8VA 4HZGA 3DWGA 4H9GA 4MRVA 4MRMB 1C7ZA 1H23A 5K2OA 1YDWA 3QOWA 2ZJAA 3ILSA 4G5FA 4PX2A 1U8AA 4RLFA 1YOVA 2R00C 3ZU4A 4Q47A 3BSSA 3C7TA 3IA2A 4J91A 4QBIA 5IM4F 2WV7A 3KUKA 3MGGA 2DY1A 3ESQA 1VSVA 3TNYA 3KOXA 4AECA 2FN3A 4TSFA 3A25A 4HOYA 1GNQA 1EGQA 2NGRA 2ZSJA 3CSDA 4W1PA 4IJWA 3F6SA 1QG2A 3UJ6A 5L45A 4PZYA 2NM0A 1N5JA 3ID6C 1N1MA 1R0YA 3C4JA 4IKOA 2QGZA 4M8IA 4OHMA 4V0MA 4FYKA 1GPUA 2C8JA 5J58A 3THXB 2GN9A 3JQRA 7REQB 4GPIB 5J4KA 3ZW8A 3FWNA 1R4ZA 3NAMA 4FLFA 2ONYA 4WDRA 3BK1A 1FB5A 4OHZA 4LOHA 5A62A 4IIGA 2IITA 3L84A 4NCIA 4A15A 4DDVA 1XCJA 4TLAA 2YIMA 1DBRA 3AB3A 4Y2GA 1PX2A 3LBHA 3QVUA 3V4OA 3PNVA 4FK8A 1MC4A 5FQOA 1C9MA 3RQIA 1GO2A 4HSGA 4HDQB 1AHPA 5BRNA 1NNUA 3WE7A 3LP5A 2CJPA 4PSUA 3BDIA 2JA1A 4M88A 4NCAA 3RUHA 1OWLA 1G7SA 4P36A 1D1TA 5A6SB 4AZSA 4CE6A 5BYAA 3EAGA 5B7GA 2JJ1D 4TL9A 1Z6ZA 2G1JA 3L7BA 2ZDGA 2RB4A 3EVEA 1YKSA 2C5HA 2PQMA 4G0YA 5EIFA 1N9GA 4JJAA 2H3EA 1MVNA 1XN1A 2HU2A 4IWNA 1IK4A 1IEWA 1S7CA 3ETCA 2A14A 5BN3B 1B0UA 3FPAA 5KTNA 3HR8A 3I83A 2GKGA 4JLPA 3E7FA 4BB9A 1UWCA 2OK7A 3PEFA 3MJTA 1TF2A 2OFPA 4IILA 1MGPA 3K9HA 3KWMA 2CYBA 1YRAA 1Y3DE 2WVAA 2QD3A 1YKFA 3A1SA 3OY7A 4PHHA 3VR6A 4EUHA 3PLRA 4F06A 1JT9A 4X41A 5K2MA 3BTVA 3H9JA 1XLTC 1A3CA 4P4TA 4EKYA 3M5DA 721PA 3HSYA 3B6EA 1QYWA 1ODTC 3NIGB 3KJXA 3EXIA 4Q21A 3MTJA 4NE2A 1PT8A 3PZBA 1KL7A 1NHWA 1RHMA 3GGCA 3BFKA 4TKUB 1YDHA 2VAPA 3OE7A 4L5JA 4NE7A 1R27A 4FSDA 2UAGA 1YHYA 4DV3B 4BQFA 1UWKA 2CVHA 3D6AA 3OKFA 2ZATA 5CH3A 3F2IA 4G1UC 1Q7TA 4IOKA 4YUXA 3QBVA 1SIOA 1Q14A 3AO0B 4Z3OA 2PYZA 3OP1A 3KOWA 1E3DA 4ZTUB 4DMLA 1JDUA 3JZIA 1NYLA 5HDQA 4Q3KA 2A9PA 4GLFA 4BO7A 3NDJA 4JT9A 2VYVA 4CF7A 4CEJB 1IRIA 4G4SO 2FZWA 3W77A 1XQXA 1BIFA 5B6IA 3FTQA 3EXG2 3EUWA 3UAYA 1G3QA 2BM8A 5KINB 1RFLA 3GVXA 5GTDA 4URXR 3OEWA 4S12A 2X8BA 2HSWA 4W5HA 5A4JA 2FMIA 4HDSA 5KNLA 3P26A 1PWYE 4BZQA 1FSPA 1KI7A 3LU1A 3Q6NA 4H3HB 2OOKA 2OV8A 2YXNA 2DPGA 4GR4A 1JNXX 4HFMA 4JROA 3U9SA 3ZUPA 2D4AA 1SCUA 1MU0A 2AK3A 1KDRA 2X13A 5IVDA 3T7TA 4F96A 3HXLA 3W34A 2ZANA 5LNK6 1HT0A 3BK2A 1QGDA 4MB0A 4NBSA 3N0VA 4TMVA 4DW8A 3GCDA 1ODJA 1SWWA 1U8TA 2I2WA 4PYMA 4ZVUA 3AB8A 5DBGA 4ARZB 2X7HA 3BH6A 2JAXA 3BMQB 3E9RA 5E2IA 5JE8A 2V7PA 4MQEA 2H7XA 4INPA 3E15A 2YCLA 4DIKA 5CDFE 4NENA 5JFOA 1LNZA 2MINB 2VNHA 4DSNA 3OQOA 3D9QX 4YRNA 4J9UE 1CFJA 2SCUA 2W2MA 1N25A 1L1EA 3PUKA 4EATA 3BCHA 4S1PA 4K9LA 1XTKA 3ZY4A 2FTKE 1N6HA 2W2LD 2UZIR 4Y2YA 3FM9A 3LWZA 2VDMB 1YJXA 4IG4A 2ZRKA 4IQ4A 5L3RA 3ZDDA 1EM8B 4MO9A 4RD2A 1GNTA 4DADA 1M2OB 3WKBA 2PMKA 5E1OA 2A0KA 2J33A 5FOSA 1DQSA 3MGKA 3OFND 5F7ZA 5EQDA 1NSYA 4GPD1 1FNMA 1R0ZA 3V8VA 3PT5A 1E4EA 4KQHA 3L02A 3AVXA 1MNAA 5LA6A 1UMBB 2CV2A 4GX5A 1WPGA 1V8DA 3KKOA 4YMSA 4D3XA 3SHOA 1WP4A 2W2NA 3SF8A 4ETNA 5CB8A 5I51A 2DJ5A 2UXCB 4G85A 3IVCA 4POAA 2YVLA 2CXRA 1YVDA 3HJUA 2PYDA 3RASA 1I7SB 1D7OA 1T2AA 1FDTA 2XGGA 1AH2A 1TUGA 4Z7NB 2JLUA 1LD3A 2WFLB 2WFZA 1JI3A 1QWOA 4KUEA 5J4YA 4J1TC 3TX6A 4WT7A 2QTHA 2W22A 4JODA 2PFSA 3KKEA 3WGVA 1LPMA 3SZGA 2ZI3A 3S2UA 2CNDA 4OYHA 2ZWIA 4QTZA 1ZNWA 1D2NA 4DR1B 3IOCA 1N6PA 2ZUCA 3NIBA 1R8JA 4OSEA 3SS7X 3TRFA 4RYDA 4FOPA 1NATA 1TA9A 3KKZA 3S55A 5I7HA 3GGDA 4ZK2A 1WD7A 5K8CA 3OMWA 4ZODA 5EN4A 1N2IA 1PL6A 4DPMA 4UKDA 5HW0A 3AF3A 5FJJA 2QLJA 4AT1A 4YVFA 1GQ2A 3GZ4A 1Y98A 3KU4A 1E2UA 4HYTA 5DNEA 1ADFA 2G70A 3OTWA 4MIOA 4DOMA 2WILA 4PHFA 2IP2A 5AK0A 4N9QA 4ZGGA 3PD0A 1EBUA 1NW8A 1P9RA 4FGWA 1KMMA 4YASA 3NTVA 3L6BA 2EYUA 5ALVA 3I3SR 4GXNA 1JSZA 5BPFA 5EIBD 4ABTA 3IUEA 2D8AA 2OC9A 1WM1A 3GG9A 1FFDA 4WY5A 1L4EA 3BHJA 4RZSA 4I1PA 1G41A 3IB3A 4IMRA 2PCLA 1DC7A 3ASUA 1ZH6A 4PS1A 1AQUA 1TJYA 1T3TA 1UADA 1A9XB 4OXKA 1T2DA 3DZJA 3WP0A 1MW8X 1SVMA 5CIWA 5BVGA 2B0JA 1JIQA 2WSMA 1V9CA 1VIMA 2Z57A 5JAZA 3QBEA 4EA6A 1ISJA 3BCSA 1SA0B 2XYGA 1BD3A 3KSRA 4W82A 1T0IA 5DI3A 2Z95A 4UXHA 1FP6A 3LHDA 1DDOA 3ETHA 2ZRMA 3LGAA 5EUQB 2W0SA 2CCGA 1UDWA 1MAHA 1GQOA 4GI5A 5JY1A 1GKIA 3KAPA 3O90A 2QNIA 5IKEA 3NTUA 1TNDA 3NPMA 4AF7A 4U9UA 3KX2A 4GQBA 3RWBA 1A9PA 2WWIA 5KHAA 5D51S 3R44A 4NU8X 5EWJA 4C0XA 1XVVA 5LP6B 4L9SA 3DOJA 1PUJA 1TD9A 1XF9A 2VA9A 3R0ZA 3CUEF 1X19A 3KD3A 2X0DA 1XA0A 4B1FA 3ZCXA 1CRPA 5J5CA 1FXUA 4IIXA 4HX9A 1SCIA 5LZ8A 4WADA 3I45A 4KACA 4PM4A 5AW1A 5I7WA 4KRXA 3VR5D 1RBZA 1AKUA 1KORA 1OWNA 1IONA 2P2GA 2VNKA 4MUMA 3EGDB 5A7HA 1AIPA 4JLOA 4PC7A 4D9FA 3EEQA 4IUCS 1KMNA 3C70A 4A6EA 5JCJD 3OT4A 4I46A 3AEKB 3UY4A 1F0KA 1RADA 2I8AA 2VYFA 3DNMA 5KKCA 3WB1A 4YJ3A 2PEZA 4H2DA 1A69A 5FKJA 3TKLA 3GFPA 4Z9XA 5CXSA 3IRVA 3RIYA 4DLTA 1ZGBA 1CQZA 1UOEA 2BRUA 2HMVA 1E0JA 1P2GA 4R8RA 6PFKA 2H31A 5JV5A 3ENKA 1RI5A 1UOQA 2ILVA 2JFHA 3COZA 3L1IA 3T5AA 2PDAA 4N8SA 4BBPA 4MDEA 1Q5PA 5AKXA 5SZIA 4DA8A 3R7WA 1BS9A 3WLNA 4A03A 3P5BA 4EKGA 5BWNA 4Y6OA 1ZJ6A 2GD1O 5JATA 4IV0A 4U2CA 3W5UA 1QRTA 5HE8A 1O5TA 2RARA 1QDLB 3JRXA 2CBXA 3G2MA 3GQVA 3PQ5A 1Z0AA 3A3KA 3ZYZA 3E35A 4DDMA 2QT9A 1QR2A 3TZBA 4YAKA 3T9AA 3BHMA 4W99A 2XQFA 4ND2A 1R9MA 5TJHA 3KKLA 2X0KA 1E79A 4DJEC 3I1JA 4Q1FA 1E63A 2DUJA 2P67A 4F91B 1JAYA 1ZNQO 4TV9B 1GGJA 3H11B 1QZZA 2DSNA 1XJ0A 4NMMA 3KBBA 5DPMA 3ZOKA 3GLVA 1S3SA 4RKFA 1UQUA 1LTHR 1EHIA 2BR5A 1P31A 2COEA 2PFKA 3PCXA 3P19A 1KBOA 4C6RA 3JVIA 3SEQA 2OQ2A 3IAXA 1KEEA 5KNDH 2A0UA 1H05A 5HQ3A 5TF0A 2CFSA 3R3ZA 1ULZA 3PDWA 4G9EA 1L5YA 5DNCA 2PFGA 1UZMA 2AJCA 3SMQA 5BSFA 4C4OA 4FYHA 3MCAA 4Q4JB 3H83A 4EZEA 4HDAA 1PJZA 1COWD 4E13A 2X2OA 2UVQA 4XVQA 4LC1A 4N47A 5IFLA 3VRHA 3MTQA 2CWDA 4MXDA 3W6UA 1ZDMA 1W73A 4UEKA 4CLRA 2ZYUX 4N4AA 4Q6BA 2OPHA 1PG5A 5FAKA 4YNBA 5TS3A 1YJ5A 1YI1A 3VR2A 2C96A 2R8EA 3R5TA 5CAEA 4QPJC 4EHNA 1QOQB 3LKVA 4RADA 4V0ME 4HEA6 2R6GA 3NEJA 1CPYA 1AKQA 3ZGOA 1J0BA 1MP0A 2J3MA 1MA0A 1ESMA 1WD5A 2QNRA 4CF6A 1PFGA 1PIWA 3T1QA 3DMHA 1EA7A 3VO2A 2IYNA 4RA6B 3UB4A 4BNFA 4ZJUA 5HKKA 3BMNB 1CKEA 1NYRA 1XJCA 1Z8FA 2HF7A 3EZNA 3TQSA 3ZQ4A 4AX4A 2ZTSA 3AFOA 2IPOA 3ETLA 4PVCA 2NU8A 3B52X 3DBOB 4TWBA 4YH1A 4DDWA 1T26A 2NPOA 2VHWA 1MH1A 4DL9A 2K2QB 4ZAXA 2XXJA 2BRUC 3RNOA 3AKEA 4FYPA 3GJ3A 1JFLA 2JW5A 5DB4A 4PZEA 1AQYA 2A4KA 4IO0A 4GOND 5F1OA 3RNLA 1KFBB 2ZAMA 4K9MA 2DB3A 1VIYA 2V55B 4CFYA 2DVMA 1MG5A 5CDUA 1FIUA 4ZQFA 3NWPA 1CHDA 4FT4A 1EFKA 1U5CA 1YCHA 5J9FA 2H7YA 5LBUA 3FKJA 1KY5A 5AUOB 5CIYA 2ZRCA 4H6VA 2A7QA 4YJKA 1G98A 3BDVA 4M8NE 3RVMA 3PHCA 2H2WA 3IIKA 3L7MA 2QE7A 2R25B 3DNPA 4EG8A 1BCRB 5EQTA 4OMDA 1GNRA 4M86A 3RS4A 2FHPA 5BUQA 2IQIA 1I30A 1RQXA 2CJYA 5ALPA 3AIIA 1M1XB 2FYTA 4ND6A 5EMLA 1PJ4A 4P0PB 2BBWA 1TADA 3TLEA 4PZLA 5TPZD 3WWYA 1A8PA 3LK7A 1IY0A 1EVLA 4P5EA 2GFIA 5F51A 3FSRA 3PJEA 3FNGA 1I1NA 2HV8A 5A5GA 3RHSA 1BDBA 1V1RA 1JB1A 1ZK1A 2GN2A 1DQNA 3K5WA 4GKBA 4LJYA 3SSNA 3V00A 4RULA 1T6XA 3VYTB 1LBSA 3G5LA 4OVKA 2RGGA 2C8VA 2XMGA 3MZ0A 1DJPA 2IS4A 2VH5R 1X14A 1P0PA 2JAHA 1LX7A 4FYMA 4H4CA 2GD2A 2VK8A 3SI7A 1ONBA 1XNJA 1PFKA 1QIEA 1SXHA 3TI9A 3ROKA 2IW1A 3WR5A 5KUTA 4M0FA 1C9YA 3IEMA 2IL1A 2OGSA 2JB9A 4OG2A 3VNBA 2IZ6A 1T0BA 4FR0A 3OT5A 1EU1A 4BJ3A 4X64B 3KWJA 2EP7A 1IL0A 5CLIA 3WGHA 1JKFA 1YHZA 1W5BA 4ODIA 4XD7D 2WTNA 3NOXA 4D9EA 2RIRA 4GSLA 3OFVA 1C80A 4UNRA 4BV3A 3GC6A 3QKWA 1L3IA 2DT5A 2VF7A 2V5UA 4DG5A 1U7DA 1HV8A 3CVJA 3HZRA 4IIDA 1PVDA 3U7QB 2ZULA 2J5BA 4AYXA 1IHUA 4BNDB 5ED0A 3SC4A 3TBHA 1NKSA 1PZHA 5DU2A 1L4NA 2Q8NA 1TAGA 1ZD1A 3CPHA 1W2WB 1PS9A 3WYCA 1XEAA 3DCJA 4KX5A 4S2EA 3W2HA 4EUEA 3ZHXA 4M76B 5BN4A 1ILEA 3F2VA 1KS2A 5A4AA 1ZHOA 2FVYA 3N2NA 1LBEA 2A35A 4JA0A 1TEHA 3REOA 1VG9B 3QMWA 4HL6A 3W5BA 2PUDA 1LPSA 3AHDA 3SMVA 4NH0A 3CN7A 2GARA 4X20B 3T3PB 2OO5A 2GNPA 5EMNA 4DR5B 2GDZA 5HE9A 2QZ4A 3PC8A 1T43A 5LXTF 3IDSA 1PUXA 3ZQ6A 3O9VA 1V26A 1Q1GA 1PJ2A 2MMCA 5HIIA 3DCYA 1P4SA 4GMFA 3TG2A 3IE2A 1SZJG 3ORSA 3KCNA 5JC1A 1K0FA 2RHCA 2BHSA 3NOQA 1VP9A 3HN7A 4NYMQ 3OCWA 3CX3A 3GIDA 3L8MA 4RIEA 5CB4A 3RADC 3MQ2A 1Z63A 4KBFA 3K0AA 1OT3A 3DO5A 1XR3A 3R5FA 4R1PA 3HM2A 1XZ8A 4WZBA 4ZYLA 1NDHA 3FI9A 3CZ9A 3AZQA 3K4PA 4KDRA 1Z88A 3LH5A 3O8CA 4R1QA 3WGLA 4TS9A 2GJSA 4WERA 3PKJA 4WJZA 5LFAA 1G5FA 1HEIA 2AWOA 2DFTA 3U7JA 2H5IA 5JD5A 1P81A 2BEJA 1SR8A 2XGOA 3PVSA 5CXQA 3PTZA 1XMIA 2GDJA 3EARA 2WF5A 3OQIA 2FFRA 4G0MA 1IHOA 3F4BA 4LCJA 2OCLA 4OLAA 2JIOA 4NIMA 5EJGA 3A2NA 4IZIA 2QP9X 3TSYA 4O2AF 1WCXA 1A27A 2VRCA 1OKKA 4C03A 5IEBA 1UDRA 1EDDA 4NNJA 1PZFA 2HA4A 1NYTA 3GY0A 1EFTA 1I7NA 1K6MA 1N4DA 1PJAA 5DASA 2WUGA 2PE5A 2FPGB 4AM8A 3NO4A 2LDXA 1UBGA 1XV5A 5B37A 2CLLB 2PR2A 2ZQZA 1JEDA 3UJCA 1P1JA 1QQ5A 1NXSA 3QEJA 1AKWA 1A8SA 2YMQA 4Z4GA 4YP9A 3WRXA 1UWLA 5E4FA 1MORA 4CMHA 4RMNA 3I9FA 3U81A 1TM7E 3ZWKA 4OQZA 2WOOA 4FJ1A 2G9RA 3IXQA 4RD3A 4HY3A 4ZCIA 3C3BA 3ENNA 1IN1A 3PC2A 4LA4A 5KTSA 4LJ9A 3BWBA 4N0DA 1Y6ZA 3QVTA 3T38A 4K03A 2UUPA 1WX1A 1XFAA 3WO0A 1WE2A 3FKSA 3LTNC 4G24A 3W7BA 3EX7C 3BB4A 1RHQA 1NUUA 2B8TA 3JYQA 4EUNA 2AXEA 4LMPA 3OZRA 4MQ6A 1LJ8A 1UBEA 3V2UA 2ONKA 5KC8A 4FS8A 5LMUB 1UUFA 3SJUA 4HAYA 3RSGA 3HCAA 5A0VA 1U9ZA 3BFPA 4G8DA 3BGVA 1WXDA 3LXRA 5LZ9A 3B60A 4OHYA 2Z1DA 2JC3A 3NCHA 3GLHA 4QJIA 4C30A 4LYHA 2Y1EA 2R4UA 5CH8A 3VBEA 2GAJA 5AHOA 3SG0A 4BEVA 2M32A 2H18A 1K88A 2F1KA 2FSSA 4E5YA 3JVVA 3EZGA 5JZOA 3B6JA 2J46A 4YQZA 4JXJA 1O96B 4C1BA 4ONEA 5FBKA 2NZXA 1FS4A 4H1UA 5HUHA 4XEUA 4QYWA 4AZ0B 4BNUA 2AD1A 3G23A 4FYXA 2G28A 1BKSB 2R44A 4Q34A 2D2VA 4UBIA 5FTKA 2KB0A 5DYYA 3BKWA 1YO6A 2IXDA 2NSYA 3MK31 5F77A 2KHZA 4DWVA 2Q1TA 2P9GA 2VHTA 4JLUA 2HZBA 3DLPX 1R1DA 1IXKA 4KBGA 5CT5A 3G2LA 3CJQA 4DABA 5KDOA 1I2AA 1VECA 1GU7A 4DT1B 4MCJA 4BGDA 1NXWA 2QR2A 3KT3A 4KUHA 5FDFA 2NXNA 5JECA 2AG1A 2R9VA 3IQHX 3ZJVA 1XCPA 2AZDA 4GT1A 4RV5A 1Z08A 1NMYA 4TUYA 2F1JA 1N2OA 1H4QA 2B3TA 1KDVA 2PU7A 1JTVA 3OE7D 4RGVA 3Q3GE 4G63A 2D54A 3LECA 5LLDA 2I3DA 3CO5A 1DXQA 4TV8F 5I45A 1V71A 3GDHA 1W4RA 4G5RA 2Y77A 1GSIA 2WJAA 4R01A 2JFQA 2WIGA 3I05A 2VYVD 1MX9A 3UBTA 2R6FA 1HFKA 2WF8A 2XXBA 1QFYA 3AGQA 3BIFA 3DDCA 1NTRA 2G9VA 3QXSA 4XPIA 1TEXA 3OOEA 4NAHA 4CM4B 2PGLA 4QUHA 4QNMA 1K9SA 2Q3EA 3IV9A 3IDZA 3K5PA 4GECA 4KCGA 3UAXA 4BS9A 4UE6A 5KMGA 1U2TA 2I22A 4R3NA 1KSHA 4DE5A 1PT5A 2FOLA 5JRZA 3ZDFA 1O1YA 4KQFA 3HLKA 1TC2A 1OLUB 4HFJA 2N0SA 4MIEA 1R8SA 5CVEA 4FFBB 3W6OA 4D45A 1GKLA 2GVZC 3SYRA 1BHSA 1SOVA 3FVRA 3WGUA 5A3RA 3Q5DA 1T0UA 2FXIA 2P78A 3T1HB 4HDNA 4RS3A 2NYUA 4AMBA 4DNFA 2J45A 1S2IA 1VHJA 3ESRA 4NOLA 2HYDA 4P3OA 3VV2A 2PRSA 3A1CA 4ILKA 2C5GA 5IT0A 2P6RA 1US8B 3KB6A 2P3SA 1YZFA 2O3UA 3V1YA 5F3WB 3WGYA 2AVNA 4NBRA 2W70A 4MUXA 4A9AA 4R8SA 1U0JA 2XMRA 2FW9A 4PW0A 1G21E 1W49A 3BF7A 3ZHTA 3DOHA 3F9RA 1D03A 4CTNA 5LLTA 1E5VA 5BOVA 3PRJA 5JNRA 2BONA 3VZCA 2XVMA 1CEXA 3KTOA 4RC9A 4TT8A 3DHVA 2Z2KA 3FTCA 4HAOA 1HE5A 4O4JF 2ZJ6A 2GBIA 5BR8B 3F96A 1YMVA 2JVKA 1L5HB 3BXHA 5DHFA 4QBFA 1C7IA 2AN4A 4HZUA 2QSZA 4XRGA 4B3SB 2HA6A 1VE5A 4D44A 4QSMA 5DGIA 2RC5A 4EG0A 1WCIB 2Y3IA 4ZOLA 1GQQA 3BFXA 3SKXA 1L4UA 5EYPA 3QVXA 3BMXA 1K5GA 4OQEA 3ESAA 2GZHA 3QFRA 3ZHSA 4HT3B 3N0WA 2HX1A 1FYDA 2Z5VA 5E4YA 3ZDAA 2CK3A 2E37A 2OCAA 4RENA 3O95A 4YO7A 1QNFA 4LCBA 3X1XA 4GWKA 5TLSA 2HCTA 4P4NA 2XI4A 4PAWA 2QIOA 2H4JA 3C1AA 3JU3A 5EUCA 2NYRA 4NNOA 4FB4A 3CGWA 3M7IA 4IIJF 5SYAA 5E3HA 1G5QA 1R4MA 2A9KA 4YAUA 1QANA 3NTXA 3ZU5A 1A7UA 2QRKA 3GZNA 3F9IA 4E03A 3EFOA 1SVUA 1R37A 1NBOA 1WXGA 3IURA 4OHUA 1J9EA 2FPSA 2YMLA 2NZ8A 4I5DA 4UUBA 5EZYB 1G21B 5P21A 4IVPA 3LOPA 1GPKA 3BXOA 3FSEA 4UM5A 3TW8B 1NZDA 1XYVA 4REOA 5JAQA 6GPBA 3QE2A 5IBQA 2CHUA 1OFIA 4C4TA 4JQCA 5ICSA 2ADMA 4AUKA 3D6FA 2V74B 4X84A 3RRFA 3ABOB 4BRWA 1JHUA 1PFUA 4G0WA 3FB4A 4URVR 2VPIA 5CU7A 4IH1A 1SCNE 3I1YA 4L7QA 3DMGA 4R9VA 4WACA 5CDYA 3FH0A 2H5LA 5E7IA 4L9AA 2PPLA 2X9VA 5K3FB 1NUAA 1YZGA 2I54A 1J24A 1JJIA 1S2DA 5GAJA 3NMUF 1K89A 5EJAA 2YJGA 2EL9A 5JALA 3W3AA 4MQFB 1JAIA 3OUUA 3OOYA 1G5IA 1PV2A 1UDAA 3BPSA 4IMIB 2HA2A 4Q3LA 3AU8A 3BD8A 2FX2A 2TMGA 3BXXA 4X85A 4PPGA 4ZPJA 1M7BA 4OMUA 2YWHA 5K0LA 1WABA 2XWJI 3PITA 1EB9A 1QXSA 4B35A 2IS6A 4IZOA 4H7EA 7MHTA 1MX3A 2QPOA 3Q5EA 4ITVA 4IOMA 3WAJA 1Q3TA 2QPAA 4QJ3A 2XADA 3O8LA 4U39A 7ABPA 1LTKA 2W6NA 1TO6A 3OHMA 2GBFA 3PHBE 4A0SA 1IMJA 3VOAA 5IT4A 5KQRA 3ERCA 4L4XA 5DWDA 1EUQA 1K7YA 2WHPA 4CQMB 2FRVA 4HUQB 5KKNB 1TKRA 2KBEA 4I19A 2EKQA 1T9GS 1E9CA 3BMCA 4DLSA 2AOUA 2Z08A 1K27A 1USVA 1D2GA 1DAGA 1R6DA 4FIZA 1WUTA 4Y1GA 1OI3A 2GPBA 2ZB4A 1YS2X 8ATCA 5LJLA 4MTLA 3TLZA 2D3TA 1NVWQ 2BHTA 2PX8A 2YC4C 4RIFA 1W8DA 4S1VA 3S2YA 3UWMA 1OI4A 1CE8A 2FWPA 3E0QA 4FGUA 4BQNA 4CEIA 3COSA 2BGRA 4RJJA 4V2IA 3GLFE 2MSDB 2F1HA 3D3QA 1I94B 3EQ7A 1EJBA 1NJ8A 3DOUA 4UMFA 4WXPA 1Y8AA 2HHHB 1I1HA 4M54A 1J06A 5IM5A 3FPBA 4NSNA 3VHXA 1P73A 1FBTA 2UUBB 1P1IA 3DQZA 5ITWA 2G09A 1H65A 2W6CX 3T3HA 2CDAA 1E32A 4BFUA 4C04A 5CFQA 4XAQA 1UK6A 4WVFA 3OE4A 1TEZA 2AUTA 5IK2A 1UM9A 3HRIA 4B85A 2FN9A 2LVBA 3A05A 4FCCA 3CZQA 2QVGA 4IIUA 4ISBA 4Y6RA 2PWZA 2VF5X 2PAAA 1P7VA 1THZA 2OCGA 4HSEA 3IQDB 2W5UA 4WIAA 5D3MA 2NTJA 4BFTA 9GPBA 1QO9A 4G2NA 4D8VA 3EVNA 1BOFA 3AEUB 3DULA 4CT0A 3TG8A 4JUAA 3GD5A 3ICVA 1G6OA 1YZQA 1Y8CA 3FFAA 2ZYVX 4D9GA 2J6HA 4JC5A 2X23A 4WXYB 2IYFA 3AZOA 3T35A 4Z1MD 2C3UA 3A04A 4HNGA 1OV4A 1SULA 2RDMA 2ORWA 4ZN6A 1QO7A 1ZO8A 2E5FA 1P5RA 2NW6A 4Y2QA 3UVEA 3ZVLA 4CYMA 3ZTYA 1L5RA 2ZIXB 5G0VA 3WGGA 2P11A 1ONSA 2YRWA 4PPNA 4DLWA 1E66A 4PBTA 3KU1A 2AEFA 5DTRA 4XDYA 1SCDA 4GBJA 4W1SA 3VV3A 4F1KA 4S1NA 5KCZA 5LOVB 3GLFB 2WMDA 1TT7A 2VYNA 3FNEA 4BKPA 4LPKA 3PFCA 1CQIA 2YXDA 3VZBA 2BMVA 3PQ6A 1KK2A 1C7QA 2DCUA 2AYXA 4UTNA 1UXHA 2XGMA 3LY9A 3GLQA 4LDZA 4DV5B 1QC5A 4JGIA 1Y8RA 4C78A 1HNXB 1R74A 4RHCA 2J3EA 5J3JA 4JEHA 3V1NA 2PA3A 3K6SB 3TBFA 4ARBA 2GWHA 5DCLA 3DZCA 4QOJA 4K6CA 4OH7A 3AETB 4XJSA 1RXSA 2PKYX 4BATA 1X77A 2WJPA 3ESBA 3OFSA 5A2QA 1EGMB 5J63A 3JYPA 4Y6PA 3KQWA 1GAQA 2PRJA 2QRPA 3FLBA 3QENA 4YCMA 2QQ0A 2YV3A 4PFJA 4XLZA 2O3TA 3O3NB 4JUDX 2Y4OA 3M49A 1S6YA 1UC5B 1U0OC 2CXOA 5ESRA 4YB8A 4RY8A 2C7QA 4DV7B 4AJHA 4DPKA 3A6ZA 3KD2A 2YH2A 4K86A 1N3YA 3HGQA 1S9DA 2B34A 4M38A 1CJBA 2VT7A 1Y7LA 4YRJA 4C0QC 2BM0A 2GH1A 1AUOA 3MTBA 4OJQA 2IYEA 1NF9A 3EIQA 3QXGA 2I3GA 1FW6A 2E6UX 2Q5JA 1IZYA 1CUDA 1CY4A 2H0RA 1PTJA 1JQBA 5C7OO 4AO6A 4FZJA 3P9XA 1Z22A 1N8TA 2ACVA 2NT3A 3EPPA 3JRNA 4H7PA 5DLEA 5K8TA 5KB3A 1L4HA 2QN1A 4LDRA 1C1DB 5F4ZA 5IAKA 3SHTA 4Y9DA 5K3EA 2C9DA 3N75A 4B43A 1F9EA 3G8DA 1EFUA 3GV0A 2VSYA 4IHJF 2J0VA 1T91A 3I1IA 4IIVA 5BMVF 1QDUA 2O50A 1B43A 5CJPA 2WJWA 1NN0A 1GYRA 2Y1WA 2VWQA 4G5YA 4CW7A 5LU9A 3IO5A 4EGFA 4FJ2A 4LTNA 5I9SA 4HNHA 4KGXA 4WY2A 3Q7RA 2GD0A 5LZ7A 2IVFA 4CRWB 5C53B 4IHKA 4NBLA 5A6SA 3G2JA 1HFWA 4EFNA 4B3MB 3EDMA 3W3AD 3GLIE 1U1GA 4P8RA 4N9WA 4QDZA 2H4XA 2C4HA 4NBTA 5CHYA 3V9PA 2XDYA 3FTNA 1CRQA 3C3DA 3SAJA 2EVWX 4B8YA 5H9WA 1T3ZA 3GEMA 3N28A 2FPMA 2PRIA 3L4BA 2DHQA 2QMYA 3LUFA 1DG3A 3IMCA 3O5AA 4R40A 4TWZA 3WB2A 4BO4A 1D9XA 3THOA 1SK9A 3HXMA 2C00A 4J2OA 1SC4A 2A84A 4O0MA 4F6CA 4DMKA 1ZR4A 4P4GA 2Z1MA 1KI3A 4K88A 3WLAA 1T9AA 2OWDA 2HCJB 1MVLA 2Q6LA 3GRKA 1Z38A 4FE7A 4BCDA 4UFPA 5FPPA 3R40A 2DHCA 2WOJA 1BMTA 3K09C 3QRWA 1RCTE 4HB3A 4TTVA 3RBXA 2O6HA 2XMBA 3O4IA 4J94A 1AS0A 1U2QA 4J6FA 4L76A 4B33A 1TZJA 4C5AA 3IB6A 4YHHB 2QTRA 4KOAA 3RFCA 2C61A 4UE2A 1A4XA 5SICE 3KYDA 1JG3A 3D4NA 1MB3A 1OTHA 2OHXA 4HNTA 4RY2A 5K09A 4S1TA 1XNRB 3PQCA 4TKUA 1OJ7A 3A9TA 3VR1A 1L4LA 2AXPA 4KV7A 1ZX1A 3U6KA 1CHNA 3OZTA 3Q3VA 4C7KA 1PK9A 2EIXA 4RJLA 1KRWA 3RVQA 2W48A 4V03A 1H5QA 2GM3A 1WL8A 3HBAA 4I99A 1CUIA 5JNWA 3RROA 1LS1A 3D2AA 3FAKA 3RG2A 4UM9B 1DP4A 3HYCA 2P9YA 2OCBA 4FD2A 1QHGA 2YRXA 1GWNA 4KLRA 3L8YA 4ROTA 1DC3A 3G9ZA 2CNOA 1T29A 4P3NA 5B1EA 3FPFA 3V7WA 4IF4A 1WPXA 2JNWA 2ZG6A 3K9LA 1OU4A 1QYDA 1QHSA 4MARA 4ND5A 3MXTA