3HYRA

Structural insight into g protein coupling and regulation of fe2+ membrane transport
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
253
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of GDP release and gating in G protein coupled Fe2+ transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
total genus 79
structure length 253
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hyrA01
3VFDA 3GJ6A 4TTQA 2F1IA 4KV9A 2FH5B 2WZQA 3LBIA 4US2R 2IEZA 2V7QD 1LF0A 4UXJA 4EFNA 1RW4A 4KI0A 3FFAA 2BC9A 2P5SA 4NYMR 4GNKA 1OXVA 1E2LA 4GMDA 4I99A 3FOZA 1S1CA 3CNLA 5JWOA 3B7GA 4MQBA 1GTVA 3T15A 2FJUA 1E9RA 4HSEA 2ZJ2A 4YMSA 3FDIA 3EPLA 2EWWA 4LI0A 2UKDA 3LW7A 3RVBA 1D9XA 3GLIB 2OBMA 2IS1A 1X8JA 3RSLA 4NONA 4KFUA 1HY3A 1D5CA 1FX0B 1QHNA 3I72A 4QNMA 4DKXA 2F6RA 4TZ0A 1N6PA 1M7BA 4GOJA 2J46A 3C16C 1R6BX 4HB4A 4UJ3A 4M2LA 3CH5A 2A3RA 3K0AA 3ZH9B 3HDTA 5KU1A 2ZI9A 4TT3D 1W36B 5JJIA 3DKPA 3GLHB 4PHFA 1ONBA 1SXJA 4ACBA 4FIDA 4DEXA 1QRAA 4B3FX 4F91B 2J0UB 2QM7A 2WWHA 4DDWA 1GL6A 3KKQA 3EIHA 1G7RA 2QL6A 3KKMA 4HZIA 1DPFA 1AK2A 4QBFA 1X6VA 4V02A 4R7ZA 1SVIA 4HDQB 3CNOA 2BBSA 4JL8A 3NXSA 2FX3A 4D80A 1XTQA 1XZPA 2TMKA 2FDCA 2OCAA 1R0YA 5EJEA 1GZSA 3QPVA 1CTQA 2ODWA 1TPZA 3FYHA 3KQNA 1EX6A 2ANCA 3KJEA 4PTLA 5B30A 1MH1A 5FR1A 5JSZA 3CR8A 3CLVA 5CM9C 4EPRA 1KO4A 4V0KA 1G21E 1U90A 2H1LA 1ZU5A 5KSZA 2BJVA 5FBQB 4BFVA 2YJTD 3SBDA 2DFLA 4MYHA 2XNDD 3NBFA 4A8JB 4BRWA 4V0OA 3IUYA 5F3WB 1ZNWA 5GJVC 1NG9A 2QE7A 3VR3A 1GITA 2AKYA 1BKDR 1GNRA 3TVTA 4PSAA 1DOAA 3QQ5A 3WHLA 2PCLA 1AS0A 4Q9LA 4UNPA 1G291 4DLSA 1LW7A 2FWRA 3GPLA 3T06B 5EZ5A 3FMOB 3K9GA 3KJIA 3SN6A 3HPRA 1MRNA 4BFYA 1JR3E 2NO0A 4F4CA 4TLAA 1OFTA 3Q5DA 3BWDD 1MV5A 4A6XA 4XTRA 3GLFB 1U8YA 1Z0DA 3ASYA 2CCKA 1QHGA 2HYDA 1T0HB 3LDAA 3QXSA 2O8DB 2CK3A 2F1HA 721PA 2ODNA 1AQYA 4QJ4A 4JLAA 2J3EA 5EXXA 1QG4A 1TQ2A 1MO3A 4PFSA 2IXEA 2OFXA 2P6UA 2H8KA 3AVQA 3CB4A 1YZLA 2QE7D 2ZRJA 2P6NA 3QF7A 3PG5A 1SKQA 2RH5A 1QZXA 4ABYA 1WP9A 4M22A 5FPSA 1EFRD 2NO7A 5B64A 3AKEA 2AKAB 4R2HA 1VCOA 5GJWC 4ZIRB 3K0CC 4MUAA 3IO3A 1T5LA 3KB2A 3SJAA 1YZQA 1TMKA 1ETUA 2OCBA 4M1YA 3NBZC 4PR0A 5FPHA 3RABA 3K70B 4W9MC 4P33A 2OUKA 2V8OA 4Q48A 1KI3A 1P5ZB 4LV5B 4IXMA 3RNLA 3NIBA 2GWHA 3CZQA 3EPHA 1GL7A 3GJ8A 2BBWA 3W8RA 2PLRA 4I1OA 3SJBA 2AL7A 1G5PA 3F5FA 4G0NA 4CEIA 4O3MA 1GWNA 3LLUA 4Q9HA 5LPNA 3MFYA 3LO5A 4N3NA 4XSGA 1FPMA 3BK7A 1S0UA 1W44A 2LCFA 3FWYA 4LBZA 4JMPA 3HYRA 2PMDA 5EE3A 2NPIA 1FQKA 2IYLD 4V0NA 4A0FA 4ITRC 3Q3JB 3DDCA 1E69A 3X1YA 1OFIA 1T91A 1S3GA 2IYXA 1JBKA 1NNEA 4M4SA 2VYFA 3SYLA 2EQBA 1E9CA 2JDID 4AI6A 5BN3A 3C5CA 2XOKD 2VP2A 3RRYA 2V6JA 3CX8A 1ZD9A 3FKSA 4IRUB 4JIMA 3H84A 3K70C 1OFUX 1ZD1A 1YJ5A 1IONA 4MYTA 3FMPB 1GNQA 4V0ME 1EGAA 5FH9A 5AJYA 4BQSA 4QGHA 1COWD 1DG3A 2XZOA 1FUKA 1U0JA 3IIKA 1EWQA 5P21A 5DNYB 2ZRMA 3A4LA 2EFDB 2RGGA 1T0JB 2GEUA 2A5GA 3QVUA 1CR0A 4U02A 1N5IA 3MLEA 5SZJA 4OI2A 5TY0A 1YZGA 2YZ2A 2ZPTX 2RCNA 1Q3HA 1CU1A 1ZCBA 5KO2A 4RZ3A 1TUEA 5JS7A 2C5LA 1IN6A 3L0PA 4B3BA 4BLRA 5M04A 3AVWA 1XJ0A 3OESA 1E2EA 1KMHB 4OL0A 1S4QA 2W00A 3U3MA 3CF6R 3WYFA 3PV0A 1TF7A 1S9HA 1WCV1 2QAJA 2QMHA 2VSXA 3A8TA 4IW3B 3SHWA 4JLBA 3LA6A 4F93B 3F3YA 2OAQ1 5TXGA 2CJWA 5KOYA 3GLGE 4TT3A 1VG0B 2QROA 2G1KA 1OE0A 5G40A 2WSMA 2ERYA 2OBLA 4AC9A 4DUGA 2HF8A 1VCNA 3UMSA 1MO5A 1G8YA 1W2HA 3M1IA 4FMDF 1W2GA 3QPWA 3W8NA 1XMSA 1FOEB 2NO1A 3B8HA 3PFIA 3EZ2A 5EP2A 4DCTA 3PITA 1Z28A 5G3YA 4CEHB 2WOJA 2HT1A 2BKEA 2ZJ5A 2KBFA 4Q01A 5EP1A 1K8RA 4PHTA 1OFHA 1J8MF 2JDIA 4HDOB 1TQDA 2KSQA 3RS7A 3NKVA 4JT4A 3CNNA 4Q4JA 1E4YA 1ZINA 1G41A 3KUDA 3NEJA 4IDHA 4B76A 5JEDA 3BFXA 1M1YE 2QTHA 4JJZA 4Q4JB 4DLYA 1XPRA 1E2GA 4FMCF 2F3TA 2OLKA 1X1RA 1DAMA 4BWYA 1G6OA 1UBCA 1HUQA 1W48A 1XNJA 3B9QA 2WSSD 1W36C 2ZRKA 2BCGY 1MO4A 3THOA 2CE7A 3H1TA 4AKGA 3BFKA 5IF9A 2A30A 4KSBA 1OHHA 2N46A 3QKSB 3RS0A 3BXZA 4IOJA 2CDNA 4EIWA 1YRAA 4URZR 1JB1A 1E2FA 3QJYA 2HCBA 3OE7A 2OLJA 3GJ4A 1SXJB 3KKOA 3KZ1E 4LHXA 3TUZC 4ERNA 4RCZA 3VQTA 1W7AA 3E2IA 3A1UA 1XXHA 5L3QB 1Q1BA 4EJSB 3W5IA 3K0SA 4XVQA 3VKWA 4CF7A 2JJ1D 4AYXA 4LRWA 3CRW1 5JEEA 3OEHD 1YZTA 1VYUA 1R8SA 4JBYA 5BN5A 2OXCA 5FTMA 1U2RA 4NPHA 3A58B 1YZNA 2F55A 3SZRA 5CB6A 1XTRA 4MGYR 2IYYA 3AVTA 1RRPA 1VG9B 3DZ8A 2WWFA 4RD1A 4O25A 5EE1A 2IK8A 5LDDC 1KY3A 4BRUA 4QFMA 1OKKA 5DE3A 4LHVA 3ZD7A 3I61A 1CKEA 2X8AA 1TADA 3P1JA 4V0LA 1T8UA 4A0HA 3B6EA 3ZS8A 2E9SA 3WYAA 4E22A 1P2SA 2D3WA 2ZE6A 3EXAA 3MJHA 2XAUA 3EPJA 4C2TA 3AKDA 1OV4A 2P65A 1ELOA 1SKYE 2DFKB 5JHHB 4CT5A 2PT5A 4C7OB 4YMWA 1KO7A 4RZUA 4A4DA 2MSCB 1ZM4A 3B5JA 4IJMA 4TQUS 1TU3A 3PUWA 5IK2A 4OI1A 5JMTA 2GXSA 4A15A 2Z4SA 2A9KA 2MMGA 3OE7D 5EXPA 3LAWA 3OAAA 4TMZA 3ZDQA 2GF0A 4U5XA 4OHVA 4EPVA 1II8B 2XNDA 2WTUA 1H8HA 4G5RA 4OI0A 3IO5A 4FD2A 1IAQA 4GZMA 4OQFA 3IPYA 4OQNA 3RRMA 2GAOA 4TZ6A 1OSNA 1P60A 4FW9A 1YR7A 3TAUA 3BH6A 4TYQA 2QENA 3UXMA 2GCOB 1AGRA 2R6DA 5GJBA 2QI9C 1A2KC 1FP7A 1NY6A 2GVDC 4URWR 4QHYA 3KFXA 4YDSA 1ZNZA 2ZITA 3EWAA 5CJ2A 5GVRA 4EQ6B 1Q57A 3RRZA 1UF9A 4MRSA 2QRZA 2ZAOA 1E2HA 1ZU4A 4L16A 1R0WA 3A4MA 3KL4A 2ERXA 2IA5A 2WKPA 4OQXA 1PLJA 4MYCA 1RE0A 1Q44A 2R62A 4JLNA 1XU4A 4A2WA 2WMOB 3IPXA 2IWHA 1KK3A 4H1VA 1AKEA 2DWPA 2ZS8A 3PXGA 4JS0A 2G0TA 4NYJQ 4QHSA 1K5GA 4PPQA 2ZJYA 4EPYA 3BORA 1W4RA 2G1JA 4ZDWA 1GKUB 2WM9B 4GT1A 1NIJA 3SU8A 2VA8A 4LPKA 1YR9A 4NCKA 4B3XA 3U44A 4IVPA 1Q21A 5H8WA 1G7SA 2JJ8A 4BPBA 1GAJA 1TQ4A 4B6FA 4FWIB 4C0BA 3RRNA 3RSOA 5DO9A 2WVJA 2XSZD 4PO1A 3X1XA 3ZS9A 4B48A 4M1TA 1W0JA 1R0ZA 4TMTA 1GRQA 1S9DA 4IKEA 3CW2A 2WJHA 4RD3A 2IUTA 4US1R 1NY5A 1UDXA 2R6GA 5DH9A 3H86A 3EG5A 2AFIE 2FPKA 4DJTA 2IS4A 2LWIA 1M34E 1SQ5A 1E96A 2W6JA 4HAXA 5KDOA 3C7KA 3FKSD 2VF7A 4XD7A 1A82A 3RS3A 4RCYA 1VYTA 2JLRA 4YQFA 2ZROA 1Z6YA 2NG1A 2FFBA 1WF3A 4MA4A 3QEOA 4JT2A 4DXAA 4TWZA 1AGPA 2N1BA 4D2IA 5KPJA 4CW7A 1NSTA 2JLZA 1NBME 4Q18A 1G17A 1FFHA 3SR0A 2P0EA 2CNWA 3RS2A 1F2UA 1FX0A 2AHOA 2A5DA 5CYOA 1EFHA 4ZI2A 4S35A 1Z2CA 1KGDA 4QGGA 3SS8A 1KDRA 1FTSA 2ZANA 3U7FB 2C2HA 2YWHA 3THWA 2FZLA 4RY2A 2CLCX 2KJQA 4EKDA 1XXHE 5BN4A 4TLBA 5HR5A 4HB3A 2FE4A 4LPSA 4PPFA 4WBSA 4C0AC 4GFDA 4Q02A 2VHCA 4JZKA 3SFZA 3VHLB 3KQLA 4Q1DA 1BOFA 2ZTSA 4JJKA 4MDFA 2L0XA 1DBSA 1SXJE 5SZHB 3KQHA 1CJTC 2XTMA 5FPYA 3WNBA 5DYGA 2CBZA 4GMXA 1Z0FA 1W4AA 5BQ5A 4PX9A 5BYJA 4LYJA 1KTVA 2GCPA 2IL1A 3QG1A 2HF9A 3THWB 1MOZA 1NJGA 4POAA 1G3IA 4XH9B 4XSHA 2IS2A 2C8VA 4JLKA 3ICEA 2DCUA 2HUPA 1OPXA 2YWGA 4Z51A 1N6NA 3BBPA 1ZUIA 1GILA 1XPOA 3NBXX 1F6BA 3GFTA 4OJKA 3BH7A 2VL7A 2ZSDA 3RC8A 2AXNA 1BIFA 4L5BA 3B2EA 5JJLA 3U7HB 3A4NA 4E5UA 3GJ7A 3CKLA 1V43A 4PZZA 4KXFB 1KI7A 2OG2A 4XTCS 5FUWA 4HI0E 2R65A 4OKSA 2JATA 1VG8A 2ZIAA 3AF2A 5AR1A 4Q47A 1X3SA 4GRAA 1ZD8A 5FBRB 3K1JA 1ZCAA 4EPTA 3I32A 3DOFA 3MJRA 4BUJA 1RPZA 3OHMA 2IYRA 3AVYA 2ONKA 5EZ6B 3WNDA 1Z06A 3DKVA 1XF9A 3P27A 2XOKA 1W5TA 4JLPA 1W0KD 1W36D 3PEWA 5TV2A 2D4HA 1ZAKA 4U7DA 5K8IA 3A1VA 1DELA 2O8CA 1WMSA 3L8ZA 5AUPB 1HE8B 1D9ZA 3CONA 4QM6A 1UDWA 4MRPA 1G5RA 1PV4A 2B92A 2ZRBA 5CIWA 4PZLA 1F48A 2QTVB 1E2NA 3JVVA 4E09A 4YMTA 2OCPA 2VEDA 3SNHA 2A5JA 3UANA 4UJ5A 1KSHA 1NVWQ 3AVUA 4B35A 1QHHB 5DN6A 3EA0A 5JI3E 3RYTC 2BVNA 4NMMA 2RGNC 4KLNA 4BFSA 1PUIA 2F3RA 2ZUDA 4WXPA 1JPNA 2ZVPX 4EJSC 4YXWA 1MABB 1KYIA 3O8CA 2WOOA 3TJZA 1QG2A 1NKTA 1SXJC 4DB2A 2ZJZA 2FSGA 3E70C 4PXAA 4LBYA 3F8TA 2PLFA 1OH8A 3HU1A 1P72A 5AWFC 3V4RA 4IVQA 1HE1C 1T6NA 4A92A 1GKYA 2QSZA 2GZDA 2LKCA 2YYZA 3QXXA 2AK2A 5FFMA 4Z1MA 3EC1A 1DAKA 2G88A 1LFDB 4RD6A 1X8LA 2OSBA 121PA 4QKQA 3GLGA 1LF5A 2BBOA 3W6OA 2P67A 3BH0A 4HLUA 1KKLA 3ZZ0A 4P4SB 3DL0A 3CZPA 2F7SA 1WB9A 1KI2A 1Q0UA 1VDZA 2BMEA 1OXSC 1D8TA 2GJ9A 2GCNA 4DLWA 2I3BA 2DFNA 4C0HA 1NLFA 4NE2A 3AF3A 2GHIA 1XJQA 4IVRA 3BB4A 1T8TA 3QVVA 1JALA 2D06A 4JYBA 2GILA 3PCRB 3BJIC 3LQRA 2B6HA 2QAGA 3EASA 2J7PA 3N2IA 3TW8B 1NN0A 1AS3A 4B2IA 5FL7A 5A5GA 3SEAA 1KI6B 4QGAA 3T1VA 4MKFA 1QHIA 5FL3A 4M1KA 3PEVA 1Q20A 3OZXA 2Z43A 3RHFA 2RGEA 3I1FA 2VLIA 1U9IA 3CX7A 4UNRA 4Q4HA 4NCIA 3WBJA 3CX6A 2ONJA 1LNZA 1R7RA 1TF2A 4PSKA 1E1RD 1KAGA 2EYUA 2PL3A 3AVPA 3TKLA 4NYIR 3UWOA 1NBMD 1A2BA 2XXAB 4LC0A 1BYUA 4QNRA 2N42A 4RZXA 3SC3A 5JRJA 1JR3D 3QIAA 3CWQA 1GIAA 2E1RA 3K0FB 5EP4A 4LSGA 1MO6A 3D7MA 5CDFE 1Z6XA 2XX3A 1IN4A 1ZUNB 4AK9A 2CVFA 1KK0A 4N0EA 5C18A 5KTYA 3AP2A 2O8EB 3OFNA 1A4RA 5J40A 1VIAA 3ND9A 4NYJR 2HEIA 2C77A 3B1ZA 1Z0JA 3VR6A 4LJ8A 4GOXA 2O52A 3D3QA 5EXSA 3U61B 3T35A 3QKRA 2IYUA 2PJZA 2QT1A 1OB2A 2ZSAA 1OW3B 1F2UB 2CLSA 3FMIA 2ZJBA 3GEIA 1E0AA 1JXOA 2VSFA 3KQKA 1XTIA 2AXPA 2EFCB 4Q00A 5ELXA 5FOUA 1E3MA 1CR2A 2ZU6A 2PCJA 4P32A 2RGCA 4TSFD 2I4IA 2Q9CA 5FOWA 1QHSA 1G5TA 4Q7LA 4TQAA 1M7HA 4D82A 5K8LA 1NP6A 2CHGA 3Q7QA 4C0QC 1NL3A 4MRVA 3FMFA 4V03A 1WDTA 2EFEB 1IBRA 5IDVA 4DDTA 4XWKA 1WRBA 4BEBA 2JGNA 3BB3A 3AKCA 3ADDA 3ZVNA 4LGMA 5LD2C 1CRQA 1QVRA 4FCWA 2CL0X 2NQ2C 3VX4A 2GJAA 1E0JA 1OLOA 4JSYA 3IIMA 5J4YA 1Z0IA 521PA 1ZP6A 3NHAA 1QHXA 5HKKA 3U4QB 4ARZB 2ZYTX 4LJ6A 1U9IC 1DARA 1XEXA 1XD2B 4JBWA 2XSZA 2GNOA 4DB4A 4L8GA 5FPKA 1DAFA 4GSYA 4OK3A 5JSZB 3BS4A 2FFAA 2DB3A 3CRQA 4MKIA 4NU0A 3K70D 3B78A 4Q1AA 3BE4A 1BH2A 4TMXA 2JLYA 2HJGA 3GJ5A 2G3YA 2NOAA 3CF2A 3H0KA 4S2EA 1N6KA 2BKUA 1F2TB 4R71A 3R8FA 3ND8A 1TQ6A 3AUYA 4Z54A 2ZJOA 2VF8A 2W2VA 3ZVLA 4DSUA 4E03A 3RS4A 1VPLA 1GG2A 4D0LB 1W46A 2H16A 3FVQA 2IC5A 3SJCA 2XZLA 4TMVA 4L15A 4HAUA 1RZ3A 2OT3B 4QJ3A 4UXIA 3FE2A 3MGCA 2CXXA 4LJYA 2B21A 4DLRA 3IBYA 2X2FA 4FINA 1SVLA 1I2DA 4M1SA 3KKNA 1LS1A 1OIWA 2G6BA 3A6PC 1F60A 1X1SA 3EZ9A 3K8YA 2EVWX 5JJKA 1Y63A 4H9GA 5JHGB 3R7WB 1N3BA 3SJZA 1E6CA 1ZBDA 3OEEA 1GSIA 1OIVA 1IXRC 1P73A 4D25A 4NCHA 2GKSA 1UEJA 1UBEA 2BJWA 1E2KA 1NVXQ 2ZSFA 2Z5FA 1ZNXA 3NH9A 1XWIA 1XD8A 2OAP1 1G18A 2PEZA 3WP0A 3FB4A 1N5KA 2BEJA 2SHKA 4AG5A 2F1RA 1JXMA 3VR5A 5FOTA 3VR1A 3ZJYA 3LW8A 2NMVA 2YINC 3DMNA 3SQXA 4PQRA 1PLLA 1D2NA 1GOTA 2ECKA 3FTQA 2FPMA 3PUYA 4GPTA 3UATA 4NTZA 3PUZA 2R8RA 2GCOA 3THYB 1D2MA 5LB2A 2C96A 2O5VA 3AV0B 3ICQB 2RB4A 4H1UA 4RD0A 1HURA 3RLFA 3DHWC 3N5CA 4N0DA 5DI9A 5H1YA 5DGXA 3TMKA 1XMIA 3T34A 2ZJAA 4DUGD 1CIPA 4QJ5A 4WOPA 2BMJA 5F2EA 2C04A 3SBEA 4ZDIA 5K8UA 3AH8A 4RJLA 2Q3HA 1E1QA 1U99A 4TLDA 1GL9B 5KSPA 2LKDA 3E5HA 3ADCA 3OEED 5J4LA 3NC1C 1OH6A 4W5HA 3DM5A 3TLXA 1JQJC 1RJ9A 2YVUA 8OHMA 2OFWA 2P3SA 5SZKB 3OAAD 1P9NA 1OXTA 5EE5B 5J4VA 3VNVA 3IHLA 3NDBB 1Z6AA 2EFGA 4NDZA 1AJEA 4MGZR 3GLGB 2V4ZA 1E0KA 1JPJA 2WPDD 3U5ZB 1G3UA 4IOKA 5LBIA 1NMZA 4P4UA 3VKGA 1VCMA 2GJSA 2GK6A 3BRWD 4IFBA 1ZIOA 1TTTA 2WJGA 4B3CA 3ECCA 4WIAA 3O8BA 1ZM2A 3P26A 4BE7B 4KITB 3IEVA 2WIBA 5TMPA 4KFSA 4Q19A 4QL3A 3CF0A 2Z4RA 4ACAA 3K53A 1G3MA 2MSEB 3ADBA 3EZFA 5FTJA 4B47A 1LVGA 1ZC4A 3QPUA 2YC4C 3EC2A 4PPNA 4KLZA 5C1BA 4BECA 1E98A 4BLSA 3U3OA 2OM2A 2JA1A 4RD2A 2HLDD 2NO9A 2ZEJA 4HZUB 5LB4A 2J0SA 2Q0HA 1E1QD 2ZE7A 1KK2A 1NVUQ 1SULA 4LJ4A 3LNCA 3TK1A 3I3SR 4ZDKA 2IWRA 2EWVA 1N0UA 1PUJA 3MD0A 1AQUA 4NCJA 2H57A 2DPXA 2GEDA 3TVDA 1OIXA 2RGDA 3BFVA 3L2OB 1W5SA 2BWJA 1F3OA 5KSOA 4NYIQ 4FWTA 3TW4A 2GXQA 1KK1A 3TUIC 2OESA 3NWJA 3ZQ6A 4CEHA 3N70A 1Z08A 2F9LA 2XGJA 2RHMA 2PBRA 4XOIA 2Q3FA 1CJMA 4AURA 3QOFA 3CRVA 4MKHA 5DISB 2WMNB 2EW1A 1U0LA 3LLMA 3VU9A 1W0KA 3HJNA 4KAXA 3L8YA 2IS6A 2ZVQX 4US0R 4WAUA 4TYWA 1J7KA 3ADKA 4CGZA 1MR3F 1N6LA 2YOHA 1NMYA 5BW8A 1U0HC 3AGPA 3CH4B 3EIQA 3HR7A 5KNBA 3B13B 4PC6A 3R8CA 3QKSA 4LJ7A 2PMKA 4QXAA 1XEFA 2NIPA 5FOVA 2VP4A 3IKJA 3I5YA 4WZBE 1XCGB 4QGFA 1G7TA 3OIUA 4RZ2A 2ZYUX 4ZPXA 3IQWA 3ZQJA 3BGWA 1NIPA 3C4JA 4D6PA 2VHQA 1XMJA 1FL9A 4B44A 3LX8A 1LV7A 2GDJA 2PT7A 3ASZA 2D7CA 2ODBA 2V55B 3U4QA 5JFGA 2XNSA 1CJKC 1KIMA 3J81k 3EX7C 2O8CB 1Z2AA 2BCJQ 4UNNA 2MMCA 4TMWA 2QQ0A 3GLFE 1OF1A 1I2MA 4YMUA 2W6JD 2UZIR 1J99A 1N25A 4CEJB 4ZKEA 421PA 2GJ8A 1E2QA 2O0HA 4X8OA 2CCGA 1NLZA 3U3JA 4M9QA 5FL7D 4MITA 1S3SA 2D2EA 3CPJB 2A7QA 3CBQA 2QORA 3PEUA 3THXA 1QHHA 2CMKA 2H7VA 1E79A 3VR4A 4DSNA 3C15C 2W0MA 5B58C 4Z8YA 2ZE5A 4LBVA 4DDVA 2ORIA 2JIZD 1P9RA 4A2PA 4PPGA 4LYFA 1A1VA 2IF0A 1VYVA 1Q12A 2JAQA 4E07A 4W5WA 3UWKA 5E3HA 2FSIA 2ZI4A 3T12A 1UKYA 3IQXA 2DWOA 2OILA 1CF4A 3AKYA 2CVHA 5JLJA 3U3KA 3LBHA 1N5LA 4TQ9A 3TBKA 1O87A 4M0LA 3GFOA 1G8GA 2H17A 5E7JA 1XB2A 2UZ3A 4XD7D 2CLDX 1JJVA 2EYQA 4U00A 3B1XA 5HZHA 4C2UA 1S1MA 1Z47A 1ZUHA 1EWRA 4FCTA 4M1MA 1RYHA 4MGKR 3AP1A 2ZRNA 4YONB 4DCSA 5CB8A 3LFUA 4TL6A 4ARZA 1Y3AA 821PA 4JLOA 2X1VA 2AR7A 4D26A 1ZRHA 2IXFA 4IEEA 1U8AA 2ZE8A 4EFLA 3TSWA 2JLVA 1GVNB 1RFLA 2FOLA 3MWKA 2AX4A 2J0UA 1SGWA 4PQYA 4MRNA 2HDNB 4TTPA 1XXHB 1TL7C 4BFWA 1GDDA 5AJZA 3GLIE 1G3RA 1M2OB 4ESHA 5JI2E 5E7MA 5BYKA 3DMDA 2AWNA 4RSGA 2EU8A 2ORWA 2QP3A 1R2QA 2J45A 4DBLC 2ZUCA 2OE2A 1HH4A 1IXSB 2QAGB 4KHZA 4MRRA 2V54A 3GEEA 1R4AA 5H68A 5DLQC 2J9RA 4JVNA 3Q5EA 2ZR7A 2GBLA 5FTLA 5DHFA 3V9PA 1E9AA 4BZPA 1KI1A 1XCPA 5IHPA 2FGKA 5HE9A 2IT1A 2DYKA 1KHTA 2PH1A 4I81A 4LJ5A 4C0JA 3MMPA 2KBEA 4M21A 3VHXA 5GVSA 4HAYA 2O8EA 1Z83A 1CJUC 4HB2A 2G9NA 3TSOA 4NZYA 3QBVA 2X19A 4PO9A 1JEEA 1WQ1R 1NN3A 1U98A 2BV3A 2G83A 2J0VA 3KB1A 3B85A 4MH0R 2REXB 2REOA 1E32A 5J4KA 2W2XA 2G0NA 3L0OA 1QVAA 3FKQA 3M6AA 3VKHA 3AB3A 3ZIAD 2R2AA 1Q22A 1KNQA 4KYIB 1EG7A 3SDZA 5L8VA 1ZM7A 1WBBA 1K5DA 1T3SA 1R5BA 1XTKA 4D81A 2PZGA 2WWIA 3NH6A 3GLFA 3C8UA 4B43A 2WWXA 5HE8A 1NI3A 2DHRA 2VHJA 1UEIA 3GD7A 2RHDA 6Q21A 4UNSA 4F7WA 1M6NA 4HLQB 5GADl 3O8RA 4Y0VA 3P4YA 1M7GA 3DZDA 1T4GA 4WA7A 3REGA 3BC1A 2WBLC 3Q7PA 4BLPA 1KSFX 2YNMA 4NKRA 1VMAA 1D2EA 2E87A 1RYFA 1GP2A 2WHXA 3B9PA 4Q66C 4LZZA 5CK5A 1US8A 3DEFA 4HAZA 3GEHA 4EAQA 3W6NA 4CRWB 3MWJA 1NVVQ 1NSFA 1HQCA 1Z6GA 2V6IA 1S96A 4JVSB 1VCIA 1XD2A 5C4GB 4Q4LA 2FFQA 4QHTA 4DIEA 4JYCA 2A5YB 2ZETA 2ZAMA 4ZI3A 1OB5A 2QMUA 2ZYVX 4Q1CA 1GRNA 4IDNA 5EUMA 4ASUD 5GJCA 1XD9A 2HJVA 4HLUC 3GP8A 4MYUA 4Q7KA 2ZRIA 4UNQA 2JLWA 2VIIA 4ZCIA 4UXHA 1MKYA 4RVCA 2JJ2D 4W7SA 4TTRA 1QF9A 1XCMA 1E0SA 3CRRA 1A5TA 4ZKDA 1KJZA 3FGNA 5BXQC 3JZMA 3NG1A 2F1JA 2J7KA 1UAAA 4CEIB 4GBMA 1W4CA 2YWFA 3VU9B 4PC7A 4KBGA 3LWNA 1YR8A 4XWOA 5IRCD 3AVVA 2BM1A 2D62A 5AJXA 3IDQA 4Q9IA 2KWIA 4WZAE 1RRCA 2XZPA 1G20E 2H18A 1H65A 1LB1B 2XJ4A 3TQCA 3KXIA 3R20A 3MWLA 2J7PD 1Z0AA 3RS5A 3U2QA 2IYQA 1A7JA 4DLZA 1B23P 1Q1QA 2ZQ5A 2QPAA 1NN1A 2YWEA 2CHQA 4WXRA 4NCNA 2W83A 5KHOC 4QG7A 4DSOA 4WZ6A 4MGIR 2VQSA 3VNUA 4IEIA 4ZV4A 5CLQA 2XB2A 2C98A 1SKYB 1HTWA 2CNWD 2NO6A 2BMDA 5D3QA 5EUQB 2NZJA 4R2IA 2I1QA 1XZQA 4LHYA 5KDLA 3EZ7A 5KDDA 4DZZA 5HKKD 4M1OA 2BBTA 3PR1A 4R9UC 1XRJA 2ZRAA 4URYR 1FZQA 1OHHD 1G4AE 2F43A 1SVOA 2ZRCA 3P20A 4GI7A 5CK4A 2Y8EA 4FMDB 4QBIA 1R5OA 5FOXA 2VP6A 3HU3A 1KMQA 3WHKA 4DLVA 3RDPA 4AD8A 2ZU0C 1ZW6A 3KTAA 3LVQE 4P0TA 2OHFA 4KBFA 4Q5IA 4I4LA 1EESA 3W9YA 4HLCA 2VP0A 3B1VA 1XEWY 4OQMA 1J70A 5J4HA 3KXKA 3GLHA 3VR2A 5DI3A 4LK2A 3THXB 4TMKA 2GEVA 3NVAA 2ZRHA 5DI3B 1JJ7A 2QUZA 3PUXA 1E99A 1H8ED 2UVQA 3C5HA 2RKOA 2DFTA 2WWYA 5E7IA 4A2QA 3KX2A 4FMCB 1CS4C 5FUXA 2DWQA 2IYTA 3UMFA 1G6HA 2IYSA 2ATXA 3TSZA 3TIFA 5E4FA 4ON9A 3KJGA 1TF5A 3QEJA 3HU2A 1UBFA 1KY2A 1DEKA 3CR7A 3QF4A 3RC3A 1L4UA 3H4MA 2I1VB 4G1UC 2FEMA 4IXNA 4LBWA 4JVLA 4PANA 4PHGA 2VHUA 2YOGA 2FSFA 1G1MA 2IHBA 1E9FA 4ZO4A 2GXUA 4P4TA 4R98A 1W49A 3BD9A 1TX4B 4PC1A 4BASA 5FOSA 1E9EA 1F5NA 1V5WA 1BO6A 1UKVY 3MAAC 1ZMXA 1P61B 2VTKA 2D74A 4LOAA 4TL9A 5H70A 3UK6A 5KYKA 1KDOA 1OXXK 4NL4H 1P62B 4A9AA 1E79D 3WY9A 2HV8A 4DLXA 3TRFA 2AN9A 3I73A 4XJXA 4FCVA 4HUTA 2C95A 3DOEA 4NBSA 2HT6A 2WJJA 4DT1A 4DDUA 4YMVA 4UQOA 1PZNA 1JEDA 3RWMB 5JCZA 3AVOA 4BGDA 4YXWD 5L3SB 1P2TA 3UKDA 1R10A 1G9XA 3G5UA 1AN0A 3MSXA 3ZD6A 1FNNA 3L0SA 1M8PA 1NVVR 1MT0A 3OFND 3A1SA 2FFHA 2VPPA 1EK0A 2R6FA 4OBEA 4AYWA 1HV8A 3GLIA 2OCYC 4EPXA 3AUXA 1XJCA 3DPUA 4B6EA 3HR8A 3VX3A 3QNUA 3K9HA 4XVUA 2VO1A 1CLUA 4B3GA 5B57C 1EFTA 3T1QA 1J8YF 1US8B 1XBTA 1Z3IX 2QM8A 3RWOA 4URVR 3SQWA 2ZI3A 2CK3D 2JLQA 2MSDB 1UM8A 2FSHA 2IXGA 2C9OA 2VP9A 2ZRFA 4GP7A 2O8FB 2KI5A 4DHEA 3SYNA 2QMEA 3CWZA 2CEAA 1QHYA 3B60A 1Z63A 1FNMA 4TL7A 1JNYA 1YE8A 4LYAA 3X1DA 4A82A 2ZSBA 1ESNA 1AKYA 1P75A 4KJZA 1CXZA 1GNPA 2VBCA 3EZ6A 1XPUA 4FMBB 1KJWA 3Q85A 3W34A 1KI9A 4B32A 4A8JC 1LY1A 2J5XA 5AUNB 4IHQA 5CYPA 1N0VC 3S1AB 3ZZUA 3BOSA 1RC8A 1ODFA 1OYYA 2OFOA 3PQCA 1IJFA 3QKUA 4AKHA 1U8ZA 4OK5A 4AKIA 1JAHA 2ZI5A 5AUOB 2VRWA 3LXXA 1R0XA 2FGJA 1KO5A 4A8JA 2XTZA 1KZ7B 2K5UA 3KXLA 5DHAA 1ZIPA 2O8BA 2IUUA 3M0EA 5IT5A 2BDTA 1GKIA 2ASEA 4PAMA 4HYYA 2JLUA 4Q4AA 1AZSC 2P2LA 2ZRLA 3KUCA 2GZHA 1SZPA 2CE2X 2F9MA 3JVUA 2Q3MA 2Q21A 4K46A 2C03A 5HZKA 2R44A 1VTKA 4HUQA 3NTUA 1RRGA 4DCNA 5KNDA 2H5EA 2JLSA 4BLTA 2C9YA 1EFRA 5G3ZA 5AK0A 4XWAA 1FUUA 2GTPA 4LCBA 3WRYC 4OYHA 1VHLA 1YHNA 2ODEA 3L43A 2F43B 1AM4D 4TSFA 3DO6A 1X86B 4M9SA 2NZ8A 1G3QA 2REBA 4KYUA 1NG1A 4LWZA 4BFXA 5HPYB 2QMOA 1CULC 2W0SA 3U60B 2YHSA 4BFUA 1ZNYA 3IHWA 2P5TB 1JECA 3HP1A 2BEKA 5CM8B 4HUQB 4IOLA 4O0MA 4MUBA 4LV8B 4Q9KA 3PJRA 4PHHA 1N0WA 3LX5A 1N6IA 2WJYA 4B74A 2CHVA 2QG6A 4EUNA 1IXZA 1E9SA 2NTYC 2OO7A 3K0AB 1G64A 2WKQA 1BYIA 4D0NA 1I4TD 2KB0A 3AF4A 4O2RA 2RGXA 3U7EB 1ZM9A 4NH0A 1IY1A 2V1UA 2XITA 5HCIA 4LY6A 2PJRA 2WPDA 4IFEA 4ASUA 2HCJB 1RRFA 3CPHA 2GRJA 1QBKC 4EFMA 3K9LA 5D3MA 3OIWA 3EPKA 4QRHA 1QDEA 1IN7A 2A78A 1NKSA 2WICA 1OXUA 1RVDA 5EE0A 4M8NE 2AK3A 2QGNA 2IYVA 1COWA 1C9KA 4LYHA 1TEXA 4DC9A 4A0GA 5AJVB 4PC3A 4RKEA 4EJSA 3LQQA 1KSGA 1IM2A 3O8DA 1C1YA 4AY2A 3K09A 1GFIA 2FU5C 4FI3C 4LJ9A 3NBYC 4GDFA 2R9VA 5CLLA 4B3DA 3W3ZB 5ANRB 3WNCA 2PX3A 3R9WA 4LV6A 4QM7A 4B73A 3TAHA 1VIYA 3I5XA 1E94E 3KJHA 4G5GA 1FP6A 1GRRA 2X77A 2DBYA 5DSZA 2R6CA 2H92A 5TB5A 1E4VA 4KO8A 1E2IA 1U81A 3OIVA 5FR2A 3GLHE 4CIDA 2QAGC 3V00A 3TUJC 4L9WA 2PZFA 4URUR 5B2ZA 2QP9X 2VP5A 2QSYA 1SVMA 2IW3A 2FNAA 4A36A 1BMFA 3QF4B 1FTNA 1ZVQA 2A2ZA 4BZXA 2ZS9A 3OEHA 4PZYA 4BFTA 4OHYA 3R7WA 3T1OA 2OV2A 2CL7X 1WXQA 2WIAA 3QE0A 5L3SA 2W58A 4JL6A 3NHBA 4BZQA 1KJYA 3MG9A 1F2TA 4RKFA 2G77B 1E1RA 4ZCLA 5HTKA 3WBKA 2QZ4A 4HAWA 4TYPA 4CVNA 2Z0MA 4D4KA 4NYMQ 3QXJA 4LHWA 4A0RA 2PEYA 2BHRA 2JJ1A 3MUFA 4X8LA 4DT1B 4K81B 4QOSA 3CM0A 1XX6A 1DADA 5KPDA 1TU4A 3ZYCA 1UPTA 2QPOA 5UKDA 1DVRA 1TAGA 3CIOA 1EXMA 1YRBA 4A6PA 2JASA 2HXSA 3H2YA 4ZCMA 5DN6D 5EP3A 1Z6TA 2GVZC 2WV9A 1PLKA 1SVWA 1YZUA 3RAPR 3IILA 1CRPA 1TEVA 4P4SA 2ZRGA 4Q1EA 3A1WA 2ZR0A 4RD4A 4JLJA 1WA5A 4G5QA 1UKEA 1Z5ZA 1L2TA 1II9A 1OH7A 2R6AA 5KSYA 1Z0KA 5TDHA 4F4JA 2ZRDA 1BMFD 2PZEA 1DE0A 4LHZA 4YC7A 2WAYA 4AYTA 3R9IA 4Z1MD 3PVSA 4D0GA 5FI1B 1G7CA 1S2MA 3DVLA 3GJ0A 3QXHA 2QY9A 3WXMA 2YC2C 1UJ2A 3PEYA 4M9XA 2IEYA 4PSVA 3M4YA 4DIDA 2AWOA 4V0MA 1G8FA 5A4JA 1Z8FA 2IHYA 1SHKA 3LV8A 4WVFA 3ZIAA 1IY2A 3WMGA 3N2EA 1IN5A 4NP6A 5DYIA 1T3HA 1H8EA 2PX0A 3QKTA 3EWSA 4X8MA 2IX3A 1IHUA 1CBUA 1NN5A 4HATA 4N1AA 5JWRA 2BIFA 3AF1A 4HAVA 3LXRA 3GJ3A 3Q72A 2HLDA 2QP4A 3LY5A 1W0JD 4I1UA 1G16A 4Q4AB 2XXAA 1BS1A 4CYMA 1FQJA 4HDCA 2AD5A 3ETLA 5FPTA 1WBDA 1CJVC 5CJPA 3ZVRA 1ZM3A 1DG1G 1VHTA 1E2MA 4EDHA 2IYZA 4RFVA 2FZ4A 4LUCA 1WE2A 4F4IA 1N6HA 1H8HD 3VTKA 1ZYUA 3IEUA 3LH5A 3HYTA 4DRZA 5JCPA 1JR6A 3BIFA 3Q9LA 2QGZA 3KFVA 3TNFA 2ZUBA 4OQLA 4Q4HB 3SE0A 5E95A 3X2SA 3T5GA 1KNXA 2RGAA 2Z83A 3TR0A 2EFHB 3FFBA 2GZAA 2VHTA 4DEYA 3FHTA 2O0JA 2OZEA 1K6MA 1KSJA 3D6TB 3G82C 2GXAA 5AUQA 3ZVMA 2FA9A 1KI6A 1E2DA 1T3LA 2GA8A 1KMHA 1SVSA 3A36A 3K0FA 1VKJA 1LTQA 2NPFA 3E1SA 2XTNA 4AG6A 1PVOA 2FN4A 1VECA 2ZREA 1DO0A 4HZUA 4QC2A 1DAIA 3AQ4A 4TLEA 5EE9A 5FUVA 2BMFA 2RGBA 3I8XA 3LBNA 1NMXA 3PENA 1JAIA 2B7CA 3W5JA 4QBGB 2ORVA 221PA 1JI0A 4DLTA 2CL6X 2QU8A 4ZIRA 2J0QA 3K0EA 4HLDA 4Q7JB 3VAAA 4KVAA 4BEJA 2GETA 1L4YA 3U6KA 1HA3A 4IDPA 5JRZA 1P2UA 1IJEA 4C0SA 3U6BA 1RIFA 1M74A 4PAQA 4FXPA 2ZI6A 1G19A 4URXR 3WMEA 1NF3A 3LVRE 5D3MB 4EQ6A 4C4PA 2QEQA 1ZC3A 3RANA 3A1TA 4D4LA 1EFUA 2C9CA 3NC0C 1AA9A 3UPUA 4TLCA 3G0HA 2ZM5A 2QNRA 1XTSA 3T61A 2D7DA 4PC2A 4D4JA 1VG1A 3B1WA 4KFRA 2J41A 2J1LA 2VH5R 1YKSA 1I4LD 3B82A 2ANBA 4B33A 3EA5A 4J0QA 4JLMA 2D2FA 4II7A 5L3QA 2QBYA 3I62A 2AFHE 1HQYE 4FN5A 3HPQA 3IBGA 5AJWA 4OK6A 3SFVA 2ZRPA 3T5DA 3I92A 1GM5A 2QTFA 4DLUA 2V1XA 2QQEA 1W4BA 2OEPA 3IIJA 1SVKA 2C78A 2W6ID 4HEJA 3I8SA 4KFTA 1X8KA 5HCNA 3WP1B 5FBWB 3CPEA 4YDHB 2ZYWX 3PUVA 3X1ZA 3EARA 2JLXA 1T9HA 2FG5A 4JVMA 3SI7A 1P6XA 3Q8XB 2FPLA 2QT0A 3ONWA 5IK2D 2YV5A 3WYGA 3OIYA 2RMKA 4B2LA 3KQUA 2QBYB 1N6RA 4KU4A 4XVRA 2AD1A 4O2LA 4CT4B 3EIEA 4JLDA 1UKZA 3U7GA 3FHOA 4X8HA 2JCSA 3C41J 2B7BA 4NHOA 5A0FA 3W3AA 2ZR9A 3REFA 2FV8A 5FTNA 1EX7A 2ZJ8A 4OJQA 4LDJA 1P9WA 1P3JA 3CUEF 3OF5A 4ILEA 4B75A 4DCVA 5C46F 2CCJA 3D8BA 4B71A 4DCUA 4Q1BA 1UBGA 1NBMA 3PIRA 3V4FA 2XEXA 1E9BA 3NDPA 4G5OA 1HT1E 2DR3A 3LRPA 4Z8XA 1DAHA 4Q03A 3BAFA 4Q21A 1LS6A 4OI4A 1YVDA 1FW6A 4JSTA 3MRSA 1DO2A 1C4OA 1XFAA 1T5IA 3D31A 1KO1A 3FPAA 4TL8A 3K9NA 5F9HA 5F98A 3AM1A 1DAEA 1MABA 4OHZA 1SHZA 1XP8A 2GJKA 1IQPA 4G5SA 4RFSB 1XTJA 4OHXA 4RFSA 1KZGB 4G3XA 3F0TA 2C99A 1HEIA 2IBMA 3I4LA 3TH5A 2Z6VA 1Z22A 3EAQA 1DS6A 4TYYA 3GCGA 4Q1FA 1J2JA 2B8TA 2BOVA 4JL5A 1II0A 1G4UR 1PJRA 1Q1ZA 2HYIC 1UFQA 1Q1EA 2A5FA 3GMTA 5FI0B 1DAGA 1CR4A 4F38A 2O8FA 2QA5A 4PQFA 3L82B 1EFCA 1E2JA 3MWYW 2V9PA 4MDEA 1AZTA 3L0IB 3C14C 4F92B 4TYNA 4A1FA 4JLVA 1KDTA 4DVGA 1CEEA 3ZZTA 1N5JA 1KKMA 5SZIA 5CITA 2W2TA 4BLQA 3BERA 2O8BB 1OT3A 1P2VA 1Z29A 3QENA 4GP6A 1G8HA 4KCGA 3S1AA 3KKPA 2ZXUA 4P31A 1E2PA 1J90A 1RKBA 4ZDJA 3QSYA 4C0KA 1ZJ6A 3ZGXA 1W1WA 2WJIA 3QXCA 1OJLA 4YLGA 3UMRA 5JBQA 3AVXA 2FF7A 3ZLJA 1RJ9B 2W6IA 3CRMA 1YU9A 3QI2A 1XDBA 3THYA 3AP3A 1KO8A 5EXTA 2WAXA 2JIZA 1NLYA 2IF2A 4JBXA 3UIEA 5DIFA 4B2PA 2J59A 2P6RA 3UG6A 3HWSA 2VSOA 4WW0A 4AWXA 2Q9AA 4HB0A 3U44B 2GK7A 2ZI7A 1CR1A 3UG7A 4GOKA 4M1WA 1L7VC 1E9DA 2DY1A 1P7CA 2YOFA 5L3VA 2GESA 2OBNA 1NJFA 2J87A 2ZSEA 2ZS7A 5CDFA 4CDGA 2GAAA 2IUSA 2RAPA 3A37A 1N2CE 4EPWA 5C4MA 2Q9BA 3WRXC 3VMFA 3KDSE 5BWMA 3P4XA 4B34A 2RGNA 4CZ2A 2NGRA 1HT2E 5FUYA 5G41A 4D4MA 2O0KA 1JQLB 2WWWA 3AGQA 1N6OA 4IDOA 4KSCA 2WSSA 2JJ2A 3SYKA 4K8OA 5J47A 4DSTA 1JR3A 1KI4A 2Q6TA 3QKRB 4KODA 1IN8A 1ANKA 2QRNA 5EQTA 5LD2B 4M53A 4LJAA 4M9ZA 5TVKA 3AF0A 2FMXA 2JEOA 2X2EA 4IOMA 3GJXC 4C3ZA 3SOPA 4AIIA 1R5NA 1II8A 1O3YA 1P4SA 2CJWB 2FEOA 2QN6A 2V7QA 3LD9A 2XJ9A 3O47A 4IDQA 1IY0A 3WMFA 2O8DA 4BFZA 2B8WA 2HXYA 2IYWA 5CIQA 4XIGS 1Z07A 1G8PA 5FTKA 4L9SA 4C7OA 1TUIA 1XEWX 2XB4A 3NEYA 1U94A 1IOZA 2GBLC 5FBVB 5JZVA 4LC1A 1OYWA 1UADA 3CO5A 4AKEA 1SXJD 3KTAB 3R9XA 4G01B 4C9BA 5JECA 3U3RA 1KOFA 1TNDA 1KI8A 4Y0AA 3W6PA 5JS8A 2V3CC 1HYQA 5G53C 4ESVA 4C0LA 2WJVA 3T1TA 1XEXB 1YR6A 1D6JA 1NRJB 4DWJA 1OKKD 3B1YA 5L3RA 1FMLA 1AIPA 4UKDA 1S8FA 3EW9A 3P32A 4I1VA 2KE5A 1KDPA 4PO8A 3X1WA 1W47A 4I1SA 3DM9B 4L4UA 1KAOA 2GF9A 3QBTA 1AS2A 4Q7MB 4GL2A 3IGFA 3K0CA 4Q9JA 5KUTA 1DTSA 2OXRA 3BB1A 5F9FA 3QY0A 4TN1A 5J5CA 4PAOA 1MRSA 4LX0A 1FMJA 5KNCA 3TQFA 4KVGA 2QPTA 4GZLA 3JZAA 3GFPA 3MCAA 5K8TA 3W90A 3QG5A 4C30A 621PA 5FBLB 2WWGA 1YQTA 2WKRA 4W5JA 4BLOA 4MKGA 1ESMA 4JKYA 3AEZA 3FHCB 1R8QA 1B0UA 3TE6A 1I4DD 2BM0A 1CP2A 1YZKA 5TARA 3GQBA 3K09C 5JWHA 1OH5A 4QBHA 2ATVA 2YKGA 1GUAA 3TGPA 1Q3TA 4JKIA 4P3YA 4CEJA 1L8QA 1XMVA 3QUSA 5C2JB 3SHFA 4OHWA 3TR5A
chains in the Genus database with same CATH superfamily
2W6OA 3VFDA 1EXDA 1ZGAA 3GJ6A 4K26A 4PLYA 1RC1A 4UFPA 3G23A 4CKWA 4BKQA 4KV9A 3ROKA 5KNBH 2X7HA 2V7QD 2XHEA 1LF0A 3X1MA 2UZAA 3JALA 4OLJA 4UXJA 5I9LA 4IJ6A 3KJXA 1VBKA 1NX6A 1Z4OA 2NACA 4YP1A 4GMDA 3VRHA 3GGDA 2QRMA 5CM2Z 1M72A 1DC8A 2J33A 3B7GA 2PBLA 1GTVA 4EENA 2BLLA 1XNHA 5JVDF 3KPYA 4FS3A 1YKFA 2IQ5A 3KO8A 3ZI4A 2HU7A 2EWWA 4LI0A 4OHRA 2ZUTA 3SQNA 2X7XA 5IFLA 2OBMA 5EPUA 2IH2A 3QLUA 1V1RA 1D5CA 4DLAA 3NR2A 5THKA 2Y2UA 1J1IA 1Z39A 3RYHA 2BZ1A 4RVHA 1HX7A 3OZVA 4J4TA 2A1UA 2AI1A 3C16C 4QDZA 1R6BX 5DWDA 4MB6A 4M2LA 3CGGA 3T7AA 3K0AA 4J0FA 3I45A 1EZ1A 1NQWA 2H07A 1X1BA 2YJ5A 4JB3A 3R7SA 4B83A 5KU1A 2FK7A 1B00A 3DKPA 4FYPA 5IDXA 3T4UA 4EUKA 5HQJA 4LJRA 1NVDA 3U4GA 1HDXA 5EMLA 2WWHA 4QDUA 4F72A 4WBNF 4F91B 3SVZA 3KKMA 4GC9A 3SM9A 4CF3A 1A96A 3RJ9A 5ADHA 1T9KA 2RAFA 4V02A 4WOCA 4Y67A 5J63A 4RK5A 1L1FA 3PHJA 4HDQB 4B3SB 2ZULA 2C2OA 2BUBA 3NXSA 4D80A 1DBWA 1WVMA 1XTQA 3RM3A 1PFVA 2GWRA 2GZSA 3PLRA 3MA0A 1M1XB 5G2OA 2FDCA 1R0YA 5BSRA 3QPVA 3VR4H 1A50B 4WSOA 3TPFA 1ZS9A 2ODWA 1GR1A 1Q50A 2CFTA 4LECA 1U3TA 3K7EA 1TM4E 5KJEA 4WKGA 5EWJA 1RZVA 1U3WA 3CR8A 2G07A 3FYSA 4M55A 4P7BA 4HQFA 2JFOA 1SEVA 2VPYA 5JASA 2W6QA 2W71A 2XXBA 2ZIEA 5C8YF 4PS1A 1ZU5A 1J42A 3PL1A 5KIAA 3T7CA 1I0ZA 2E2WA 2J3QA 1SC1A 2Q5OA 3CPSA 3HB7A 3KEGA 4Q15A 2R86A 5LLDA 4E1AA 2P9CA 4CQNA 1Z45A 1MVOA 1E64A 2QE7A 1GYQA 4IIDA 1TKBA 4C4ZA 1GITA 5CD9A 2OKCA 2C5HA 5ILQA 1BDJA 1GPWB 2VT2A 5FXMA 3WI7A 1DOAA 1Y82A 4HF7A 2QE6A 1AS0A 1EUCB 2OB2A 3BRWA 4UNPA 2JH9A 1G291 4YQYA 4G4SP 3T06B 1QK3A 2XCSB 4HFJA 5JZMA 3KJIA 1ZSVA 3RODA 1A9SA 4B46A 2NO0A 4JEUA 1NMSA 4BFYA 2AOWA 4RPJA 2HM7A 4NFYA 3SR3A 2WJ6A 3V4LA 3DH0A 1DKUA 2EEZA 3EULA 4BX3A 1SRQA 2EJBA 4PZ9A 4A6XA 3IUPA 5JXWA 1U8YA 2JZOA 3F5QA 1HE3A 1QHGA 2CCKA 4I3FA 3Q6NA 4PZAA 1T0HB 4YJ3A 1K4KA 3VZPA 2GRAA 3EVZA 2JHPA 1U8CB 2NTVA 4H18A 3GA0A 4QTYA 2CK3A 2F1HA 4X41A 5L7YA 1RXIA 3WB1A 1SJ9A 4JLAA 2J3EA 4IUBS 3FF4A 2WWTA 5IDYA 5LUBA 1BWQA 3C8DA 1KE2A 5JQGF 1MO3A 4LE2A 5DIZA 1LJLA 1N2JA 1E6LA 4TVOA 4RGYA 1BE1A 2BELA 2IXEA 2M32A 3PICA 4QYIB 3UH1A 1N8KA 1SO8A 2Z8ZA 3PJGA 2YWDA 3HBJA 2P6UA 3FM9A 3L06A 5A6SA 2G08A 2XF2A 3AVQA 2G1UA 3CB4A 5INTA 1C3VA 2FG6C 2P6NA 4G85A 1XZGA 1SKQA 5ESWA 5LU8A 1M0WA 1QZXA 2B94A 3NGLA 4HADA 1WP9A 4KZKA 1ADJA 1TT5A 2XB6A 5FPSA 3TCXB 3OT1A 4E14A 1S2NA 7GPBA 2JBHA 1PT8A 2O14A 4DR2B 1PDVA 2X42A 4KPEC 1QVZA 5GWXA 3IO3A 1F9AA 2C5GA 5C1PA 3KQPA 2UDPA 4LZOA 2WWRA 2OCLA 3S55A 3ANTA 4R2XA 4RH0A 3CT4A 4HRAA 3GEGA 1Z33A 2VQ3A 3I2HA 1I94B 1Y8QB 3GAAA 4EUFA 3N2KB 1F9EA 4ARAA 4W9MC 3FNFA 3KUXA 2ZT5A 2P2SA 1I1NA 2V8OA 3QA9A 3HGMA 3NONA 4Q48A 5EZQA 3RNLA 4CCWA 5CDUA 1VMEA 2Y1GA 2VZ8A 4GO1A 4D3SA 3CZQA 4PLVA 4LIPD 5FKJA 1EE2A 1RJFA 4BTEA 4UPEA 1CCWA 2I6SA 3AM5A 3GJ8A 4C7OA 3BXEA 2PLRA 2G17A 2WAAA 2AL7A 1G5PA 2BPOA 2PMBA 4ME6A 3TEMA 1VPWA 1H4SA 3OJXA 4O2BA 1GWNA 2QV0A 4Q9HA 2FW7A 1O9HA 4ENTA 5LP1A 4YQZA 4GXTA 5FDFA 5LPNA 5ADVA 3LO5A 2O8NA 1NXVA 4N3NA 4XSGA 3BK7A 2JK1A 1IHDA 4KIGA 2VDQB 3HB1A 3UUFA 1E7SA 2DXIA 4LBZA 3L7MA 3HYRA 3Q2IA 2V6GA 5LQNA 5H4HA 1YAHA 2G5TA 3GP5A 4GLJA 5JFTA 1DFGA 4ITRC 3Q3JB 1GZDA 4NI5A 4OPMA 4O8CA 5EMHA 3O8OB 1IL0A 3CA8A 4KRGA 1S3GA 4ZZ2A 4C87A 1NNEA 2G25A 3VJLA 3A70A 3DZGA 5BN3A 1HC7A 3LMKA 4I19A 2A9JA 4M76B 1AG9A 3CX8A 4OXKA 1ZD9A 4YMLA 4RIGA 1LX6A 2RGYA 3H84A 6REQA 1QP7A 3HYSA 3FMPB 1O0SA 2VCEA 3CH6A 1F20A 1QSGA 2II6A 4YTEA 1COWD 3JASB 1DG3A 3IPRA 4XIFA 3O8QA 2FRDA 5P21A 1JHXA 3R6WA 4XJTA 1NXSA 1C7ZA 1FUIA 5FA5A 1CR0A 3UM9A 5HQTA 3EEIA 3QU2A 3TZEA 4AZ0A 2LDBA 2YZ2A 3PNBA 2V0GA 1J9EA 4K6HA 3VHQA 1CU1A 1ZCBA 4OYLA 1WPRA 4RZ3A 5D1HA 3PRHA 3Q2OA 4J7UA 3V2HA 4Z7OB 4HQ6A 3A6JA 3BE6A 1QMPA 4NZ9A 3AVWA 4GMHA 1WUHS 3K8OE 1IWPB 3TLEA 2V9CA 4KDCA 4CKCB 1S4QA 3OTWA 3ZPXA 4GXRA 3K2EA 5E1MA 5CVCA 1WW2A 1S9HA 2QAJA 2QMHA 4HK4A 4IW3B 3FXAA 3WQBA 1IN1A 3F3YA 5KOYA 1T0UA 2CJWA 4HPXB 1EDZA 2Q6KA 2BZ0A 1NW8A 1SUFA 2Y0CA 1OE0A 3O3CA 1C2TA 1YRLA 2WSMA 4IYRA 2NXNA 2ERYA 3ZWDA 4FYVA 2GN9A 1NAIA 1JR4A 4DGQA 1MAWA 1MO5A 3PKJA 3KOOA 4BV3A 3M1IA 3QPWA 2JFUA 3PGKA 1XMSA 5EUBA 3SE7A 1FOEB 3B8HA 3DZFA 3W8NA 4DMUB 5EP2A 1LZKA 3MHPA 3RC7A 3WAKA 1EJ0A 2HT1A 2BKEA 2ZJ5A 4J3NA 4Y9SA 3DBHB 4URHA 1XRMA 1K8RA 1JVNA 1A95A 2HTFA 3D6NB 3DONA 3IQHX 3QTLA 3KLOA 5BPFA 5LP6A 3VR4D 3PE6A 2YXBA 1DC4A 3HLYA 4F9FA 2KSQA 2X5KO 4RV4A 5KOJA 1E4YA 4BC1A 1FRZA 5GIPE 4IDHA 5C8DA 1XMOB 3E82A 4JJZA 4Q4JB 4UARA 3NTQA 4I66A 1FNBA 1XPRA 1E2GA 3PPXA 3R0XA 1LTHR 3U3XA 2I8CA 4M38A 1QFZA 3U62A 1UBCA 3FVRA 4MYDA 1W48A 5IASA 4HWKA 3DQPA 2DHCA 1WY7A 2VJBA 3B9QA 4CBVA 2WSSD 1W36C 1P81A 1MO4A 2R5FA 2ODPA 3WZLA 4AKGA 2ZCVA 2DWUA 3JTMA 4LYEA 3RS0A 1D07A 1L5YA 2QLTA 3UH0A 1E2FA 1KXZA 3EE6A 1BEEA 1EK2A 4GX1A 4ZOAA 1LPSA 2HCBA 3TTYA 4XYMA 1SXJB 3AG5A 3KKOA 4JGGA 2EAUA 2NT3A 1G2IA 4UCFA 4ERNA 4A2CA 3I6BA 4RIFA 1UJNA 3RYIB 3USCS 1FFYA 3H05A 4O4IB 4V0SA 1JA1A 2NSLA 3GBSA 5JC8A 1HETA 1M8JA 1NASA 5BN5B 3KQYA 1YZTA 3OE4A 3I4CA 3OPQA 1IJBA 4IIYA 1FU7A 4W4TA 3WJAA 2G67A 3S2FA 5JD4A 4BMNA 1QVWA 1SHTX 2CVOA 2SICE 2C4WA 3UGJA 4MVCA 4XVCA 4FDLA 2OAGA 1SD2A 2F55A 2R68A 1M6VA 2QW0X 1YZFA 1ORRA 5AVJA 2XKJE 5KAPA 4N3BA 2HDWA 3K94A 3PQ5A 1RRPA 2WWFA 1QIIA 2DSNA 2FCAA 1QGOA 4JBIA 5DE3A 4RENA 3I61A 3P1JA 4LJSA 1D4FA 5D00A 4OA5A 2O4CA 3GX1A 1Z73A 2D3WA 2RHTA 3PNMA 4YJDA 1IY8A 4DBLE 2ZJ0A 1V4NA 3AKDA 1OV4A 3FBGA 1SKYE 3MD9A 2HA7A 1C3OB 1VBNA 5H81A 1XYYA 1SCKA 2DFKB 2D6FA 4PO3X 5LYJA 2PT5A 4E21A 4C7OB 1SQGA 2GT1A 2B3DA 3FPCA 2NVUB 4MWZA 4UVIA 4E2WA 4OI1A 4ENUA 4F6RB 4A15A 1QBGA 1ID8A 2MMGA 3OAAA 3ONEA 4CCYA 4B1FA 1XAHA 4WK0B 1IOWA 2LTAA 4U5XA 1SQ6A 5HIIA 5C7YA 1XLTC 3H2HA 1OZHA 4G5RA 4OI0A 1R16A 3GLRA 4FD2A 1IAQA 4MDHA 1VE7A 1W75A 4OQNA 1N2OA 1G6Q1 5ALNA 2GAOA 3RRMA 3LKDA 3X2EA 1P60A 1R64A 3JSXA 4FW9A 4KXWA 3WIUA 3B89A 1VM6A 4AB1A 1BXRA 2YY7A 3CVYA 4OGKA 2FOXA 3JCZA 4L5YA 3KT6A 4KXXA 1VHWA 2PE5A 2OP0A 5HX7A 2YVAA 3ZCVA 4CN9A 2QVCA 2R25B 4E2YA 2QI9C 1A2KC 5AI8A 5KQSA 3N86A 3QW4B 2HQ1A 3KFXA 3DVRX 1D8AA 2ZITA 1CQPA 4R3NA 1XNGA 2PGAA 2XTJA 3RRZA 4MRSA 1JEYB 2QRZA 3IUQA 2ZAOA 4L16A 1R0WA 2XE7A 2XMBA 3A4MA 2CUKA 4UBIA 4A0SA 2IA5A 4I5DA 2GSDA 4EI8A 1GA6A 2A92A 2JCGA 1JKMA 4MTCA 3L41A 1PJCA 4JGBA 2W6ZA 3LWBA 4U2EA 1XU4A 3SDSA 1HT3A 2VDPB 1JDPA 1FXSA 3A1FA 3CQ9A 5BUQA 1IMOA 1HR0B 5B1HA 4KP7A 4J4HA 3OWHA 3EQ8A 3NVDA 4ZP1A 2ZS8A 3IUEA 3KE9A 1MG0A 3GDGA 4NYJQ 3CEHA 1N8SA 3BL6A 3RIXA 5EWMB 3ECAA 3V46A 2ZJYA 2V7TA 4ER6A 3M89A 4G1MB 1PNRA 2G1JA 4GT1A 4N39A 3DNMA 3SU8A 4LPKA 2Q7DA 4B3XA 1B8VA 1QHEA 1GPLA 3G2KA 4TKUA 3SXPA 1Q21A 3NGMA 4MK4A 4OLAA 2VT6A 3BFJA 3TW8A 1O2DA 4C4RA 1QE0A 3CB2A 4BYGA 6REQB 4YCLA 3RAFC 1YS6A 3I52A 5D1NA 4G8DA 5BRJA 1T2UA 2GD6A 3ENQA 4M1QA 4RPGA 1SKUA 3RSOA 5DO9A 2WVJA 2HKIA 5TQ2B 4IDFA 1ECJA 3F2VA 4XQEA 2C1ZA 5BURA 3OP4A 4PO1A 4L7VA 1QV9A 3ZCTA 1D4AA 1EBBA 4M1TA 1NR1A 4Y6PA 1R0ZA 2B99A 1GRQA 1B43A 1S9DA 4IKEA 1VDMA 1VL6A 5EWLA 4CLXA 1NY5A 2R6GA 2QTRA 4UBOA 1OLUB 1MC8A 4DILA 4C7JA 1AKVA 4IWNA 3H17A 4A73A 5EHZA 2H8GA 4TTVA 1M34E 3E3OA 4E15A 4PY2A 4N41A 5I7RA 1JHQA 1W35A 1MXFA 3FKSD 4KB5A 2VF7A 1NPTO 4UMFA 5IKXA 4XD7A 3RS3A 4RCYA 4DWWA 2H2AA 5ALHA 5HRUA 3SQLA 2H6EA 2FFBA 4HBZA 4AX4A 2J5KA 3M3DA 4G09A 5EQFA 4TWZA 4EW2A 5IJAA 5I8PA 1R27A 2OPHA 1UQRA 4GKAA 5JD6A 1XJ5A 5KTRA 3MBIA 1VL1A 4K6CA 1F2UA 3HWWA 2AHOA 2LW7A 3IH5A 4I5GA 4M1ZA 1EFHA 1NW4A 1T0PA 2PJDA 4G5YA 4RNCA 4EMUA 4EY5A 1JWLA 3MCUA 3FCCA 3HXKA 4DA9A 5IX8A 1R37A 3VUEA 1SMKA 4U3JB 4CN8A 1XZFA 3JQ7B 2C2HA 2YWHA 3TGLA 4W5RA 4ZAYA 1RWPA 1M2KA 2CYBA 2FZLA 2JNWA 4YBRA 3RSSA 3IL2A 5BWBA 2UU9B 3JAWA 1KEZA 3ML1A 4EKDA 1XXHE 4F5DA 1AQJA 5CFLA 3HUFA 1V47A 3H5RA 4HB3A 3GDOA 4MDYA 2O9JA 4OP3A 4PPFA 3LYHA 1P0QA 3PNPA 4ZQBA 1CUFA 3SFZA 3KVYA 1WL8A 5ALGA 2ZTSA 5B1DA 4MDFA 1DBSA 2JGFA 3DHNA 3QMVA 1V26A 1U28C 2ZWPA 5TF4A 3NUZA 2PSEA 4ZVQA 5CBKA 1J23A 1D4OA 3L6OO 1G59A 1NP7A 1V4VA 3A0RB 5DYGA 5KYGA 4FLFA 2NYRA 4FFWA 2PX4A 1YHZA 5BQ5A 5DBGA 3EGDA 1Z8NA 4LYJA 1ZK0A 1Y5LA 1MOZA 4XH9B 4C4TA 1PJBA 2A9QA 5BSFA 1UPAA 1U7OA 4EA7A 2Y92A 5D8DA 1DMSA 4LF6B 2C8VA 4XCXA 1QIEA 4EMBA 2J9ZB 2VWQA 3N2ZB 3WIVA 1N6NA 3H7IA 1CVIA 3IAFA 5BRNA 2LIPA 3K0BA 3V8MA 5T64A 4G9GA 2VSNA 1QHFA 5I51A 2XBMA 2PVPA 2PWBA 2ZSDA 5KTSA 1DOHA 4LF7B 5IH3A 1MNAA 3NBAA 4D96A 4HWSA 2PUCA 3A6EA 4GQIA 4O5OA 4WLEA 3U7HB 2A1TS 3A4NA 2Q49A 3GJ7A 4KXFB 4PTYA 1W85A 2P41A 2XKBA 2OG2A 4XGIA 4XTCS 2R65A 4FZ5A 2JATA 3AF2A 1VJ0A 4P81A 1TJPB 5CXXA 1QRSA 4OV6B 13PKA 1GU7A 2F90A 2A58A 1TO6A 4E5SA 2F59A 3TLZA 1I32A 2CDRA 4BMSA 1FS4A 5B5SA 4U7WA 3R40A 2YZGA 3ZK8A 1PHPA 1RPZA 2IYRA 2ONKA 2WT8A 4YT2A 1JHUA 3OQ1A 5BN1A 5HOQA 2VZLA 2XOKA 4R40A 3NALA 4JLPA 2GZ1A 1GZ3A 1W0KD 3ABRB 3PPYA 1DNPA 4OBXA 4QEZA 2PD4A 4MV1A 4R9RA 4YAUA 4U7DA 3HNOA 4CLOA 2G4LA 3R7DA 5K8IA 8GPBA 1HKHA 1DELA 4BN4A 3K16A 3HMKA 5COQA 3L8ZA 5JE8A 5K3FB 1QFXA 2IYNA 3C8HA 4AG3A 4HXGA 4MRPA 2B92A 3IV7A 2ZRBA 3KEQA 4GICA 1IK4A 1Y5RA 3UC9A 2QTVB 3JVVA 3UYKA 4E09A 5H3LA 2WB2A 4PRZA 3SNHA 4YR9A 1HRDA 3UANA 1KSHA 3PRJA 2O0MA 2VXYA 4OJYA 1NVWQ 1R8XA 1YJQA 4Y2JA 1Y6GA 5JI3E 1ICEA 2AJTA 2BVNA 1KC3A 2B5OA 3ABIA 1PNOA 3PGLA 5AOCA 2QIPA 3DC2A 4BFSA 3OMXA 4BNUA 4YRGA 2F3RA 2PM8A 2YFQA 3PDHA 4WXPA 3ZJTA 4DABA 4IDDA 1EIWA 4YXWA 2A4MA 4YAEA 2BR5A 3TZ6A 2P4QA 1WV1A 2PDAA 1UFOA 4QQRA 3SBXA 4ZEVA 3BSWA 2Q1YA 2VJMB 5JAZA 3I01M 1NKTA 3PJEA 3RT7A 4CIXA 1JG2A 1Y8CA 4I4TB 2M6SA 4CMEA 1ZOPA 4DMRA 2FSGA 5FADA 3DVAB 3OOSA 5CB4A 2XXJA 3CKMA 1CUHA 2X1MA 3ASUA 4F56A 3IC5A 3O73A 4GQBA 1NYTA 1B2LA 4Z1MA 5TPWB 1E3QA 3MT9A 3L0DA 5B1SA 3EC1A 1STOA 2CNLA 3SKXA 4BVGA 4CIWA 4AMUA 4UEOA 2VZ0A 4IXWA 2O19A 4BWGA 4G1CA 3BH0A 3LXMA 1KKLA 2Q0QA 3VKVA 2NU6B 3BCHA 4DV3B 3U5TA 2YJGA 3WV5A 2WYIA 4EI7A 3DXFA 3CZPA 3TVYA 1ATIA 2F7SA 4GC5A 1Q0UA 3F6RA 1LSUA 1QC5A 3LHFA 3PNLA 2BFCB 5B7PA 1RQ7A 1ZVVA 4NXMB 5KKAA 1D8TA 3BCSA 3LX6A 5AXAA 4C0HA 1LPNA 3K2IA 1BDBA 4ZOLB 8MHTA 4KBYA 1ADYA 2X58A 4OUDB 5CHEA 2DFPA 2GHIA 2X5NA 1UDAA 3CEAA 3QVVA 2AOTA 1L1EA 1QWSA 3PCRB 2OVFA 5H83A 3BJIC 4TVSA 4HWGA 3ADPA 3WMRA 1USWA 1SCJA 3KAKA 5JVDB 3TW8B 5EEHA 1QH1B 4X24A 1V71A 4B2IA 4ID3A 1QP4A 3Q8MA 1E9VA 2J3JA 4Y1RA 3ZJVA 4DJEC 5A5GA 4QPCA 1JFVA 3H9EO 4P53A 1DFIA 2GGSA 4MHTA 1Q7CA 2RHCA 2Z08A 3MJDA 1YOVB 3RRJA 2ZIXB 3DTVD 4S3MA 4P4GA 4M1KA 3PEVA 4F2GA 4K8RB 1SKAA 3RG2A 4UBJA 1U3CA 1D2CA 2VLIA 3RTGA 1DUIA 3IUNA 3DDZX 3L1JA 4A6EA 1HSOA 2HQOA 2X5JO 2DERA 1J49A 2EYUA 4KQGA 5JAOA 5LLSA 2ORYA 1OBHA 2QGFA 3ZY2A 1NBMD 1YQWA 2HL6A 3WQRA 1A2BA 1VSQA 4LC0A 5LYJB 3IMCA 4QNRA 4FR0A 2C00A 3VPGA 1WD5A 1M54A 1ODCA 2DLNA 1JR3D 1AF4A 3CWQA 3MAGA 3QIAA 4PYNA 1GIAA 1I4EB 4YT4A 1GUBA 3KSAC 2DQSA 4LSGA 1MO6A 1Z6XA 2XX3A 4M46A 5JDIA 2CVFA 3GVIA 3GZ4A 3P7MA 3B38A 4PBTA 3RK4A 4AL4A 1T5SA 2YQZA 3AP2A 3M3PA 1A4RA 5KTYA 2C57A 5JG7A 2LNDA 2YV1A 3FJYA 3UUEA 1DBQA 1X7ZA 3RVPA 5C52B 2O52A 4HXEB 3IP3A 5CYGA 2DETA 3N0RA 1USGA 1LBSA 3QKRA 3LU1A 3RW9A 2J4FA 1RIIA 2VSYA 1OB2A 4Z5XA 1OW3B 2ZIUB 1E0AA 2FMUA 3K92A 1E6UA 4QYTA 4BCCA 2AVDA 1E3MA 1QK5A 2BEUB 3JQFC 5H80A 3JZFA 5AK5A 5LIPA 4OQ4A 1RWWA 4LMBA 5FWYA 1G5TA 4Q7LA 4TQAA 4UNIA 3HI6A 2BGKA 4D82A 2P69A 1MQSA 2QUKA 4NJEB 4WK6A 2Z2KA 3TQTA 1OLSB 3HKEB 2HJ9A 1WDTA 5IM4F 3EUAA 2EFEB 1QJCA 2VJQA 4XWKA 1Y48E 1G21B 4N5MA 3RB8A 1J22A 1OWLA 3ADDA 4Q3CA 4AM8A 4BX8A 3OBIA 3HP4A 4OU4A 2CL0X 2QX7A 1TCAA 4WFJA 3ZWKA 5JSUA 3L7NA 2R751 5DYWA 5J4YA 4EMSA 6GPBA 2C3MA 2WIGA 3NHAA 5T41A 3ZV5A 1V1MA 3F7OA 5ICEA 3HRIA 3DFKA 1PN3A 2R7MA 2ZYTX 2W93A 4DQKA 4BPRA 3IALA 4TUYB 1U9IC 3DW1X 1DARA 2J9XB 1XD2B 4CKZA 1E5VA 4G67A 4QOJA 2PN1A 3COPA 3WHPA 3AONB 4X92A 3WG9A 2QN7A 4YO8A 3BS4A 2J5QA 2OWEA 3H97A 3I01A 5EIAA 3EF1A 3CRQA 3K70D 1MMFB 4NU0A 5A9TA 2UVPB 3MWEA 3EZYA 5BMOA 3B78A 4TMXA 3A2LA 3D2LA 2HJGA 3GJ5A 2NOAA 4PLZA 1R4NA 3CF2A 5LQAA 3UFBA 1T9ZA 1DEXA 2OBFA 3E4DA 1RWMA 2RH4A 2ZBDA 1DRUA 4RKYA 3W3AD 2O2EA 2ZJOA 4IICA 3FW1A 4L22A 1V39A 1L4EA 1YRHA 3C5VA 3R3SA 3Q3GE 5C1IA 3VZSA 4E03A 2YNMD 2X5XA 3GEBA 3OD5A 4OSEA 2J5BA 4PZCA 1H0RA 3FVQA 2V58A 3G13A 1MEJA 1M0SA 3LC2O 3KSRA 5DTRA 2BTQA 3QFSA 3NI2A 4TMVA 1RZ3A 5BY2A 1O96B 2OT3B 4GX0A 3VVBA 3B7PA 4HGOA 3R7FA 4MWBA 3GLGA 2Y2VA 2Y4OA 3MGCA 2H11A 3SZ3A 2B21A 3IBCA 1JFFA 1OJ7A 5MGNA 1KJQA 5IUKC 1AUXA 2OHIA 3CZMA 1KEKA 5HUHA 4HDSA 1RLJA 3BEOA 2ZTMA 3VV3A 3BZUA 2QD3A 3DW3X 3A6PC 4L9RA 1X1SA 5HKLA 2C5FA 1ZOOA 3TKAA 1TK3A 1E7WA 4LF9B 1NWCA 1TUGA 2HO5A 3GCWA 3DQZA 3N05A 1E2BA 2BLNA 4NS4A 3KZCA 3R7WB 3PA6A 4EY8A 2JHCA 3BGIA 1ZGHA 1E6CA 4E6PA 5BNIA 1KEWA 4H7HA 1OIVA 3WIBA 4AROA 3GEMA 4JNCA 3S6JA 4QUDA 5KTNA 1IXRC 3SGLA 1NQVA 1PZXA 1YI0A 3WHIA 1CUXA 2BJWA 4MV6A 5ISMA 2I6XA 2ZSFA 1W59A 1CQZA 1XWIA 2OAP1 1TQ8A 1G18A 1O6GA 3FTCA 3KRTA 5BW6B 5TPZD 1JQDA 1I6WA 2RK6A 2SHKA 4IGAA 5CYFA 2WHRA 4D8XA 4HGZA 2B30A 1JXMA 1W8DA 2B6NA 3LZ6A 2EKQA 5E4TA 3RU9A 1O9BA 2YINC 3DMNA 2NU9A 1D2NA 1U0NA 5AIBA 5I4BA 4GPTA 4RV5A 5B53A 4NTZA 5CDYA 1NZJA 1ONOA 3DAFA 4CIVA 2PMFA 5LB2A 3FPEA 4F9TA 1WY5A 3AV0B 3E9MA 4H60A 4MMXB 4X6YA 3ICQB 2QUIA 4H1UA 1HURA 3LT5A 5K0LA 2BHTA 5DGXA 1ABEA 4N4AA 4Y9UA 5PGMA 1D2AA 4CG3A 2GARA 2BMJA 4MQMA 3A9TA 5F2EA 1E58A 4MPTA 3WLPA 5C8XA 1HQDA 4HKTA 4ETNA 4XX0B 3EZGA 3D0KA 1ND6A 3FPJA 3QHPA 4GZ6A 4UTOA 5DX8A 3S1LA 3ADCA 1E8DA 4KXYA 5J4LA 5AH0A 2FHPA 2JCYA 1OH6A 5ICFA 4V1CA 3PFGA 3C85A 4UEJA 2CWDA 2R8PA 4X1YB 1V2GA 5EERA 1JQJC 2E0IA 2I2CA 3G2QA 3FF1A 3HA2A 1KMCA 5IARA 4LGVA 1P9NA 1KU0A 1EM6A 3DYBA 3PXAA 4KWIA 5EE5B 5IU6A 2P9TA 3JD0A 5J4VA 1Z6AA 3EJWA 2K2QB 4NRDA 2XMRA 4U0JA 2NP7A 1AJEA 2BUCA 1I8TA 1X13A 4L5JA 4RZQA 2WJ3A 3UGKA 5IM5A 3NANA 1T13A 1Q6ZA 1VB3A 4H0FA 1SKBA 3R7AA 1NMZA 4BNXA 5F77A 2Q3JA 2XVAA 3OMWA 4FSHA 4K9NA 5KX5A 1EQUA 4B8YA 4BVKA 1XN1A 1DSSG 2FZGA 3HDQA 4NECA 4WIAA 3MB8A 4GYJA 5LOVA 2AOXA 1C7FA 1CEQA 1DZIA 4KITB 3UB3A 4DR1B 2KPOA 3O03A 1VOTA 3FFTA 2WIBA 3ESYA 1DKRA 5TMPA 1COZA 4RF2A 2BFNA 5FD8A 4QFCA 4ACAA 4ZGGA 3K53A 4YP9A 2MSEB 4IQ4A 1Z37A 1HOTA 2ISSD 1C0IA 1NHGA 4H15A 1DWUA 3DO8A 4YCBA 3EC2A 1LDBA 3LFTA 2RHGB 4PPNA 4XR9A 3UMBA 4LDPA 1Q11A 3BWMA 1NYRA 2YZNA 3LGXA 3O1IC 4MUMA 4ZO8A 2OM2A 1QGYA 4EB3A 5HBRA 1FXWF 2HLDD 2NO9A 3RHSA 2WB4A 1RWNA 2ZE7A 1AQIA 2MYTA 3AUFA 3IQZA 2D1YA 1GTL1 3VNQA 1JG1A 3PQ4A 1GT6A 2OXFA 3TK1A 1MW8X 3IODA 5DXAA 4EG4A 4HNSA 2Q6LA 4ZDKA 4KQEA 1PUJA 4F8EA 3DPIA 3E9DA 1ISMA 3JAWB 2DPXA 3S70A 4IUDS 1JIJA 2DH5A 3AEUB 4JIGA 2RGDA 1QO9A 1GCIA 2YXEA 2AEEA 3FKJA 3I2GA 1UMBB 3QE4A 4GBED 4C5BA 4DXHA 4FWTA 3TW4A 2OESA 2ACWA 3QOXA 4UCWA 5HNKA 1M5RA 1CERA 3F9IA 2A86A 2X13A 4FT2A 5EJ9A 2XGJA 1UKBA 1NUUA 2PBRA 5C7LO 4XOIA 2IOHA 2P9ZA 2Q3FA 2VBIA 4ALNA 3WLIA 1FDOA 3HJAA 1UT5A 2Q1TA 1JA0A 3PC4A 5DISB 2Q4OA 5JOQA 1UKCA 2HPVA 2I7TA 1KFBB 2G04A 2IU4A 3ODPA 3LLMA 1HE2A 3VU9A 5KEIA 3HJNA 1QYIA 1RM4A 5CU7A 3WQHA 4EEKA 4L2IA 3ZWOA 4IJQA 2WFLA 2P40A 2ZVQX 2I3GA 3EAGA 4DUZB 1J7KA 1FPQA 4Y2YA 5GMOA 3ESQA 2C2WA 4FONA 1YO6A 2BRUC 3IBSA 4M3NA 3N0XA 3D2AA 3IT1A 5F9MA 4EFMA 1IZZA 1GZ6A 4E1VA 1NMYA 5HFNA 3MLAA 3TLJA 1TLLA 3S7TA 1U2GC 2V7BA 3ZHCA 4CLHA 2NT4A 4O08A 3QKSA 2XUFA 1N5DA 2I2BA 4MUYA 4E4RA 3LJKA 4IHJA 4Z7QB 3H5OA 2P30A 1QH1A 3E0XA 2WTXA 3DBVO 3ZW7A 3M9XA 2E5WA 3H13A 2YW2A 4ZYVA 3RUPA 1EKXA 3QHAA 2QRPA 2IGBA 4WZBE 3UF0A 1XCGB 3N0WA 1TZBA 2RHWA 4HQOA 4ODIA 3OQHA 4LSZA 4J7CA 1ORIA 1RTTA 1NNUA 4MUHA 1GSAA 1E8NA 3AUKA 4UREA 1RBZA 3BGWA 4CM7A 4D6PA 4OFWA 3LX8A 4UHKA 2FLKA 1N1DA 1LV7A 2PT7A 4IJWA 2DR2A 1X9GA 3ID6C 3LFHA 5JFGA 1UP4A 2XNSA 1KIMA 2GUGA 2W2PA 4TX1A 3S99A 3VSAA 3FOAA 3HEMA 3PX7A 5ES3A 1U5BB 1K6XA 4NDNE 1FYVA 4NZZA 1LDNA 5BN3B 1ONNA 3FOCA 4WK2B 3VYTB 3CZCA 1J99A 2AI2A 4AX8A 1BDHA 4ALLA 2P2YA 5LYYA 3CLUC 2BGRA 4X8OA 3U13A 1NLZA 4OVKA 4PZPA 2CXOA 1A77A 3D8HA 3H8JA 4K9QA 4LDNA 2X22A 1JJBA 2AG8A 2JVIA 1BHSA 5EHGA 4UUBA 3CPJB 4XWTA 3ZGLA 4EW1A 2QORA 4Y1FA 3IVAA 4XPIA 1QWOA 1Z88A 2O5EA 2H7VA 1YTLA 4DY6A 2W0MA 4BP1A 5B58C 2ZE5A 2ZKLA 4LBVA 4B4UA 4BNKA 2ORIA 3OA2A 1AZWA 1P9RA 2J30A 1ZCFA 3I12A 3NAQA 3NWOA 1GU1A 5F3DA 3NIWA 3OQNA 4D44A 1D6MA 2FPSA 1LJ8A 5TEVA 4E07A 1A9XA 1JZQA 2OHXA 2Q2OA 2G7MC 3HVJA 4W5WA 3UWKA 3WLEA 4EG7A 1UBMS 1VFPA 4A03A 2ZI4A 1J8QA 2FJ0A 5HIMA 2AE1A 1U0BB 1HL7A 1TZCA 3IQXA 4XUCA 1G9TA 2ISCA 2OILA 4Q16A 5TJ9A 4HGYA 3AKYA 2BW0A 5FAXA 5C35A 4WCFB 3E23A 1IIBA 3NM6B 4ZXFA 1E89A 2JAHA 3JQ8B 3TBKA 1Q7TA 2R0QC 4M0LA 2XNKA 2E4XA 4BO8A 3E8SA 2LBPA 2BFEA 3OPXA 3PFCA 3R75A 4D46A 1CS0B 3R3HA 2PZBA 4AF7A 1Q95A 4NATA 5FPQA 4OTZA 3HCAA 4FSDA 2ZTVA 1NU6A 3ZE7A 1QC5B 3DP9A 2W7TA 3N6XA 5K2MA 1S1MA 3MTJA 2C7QA 1R3DA 4E11A 3G7UA 4BJHB 1RYHA 2X41A 1TC1A 3E7FA 2ZRNA 4PIPA 5CB8A 1T35A 4MCJA 3JWIA 4TL6A 3EQ6A 4N65A 1PRYA 3CLHA 3NPMA 1L1RA 1XCJA 4JLOA 3B1JA 2D1TA 1F8YA 2AJLI 2IELA 3DKKA 4JK3A 4JLWA 4KGDA 4P54A 4U7HA 5AD1A 4JGIA 1ZN2A 3STWA 1VPEA 4KGVA 4MA5A 1L5HA 2ZWAA 5IT0A 5HQ3A 2I80A 3FLMA 2N3ZA 5I4CA 1MB0A 5E4YA 2JB9A 4LE1A 1P1KA 2XOXA 1TL7C 3DLAA 1L4GA 5AJZA 4OHKA 3CLTD 4CEHB 3I9JA 1G3RA 1V5GA 3GFGA 3BPSA 5BYKA 3KYJB 2W70A 4IM7A 5HS4A 1AKUA 1WZNA 2EU8A 2M9MA 2ORWA 3QSGA 4GLBA 4OJMX 4UU1A 5DW3A 4DBLC 2VDMB 1PR0A 3B1KA 4RDHA 4BVLA 4I55A 5U4QA 1K7YA 1WZ2A 4G0QA 1R66A 2ZR8A 4JVNA 3OKFA 3Q5EA 1EUCA 4KN9S 5ALQA 1YTUA 4QDKA 2O2YA 5FTLA 3TQOA 1HOXA 2J3DA 4CMIB 3V9PA 1XCPA 3BHMA 3FOBA 3F4BA 2DYKA 1KHTA 2ZUWA 4AW9A 1U1FA 2FJPA 4BLUA 1EFKA 4MP3A 3GPBA 4M21A 5B7GA 1OY1A 2J85A 4X84A 1N75A 2GH1A 3N6VA 2BKAA 3THSA 1MA3A 3PPVA 3VUFA 1X7ZB 2VNAA 3S8YA 1T2CA 1VQ1A 3VO9A 1JEEA 4QZVA 2JG3A 1KY5A 1NWHA 1V8BA 2REOA 3EEBA 3WGGA 4ZYWA 3DZJA 3WDKA 4J6EA 4ZVUA 3VOBA 4KQWA 4FUQA 2R2AA 1C0KA 4CKBB 1PI3A 4M8LA 3HJUA 1NXWA 3NFRA 1T3SA 1PVVA 1R5BA 1G42A 2QLLA 1CUBA 1Q7EA 2NUAA 4YJ3F 3C8UA 1C2YA 1GSHA 4TKVA 1F0YA 3L7IA 1YIDA 2WWXA 4X20B 2M2IA 3AERA 2VHJA 2XQVA 2HMSA 1SUEA 1U2GA 1FVOA 5BSKA 6Q21A 4EB6B 4EUHA 3ED1A 2GB4A 2ST1A 3WLSA 1M7GA 2MR6A 4FLEA 3CW9A 4XEUA 5HILA 2PQ0A 4BLPA 3ZE2B 1KSFX 4Z0NA 4MJ3A 3VSEA 2E87A 5KYUA 4MQ5A 4ZQCB 5KJ6A 2VAPA 2PZLA 4V3CA 3P2MA 3GEHA 4EAQA 1K4MA 2VI5A 3A28A 3Q3HA 1C4XA 4P58<