1Z35A

Crystal structure of trichomonas vaginalis purine nucleoside phosphorylase complexed with 2-fluoroadenosine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
235
structure length
230
Chain Sequence
ATPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEERQNSFQNMMKIALEAAIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords purine nucleoside phosphorylase
publication title Identification of a subversive substrate of Trichomonas vaginalis purine nucleoside phosphorylase and the crystal structure of the enzyme-substrate complex.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 84
structure length 230
sequence length 235
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z35A00
1CB0A 1ODJA 2OECA 4G8JA 2I4TA 3BSFA 5F76A 3UAVA 3TL6A 4R2XA 4QASA 1Y6QA 1RYZA 5CXSA 1ECPA 1T8RA 1RXUA 1NC1A 1PR1A 1TCUA 1U1EA 1B8OA 1A9OA 2A0YA 4DAOA 3T94A 2H8GA 1RCTE 4D9HA 1G2OA 3GB9A 5IFKA 5KB3A 4M1EA 1A69A 4TXMA 5F7ZA 3GGSA 2RJ3A 4KN5A 1V45E 3KVVA 4RJ2A 1ZL2A 4GKAA 1RR6A 1Y6RA 4QEZA 4DABA 3K8QA 3OZEA 1LVUA 3UAWA 3PHCA 1U1FA 3OPVA 4IP0A 3UT6A 1T0UA 1PWYE 3OZDA 4P54A 4QATA 3BL6A 3E9RA 1RSZA 4WKNA 1C3XA 3OOHA 1NC3A 4TTJA 4R2WA 1LX7A 2P4SA 3OZCA 1K27A 4F3KA 3FWPA 3UAZA 4G41A 3K8OE 3P0EA 1YR3A 2GUWA 4LKRA 2B94A 4F3CA 1V41E 4E1VA 1V2HE 4EARA 1PR4A 3LGSA 1T8YA 1U1DA 3EUFA 1K9SA 2OXFA 3PHBE 4DA0A 4QAQA 3UAYA 3KHSA 4DA8A 3O4VA 4I2VA 4L5YA 1QE5A 4QARA 1K3FA 3PNPA 1OU4A 4TS3A 5EPUA 5F73A 5F7OA 1RXYA 4DA6A 1Y1SA 4DA7A 1ODKA 4TXNA 1SD2A 5I3CA 1Q1GA 1Z5PA 3DDOA 2A0XA 5DK6A 2QDKA 2PGAA 5EFOA 2AC7A 2OC9A 1JYSA 3E9ZA 4UC0A 4OGKA 1OTYA 4TTIA 1Z35A 4PNPA 2ON6A 3FAZA 1PR2A 1PK7A 3E0QA 4LNAA 4L6IA 1YQUA 4F1WA 3KVYA 4D98A 1T8SA 2Q7OE 2A8YA 3FOWA 3U40A 3OCCA 4TYMA 1Z39A 2HSWA 5B7PA 2QTGA 3EMVA 4JOSA 3OF3A 3FUCA 4H1TA 2ISCA 1A9PA 1VHJA 1PBNA 1A9TA 1JE1A 1JPVA 4YMLA 1A9QA 3QPBA 1Z34A 1JDZA 3OZBA 4L5CA 5CXQA 1FXUA 1TGYA 4OF4A 2A0WA 3MMSA 4G89A 4TXLA 3IOMA 1RFGE 1Z37A 5F7JA 1SD1A 1LV8A 3C74A 4L5AA 4LZWA 4M3NA 1Z5NA 2HRDA 4WKCA 1Y1RA 4K6OA 4FFSA 1Z38A 3ONVA 4GLFA 4JWTA 4PR3A 3LBAA 4DANA 4BMXA 4F2WA 3BGSA 2OC4A 3DF9A 4X24A 4MARA 1OTXA 3PNSA 5K1ZA 1V4NA 1ODLA 1Z33A 1CG6A 1TCVA 2XRFA 1SJ9A 5B7QA 5F77A 4DAEA 4QFBA 1U1GA 1WTAA 4F2PA 4D8VA 4MCIA 3KU4A 3DPSA 5ETJA 4LNHA 4WKPA 4JP5A 1JDVA 4LDNA 1JDUA 1ODIA 2QSUA 3NM6B 3FNQA 4OGLA 4GMHA 1YRYE 2BSXA 3SCZA 3F8WA 1VHWA 1OUMA 2AI2A 3FB1A 5JPCA 3P0FA 3ENZA 4BMZA 4WKBA 3NM4A 1PKEA 1ZOSA 4D8YA 1A9RA 3ODGA 4L0MA 4WKOA 4ECEA 2IQ5A 1U1CA 2HWUA 1XE3A 1Z5OA 1N3IA 4YNBA 1YQQA 1TD1A 4D8XA 1PR5A 5CYFA 4NS1A 4DARA 1OV6A 4NSNA 5F78A 1PK9A 4YJKA 1JDSA 1JP7A 1PF7E 3NM5A 5B7GA 4R31A 1TGVA 1NW4A 1YBFA 5CCDA 5CYGA 1V48A 3O6VA 3IEXA 1Y1QA 1ULBA 1V3QE 2QTTA 5F7XA 3KVRA 1RXCA 2HN9A 1ULAA 1B8NA 4NY1A 1PW7A 4OY3A 1PR0A 4YO8A 4OEHA 5IU6A 3D1VA 1RXSA 4TTAA 1M73E 1PR6A 1T8WA 1Y1TA 1SQ6A 3UAXA 3EEIA 2I8AA 3DP9A 1VFNA 4TXHA 5B7NA 3EUEA 4M7WA 4EB8A 1OVGA 3DJFA 1Z36A 1JE0A 1I80A 5C80A 1VMKA 4GLJA 1RT9A 5FAKA 4TS9A 3OOEA 4BN0A 4BMYA 1JDTA 2AI1A 3MB8A 4U2KA 5CCEA 3LA8A 3KUKA 2QPLA 2AI3A 4OJTA 3BJEA 4MCHA 4TXJA 1A9SA 3INYA 5EUBA 3NBQA
chains in the Genus database with same CATH superfamily
1QR2A 2VDUE 1E2NA 4WY5A 4WCVA 5C8YF 4HPJB 1ESZA 2D0IA 4I1SA 1FLVA 3CURA 4ITVA 1ZK3A 4Q6WA 1PJQA 5E6UB 5GONF 1VBNA 1JGTA 2C4HA 4LQ4A 4LVNA 1K4MA 1ORWA 2Y66A 1YDGA 4ZC1A 3R7DA 2AXQA 2JIQA 2IF0A 2IUFA 2Q5QA 1CR1A 2WJ6A 3FGZA 1I4LD 3ZNPA 1CULC 2YYYA 2IV3A 2ZS7A 3WGGA 3E5RA 3F46A 3L8EA 5L95A 1XVLA 2KPOA 1ZPDA 1FE8A 1XDWA 2DF8A 2KW5A 4G63A 5FXMA 1W2GA 2C61A 1TCUA 2W4QA 1HE4A 3WDMA 4C4OA 4KZPA 3X1JA 2GDJA 5U4XA 1ZRSA 3R3WA 5G3ZA 1IEVA 1C7QA 4OKSA 3MJTA 1NNSA 1PVDA 2GTPA 4L3VA 1KBZA 1LLDA 4R6WA 2V5AA 3W5CA 2VPXA 5FUYA 2YJ3A 4CU5A 3F2VA 3ZVNA 1CYEA 1NPTO 2Z2KA 4YRCA 1Z17A 3ELDA 5FLYA 1V43A 1X7DA 4DS3A 1TUIA 5IJAA 2FSSA 3A0RB 3KYCA 3TBHA 2CFTA 4CLOA 3SZGA 1PEKE 1GUFA 1GCIA 2NX2A 4XA8A 1N8SA 3OZUA 1A97A 1N2ZA 1YT5A 1PZXA 2AH5A 4YYZA 2M1XA 4RSGA 1BHO1 1FTWA 1HRDA 3ZDQA 5I45A 1XB2A 4AWAA 3EZ9A 4GKAA 1XLTA 1O94C 4K6KA 4GE0A 3DBRA 3RFCA 4CTKA 1E99A 3D0OA 4Q47A 4I66A 4EY7A 1JAXA 4B81A 2YJ6A 4B3GA 1PFUA 1Z26A 3PQ7A 1GKIA 3P9XA 3GVXA 2AK2A 3TDNA 3UYKA 1P9NA 1T6ZA 1E89A 5FWYB 5EP2A 4CEHB 2FSVA 5I4KA 1A1VA 4AG5A 1H1DA 2HQOA 2HX1A 3OJCA 1RLUA 3HFSA 5EWMB 3OQBA 3GHYA 2IBTA 5FNVB 4P54A 2E7ZA 2JFOA 2JLVA 4DQXA 2PRIA 1IOLA 1AE1A 1TYEB 3U3OA 5CM9C 1SCQA 1QSGA 3E9DA 2FSPA 5F1YA 3FFTA 3QVSA 1AHHA 1E6UA 3GXBA 5JZBA 1KPIA 3LLMA 5TY0A 2B82A 3QLTA 1TZCA 4PXYA 4D81A 2VDLB 1RM0A 3FH0A 2P4SA 3EYAA 3ICWA 3G49A 2FN9A 4CF6A 2HMTA 2AMFA 1S01A 5DHQA 2JDIA 1UAYA 2I99A 4HXGA 1AUVA 2H1LA 3B1YA 3G9QA 3PDWA 4L08A 4NOLA 4OJNA 3WWOA 2B7BA 1I2MA 5BN1A 3UGQA 1EFRA 2FWRA 2VZEA 3BRWD 1WLYA 1A7UA 3D0RA 3ND8A 4E5NA 2IHVA 4C06A 1KIAA 1CFJA 1QQAA 5AW7A 1KFCB 3VV3A 1I3OA 5DIZA 2C1EA 2N42A 1JQLB 3VPAA 3L1VA 2WM9B 1U1DA 1Z2OX 3BSWA 1MJ5A 1J09A 1DS6A 3WRYA 1CZOA 4KQJA 4X1YB 1NT4A 3G5UA 1T4MA 5IVIA 3K8ZA 4WT7A 1NX6A 5G0SA 3U3DA 3V9AA 2VNKA 4AW9A 2B8NA 3KJEA 1AHIA 2XYQA 3QPWA 2GTIA 1JTVA 4OTZA 3PX7A 1DFGA 3DVAB 5B1EA 1QHSA 3GJ0A 4XCXA 3RH0A 5KSWB 3IQGX 4P4UA 4DIKA 2H1WA 3SG0A 5IJXA 1DRKA 2ZG6A 4KBGA 1TNDA 2YMPA 3EUAA 3SWWA 4NDNE 4NU5A 4MRMB 5DYTA 4TX1A 4ZYYA 2PSSA 3ELUA 3OA0A 2B9EA 1CWUA 4TTVA 5JRZA 3L5KA 3HN7A 3IAS1 4D4MA 4WDQA 1ILEA 2FW9A 2ORIA 2F8LA 2REQA 3RQIA 1PUJA 3P52A 4ZGWA 1YL5A 1E3MA 1EA5A 2WFZA 3RIYA 1D1SA 1NPDA 5KQLA 2ZQ5A 3PKZA 5JC1A 3DLIA 2X5NA 3FWNA 2JGFA 2SECE 2ZWVA 4B33A 4UAUA 4PHCA 3S81A 5I7FA 3CHYA 3CF2A 1GXSB 5DXJA 3AFOA 2XQIA 2GBLC 4X0EA 2O8BA 3P20A 4U5QA 1WWKA 4IM7A 3CN7A 3MMZA 3VR5A 4RA6B 3ZCTA 3CINA 4CM6A 3GPLA 1QFSA 1NDHA 4J29A 4JDUA 2AZMA 4ND8B 1UADA 4UTRA 5D51S 5E8RA 5IJ0A 1NXVA 3WK6A 1PTJC 1KETA 3NIDB 1HL3A 5KOIA 3G2HA 3IALA 2VBFA 1OZFA 2I4RA 5C3UA 3I6QA 3W2TA 4QRIA 4Q4CA 3INRA 1MCZA 4NDAA 1QVRA 3WYDA 2GB4A 4QBKA 3JVVA 4TM8A 2NSJA 2E4WA 2PJUA 3N8DA 1EWKA 1J8DA 2ILTA 3DKPA 3Q5EA 1F0YA 1EIWA 2XY4A 1FVOA 2FK7A 2P9HA 3CPHA 3L92A 4BRWA 1MQ8B 5LIRA 3C3MA 3L8FA 4BNNA 1NDUA 1KEZA 2EZTA 1WCIA 4YRQA 1QLWA 3BRSA 5HDBB 1G41A 4RZQA 4FEEA 3EVCA 1P4HA 2GPBA 4GWGA 5JASA 3MBIA 4GG1A 4UASA 2JGDB 4BO1A 3DOJA 4O4HF 3EZFA 3OLYA 4TKLA 1ZM4A 3C7KA 4PCUA 4CHGA 1NWHA 4GBED 4JA0A 5REQB 2HCJB 1LBSA 2GWHA 2I1LA 3IP8A 4B6PA 1ZH0A 3PCTA 3A25A 2PCLA 1AURA 2QUBA 3PUIA 2ODPA 2QV7A 4LYGA 5CXXA 5JDCA 1JBKA 4KVFA 4BVJA 2NOAA 1FYWA 1YL7A 1CT9A 3CX4A 4NMWA 1L1QA 1IN6A 4LF8B 4KG7A 3BZBA 5J1TB 2Y27A 1U7TA 4L78A 3D3QA 1LPPA 5BWCA 2AUTA 2NVBA 3E7XA 4LC0A 4HCJA 2FX3A 3SVZA 1G20A 5J2UB 4E5SA 4A6PA 4CUZA 3CWCA 5A9SB 4KXNA 2XHEA 4AMUA 4D56A 1GNQA 2JD0A 3UJ3X 1K0FA 1C50A 2OFXA 3ZY5A 1LZKA 2AYXA 3M6XA 1NATA 5FLXA 1V5GA 4TV8A 5JFGA 2TS1A 3F7TA 1XMIA 5JV5A 1SELA 2RH4A 2XUPA 1KNXA 3H7AA 1QDLB 4RESA 1NZDA 2BM0A 4HDKA 4GI1A 3KAJA 3L7LA 4NMXB 4X9XA 1ZUIA 4P80A 4UNIA 1H2RS 2Z09A 2CJPA 1YZLA 3RC9A 1WQ4A 2WZQA 4DCUA 3DXYA 3FSRA 3PP8A 3S1AB 4FBMA 2FJ0A 3CZMA 1Z5VA 3T1OA 2X0IA 1D2MA 2Q4BA 1TXGA 4G89A 4E1AA 1DNPA 3AILA 3D54D 3K92A 1EQAA 5HDQA 2XUJA 2I2CA 2C97A 3MUNA 3GMIA 4PZUA 3W4KA 4DDHA 4NTZA 1DZ3A 1D2CA 1M34E 1HC7A 1SVSA 4JCOA 4Q1DA 5IXSA 3WGNA 3IDSA 4DYVA 5BWNA 4KR7A 1CJTC 1D0IA 5KX5F 1JU9A 2GASA 3OM9A 4S0ZA 2R2GA 4MUIA 5KTOA 5HZMA 4S04A 1XJ0A 4G8BA 2W2TA 1TT5A 1WMFA 4MS1B 4N7JA 4MHOA 1A2QA 3BGIA 3KVNA 3OZSA 1VG9B 3GG2A 1XRMA 2YIVX 3SQLA 2C0CA 4JL8A 2SKEA 3FCSB 1N77A 3TJMA 4RZSA 3ZBQA 1QO9A 2WSIA 1OXUA 5M2QA 1ZJ4A 2GZSA 1Z38A 4TQGA 4BLRA 3BE4A 4N82A 5EIXA 5M29A 2BUCA 3IUYA 4RAOA 1YBMA 1MX5A 1Z22A 2WHPA 5I6DA 1E5XA 2EP7A 1D03A 1LI7A 4LSWA 4QBTA 4WA8A 2Q3EA 1T4BA 1JG6A 1ZWKA 3IH5A 5DF1A 3ENQA 4PWZA 1U8TA 5I8WA 1WMDA 4G0ZA 4JEMA 2ILVA 3NFRA 2PT7A 2DPHA 2FXIA 4X54A 4DANA 3GROA 5IH3A 3IR6A 3IULA 3PNOA 3L6OO 2BEJA 2XH8A 3I62A 3VJRA 4IIGA 1OX6A 1Y7LA 4DRXB 3G0DA 3BM5A 2NACA 1HTBA 2W70A 2NO1A 3V4VB 2VL7A 3MD9A 1VB5A 5KYYB 2BLNA 3RSHA 5DRTA 4ZHQB 3AR4A 1MAUA 3DV0B 2XUKA 3HJBA 3HXPA 4E4TA 3IX7A 5ED0A 2O54A 5DKFA 2W43A 3GI1A 4B6OA 4DR6B 2RHWA 1NVVR 4LPSA 5BUCA 2ZBFA 3GLFB 2H3EA 3JWJA 4JC4A 3DFMA 3QOFA 1T24A 2JIBA 4KYVA 1ISGA 5CMLA 4XAQA 1IG0A 2F4NA 2VKQA 4HYTA 3EQZA 1F2TB 2BT4A 2CZCA 2BMJA 4CMIB 4JT4A 4RFSB 4LI0A 1NURA 5TEVA 4EJSB 3LH5A 4H0FA 1K06A 2MSEB 4MCIA 2DR2A 2Y1FA 5FA8A 1W0KA 4F2HA 4MITA 4PYRA 4ERNA 1UAAA 3WIVA 1XMSA 3K0SA 3O4GA 3VR5H 4H77A 4AG6A 5JROA 2L19A 2WFMA 1T13A 4QOSA 3UB4A 3UG6A 4BN4A 4TUYA 1CUZA 1ZW6A 1EVKA 1XZCA 1VIYA 3A3PA 3ADOA 1LWOA 2VYVD 4HDRB 2WWVD 4EIWA 3HXQA 2EFJA 3HSSA 4NRDA 1ZD5A 3INNA 4GOLD 5DCLA 4YQFA 4NBRA 2QR5A 5DN9A 4I55F 1E9AA 1BCSB 1GSOA 3C8ZA 2BSXA 2PJDA 3UJBA 3GD7A 4JYCA 2LRHA 3CR7A 2C2BA 1WB9A 3DEJA 5KYGA 3LPAA 5EJAA 1NU6A 3TKYA 1CZUA 4AS3A 5KYUA 2BDUA 3ZY2A 1KS9A 3GBVA 3O8OA 1LDNA 4OREX 2OENG 1J9ZA 2O7RA 2FZ4A 3NOQA 1WKVA 4FOPA 1W5BA 4R2HA 3ROKA 4URUR 4Z2YA 5JAPA 1KSJA 1RYYA 2B1GA 2F8MA 1C3JA 1F38A 3OT1B 1IVSA 4IFBA 1MO5A 5EJFA 1PKXA 2IOFK 4JYBA 4L0MA 1EFPA 4YY3B 3BMNA 4F60A 3PG5A 5HFAA 3MT0A 2XQFA 1QC5A 1SHKA 1FQWA 2XAUA 2ZJFA 3VPBA 4BWGA 2ZZMA 1PZFA 1VPEA 1I8TA 4GH5A 5JS2A 3SJCA 3OQ1A 3CH6A 3D6FA 3PGKA 1KH2A 5FQOA 3JD1A 2G9NA 4GNKA 1TD1A 3H17A 3QFCA 2FK8A 4I5EA 3TNJA 3ZXYA 4DEVA 1MW9X 2FEKA 2HCFA 4LZAA 2CCGA 3B9QA 4DY4A 1FFGA 1YVRA 4ALNA 4CDGA 1PEAA 3FFWA 5AHOA 1Q92A 4LRSB 5AOBA 3U48A 1T4DA 4MA4A 1DBIA 2O50A 3JQAA 4F4IA 5JS6A 4D25A 2AMYA 2DCUA 4URHA 5AUOB 3FHOA 4BPRA 2JDID 5K3AA 3SHVA 2I5PO 2WF8A 5DO9A 4C88A 3WKAA 1RZVA 2R79A 3UTCA 4NU8X 4FSDA 1SOVA 1XCLA 1T9HA 4PZDA 1C2TA 2DH6A 3QG1A 1L8XA 2JJMA 1NW4A 2BN4A 4RIFA 4Y2XA 2W58A 5DN6A 5E1BA 3QVMA 4L07A 2M32A 5KJEA 4DMLA 1GU7A 2GH1A 3EJ6A 1PYOA 4G26A 4NENB 3BEOA 5GPBA 1T1GA 1X86B 3ZCSA 1NASA 1ULBA 2ODQA 4J0FA 4R1NA 2PUVA 4HYQA 3FD8A 3HGQA 1GZ3A 1RWVA 4HK4A 1W0JA 2OYRA 3GFVA 1JKFA 4C21A 1JDJA 5LXTB 4JKYA 1FFAA 1BX3A 1JEQA 4PLVA 5DULA 2P9GA 1JDBB 4Q7MB 2FEXA 3OA2A 3I4FA 2IZOA 1DXYA 3EQ6A 3H1GA 3OZAA 3LQQA 4GMFA 5KKAA 1MT3A 2JAHA 4B31A 3Q0EA 4GXRA 4G1EB 4Y6RA 5TQ0A 1KDVA 3WK8A 5HK8A 1IXYA 2YASA 2J7KA 4FMPA 3G2MA 2I8LA 3H5WA 4IXDA 4P82A 5IDWA 4NABA 1WF3A 3I04A 1GZSA 2GNPA 3F7MA 1JSCA 1F3LA 1RWOA 1ZNXA 3DMRA 3EEIA 3NW9A 3UANA 5CA1F 4YP9A 2HUNA 2RAFA 3FOCA 3AEKB 1GAWA 1NU8A 5HUHA 2FUG6 3CLRD 4HQOA 1IUNA 5FPYA 2JFZA 4GC5A 2NU7A 4DA4A 2V54A 3MUEA 1PFQA 4QT0A 2ZIUB 4Q7KA 1VE1A 1KDPA 3ZLVA 2E4VA 3VKHA 1H1LA 1AQ6A 2PD4A 1NUHA 4V1CI 4K86A 3U7HB 3BQ9A 3IUJA 1PO7A 3FDFA 4P3XA 3TRDA 3KJIA 1RBQA 3KOUA 3FG9A 3QVJA 4M53A 1KI4A 2HSDA 2PAAA 5K3OA 3A27A 5AW2A 4ZVVA 5FQNA 2PX5A 4F2DA 2ZIWB 4MJXA 2V7XA 4AMGA 2RBGA 4BV3A 1ULTA 3BL8A 4J16A 2IEYA 1TDJA 1J0DA 1Q21A 4WW0A 3ZHQA 2ID4A 4H59A 4CTOA 4QXQA 3T41A 1IBLB 4C0XA 4HFNA 2G0TA 3JASB 4MVJF 1ST3A 1Q44A 3NHZA 5HKOA 4AZSA 1JWAB 3B6IA 1KJNA 3HS3A 1P0PA 3F5FA 3R09A 4BS9A 1LRLA 2EX4A 4JDPA 2Q9CA 4Q9AA 2C0QA 3DE2X 5EJ4A 5G53C 3R0XA 3IIJA 5THXA 3ZE7A 3GCXA 4I3GA 5LP1A 4XQ9A 2R7LA 8AT1A 4EW1A 1Y42X 3CO5A 1SZCA 2IHUA 2Z3VA 5LUBA 5LLTA 3NHUA 1H2YA 3GLVA 3WB0A 2BYTA 4A6XA 1P1KA 2RI6A 3FPSA 5G0TA 1QVWA 1PTKA 4MV7A 1F6DA 4AO8A 1NNUA 3QX7A 1N4AA 1TU4A 2CE7A 1NP3A 3EXHA 1V1MB 1KJJA 3LHSA 2AEEA 3H4MA 2P9BA 4EPXA 5DOZA 3VH4A 4FHZA 1WPRA 1M8JA 3LCRA 2FMHA 5AOCA 4B32A 4BBAA 4CCWA 1U81A 4QVGA 3ER9A 1Q12A 3RFXA 1DIHA 3BWBA 4Q82A 3FR8A 1GKKA 2IU0A 4F5ZA 1R8JA 4KAFA 4TWRA 1OFTA 3I6MA 1F9AA 1MOZA 1TEVA 2APJA 1E2DA 4K9KA 1MJNA 2HBQA 3RKRA 3WYCA 4OX9Y 4H1HA 3WNDA 1ZN2A 2G7MC 3SQXA 4TWBA 2GARA 2JHGA 4C0JA 2C2XA 2JGAA 1NXSA 2O05A 2VDVE 2VDRB 4MB0A 3MAAC 1Z5ZA 3NTUA 1ZU4A 3QQPA 8GPBA 2OAEA 1S9HA 1ZJ6A 2C5AA 1GITA 2RB4A 1CY0A 3FPFA 4HUQB 4QUDA 3S2FA 2G1KA 2ZYTX 4HG2A 3I9OA 1I9GA 4OFBA 1Y5MA 2CLSA 3R5JA 4DCOA 1H8EA 1UDWA 3OC0A 3CWZA 1JEEA 3U37A 2CUNA 1G8MA 2HWYA 4B9EA 1J0AA 4TOIA 3P2YA 2MSWA 2O0JA 1JV2B 2ZUVA 4B46A 4B44A 4OFXA 1LBIA 2CUTA 1DO0A 2J30A 1QR6A 3SR4A 1P5FA 4ZDKA 1MABA 3E03A 1OXTA 2PYZA 3M1AA 5EZQA 5AVKA 2CHFA 1ZK1A 1GT6A 1Q50A 5BR7A 4RNDB 1B0AA 1ZLXA 1UIRA 6REQA 4CKZA 2A1TR 5J5CA 4I5FA 4K40A 4MWTA 2QU8A 5BMVB 3FFAA 4TVKA 5C32A 2Z8YM 3K94A 2W5UA 3M70A 3RS4A 5LD2B 2ID9A 1ILWA 1U99A 4WESA 3Q15C 4F4DA 3TG8A 3ADKA 4G4JA 3BMQA 5EMJA 1UPXA 5HG0A 4EX7A 4AY2A 3V1LA 2OO3A 1C41A 4Y98A 4F8YA 1KGDA 2DFDA 1Q2UA 2OSBA 2VP0A 1TX4B 1KEWA 2VS1A 3EIFA 5LNK1 5IBCA 3KBOA 4HNHA 4IV0A 2DFLA 4P53A 4Q4JA 5F1OA 3IMFA 1PWYE 4CLXA 3TM4A 4CL0A 2B92A 3MELA 4OVKA 3OZDA 1KTIA 3HJGA 1QPBA 2BHNA 4BWFB 3AXSA 1NONA 5CP8A 1K7SN 2P9CA 4PO3X 4IS2A 1N6KA 1V9SA 3CEHA 1AUQA 1A5AB 4NG4A 4Z9FA 2C5BA 4ZQIA 1P2VA 4QXAA 5CA0B 1JUDA 1NBHA 4IJ6A 1YB4A 4CZ2A 2PU5A 1RYEA 5JI3E 3BA1A 2ZIAA 4MUMA 5SYNA 5JAIA 1WHSA 3TAXA 3WKBA 1EG7A 3COZA 5FDFA 5L4LA 1Y82A 2EG5A 5BPHA 3V1KA 4Q34A 3BMCB 3EAQA 4PG4A 5CB0A 3HKDB 2D1FA 3HR7A 5I7OA 1DBSA 1U5BA 5B30A 1E20A 4LMPA 2Z04A 3EOAI 2FSUA 4HJRA 3CF6R 2ZBQA 2ZULA 1SUIA 4KQFA 2ATEA 2NT3A 4C6RA 3K0CA 4EARA 2O59A 2WYHA 3DTVD 5E7QA 4AJEA 4RPIA 3KEMA 1T3LA 1D2AA 2RONA 4AX4A 1ORHA 1GGJA 2CXRA 3LF1A 4KQ1A 3QZUA 1W0KD 3TGPA 1KF0A 2HDNB 4G0OA 4XVRA 1A82A 2QP9X 3KIPA 3MVEA 1K9SA 5AVRA 1ZMBA 2PDAA 2HCRA 4QAQA 3K2IA 1LJ8A 3GZTB 4ARCA 1WNFA 3BJRA 1X77A 1RIIA 3RUHA 4EMSA 1IB6A 2IOFA 3JZIA 3MAJA 4DV5B 1ZO8A 1EVZA 2V7UA 2XHZA 3SEFA 4DLBA 3G5TA 1DKUA 1ZC4A 2P2GA 3PJRA 3AWDA 2O5VA 4JB2A 2WD7A 1YVPA 3M4YA 2G6TA 2V6FA 4L75A 1YO6A 2LIVA 1JNXX 3TX6A 4JBHA 5EZSA 4MYUA 1VLLA 3C5CA 2QENA 3ZBUA 4B3SB 5FBRB 4BNFA 1KWKA 2A1IA 2OR3A 2Y76A 3VHXA 2CLIB 4UBNA 4I36A 4Q3KA 3PB3A 1EGVB 4JP2A 2AXNA 3GFBA 3COJA 1QFJA 1TM2A 3PYMA 1O4WA 3AG5A 3DEYX 3FMVA 4FDAA 5PGMA 1YR8A 2ZKIA 1BXGB 4RD6A 3UJ8A 4ARVA 2FQQA 3F98A 2VSYA 1XQWA 1HBJA 2XEDA 4BKRA 4JNCA 1KI8A 4PM4A 2GM9A 1TJ5A 2X2EA 5CFQA 5IJ9B 1IM2A 2GBPA 5IMSA 2PRYA 3ZW8A 1Z2NX 5C35A 1XZLA 2ZRHA 5C4GB 2IA5A 1IHDA 3NTRA 4TT3A 3TTXA 3VPDA 1I4EB 2JGRA 1P75A 1VIMA 2PR2A 3JQGA 4I4CA 4EGAA 5DYGA 3W6UA 3EFBA 4IHJB 4MPPA 3EZYA 4B3JA 2PV7A 4UCXA 1H2AS 1ZHHA 3E7PA 3UGJA 1XAIA 3QWBA 2EJWA 4H4DA 3O7WA 4PFSA 2FPOA 1NQTA 1ZM3A 2DYKA 3KEOA 4RBNA 1T2NA 1KP9A 4J1NA 3BSYA 1CQPA 5FFNA 1P72A 1JZQA 1C7ZA 5EWLB 3CEAA 1Z63A 4R0MA 3ZWPA 3HB7A 1P6XA 2R4TA 3ICOA 3R41A 3QFTA 2KLBA 4FYHA 4M9XA 3E9QA 5FP0A 1Y63A 5EE1A 2ONJA 3BH6A 5BN3B 5I7UA 2IZ1A 3U6KA 3ZJUA 3UWOA 4EUHA 2QTHA 5JATA 4YRJA 1AKTA 4F9EA 4C2BA 1NR1A 2VJLA 4XLTA 1XPOA 9LDTA 1OFUA 2QJTA 1NIPA 3JYOA 4RSRA 3ZK7A 3AQ4A 3C3KA 5K51A 1ZXLA 3K1TA 4PRKA 1LCIA 3GOHA 4O2BB 3UMBA 4P08A 4BP9A 2OPHA 4HX5A 2WHEA 3AIKA 1A9PA 1R5JA 4QBIA 5JHGB 4FXOA 2JCVA 2G1UA 3IFSA 4J6EA 4OHWA 3JQEA 4RCYA 1OA0A 1K7FB 4BNKA 2JEOA 4PS0A 4QICA 5BWOA 1AHPA 3MK31 1XYVA 4DMKA 5IPFA 4JB3A 4HKTA 1XRQA 3MXOA 2Z2YA 2R6GA 1JAIA 1EK2A 2JIPA 5A9TA 1E3QA 1DCMA 3MCZA 3K0FA 3PI7A 3HDTA 1QHHB 4RK4A 4EPVA 1AO0A 4E88A 5A4FS 4AICA 4KOAA 1QWOA 2YHBA 1I3LA 3PUZA 2IV7A 9LDBA 2I80A 3UYLA 4LXHA 4W7HA 2Y3IA 1KNQA 4QX6A 4GWLA 4FE7A 1X9GA 4LY6A 1KXZA 2CHGA 4ZOLF 4P1ZA 3RS8A 3S0JA 3SLGA 3CEMA 4DMFA 3QVOA 2V9CA 2XZPA 5AKEA 1H69A 1X15A 5BRJA 1AXRA 4D45A 2Q1WA 3VDXA 3IBCA 3MMSA 3OWXA 3HWX1 2E6UX 1TUEA 5HF9A 3SFZA 1U3TA 4BL5A 4CMJA 4CWAA 4CIWA 2DWQA 1MTZA 1ZOIA 2R1TB 3U39A 3VPFA 2C9CA 1OROA 3PNVA 1LPBB 3HL0A 3IP7A 3HDGA 2RBKA 2MDTA 3VAZA 3U4AA 1G4HA 2WJ4A 4Q4HA 4L4UA 2NU9B 5DX1A 3KB2A 3E5HA 4FSHA 5DIFA 1L5YA 4TGLA 4FR0A 1YBHA 4LV5B 1Q1QA 1MB9A 1M6EX 3V4LA 4ZVQA 1N2GA 1H8HA 3QPAA 3T7EA 3EPJA 3GFFA 3LWBA 1WQ1R 4UM8B 2W90A 4CL3A 3WMXA 4CT5A 5BRAA 2UYQA 5A3VA 2EF1A 3CUEF 2IT1A 1IZ0A 3RT9A 4B45A 4ES6A 4I2NA 4UBJA 3I2JA 1GNRA 1DKPA 4HI0E 4B2YA 3BF7A 1ZCZA 3C3PA 3K70B 2Q1UA 7GPBA 5BYBA 4JWTA 1YS6A 3OETA 2B30A 4TV9B 4C22A 3QKSA 4JYZA 2JJQA 1DRVA 2POCA 5JRDS 3N6VA 4AAYA 2WIAA 3OQVA 1ZONA 2ZW9A 1G5FA 1R3DA 1UMBB 3Q9LA 4NZ9A 4PYKA 5LFAA 1E9EA 2NXNA 2AB0A 3ZHOA 3B52X 3JWEA 2XGMA 3DTYA 4HXYA 2W7TA 1WF6A 4JP1A 3I39X 4CETA 3ZD7A 4PYMA 1T5SA 2FR8C 4UJ3A 1F0KA 1EVJA 1XZEA 1MO6A 2VHXA 3DBIA 3ZIAD 4UOZA 1TM7E 2LDXA 1C9NA 3AF5A 3G8DA 4S12A 5DBOA 3UJPA 1TMOA 4E3ZA 1QOZA 5AW1A 3SHWA 3VR0A 2YBEA 3ECAA 1NY5A 3KELA 4HN2A 4LXTA 3Q2OA 4Q15A 4BLUA 3U0VA 4GKJB 4UMVA 4YN3A 2ZJOA 3UEOA 1UKVY 2F7SA 1LNQA 3NRCA 4LY3A 4A9AA 1IUOA 3DM5A 3EMBA 3FTEA 1H5QA 5TS2A 3BFXA 3PFNA 5TPWA 3RANA 3F96A 2HJ9A 3TI9A 1L2TA 2FN7A 2P7IA 4TZ6A 1JEJA 1VPTA 3EULA 3IB3A 3IEVA 2PGLA 4RD0A 1TIBA 5A3SA 1DX6A 4BIMA 2FEOA 2PL3A 1U7HA 4ZZ1A 3U31A 1ODFA 5F9MA 5BVHB 3O8RA 1L5MA 4IHQA 4FOOA 4PE5B 4Q3OA 1Z08A 2YS7A 4Q9DA 2V3CC 3RVNA 2C96A 1BE8A 1N9ZA 1LPMA 4ZVMA 1IC6A 4PAOA 2P9EA 4X6LA 3T3GA 4R81A 4QJBA 4EGSA 2A9RA 5JD4A 3CB2A 4E0BA 3U6BA 1CUEA 3K30A 3ZVLA 3LRXA 1C9JA 4IRXA 3TZBA 1AZTA 1H4TA 3KOOA 4RF4A 3R77A 5KJFA 2X7HA 4JVSB 3TRFA 1A71A 3BB4A 5EKTA 2W00A 3SCZA 2VHQA 4GXNA 3PLAE 2OORC 3DBVO 4RLSA 3W8FA 2AOUB 2C1ZA 5MN5A 3H13A 1R9GA 4YO7A 2WZDA 4YONB 1AF4A 3PE4A 4QSMA 4UUOA 1P7ZA 3FNBA 2C92A 3H4IA 5JSQA 2VA8A 2BFFA 2L18A 2ZT5A 2A7XA 2C31A 4OYYA 2O8DA 4JAVC 3GCDA 3RYFA 1ZOSA 3P45A 2O2HA 4WIAA 5HKAA 1ZAKA 4BX9A 5LC1A 2K7ZA 4H7JA 1NVAA 1NJGA 2GVZC 4MDYA 4X61A 5ICCA 3RVSA 3QX3A 4LF6B 3A4YA 2VHWA 1RQNA 2YOHA 3DBLA 1YIAA 1C4KA 1G19A 1LQTA 2IU3A 3BG5A 4LJYA 4OD0A 1OC4A 5DMXA 4AZTA 3HFRA 3TR6A 2G9VA 1AGYA 4M9SA 1HT0A 4G0YA 3EGVA 1J2JA 3RFUA 3WL4A 4EHHA 1Q95A 1N5KA 2SCUB 1NWCA 1TC1A 1ZMRA 4HXEB 1IQRA 5DW0A 4MS3B 1WOYA 3B48A 4CTMA 5JMOA 5K01A 2PX2A 1EFAA 2QL7A 3FBTA 4ARBA 3SFVA 4W8GA 3G0CA 2V9PA 1VYVA 3JR7A 4PLTA 4W7SA 2I67A 3NPMA 4NV3A 3I6YA 4JLWA 1GZ5A 5A0FA 1WUIS 3S29A 4R1QA 4R71A 4L9AA 4JI4B 4QNNA 5CEJA 3FYTA 5CRIA 4CR6A 1GFZA 5JS1A 1E3TA 1E32A 3EZ6A 5BXQC 2WHRA 1SUWA 1PW5A 4FW9A 1SMKA 5C1PA 1IIBA 1CP3A 1G5TA 3ZHSA 3I5XA 1N9GB 4N6NA 2FUNB 3IDOA 4WVFA 1NPYA 1GKUB 1DJPA 3ZWNA 2ZATA 3BRQA 1T25A 3AHCA 4YXWA 3V8BA 1RDFA 1OXBB 2O0KA 1E6CA 1NFFA 4PV7A 4NDZA 2C5GA 1V7CA 5CA0F 4PLZA 3RAJA 2WIFA 4JLNA 3OX3A 3TLEA 1QE3A 2V58A 1DG9A 1EX6A 4FN5A 4OM8A 1NJSA 1PU2A 1ZWLA 2I6XA 4F56A 4B4OA 1CHDA 2VT7A 3TQHA 1SQSA 1XVTA 3F73A 3D3NA 3IODA 4O0LA 3ZJYA 4ZJUA 5BT9A 3O2QB 2PIAA 4DWJA 2HBYA 4TYPA 5IU6A 1O97D 2I76A 3TEMA 4UKDA 3H11B 5ICSA 1JJBA 5AT1A 1PLLA 1SXIA 2VP5A 2GRJA 3PC8C 3GT4A 1XQ6A 4GXQA 4QYMA 3SK0A 5FH9A 3OJEA 4C4ZA 1ZR4A 4PNHA 3R6DA 4LYYA 4I6EA 4JS0A 3UAXA 1FTNA 5I4BA 3R40A 1ZHFA 3MWEB 4WMLA 4U9UA 4IIJA 4DUZB 1QF7A 2YUIA 1NUUA 1Z7GA 1U7PA 2X1MA 5BQXA 4DV3B 4BO0A 1ZISA 4PGHA 1KR5A 1A72A 1W9MA 3BK1A 3B6KA 3NP7A 1KFJB 1B2RA 1NX9A 2IFTA 4GLLA 4LOAA 3ZS9A 3UB2A 2WP8J 4RD2A 1G0NA 3OQ6A 3EIEA 4AY4A 1EAMA 4BB6A 4TKVB 4QRHA 4US1R 1Z62A 4MAMA 5KQSA 1K89A 3GEDA 1BS1A 4QYIB 4EKYA 1XL1A 1PNRA 1L5KA 3PEYA 1LDGA 1H3FA 4FINA 2QVLA 2Z98A 1G8KA 4G0MA 1JE0A 5CK4A 4ZOLB 4EI8A 3Q8KA 1S02A 3G2KA 2IP1A 5B55A 1ZD3A 3JRWA 2PE5A 4CKBB 3ZJTA 1CY1A 4GGPA 3RW9A 2QZZA 4K5QA 2I1QA 4MRRA 1WPQA 3QYFA 2HGZA 3CISA 2J5BA 4B6SA 2VP9A 1U3FA 4HY3A 1QYVA 2FKAA 2AKYA 1OB2A 3FPLA 2H1VA 3LCUA 3O3MB 3OEHD 1FP4B 3NPAA 4IXNA 3HG7A 1EQ2A 5E95A 4AVYA 4H9GA 2GAOA 2QAGA 3LA8A 1LV7A 4I5IA 2V65A 4YRRA 4DT1B 2WIDA 2BEWA 2GPSA 1MHPA 1QHIA 3KTOA 3PFCA 2X7JA 4JJFA 2J4CA 4TXJA 1E9SA 1GPWB 1KJIA 2X4DA 1T2VA 2CNKA 3GJYA 1NI4A 3JQ8B 3TSWA 4DG5A 3IXQA 4PHFA 4X6YA 4M22A 3OIYA 1FMLA 2NIPA 1X8JA 3CC8A 4O1HA 4ENUA 1BC5A 4BGEA 4LYEA 2P9TA 3M4XA 4RJTA 1E1YA 2PLAA 4OQXA 2B35A 1ZM2A 3MOIA 4RXUA 3U9LA 1KR2A 3MCWA 4A03A 1O0SA 3KT3A 3IAM6 4Z2AA 1U0OC 5KKCA 1L5RA 1R0RE 4N8EA 1Y3AA 2R8YA 3HWWA 3LWNA 4MRPA 1WZCA 4P33A 1PDWA 3FYUB 4DB4A 1ACMA 2PT5A 2A84A 3VRHA 4NU0A 3KKNA 1NR7A 1EWRA 5A3RA 3GJRA 3CLSD 3GFGA 3IEKA 4UHCA 2ZWAA 4UU8A 2MSKA 2CSUA 1WXDA 4BEJA 1ZOPA 4OAPA 2PZAA 1XXHB 1T9AA 1I7QB 1W36B 4D02A 3AM1A 3I2KA 3CLKA 4Z6KA 1GQYA 2A0YA 4O2BF 3O1LA 2K2WA 4CM9A 1TJYA 3T94A 2XWSA 4WZZA 4H4EA 4WOKA 2ZAMA 1DQRA 1GA1A 2AQHA 4EB0A 4YCBA 3GRCA 3TNFA 4XZ3A 1TFUA 4F6CA 3J80A 4EUFA 1N2EA 2OV8A 2JHAA 1X2BA 1E79D 1CUXA 2V3WA 2I71A 3BD7A 2XNDA 3D3EA 2HDHA 1Z18A 2O3SA 3R3UA 4G1BA 4M1EA 3NB0A 3EDYA 3QHAA 4PQRA 4QNMA 4RH1A 4WXPA 3UCEA 4P4SB 1I2DA 1DQNA 3MWYW 4JT9A 1I51A 1AMNA 3GGSA 1IEWA 4OSPA 4YDSA 2EKPA 4ZV7A 3RBXA 3UMGA 2ODTX 3QKIA 3UKDA 1P19A 2JH8A 3Q41A 4P4NA 2X2OA 3FJOA 1SXJB 2R1ZA 1LDMA 3RDPA 2BKXA 1P1FA 2OO5A 2XUZA 1G7SA 3B1FA 3I61A 1OASA 2YS6A 1OPXA 5L7YA 3D6TB 1L7EA 4ZI7F 1A8UA 2B61A 3ZCVA 1UPTA 3U60B 1B6GA 4NZOA 1SIWA 3I9V6 4P31A 2QA5A 3K09A 5JDIC 4IV8A 2MCFA 3RBVA 4ZDWA 4MKHA 1QDEA 4HP8A 5IT5A 1CUYA 4G8DA 3WMWA 4ZKDA 1KSHA 1P6QA 2GXUA 2J7PA 1EBUA 2ZJ2A 3EIQA 3O2JA 5T4FA 2GLXA 4LGYA 3QI2A 4QREA 4CTJA 1WZEA 4Q66C 3TZ6A 3L02A 3GRAA 2A14A 4L8LA 4MCJA 5A0TA 3LBHA 2IV2X 1C3XA 1L4EA 3W0LB 1O95D 4K7JA 4TMYA 4OH1A 1XI2A 3F6PA 2XA9A 1D0VA 2X0KA 4CEHA 3E1SA 4FGLA 4EKEA 3EYWA 4C7VA 2NVUB 4KLRA 5F3DA 5JQGB 1AJEA 2YZ2A 2NADA 4PBRA 5EWJB 3G7NA 1NSYA 2AQIA 1NMQA 2RGUA 3HWSA 3L0OA 3NHMA 3RVKA 2CJXA 5JZOA 2UXBB 1CUAA 1U11A 2EKBA 4TS4A 5EINA 5EQJB 2BGKA 3FYCA 3OP4A 5LP6F 1FFSA 4BP8A 4TV9F 1MPTA 1N1EA 2JS7A 4OKIA 2VHJA 3BVPA 5BY2A 5F4ZA 3ZVMA 1PCXA 1GADO 2EW2A 3DLTA 2WJWA 4BNHA 3R20A 2JIMA 3O03A 1T8YA 2GT1A 3C6KA 4HUJA 4JP8A 2F2TA 2Z4SA 4ZDJA 1PT7A 2VP6A 1FNSA 2AEFA 3N7TA 1EFVA 3DO8A 4OXIA 4X3CA 4Z4CA 1W6UA 1HWYA 3JRNA 5AW8A 4ETIA 1NXOA 2MSNA 3I6BA 3MRTA 1E3LA 1A9XB 4DA8A 3MWLA 3QMVA 4A0RA 2DU8A 4DLWA 2E87A 3IQHX 5BURA 1JEDA 4L5YA 3ULKA 3CT4A 1FMJA 4QARA 1D5WA 3X44A 3DCIA 2H2GA 2WIKA 3LUCA 4O5AA 5TARA 1HDYA 1S0UA 1RAFA 2G06A 3BQMB 3PXBA 4PBTA 3WNBA 2MSLA 3KOYA 2VJYA 1LDBA 1P5RA 1YS7A 5I7HA 3FPBA 1KVSA 4DA6A 4BZPA 2IODA 4DIUA 1EJBA 2YQ4A 1EG2A 1NVBA 2WSLA 16PKA 3CZAA 3KB1A 3N07A 3N59A 3W06A 4B82A 4BJ5A 4BC1A 4D99A 2ONZA 2ZUTA 4EG7A 1ODKA 2ZUEA 1QCCA 2OCYC 1XHEA 2O2YA 1S2NA 3CKMA 3FRHA 3NGLA 3ZE2B 3K9NA 4MRMA 3CPEA 3SS7X 3ORHA 1NFQA 2VH2A 5HFNA 3A1UA 1NW8A 4BN5A 4GSYA 1U28C 2QDKA 4MRSA 3RFTA 2WTXA 4Z3OA 5CLLA 1XKXA 5DMHA 2XGOA 1LSSA 5DI3A 4EYGA 1DIBA 5AM5A 2CHQA 4LHVA 5EPEA 4DTIA 3THSA 3KYBA 3VGPA 3DYBA 2X4GA 3W3AA 3LY9A 4TTIA 4HZGA 4PYLA 1GXSA 3SI7A 4GPAA 3QNUA 1U8CB 2ON6A 1OFIA 1U2RA 4IPTA 5DNAA 4XEHA 4AD8A 3RYCB 4QPDA 1XZNA 4HDSB 4RA6A 2DP4E 1CVRA 2KWIA 2OAQ1 2ENWA 4ND8A 3T1TA 1Q7GA 4A91A 2J3KA 3H8VA 3JTEA 4HQ6A 3QX8A 4FMBB 3T1HB 2RHLA 4I8IA 4BB9A 4LDJA 4ZO6A 1F8GA 3H86A 1R8YA 2HU2A 3MIZA 5J63A 1VA4A 3D43A 4EJ0A 3L4KA 4ZU6X 4YXWD 1CRLA 1FRFS 2OCBA 2WUGA 5ALUA 2W6JD 3SFTA 1QKKA 1DIRA 2D7CA 1MFZA 2HADA 2O5CA 3NKVA 3AB8A 2ZSDA 3GFSA 5IABA 4TKMA 2F3RA 4XFJA 4OHVA 2G28A 2JHPA 3GY0A 1GUAA 1U65A 4BWVA 2JGDA 3THXB 1G1MA 4F8JA 1U3GA 5J4LA 1FTGA 1NKVA 4ARSA 3NS7A 5IKPA 3LTNC 3LQRA 4LWPA 1G20E 4NJMB 5LSAA 5K8CA 1JHPA 3EVAA 4B7UA 2WA2A 4P3OA 2PO7A 4N7BA 5EP1A 3TW8A 1DVRA 1Z34A 2H51A 3OZBA 4AP9A 3MGAA 2QPAA 2R87A 4PAQA 1IUKA 3AUSA 2FPIB 4MLDA 3KSUA 4E33A 2YFKA 1DELA 4WCFA 5AJVB 3JZAA 4WK2B 3WQSB 1S7GA 2VYNA 3DL4A 4LWQA 2QWXA 2ANCA 4I4TF 5G1NA 5A9SA 5J2UA 3AW8A 3CNLA 2ZCVA 4UD2A 3WGOA 1RYBA 2XF8A 3IIKA 1OWOA 3DONA 4LBZA 3GJ7A 3PGJA 3SZLA 3VM6A 1Z0SA 4BIIA 4Q12A 1F4VA 1RFGE 2YNMA 3BHNA 4K6HA 3VZPA 4MQEA 4ZTUB 2CXOA 3KO8A 1HQYE 2YN0A 3LGAA 1QQ5A 4JVNA 3M4NA 2CNLA 1EVIA 3D6VA 3OOWA 1SXPA 4MP3A 2PYIA 3REQB 1C9DB 3LW7A 1YR1A 3ZI0A 3ZWCA 3ACBA 3N8HA 1SVNA 1ZVVA 5TGZA 4PF1A 4G5SA 3S1AA 4AWBA 5HKKD 2P6NA 4YDRA 4LZWA 1DIGA 4LDRA 4K26A 2Q3LA 5EXEA 4F0JA 1X8XA 4RKYA 1EEHA 3HM9A 1Y8ZA 3F5SA 5JFTA 4D43A 3QUQA 1XNRB 1Q6ZA 2VDMB 1Z5WA 2GO1A 3IPLA 4Y9UA 1DU4A 3K9BA 1TRHA 3R24A 4DPKA 5L6MB 1I7NA 4R5HA 1RABA 4HWTA 2P3SA 2QU7A 4Q1AA 5A2GA 1DTWB 4MS1A 4Z8YA 5U4QA 4RF3A 2EATA 3JAWA 2O4CA 3V2HA 3EEOA 3E4CA 1NN5A 1KQPA 4CM4B 1LI4A 2C5SA 2GN6A 1ISFA 5HIMA 3UJ7A 2JBAA 3CMMA 3D0QA 4IRUB 4QJIA 2I4OA 1KK2A 4RELA 2W11A 3ORFA 1U1IA 4W8OA 5EIAA 3IV6A 5LB2A 1YCDA 1HTTA 4F2WA 1JU4A 1AA9A 2OC4A 5EZ6B 2DLCX 3W5DA 4R9SA 4X24A 3D7LA 5DBEX 1THTA 4L76A 2HT1A 3LM8A 4IHKA 5CD9A 3BIFA 4IZOA 5AVWA 2J0QA 1E0SA 3L7KA 3KYJB 4KXXA 1BVYF 2H85A 1N5MA 1EK1A 5AHWA 5I7VA 2YJ4A 1PDVA 1YSCA 2PWAA 2VWGA 5L3RA 3VC3A 4BB0A 5ADUS 3BXPA 3CVYA 1K8YB 4TLCA 4Q7EA 4L4RA 4DLYA 3CXRA 4PPQA 3PTLA 5BW5A 5LPNA 4DRXA 2IXTA 3PT9A 2C7PA 1T4CB 3HJCA 3WBFA 1T2UA 4N3CA 1D7AA 5KYYA 4B3XA 3QXXA 1DZIA 5SZJA 3ZQUA 1AV6A 3DV0A 2R8RA 4EG1A 4CM9D 3EPHA 4HEJA 5FX2A 4Z1MD 3SC2A 3NBXX 3GLFA 3U3JA 4A2WA 5CAEB 3EWIA 1AZLA 3ZX5A 3NLLA 2J9GA 3N8GA 3UUWA 2QTVB 1K6JA 3FZYA 4C4SA 4Z1OA 4KQXA 4BNMA 2XNDD 1UPFA 4WEOA 3GLIB 4C30A 3G9XA 1PS9A 3KXPA 4RFSA 2D1RA 4X00A 3W3AH 4AJOA 1XWIA 1Z8NA 4KV7A 4EJSA 3QEAZ 1M5UA 3C70A 1RI2A 4HNRA 3KJQA 3FHLA 4AMYA 4F3YA 2OSVA 7MDHA 1EK6A 1OW3B 4EQZA 4TMTA 1YH3A 1U0LA 2C58A 3H84A 1LJUA 3HY4A 3S2ZA 2QG6A 4XGQA 5B1IA 4HVCA 2VDWB 5JCXA 3I4LA 2G5GX 4TYQA 1C3OB 4RVFA 1XTBA 4YXFA 4Z53A 4FYIA 2PBFA 2NSHA 2K2QB 5GVRA 1US8B 3KJZA 1WDLA 3FUUA 3GRYA 1HKHA 2JC3A 3IEUA 3NEPX 4BMSA 1RZ3A 1K86A 2Z2ZA 1A9ZA 3RNLA 3OQMA 1N8TA 1B26A 2Q99A 4PXAA 4WXHA 4TZKA 4QJ3A 1XLTC 2HPVA 5FWNA 1NM5A 2HWKA 2FFJA 2WR8A 4K2AA 1ECFA 3ZUGA 4EAQA 2OQ2A 3H97A 1J7JA 1GHTA 1P39A 2IYUA 5I9LA 2PNFA 3ELYA 3JYLA 1UJ2A 4AF6A 3EDCA 1YULA 4OQYA 4L3WA 2IYTA 4KWCA 1BRMA 3A4LA 1U8EA 3W4IA 2FSVC 1MZPA 2WWFA 3JY6A 4BCDA 4NSNA 4XPIB 3TEJA 5BN5B 4KQGA 1JMKC 2QW1A 2ZM6B 1WZIA 1T9BA 4Y1FA 5DTRA 2ZAIA 4WOBA 4B8ZA 1B42A 2WAXA 1EM6A 4DQLA 1E9DA 2NO9A 1VE9A 2YZGA 4L8YA 5K0BA 1XO1A 1TEHA 3GLUA 3WK5A 1U02A 2KHZA 3N2KB 3E05A 4BGDA 3VKWA 5KSYA 3CY6A 3LQ1A 3IAFA 4X6UA 1VMDA 1YK1A 1AKVA 4EMBA 4YPOA 4MQLA 1AA6A 4N9WA 1QIJA 1SWVA 1DAMA 2ESRA 3PUKA 3T95A 1BVUA 2YFYA 4ALMA 3IEMA 3ANNA 2X0DA 1IK4A 3ZHXA 1J5EB 2FSIA 1G59A 4FCTA 4OUKX 3EWAA 2Q5IA 2QTTA 3GNSA 4P7GA 3W4JA 3UMFA 4GMXA 3SJ7A 3M3PA 2H7XA 4F2GA 1GRVA 1QRRA 2E3JA 3C41J 4IWNA 3OFNA 4QEKA 4UVEA 4Q02A 3SEZA 4R1LA 3C15C 5HQJA 4NENA 1PR0A 3RU7A 1FS5A 3OLQA 4K88A 2JLQA 3D1VA 4YB8A 2X40A 5DM0A 4XSGA 4OJKA 1EFTA 2PH5A 3G2QA 4C0AC 2P77A 3A6DA 3P2IA 1ORDA 2PMEA 3R5FA 1ZYUA 3WRYC 4RHFA 1IAVA 2IYWA 5ES4B 5LXTA 1H9CA 4BBJA 2QMZA 1G21B 3AINA 3IT3A 4F3TA 2XE6A 4MWCA 2F1OA 2G5CA 2RMKA 4HH4A 4PU0A 2ID7A 2UYCA 1G98A 3F6BX 2IH2A 4HAIA 1ZSYA 3U49A 4PIMA 1P9RA 5I7SA 1SZJG 4EPTA 1D04A 4P22A 4B3IA 3ZYZA 3E6AA 3G6WA 3LT4A 4LI3X 4B85A 1TQDA 1RJFA 1VI6A 2BFOA 4GR9A 4PLFA 4U02A 1QHGA 4WTOA 4LGMA 3HCFA 4WZAB 3MCTA 3EWSA 4HNVA 1XWFA 3ZU6A 1D6SA 1JTEA 1VJTA 3B6ZA 3UWDA 4Z4FA 1P9OA 1EYZA 3AEKA 1SCIA 4LVUA 5CGZA 3RSOA 1E9VA 1Q0RA 5TGTA 5IXJA 3T34A 3H9UA 1RQRA 3B9RA 2PWYA 1ZGJA 5CCXA 2IEAA 4DQUA 4NPHA 4C4YA 1JF8A 2W8BA 2BIFA 4H7IA 1J25A 4ZT7A 1ID1A 2CMGA 3HFJA 3QVVA 4GYWA 4M0MA 4YDHB 3W05A 3DG9A 2LE0A 4V02A 2Y1KA 2D4AA 4NS4A 4F4UA 3ZLJA 4Q6BA 3IUMA 2BGGA 1RT9A 2ZTHA 4EY8A 4L28A 1I2AA 3HB0A 4J1TC 5KQPA 4R1OA 4O4JB 4LEIA 5EIFA 3UK1A 3IVMA 3MB8A 3QU9A 1B00A 1XTPA 3NBUA 4KIGA 4EB3A 3NG1A 3C45A 3PWSA 1WY7A 4L0QA 1EX9A 2NQTA 1PRYA 1XKQA 4KR2A 2ZANA 3D02A 5A7HA 3GA5A 1UT5A 1ZD4A 1TB4A 1U9ZA 4LHEA 1SA0B 2OQVA 4ZVLA 3PUWA 1E5DA 5KHAA 5LR6A 1OIXA 1VC2A 2HDWA 3FGNA 3PPYA 2OECA 3NH9A 1ZESA 2H4WA 2QRJA 3IUPA 3NHWA 3SSOA 4DXAA 2BFDB 4FB5A 4D0GA 3FA2A 1VSBA 3EXFB 1FJ2A 3D7SA 4RD4A 3CBQA 2EJVA 3NTVA 1D4AA 4RMIA 4HWGA 3ZH9B 5IAOA 1TKBA 1QIKA 2EFEB 5C52B 2JAUA 4AT1A 1KRWA 4CM3A 4LDPA 5JDCC 2NSLA 1QIFA 2PBRA 4UARA 1NYRA 4KR6A 2WIBA 2DWOA 2BZGA 2ZIEA 1V1MA 3ND9A 1N9KA 4V24A 3F6SA 1YR2A 3OZ7A 2FUG1 4KQEA 1R9NA 2NV0A 3G3EA 2IE0A 2BFBB 2G72A 3HLKA 1KFBB 2B2XA 2CLOB 4MYSA 4EZEA 1QFXA 1FNNA 4KN6A 3KKPA 1FDOA 1YU6A 1HKUA 1H2XA 3RG2A 4B9AA 1ESDA 2CLEB 4J6FA 4EA8A 1AGRA 4ZAYA 3AERB 1QKJA 2F17A 2Q41A 4F97A 4QBGB 1JS1X 2MHCA 2OQIA 4B75A 4ANFA 2FMTA 1R37A 5F7ZA 2R751 4RD1A 4O2AF 4WBNB 1XVIA 2ZE6A 4YRIA 5JFOA 4Z7QB 1T35A 4IG4A 2FN3A 2A67A 4YGXB 1OAKA 3HC7A 4BNVA 3BWEA 1C3EA 3M6LA 1KQGA 4J4BA 3ZV7A 4PGGA 3QBJA 4H35A 3WGZA 3ETNA 4LX0A 2PXXA 2Q21A 3DB1A 4IIEA 4ND2A 2Y99A 3CRMA 4WXRA 3DTTA 4M55A 1C9MA 2FA9A 3A9CA 3PHCA 4MVJG 1LKZA 2VZ9A 3PK0A 3DE6X 3IUBA 4GUAA 2WYVA 4NYJQ 3LY7A 1XX6A 5BMVA 5KYWA 4XWOA 3TAUA 1FJXA 3H5OA 3C1UA 1YMVA 3K15A 1K68A 3L7OA 2O0LA 5E9JA 3ROFA 3TQOA 3VKFA 1S1CA 2P9YA 3OUUA 3QU4A 1OU0A 4XM2A 3TR5A 3C7DB 1ADGA 1BMTA 2C8LA 4RPHA 1TVEA 3EHDA 4TMKA 3EIUA 4XEUA 4EY3A 1O2DA 4M54A 1GUZA 1VXRA 1R12A 3P0RA 3D4NA 3DNMA 2L42A 2WTBA 3B38A 3AI2A 1LX7A 4J0QA 4EUNA 2G4LA 2HPZA 1ES9A 5DJ5A 1A5BB 1Z4MA 2EFHB 2XT9A 1EUDB 2X4IA 3SC6A 1J5XA 2CL7X 5DYNA 1BW9B 1XKTA 4EZIA 4HH0A 1AIPA 1OYWA 3LUDA 3T4UA 3MINB 2PMCA 2BBWA 2AQKA 3TZHA 1IY0A 2Y0EA 3DOFA 1SVWA 2XTAA 1DOHA 1WCYA 3DFUA 3K1ZA 3GRKA 3INGA 1UQRA 1A8QA 1N6RA 1R88A 3ZV4A 2CXNA 2VAPA 2BZ1A 3GRPA 4FYJA 5IS2A 1LBHA 1TAHA 4RQTA 4GQIA 2GM3A 1TUGA 3IBGA 2TSYB 3OZIA 4DW8A 1WUKS 3CVJA 3THYB 2J3DA 4QLOA 2LXNA 4CIDA 1JQDA 4RMJA 4WNIA 4XLZA 4GGMX 5GM2A 4RVOA 1T9CA 1P62B 4OXRA 3HJNA 2FQYA 1LDYA 3FGPA 1HDCA 2CLLB 1NBMA 4KSCA 4OSEA 3ZKAA 2C2YA 4FCVA 4JZYA 4Q3DA 1WVMA 3FSGD 2KX7A 4L57A 1KY5A 4LCEA 4E5PA 3UOWA 2XX3A 1J2YA 2GJAA 2EKZA 3WADA 1B4DA 1L3BA 1DQYA 1L7QA 3WG9A 2YWDA 5JSKA 3VVMA 3TGWA 4Z4EA 3TJZA 1E77A 2QMYA 2O8EB 1K6EA 5E1OA 4V1CB 3HBNA 2H52A 1WVGA 2FW7A 1OAOA 4RK6A 2HGSA 4IIDA 3RYHB 4ETMA 5GQSA 4MW1A 1IUPA 4RVHA 5JCOA 1NAIA 3H1TA 5BP7A 1YQEA 4ITRC 1S4MA 4LBYA 4CG3A 1YR7A 4KIFA 1Y8QA 1R4NB 4RDIA 4JI0B 1FVXA 3FF4A 4GNRA 4NK5A 3BHIA 3WL6A 1JLKA 1J49A 1ADYA 3FPJA 3DWEX 4ZI5A 3GFOA 2AC7A 2P9FA 4X44A 1M74A 1D6MA 3BX1A 2XCLA 3FPEA 1MVLA 3R8CA 4DG9A 2XNSA 3E84A 5E4YA 1BXGA 2ODWA 3TW4A 5JBIA 3CVUA 5A6SB 4PNPA 3M6VA 3N70A 1GSIA 4G5YA 2LGJA 3DFKA 5C0OE 4K6FA 1TF5A 2QQEA 3K16A 5IDYA 3ZK8A 4IDBA 3KE9A 4KWIA 5ALSA 4AY5A 5A4KA 3I01A 4CMBA 3I28A 4F1WA 4U6NA 1G6Q1 3KVYA 4TL6A 4ZTBA 4QU9A 3GWZA 3U4DA 3O8CA 4YAOA 2HTEA 3VNBA 1KE1A 3NHYA 5CG1A 1ESMA 2DQKA 4IHJA 4J43A 2AJTA 2PEYA 2WJZB 2YHIB 3A9SA 3C1TA 4FKBA 4IEFB 1HYBA 4WFQA 1N1GA 1PHPA 5B7PA 4S2EA 3HPRA 2QDXA 1DARA 4FGUA 4K8RB 5IAEA 3L4JA 3SSAA 2H6EA 2R00C 1U2QA 4EHLA 2DM6A 2OMEA 2ZJ3A 4N5MA 1JQ5A 5EWLA 2JHFA 4DJEC 3A1WA 3PHHA 3OFND 3JAKA 2W6PA 5BN3A 5FUQA 2LD4A 2WFAA 3G23A 2MIIA 1FQKA 2ARKA 3KPVA 5UKDA 3STUA 5CTJA 1FQOA 3NNDA 2J09A 4LFBB 3QLUC 1XAJA 1PEDA 3QQ5A 4I99A 2CVOA 1SEVA 1LFAA 2H4XA 3A4NA 1CUCA 2J6BA 5DB4A 3NHAA 5ICFA 4HVAA 3W77A 5JD5A 1RRMA 1XROA 4U2GA 4YX9A 4M8KA 5IASA 4Y9RA 3RS7A 3PQ4A 4YGYA 3HNRA 1YWGO 1A7AA 1R0SA 4YJ2F 2CFSA 4KFUA 2I65A 4NV0A 2VRCD 3E53A 1C1DB 3U81A 4BE9A 5KWIA 1KIFA 1TKRA 4HAYA 2HRBA 1XVAA 1VDMA 1V2GA 3BCSA 2IK8A 1T0HB 4IDQA 3S8YA 3HXMA 2Y9PB 2B1IA 3EMDA 3GUZA 1YC2A 5IAGA 1ISMA 2H11A 4OI1A 1MQAA 3A6HA 3ZDZB 1YRBA 5DHTA 4B3HA 3K1JA 1MO4A 3ROPA 4FEAA 3TIVA 4HJXA 2ZT7A 5KNLA 2VF2A 3ESBA 4JU8A 4YMWA 1GTL1 3UICA 1VDZA 1YVDA 1SHZA 3GIWA 1P8JA 2IHYA 2J41A 4A92A 4CFZA 4JKIA 2W6OA 1QH1B 1WM1A 3JQDA 3ZLBA 4ZAFA 1V11A 3IBTA 1SBYA 2FU5C 2GZHA 4RVSA 3IRUA 2A6PA 5DNVA 5AVSA 4ZKEA 3PDJA 2CW5A 1EE1A 4IS3A 2R1TA 3CZ9A 3A7DA 4H6VA 1S2DA 2VK8A 1OYOA 5CPFA 3FCCA 2I55A 521PA 1WETA 1A96A 4ZQFA 3ZE1B 5FUXA 2QZJA 2NU9A 2XZTA 1GQRA 4KMOA 4P7JA 3AETB 1PJ8A 4D8WA 1FRNA 1RQ2A 1G5QA 1ZD8A 2GFIA 1D9XA 3VYTB 1EXWA 3KM0A 4J16C 4KO4S 3JQ7A 1P2TA 4EA9A 1Z74A 2XOKA 2G36A 3BGWA 2Q6OA 1XALA 3O3OB 4K0KB 2PVSA 4KGVA 4MPTA 2VSFA 1KYQA 4ABTA 3BD9A 1RLTA 1NW9B 1SVLA 3Q7IA 3O4FA 4OHBA 2HD4A 3HU2A 3LCVB 3U1TA 3QHQA 4CEJB 3NALA 5AK5A 1T34A 2VFAA 3PQEA 4I4NA 4OGWA 4R1MA 4OHRA 4LRUA 5AJTA 1LBTA 3PNSA 3CO0S 3RLFA 3ED1A 1GIAA 5FWAA 1OVMA 3LT0A 2XMRA 3SM9A 4P5EA 5ADVA 5FTNA 3IKJA 2ASVA 2B4AA 1JBEA 2G63A 2EYQA 2I34A 5HM6A 1UMBA 2ZRIA 4TT8A 2WB4A 5ALFA 2UXDB 5EP3A 2MYTA 3GPBA 1V4BA 2R47A 2G3YA 2QUHA 1OH5A 3EXHC 2H65A 3UO8B 2O7VA 2W71A 1QNLA 1U1GA 2DR3A 2Y6VA 3VMMA 3IL2A 5JYDA 3UCXA 3FN4A 4M76B 4B48A 3RM3A 3ZGVA 2JNWA 4LYJA 1U6JA 4ZJYA 3O9VA 2L17A 2J87A 2EAUA 1IZYA 3GL9A 4J0GA 3M6IA 5CPBA 5A5VA 4RL4A 5E4FA 1WXEA 1PN3A 4JP5A 5TQ2B 1QJ4A 1Z0FA 2KBFA 2R85A 4XLLA 4YRDA 4Z7JA 4KFCA 3W8RA 1DEOA 1JVNA 4BLOA 4P3NA 1AF7A 3KQQA 4MDHA 4DE5A 4NCIA 1APBA 2GPJA 1DKLA 2Y1OA 4OGLA 2R8XA 1I5RA 5G1PA 1P4SA 2PA0A 1KEKA 1SCUB 3GEEA 4IDGA 4OMFG 3E3AA 3CU5A 1TO6A 3OFSA 1J33A 3SZMA 3GFPA 2P8SA 3HEAA 4MIOA 4P4TA 5CNJA 1I01A 4KP7A 4HZIA 3HE3A 2FG5A 2HJGA 3V4OA 4XRGA 2Q3MA 4MZXA 1PJ2A 1UR5A 1E58A 1YZTA 3OE4A 4PG6A 4TL8A 3IMEA 3N8KA 5ILOA 2AFRA 1NA5A 2LCIA 2XRMA 4JLDA 3KE8A 4N47A 1QF9A 5H7XA 2GCOA 1LEHA 1PZEA 3OF5A 2BFEB 2EQBA 4DCGA 2AMLA 5DXFA 5EERA 1MRZA 4JXKA 4G0PA 2CFCA 4GDMA 1X70A 4G25A 3RS3A 3H1PA 3ZDFA 2FW6A 2AN1A 1U1CA 3DQQA 3W6OA 1QG2A 4CVNA 2ZREA 4M1WA 3O8LA 4JODA 2KS6A 1O4VA 1RC1A 3WJAA 2QXYA 1HYEA 4YRGA 4IR7A 1I1OA 2OFFA 4O02B 1TMYA 2FSFA 2HRZA 4EL0A 3KJXA 4JXJA 4YRZA 1RTKA 3P9YA 5EMLA 3ECCA 5FI5A 5L3SA 3QGMA 1VCMA 5IT4A 5F1KA 3W2IA 1SZPA 4UQPA 5D1NA 1VBMA 4IDHA 4U5XA 4RTMA 1VHTA 1R6BX 5CH5A 3UT5A 1YB7A 4FSXA 1U6IA 2BBOA 1PUXA 1OLOA 2DZDA 1CS0B 3PYXA 4DDWA 1MGPA 4INOA 4NWIA 1YNOA 2JCBA 2V9ZA 3AL2A 2XBUA 1OBCA 1Y6GA 4P3PA 4OX9B 3S7ZA 4K0RA 4AZWA 1W0CA 2Y1LA 4KXYA 5EJIA 3X1ZA 4D79A 5FUVA 4KDFA 5K3DA 1D8TA 5JMPA 4BKOA 1L9KA 2CXSA 3QPDA 1FXWA 3CLTC 3DKKA 3TTUA 2OHGA 4C0HA 2W2KB 2YMMA 3VISA 3ZI7A 4G0XA 3JZDA 4YUYA 1KFKB 2Y1WA 5F7XA 3GDFA 3T52A 2A1UB 2VWQA 1C9KA 3GHHA 3MYYA 1UBEA 1E5TA 2BGMA 2I7VA 4C3ZA 3CNHA 4KGZA 3QVWA 3RIGA 4E4RA 3F5QA 4WD3A 1G3MA 1WIWA 4E1BA 3GT7A 4E2ZA 2V4MA 3K0CC 2VJMA 2W2NA 3LFTA 1NV9A 2IBMA 4YO8A 1ZOOA 5DHUA 3OZGA 3ZWYA 1JHMA 1NBMD 1UC9A 1XLVA 3RTCA 1DKMA 2AYYA 2O0HA 3I04M 3FDZB 1T8WA 3L0YA 1YE8A 2WDPA 2B1JA 4NBKA 4L5BA 3RU9A 3W8NA 3HDYA 4MW7A 1IATA 2NUAA 3H4VA 1PD0A 4CQLB 3E3LA 4M46A 2GHIA 1EWVA 1R16A 1AD2A 3CG0A 3RBZA 3N2EA 2PZLA 3QPUA 4OBEA 2Z8ZA 4X63A 4L4YA 3DE0X 1AM4D 1ZINA 1L4YA 4NJOA 3CZPA 3H11A 2XT0A 2VSOA 2X6TA 4Q39A 2BM9A 4RWZA 3ZGYA 3LIIA 1CQJB 2NZVG 4RAQA 1BD4A 1R8SA 1SKYE 4A8JB 1OX4A 2B2NA 4GOXA 4UE6A 4F3RA 3RUCA 5B7NA 4F4CA 1JIXA 4M7WA 3RIXA 1PS0A 1FIUA 1CE8A 4QOEA 2CT8A 3DWGA 1QO7A 4YPFA 3MUFA 1ND6A 4P2BA 1VKHA 4M7PA 4Q9HA 2NTNA 3PR2B 4DV7B 3RTAA 1TECE 5CNKA 3LE8A 4DJAA 2IELA 3W9UA 1T9GS 2YYZA 3GJZA 5LWQA 3QMPA 4TKVA 3KLMX 3VI4B 4YV0A 1A8IA 1GKYA 1KKMA 4BY9E 1TLTA 3FNEA 3PITA 2FCAA 2GYWA 4LXXA 5ERXA 1Y34E 1DHTA 2C2GA 3BWMA 4H1VA 2NUTA 5J1SB 4HATA 3ZGZA 4WWHA 4LY9A 4MI9A 3RFFA 1R5NA 2J0VA 2J8ZA 4B74A 3L7DA 4GPD1 1U2SA 4HZUA 2EZUA 1M1XB 4NBWA 4GR5A 4W8HA 2QM3A 5FJJA 3YASA 4DDUA 2WICA 4XD2A 4C7KA 2BGTA 1PWZA 2G71A 2V6IA 4PSUA 5I8ZA 2C84A 2ZYIA 2DLDA 1DKOA 4L8GA 4S1TA 4Y6LA 5FL3A 1X87A 3IA2A 1ZI9A 2YTZA 5KSPA 1MR3F 2Q7XA 5ABPA 5ALRA 2X6QA 2BP7B 2P5UA 1UBMS 2OY0A 3DKRA 2EGHA 5YASA 3OM0A 5B58T 4S3MA 1QV7A 3AUYA 1N2HA 3OI7A 4FWBA 4ZREA 1Q0HA 1ZX1A 4OI4A 5D85A 3O1JC 3RF7A 4CM1A 2I1VB 4AM8A 4DT1A 2PX6A 3KD2A 1HV8A 5F3WB 2BF4A 2Y4NA 3P9KA 3TZLA 4NCJA 2ODNA 4RZHA 3ABIA 1QB8A 3JQ8A 3HBAA 1XN4A 3DMHA 2ZR8A 3X1WA 3K5PA 4TTPA 2HHLA 5GONA 4ZAVA 2EERA 1M8PA 3WO1A 2WQ7A 4X1OA 1I4TD 2HI0A 3ILHA 4ZEWA 1K8QA 5EESA 2VQ3A 3LKVA 5C5DA 2PRKA 2CVHA 2YBDA 4PHHA 2PUDA 5DLYA 1ZJYA 3SHQA 3KX2A 2HZBA 1X1RA 3FYUA 2FX5A 3MNFA 2XOXA 2QE6A 1R4MB 3PVZA 5G4LA 3QIVA 4G24A 1ICEA 2Q2WA 1FUEA 1Q0PA 2N46A 3FZEA 1FP6A 5K20A 3UFXB 3DEFA 1KYVA 2X5OA 3MTDA 5ALTA 5KNBA 3BE6A 5AVUA 5D7NA 1COWD 3T9DA 4YV1A 1X94A 2O07A 3SNKA 4UBMA 3UAGA 2NPIA 4XJTA 3KOMA 3HYSA 4ZEOA 5MDHA 2OG2A 3HCDA 1PX2A 5GAJA 4TVOA 4URWR 1DBRA 4Q7JB 2NTJA 2PJZA 2WSMA 3CVOA 1H3NA 2DQZA 2W37A 2X0EA 4DM3A 1WU7A 2B4RO 3HVIA 3MJDA 1IFXA 3E2MA 3OZVA 1V96A 3RU3A 2PU7A 2DHEA 4GE3A 4QEZA 1KAMA 4G5GA 1UK8A 3K0EA 4K9PA 1MA0A 1JR3A 4K9NA 2J3IA 4P4SA 4RFVA 1RAAA 3AQIA 3MSXA 5LYYA 3THOA 4MGKR 2ZUFA 1NDQA 4HFJA 2E85A 3AWIA 1CX9B 2ZR9A 3R0QA 4GQAA 1JJFA 2P4QA 3QKRB 3TOVA 1WOMA 4R05A 4FHEA 1V1RB 4K9RA 5FCDA 5L3ZA 5EQDA 3AL3A 1FYDA 1NUSA 2XZDA 4B09A 3P26A 1ANKA 4FTWA 2RAVA 5LKRA 2QRMA 1VIDA 2XYHA 3A6EA 2VJDA 1XCMA 1I5EA 2IEBA 3EHEA 4BQNA 4S0XA 5K03A 2NZ8A 1WMEA 3Q7PA 3EQ9A 3IAM1 4NEQA 4RTNA 3CR8A 2G09A 3O0DA 3N0TA 4RHEA 4XR4A 1E2BA 5C31A 2Z4TA 4YRKA 4Z99A 2H2WA 3SU8A 1P2SA 1TEXA 2W8ZA 5JSZB 4X65B 3P0EA 3OFVA 4MSUA 5KHOC 1EFLA 1YR3A 5IW8A 3ZHBA 4KBFA 3NBAA 3AVOA 4UUQA 1P7VA 5BV8A 1R8QA 3NTLA 2AMJA 2INGX 3KR2A 4W7IA 2DY0A 2RG1A 2UKDA 3N7AA 1VJRA 4C1NA 2NVUA 5JNLA 5JQGA 2OUKA 3R7NA 4YAKA 2N1MA 3IQDB 3JPWA 2DFKB 3H83A 5EWJA 3EISA 4RYDA 4CUKA 1M2HA 1IQUA 3I45A 4QJ5A 5BQ5A 1EA7A 1JR4A 5E1DA 3W79A 4DA0A 3AMVA 3L6RA 1HLGA 1SEPA 5BMOA 3CN9A 3OT4A 4JP3A 1FPQA 3OLVA 3UAYA 4Z9XA 1NJ1A 3VR4A 1IONA 1C7RA 3IAHA 4DBLE 1IZ7A 3G2PA 1E6WA 3OTIA 3PC6A 2Z43A 2GD2A 4GMKA 4W9RA 1K3FA 4XJSA 2RGGA 2BHLA 3NYIA 5AHRA 1YTUA 4IO1A 1IH8A 3AU8A 1Q19A 1NVUQ 1RXYA 1KZ9A 2Q3FA 3T1VA 1GDHA 4HS9A 3WK7A 1USIA 1EJ6A 2R8PA 1FDVA 2WTAA 3KHTA 1AKUA 1A9XA 1KSFX 3PQCA 1MIOB 2REBA 3PEVA 4FW8A 3VDNB 2ZR0A 4JV5B 1CXZA 4A0QA 4O63O 5GWXA 1FUKA 4UTOA 2Q0XA 3WJ1A 1OIWA 1P2UA 3IV9A 3LVQE 4OL0A 1W85B 5BV7A 3I9V1 1D1PA 2V7QA 4MEBA 1B23P 3PWKA 2PGOA 3EY9A 3R76A 1MPXA 4ZOQI 4PC7A 4ID3A 4G5RA 2EXXA 3HU1A 5D3MB 4IF4A 4AWXA 4UDYX 1VLZA 2PNJA 4C05A 1T3HA 2A0XA 1E59A 3LKDA 4YAEA 3C5HA 4DLNA 5DE3A 5BV1A 4G0VA 3OQIB 4X7RA 3A26A 3GJ4A 4OM7A 4I50F 2ZRKA 3ZN2A 1KRXA 3NYWA 2WU0A 1XDUA 4JIGA 2OC9A 1JYSA 2R3SA 4LV6A 4ZA2A 1RMQA 4F7DA 1QS0A 2I7XA 5LJIA 5LOVB 5C3MA 2O8CB 1K8RA 4UC0A 3TL2A 4ZYUA 3ORRA 1E4OA 2AT1A 5CH3A 4LF4B 3SVTA 2B99A 4NU6A 3VSAA 1XRSB 2EDAA 4IVQA 1QHXA 2PEZA 4NCXA 2QNRA 4XDZA 3TIFA 3B6JA 4TZ0A 5GJBA 1PWXA 3AT1A 5I47A 5AI5A 5ESWA 3EW9A 4D3SA 1F2DA 4PYOA 5EVCA 4OYLA 3KETA 3AO0B 3LNCA 1L4KA 2F1KA 4D5EA 3RUFA 3RVMA 2HAEA 1KI3A 5JO9A 1GAXA 1JHDA 1EIZA 4M98A 2VHVA 4OK3A 4EHDA 3V7NA 4WLNA 2YVUA 4FT2A 3ONWA 4HDCA 3L06A 4IQ0A 1R0CA 3RRFA 1XEWY 3CEPB 3LO8A 2P0YA 3PZRA 1YKGA 2M9MA 4HDSA 2FSGA 5DK4A 3RJ5A 2H4HA 9GPBA 2QUAA 4KLZA 2A57A 4P4GA 1QTRA 2Q8PA 2YVAA 5KNBH 4G0QA 3VBCA 2OFPA 1RQ7A 5JSYA 1FPMA 2GD0A 3VV2A 4CQJA 4PTYA 3PC3A 4ZVKA 2AFIA 4YRNA 5BNWA 1FYXA 5AVXA 2J67A 3PKIA 4DUYB 2WJGA 5D3KA 5AI9A 4PBSA 1UK7A 4UZEA 5EGSA 2IIQA 5HGXA 3ZWAA 1MO2A 1MXFA 2O23A 3FHCB 1II0A 1KAQA 4CKYA 4M99A 2N3ZA 4HLNA 1A9QA 4MXDA 1EUCA 3KFLA 5JS8A 1R6UA 2XUDA 3D4IA 3WQQA 2HHJA 1RP7A 5CBPA 1HT2E 4MGIR 3PSAA 5H5JA 2SICE 4FLEA 2NU8B 1H94A 5D00A 4FJ0A 1OKKD 1Q6YA 2PQMA 3MTGA 4QGHA 4DM7A 4TYYA 1CUDA 4RPLA 4X90A 2ZROA 3A3YA 4X84A 5EQTA 5DRYA 5DT9A 4RFLA 4LBWA 5CBKA 3DH0A 1V8OA 2WF7A 1ZD9A 3FMPB 4D3ZA 3P9NA 4M0LA 3BDAA 1ISIA 3ESYA 3GNQA 3BCUA 4JU9A 3AV3A 5DTEA 4OAOA 2BBTA 3LUAA 3U61B 5ECYA 2J0UA 5HIIA 1H2HA 2CXHA 5HYVA 3KQWA 4LF5B 1KYWA 3PUJA 4CG0A 4KNVA 1J2RA 1GSAA 3W7AA 4YRAA 4NX2A 3NYQA 3QVXA 3IHTA 4GX2A 2WWTA 4FNMA 4HB3A 1CJSA 4KX3A 4Q4DA 3RTBA 5BWBA 2GM4A 5KQMA 2PT6A 3D64A 4GI5A 4UCWA 1NYLA 2YMLA 3EC2A 2PUCA 1YBAA 3EPRA 1S2IA 4H7DA 4U7GA 3WBJA 2Q5EA 4QGGA 1Z5NA 3Q7TA 4BMVA 3MM4A 5IC4A 2HK7A 3HXOA 3AJDA 3GJTA 2VIIA 1Q91A 2NV6A 1U0HC 2WABA 1ZMXA 3ETJA 2HPHA 2PZBA 3X0DA 4PWYA 5C9ZA 1ZJ5A 1AV7A 1MJGM 2PGXA 3AB7A 1A04A 2HQSA 4TN1A 2AX3A 2ZRBA 3RSLA 1AB6A 4OCZA 2G4VA 5B36A 1IN7A 1HOTA 3TNLA 1DTEA 1NVGA 3AF3A 2NU6A 2FZCA 2V7VA 3FMGA 2D5IA 3L6BA 4UEWA 2MINB 2B6HA 3HFGA 4BVEA 2CFRA 2IX3A 3OZWA 4AJ9A 2VDJA 5KJ6A 1ULUA 1P31A 1X7XB 1WPGA 2BE9A 2UVPA 4QTXA 4R5MA 4RK5A 4X6XA 3OZTA 3VR4H 4HNUA 4DR5B 5JJKA 4BMXA 3COPA 1BAPA 4EO9A 1I6LA 2I2WA 3AC0A 1GFWA 2WWXA 3DPUA 3Q3IA 2RK6A 1KSGA 3VTZA 1EE9A 2HMSA 3B82A 5JZSA 4ID9A 1CRZA 2C77A 3EBOA 2NSYA 2QAGC 3VTKA 1J90A 1SIUA 1WCV1 4HL6A 5FHRA 1BMFA 2IOYA 3R74A 2DUJA 3VNQA 4HFMA 4BNWA 3QBTA 4CM4A 1ULSA 2IE8A 3R5TA 1JG7A 3K53A 5LMUB 3RAFC 3AVVA 3AHHA 2EQAA 3U0BA 2AZ4A 1IVNA 3PHLA 1P1HA 2GHQA 3DFZA 1BS9A 2YZNA 3GOQA 3ZLUA 5AKGA 4DAEA 3O94A 4RLFA 3UA4A 1YFZA 1SUDA 3J7AC 5BQFA 3DAPA 4YCSA 1SC6A 2VZ8A 4DB2A 1AU9A 3EAFA 1E5VA 5HUQA 4WVLA 1W44A 3GIDA 3LO5A 4G67A 3RTDA 2NO7A 3QSYA 4RTSA 3GLFE 5CDYA 1CRQA 1ZKDA 2O14A 5DOVA 3SR3A 1UPBA 1RMYA 1DJLA 1U2GA 1SU4A 1GAQA 2RHJA 2HPAA 3KOXA 4UHKA 5IAKA 4W5TA 1Q84A 3SDZA 1PWHA 1U2DA 3ASVA 1MOSA 3BXOA 3V3TA 3WB1A 1B0PA 1NQWA 1NN0A 5C7OO 1O08A 4K6MA 3ZDYB 2I4NA 1YJAA 4C7OA 1VL8A 1QYCA 3AUTA 4JCCA 2UUBB 1ZIDA 5CAEA 3R0ZA 1BXKA 2DT5A 4JJ4A 3VO9A 2H59A 2QTVA 2D8AA 2QYHA 3OSUA 4UDXX 4MWSA 3MB5A 4QD3A 4ZYTA 5JT1A 3GLIA 1PUIA 3CIFA 1HE3A 3TMAA 1PQYA 3SAJA 1NW6A 3NM4A 2JK0A 1PKEA 4ZEMA 1UBGA 2X42A 2EW8A 3HA5A 4A26A 4EMUA 1ZQ1A 4KVGA 5FUMA 3KYCB 2FPPA 4E07A 3OPNA 4CIBA 1P7CA 1KZ4A 2ASEA 2VDWA 2VDPB 3G02A 4RSMA 4CV0A 3LPCA 4ERXA 4EG8A 4D8UA 1C3OA 3FWHA 1N3IA 2E4XA 3R23A 3GR6A 1KFEB 4H18A 4PNEA 3SHTA 1UEJA 3UK6A 1CUHA 4UNSA 4L4SA 4QU8A 5K0EA 2CCJA 2VSXA 3F6EX 1US8A 3DW1X 4FKMA 1QP0A 2DX7A 2P90A 1FK8A 1UZUA 2Q5HA 3DBRB 3WI7A 3K09C 1Y0BA 4BGIA 5EEGA 1KL7A 1T2CA 1OA1A 5F78A 1Z8DA 3HLTA 3OE5A 4QHYA 4ZAGA 3LLSA 4QPJC 5INTA 3U44B 1IBCA 4H2DA 1F0NA 4HDMB 4MP6A 2PQ0A 1UT6A 3EXIB 2OA0A 3STWA 1P0QA 1PSWA 1QXSA 1S3FA 3NATA 4Y0NA 5B7GA 4DMUB 1N36B 1SZDA 3CBGA 1NJ5A 3JS5A 3G8AA 1VXOA 4DY6A 1GLNA 1IG3A 3U1BA 5CM2Z 4ETWA 3NKLA 1YJ8A 3LDGA 4HGZA 4XPIA 1XU4A 3LYUA 4MWBA 1YFJA 5I8PA 4O4IB 1SKUA 4AKEA 4RDHA 1PLJA 1VL5A 2H16A 2Y6UA 1LSOA 2ZWMA 3R4CA 1V3QE 1DX4A 5K4HA 2UZIR 4WUTA 2BCJQ 3TSOA 4MYRA 2H4FA 5CU7A 1SVUA 3DVRX 1UH5A 4ZOAA 2ZE8A 1IY8A 1KVUA 1PV1A 4YP7A 2D6FA 1UM9B 1WPXA 1VGVA 2GJ8A 4OY3A 5JD3A 2Q07A 2ZZKA 4IJVA 4U2CA 4OQEA 5JSUA 3KV1A 3BWDD 3VDQA 1PQUA 2G1JA 1P6UA 1E3DA 3KWLA 3P2OA 3LCMA 4YAWA 4EW2A 2B83A 1STOA 5KNCA 1QTNA 3MMNA 4RF2A 4N03A 4Y2YA 5CIYA 1LS6A 1NLYA 1P1CA 2PH1A 4RYLA 1X3SA 1RHQA 5FA6A 2VDNB 4DIOA 3KSBC 1RKUA 1W52X 1Q0LA 1ECGA 4DG8A 2QRHA 2HT6A 1BXRB 2PL5A 1TJ3A 4DLTA 4RVNA 2AWNA 3A05A 1X1SA 2E37A 4RABA 1JFVA 4GZMA 3M1LA 4K9LA 1GDDA 2VXBA 4KYTA 3N0VA 2C3UA 5H4GA 1BA2A 7AT1A 3I9JA 4CN9A 5CA1A 1S8AA 3MLEA 1E0AA 2XMDA 4AYTA 2JJ8A 3IBYA 2DFPA 3IP9A 3OOJA 2PUAA