1DP4A

Dimerized hormone binding domain of the atrial natriuretic peptide receptor
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
425
structure length
425
Chain Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor receptor, lyase
molecule keywords ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
publication title Structure of the dimerized hormone-binding domain of a guanylyl-cyclase-coupled receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 144
structure length 425
sequence length 425
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dp4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dp4A01
5ED4A 4G0ZA 2WJAA 1YK0A 4E7PA 3LMKA 3F6CA 2RJNA 2MYNA 1F51E 3BRSA 2LIVA 2QVGA 4MR7B 4MRMA 3EGCA 5DLEA 5DCLA 4Q7EA 3TO5A 1RZRD 1NXPA 4RK5A 4UHKA 1BAPA 4WZZA 3RQIA 5CNIA 3N0RA 4XXHA 2WWVD 1QP7A 1QO0A 4D74A 2DRIA 3GWGA 5TQ2A 4OLBA 3CHYA 4XARA 3L6UA 3IP7A 3EQ2A 1KRXA 3RVKA 3OLVA 2W42A 3BRQA 3SNKA 5B3JC 1C4WA 1ABFA 2RDMA 4RZSA 2PUFA 1MIHA 5CNKA 2JRLA 1W9HA 2O20A 4NICA 3JVDA 1F4VA 1NXVA 3LKVA 4MR9B 3O1HB 1D1PA 4WUTA 3CFYA 4P1ZA 1SXIA 3H6GA 4FB4A 4Z4FA 1LK0A 3DZDA 4KQ9A 1EWTA 4W5TA 3A0RB 4MS3B 3HV2A 3OQNA 3GA5A 3ILHA 4RK6A 3IPAA 3A3KA 2QVCA 2PAFA 5FWXB 1EWKA 1BDIA 3JTEA 1PNRA 2PUAA 2F8SA 1U0SY 4G0MA 4DQDA 4Z9AA 3MF4A 1GCAA 2P9HA 4F11A 3MIZA 2IKSA 3UKJA 3FMVA 3OO0A 1E6KA 4QYMA 4N47A 1BDJA 2PLNA 4PICA 2LPMA 3FDFA 1ZVVA 2P4UA 3LUGA 4MLDA 4ZYLA 1D4ZA 4F8JA 2IPNA 2JBAA 1ZHHA 2L19A 3FFWA 1FSPA 4MLCA 4XASA 1BDHA 5JNVA 2V0NA 2IDMA 2GWRA 3EAFA 3IP6A 5TPZD 4EVQA 3CRNA 3K4HA 5HQJA 2HJ9A 2YHBA 5F64A 2CD7A 1Z13A 3OLZA 2NUBA 2HQBA 2HQRA 4IRXA 5CNMA 4YGXB 4D6XA 3LTEA 2IPAB 4N76A 2QV0A 3HDGA 3N8IA 5KQGA 4N0QA 4KQCA 4DADA 1VRVA 2FEPA 3UK0A 2BGGA 2R48A 3HZHA 3URMA 3C3WA 3VNBA 1DRJA 1GLGA 3H5VA 2E4VA 5KQMA 4MR7A 5TQ2B 1USIA 4EY3A 2QU7A 3KHTA 5IUNC 1AB6A 1P6QA 1NXTA 3JPYA 4RKQA 2H3HA 4XAQA 5D2CA 1JHZA 4Z9BA 1JLKA 1KGSA 3ROTA 3T38A 1UDRA 2N9UA 2RJOA 5JNSA 1KRWA 4H3HB 1RXIA 3D8UA 4RKRA 3T8YA 1Z18A 3M9XA 1U8TA 3I5AA 4MQFA 4RDCA 1ZITA 3JS5A 4G97A 5PNTA 2X7XA 1VPWA 4KVFA 1RZRA 4NCAA 1NXOA 2JVIA 2E4XA 1EHCA 3QX9A 1D1QA 1USKA 3KG2A 1ZH2A 3NHZA 3LUFA 3OM1A 3Q7TA 2FXIA 1C0EA 1JDPA 1BVHA 2PUEA 1MB0A 4EYOA 4YS6A 3CNBA 3TB6A 1GUBA 4W5QA 3K9CA 3ROFA 1A2OA 4JP1A 4ML3A 2ZAYA 4MPTA 3OLYA 2JBAB 1DC7A 4QICA 4WXEA 3G85A 4E7OA 1JYEA 1A0OA 1YMVA 5GOTA 2AYZA 2B1JA 3CLKA 2XDYA 2JVJA 4XFKA 3O2QB 3EDCA 4JA2A 2H0AA 1JWLA 1WETA 2FEKA 3CZCA 3F73A 4WXMA 2HSGA 3QEMA 3F7NA 1YS7A 2QXYA 3LKBA 3TD9A 4Z4GA 1DCMA 1JDNA 3N53A 3S99A 2MYTA 2VUIB 4Z4CA 2IPLA 4NV3A 3UUGA 1TM2A 2R47A 3SY8A 2HQOA 2JK1A 4OLAA 1ZN2A 5IULC 4LDAA 4OG2A 3JPWA 3R0JA 4QPJC 2YHAA 4GNRA 4RWEA 1JFSA 1A04A 1J56A 2OQRA 5TPZA 8ABPA 3MQ4A 1M2FA 1P8AA 3MM4A 1EAYA 3H1FA 1DJMA 2KYRA 3BBLA 4MQFB 1URPA 1XHFA 2Q5CA 4O1HA 1CYEA 5KC9A 4ETNA 5IUKC 3IPCA 5DGCA 4WWHA 1ZDMA 3GRCA 1FFWA 5TE9A 1D2AA 2FMKA 3KJXA 5IEJA 3NNDA 4LE0A 3KTOA 4JAVC 4RY8A 3OQMA 1JF8A 4IMJB 4MS1B 3SG0A 3A0UA 2E4WA 1Z16A 3EODA 1PNTA 3H5OA 3NNNA 4Q6BA 1TVMA 3H5LA 3I09A 1Z2EA 5IBQA 3LUAA 2FN8A 1E6MA 4P98A 2ZWMA 1L5ZA 1APBA 3I45A 4IMIB 5EWJA 5IUJC 2PUCA 1YS6A 3TX6A 5I4CA 1IIBA 4S05A 1DCKA 3QLUA 5CHYA 1ZGGA 2ID7A 3N75A 3O21A 2FMHA 1ABEA 5FBKA 5IX8A 4W5OA 4LDZA 1JL3A 3HUUA 5TQ0B 3QEMB 4JASB 3RVSA 1EFAA 3H5WA 3IP5A 3LUCA 1JH9A 3QLVC 4RK1A 2FQYA 3T6KA 3O74A 4N0PA 5KQLA 2MSLA 3RVQA 3CTPA 3RVLA 4RXUA 3Q41A 5HSGA 2FQWA 3FFTA 4D6YA 2PL1A 1XWWA 1Z17A 1SXHA 5B3JA 2GX6A 3CG4A 3D02A 1XHEA 3QELB 3HDVA 3HEBA 5JNUA 2VK2A 6ABPA 1H9CA 3OLXA 3KYJB 4O1IA 3FGZA 4MS4A 3N0XA 2E4ZA 1NXWA 4EVRA 2GKGA 4G0QA 1NY5A 2QSJA 2A9OA 2WB4A 2WMYA 3RVPA 2L2QA 2NT3A 4RV5A 3H5TA 1MAVA 3MMNA 4RK0A 4B09A 3HJFA 3LUJA 5KI6A 5IC5A 4JB0A 3NBMA 4KREA 3L49A 3IP9A 2B4AA 4FE7A 2PE5A 4LE2A 2FVYA 3C97A 3GYBA 3SM9A 2FSPA 4KV7A 4KPYA 4YP9A 5JNTA 1K66A 4KK3A 3M6MD 3Q15C 1Z2DA 4MS1A 2CHEA 3BILA 1DCFA 5EWMB 5EWJB 5HKOA 2AYXA 4ZMRA 1E6LA 4LRQA 2PUGA 3CU5A 3B2NA 4GPAA 2OENG 3O75A 4YO7A 4ZPJA 4Z4HA 2FMIA 4OTZA 4ZMSA 3EULA 4MQEA 4KNYA 4IGAA 1QP0A 2LBPA 4G0OA 1KMIY 3GBVA 5BR1A 2PJUA 1QP4A 1TLFA 4LX8A 4WT7A 4UHJA 4XLTA 3KKEA 3G1WA 1CEYA 5BRAA 1ZY2A 3HCWA 7ABPA 4HNRA 1DBWA 3RVOA 1YTUA 4QYWA 1ISSA 3LOPA 2VYCA 1YMUA 5TQ0A 1YIOA 1EWVA 2GBPA 2PL9A 3CS3A 1JBEA 3C6QA 4N41A 2A9RA 2QW1A 1QPZA 4Z0NA 1PHRA 4KK4A 2NT4A 1JFVA 1JYFA 3BREA 1M5UA 4YRZA 1OXBB 4Q6WA 2QZJA 5C5CA 1W25A 4KRFA 3H1EA 3JVIA 1LBHA 4FE4A 1PEYA 4MYRA 4YWHA 3OMXA 4MS4B 1DG9A 2FLWA 3GT7A 3ILYA 3Q7RA 4H60A 5TPWA 6CHYA 3C3MA 3N6VA 1TMYA 1RPJA 1ZAYA 2IYNA 2IPMA 4RY9A 3GV0A 4N03A 3QELA 3EQZA 3F6PA 5DTEA 3N0WA 4EYKA 5JS1A 2CWDA 3KS9A 4MAAA 1GUDA 1DZ3A 1NXXA 2WRZA 3KSMA 2FQXA 4O5AA 1B00A 4TLLB 4EYGA 3OMWA 1SD5A 3O2SB 1P2FA 3SAJA 1CHNA 3H1GA 1Z26A 3IDOA 1USGA 4MGEA 3HXMA 4PZ0A 2FTKE 4TLMB 3HK2A 1YK1A 5KC8A 1DBPA 4ETMA 4NCBA 4EYQA 2IOYA 3DGEC 2QR3A 3E3MA 5TQJA 2L18A 1DRKA 2PMCA 1M2EA 5FWYA 1QQAA 5E3JA 1Z25A 2LP4Y 4MQEB 2R4QA 4RS3A 5BQ3A 1QNLA 3EJWA 2J48A 2NZVG 5EWMA 5GQSA 3RVMA 2WY2D 3T95A 2FMFA 4RU1A 4JB2A 1NTRA 2MYUA 4W5RA 1L5YA 3FFXA 1DBQA 1FFGA 5KQPA 2R25B 4PEVA 2E4YA 5FBHA 5ABPA 4PYRA 3LUDA 4IILA 1U2QA 2PUDA 3JY6A 1LJUA 2ID9A 2MYPA 5KWSA 3KLNA 2LUOA 4YCSA 1DP4A 1SRRA 4KFCA 3OQOA 3OO1A 1JX6A 1FQWA 1QKKA 1YVUA 3CZ5A 3NNSA 4G0XA 1GCGA 1PUXA 1R8JA 4HNQA 3HUTA 4OATA 1D5WA 1U04A 5TPWB 1LBIA 4RK7A 2MSWA 5DKFA 1QMPA 2I6FA 3RVNA 4G86A 4EUKA 4G0PA 5EWLA 2FKAA 1ISRA 3DLBA 2PKXA 4L85A 2A9QA 1AB5A 1NXSA 3H75A 2JCGA 4HYEA 4ETIA 3RVJA 1QO0D 5JNRA 4S04A 4Z4EA 1OXKB 2GI4A 2RGYA 3I42A 5C5EA 4KMRA 1HEYA 1Z12A 3NHMA 4TMYA 2F8TA 3Q9SA 4MRMB 4MR8A 2TMYA 3HSYA 2NZUG 5T7BA 1U2PA 3LUKA 3C3KA 3SQNA 4YLEA 3KCNA 4IF4A 3RH0A 4NQRA 5JNWA 3HM9A 3HO1A 1ZGZA 3KLOA 3OLWA 3DLHA 1K68A 3TMYA 3GL9A 1I3CA 3H5IA 5FWYB 3M9WA 1VLZA 4F06A 1MB3A 1RNLA 2FEWB 4F12A 1Y1LA 3QLTA 2CHFA 4JOQA 5BRJA 1LJLA 3O1JC 3DBIA 4Z4IA 1RXEA 3CKMA 1ZH4A 3CG0A 4RY0A 4EGSA 2FN9A 2HPHA 2JB9A 2L17A 4Z99A 2MSKA 4DN6A 1M5TA 3MA0A 4TN5A 3QLVA 2M98A 5JS2A 3RVRA 3VNAA 1BA2A 4H3KB 1SXGA 4RK4A 2E4UA 2JVKA 3W9SA 3LFTA 3MYYA 4Y9TA 4LE1A 4MR9A 4RSMA 1FFSA 3QK7A 4L4UA 2VUHB 9ABPA 1VKRA 2FLKA 1QQBA 4F3TA 3Q7SA 3HS3A 3KYIB 4MS3A 4YR7A 1ZESA 4LZLA 2PUBA 4YV7A 1Z15A 2WJWA 3O1IC 5FWXA 4M88A 4PE5B 4W5NA 4CBVA 4EVSA 1TJYA 4RXTA 5EWLB 1JFTA 3H6HA 1MVOA 3OM0A 1P6UA 4RXMA 1E2BA 3P9YA 2M1ZA 4ZJPA 3QX8A 5CNJA 4HNSA 3GBPA 3A10A 1T34A 1DC8A 3HVRA 1PEAA 3DGFC 3QEKA 5IEBA 4G0YA 1NATA 1S8NA 2FW0A 2A9PA 5HM6A 3LUHA 4KZKA 4MR8B 3O2JA 4OBBA 3E61A 3QLUC 5T3YA
chains in the Genus database with same CATH superfamily
1W34A 2G5PA 2VDRB 4EHNA 3TRHA 4CV3A 4NY1A 5HFNA 1VPEA 2OHOA 1PX0A 4MAMA 5E7QA 3VNSA 4JROA 4B5KA 4ZKDA 4QVIA 3V4LA 3VHXA 4CEJA 3U4GA 4R9VA 1PWEA 1RFLA 3CURA 3QVJA 1KJ8A 4YCNA 4GH5A 4ND4A 3BK1A 3QOYA 2RHBA 3GZ4A 2PRZA 3O8NA 5AK3A 3P2EA 2QP4A 4FU0A 3O84A 3DFFA 1TAUA 3PG5A 3K70C 1K27A 3F5QA 1PVVA 3GDFA 1IOVA 1K6MA 1T2CA 3MWEB 1R7RA 1AV7A 2APJA 3LW8A 3DC7A 5TQ2A 2BKAA 2NN3C 3G2OA 1A8SA 1BGWA 3KTDA 4DLWA 1EUDA 4KE7A 1KJNA 3G89A 2VJCA 4UUPA 1HXHA 1V8DA 4JBIA 4M60A 3TNLA 3VHQA 2O7VA 4X66B 1EFVB 1WCV1 3A1SA 4MYHA 3LDUA 2RGCA 4QG3A 2Z56A 1D1PA 3P9CA 3LPAA 1NI3A 1POXA 3D8SA 3H9GA 4WZAA 4Z4FA 4MGKR 2JCVA 1PAUA 3MG9A 4N39A 4UAGA 4BX3A 1EDZA 4IUDS 4CT4B 3X1KA 4FNOA 5CK5A 1ZOSA 1E9DA 2NACA 1EX7A 1TKRA 3PUYA 4D9GA 1M66A 1PSZA 2RBGA 3OIDA 1R0RE 3PFNA 3U9LA 1Y9EA 4NPHA 1CUJA 3EVCA 3WXMA 4V0SA 1J70A 4Z9AA 5AKKA 5IKMA 3LPDA 2YN2A 5CM8B 1L7NA 5C1OA 1JG1A 2B61A 2HA2A 5TF0A 3S2YA 3OO0A 2ERYA 3K72B 1Z6QA 4OKSA 4QYMA 3UJ9A 1VE9A 4Y1RB 4FMDB 2PTGA 1G8MA 3WGIA 5BN3A 1ZHHA 2QTVA 3EVDA 4EL0A 1DUIA 3PVSA 5JLJA 1FX0B 4JBWA 1HPLA 4UFPA 1HY3A 3S1AA 2OQIA 4B4UA 4X8LA 5F64A 2P6NA 1IDOA 3DTVA 1I24A 1ORHA 3ZDQA 4HEA6 2IODA 1QH0A 2Q2OA 1MO5A 3UJ8A 3N8IA 5DHUA 1QIDA 1YBFA 4DADA 4XTRA 1VRVA 2C4TA 2D7CA 1YKSA 1GRNA 2R11A 2RAUA 4MQLA 5KTTA 3PEUA 2VDQB 3RANA 5FPTA 1Z6YA 3QZUA 1Z37A 2Q6VA 3AGQA 4EY3A 3SCZA 5LXTA 3H2ZA 4TKZA 3CF4G 2B7BA 3DOFA 2CDRA 1A2KC 4YP7A 3O4JA 4MRVA 3R3XA 4M8KA 2EZ8A 3QE3A 1QFSA 1W29A 4ZI7A 1EVIA 2BZSA 4TLDA 1AZWA 2H1VA 5LDGA 3FZGA 1YJQA 3Q5EA 3OOJA 3HG7A 1RQGA 1V1RA 4JLNA 1JAYA 1TRKA 2RH4A 4K9PA 1DIOB 4RLHA 4RDCA 3JRNA 1LS6A 1ZMTA 1N6HA 3FZNA 3D1JA 2E4XA 4MA5A 1UANA 3AO0B 5C31A 2Q4RA 4U8HA 3FA2A 3LHFA 4X64B 3LUFA 4JX8A 1JDPA 1OU4A 3E82A 4L02A 2RD2A 1W0JD 3GJ7A 3RR2A 1AO0A 4AKGA 2CNLA 1N36B 4LOJA 2IYRA 2JLRA 1GUBA 2QG9A 4UASA 4HXYA 4AX8A 1T2EA 4XM1A 5AVUA 1AMUA 2X41A 2Y1GA 3JD3A 1UJ5A 3OU2A 4NU5A 3EZ2A 4UNIA 3ICCA 4YQZA 2BKUA 3LRPA 1XYYA 4R83A 1AOXA 3ZE0B 4QM7A 1PO7A 1ZNQO 2WZCA 3UH0A 1W1IA 1R0KA 3A6EA 3OPNA 1K5DA 4TTQA 1A0OA 1O08A 1YMVA 1Z3IX 4NHOA 2G9NA 1ORVA 2JS7A 3L7AA 3S4YA 4YAIA 2E89A 2FPWA 2ODEA 2W6ZA 3AZOA 3NHBA 5I7EA 5A5GA 3BB1A 4L78A 2I29A 1EDDA 1UPCA 1KJ9A 1PNOA 2C2ZA 1Z0SA 5E9QA 4QUBA 2NADA 1PVDA 2FY8A 2ZJ4A 4OKIA 1AQYA 2ZP1A 3U6KA 1G8JA 1V96A 3LKBA 1LPAB 1UFVA 2Y05A 3UMBA 3W2HA 1XJCA 3W6ZA 6ADHA 1L3CA 3GEPA 3GP3A 5JYCA 1T4CA 1ICIA 1NMZA 2OFXA 2PSEA 3K92A 3C43A 3ZWWA 4ESVA 3W5AA 2C9ZA 1S9DA 4A2PA 5BYKA 1DG1G 3P4XA 2O07A 3GFOA 4QHTA 4YACA 5AJVB 4FJ2A 2ZKIA 3NTXA 4FBLA 5AVKA 1T5LA 1R4ZA 3AHHA 4HQLA 1F1BA 1ZCBA 3SY8A 3ZTWA 4QFDA 2XMCA 3M6LA 4OMUA 1FDOA 3IBGA 4D3XA 3TAXA 3ZGVA 2V6BA 4IUCS 5DDIP 1GVNB 2QTHA 5DLDA 3TQQA 2KWIA 5FDFA 3QPAA 5C7IO 1U1GA 1NASA 1EAYA 3MTDA 5E1MA 5BW8A 2HCRA 2WF6A 3FNIA 1URPA 2XZPA 2XUIA 2PUWA 1I2ZA 1CYEA 1KEKA 2D06A 2FF5A 1E9FA 3DMYA 2QDXA 4PZZA 4PCVA 5FXMA 1W5FA 3V2GA 4BX8A 4XIYA 1XZLA 1AQ6A 1F0NA 2ZCVA 3CF6R 5FO1A 3SF8A 5BSEA 5IJZA 2ZRQA 1CC1S 1YCGA 2AHOA 2J1LA 1J1ZA 4EELA 1SVSA 1FPMA 4C6HA 3I61A 1WUTA 3H5LA 4JUAA 5AOBA 1QU2A 3EXEB 4PAWA 1SZJG 2VCEA 3ONWA 4KACA 1AQIA 4CM7A 2H4JA 2AF4C 2J6BA 3DZKA 3EVGA 5ALYA 4CGZA 2IIPA 1RI3A 4V38A 3OMLA 1IHXA 1QIMA 5DHRA 5A0FA 4LW8A 2BMAA 4U7DA 2YWXA 1YE5A 1IIBA 5B2EA 2J6CA 3SZLA 1V48A 1ZGGA 4NAHA 3TINA 2FMHA 5F78A 4TKUB 4FBMA 4PW0A 1R3UA 3SYTA 1CRLA 1E2MA 3ZD6A 2Z8YM 4LZJA 4PY2A 2A92A 1HO3A 3GO4A 2I6QA 5EERA 4C06A 3EAQA 2CXPA 3A32A 1J2TA 2CEKA 4J43A 1WA5A 1N5RA 1NJ8A 3UGJA 4MJXA 1CXZA 1GGMA 1Y7TA 1IXRC 5DF1A 2XUGA 4A03A 3ADBA 4QGBA 421PA 3F8SA 3NYQA 3BQNB 4Q9AA 3W5IA 3MUFA 5THKA 2I1WA 4A0SA 4YRAA 3ZBUA 1R5NA 2PUVA 2YNMA 3ORYA 4AZTA 3TQOA 1K7SN 4H16A 3A9WA 1RIIA 1ZGBA 4EDHA 1M2HA 3VX4A 4A1FA 2YZ2A 3T35A 2PA0A 3ZE6A 4PFSA 3CZ9A 5E2IA 1CULC 1O89A 1SGWA 3L9WA 5G0VA 3T3NA 2JI8A 3L7IA 1J1IA 1ENZA 1T3GA 3KKPA 2HSEA 4CM9D 4EGFA 4P54A 5K3OA 2UZIR 3OHSX 3ES9A 3L8EA 1GGHA 2P6RA 1RQXA 4X1IB 1EK0A 3I4LA 2QLLA 1C7IA 1ODJA 3H5TA 2IY9A 1TQ2A 1ZVQA 3MLBA 3HY6A 1JSCA 5AKYA 1M9NA 2O48X 2YWJA 3H5NA 2M6KA 3E23A 2AN9A 4JODA 2YV3A 3ERCA 3RRBA 4RPIA 1L4BA 4Q4JA 3ORRA 4G5GA 3LH5A 4P34A 4BNVA 5CCXA 1C9DB 4QUDA 3SM9A 2FSPA 3VYTB 3GLIE 3ADCA 1JVBA 1WMAA 3FSJX 3H8JA 1YJXA 3R6WA 1GAXA 3KL4A 5EIBC 3D0OA 4Q1EA 1LKZA 2AC7A 1Y1QA 4BOYA 2JAWA 4CTMA 5LDHA 4UDOA 821PA 2DMRA 5FI3A 1CFJA 1W4RA 3VPBA 4FILA 3FKSD 3GFPA 4IQGA 1EEXB 3K5IA 4GPAA 4IGEA 3W1WA 4OSEA 4Q7LA 4XRRA 4F71A 3M4JA 5BN5B 5BV8A 2FMIA 3RUFA 1Q3TA 3A6FA 3L0IB 3Q72A 5ICCA 4K05A 4G8DA 1BXGA 4G25A 1FX1A 1ZNWA 4PLFA 3I2GA 4JQYA 2PGOA 1SUWA 3IGFA 3TVDA 4E15A 7ABPA 2Q4DA 3QUTA 3RVOA 2VHUA 4QYWA 2ZS9A 3SZMA 4EJSA 2ZUWA 1Y8AA 1Y8RA 2Q4BA 1W1WA 3VO9A 2EF0A 1HGXA 2CLEB 2B36A 3DXXA 1NF8A 1JEQA 3BAZA 1QAMA 3I01A 4GR5A 4NK4A 4QARA 2BDEA 2I8AA 5F7XA 5ERXA 1PHRA 4KXUA 2NT4A 4FPXA 3RUDA 2KM1A 1VHTA 4AM8A 1OZHA 1VZ3A 3PV0A 4BECA 3QKWA 1OXBB 4G1BA 1BGVA 3I9V1 3QFSA 4JENA 4LNUA 4NFYA 2WOOA 2HH9A 2W6JA 1SXJA 3H1EA 5CR9A 4EG6A 1G8YA 3OMXA 4P53A 2K4MA 2ZSEA 3C5HA 5DHQA 6CHYA 4CQMA 2PDAA 1M2OB 4JJZA 4D8YA 4XVHA 1NR7A 1UQRA 4EFDA 1N5MA 3AOGA 3FTCA 1IMJA 4ALMA 3BULA 5TS3A 4EYKA 5I4BA 5EXTA 4RF5A 4LF6B 1XJQA 4LSMA 4MW7A 4QJIA 3KSMA 1YKGA 2QL7A 4CIVA 2OCXA 1DQZA 1JJIA 2LVBA 1Q1AA 4YJ2A 3EFEA 3UW3A 3RODA 4IVNA 4RETA 1JLSA 4RGVA 5EMKA 4QE3A 3RTAA 1TVKA 1Z34A 2CL7X 1BHQ1 4PZ0A 4TLMB 4XM2A 3U4HA 1WPQA 3FNQA 2PBRA 4CE6A 1YV9A 2R66A 3G5TA 4MIKA 3CWCA 2Z6AA 5TQJA 1IUNA 4ONEA 1W75A 3WMEA 4CR8A 2BFEB 4HDNB 3KSBC 2O6LA 5FWYA 2W9XA 3IULA 4AURA 2E6KA 1U7UA 4OB6A 3TN7A 2UV8A 3GI1A 1OT5A 1WCIB 2AFIE 4DKXA 4DV5B 2TMGA 2DBVO 2PGXA 3DYBA 3EDMA 3JQ8B 2Z8ZA 4BV9A 4DT1B 5KVAA 1HSOA 2C77A 5JMOA 3WAJA 4L3WA 2OB1A 5B4UA 4BPRA 5CB6A 4W5RA 2C7QA 2PEYA 1T29A 3TLMA 1FP6A 1L9KA 3UJHA 3WQRA 1BMDA 5LLDA 3KB6A 4HEQA 3SC2A 4PEVA 4MW0A 1KQPA 4WZBE 1L7MA 2I6SA 1T8PA 4LPSA 5JBQA 1JAHA 2WVGA 1M0SA 1NQXA 1QG0A 4E4YA 4I8XA 4IJ6A 2IEYA 3H13A 4PLZA 5KTMA 1KVRA 1ZS9A 3GFFA 2HQ1A 3TKYA 1SRRA 3FPGA 2NU6B 3S2GA 1IBSA 3N8NA 4BCDA 3G79A 2VF2A 5AK0A 4FHZA 1WU8A 1RKUA 4HL6A 2BGMA 3SFTA 1X7WB 2G7MC 4OEHA 4HNAB 3O90A 2K7FA 1B23P 2Q2NA 3GEDA 1CUEA 3CLHA 1E3QA 3II6X 3V7YA 1IWOA 2PM8A 4Q1FA 1U0EA 1H8HA 3B6MA 4XEUA 5DBFA 1PR5A 3CR8A 4HS9A 4M0UA 2ZSFA 2FPPB 4TV8A 3M7IA 4MWEA 1GCUA 3TJRA 1ZIOA 2I4NA 2PT9A 5G1OA 1PL6A 1C3OB 4YT8A 4LXQA 1NI4B 4AB1A 1Z12A 4W8HA 4XIJA 1IXSB 4MWZA 4UTPA 4I8DA 4CTOA 1TB4A 3C1TA 1LH0A 1N2HA 4QUAA 2AI3A 4WKPA 2D5CA 4TWAA 4NQRA 5BWNA 3V1UA 3EZ7A 3QA9A 2UYCA 4D8UA 1PRYA 3F6EX 1BMFA 3WLMA 3ID6C 4Y2RA 1TUEA 1Y7PA 1D04A 1FFXB 2IDKA 4MWBA 4IHJF 3BVPA 5LP1A 3GQVA 3E58A 2G76A 3IVXA 2PWZA 1NKSA 3GNLA 3UH1A 3VH2A 1J0AA 1O54A 4ARZA 4E70A 3COYA 5LWQA 3OE1A 4RLFA 3THYA 4MUBA 1KZ1A 1Z5OA 1WZIA 2ZWVA 3DFZA 3HR4A 5CT5A 3RAGA 3CNNA 2V7GA 4BKRA 4BVLA 1KU6A 3KVYA 3KL2A 4DWJA 2CLLB 1SQFA 2GCOB 3E2MA 4TTPA 3BIFA 3OP4A 1TYEB 1PFKA 1RC0A 3ZBPA 4XYLA 3AR2A 2MIIA 3EGIA 4BLVA 4HYQA 1BH2A 1IN7A 5KX5A 1RYMA 2IELA 1G5RA 2EAUA 4ZCQA 3SU8A 2X5OA 1JYSA 4Y9TA 1IN6A 1XZFA 2WG0A 3TZKA 2HY7A 2Q0QA 2ZIUB 4I19A 4L4SA 3LZDA 1JSXA 4TV9F 1D0SA 4D7AA 4EI8A 4LV5B 3IQEA 1T8YA 1JHVA 3HS3A 2WHRA 4PQGA 3JW8A 3M8KA 4QG7A 3ZDXB 4EMTA 2JFNA 1GDHA 2XI4A 3EXFA 3GCZA 4A0HA 5KSWB 1U28C 2WJWA 1WXGA 4IIDA 3KEFA 5TS2A 2BUBA 4MTLA 3ZWMA 1QYXA 3QXSA 4MUHA 4RXTA 5HS6A 4IOMA 4MQMA 1J8FA 3IKTA 1SXPA 3SC4A 4I5DA 1GRCA 2XLBA 1XN4A 2W8BA 3WJ2A 1VBFA 1PR6A 2GAJA 1UBGA 1ICEA 4GEGA 1O8CA 3BMOB 4I4CA 3WLSA 4A9AA 2Y1XA 4LJSA 4LTMA 3DJYA 1PFQA 2D0DA 3IPYA 5JCJA 1SKYB 5BURA 3KYDA 5E3IA 4MR8B 3O2JA 4BB0A 1BA3A 1W88B 1K88A 2IJGX 4G6ZA 2EJBA 4LWZA 1B0PA 2Y4OA 3TQRA 3WYEA 4ND1A 1YK0A 2HV8A 3AR9A 3OWOA 3L18A 2HCJB 2RJNA 1RWKA 3C8HA 1SHUX 1AKQA 3MJVA 2CD9A 2CLHB 2PKQP 3HJHA 1MW9X 1NF3A 4JR1A 1HZJA 5FLYA 3EIHA 1XVTA 1Z0DA 1M3SA 2N47A 4XEHA 3MN1A 4GC9A 2HC9A 3IB6A 3WWCA 2FUG1 2DX7A 3KXDA 1I1NA 1X8KA 2B9EA 1LJ8A 2H2IA 3C1UA 3GUHA 1T1EA 1JGTA 1XI2A 2YN0A 4ZI7B 1IEWA 1LLUA 3NHLA 5B57C 4XARA 1T4DA 1ENPA 2G6TA 3OT1A 4M1MA 1OZAA 2YY5A 1WKCA 4O6VA 1D2NA 4LF5B 3PEEA 3O4GA 4IO0A 2R5NA 4LZOA 1JW9B 1R2QA 3ZD9A 1AZSC 2HKIA 1BCRA 3PE4A 2DQYA 2VWGA 1G8SA 4JNKA 2B1GA 2GJ4A 2QQ0A 3MFQA 4R2MA 4R8RA 3S7ZA 5KNCA 1T0HB 1T15A 2VNKA 1WMDA 5CX1A 1XLUA 1AO3A 4X3CA 1S3FA 2ZVDA 1EJBA 4ZC8A 4OB8A 4DABA 1TM1E 4RK6A 2Y0DA 4R01A 5EP1A 3VKFA 1NSFA 1V3VA 4R9RA 1G59A 1BDIA 4Q18A 3ZYZA 5HIKA 1EDOA 3U3ZA 3E9QA 3GROA 5AI4A 2PIDA 2ZYIA 5ALTA 1Z82A 3DPUA 2GZ3A 4HEHA 4DB4A 1FBTA 3HR7A 2J3DA 3CN7A 5EIAA 4CDMA 1JFLA 1FSGA 5GVRA 1N9GB 2DR0A 2YCLA 3JQFC 4Q21A 5EQDA 3DWFA 2OCGA 2VDWA 4GXQA 1B8PA 1C9YA 3OD1A 4FOTA 2ZLBA 3T0IA 4AWAA 2FPGA 1XCOA 5IFLA 2P6PA 3AEUB 2DKOA 4FLFA 4KSYA 2EW8A 4M0PA 5EEGA 1L1RA 2GWRA 3UWKA 1MKYA 1NJ1A 2QZ9A 4EGAA 3S8YA 3CRNA 4R3UC 3ZK8A 2XQJA 1T4CB 1AF4A 2DEUA 4YAOA 1TAQA 2J9RA 2NUBA 2HQRA 3N2NA 3LXUX 4NSNA 5CNMA 3WBBA 2IPAB 1AURA 5M34A 4GR9A 4IJ5A 5HQTA 1QBKC 5KQGA 1SU6A 3R23A 1RFGE 1TW2A 5ADWA 4JJ8A 9LDTA 2G7ZA 4KMOA 4S3MA 1Q20A 1D2CA 2Q27A 4H08A 2YBEA 4I5IA 4MUJA 4P7BA 2Q41A 3THWA 1LPPA 3CN9A 4UULA 1ZN9A 2JC3A 1USIA 5IC6A 3KHTA 3AR3A 1FBNA 4R84A 4DCOA 4LKOA 5LA6F 4I5EA 4AXBA 3IBYA 2E4AA 4DTCA 3ELWA 4Z9BA 1Y3BE 3UMCA 3ROTA 3WFJA 4LY9A 3AVTA 3K9LA 4Y30A 2FWNA 4H6XA 1W7AA 3COSA 1TK3A 4EQ6B 2Q6KA 3VO1A 1S3IA 3PNPA 1KVTA 2XEXA 1RBZA 3QVKA 3TVTA 1RXIA 2HFJA 4RKRA 3UPDA 4JEMA 1JG3A 1E1QD 2GN1A 3S7TA 1O8BA 3I5AA 4X61A 3AJ9A 4YI3A 3NTQA 5B5SA 1JEDA 3MAGA 3QPDA 1RWPA 2BGLA 4BFWA 4W5WA 2JF0A 4B75A 1USKA 4MEBA 1P75A 4XFJA 2DT8A 5BRJA 3LVBA 1MAUA 2ZCUA 3LY7A 4YS6A 1ORIA 5C1DA 5LQUA 1C3LA 1DLJA 4HY3A 5E1DA 5C81A 1LK5A 1WW2A 3SZUA 3D54D 2XZOA 1B26A 4K9RA 1V47A 1JEAA 1ZVJA 2IIVA 5ARCA 3T9FA 3KSRA 1HR0B 1E59A 5C7LO 3CSUA 1KEWA 2VZEA 4L75A 3BICA 4Y1GA 3W5UA 2V7QA 1Y6QA 5CLQA 4FUTA 1O58A 5KWIA 1YQEA 2GAOA 4RIFA 2MT9A 2PD6A 1WDTA 1N7GA 4MUMA 2P7HA 5KUTA 4KNVA 4NOMA 4NYJQ 4XWTA 3RROA 1RLJA 3PXBA 2WJ4A 4PSDA 4A73A 4B82A 1WCWA 2EX0A 3MHPA 5KNCH 4M86A 3O4IA 4HGNA 3PHHA 3F7NA 4RANA 5EXSA 2VP3A 4CODB 1ZLXA 3GJ8A 4MYDA 3ZE8A 1ODTC 3B6KA 4BASA 5JDIC 1L5HB 1T5SA 3FSGD 1N6NA 3PI7A 3F6YA 4OXIA 3ZKWA 4EJ0A 3CLTD 3MRXA 2VK1A 1E58A 4E14A 1FLVA 2VHVA 3DE1X 2XMQA 2CEAA 4BLQA 4WBXC 5AHWA 1U90A 4X91A 3V1KA 5CB8A 1ZSYA 2PMEA 1WLSA 2E82A 1JBQA 1Q2UA 1OB5A 4HDSA 1QC5A 1YUMA 2JFGA 1U7OA 1M8PA 1WDKA 3GNQA 8ABPA 1KPGA 3WFIA 2QJRA 1W4LA 1Z0AA 4O4LB 1J5XA 4BBZA 3B1YA 3JQAD 4UZFA 5CIQA 5FFFA 4M98A 4Q4JB 1IBCA 4B5LA 3OWXA 2VJBA 1VMEA 3AF1A 3ORFA 5CT8A 3X0DA 3AERB 1VIVA 1XZCA 4HV4A 2EJUA 4XSVA 5IKEA 2BYTA 4TMTA 5TE9A 2I7TA 1RI2A 5HW0A 5IEJA 1ZJWA 2JJ1D 2NPOA 3VKUA 3WHPA 3OE7A 1JECA 5FWAA 1JSRA 4G1CA 1KJYA 1T3ZA 1YB2A 4LMBA 1QJ4A 4DWWA 1KR2A 1G21B 5FHRA 4OYYA 1MOZA 2O05A 2P9BA 3JQ9C 1G1AA 1E7YA 1JT2A 4P98A 3FTNA 5B55A 5F12A 3G17A 2K6GA 2OR3A 3NBZC 5TT0A 5C46F 1P31A 4QBHA 2V7PA 3QVUA 3KEOA 4FD3A 4OLJA 2F3TA 2Q62A 4QTUB 4ZYZA 3N70A 4PYQA 1FE8A 1RTKA 1DCKA 4DQKA 4AY3A 4D9JA 3N75A 5LQMA 4XB2A 3PIRA 2AR9A 4FOOA 4EJSB 1RZUA 3TW8B 3RW9A 3HUUA 3JZDA 4YONB 2WQ7A 3PDIB 3ECCA 1OXMA 4RPLA 3CXRA 3KFVA 2AI1A 1PJBA 1XQVA 3U0VA 4C04A 3CLUD 1WMEA 1OFUX 2GPSA 5BYBA 4NH0A 2PWYA 4EF6A 2PBZA 4LNUB 4HNVA 3RVLA 1RM3A 1YQXA 1HKUA 1SXJB 2FV8A 3KUXA 1SCUA 3FPHA 4NBSA 4ZV4A 1I3OA 2GA8A 3DMRA 2GXUA 4AJOA 5CFZA 4CQMB 4D6YA 2AE1A 4FZ3A 4Y0AA 3PX3A 4EDFA 1RP7A 3UK1A 2ZSUA 3ED1A 1KVQA 1X7ZA 3FWZA 3I4CA 1N3IA 3KQTA 1H0RA 2WTAA 2FWPA 3PQDA 4NABA 3C24A 5DW0A 4YRNA 5K0EA 4YJ2B 5FFNA 2L2QA 3WLFA 1ISGA 5JO0A 1G6Q1 2NZ2A 3ZJ4A 4B09A 3F4BA 4ZYUA 4N4AA 4Q1BA 3TCKA 1CRZA 2RG7A 2WW8A 4IUYA 4JB0A 4W1PA 3H5AA 4PZ9A 1E9RA 1DAHA 1OE0A 3HCFA 3Q6MA 4P84A 4LE2A 1XCGB 4RA9A 3LPLA 3SC3A 4MV0A 2K87A 5IM4F 2JLYA 3AKEA 2BM1A 3SJBA 1LFAA 2D4HA 1Z33A 1YI0A 2QP3A 2XRFA 5JAOA 2C2GA 1IHYA 3HLKA 2O8EA 3U7EB 2XUQA 1ZCJA 3FNGA 4WCDA 3N9IA 3D8RA 3QITA 4WZAE 4JZKA 3CU5A 3RT1A 4Z54A 4AMUA 1VPVA 3NTLA 3CLVA 1E3LA 3N0VA 2I7DA 4IUBS 4QYTA 4ZT7A 1RQ2A 3O31A 4DA8A 2ZSIA 1HLGA 1SOWA 5DYGA 4OHZA 3ZU3A 2X1HA 2REQA 4G0OA 2AOUA 2GYWA 4IBOA 2X76A 1A96A 3G8AA 2BHRA 3GEEA 4DDUA 5CFNA 3LHIA 1ZW6A 3V2IA 3WSWA 1UPXA 4LHSA 1Q1EA 1CEYA 3V80A 3ZCPA 1ZY2A 2V96A 2YZ7A 3JQEA 4B4OA 4HFRA 1ISPA 1DJNA 1PQYA 1YTUA 1NJ5A 1UAYA 1YOBA 1HKHA 2Q1TA 3FVTA 3N28A 2J41A 4PC3A 4R31A 3VFDA 2IH5A 4CQLB 3FUCA 4NXNB 2VHZA 2WDZA 1G6KA 3HCCA 4RF3A 2OLKA 2PQMA 4ZT3A 4Y3UA 2BP7A 3K70B 5CDFA 5JXIA 1X9IA 2FJ0A 2MINA 2WSYB 4EY8A 3VKGA 4ZQGA 5BN1A 1M5UA 3H2SA 1OF1A 1RJWA 3LC2O 4Q7QA 2WT8A 4OX9B 3O2NA 5LMUB 5LSAA 4GLJA 2VP6A 4MYRA 4TL7A 4V24A 2OM2A 3DMGA 3EVNA 3P9XA 1ECFA 3BCRA 4WOJA 4QXPA 1BW9B 1XELA 1T8TA 2BY4A 4R5HA 1C7FA 3P32A 3DLPX 2GCPA 2PWBA 1K6IA 4AULA 5T41A 1J99A 3KOZA 2OBBA 1JQAA 5BNFA 1WLYA 3Q7QA 1GUDA 4JP8A 3THXB 5AW0A 2LZ0A 4EYGA 1X7YA 4EZIA 4PRYA 4A7PA 1N25A 4ID3A 5KWEA 3IDOA 2PH5A 2W90A 2ZSAA 2QT9A 3NLLA 3IP8A 4H7IA 2GO7A 2OVBA 3MAJA 1U28A 4H31A 4E11A 4S0ZA 4DLKA 3WJ7A 1DBPA 2VIIA 2YCBA 3U7HB 4YXWA 3UJAA 2HU5A 1E0KA 1RC1A 1V3UA 2H1FA 3GD7A 4YJGA 3THYB 2L18A 3ON5A 4ON9A 3U80A 4B3RB 4YQYA 5AI8A 4KX3A 5FTWA 4G5XA 1Z25A 2LP4Y 4DBLE 1G42A 5HWSA 2JLSA 2OO5C 4LHZA 1JEYA 4IHQA 3H2YA 3WWDA 2Y1CA 3EEOA 3TE7A 4DRYA 3H5RA 2GRJA 5AWFC 4JY7A 3VPSA 3TL2A 3GDWA 4REOA 2EG9A 2FN4A 3NXKA 3L4SO 1OVMA 1YONA 1T0UA 2J9XB 3EFOA 2WF9A 3VSBA 2QTLA 1NN1A 3LUDA 4IILA 4RMNA 1ZM3A 1GPMA 4Q48A 3LBAA 1VMIA 3T3DA 2Q7OE 1Z6PA 2B30A 1XCPA 3ZI0A 4B2PA 1N9KA 1Q0HA 2PSFA 4LCBA 4AJLA 1E9VA 1RJ9A 1ZUHA 1SXQA 3GARA 5IT0A 3DEJA 4KQMA 4NI5A 3WISA 2O5RA 3ZV4A 4UTVA 1GT6A 1XZBA 10MHA 4CTJA 1ZOPA 1J22A 2W8BB 2GM9A 3MT8A 4EHJA 4V3BA 1EGQA 1QU3A 4RZUA 4ZTUB 3RJZA 2HA4A 3LSYA 3QENA 1I0LA 3GLRA 3ZN2A 4BHTA 4PZEA 2AJCA 2JGEA 4IHAA 2FF7A 4LVCA 4OI4A 3KYDB 2XT6A 5A5VA 3MJRA 1PL7A 4C0HA 4K26A 2FKAA 4Q9HA 1RXWA 1FNMA 3EGVA 2YDXA 4L85A 3L92A 4Y98A 1NOIA 3DKKA 3TGLA 3NYWA 5C0OE 1P7YA 3NTVA 1OXKB 3AEQA 5JSZA 2GI4A 4H2DA 1HE1C 4Y6OA 5C5EA 3U7IA 2EFCB 1ECJA 2IUTA 3EA5A 3C3DA 4RNCA 4ZCLA 4DLTA 4PYJA 1UAAA 1NBAA 3BXOA 2W6ID 2Q3DA 1QG4A 3D64A 4HDOB 3W6PA 5CAEA 1WSAA 3V7FA 3ND6A 2ONZA 4GZ6A 1N3YA 4XD7D 1CP3A 4WCFC 5CFQA 4RSGA 4KQWA 4URXR 2Q9UA 3AUFA 1Y80A 1UOOA 4R2XA 1U6KA 2RG1A 4MK4A 1J0CA 3OT1B 4G56A 4MPJA 2ZJZA 4XPIB 2AZDA 2GVDC 2H2AA 3GPDG 4EECA 1A9XB 1SWWA 4R71A 4AKTA 3JQFA 2HB6A 4N40A 1ONSA 3WKDA 1H1TA 1STOA 3K15A 4JLSA 4JT2A 2IU4A 4EGSA 5TXGA 1ZN8A 4CMHA 4XUEA 4DV4B 1M5TA 1P2TA 3CO0S 4C6TB 4HADA 2J5RA 2XGOA 3H2JA 2M98A 2NG1A 3OCYA 4W6QA 1KI4A 2AKYA 1YHYA 3PQ8A 4YV1A 5LQKA 1GFIA 3DHYA 3R5SA 1WHTB 1Q7EA 3TL6A 3AESA 4MB0A 4XDGA 5KYGA 3OEHA 5COQA 1DWUA 2F9LA 2ZVJA 1SCIA 3HXPA 3Q0TA 3LS2A 4GMGA 4TM7A 1LNSA 4OP1A 4WK2B 3MMZA 1JHAA 4WXYB 4BMPB 3OFVA 3LT5A 3L4JA 2EL7A 1E2IA 4HZIA 3SJZA 2YYZA 4CCWA 1NJ6A 3QVOA 2H07A 4YV7A 1JSZA 2Z2XA 3KOXA 1QH9A 4GBJA 4WNCA 5ALLA 5BOVA 3VISA 1OC2A 4EVSA 4X62B 1SUAA 2WUGA 1TI7A 1UIMA 1X1EA 3CQ9A 2PR7A 3L4BA 4MUFA 5AI6A 3RAPR 3SQDA 4KO4S 3TL3A 2YQ5A 3CWZA 1LNZA 2QU8A 5H4HA 3AMVA 2B1IA 1E20A 4JC5A 3DTTA 3HNPA 2XGMA 3M1LA 5BPHA 3UT0A 2I2BA 2IYSA 1C7ZA 3GXBA 2ABWA 2CLOB 4P33A 3ZKAA 1QKJA 4CF6A 2C00A 1PQUA 2V9ZA 1SQ6A 2BLNA 1SD2A 1L4YA 5AVJA 1EWRA 4DLAA 2IYAA 2VZ9A 2CLCX 4MRNA 2Q8PA 4RVDA 1NL3A 1ODSA 4MUAA 1NW8A 4PZAA 5AOVA 3OJCA 2PGJA 3F3SA 3GRFA 3THWB 3DONA 3QOFA 5JWRA 4B3TB 2JGJA 1A9OA 3HE3A 4CQNA 2FZKA 1GITA 4U2CA 5DCLA 4LC1A 3C8UA 1RM4A 2QUAA 2H5EA 2HDOA 3E1KA 1DJOA 1Z6GA 5LYYA 1RPTA 1MG5A 1BEZA 3ELBA 3GLHB 5EZ5A 3BMXA 3KKNA 3ER6A 4Q39A 2UYOA 4RKEA 2ZBVA 4HQ6A 3BB4A 4QEKA 4E08A 2IS4A 1TVCA 5THXA 5JQGB 5JQWA 2VZ8A 4Y2UA 4C3OB 4DZTA 3DFKA 2OESA 2QRHA 5FULA 1ZJ4A 4LJ9A 4RCZA 4BRUA 1IU9A 3ZIUA 3PD1A 4RZSA 3A1VA 1MIHA 3A3OA 3FKQA 3LDGA 1C9NA 4UUOA 5KAMA 2J31A 2Y8EA 3Q40A 4F4DA 3LKVA 4MR9B 5HKKD 1V71A 2O8FB 3CFYA 3ZGYA 3CVOA 4RJTA 3DZDA 1E3JA 2PKEA 3EGDA 5LYJA 1LSUA 3KKMA 2O4CA 1N0UA 2FG6C 3EUEA 3AKCA 5CLHA 3B38A 4I46A 4QX6A 3EASA 2QLFA 1C0KA 1KS9A 2V45A 5CVJA 5AIAA 4CLRA 4TSFA 1ECCA 3BZWA 4JI5B 2PUAA 4CIDA 2GCNA 5AVWA 2PZGA 2X3YA 5FRDA 1UKZA 2O2DA 2J0EA 4COOA 2RHTA 4ANFA 4WEOA 4A27A 5AW3A 1J8YF 4RZIA 1AKWA 1M8FA 2GARA 1PG0A 4QC2A 3FDFA 3SBOA 3LUGA 2O8BA 4ZCIA 3CX4A 3B3AA 3BT7A 1RMQA 2K5UA 2RE8A 2I67A 3FFWA 3WLKX 4PZDA 1FSPA 4EPXA 3RF7A 4LECA 1EZ1A 1AM4D 2VYNA 3AI2A 5CXQA 2CCJA 3PSAA 1UM9B 1P9LA 3KR0A 3KR1A 4L8FA 2KI5A 1A4RA 3NS7A 1E4EA 3PUZA 3COPA 4MX8A 4R54A 5LA6A 2BGNA 4D46A 4MUXA 4RTLA 1YR3A 5JVDA 5AXBA 1XQWA 3RS7A 4N76A 1RYZA 3ZKWB 2QV0A 4GX5A 4KQIA 4F6RB 1K2VN 2ZBQA 1CG6A 1BO6A 1DO0A 1EJ6A 2Y68A 3JQ9A 5CT6A 5LBIA 4DYHA 1KA9H 3GRYA 3OIUA 4V1CB 3U7RA 2QX7A 4M7OA 3ZHZA 2GNAA 4QOFA 1U99A 3GA0A 4RA6A 5JROA 3C3CA 1DRJA 4FN5A 5A02A 4DDKA 1N2BA 5L4LA 3CGGA 4EHHA 3RRYA 1E5LA 1PV4A 3ZU2A 2F43B 2XAAA 3KVVA 5BSFA 2H3HA 3FN4A 3HCDA 3A4YA 1CQJA 2XVZA 4TTVA 5D3QA 3ZWPA 5K0ZA 1XEWY 1OBOA 2YV1A 3QYAA 2QE7A 2Q0HA 4XFDA 4MRAA 1I6MA 3T38A 3BWBA 2IEDA 4UMVA 4ZKEA 1R4MB 3FWKA 4S1VA 5CVTA 4C05A 4KLZA 4B40A 1HRKA 5GONA 4HGPA 2G09A 1U4SA 2XNCA 3M9XA 3FF4A 5F23A 5ENZA 1CHDA 3IQWA 4MQFA 1L1QA 4U1RA 4X93A 1QPGA 3RIMA 3VJLA 1XTUA 1SU4A 1R6AA 3NFRA 1YS2X 4IDNA 1MAAA 4JYCA 3T5TA 2VQFB 4FDLA 3BCSA 4RZ2A 4GIBA 1FRVA 2Y9PB 1FUIA 5ER9A 1N6PA 3N0TA 2Q0SA 3ZZ1A 5A5FA 2I2XB 3ITKA 4YDHB 3F7TA 4FQ5A 4A16A 3BL6A 4CKBB 3TLGA 2Q7XA 2B8JA 4F9EA 2ECQA 4Z7JA 4QEDA 3OTOB 1KK0A 2QZ4A 4IYRA 2FWAA 2GJAA 1FJXA 2QL9A 4G2NA 1V2GA 2R85A 4IRMA 3OLYA 4HGRA 4UEQA 4DNOA 4JUCA 1YJBA 3G85A 4X9XA 3VNUA 3KOYA 1F8UA 3LQKA 4PWYA 4UBKA 1CDDA 2DPGA 3UG7A 4DM7A 3ZS8A 3HRKA 4Z9FA 3IMFA 8OHMA 3O26A 2X3FA 3P45A 4OL0A 3WNZA 2VPTA 3IC5A 4FONA 3WDSA 4EPYA 2J45A 2QX4A 2R1ZA 3BHIA 2NTYC 4QO7A 4WIAA 2VXYA 2VRWA 3VR1A 1B6GA 2RAVA 4KYTA 4HNGA 4MJ7A 2HMUA 4KOEC 2BJHA 4Y2JA 1W0KD 5F7ZA 4BFUA 4NZOA 3GEMA 1IRXA 2H7YA 2PMDA 1VDMA 4GPBA 2OLEA 3IR7A 4HXEB 4OHWA 4DV2B 1SB8A 2C1ZA 1QJCA 3LT1A 1X14A 1ZGHA 3WQHA 1TMOA 1YBMA 3DEYX 1X7ZB 1WXDA 1RE0A 2B3DA 2IPLA 2YVLA 3K1ZA 1I7PA 3MLEA 5F1OA 1O9GA 4A0FA 4ZYXA 4G5SA 4LEIA 4N49A 1THMA 5HK9A 1Q17A 2J33A 2HUPA 2JKZA 4MYSA 1WCYA 5DNUA 3MQ4A 1C2YA 1YB1A 5JWOA 1KY2A 4MYUA 1G20A 1UC5B 2ICAA 2QN2A 3M6WA 5DM1A 3TW0A 3SS7X 4A2QA 4BEWA 4KEAA 1VTKA 3PI6A 1U6IA 5EY5B 4YRDA 1I2CA 1UMDB 1MZVA 3PVZA 4EUSA 3QI2A 4WN3A 1DJQA 3CKYA 1XMSA 4Q9NA 4OU4A 3FBTA 1TD1A 3OEYA 3WRYC 4OK6A 2PGIA 3U26A 3T4UA 1OWMA 1VL6A 4BJ1A 1QMGA 4ND8A 1ECBA 1Z08A 2CZCA 4FYYA 3RNOA 3VYSB 2YXLA 5IWAB 2I4TA 1G5IA 1DOZA 5LQSA 5T6BA 3BTOA 3IHWA 3CB4A 3LUAA 2V7VA 4PGFA 1ZUNB 3PHGA 3IO3A 4PCAA 3I45A 3C5WP 1Y6FA 1ZX1A 3DBRA 1Y63A 2AOUB 5CLGA 3BSSA 1Y1SA 1CRWG 2E48A 2QTCA 1Y42X 2ID7A 3E7DA 2PXXA 3HJGA 3QVTA 5CYGA 2I66A 1FVOA 4HPXB 5D87A 5DK6A 1LBEA 1CR0A 1E2QA 2WTXA 3ZE9A 4YUWA 4ZXFA 1SUDA 4HXFB 4LDZA 1E77A 3WK7A 1AQLA 3ZE7A 3P2OA 1KEEA 3H5WA 2NP6A 2OZPA 3T5AA 3LPNA 1UBHS 2H63A 2XUKA 1BS2A 1SR8A 4H18A 3LE8A 4NQZA 2HL6A 4O4JA 3UHFA 2Y0CA 2Y6VA 1KY3A 1RPNA 3T1VA 4PBRA 1QB8A 2YHUA 3R0XA 4AN1A 4U2FA 2Q2WA 5SZIA 4IGFA 1MD9A 3PF8A 3FYUC 2FQWA 3DZIA 3FFTA 4ZODA 2OO5A 2EL9A 4FYXA 2NSDA 1WPXA 4H1UA 4JBXA 1MB2A 4Q9IA 1EWYA 3OZIA 3VSEA 3KQNA 1FZQA 1M6YA 2IT1A 4YT5A 2DUJA 3PFBA 2GD2A 1ZM7A 2OV4A 3RG2A 4WK0B 4ZVPA 1KDVA 2ZI4A 1X7YB 2BKEA 2EKZA 4J29A 1MZPA 4ENUA 3GHHA 4JXXA 2WMYA 5EYPA 1AHHA 1GKUB 3CRMA 3EB9A 1M1UA 1U1FA 1YQ9A 5B1DA 3BGOS 3ME5A 1CJKC 3VR6A 1FNCA 3Q1LA 4AXXA 1YJAA 1JTVA 2B8WA 1QQTA 4DPKA 1JAIA 4Q82A 1FTSA 1U5BA 3LO5A 3A6GA 4IGKA 4NZ9A 4HBZA 3UJBA 5JD4A 3VVCA 4GOJA 3QE2A 1ZBDA 1MO3A 3OSZA 4QPDA 4Q01A 1VJGA 3S70A 3PEWA 1QRTA 1T9HA 3M6MD 1T3LA 4R7GA 3WP1B 4E1AA 5A4JA 1O95C 1PFVA 1EJ2A 1W49A 5GGXA 4CL8A 4AKIA 1ULHA 2M6SA 4JJEA 3TSCA 2H1OA 3IDSA 4V0OA 1MX1A 5JSHA 1OIWA 3A11A 3KEQA 1PGQA 4N7MA 2Z95A 2ZR8A 4PAGA 1G3QA 3PNSA 3ZZNA 4DSOA 2CXUA 2A9VA 3AKZA 3DR3A 3X1WA 1RYHA 1OZ0A 1QP4A 1L7RA 1NVGA 4XLTA 4Y9SA 2NUTA 5KOJB 1ZIYA 3CB2A 1YR2A 2J7PD 2G4CA 2HRBA 1RBQA 1P2GA 4C0XA 1V7QA 2C5SA 1YRHA 1UXKA 4QEZA 1ISSA 1CR1A 4OK3A 5IM5A 2A5LA 4L16A 3PWTA 4KWCA 1ILWA 1YIOA 2ZE8A 2PL9A 1LPNA 1JRLA 1GPDG 1QYDA 1KMNA 1Y4DE 3O5AA 4FYKA 4BNIA 2V6JA 5AJZA 4BVGA 1R37A 5CVCA 5KBYA 4Z0NA 1HQDA 1FFCA 2BMJA 5A0VA 5GJCA 5CVUA 2F3UA 3KRTA 2WICA 3RHZA 5HIIA 5TR9A 1T6XA 4DMUB 8ATCA 2JGNA 3FNEA 1OI4A 4IHJB 4E5YA 5BUSA 1ZK4A 1KDTA 4I08A 4TWRA 3HA7A 4ZJYA 4B83A 5HBRA 4ZYTA 4KUHA 4QOJA 2HU8A 4LYGA 4XB6B 5MN6A 2BEWA 4A26A 1V4NA 3H4IA 5F5XA 3S29A 3QYJA 4GSLA 3R3ZA 4MVJI 4ZI3A 4Q3KA 3U1TA 3OFND 3WZ2A 5DGHA 1PKEA 3M1AA 2OHXA 1Y7LA 3QE0A 4DE5A 2DJIA 2DLNA 2WAAA 3FUVA 1SD5A 4TX1A 4R6WA 1WY7A 2P8JA 2C78A 1Z62A 5I8WA 2FPXA 1S9HA 2EGHA 2JARA 4OOFA 2AMYA 1KYVA 1MO6A 1REQB 3GIWA 2LE0A 3SSAA 3FWYA 3PYMA 3KC2A 4OAPA 5EEHA 4AF8A 2VHXA 2IEGA 3PGA1 3R1IA 3AJAA 4YMUA 3SXUA 3CH6A 1P29A 1G8FA 2JFHA 2LXNA 5DYNA 3CX3A 4TV9B 4ZO8A 5EXEA 4CLEA 1P7PA 5EUMA 2OCBA 4RFVA 2H4YA 4OIFA 4YMIA 4B3XA 1XNJA 3QU9A 4CM3A 1GGNA 4YRKA 1XDSA 1H0HA 4IX1A 3RIXA 1E5XA 4KL8S 5FUMA 3FCOA 1ILEA 2PLWA 3E03A 5LU9A 1GU1A 2NU7A 3JSAA 4URYR 3NJ8A 2FMFA 3OE4A 4QRIA 3PQCA 1CCWA 2GUGA 2ADFA 5BW6B 1N9ZA 2EIHA 4WKNA 2QUBA 3IIEA 4D3FA 4UNQA 3IERA 4L8YA 1GL9B 2GUWA 3D5TA 4HDKA 3BTSA 1TUBA 2EQAA 3E53A 4BNXA 1E2JA 1K7XB 1IVSA 1YHZA 1WIWA 3I9OA 4L9RA 5CA1F 4HS4A 1EFRA 5DMHA 1N6OA 4KR6A 1M6NA 3AP3A 2XECA 4F9FA 1JX6A 4GGPA 4JV5B 1RI1A 3FW1A 3UATA 3MINA 3LTNC 5C8DA 1V16B 2OSBA 2WJ3A 3HN2A 4TMVA 4GGMX 3OZUA 1FEZA 4RK7A 4WY5A 1EDBA 3T7TA 1QMPA 2I6FA 3ECAA 4Q3BA 4EUKA 3FIUA 4XQEA 1GNLA 3SHOA 4MMZB 2J46A 2WM2A 5H3LA 4S04A 2BI8A 3NHSA 5TGTA 1A3CA 2EKQA 3RVJA 3WS7A 3WKAA 8ADHA 3PX7A 5K8VA 3ZY4A 3I42A 1FVXA 3VR2D 4ENQA 3LWNA 1K7EB 2HZ7A 1PWXA 2HJGA 4B0PA 3T4XA 1K3FA 1ZH6A 2FX5A 4WESB 2WYHA 1OQAA 1NQ5A 1AF7A 2D3WA 1G6HA 4KQ2A 4H7HA 2CYCA 2G1KA 1NHWA 3P4UA 2XVYA 1DQNA 4P92A 1PNVA 2YRWA 1E3EA 1Y4AE 1K98A 1XRJA 2ZYTX 1P73A 3GRUA 5LPNA 4TVKA 2BEKA 2YWFA 1HFWA 3NT5A 3REOA 1V5GA 2ZUDA 1F48A 4B2YA 4DA6A 2X2EA 4F06A 1ES9A 3N3BC 4EHDA 3D6FA 3WIBA 1J5PA 3MIIA 5F9MA 1FMTA 1T6BY 2FFHA 4JI7B 1CYDA 1UKCA 1Y1LA 2HCFA 1NMEA 2VJNA 2KX7A 2GN0A 3E9YA 3I01M 3OPMA 4J7UA 2HPVA 4N3NA 2Q3HA 4TGLA 3CEJA 1BE0A 4OJMX 1YQUA 1IWBB 4K9MA 2H7CA 4Y2QA 3MA0A 4G9GA 3G7UA 4AJ4A 1R5OA 5KYUB 1PN3A 1PJCA 1SHKA 2PCLA 1VSUA 3QLVA 3KUCA 4HO1X 4QSMA 4U00A 1J90A 2F3PA 3K2BA 4J90A 5HTKA 1F0YA 2XCSB 1K5HA 1UWLA 1E0AA 2R97A 2ZWOA 2PUHA 1PK8A 2CDNA 4RHUA 3U4CA 3CZ4A 4JLDA 2VUHB 2EW2A 2VHJA 5LIRA 3Q7SA 5A4AA 4YVFA 4C88A 4YR7A 3JQPA 4KOAA 3DTVD 1ZGJA 3ASUA 1HFKA 3LOQA 1R4NA 1F4PA 1LQ2A 4M88A 4LYDA 5F77A 2VATA 1ST3A 3M5DA 5JG7A 5AOCA 4UFNA 4L4YA 8MHTA 4D9BA 5EWLB 5MN5A 5I47A 4OQFA 1S2LA 2PLFA 1FB5A 3WOHA 4KFSA 3P9YA 4JI3B 2P6OA 5COBA 3TLKA 3VZCA 5HZGA 3GBPA 1F5SA 121PA 1E4EB 1PEAA 2ZUBA 5IT9A 5LA6B 3UOAB 2WA1A 3FHCB 3OJFA 5F3RA 1MAHA 1HDCA 1X8JA 2BGWA 2FRDC 1JI3A 1T9GR 1KI2A 1T9BA 3L07A 5DIFA 2B34A 1P8JA 1KZ4A 2RCYA 3I4FA 1ZONA 4QFCA 2OBLA 2SCUB 1U3VA 3A7EA 1RWOA 2ECPA 3MOGA 2YZNA 1NT4A 3F6CA 3FLAA 5LN1A 4E3WA 3DV9A 3P94A 3FWPA 3EFBA 5H8WA 1E8DA 2JNWA 4DC0A 3BERA 4UAUA 1WKBA 2ZIEA 1QRSA 1ODKA 2Q6OA 1BAPA 2IBSA 4S0XA 1L7PA 4PLCA 2VDVE 3T3PB 5GZ6A 1XRQA 3EG9B 2DXIA 1C1XA 2HSZA 5CW1A 4L57A 3MB5A 1YB4A 4Y2TA 1T43A 1OKKA 2ZVQX 3VKWA 1CBUA 2HBRA 3LBIA 2W42A 4OJQA 1ABFA 2RDMA 4RADA 2PUFA 4XVUA 1U3GA 3DV0A 2PMWB 5K0SA 1UBOS 3EIOA 4FJ1A 5FLXA 1W9HA 4DTIA 4R69A 4RC9A 3QEOA 1M6VA 1NRIA 4ZOBA 2JCSA 1G291 1N2SA 3CRVA 1SXIA 4QYXA 4FX2A 4JFRA 4KQ9A 4I4NA 2X77A 3JWHA 4XUCA 1GPKA 1NRWA 2C82A 3DMDA 2VWHA 1E8MA 1QX3A 2Q29A 3HV2A 4GE0A 4X00A 1F4LA 3LC0A 4BWGA 4UXIA 1OXVA 3GN2A 2ID8A 3S55A 1H2EA 1S2GA 1TU4A 4E33A 2FPRA 3OZCA 3EFHA 5AVSA 1KAMA 2VT2A 3RAFC 2E1RA 2REBA 1T5DX 1DTEA 3NONA 1DUSA 3MIZA 3R40A 1NW9B 5D84A 4PICA 4EMBA 1S3SA 2VAWA 4BFCA 3PXGA 1DL5A 1D4ZA 2ONCA 4DIFA 3T1TA 5CDFE 4OI2A 2WWIA 1OX4A 3BXHA 1FNBA 4R05A 1YR9A 1MENA 3P8ZA 4MI3A 5EP3A 3WJ1A 5HDBB 3WLOA 2WFAA 5IKPA 4GD3Q 5B7PA 4LI0A 1AJEA 4AP5A 3QQ5A 1I4EB 1G66A 1ZZEA 2P68A 1N6IA 1JJFA 2KLHA 2V5AA 1GPNA 3H42B 5F73A 4DIDA 2W2MA 2NZ8A 2R6ZA 1FLAA 2V3WA 4FIDA 1Z2PX 3H2BA 3ICOA 2NU8A 1QE5A 3FZYA 4G36A 2ZJFA 3JZFA 2FEPA 1W85B 1WBBA 4H9GA 1UKAA 1DAFA 3D8TA 3WQQA 1BGXT 2WIGA 1OI3A 1XDWA 1DHTA 2JFYA 1Q0TA 3C39A 4IDCA 4DA9A 5CVVA 4P83A 3WBFA 1XDBA 2AK2A 2XYGA 1PT8A 2YJNA 4TSRA 2RK4A 5B37A 1E3TA 3H8SA 3BJZA 1BS1A 3SMVA 1QHIA 3OOWA 1VZ2A 2QY6A 4O4HA 5FTNA 1VYUA 4GRDA 2OK8A 1F6WA 4GT1A 4F4FA 5ELLA 4BDSA 3C85A 3H11B 1K06A 3SLKA 3IAM1 4CEHA 4RORA 2A3RA 3ZCTA 5EJMA 4Q7JB 2JGKA 2ZI9A 4ND8B 4FCVA 1U0RA 5L95A 1SG0A 4DYDA 4KVFA 1GG5A 4CM5A 5E2AA 1DKNA 1NXOA 1Q15A 2D74A 3A1EA 4PS0A 5EINA 2XXAA 1D9XA 3PFHA 3OPVA 4LS3A 1L8QA 1RIFA 3LNTA 1D2RA 3W8EA 1EUCB 2NO1A 1NBHA 2G70A 3DBRB 3SVLA 3RSFA 2D8MA 2YUTA 2ZETA 3AIKA 4KUGA 3SZOA 2V6FA 2R7LA 4YXFA 4X3PA 1NE2A 5A3QA 4JBLA 1QRUA 4NJEA 1D09A 1TKAA 1C29B 1QHGA 1T9GS 2BE7A 4Q12A 2PQ0A 1KFKB 3L2OB 1BXRA 4BXOB 2ZUSA 1JMYA 2PNFA 3CRZA 2DPHA 4BX0A 2BFDA 1Z4OA 1ZWKA 1UXHA 4WXEA 4E7OA 2O2SA 2YNMD 4GEKA 4BE9A 4BO8A 4CFSA 4OYLA 3WGNA 4QVGA 1KEEB 1QZ3A 2O2XA 3ITNA 4MIYA 2OKCA 3HRIA 2IU0A 1U2RA 2YOHA 4E46A 3FOEC 1FDSA 1GZ6A 2FNAA 3EGXB 3ZVMA 2YBDA 2XTAA 2CXHA 3H7AA 3O2QB 4V0NA 2J3KA 1PG5A 4LXIA 4B81A 1KK3A 1JFFB 3IELA 3OF5A 3FIJA 5T3UA 2A9FA 2HK8A 4I3HA 2DZDA 1LY1A 2V6MA 1CR6A 3QRWA 1NLZA 4D9CA 5CFPA 3FAZA 3OX4A 1E3IA 1QXSA 1SKUA 3ODPA 3O8OA 3OQBA 4BV2A 4DW8A 2DHQA 1MPTA 2ZYUX 4MDEA 2N42A 2QMUA 4AROA 4R1QA 3V00A 1O5OA 5J5VA 2R4UA 3WYGA 3Q6IA 4ZHQF 3M3DA 3ZZMA 3P0FA 5LWHA 2DETA 4JL6A 1VJ1A 4NV3A 3P71T 3NKLA 1I1OA 1Z4MA 2BMDA 1ZKMA 2KS6A 3ANXA 3GF4A 3KWMA 2P5SA 2Y1LA 3DAFA 3TZQA 3IUMA 4OJYA 1AHPA 4QPJC 1Z73A 3CUSA 4KRXA 4UQOA 1F0KA 3WYFA 3G6KA 5HNKA 5E6UB 4RD0A 4EO9A 1Y3DE 3JQ7A 2BGUA 2GZMA 3GQBA 2V8BA 3ONNA 3G88A 4DS3A 4C4OA 5BWOA 5M04A 4PLHA 1JDSA 3R5HA 5K1ZA 3U5ZB 2YWEA 4EFNA 1UZMA 2VDKB 2GN6A 3F5MA 5FCDA 1MJFA 2FB9A 4UKDA 4J7CA 3A4MA 3B2QA 3EPHA 2YWHA 2B1QA 3AW8A 5K8TA 5HIMA 3O6VA 1GJRA 4IIYA 2A67A 4K0RA 3VA7A 1Y9AA 4TVOA 5D3ZA 3SJAA 1PNTA 2N1MA 1VYVA 4HT3B 5A4FS 3JARA 2NVUA 4Q3NA 3V3KA 1Y98A 4HVCA 4K9NA 3FX2A 5U9CA 4R9UC 4ZO6A 4R0MA 1GNTA 1NPYA 4GZ5A 1LTKA 5C53B 2NUTB 4GLBA 2O3JA 1KKUA 4DUPA 3BGDA 3VDRA 4REMA 1MV8A 1PYGA 2DWQA 1N5DA 4R5MA 4HGZA 3W2FA 4WCFB 5IX8A 2W6JD 1SXJD 2II6A 2Q99A 3X1XA 3ISTA 4DR4B 2VNAA 4L50A 4RD1A 5IH7A 5DASA 2V0GA 4JJIA 2P79A 4CQMD 4BIMA 2FUCA 4FI3F 2GOYA 2HIAA 2R84A 1XXLA 3KVNA 2CY0A 1AUVA 1Q92A 2BD0A 2PVSA 4UVEA 3WG9A 5EZYF 5K3DA 2DQSA 2BW0A 3RYCB 1U0BB 1H05A 4B48A 5E1BA 1CY6A 2A88A 4RK1A 5J63A 3PJRA 2PCJA 2FQYA 2H65A 5BV7A 2FPLA 3K9QO 3AIOA 4N0PA 5IG2A 4ABYA 2MSLA 4BQRA 2PS1A 2J59A 4F56A 2P5UA 2ZB8A 2C5EA 2OD7A 3ET5A 3OEEA 1ZW1A 4R1NA 1KFJB 2NAPA 2IYZA 2J7KA 1CK4A 4BCBA 2WAYA 1U9ZA 4L6AA 4TYMA 4EKEA 4MARA 2OV2A 2YVAA 4NP6A 3CG4A 2BEWB 1Y34E 4LGYA 1XHEA 4BBJA 4Y9RA 1E9BA 3DM9B 3FOCA 4AS1A 2ATVA 4JX9A 1WSBA 3OLXA 3H8WA 3I9V6 3FGZA 1U31A 3BWYA 3N0XA 2WKQA 5JAIA 3DKIA 2P1RA 3CIFA 4P0TA 2DWOA 4P3PA 4MMXB 5AM5A 3WMXA 5ARBA 3RVPA 2QSJA 4A82A 5IH3A 2RKOA 2R1TA 3O92A 5JI3E 4RV5A 2XUPA 1C30A 3WRXC 3GCWA 5DSXA 1D8AA 1KQ3A 4D4GA 1JMVA 2PK3A 5A4KA 5FTLA 2HHHB 4I5GA 2J07A 3KVOA 1BRMA 1Z0ZA 3QU2A 5BT9A 4BVAA 3R7BA 5JY6A 5DBGA 5TMEA 3GPBA 1TZCA 3DVAB 1OLOA 1JQ3A 4KV7A 4NV0A 3COJA 3FY4A 1WQ4A 1OUMA 2DPLA 4DG5A 2GDZA 1WXHA 4ZVVA 4Z51A 3AP1A 1E79A 5E38A 4FDUA 3BILA 3SHTA 2H7XA 2WAXA 2V65A 4A6EA 1RRPA 2FZ5A 3ABRB 5HRCA 1BOOA 1VB5A 3WKCA 3O75A 4HB3A 3VU8A 1OFUA 2UVPB 4NL4H 2VZ0A 3R6DA 4OBWA 5ADUS 3K70D 4MLZA 1I7LA 4CN9A 1L4LA 2IOFA 3C6ZA 2ZE6A 4HQKA 1JTEA 5EPOA 5ITWA 5B1YA 3UWMA 3IBSA 4IL5A 1TUBB 2RH5A 2I22A 2VSFA 5AW7A 5JJKA 3FUUA 4JR0A 4L8WB 1AH2A 1GYRA 2OBXA 1H8HD 3S2ZA 1UFRA 4F3YA 4ABTA 4JLKA 1AKTA 3RS3A 1FZTA 3E22B 3K8QA 3PGMA 1BTOA 3BH6A 1UAGA 1UK6A 4RDIA 1QAQA 4LXYA 4L0MA 2VNHA 4Y9UA 4DDVA 2BEJA 2EW1A 1KWKA 2C4MA 2BONA 5E6RA 3SOPA 2AIRA 3GDGA 2X9VA 1QAOA 3L1UA 3LQ4A 3R7FA 4NE9A 3RYFB 5A5EA 2B83A 4HK4A 1JEOA 3H2HA 4P86A 4BNUA 1XEWX 2GF2A 2ZS8A 3BMCA 3EZNA 1P0FA 1UDCA 2UKDA 4KJXA 5AM3A 3BREA 3S1LA 3VJKA 2X0DA 1THTA 3WIVA 1PFWA 5L3SB 3KQKA 2WSMA 4QAQA 2DAPA 4ENRA 1KAGA 1BMFD 3AY7A 1NFQA 2G36A 2AKAB 4FI3C 3ROXA 4Q3AA 4D96A 2HW8A 1RQNA 4I6JA 3HJUA 4PWZA 2XWSA 2Y3IA 2XUFA 1U63A 3Q0EA 4NS1A 2FDXA 2DPXA 1DFGA 2PX0A 1YR7A 4ASUD 4F85A 1MEJA 5AUPB 1N33B 3LD9A 1XROA 3PXXA 5J4LA 3MJTA 4FFVA 4II3A 4HB0A 3BB3A 1H2WA 2FGKA 4W1RA 4B84A 3NVDA 4RLSA 1C4XA 2GFIA 3GGJA 4WLOA 4IIUA 3BGIA 4MGEA 3UGKA 2QLBA 3IV6A 4JL8A 4XOUA 1GZVA 2C31A 4WK4B 2H2WA 3DD5A 4XSGA 4DKJA 2VWPA 1CVLA 4NRDA 4PCLA 2G8LA 2WE7A 2WKWA 3UXEA 3O8BA 5DN9A 2DFDA 2LDXA 2ZOSA 2CMKA 3IP3A 2WJVA 1QQAA 2Z6VA 5FI5A 3L05A 2X7HA 1MRSA 3N8HA 1WABA 1FVHA 4D8VA 1P61B 1YRAA 1Z8HA 1VCIA 2ZSBA 3V4SA 1RAAA 4RHEA 3T95A 4XQ9A 1SVNA 2FRDA 1J5EB 4G1VA 3P2MA 4C29A 1KP9A 2PKCA 3I2FA 4WADA 2JANA 1HA3A 2GBCA 3EZYA 1AK1A 3QVWA 2IOFK 4QTZA 3I83A 4WLEA 2BJWA 2O7NA 2ZTLA 5JCJD 2PUDA 4AY2A 3RJ9A 2VYFA 5EPEA 2V7BA 1Q7GA 4FLEA 2C2BA 3JQGA 4HUQB 4ZU1X 5LL6P 3AHFA 3QY0A 4ZOLA 1NVKA 2PS9A 2FQ1A 3OQOA 2BBOA 3DEIA 4BVFA 3I5MA 2G9RA 4BLOA 2CUTA 1VSVA 1MH9A 4PLWA 1RE1A 4KG7A 3RJMA 3IDZA 2A0WA 1PS9A 5G40A 4ZOQI 4Q4AB 5B12A 5FA6A 5IDWA 3VOSA 4B6QA 4RCVA 1GGJA 2PKXA 4X7BA 2W37A 2VRNA 4V0QA 3W7BA 4R8KA 4ZALA 2Y1OA 1FK8A 4M46A 4PPYA 5F9HA 1ST2A 1OH6A 4F1JA 4PNEA 1RD4A 1NLUA 3NHMA 4KMRA 2A78A 1N0HA 4I4TA 1O97C 2R6FA 2XHZA 1LC3A 2G0AA 2AJBA 3A1WA 1US8A 2IGTA 2WWXA 3F49S 2I54A 2ZI5A 3ZU5A 5T7BA 3NKFA 3SQNA 2Y2UA 1YH3A 2NXNA 3R24A 5BR4A 8GPBA 2DJ5A 5KNCD 3HO1A 1ZGZA 4BU0A 1OYVA 2Y1FA 4JH0A 4TTSA 3K73O 3R3UA 1H9AA 3PKJA 1UBLS 3ZGNA 4B44A 1G20E 3CZAA 4D0RA 3MWJA 1GEGA 3ZDRA 4F92B 2EFYA 3WWYA 2OAQ1 3WLRA 2YIMA 4D9EA 2Q1SA 1MB3A 3I72A 3L0YA 3PQ7A 2W00A 2FCAA 2LIPA 3Q7PA 1TRHA 4Q19A 2FUG6 4M36A 2GA9A 2JHCA 3SF0A 3T15A 1BROA 3ZNQA 4TWIA 5ALDA 4CMEA 1J8DA 2HJWA 1CE8A 1JILA 1M6VB 4ITUA 2HPHA 2RAPA 1TW3A 1ACMA 3DLIA 1F3LA 4QXQA 1NWHA 1Z45A 1O5IA 4DDHA 2GXAA 3F0TA 1IVYA 1CS0A 7ADHA 1XVVA 1YDFA 2BM9A 5FR1A 3QMPA 4TS9A 1IN8A 5WRFA 5AK4A 4PYNA 3A14A 4S24A 4CL2A 4K03A 2G8NA 1I2BA 2PQ2A 1UOEA 4B7CA 4LKRA 4N5IX 2AG8A 1PDWA 1RU3A 3TNYA 2B25A 4LK2A 1GQYA 4LHWA 2ONYA 4ETWA 2BGIA 2QA5A 4JLPA 3GLFA 2C61A 2C42A 5I5EA 2F2TA 1YCFA 2VAPA 3RI3A 4XQCA 3H6HA 4HTFB 2E2WA 4MWGA 1KIAA 2GTPA 4OQZA 5CCBA 3CONA 5F1KA 4NXMB 3W5HA 1KBZA 3BGSA 5CNJA 2WILA 3KQYA 2OPBA 3DDHA 3F96A 5F2NA 1UPTA 1CP2A 3N2GA 3QEKA 4P58A 2GK7A 5IEBA 1U4OA 4BVEA 4DV3B 2FG5A 3AI7A 1O96B 4XYMA 5JUWA 1X7GA 3QLUC 2R86A 2WD7A 3I6MA 5CH3A 4QZVA 2JLCA 4URZR 4AO7A 4KTTE 3A9SA 3TD2A 4MW9A 1H69A 1I80A 3DQZA 4ROTA 3HMQA 1S2DA 1L6IA 4GPD1 3AVWA 3OP1A 1OH7A 3T5CA 2I1VB 1YI1A 4XCQA 2ENUA 4C7OA 3I73A 5A6SA 1VL0A 4R16A 3CE6A 4OREX 3EVEA 4GWKA 5LQAA 1XDUA 5BWLA 2BHTA 5LOVF 2WWVD 4D74A 3TVYA 3PLRA 3AOEC 1VG0B 3KZCA 4BNNA 4WKOA 1MQ9A 2FZCA 3QUQA 1ATZA 2D5BA 3DAPA 2PH3A 3CMMA 3D0RA 4NTZA 5FWDA 1D2MA 1DQPA 3UB3A 3MFYA 4IJVA 4C07A 1KMHB 3P9IA 3HY4A 2GK4A 4K9DA 2P3SA 3O9VA 1NZFA 2ZZKA 1S2IA 3Q3GE 5JS7A 1FYVA 2C03A 2V7QD 4E0BA 2OO7A 3DF7A 3K4PA 5KPDA 3FYUB 4X65B 3UA3A 1LK0A 3T7KA 1ZCZA 1EWTA 3A0RB 2QB5A 1YDMA 2JGDA 1Y5RA 4G1MB 3FG9A 2D7JA 3L0DA 1N92A 4NYIR 4NJEB 1ATIA 3JR3A 4X44A 4V0RA 4ZPXA 4QATA 3MQFA 1Z07A 1PW7A 2JHFA 3JTEA 3WIEA 4D4KA 4W7IA 3NAQA 2X4IA 1C14A 1A4IA 1H6AA 5KS2A 4XDYA 5EIBD 4CW7A 4QU8A 1CD5A 2JJMA 3RYHB 3UKJA 2OGZA 2Q5LA 1E61A 2VDUE 4WD3A 4A2CA 4YUXA 2ZXUA 3F1KA 4M1OA 3PYXA 3SOZA 1IZYA 2OILA 1E4YA 2DGDA 1T9AA 3GZNB 3MUNA 1Q77A 2YXPX 2ZRKA 3FR8A 2PZ8A 4QBTA 3HACA 2WFLA 2FHSA 2YTZA 4UU1A 4LSZA 1KJQA 4AJJA 3GG9A 1Q6YA 2E1PA 2C83A 3DNMA 1CJBA 3OLZA 4H4DA 4B32A 1W30A 2IP2A 3LTEA 4HD8A 4JLAA 4UREA 3LCUA 3BFVA 1WXQA 3CUVA 2Z98A 1OFIA 1JKJB 5JRDS 2D1FA 3HPQA 4I4LA 3V1YA 3RYIB 3UK0A 3LHKA 5DBEX 5B1HA 3OE7D 5ED0A 3ZW8A 5B6JA 1P1CA 1P1FA 2I8CA 2X6QA 3PSHA 1X3SA 3GCGA 4K5QA 1LNQA 3SIRA 3JQ7B 2B92A 3K0AB 2ZUCA 3VU1A 5KREA 2IFTA 3Q7IA 2EU8A 4DMFA 3EBLA 3U4AA 1EZZA 1A5BB 1AC5A 3BXEA 1UFQA 5D00A 1MHTA 2ZXFA 4MH0R 2P65A 1RKVA 1TIKA 1QLWA 3VC7A 3S2FA 3NIGB 3ZLJA 5AOAA 4KPUA 1D2GA 5TVKA 3E1GA 2WNHA 3TAHA 4UJ3A 2BKXA 3UV6A 3ZHRA 2X7XA 1HL3A 3CTMA 2O8CB 1FP4A 1RXUA 4XUDA 1P3Y1 3BCUA 5CPBA 1KBOA 1FSZA 2GM5A 5IHXA 3KG2A 2O8VA 4HAUA 1KJIA 4Y67A 5GJWC 4GBED 3TI7A 5K3AA 1ELOA 4DFDA 3CNBA 4DGSA 4QQFA 1J39A 4CKEA 1T8WA 1HE5A 1WWKA 1A2OA 3PC2A 4HOYA 5KINB 3QBTA 2XITA 2ZAYA 1XD8A 2YWBA 1CX9B 1CT9A 1IJEA 1Y0BA 2XDAA 4MCIA 3S68A 4CIBA 3GY0A 4OB7A 3ZCRA 3EXG2 1NW3A 1Y1KE 5KJCA 5KU1A 2CFCA 5JRJA 2ZIVB 4G5RA 3ISVA 3RQSA 4Y18A 4EJMA 3WRXA 3EIWA 3AONB 1E6EA 3IODA 2H5JA 1R8YA 5ICGA 3EGWA 3JX9A 2P2GA 3M5CA 3PIIA 2HSWA 5CEEA 1E18A 5MHTA 1J2RA 3PRHA 2H0AA 1JWLA 4FZ5A 2JDIA 1TT5A 1D03A 2XNHA 3KYBA 4KHZA 1FYEA 2HXGA 3TWOA 3U49A 4C4YA 4NNOA 4JXKA 1Z4IA 2X4LA 1ZGAA 4S1PA 3WAGA 2QXYA 4FQ8A 4V03A 4WLNA 4ZJUA 4I14A 3EC2A 2UZ3A 3ORSA 5TGZA 1QE3A 3AJDA 2CK3A 1V43A 3LI2A 4OGWA 3WR5A 4AICA 1PWYE 5HVNA 1L8AA 2IP4A 3KU4A 3U4DA 1LFDB 2XMZA 5KVQA 2H5LA 5G1PA 2LCFA 3ICQB 4DQXA 1LRLA 2CXSA 4NMHA 1JLHA 2KLBA 4P35A 3R0JA 1Y8QA 2P30A 4N48A 3A27A 1F6BA 2O50A 2XRMA 3K1YA 4ZZIA 4WNIA 3AL2A 2QT1A 1KH1A 2R1TB 3HUFA 1T4GA 4IF6A 1Y8CA 1GQOA 1L5RA 2DFTA 1GAWA 3E9CA 2N1BA 2HI0A 4TT8A 1G5PA 4PZUA 1QV6A 4M1WA 3ZEAA 5TARA 2Q5CA 4TYNA 3EHDA 1SOVA 4RD3A 1K4MA 1D1TA 5E6SA 4DLVA 2DFNA 4RTOA 1JIKA 3VI3B 3RM3A 5I7SA 2XTMA 3EMBA 3T7JA 1U8XX 4BJ5A 4U3JA 3KWFA 1Z7WA 1EI9A 1SU8A 1N7IA 2WIBA 3AZPA 3M1IA 1USWA 4JGBA 1H1DA 3Q4GA 3VR5A 3JYNA 4DY4A 1IPHA 1I7DA 1RAGA 4X54A 4Z1OA 4CIYA 3AVVA 3X1YA 1KY5A 5EMJA 5BV1A 2H2GA 2ZIGA 1RRFA 1UOPA 3C6XA 3VSCA 1R00A 1VCOA 5JS6A 4L5JA 4UTXA 4F46A 1SJ9A 1A7JA 2H9YA 3RC9A 2WF5A 4EB8A 3A3PA 2XYRA 4WEQA 3WTBA 3L93A 5JANA 1NZDA 1VPDA 1QVRA 1K6XA 1LB1B 1V95A 2AMJA 4LGMA 1PFYA 2ILTA 4M55A 2C20A 4GICA 3ZE1B 4C1NA 4D0GA 3J81A 3C5VA 4AN4A 1VL1A 2AN4A 4WGFA 3GLGA 1XVAA 1QGAA 2WINI 3P7MA 4L8GA 2OYCA 1P9NA 4AY6A 1WX1A 4PZYA 4DCCA 3BMCB 3UUFA 1II8A 4ALIA 1VI2A 2WUFA 4RW0A 5DM2A 4GRAA 4BX9A 4UUNA 4GUAA 5ENDA 5KQLA 2JLZA 5H59A 1WXXA 3MRSA 4LDPA 1C0PA 2VFAA 3AKDA 3B53X 1E92A 1L5MA 1YKFA 3GB9A 4AZWA 1TF2A 3VPCA 1E2PA 3BQ9A 3X44A 3KFLA 4YQEA 5KYKA 1QFJA 2CSUA 3BL8A 4YXWD 3BXFA 2CXOA 1Z06A 2NSJA 2VJMA 4BZQA 4R2JA 2ZYHA 2JI6A 3LYHA 2Q3FA 1FIUA 3IE1A 5BWCA 4JJ4A 2GKGA 3R0VA 4MEAA 4NF2A 4UVIA 2DTXA 1CY8A 1GLVA 2BF4A 4HN4B 4FS8A 1LF0A 3RREA 4RK0A 4W1SA 4JP5A 3HJFA 4BZPA 4IH9A 2AVNA 3QWIA 5IJWA 1W35A 3K0CC 2X42A 4DMKA 1VE7A 4JDPA 4XM0A 2G88A 4KIWA 4M2LA 2J9ZB 3D6MA 2B4AA 4LWQA 5CTAA 1XP8A 3RT7A 2YMPA 2OXCA 3CW9A 3HY3A 3IALA 4KRGA 5CIYA 1KAHA 1IHOA 4X8HA 5MFZA 3CR7A 5ALNA 1CY4A 4R1OA 2FMXA 3GT3A 13PKA 2C9MA 3HMKA 5TX7A 1LRJA 1W73A 2FWMX