1DP4A

Dimerized hormone binding domain of the atrial natriuretic peptide receptor
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
425
structure length
425
Chain Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the dimerized hormone-binding domain of a guanylyl-cyclase-coupled receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor receptor, lyase
molecule keywords ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
total genus 144
structure length 425
sequence length 425
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dp4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dp4A01
1P8AA 3NNDA 4KQ9A 2PJUA 1NXOA 2JRLA 5KC8A 4N03A 4KREA 2WJAA 2JCGA 1NATA 3A3KA 3QEMB 2JB9A 4RXUA 4MR9A 4MYRA 2RGYA 4LE1A 1TJYA 2AYZA 4Z9BA 1JWLA 3NHZA 4N0PA 2GKGA 3FDFA 3KLNA 5HQJA 3O2JA 4MQFB 4RK0A 4H3HB 3I5AA 4Q7EA 3JVDA 1R8JA 3LKBA 4WZZA 1M5UA 2GI4A 3H6HA 2LIVA 4PICA 5KQPA 1QP0A 2FQWA 5FWXB 2FKAA 5JNSA 3OQOA 4S04A 1ZH2A 1J56A 3RVLA 4S05A 1NXSA 2BGGA 3GBVA 3RVRA 1YK0A 5JNUA 3IP6A 9ABPA 4HNSA 1LBIA 4KK3A 4NQRA 3C97A 2RJNA 5DCLA 3RVNA 1LK0A 1ZESA 2MSWA 2RDMA 3RVMA 3FFXA 4TMYA 2PKXA 4MLDA 2PUFA 4KVFA 1XHEA 2QXYA 3N0WA 1VRVA 3O1HB 5EWMB 1URPA 2PUAA 2PUDA 4MS1B 5C5EA 3L6UA 2HQOA 3JY6A 3O21A 3T95A 4EUKA 4MQEA 4MQEB 2QVCA 4G0MA 1C4WA 1HEYA 3LFTA 1PEYA 2LUOA 5JS2A 4Z4IA 1A2OA 1RNLA 2LPMA 4MAAA 4E7OA 2E4UA 5IUNC 3S99A 4L85A 4RXTA 1QP4A 2R4QA 3LOPA 4HNRA 5TQ2A 1ZGGA 3CFYA 4Z4EA 1DRJA 1YIOA 5EWLA 2PUBA 4G97A 1KRWA 1CHNA 4MR7B 2HJ9A 5EWJA 3KHTA 1JLKA 4RS3A 2JVIA 1C0EA 4RY0A 3L49A 2LP4Y 1FFGA 4KRFA 1D2AA 1LBHA 4KZKA 2HQRA 1K66A 1GUBA 4B09A 5JS1A 4F12A 3O75A 4MS4A 4NV3A 3SG0A 5B3JC 1KRXA 3GV0A 3IPCA 2QZJA 4DN6A 3VNAA 3DBIA 2YHBA 4HNQA 2WMYA 3CG4A 4WXMA 5GQSA 4MRMA 1L5YA 1A0OA 1DCMA 3H5OA 1E6MA 3KG2A 4IMJB 5TPWB 3JS5A 4H3KB 1FFWA 3OLYA 1H9CA 1YS6A 2KYRA 3F73A 4EVQA 4W5QA 3K4HA 3D8UA 1FFSA 3HV2A 4XFKA 1TMYA 2IOYA 2MSLA 2NZUG 2FLKA 2ZAYA 3EGCA 1JF8A 4WT7A 2E4ZA 1ZH4A 4G0ZA 2Q5CA 4LDAA 1M2FA 4XASA 2PAFA 3EDCA 4QYWA 1QQAA 4FB4A 3OQMA 3H5LA 4JASB 1DJMA 3FFTA 2CHEA 3P9YA 4LZLA 2HPHA 3GT7A 3KYIB 2I6FA 3QK7A 2FEKA 1E6LA 3DGEC 1DCKA 1S8NA 2P9HA 4LRQA 1SXIA 2QSJA 1MVOA 5EWMA 4ZYLA 4TN5A 2F8SA 1QO0A 4DADA 5T7BA 2QVGA 1Z17A 2JK1A 4YO7A 4QICA 2PL1A 1RPJA 4PE5B 1DBWA 1AB5A 5IBQA 3OLVA 3EULA 1RZRD 4D6YA 3ILHA 4ZPJA 4OATA 5E3JA 1ABFA 1VLZA 1ZGZA 1QKKA 3H75A 2M1ZA 2QV0A 3CTPA 4IILA 4MR8B 4RU1A 3RVJA 3W9SA 4RKQA 1USKA 2FN9A 5D2CA 1D1QA 1TLFA 3I45A 4Q6BA 3BREA 5IX8A 1GUDA 1QMPA 3H1FA 4MR7A 5I4CA 1A04A 1YK1A 4EY3A 4F3TA 3LKVA 3N0XA 4FE7A 3I09A 3N53A 3JVIA 1Z2EA 3OLZA 1QQBA 4W5NA 1XWWA 5CNIA 5B3JA 3LTEA 1U2PA 2FQYA 4JP1A 5IEBA 1CYEA 1NXXA 4RK6A 5JNRA 3HDVA 3KLOA 1EWVA 3RH0A 1NY5A 2AYXA 4ML3A 3KS9A 3LUHA 5HM6A 2M98A 1M5TA 4RKRA 1P6UA 1GCGA 3CG0A 3BILA 3KKEA 4Q6WA 4RWEA 4N41A 3QLVA 1JFTA 4MQFA 1XHFA 3M6MD 3HM9A 3MMNA 3E3MA 3ROFA 6ABPA 3HXMA 2R25B 2QW1A 4LE2A 5HSGA 3OM1A 5FWXA 1ABEA 2VK2A 4RDCA 5BRAA 1ZY2A 4G0OA 1SD5A 3TO5A 1SRRA 3GBPA 4JAVC 3N75A 3SQNA 2GX6A 4O1HA 3HJFA 4N76A 1BA2A 2E4VA 3T8YA 3N8IA 1KGSA 2CHFA 5IC5A 6CHYA 4RXMA 3QLVC 2ID9A 5KWSA 1W9HA 2IPLA 3HVRA 1JDNA 1ISSA 4JB0A 3KYJB 4MS3B 5CNJA 2PUCA 1DRKA 2L2QA 3IP9A 4IF4A 1YTUA 3CU5A 3RVQA 3A10A 3KCNA 1D4ZA 1ZDMA 3MF4A 3NNNA 4EVSA 4YRZA 2E4YA 2PUGA 3LUCA 2JVKA 5BQ3A 4YR7A 4PEVA 4Z4HA 1GCAA 4MR8A 1JYFA 4KFCA 5IUKC 1MB3A 4L4UA 4O1IA 4JA2A 2PMCA 2OQRA 2FMKA 2J48A 4OBBA 3TD9A 3EAFA 1JFVA 4YCSA 1QPZA 4MLCA 2JVJA 1U8TA 4QYMA 5IUJC 3Q41A 1BDJA 1QO0D 3OM0A 1K68A 5BR1A 1BDIA 1Z26A 3IDOA 5JNWA 3H1EA 5TQ0A 1JFSA 3DLHA 2NZVG 4Z99A 3F6PA 3HDGA 3MIZA 1OXBB 5ABPA 2JBAA 5FBHA 3I42A 5IEJA 5TE9A 2V0NA 3LMKA 5GOTA 3CKMA 1DZ3A 4IRXA 2FLWA 3BRQA 1Z16A 4XAQA 1WETA 3HSYA 5TPWA 2IPNA 3GYBA 3MYYA 1AB6A 4N0QA 1F51E 3LUKA 1YVUA 3N0RA 3HUTA 4WUTA 1OXKB 4G86A 4Y9TA 1D1PA 1T34A 2ID7A 8ABPA 1QNLA 3D02A 2IPAB 4P1ZA 4KPYA 2FSPA 4RY9A 3H5IA 3OLWA 1EAYA 2H0AA 4D6XA 4N47A 3CLKA 1ZN2A 3OO0A 5CNKA 3KJXA 3GRCA 1U04A 4YGXB 4UHJA 3OMXA 3OMWA 1VPWA 3QELA 4G0PA 4WXEA 3BRSA 3QLTA 2H3HA 1ZHHA 4PZ0A 1YS7A 4OTZA 4TLLB 1DC7A 4MS4B 2R47A 4YLEA 1I3CA 3C3MA 2TMYA 4MS3A 1DCFA 4MGEA 5FWYA 1PNTA 3M9XA 4E7PA 2WRZA 3RVKA 3H5WA 1ZITA 1JDPA 2WJWA 5TPZA 1SXHA 1B00A 2L19A 3Q7SA 3MM4A 2F8TA 5F64A 5TQ2B 4ZJPA 3RVOA 4Z9AA 2PUEA 1KMIY 2FXIA 4NICA 4RY8A 1Z13A 3DLBA 2FEWB 2HSGA 3NNSA 4RK1A 3TX6A 1QP7A 2CWDA 2NT4A 2HQBA 3KSMA 3CHYA 1DC8A 3UUGA 3H5TA 1USIA 2JBAB 2FMIA 4LDZA 1LJLA 4HYEA 3SNKA 1VKRA 1E6KA 2GBPA 3K9CA 3R0JA 1D5WA 1RXIA 2MYTA 3ILYA 5C5CA 3OQNA 3CNBA 3LUGA 2A9RA 2B4AA 2MYPA 2MSKA 1JL3A 4ETIA 3G1WA 2PLNA 1USGA 3GWGA 3H1GA 4O5AA 4ZMSA 1MAVA 4KV7A 2IDMA 5KI6A 3B2NA 4JB2A 3O1IC 4W5OA 5CHYA 5EWLB 1BVHA 5BRJA 2N9UA 1F4VA 3E61A 3Q9SA 3KTOA 3SY8A 4IGAA 5KQGA 5DTEA 4GPAA 1UDRA 3HUUA 3QX8A 1LJUA 2WWVD 1Z25A 3EODA 4FE4A 4EVRA 3IP5A 1IIBA 4MS1A 3O74A 5PNTA 1RXEA 2WB4A 3OO1A 3H5VA 4DQDA 4YS6A 1NTRA 4RV5A 5FWYB 2E4WA 3LUAA 2FMHA 1ZAYA 3QLUC 1Z18A 2VUHB 2A9QA 3HEBA 3HK2A 4RK7A 4RK4A 4KK4A 1JHZA 4XLTA 4Z4GA 4LX8A 1DBPA 2FMFA 3DZDA 3URMA 5CNMA 1CEYA 4M88A 3SAJA 1JYEA 3FGZA 2L18A 3OLXA 1ISRA 4D74A 4EYQA 2FEPA 2FVYA 3IP7A 3LUDA 3Q7RA 2WY2D 5ED4A 2PE5A 4Z4FA 3QEKA 2VUIB 3GL9A 1EFAA 5TQ0B 4OLAA 4UHKA 3SM9A 4YV7A 1BDHA 4XARA 3EJWA 3QEMA 3F7NA 3QLUA 5HKOA 2DRIA 4OG2A 3C3WA 1DBQA 1U0SY 5T3YA 5KC9A 4KNYA 4OLBA 4KMRA 2CD7A 3O1JC 5DGCA 4Z4CA 1FSPA 3LUFA 1TM2A 3G85A 4LE0A 4ETMA 2MYUA 2QU7A 4Z0NA 3C3KA 3UK0A 4EGSA 1YMVA 3MA0A 2QR3A 4GNRA 4ZMRA 7ABPA 4NCBA 1P2FA 4PYRA 1ZVVA 4G0QA 3M9WA 2RJOA 1PNRA 5JNVA 1JH9A 1YMUA 1NXWA 1PEAA 1U2QA 2FQXA 1DP4A 4XXHA 1PHRA 2X7XA 3IPAA 3GA5A 3QX9A 5JNTA 1TVMA 1SXGA 2P4UA 3FFWA 2O20A 3HCWA 3CZ5A 3RVPA 5KQMA 1Z2DA 2LBPA 2MYNA 5TPZD 4WWHA 2ZWMA 3LUJA 3Q15C 1NXVA 4QPJC 1MIHA 1FQWA 5DLEA 1L5ZA 3JPYA 3N6VA 3QELB 4ETNA 3A0RB 1Z12A 2L17A 2OENG 2YHAA 4MR9B 3EQ2A 4TLMB 3TMYA 1NXTA 2A9OA 5KQLA 3CS3A 1Z15A 4G0XA 1EWTA 2B1JA 4W5RA 1M2EA 1Y1LA 2IKSA 3VNBA 4EYOA 2FTKE 4EYGA 5TQJA 4NCAA 2VYCA 2R48A 3BBLA 1JX6A 2GWRA 2W42A 3H6GA 4RSMA 4F8JA 3RQIA 2IPMA 3F6CA 1GLGA 1W25A 3JPWA 3JTEA 3HS3A 3Q7TA 3FMVA 3NHMA 3TB6A 3O2SB 1P6QA 3HZHA 1APBA 3O2QB 5FBKA 4KQCA 1RZRA 5IULC 2XDYA 4YP9A 1EWKA 4JOQA 4F11A 4F06A 4MPTA 4W5TA 4MRMB 1MB0A 2FN8A 4H60A 3EQZA 4CBVA 4IMIB 2E4XA 3CRNA 5DKFA 3UKJA 1BAPA 3NBMA 1NXPA 3MQ4A 2PL9A 4EYKA 3C6QA 3T38A 1EHCA 3CZCA 4RZSA 4YWHA 3RVSA 1DG9A 3ROTA 4G0YA 1JBEA 3A0UA 2A9PA 4P98A 3DGFC 5EWJB 3HO1A 2FW0A 1E2BA 3T6KA 1PUXA 2NUBA 4RK5A 2NT3A 2IYNA
chains in the Genus database with same CATH superfamily
3SS7X 4RH3A 4BEWA 2JRLA 2K4MA 5KC8A 1ZSYA 5KSZA 4YHHB 3U3KA 1GNTA 2OWDA 3WIEA 2ZAMA 1JZQA 3V2UA 1OI2A 3KL4A 1OJ7A 3ZCTA 1B4DA 1EBUA 3KTFA 4IXNA 1OTHA 4H17A 3PNOA 2GZAA 3U3RA 4M8LA 2P6RA 1N32B 4YMTA 3EAQA 4KXQA 4X7RA 4L8VA 2AMVA 3JWIA 4MQFB 3I32A 3ELUA 1KOLA 5LM3A 1IN5A 1JJBA 2GCGA 2JPDA 3E70C 4HUQB 5IC6A 2VDLB 1CEQA 1MA0A 3R5TA 1XTSA 1PSZA 3WGVA 2R60A 4C6RA 4HGQA 2HX1A 3RUEA 4EF4A 2CXQA 2HFKA 4Q48A 1U7WA 3GJYA 4JBXA 1JIUA 2PQ2A 2XNHA 3SZMA 4BU1A 2BGGA 4AWAA 2Z2KA 1FUIA 4MYTA 3BIOA 2GRJA 5EEHA 1TD1A 1YK0A 3JRNA 4V0RA 4AKSA 4NTZA 4FZVA 4YCLA 4X1OA 3DF9A 1OX4B 4Q1AA 1UXJA 2ZSBA 1VE5A 4B74A 2Y92A 4TTRA 4F86A 1J21A 2XY4A 1A1SA 4V1CB 2JCSA 2OZKA 1UMKA 1XHEA 2A9FA 2Q1SA 3I9OA 2ZRAA 1TU4A 4FGUA 4PLVA 4FX5A 1D2GA 1GRQA 1KAQA 2VUUA 1JSZA 4DXAA 1NU6A 4MUMA 2CKMA 3ZV4A 3WB1A 4BN4A 5FEUA 4HEQA 4QDUA 3RTEA 3K2IA 4MGZR 2RH5A 2ASVA 2RI6A 3I2GA 2GA8A 4OHOA 4W99A 4X71A 5JS2A 4QUEA 2PA3A 4AO6A 2GPAA 3BF7A 4ZWNA 3VV2A 4MGKR 2H2DA 1FDWA 2KBEA 2ZUCA 3V9PA 5EJ5A 5IXSA 2OHVA 2C1EA 2OHJA 3HL0A 3QW2A 2WJJA 2LRHA 3C85A 4INZA 1N5LA 1U2SA 4AM8A 3D64A 4LJAA 1YIOA 4HQFA 4TSFD 2EJUA 4CLDA 3AF3A 2ZB7A 5KTTA 3E05A 1KZ6A 3OMLA 1Z63A 3HYTA 2R4TA 3ZWXA 1N77A 2J0EA 3LPLA 1VCHA 2GETA 4WX2B 3R20A 4YC7A 4PS1A 3CUKA 4W5JA 5B6PA 1V9LA 4KZKA 1WCV1 1BJKA 4H4DA 4MW7A 3UW3A 4D4IA 1MC8A 2BFFB 4MDYA 2BEVB 3DMHA 3FYDA 5DBFA 1XBTA 3EIOA 1TUEA 3GNSA 4YGYA 2DWOA 4NV3A 2EC5A 1RYMA 3H4IA 2DE0X 3UY4A 2W8ZA 3IEKA 4CQLA 4EG1A 3VNAA 3L0BA 2WKSA 2X22A 2CVQA 3D0RA 3LHKA 1QGUA 5T4BA 1QRAA 4EG3A 4WXMA 2W6PA 3JQAD 3T1YB 4MRMA 3H5OA 2W22A 5J4HA 1B8VA 1FSZA 2R3SA 2P5YA 1BU8A 3BJZA 3D81A 5EHNA 2C3PA 3COZA 5DWVA 2H2HA 4WK2B 3KBBA 2V8BA 2ZT8A 3D1LA 3PK0A 3HB5X 3K73O 3L9WA 4XLLA 5L53A 1PQWA 4EPXA 1KERA 1Z73A 3E1GA 2E5FA 3OCXA 3I9JA 3OHPA 4HTAA 4WT7A 2Q0HA 5HEKA 1ZH4A 4I1PA 4MPPA 3OFVA 1M2FA 3SYKA 4XX0A 5A5FA 3EDCA 1DB3A 4DCTA 3NHWA 4Q15A 2ID8A 4M6WB 5DTJA 2QT0A 3ZGLA 2CZQA 3GT3A 1Z6PA 3DTVB 2EOAA 1OY1A 3O38A 1L5KA 4FQ8A 3ROKA 3RO7A 4BX2A 4LFBB 2E2WA 2JF0A 2NUAA 3LNTA 1HTWA 1MPXA 1BOOA 2P9HA 2ZUWA 3CRRA 2D8AA 3E15A 3INTA 3MD0A 5E6UA 4GSYA 3J80A 3A4VA 3FPGA 5L3QA 1UUFA 4IDHA 5AOBA 3BGOS 5CVTA 1YR6A 4ZXPA 4EB3A 1ST3A 2DLDA 2IYXA 4GOJA 4IDFA 2VP6A 4C7OB 1XHLA 3UATA 2BMDA 1YJBA 4R0VA 2UKDA 1CZKA 1SKBA 3AR3A 1DJLA 3QXSA 4JJIA 3FB4A 4HQLA 3SE0A 3ZWDA 3UK2A 5AW0A 1Y3DE 3BQ9A 3KT0A 1A9RA 1ABFA 1WKVA 1JZTA 3C14C 3H75A 1KAMA 4PCVA 1SHLA 3PEFA 2E21A 3X3HA 2XKBA 4PYMA 3LAWA 4G1CA 2B6HA 2JGLA 3NT5A 3BMCA 3HLTA 3RYHA 4MR7A 1GCOA 1A04A 2VXCA 3QXGA 3ONDA 3MMXA 3R3UA 5B4UA 3TTVA 5AKGA 3GLIA 1R0YA 2VYQA 2UVQA 4NXNB 3MG9A 5CNIA 1DTWA 1AHNA 2I2XB 3ZHVA 4NATA 5ALKA 1VFPA 1NXXA 5BNZA 3P1JA 4AXXA 2IVFA 4ERNA 1JG4A 2ZWOA 3MS2A 1C9NA 4PZPA 4DT1B 5J5AA 4FDTA 4FDUA 4N5HX 4NRDA 4XWGA 3TXXA 3AHGA 3CG0A 1OH6A 1Z2NX 1EDBA 1N2CB 3KYCB 4OHRA 1JFTA 2IVZA 1QZXA 2TSYB 2R1VA 2VJAA 2F67A 4Z9FA 1QRSA 3K6SB 1FFXA 3VO2A 1XUOA 1QFYA 2JGKA 2JGIA 3IXQA 4DJEC 6GPBA 1O6FA 1GYRA 3TEMA 2CEAA 2GSWA 2Q45A 4TYMA 5DBGA 1JI0A 4YMLA 3WLIA 1AZSC 1IULA 2NXNA 4A2QA 1UBCA 2RB5A 5ELMA 3UO8B 3BTSA 3UTCA 2D59A 2GX6A 3A4TA 4B7ZA 3ZWCA 1XMVA 2IOFK 3PD7A 4BC0A 4E15A 3QV1A 5DBHX 4GYJA 1BH2A 4S24A 2BHSA 3W7BA 3D6TB 1CQZA 5AXBA 4CMCA 2EJCA 3LE8A 3UTDA 3VZQA 1S8OA 3QVJA 5J4KA 2FSHA 2ASEA 4F6LA 4QM7A 5IAGA 4F5WA 3N3BC 4C5BA 4BFWA 3R7NA 1XD8A 1PX2A 4PQFA 4S3MA 4OFXA 3MRVA 4Z7NB 1UINA 2ADMA 5CA0A 1UBSB 5BQ3A 3NHPA 1BQEA 1MJGA 3FTQA 3IIEA 4EATA 1FA9A 2PWZA 3TD2A 3O92A 2QR5A 4JLOA 4BFSA 3QKRA 4JA2A 1P4JA 2HREA 1JFVA 1CZOA 1I7LA 2QIPA 4BLVA 1K06A 5AVQA 4Q03A 1R64A 4BV8A 2CLHB 4B76A 5J4VA 5GONF 4R0MA 1ZRHA 3F6PA 3NCHA 4C04A 2RGUA 3DMRA 1G20E 3PICA 3UWDA 1RU3A 1T8UA 3FPEA 4G4IA 4C78A 5AIAA 1N5RA 1YQUA 1RVDA 1I7PA 1MDFA 3DKVA 1I32A 1FP6A 1ANKA 4UJ3A 1G2PA 1QXSA 1NMYA 1BVUA 3FAKA 2ZQZA 2WZQA 1WF3A 2QMOA 4J16C 1FYDA 4Y9UA 4BNTA 1RI4A 1R0BA 5KOYA 5AI5A 1Z33A 1GPBA 1IY2A 2NADA 2VG8A 3HUTA 4QFCA 2F3TA 3WLJA 5JHHB 4FZ3A 1QIHA 1YBFA 4WDRA 4ZQGA 4F9GA 2YRWA 1WXHA 4KUGA 3JQ8B 1IHDA 2IPAB 4F72A 3F2IA 3WC4A 3FI9A 2FSPA 1BSVA 4MV1A 3RSGA 4CTMA 4AKGA 1OGYA 1J8DA 4YH1A 2FZ5A 4HQRA 3P2OA 2UDPA 1LLFA 2Q6VA 5HIIA 3R24A 3GFBA 4ZREA 5LBUA 3TVTA 4CKBA 4I08A 2O2YA 5E1BA 1LLDA 2AEEA 4I4TB 1KARA 4QQ8A 4EG0A 2DM6A 1AGNA 2BJHA 5IKEA 1Y8RB 1NIPA 1T3ZA 1Y6ZA 2AI3A 3AVQA 4B6JA 4F5DA 1FY2A 5C2JB 1W94A 2JKZA 4JD5A 1NQXA 2XGGA 4MAFA 1W75A 5CT9A 4JJKA 4YUYA 4FYYA 5JCZA 4GBMA 1U9ZA 1V9CA 1PTJA 1OA1A 3T15A 1T4GA 2ZULA 3SKYA 1E18A 1YE3A 1W4LA 3NBFA 3R7WA 4C4TA 1CY7A 1AUXA 3IALA 4IQ4A 4V0NA 2FEAA 2OFOA 2RHTA 3ESDA 2WJZB 3TTWA 5AI0A 1RCFA 4X8LA 3STHA 1SUWA 1W93A 2CCJA 5C0OE 3WGIA 1Z13A 2ERXA 3SSOA 3C1UA 1CQIB 2ZDGA 3DBOB 4DG5A 3S8YA 2J5XA 1QP7A 1FTQA 1PG2A 2QI9C 2AR7A 3L1HA 1QB7A 4R5MA 1CY6A 2BF4A 2XJ4A 3ZLVA 3V7UA 2F2TA 2VYNA 3NTXA 1ECJA 4JGGA 3Q98A 4ARIA 4PNPA 5CW2A 2BEWA 4HWSA 2IIVA 3ZD8A 2CXRA 1XIVA 2P4EA 5JWHA 4YY3B 2W7TA 1N1EA 1ZGHA 1VMEA 1XZLA 1OE0A 3NBKA 4XOIA 3TK1A 2J4CA 4AG5A 4XI9A 4A92A 2I4LA 4KWCA 4PG7A 3R7BA 3ZI0A 4IHQA 4ZGGA 5JRZA 2OHFA 3IAUA 4FC7A 3FUXA 1T5BA 4ZCLA 1GCIA 2FPIB 2PQ6A 2YWCA 4O5AA 1KO4A 3RBZA 1ODJA 3G7SA 4OAOA 4C4AA 4OQLA 4MVJH 2XDAA 4H7EA 2VP4A 4WIAA 4HB3A 2DHEA 4JB2A 5DSTA 2VOEA 2QAGB 4WD3A 3CBGA 3TOZA 2YFYA 5FL7D 4NYIQ 2HMTA 2QYSA 5G4KB 3DA8A 3U48A 5F7OA 3SR3A 1UFRA 2VDRB 4GO1A 1D8AA 5EIBC 4W1RA 3CLSC 4P54A 1BN6A 3RAJA 3TCNA 2Q2VA 1OGIA 3QF7A 2DU8A 2X6TA 4O2AB 1XVAA 3R9XA 1LWOA 2PD3A 1MAAA 3BXPA 3D0OA 1CEXA 4AJNA 4V0ME 1LV8A 1N4AA 2WTBA 1OBCA 1KC1A 2C3MA 3DBRA 4WFKA 1RHRA 1SUDA 2H1HA 4QAQA 4WASA 4YS6A 5H3HA 3U1TA 5FWYB 2W6IA 1YJCA 2E4WA 1IONA 3EZ6A 4Z7QB 5CH3A 1Z18A 4Z2YA 3U62A 1F8GA 5ARDA 1I1HA 2VDJA 3IE2A 1R0WA 3X43A 1FFEA 2ZJYA 3QGMA 2IA5A 2NZJA 3BMQA 4FHEA 4JBHA 3ZXIA 1NLZA 2B0CA 1EDZA 1FUYB 3DUFB 3B6KA 3LT1A 4GIBA 1G4HA 4M8KA 3VR2D 1L8LA 5SYMA 3UKDA 1YDHA 1Z88A 3MJHA 2HAEA 1T6YA 3DAYA 1MEEA 4IRUB 4G9GA 4JLMA 4M1QA 1ESEA 1TK3A 2C8KA 1VMAA 4ARZA 5C9ZA 3U4QB 1TGVA 3RU3A 3T1NA 3PE6A 4QU5A 2CVFA 3DL4A 4E2FA 1D4FA 5C8YF 3O4HA 3WMWA 4NBSA 2XOXA 2PQMA 4YAIA 3L1JA 4BFZA 2DUUA 3PX7A 3QEAZ 1M34E 1I3MA 2C2XA 4DMFA 1I4EB 5JALA 5AQ1A 2H51A 2GVZC 1OYWA 1RRKA 3RG8A 4C6TB 5CFPA 1JDSA 2FX5A 3EDMA 3JASB 2OLJA 2VPTA 3TKLA 2H1WA 3LCVB 1CUBA 3N2YA 1IZZA 4FPXA 4DR6B 4IDNA 2J1LA 1Q1EA 3TPZA 4C43A 1A27A 4ZMRA 3Q11A 1VBFA 4HSGA 4B40A 3OY2A 4KXUA 2NXWA 2R84A 3OFJA 2SKCA 3M9WA 4MYCA 5KHLB 4DV0B 2R1TB 4PXSA 4IUYA 3FPJA 1N33B 3OEED 1DKLA 3PKIA 3I2FA 3W8NA 3QFHA 3N6RA 5HG0A 4YUZA 3ZHZA 3BX1A 5FWNA 3BWEA 3JCZA 3OT1A 3UGTA 3ZJYA 3CRW1 1AMNA 4PIPA 1C50A 1XDZA 2YXPX 4ATNA 3QIAA 3DFFA 4NXMB 1IRXA 4QFBA 3KPJA 2QJFA 2B34A 4YRAA 3UAYA 4ZTZB 1MIHA 1GQSA 2FPGA 3RJMA 5DHPA 1Q7CA 1YL6A 2FR1A 2RKOA 3QELB 4DM3A 5MGNA 1GFIA 2A14A 2JGNA 3NDRA 1MX5A 5IM4F 1P2SA 3F6SA 3T9AA 4YXWA 1V2HE 4JYCA 1JAYA 5CT6A 1D6SA 1PKXA 3PNPA 4IUCS 5FLEX 4ZV9A 1CS0B 1W49A 1U3WA 3QFTA 2IU0A 4B1FA 5HQTA 3HWWA 4W5RA 5FBQB 1N5DA 3LV8A 3TQRA 1D2NA 1OILA 2RG7A 1AY0A 1W1IA 1NW6A 1W96A 1V3VA 2FPKA 2O2HA 2Q4OA 4TMWA 1OR8A 3GROA 2JLUA 1SKQA 3D6JA 3M4NA 3W6UA 3IQZA 4M0MA 4ZRMA 4EYGA 1H8HA 1MTOA 2GSDA 4XB2A 3DAHA 1I4LD 1R00A 2RGXA 3VPGA 1R12A 3QF4A 3QUAA 2JIMA 2PWBA 3BBLA 3UT5B 4CI9A 2NPOA 3RDPA 3V4RA 3QUQA 4P6VF 3MW8A 3RRYA 3ERCA 2AN5A 4CCAA 2UV8A 3HWX1 4DLNA 3BXXA 5A4MS 1J1ZA 3JTEA 4HADA 3COPA 1MQ8B 3CF2A 2GNOA 4HFJA 5KCZA 4PHTA 1MVNA 5IZCC 4PTLA 1IJKA 3HACA 2Q3MA 4BNFA 3PC8A 2I6SA 5FBKA 3FNEA 5KNCA 1AKQA 3DOCA 1JHMA 3UJ7A 3HY3A 1RLJA 3NR2A 2WLTA 3OZBA 3FPKA 2I99A 3MTJA 2JGMA 3MRXA 1BFKA 4MPTA 1XRQA 5HIMA 1ZK1A 1OYOA 4C87A 4F06A 3AUTA 3ME5A 4M98A 2FN8A 2ZUSA 3DZHA 1XCMA 2X0JA 1LLQA 4ZOAA 3V55A 4DGQA 3CRNA 4RIFA 3ZLTA 4B2YA 1NW9B 2RAFA 3PL5A 2ZI3A 1GQYA 5A7HA 3SC3A 3C6QA 4MULA 1NAHA 3MOIA 1U31A 3PLRA 2IOFA 4JYMA 1QHEA 4ZCPA 1OTYA 2ACVA 1L5HA 4I0WB 2BDTA 3AC0A 4ZCIA 3NEPX 1PVVA 2FW0A 2XQKA 1THMA 1XF9A 4DSNA 1T91A 5ILOA 1Y5NA 4KQ9A 2W9XA 2WMDA 3AU9A 1NXOA 1N3BA 4JI3B 5BWOA 1J5EB 1OVGA 1LXCA 3CRZA 3RADC 4BMOB 3B8HA 3O4RA 5LP6C 2C4WA 4OKNA 2OOSA 4RF3A 2RGYA 5JSZA 1SUPA 4LY0A 2W2KB 2Z2XA 1TMOA 1Z6GA 3TMKA 2ZTHA 1EFLA 1I13A 1RRGA 2Z43A 3BJEA 4UQOA 3G88A 2XB6A 3RRBA 5A5EA 1IDN1 2EWMA 5J1SB 4ON9A 4ZK2A 4HATA 4EZEA 2FETA 4PPGA 1NE2A 1YCDA 4IEEA 4PICA 3KZCA 4S0ZA 1DC3A 4P3OA 3LG2A 2GCIA 5IWAB 3GZJA 3AF6A 5I9SA 2GRAA 1CZHA 1WLYA 4KXLA 4L07A 5HKKA 4Q9DA 3KZVA 4A03A 4GFDA 4ENSA 3FPFA 3MCAA 5LR6A 1L9KA 5E6RA 1T0UA 5CFMA 1C4XA 1R9JA 2O2XA 1QTIA 2LZ0A 3KE8A 2CHVA 1U2TA 4NBTA 3AJRA 3GRAA 4IJMA 4OBXA 4QIHA 4TRJA 4ZO9A 4REMA 3FFXA 3HP4A 2QN9A 1YQGA 4UBJA 4TMVA 5T4HA 1IJEA 1Q20A 4OL9A 4QNNA 4RMGA 4EEXA 3FBTA 4J0FA 1JEJA 3FMPB 4KHZA 3L6UA 5DYGA 5C53B 3WHIA 4MHSA 3AXTA 1PL6A 3VFDA 3LFTA 2W98A 1ZJJA 1P45A 4LMBA 3UOGA 2QP4A 5AW1A 5K4GA 3JQPA 4UU7A 1XVVA 2RC6A 4CGZA 1FZQA 5ALHA 1DAOA 2J4FA 5F1OA 1JXMA 5BQXA 1E1MA 5JDCA 3SJBA 3L7KA 1Q19A 1W59A 1X8XA 3CF4A 1L7DA 2H9IA 3U39A 1N75A 1ZINA 5HCIA 4A23A 1DX6A 1VZ2A 2HJ9A 4KXNA 1P6XA 3IQGX 2O8DA 1XNJA 1Y8ZA 2WA1A 4R8RA 4YK7A 3ROEA 4BASA 3PKZA 2VAMA 4O4IA 4D9EA 3THOA 3FHOA 3H9JA 3UCFA 1P72A 1JEYA 4C7XA 2XNJA 3C8ZA 5LU9A 1N2SA 1Z5WA 4WN3A 1H2BA 1VSQA 3PC7A 2PH5A 3DQZA 3F97A 4JYZA 2IU6A 4W82A 2EJVA 1QK3A 4JJAA 4E11A 4UBIA 4AJ1A 3ZW8A 2XWPA 2APJA 3WMRA 3N3AC 4AZ0A 2WT8A 4CTNA 1CTQA 4XE5A 1M1UA 4A5SA 3CWZA 2ZSKA 3IEUA 2VDOB 4W5QA 5BUCA 1V6SA 2ZSJA 1FLVA 4U7PB 3PC3A 4XFKA 1ZD2P 5I9MA 1T9BA 3HFRA 1C1XA 3O7MA 5FNVA 3U2QA 3ZZ0A 1XKXA 3I1YA 3GJ4A 2DZDA 1HX7A 4M9UA 2HT1A 3E9CA 4DR2B 4NSNA 4I19A 4KQGA 4U5QA 3LO8A 1JXOA 1C8LA 1DEOA 1YJQA 1H5NA 1GWNA 3HL4A 5ALNA 4LTDA 1LUAA 3UMBA 5I4KA 5LD2C 1G98A 4KPFC 4JJ8A 3PZBA 2YWEA 2ZE5A 3RHTA 3KX2A 4UTVA 4F4CA 4RSHA 2R2GA 1S8NA 1UMCB 3PR3A 1SXIA 4LRQA 5DNCA 1KI8A 2GUGA 2R6JA 2BRUC 1QC5A 1ZJ5A 1THTA 1YR3A 1S7GA 1G3QA 2HA7A 4GEKA 3JQEA 1HDEA 3AERA 1Z56C 4DADA 3CH7A 3IUEA 2HHLA 2WC1A 3DZIA 2O52A 2CMKA 4FNMA 5IJAA 1RPJA 1RLUA 3U5ZB 3H4TA 1ACLA 1FYVA 3ZY3A 3N8HA 1W1WA 2QP9X 4KBGA 1T0HB 2VPYA 3FPBA 4M2LA 1SO8A 3W0LB 2PXAA 3G2JA 1ZN7A 3KQOA 3TL3A 1USKA 2FN9A 1TCCA 3OU6A 2IBTA 1TLFA 3P9KA 1CP3A 1QMPA 3AEYA 4UBLA 3DEJA 4U8GA 1L7NA 3DTYA 5E4FA 4DWJA 2OE2A 1Z2EA 2WHRA 1YA4A 5FOXA 3NRCA 5KREA 5E6SB 4K6KA 1G5TA 1DI0A 1B41A 1TTPB 3G9ZA 1KBQA 2JJ2A 4QX6A 1JUDA 1TLLA 3AUXA 4OYHA 2FG5A 3A2LA 2AJBA 3B5JA 1R0KA 3BHNA 1DIOB 1FVHA 1MO2A 2POQX 4RKRA 4OK5A 4UMFA 4BTEA 3KKEA 3WWZA 3K1YA 3A11A 1JNXX 3VQTA 3AHDA 1NI4A 2I1QA 2WICA 3I5XA 1Q0LA 1UJ4A 1ADBA 1GLNA 1S89A 4QELA 5EYPA 4DMHA 4PVDA 4AJIA 3A1FA 3ZWMA 5HSGA 1GAXA 5CBPB 3OM1A 3GJ6A 5FWXA 1S96A 5AKKA 4DMMA 4AN4A 3W5AA 2OQVA 1SQSA 2FB9A 4CL2A 3IO3A 4W8HA 3FWNA 3U6KA 1VHQA 5HOQA 5M04A 1UZAA 2HSDA 3EPRA 4BP3A 3HJFA 1WXDA 1QHGA 2VAVA 3PYXA 1A5BB 4WLOA 4YCBA 3IQEA 4ZXFA 1UDAA 3W5UA 4AY3A 2CHFA 2PMBA 3NVMB 4RXMA 5IC5A 3QLVC 3QPDA 5K4AA 5A9SA 8GPBA 1TTTA 5KYUB 1A2QA 3O4FA 2BM9A 3IP3A 1CG6A 4J07A 3ZD6A 4IMPA 1XZNA 5ENVA 2CF6A 3W05A 5DNAA 1ZDMA 3WRYA 1YHYA 4BO6A 4F6CA 2YXNA 2YYAA 3H18A 3LPAA 1P1JA 1XZDA 1A95A 4MTLA 2A5DA 5J63A 5KINB 4XGIA 3QHAA 2UXDB 2GEKA 3C7CB 4D4JA 1SK9A 1E98A 1I2MA 4B7CA 1TRKA 3WGKA 1OTXA 1IUNA 4IGKA 4WKPA 4POOA 5K8CA 1GVNB 1PGPA 4TN1A 3D7MA 5LA6F 3R5HA 5JSUA 3KOYA 3Q41A 4OI4A 1THZA 2V96A 3PBKA 5D5QA 5JNWA 5TQ0A 4Q3CA 1XP8A 2BAGA 3HDGA 2BFOA 3D2CA 1XG5A 3VR4H 1DQSA 3DM9B 3FGNA 2C92A 1ZN9A 5LIPA 1UK6A 1X7XA 1E2GA 1AS3A 1UIMA 3JQFA 1C3LA 5AJWA 5ETJA 4MI9A 2ZZKA 1C29B 3ESXA 3TUIC 2HTFA 1C14A 3G2LA 2CB0A 4CU2A 4CPDA 3GYBA 3DT8A 3HNPA 3O8OB 3R6TA 4FGKA 5LNK6 2Q5LA 1U90A 3LPNA 1Y3BE 2O06A 1N1GA 2GEJA 3HXLA 5CD1A 4ZOLB 4LXGA 5D87A 1NI5A 1P80A 1WCIB 4AP9A 1N2OA 1TIKA 3B20A 1N2CE 4LRSB 4GYWA 1XZJA 2PVCA 1TF7A 4CTOA 2C82A 4H7JA 4XLZA 2ZBQA 1DQZA 1MIOA 1TIBA 1TKCA 2JDID 3P20A 3UAOA 3VR6D 3AVUA 4PRYA 2HR1A 1O95A 5G3ZA 1QCDA 1GRCA 1HLGA 1OROA 4LXXA 5D1NA 3TXYA 1JHPA 2FUKA 3DJYA 2FA9A 2FP3A 1DCFA 1WM1A 2JIOA 3M7IA 4GMDA 2KJQA 4FS3A 4QUHA 3UJDA 4OHUA 3MEQA 2GESA 2XE8A 3A04A 2DKFA 2ON6A 4L0MA 1Z4IA 2WWFA 4Z8YA 3U09A 5F51A 4KSYA 1YE5A 3D2BA 1TJ3A 5JANA 1MABB 3PRKE 5HTKA 2VTKA 3MD9A 4V0MA 3IDSA 4KXXA 2O3QA 3AUJB 2B98A 4NNJA 3CUSA 1EA5A 4FI3F 1A71A 4C05A 2X58A 1PRYA 4YRCA 1Q77A 1I33A 5IMSA 2BTQB 5LQKA 1QG2A 1X92A 4X1KB 1V39A 1W0KA 3HFGA 1KSHA 1HGXA 2DEUA 4HQKA 4P3XA 4OSPA 4P86A 5CX1A 2V3CC 1USIA 2F1OA 3WZLA 3UJ3X 1F7UA 4NE7A 1Y63A 4WZBA 5T3UA 4EI8A 5HJ5A 3CVYA 2EP7A 1NV9A 4KMOA 1SNYA 4LY9A 3FRHA 1YI8A 3OZEA 1D5WA 1F8UA 2I29A 3LL4A 3L8CA 3AGPA 3ILYA 1C30A 5A0FA 3WI7A 3OQNA 2XTMA 3IDZA 5IM5A 5B6JA 1L7PA 4GPZA 4KTVE 1RD4A 3W79A 2UAGA 3LQ2A 3SWWA 4KE7A 3G1WA 4GECA 2X6RA 2ZTLA 4JC8A 2Q5EA 3RAEC 1Y9AA 2JJ1A 3T99A 1UBUS 1NJ2A 1ZVKA 3KD3A 1PEDA 1A9XA 3F8WA 1WDLA 4EHFA 2G5GX 2EKQA 2ZB2A 1MW8X 1YT5A 1A9PA 3HBNA 3SQDA 4CKCB 4Q3AA 4Q7JB 3ZE9A 3VC3A 4PC2A 4U2FA 5G3YA 4BY9E 1TLTA 3D6FA 4MYSA 4DMKA 3RFXA 3LOUA 1EJBA 1XK7A 1E4EA 1O77A 2WJVA 1E7YA 2P78A 2FRXA 3VYRB 5ESXA 2QTWB 1H0HA 1QV6A 3FETA 1E3IA 2ALJA 4N6GA 4AROA 1DIGA 2QSYA 5H02A 2IHZA 4D9IA 4QODA 4TX1A 3SEZA 1RXEA 3OO1A 1LH0A 1VE3A 3URKA 3PCTA 5I7FA 3NOOA 4EJMA 1TCVA 3LUAA 3VKHA 1QOQB 3R7DA 1C41A 3KFLA 4I55A 1I7DA 5FOQA 3IUBA 1K2VN 2WSYB 1GTVA 1IEQA 4JELA 4RSGA 4EX7A 3KKPA 3JRXA 1GU7A 1QYWA 2OILA 2Y1LA 4GL4A 5L45A 1HOXA 3CN9A 2ZCUA 4KIWA 2Y0CA 3GW8A 4M7OA 2HWUA 1O96B 1VYUA 2V54A 4RS4A 1WUYA 1Q0ZA 2A0XA 2YX1A 3PR1A 3IPRA 3VM6A 1WPRA 2BBOA 1PUJA 3WDMA 4GICA 4F3CA 2WYUA 4X60A 1YACA 5FPKA 2PE5A 2WNIA 4K9RA 5H5JA 4WK4B 1BS9A 3QITA 2WA2A 3GL9A 3KVRA 3HCFA 4XTRA 4Y9SA 4JHLA 4CVNA 2EAUA 1UIRA 5J2UA 4ND7A 3QEMA 2JFFA 3PB3A 5ECYA 4X3PA 3CWCA 2H1SA 2QXTA 1SU4A 1UMDA 3CUWA 4I4CA 1RI2A 1U0TA 3C3WA 3V34A 5FJJA 3VAAA 2FP4A 1L7MA 2PWPA 1EDOA 3ACDA 2PX6A 3CJRA 1B93A 4TKZA 2FJ0A 1P60A 1P31A 1YQXA 3FYUB 3FD8A 3V7WA 3DO6A 4IKOA 3MAJA 2ETVA 3A4LA 1HQYE 1PR2A 2PZEA 3ETCA 4UEKA 2GBFA 1R4NB 2PD6A 3TW8B 7MHTA 2EFGA 3T3MB 1KYWA 3KJGA 2PCJA 3GDWA 1HE5A 1TF2A 2IZ7A 3D3NA 5CVEA 1MB2A 1UP4A 4TTJA 5B6IA 1HYQA 4JI7B 3RVPA 3OETA 2TMGA 3NV9A 5JWRA 4QXRA 5TPZD 4WWHA 2QYHA 2D1RA 1NXVA 2OZLA 2F3PA 2C9OA 4RJ2A 3RC2A 3RTAA 4RBNA 4WESA 7GPBA 3TSCA 1MOZA 3SHWA 3V1LA 5AFSA 1G64A 4ETNA 1G8FA 4PN3A 2OG2A 1HYEA 2KX7A 3EQ2A 1RWMA 3I1IA 1TYBE 4DUZB 1I0LA 2NW6A 1LBTA 3WYCA 2EJTA 4X1YB 5AVTA 5AVVA 1S2LA 1YS4A 2JZOA 2LTAA 2ZI5A 4FJ0A 5DVZA 4E4RA 4NV0A 4Q82A 1EFPB 4BPBA 1U3DA 3BCHA 4UHDA 1U7HA 1M2EA 1E0AA 5TT1A 4L3OA 1YWGO 4PSAA 4F4UA 2O8FA 5E2AA 5LJIA 2K2QB 2FTKE 1N2EA 3AUFA 5K0CA 3FZGA 4IGEA 3TW6A 3H9QA 4BUJA 4GKKB 4NCAA 5B2EA 1NUQA 2GJ4A 3F47A 3FDZB 3H42B 3IULA 3R3XA 5FNZA 5FOWA 3ZTWA 5BXYA 4DANA 1JH8A 1AO0A 5BSMA 3AYXB 3ADDA 2OV6A 1F20A 3HS3A 4BZWA 1XL1A 1GYPA 2X5XA 5BR7A 1XDGA 1BS1A 4KXVA 3PHBE 2R8ZA 4MP6A 1EQ2A 5CAEB 1FXUA 5JYDA 1XZIA 1UDXA 3IEPA 5KYTA 2VBFA 3CB4A 3FOEC 3HN7A 1XZGA 2ZXEA 2XDYA 2C3YA 2Y05A 1U3TA 3ZD7A 4GLBA 4HDSB 4JOQA 3VR3A 2XOKA 3OM9A 3EB9A 1HDYA 1XPJA 1V16A 1ZK2A 3IQXA 4Q0MA 3OX3A 1QIIA 4ISCA 5LYJA 3WMFA 1ODSA 4HLDA 5UKDA 1SBZA 1KE1A 5ICMA 2H7XA 4TVOA 1P19A 3OIUA 4A27A 3DV0A 4M83A 3MQ4A 4K1XA 2Y1GA 3G0DA 4P3PA 3S2GA 4WKOA 5BNIA 1HV8A 2QTVB 4KMMA 5BN5A 1R27A 1NQUA 4IQ8A 3SJAA 3F67A 4JMPA 2XEXA 2NMVA 3OOYA 4IIHA 1HYBA 3F1LA 4U7WA 4BFCA 5FQNA 3RW9A 1AU9A 3GPBA 5B7NA 2NXEA 2QN1A 3WOHA 3G5TA 2Z3WA 2WJAA 3OF3A 4R8LA 4ZT3A 1N6IA 2PX8A 2UUPA 3FJYA 3HMQA 4B3CA 2B94A 1E8MA 2AFIB 2GPYA 4OXNA 1MX3A 3O2JA 4LDQA 3SDSA 3IAHA 3Q87B 5LKRA 4CMEA 3KV1A 4F2DA 1BX1A 2EARA 5CDSA 2P35A 4OX9Y 2OGSA 3TIFA 4OQMA 2R7MA 3VO1A 4IDOA 2LD4A 4NAUA 1JPUA 3DZBA 2Z4RA 1GZDA 2Q1XA 4HRYA 1R7RA 2IIPA 1SWVA 3Q7PA 5IARA 3DHWC 4J7UA 5NULA 1VA5A 3UM9A 3NB0A 1I0ZA 2YV3A 1NLFA 3FYSA 5CXUA 4D4GA 5J9FA 3QM1A 4Z5XA 1NQTA 1RYHA 2G6TA 3HB4X 3X0DA 1KAOA 2G25A 2OBFA 2OBYA 3ONFA 4HNSA 2G4CA 3PYMA 3P9XA 4JB3A 4YJ2B 4DIBA 5F21A 3B1ZA 2IGTA 4JJ4A 4G8BA 3DR3A 4XYEA 2QTHA 4DDWA 2X2PA 2QXYA 3ETHA 2QUAA 3GP5A 4AQYB 4QXAA 3G1TA 5J43A 1CF4A 5AUNB 2PUDA 1C9JA 2FUEA 1XZBA 2ERCA 5C5EA 4R1PA 4AKHA 2FG6C 1VGRA 2GD6A 3H05A 4IXWA 4JSRA 4MQEB 2ZB8A 4U2EA 3ZHTA 4YIKA 2H06A 3TF5A 3QLEA 4JDUA 1W44A 3ZLJA 3BIFA 3BFPA 4G41A 3AG6A 3EYWA 3EA4A 1AHIA 1Q14A 3GGDA 4RXTA 4TV8B 4AMYA 1PJ3A 2P5SA 3IUJA 1CRZA 1FUKA 1GU0A 1T4CA 3L40A 4YJFA 1CHNA 2W6CX 2XPCA 3A1UA 3WLFA 2G7MC 5JMTA 5I7OA 1HI9A 3OZTA 1J22A 3AKDA 5ESRA 3JQFC 4LOIA 5DX1A 4KRFA 1WW8A 3ZV3A 3QPWA 3THXA 1P33A 2MR6A 3EQ8A 2XHZA 4HXEB 3HB1A 1GQ2A 1GUBA 2XVXA 3EFHA 2O7NA 3NBXX 2EFDB 1LW6E 3QHPA 2B7LA 4Y3UA 5LN1A 3WMEA 1LBEA 5IAEA 1A72A 2WBLC 4PRLA 3BA1A 1QHHA 2CUKA 5DYNA 5EESA 3VKUA 4HVTA 1FYEA 4WK6A 3EBPA 1ZI6A 1WVMA 3MWKA 4IMJB 1CIPA 2FOIA 4MRSA 5FNVF 3S7ZA 5B5SA 4P5PA 1R4MB 1NVBA 4I8IA 2Y27A 1DG1G 3IBTA 2I22A 3KOZA 5AVOA 3EXEA 3AP2A 1BQ3A 4QUDA 1UBTS 4ZD6A 4CRWB 1AQNA 3QKSA 4Q19A 3TNJA 4LYAA 4UM7A 1TC1A 2V9ZA 4ZT6A 3O4IA 1SBIA 5BQOA 5ADVA 1T1SA 1SVWA 3O31A 4K6HA 4UPVA 3ZDZB 1YNOA 5L8VA 5JBIA 2PMEA 3TG8A 3Q7QA 3VR4D 5DM4A 1Y3CE 3C43A 5KCMA 2P6PA 4J2HA 1GZ4A 1G2IA 1FMFA 3MSXA 3EEOA 1SR8A 2HPZA 3DGEC 1IB0A 4PC6A 4J91A 3PFNA 3IXMA 1YCHA 1L7RA 3IP8A 1J0XO 2HV8A 2R6HA 3MJEA 2J9XB 1KJQA 1JMKC 2R1UA 4YR9A 1LB1B 4ZTUB 4J0HA 2UZ4A 4PAWA 4RPCA 4WZAB 4YQZA 2QL6A 3LOQA 3AVVA 4LCBA 2PMWB 4PZ9A 5K6RA 1EMDA 1XZPA 1RZRD 1GNLA 2NU6A 3GFFA 3ILHA 1EIZA 2G1JA 1T5TA 4ALMA 2H8GA 3QEBZ 1ZMTA 2Q99A 5FYQA 4IPTA 3A1NA 4IILA 5KJCA 4A36A 3CZMA 3RVJA 3WWEA 3COVA 1GUDA 1VE9A 1SIWA 4GX2A 3RSCA 4WJLA 4Q4HA 2EQ5A 2GPBA 2YY6A 5KIAA 2UUBB 1GLVA 2ZYSA 3W90A 1OXMA 2R68A 1KK1A 3R09A 4JOSA 3FZNA 3D7RA 3OP1A 4GPD1 3HR7A 1U2PA 1GTL1 4L50A 4D46A 1RMTA 1XZHA 2DULA 5JNRA 1NT2A 2ZR8A 4F4FA 4M21A 2DC1A 2W6ZA 4X8OA 3GH3A 4G37A 3AFHA 2XITA 2AFHE 3HGMA 3THRA 4FGZA 3N87A 3OE4A 3ZR4B 2VJPA 3VH4A 5GM1A 2AN4A 2PKEA 3B3GA 2O1XA 4IQ0A 3COYA 3K1TA 5REQA 4EGAA 3CZQA 1JIQA 4Z9XA 4ZT4A 1SXJE 3SHQA 3BCUA 4E03A 1SZDA 3ND8A 4LUCA 4BNJA 3HXMA 1PR9A 3L07A 4U0JA 3WZMA 4C9BA 4PXAA 1IYZA 1QYCA 1RBYA 4NKRA 1REQA 1V11A 1ZJ4A 3DYBA 4ZAZA 2Q49A 1ND6A 3TQHA 2GYUA 4B6EA 4CEHB 4NNPA 2A84A 3I8XA 4FGSA 1SFRA 1JT9A 2OCGA 2OD9A 2VJNA 4O1HA 2X0FA 2VCYA 2FZ4A 3TBFA 1AD2A 2JAWA 2DFPA 1CRLA 5CFQA 4LSMA 3IUYA 3OFNA 4JBGA 3IQFA 1O9HA 5C1PA 3HVRA 3J81k 3MGAA 4YAJA 1M0SA 1VLHA 3KYJB 2FSSA 2L2QA 3V3KA 1ODTC 4LS3A 3VBEA 4J8PA 3TFOA 3B8EA 4ZJUA 4YRZA 2OBNA 4ZICA 2V1UA 3FKSD 4RTOA 4OOEA 1PJ8A 4YMWA 2WF5A 4DV1B 2VHQA 1M1XB 5AI6A 3IT0A 3AM5A 1NDQA 1O57A 4EY6A 1CR0A 1ESMA 3G1UA 3UK6A 3WHKA 3PPYA 3BGWA 2IOHA 4MR8A 4C7KA 1EU1A 5JWOA 2VK4A 5KOHB 4RHYA 5C3MA 4E22A 2I4RA 2AL7A 1XFDA 3U4DA 4JP8A 5IUJC 1UADA 4ARVA 3PJFA 5A5DA 3IDOA 5C8YB 4ZJZA 1JKIA 1T9GR 1VPEA 2ZK7A 3WBKA 1A8IA 4DSTA 1N5MA 4V2UA 2JFZA 3NCTA 4J7AA 1E0SA 1MRNA 2CUZA 3SIXA 2X4DA 1WABA 4B85A 1I3KA 1U2DA 2YIVX 4AO8A 2HGZA 3L7NA 1P7WA 3HLYA 5IEJA 1JEEA 1Y33E 3T1TA 1XNRB 1MO6A 4JQOA 1FPQA 4B4WA 5AI8A 1UDWA 2GF9A 3U6BA 5JQWA 2FEXA 4AT1A 1KJNA 1XMOB 3QE2A 3ULKA 3PHIA 4KWTA 4QGSA 1YR8A 2EKDA 3CR3C 2B5OA 5HR5A 3MOGA 1RC1A 3AWDA 4L9SA 4WL0A 3LUKA 3TZKA 4DSZA 4UHEA 3EGDB 5BNWA 4U02A 3IHKA 2QF7A 3N0RA 5M34A 1U63A 5KAMA 3TRDA 2WAYA 4EYSA 3PCXA 2W93A 621PA 5SV2A 4N7MA 5LZ5A 3NJRA 5J5CA 4RY9A 4MIOA 3VMMA 3W2IA 4BRWA 3I9NA 3AT1A 4D6XA 2KSQA 1VYTA 3AUYA 4I9GA 4UEWA 1J0DA 1ZHOA 3WYBA 1KU0A 4Y18A 4LVNA 3RT7A 2XKJE 1XTZA 3MJCA 4UNQA 4EX6A 3W8DA 4US1R 4CV3A 4H3SA 2YWBA 4M0KA 3NM6B 1ZSNA 4ZVRA 1F2UA 3VR2A 4BVEA 4B80A 4C22A 4EYEA 3NDIA 4ESVA 1L3BA 3BGSA 4MGEA 4Y9RA 4YJ3A 4D9FA 1FBNA 4N4AA 3DVLA 4E7PA 1XQ9A 3IBFA 4R2LA 2D6FA 1ZM2A 2VJMB 2VNJA 3PUVA 1EFVB 2XCLA 5M2QA 2F8TA 4RA9A 1LRLA 1VJTA 4DLXA 2PV0A 4PWYA 5JY6A 4BNYA 2XOKD 3FWPA 3QVMA 1C9EA 5AW9A 5K0EA 1DWPA 1U3CA 4UUAA 1V0JA 1P9RA 2YV2A 4NARA 4Y0AA 2H1FA 2HU5A 3EIQA 3OTGA 3BS4A 4BNIA 1XLUA 1LJ8A 4WCFC 2Z95A 1QRTA 3TX6A 1Z7GA 1HFJA 3OHSX 1GNRA 4HDMB 2EKPA 4YJDA 1DKMA 3AMVA 2H2IA 2KPOA 3A9VA 3EGXB 5EJAA 4FEEA 2AOTA 4HO1X 3VSBA 1GV1A 1UEXC 1AKNA 4K6MA 3TGPA 2QD1A 421PA 1LJLA 3BGIA 4FR5A 4IHJF 4Y1GA 5KYUA 4H7FA 2GBPA 3KPWA 4D0GA 1RXIA 2VZ8A 2P69A 3CGGA 2H4YA 4R1OA 2EWWA 1UFOA 2XD4A 3A9TA 4FOSA 1E5LA 3RYCA 4WFQA 1PFGA 3W04A 1T36A 4OM8A 1P8JA 2ZIUB 3JD3A 2WWGA 4TL7A 2EW2A 2QGZA 5D6OA 3N2ZB 3TTYA 3G2QA 5FBZA 2WJPA 4NBUA 2OR3A 4MHTA 2QPTA 3UC5A 3MINB 2F55A 2M1XA 1EUZA 3ICCA 2PEYA 3QVTA 5CB4B 2IY8A 2OWEA 4IW3B 4GXQA 4OGWA 5GMOA 1IXYA 1PR4A 3H7AA 3D6VA 2AQHA 2XE7A 3ZWQA 3L8HA 4CG2A 1UJ2A 2WINI 4PX3A 4HZGA 4UD2A 1KKMA 4KJZA 4OMDA 1Y81A 1HDCA 2OCBA 3WYDA 2JI7A 3VC2A 1JDVA 1Z0AA 3BWVA 4DQXA 2C7RA 1SJ9A 5IDVA 2DBQA 2FX2A 3K15A 3ECSA 1DFGA 4RKEA 2GHIA 3IP5A 1IIBA 3KLMX 4ND5A 4LTNA 5LUBA 3REGA 1WW2A 3E9QA 4FFWA 4R3UC 3X1ZA 4QE3A 3EUFA 3H5VA 4DQDA 4G1MB 1YFLA 3QBVA 1GCUA 4MW5A 4NMHA 4XZ3A 2VUTA 4MRRA 4NZYA 5ALTA 2A9QA 2I71A 4Q7LA 4V02A 2OAGA 2EBHX 1ZW6A 3TSWA 3SEQA 1TZCA 1DBPA 1DFIA 5MHTA 1JQ3A 2XQJA 2ZBPA 3QEJA 1DWUA 3PXBA 1L7EA 2H52A 4ZQIA 5F1KA 3WNCA 3PZRA 4GOOD 2L18A 1ISRA 4EYQA 1FRVA 3GRRA 3N59A 2XRYA 2M6KA 3FF1A 3N76A 3Q7RA 3A4NA 2DVMA 3FSRA 3G13A 4YT5A 5IRCD 1EFAA 4OLAA 2IWHA 1N6PA 3M6FA 3OCCA 1LDBA 4D98A 2FMTA 3LHDA 3TGWA 4R4JA 3HY4A 4FOTA 3P0IA 1XTKA 1PJZA 4YEDA 1KDYA 3VR5D 3E2MA 2GM9A 3IT1A 3LLCA 2VZ0A 1VCIA 1H05A 4QC2A 4FHZA 2CNBA 4MUJA 2IKQA 4Z0NA 4EGSA 1AH2A 1W0JD 2JEZA 1J24A 3LHIA 2VRWA 3JZAA 2YZ2A 3UICA 4QPDA 3F5DA 1Y37A 2B1RA 1QX4A 3RFFA 1LF0A 3E84A 1KPIA 1R9NA 4I7EA 4J0CA 1IQPA 5C7YA 1CZLA 4JI0B 4B8ZA 4LRYA 1F2TB 2JFPA 2Q9AA 4UE6A 1VL5A 4A82A 4FFNA 3NO4A 5JNTA 2BFEB 1FXWF 1FFAA 1XC7A 3I76A 5E9JA 3CZ5A 2V6JA 4H0CA 2LBPA 2VOJA 3C5HA 3DEHA 4FMCF 4GSLA 2ZU6A 1BYUA 3VHXA 3OEHA 2ZWMA 3NWEA 1P2DA 2UYGA 2HQSA 3FBWA 1JTVA 4J75A 4JJEA 4RVDA 3BKXA 5AJXA 5GINE 2E6UX 4OHVA 1D3AA 1L1QA 1OC4A 3NP9A 2PSFA 4JBYA 4LXTA 4ERXA 1YRWA 3FNHA 1T0IA 1M74A 1DKPA 1F0NA 1K0FA 3ID6C 1EWTA 2VUSA 2PUWA 1GPNA 2CNDA 3FOAA 4HRXA 1M8GA 1GDTA 4PRKA 5I3ZA 1G8HA 4NENB 1I7NA 2PYZA 1IOLA 2PNJA 5C31A 1Q2UA 1H2FA 1A5TA 3MT9A 3I53A 2ZJ5A 3IT3A 2XDWA 1EX1A 4PLHA 5TQJA 4A10A 5JT1A 3FSJX 3K70B 3OTOB 3OQHA 3PCRB 1W25A 4PSCA 3YASA 5TMEA 3P9PA 2OO7A 2Z5GA 4NVRA 4XDHA 1ZCBA 1RQGA 3TB6A 2PM8A 4RENA 3KYDB 3KJHA 3HZHA 4JBNA 3SXPA 1B74A 3H2YA 3O2QB 4FSDA 2PIDA 1LVUA 4HTFA 1U8ZA 1KK2A 1LSJA 4NL4H 3IUNA 3IRUA 1EWKA 1GQQA 2C2BA 2ICAA 5JMPA 3PEWA 4BXOA 1BX0A 2O8CA 2R6CA 2JIPA 1XQVA 4GUDA 4OLJA 1PZFA 3VC1A 3MUEA 5CDFA 1J97A 2FPOA 3F0TA 3TM5A 1QIKA 4QVGA 4AKEA 3H9CA 3M49A 4BAGA 1ISGA 1VSUA 3LBFA 3ZZUA 6ADHA 2X14A 3CCCA 3M9LA 3ZH2A 1N25A 1HC7A 2O8EB 3AZOA 3HWRA 3MWDB 4JA0A 1KOGA 2J31A 4C3OB 1B6RA 1QCCA 1AHHA 3WDSA 3SQWA 5EVJA 4ZARA 2ZQYA 1X86B 2NV6A 1KMQA 3PC8C 3DOIA 3CUUA 3ZJ5A 4ZZ1A 2B6NA 2HQ1A 4R2KA 5DTMA 3RBVA 1N6NA 1QWOA 3HGTA 1A8UA 2JEYA 3PQ8A 3L8ZA 1YE8A 2PBLA 3AKYA 2AFVA 2BKVA 1YZGA 1RIIA 3LC0A 3F5QA 4Y2YA 5BUZA 5KYYA 3A1TA 2VQDA 1TGYA 1XCJA 4OJTA 2PK3A 4G63A 2RAPA 3VAYA 1H2RS 2RI1A 2ATXA 3DPUA 4QLAA 3NH9A 3JYHA 5FA6A 4BZQA 4D6PA 3O3MB 3B2EA 1V3QE 2AYZA 1MOQA 1O8BA 3B3QA 4LE1A 2KLBA 4DYHA 2BELA 4JOCA 1PD0A 2BHRA 2PANA 6REQA 1EUCA 4M1WA 4MGIR 1V4NA 2WPNA 3MFYA 2VIIA 1A4UA 1PK8A 4FGWA 1BDMA 1FSFA 3Q88A 4RHXA 5A9TA 2VS1A 1VYVA 2GI4A 3ZKAA 4AMUA 4REQB 3F3SA 4EL0A 3KT3A 1GT91 4TT8A 1RS0A 2BOVA 3B1VA 3EDQA 1ZH2A 3RVLA 5LLSA 1W9MA 3D7KA 2P9FA 4PHGA 1PFUA 3PG5A 5AYVA 1BD4A 2VHWA 3NC1C 2DPXA 3NHJA 4BQOA 2GZRA 2DXIA 4WE3A 1TMKA 4LYFA 9ABPA 3U40A 1YQTA 1U0RA 1YO6A 2DG2A 5LDDC 3C39A 1M54A 2YN0A 3E0QA 2NQ2C 3P5BA 5EUCA 5IAKA 2E55A 3IIKA 4JVSB 4AWXA 4YRBA 4DYVA 1J25A 4EY4A 4DC9A 4KVFA 5ALUA 3ETLA 2C4HA 5K20A 3CCBA 3GQVA 1NR7A 2VNSA 4H7DA 5F77A 1RTKA 1I2CA 3OCYA 3U7EB 4CFSA 1PV4A 4CL0A 3M6IA 3T95A 1KNXA 3V7YA 1ONPA 4RFLA 2CE2X 1T2EA 1UZNA 2BW0A 4M46A 3RYFB 3SYTA 1O0SA 3ILVA 1XZEA 2ECFA 2PD4A 4LC0A 3GOHA 5IUNC 4MUEA 3S99A 4DUPA 2AR9A 2IE8A 2R4QA 3VU9A 2B4TO 5KDOA 3CFYA 1UQTA 4LOLA 3W78A 3LBHA 2CWWA 3Q3VA 1VP9A 2VT3A 2O2GA 3DOJA 1GD1O 1SAYA 2VXOA 1JDBB 5IT9A 3NHRA 3K0SA 1VM6A 1QCYA 1CR1A 4M0LA 2YS7A 1UK9A 1KVSA 2R6R1 5DX8A 3C3AA 1K66A 3A28A 2ILVA 3L3BA 2YQ4A 4YFVA 1EEXB 3SQXA 5HZGA 4BVLA 4RVGA 3O0DA 3TSZA 2QX7A 3ZOKA 1R1DA 4DDTA 1AVTA 1GSAA 1USUA 1YUMA 2Z2IA 2ZDQA 4HNQA 2PV7A 3UXMA 4YAKA 1ZIYA 5JZSA 4NV1A 2AK3A 4CM9A 4CIBA 4RGYA 5B1YA 3CVXA 2AC7A 1XA3A 1KMHB 2AVNA 2V7BA 4H3KB 4BO5A 5TJHA 2QUJA 2IXAA 3EIEA 3H2SA 4I6EA 4PG5A 4NI5A 3BOSA 2IXGA 5B55A 1WQ4A 2FEOA 1B2RA 3KTDA 1RR6A 4NIMA 1N9GB 3OIVA 2Y93A 1LI7A 2WABA 3F1KA 3MJ4A 1JF8A 4RORA 3ZHBA 3PX3A 1Z7BA 1GNSA 3A6EA 1XSEA 1GPJA 2BFNA 3IAAA 5A71A 1GFSA 3JQGB 4C4PA 4RAQA 5FFFA 2G17A 1TCUA 1XLTC 4GXNA 4XD7A 1VL2A 3M6VA 4NFSA 4BVFA 4MPRA 3VOSA 3EDRA 4TSRA 3SM3A 2EFJA 3D1JA 1NRWA 3KVOA 2YOFA 1MAWA 1GDDA 5EJ7A 2BCJQ 2ZRMA 4V24A 4LF7B 4XW2A 2EF1A 4FEGA 1Z8FA 4DMCA 1EVEA 3KB1A 5GGXA 1JDTA 2QVGA 2FW1A 3QP9A 4HS4A 4KNVA 4MV9A 4ZQHA 3WLTA 4EGJA 3L8YA 3QMWA 4JQZA 3N2KB 2AMLA 5IBQA 1JQLB 1PDOA 5JH7F 3THWB 3AB8A 5AK5A 4JFAA 1BE1A 3I4FA 4UBKA 4CQNA 1RJDA 2OMKA 4DCGA 3JZFA 1U94A 1CRWG 3N2LA 2PJRA 2X3YA 1R4ZA 2H2AA 3BA6A 4BNUA 4EJ6A 1RT9A 2B8JA 2XGSA 2A33A 3R41A 2NO1A 2PKCA 3F98A 4U3JA 4N0DA 1WMSA 1Y6QA 5IJXA 5T6BA 5EP1A 2B83A 1SZPA 2JHGA 2CBXA 3N2GA 3EASA 2BR4A 4F6RB 4EFKA 2BEUA 3TKYA 4OKIA 1QYVA 2PEZA 1D2HA 3BM5A 2AYXA 4IHAA 3PDHA 5EINA 1K92A 1M5TA 4RTRA 4K9KA 2FG7C 3QVGA 5EP3A 1GCGA 1N2HA 4K8RB 3RUCA 4AY5A 1UDCA 3NZEA 4JLBA 4HQ6A 4DMRA 3QLVA 4ENQA 4LK3A 4UXIA 1YRBA 3ET5A 1YB5A 4AWBA 1RRCA 3M83A 1ZXBA 3ROFA 3K7EA 4DILA 5JV5A 1NLUA 1R0CA 2CCGA 4M1ZA 4X0EA 3WLKX 5IVPA 5D86A 4EHJA 1J8FA 3OT5A 4I14A 3PJGA 3EVEA 4R2XA 2FJUA 2XB8A 4B43A 1YVEI 3T7TA 2QROA 3V8BA 4IG4A 3H2IA 4YT4A 5ENDA 4EUSA 2GN2A 1KS2A 4WBXC 4RDHA 4N76A 4F84A 3ILSA 2V03A 3MCZA 4PCUA 3O4GA 3IOCA 4FKBA 2QTRA 4Q1FA 5K03A 4C5CA 4OQPA 3R5JA 4HBGA 1QE5A 1RBMA 1EK0A 1NUUA 5IK2D 2IPLA 4R5HA 3ZWNA 3V42A 3BWCA 5JNLA 2XZOA 4HXFB 4H9GA 4V3BA 1HT3A 4N40A 4MW0A 3E8SA 2OYCA 2INGX 3FKJA 2WSSA 2B5WA 3BJIC 4H6PA 1MORA 4KO8A 4ZOBA 5E8RA 2E4YA 3ROXA 3OA0A 3AR8A 1ONBA 4FFRA 4U4AA 1SC4A 1M8JA 5DWDA 3KWLA 1ZUNA 3RU9A 1UMBB 4ACBA 1IB6A 1Y82A 2Y8EA 5EUMA 5G0SA 3QOWA 4KYVA 3TSOA 4A6EA 2P8JA 1H2AS 3ZHQA 1RWBA 5E7IA 5AM2A 4OOFA 4U0KA 3GLFE 5DGXA 5P8WA 1XRPA 1F3OA 3GA0A 4YAFA 1QU2A 4C3VA 3IKJA 3K6RA 4CG0A 2HNAA 4CLRA 4YXFA 2C5EA 3KWFA 2FQQA 3QMVA 8OHMA 4QUJA 2BKAA 2QVXX 3GCDA 3EQ9A 2X1MA 4H7PA 3SYLA 1MCZA 4K03A 3ZGVA 4CDMA 1QVRA 2O2SA 4LBVA 5FBHA 4ZCRA 3WL3A 1ISIA 3I42A 4RPLA 1GG2A 2DUMA 1I3OA 3QBDA 1P7PA 4PCLA 1WPQA 3HN2A 2AUTA 3BULA 3OZCA 3SF0A 3C15C 1X7YA 5KB3A 2WDPA 4PG6A 1HWYA 1NP6A 1R10A 2HBQA 2YMMA 4EJFA 3ZK9A 4OP1A 2AS0A 3OOWA 3UHPA 4QTYA 3PRYA 1M2HA 3FRJA 1HDGO 3WLLA 3IBGA 4EKIA 1YF3A 3BD9A 1V25A 2FV8A 3FPLA 3LP5A 1SCDA 2O4CA 2W2MA 1ZN8A 3C0KA 1UOPA 1XR3A 5A3VA 3WLRA 1QIGA 3I37X 3CNLA 3NGLA 1A2KC 2YWHA 2PNFA 3WK9A 1NN5A 1DT3A 2DUWA 1EVLA 2FFHA 2HADA 2XTNA 4KAAA 3U4CA 3MBKA 3GJ5A 1FMCA 3GJRA 1NF2A 1Z39A 3PXDA 4TOIA 1VMKA 4XYLA 4YIHA 4FHFA 4FT2A 5AKEA 5DI3A 1E9EA 4R81A 2J45A 4YQYA 1IWBB 3CKKA 2NVUB 3T1VA 2WHXA 4RETA 3ZI4A 5A4FS 5FDFA 2GH1A 2QW8A 1KPGA 3ETDA 4PRZA 3CEJA 4TRMA 2YC4C 1KO1A 3SBEA 2HDOA 1Y8QA 1YS7A 1SCAA 1HR0B 3DJFA 2GEFA 1CB7A 1CQXA 3C5VA 3AJ9A 4G1FA 3HXQA 4WQMA 4KRXA 1QM5A 3DWFA 3EXFA 3T3HA 1NMQA 3Q72A 2F8MA 4HLUA 1DEXA 2FR0A 2OCAA 5KSYA 2X4LA 1SOUA 3B1XA 2AUNA 4B84A 2GPJA 2VYFA 4O1MA 5F64A 3VU0A 1XTIA 2QT9A 3O84A 3D5TA 3N2NA 3OECA 2VPQA 4IMRA 4PFKA 1AKRA 5JJCA 2YIJA 3H0EA 3AGQA 3LXMA 1P74A 1U6IA 4MWTA 2VYND 1QZUA 2C1ZA 2I4OA 1MO5A 3WP0A 1P3Y1 4LI0A 4MWOA 1O95C 5JO0A 3QU5A 4DCJA 1K97A 2EG5A 3OOSA 1OIWA 4J2TA 4NK5A 4PLGA 2I66A 3DVQX 4Q9HA 3V80A 4E3WA 3AYZB 4QGHA 1P0FA 4GKAA 1NTOA 5BN3B 1L4FA 1U0NA 2HA4A 3L6EA 4JBIA 2D7JA 1XWFA 2JBAB 3AQIA 3G0IA 4MUXA 2C4VA 3MGKA 4IJWA 3DB2A 1INLA 2HSEA 1E6KA 2LKCA 3CO0S 1KDPA 2OXCA 3OD1A 4IM7A 4RNCA 4WOJA 4OCZA 1NZJA 3AB3A 2XLCA 3DTTA 5BSHA 1GM5A 5HIKA 4E2ZA 3C1TA 5H9WA 2H00A 4JN6B 4E5PA 5B1EA 3AIOA 3AHJA 5DLYA 3GJZA 1MXHA 4WAUA 1VHWA 4UBOA 3LDAA 1NZDA 1AKUA 4PC1A 2COEA 4RVHA 4A0QA 2W4MA 1YD7A 2H9YA 3OG9A 1VDZA 3O1IC 4BRZA 4IGIA 1PBTA 2QRNA 4RULA 1J7JA 2JG3A 2OPHA 3VVMA 3E9DA 3WGZA 2B7BA 3CLUD 3A4YA 3IAXA 2ZCJA 1OX6A 5L3ZA 1U7DA 1YONA 2AD5A 3AHFA 4UHHA 2CXUA 4WCFB 2YJNA 5D01A 5EKUA 2O8NA 2CUNA 3KEMA 4D43A 1L7BA 2QX4A 4US2R 3W9BA 4GKJB 3RODA 1CLUA 2Z04A 2VHJA 2R7KA 1ZKMA 1TUBA 4HDOB 2WB4A 5I4BA 2WD9A 1N36B 1E7RA 1T4DA 4EMBA 4P4SB 4LNUA 2G8NA 3DYIA 2ILTA 1L8AA 1ZC3A 4N48A 2WFMA 1JHZA 4HY3A 3S2IA 1NLMA 5KU1A 3HKEA 4QWMA 4UHBA 4RPJA 4OJMX 3D3JA 3RASA 3ZCSA 3FZEA 2PBZA 2ZWAA 3CUYA 1BEUB 3EFOB 3HBMA 3L18A 3QA9A 4M88A 3TCKA 4HQNA 4WGFA 5A3QA 1GRNA 5HILA 2YDYA 1RYYA 4LXUA 4A6XA 4ZDIA 4LJSA 4LC1A 2HLDD 1I4DD 3IP7A 4MB0A 2IEIA 4Z4FA 3DL0A 2GAFA 3LFHA 3CQ9A 1T2UA 1I51A 2P9QA 2O0KA 1L6RA 4TWZA 4II7A 3UFXB 2P9YA 2ZAGA 4G2NA 1QIMA 4ZGBA 4L4SA 4LHVA 1PFWA 4RZIA 3Q8MA 1M3SA 4B3JA 5K0NA 1DBQA 1K5GA 4Q9IA 1FFHA 4YLGA 3W34A 1U8UA 3KQUA 1UFVA 2G06A 2CD7A 2GN4A 1F2UB 2GO7A 4GGMX 1CR4A 4H59A 4LVUA 5T4FA 2MYUA 3H11A 3KM0A 1OLUA 3CH4B 3DOHA 4KDFA 721PA 3OOHA 2H5EA 4QPZA 4C7BA 2AHRA 10MHA 4ITVA 3IT2A 3IV6A 1PNRA 4DSAA 4JOBA 1G8GA 1M2VA 4ZCQA 3REOA 4G5YA 1CSEE 1MLDA 4ZQCB 1VZ3A 4XXHA 4BO8A 4RA9B 2JA2A 2IGBA 4EGCB 4F2HA 1GKKA 2IPXA 1ZWKA 4BWYA 2R5WA 4PM4A 3HCWA 4HDRB 3BWYA 4OYLA 2PGDA 4A3SA 3D4OA 2X1VA 4M53A 4WCVA 5IWCA 1IK6A 2BMAA 3DR5A 2SICE 4MQMA 3MUNA 3P4YA 1KSFX 2D5BA 2HRBA 4IIEA 4UTNA 3GO4A 1M7BA 2HO4A 3A0RB 3MHTA 2CV1A 2L17A 4AKIA 1O6BA 3L6BA 2AMYA 2XE6A 4RH0A 1OLSB 4G0XA 4CM4B 2IUTA 3A9UA 1JR3D 1WCWA 2XUQA 4ARSA 3LBAA 4QYIA 1N1DA 3PNMA 2YC2C 4KPUB 3DB1A 2BFBB 1BRMA 3LC7O 3UVEA 3I9V6 3QFCA 2Q4DA 3I8OA 2AG0A 3SSMA 3VNBA 2PRSA 4U63A 1Q7EA 2HWXA 1TECE 1WU7A 1Y6FA 3NV7A 1PTJC 5DNVA 2DQYA 4CUKA 4J1TC 3MPOA 3O9ZA 1Q15A 1E77A 4JBWA 1MUUA 2VDPB 1JP7A 4LOJA 3L5KA 2PZFA 4JUFA 3FMVA 3T9EA 2EWVA 2WPDA 1KZ1A 1NVAA 1RQRA 4KQCA 3P32A 3E4CA 1SBTA 3EZXA 4CW7A 1Q7TA 2JLCA 2HB6A 2YTZA 4CXMA 4N3BA 4Q4JB 3KKZA 3O9VA 4EKNB 2E1PA 3D3WA 1IOVA 1C1HA 2A9VA 4N5LA 4IMIB 3TR5A 3GPDG 3C7TA 2SNIE 4B35A 4NEGA 3BE6A 4Y7DA 3W2HA 2BUAA 4BU0A 2Z6QA 2OM6A 2MSEB 3T38A 1M0WA 3GNQA 3CJTA 5CPFA 3CZCA 3WWCA 2J67A 2AB0A 2PSEA 2B3TA 2O48X 3ROTA 4RTJA 5HM8A 2QRJA 4J0IA 1VLQA 5ARBA 4TVBA 2IRWA 3QKTA 2EZ8A 2V6FA 2CNWA 5E1OA 2D2IA 2DWPA 1AKMA 2CDRA 5HJEA 5KS2A 1JA9A 2R6ZA 4HP8A 4J9UE 5KVSA 5T8KC 4NMMA 3RJ9A 3V2HA 1UJCA 2Z8XA 3IQDB 1UFQA 4A2PA 3UMGA 4C0XA 3D7SA 4EH1A 4WN9B 4IYJA 4ZEWA 1Y6RA 1SURA 3D3QA 4KR0A 4TSKA 3RKSA 4TTSA 3KAQA 4EJSC 2A6PA 1YGPA 1Y89A 4W8OA 4XCQA 4R9RA 1F0YA 3OUTA 1G7CA 3LVRE 4KXMA 3TXAA 3V1UA 4YRMA 3AR6A 3FVWA 3EF1A 3RRZA 3TI9A 4EY8A 5BN1A 2DF8A 1XAJA 1M5UA 2WSIA 5LL6P 5DPMA 4G5GA 3OFND 2ORYA 3WX0A 3PEEA 2CKDA 2AI2A 2IXFA 1NOKA 5G0TA 4CR8A 3CF4G 4RM2A 1II8A 4G84A 3VO8A 4AB1A 3M81A 4OU4A 1G3IA 4OI0A 4TKVB 3HA2A 2GA9A 3UQYS 4BJ1A 2NIPA 2WJHA 1EUQA 1N6HA 2VATA 2A3NA 3GQBA 3ZLUA 1JKMA 4JIGA 2YMLA 4BVHA 4ER7A 3A7DA 2WK1A 1IHUA 2ZOSA 5DCLA 3FKSA 4YJKA 1DHRA 2Z3ZA 4W5WA 5FUBA 1U1IA 3RVMA 1EGVB 1QIJA 1W6UA 4IG9A 4NZMA 1FDSA 2QN2A 3AEQA 2O2EA 4KN5A 5BT9A 3L7MA 1T5HX 3DHNA 3IHLA 4O2BA 4CQJA 1SC6A 3EXG2 4PR3A 1Y0BA 2E0IA 2G4VA 2YJ6A 3ORYA 2BC9A 4RF2A 5F2OA 2QTMA 2BRUA 2C31A 1FP4A 1JFFA 2ATIA 2HK9A 3F74A 5CR9A 2LPMA 2PZJA 1XN1A 3DWEX 3EPLA 3PWZA 5DYYA 3P0HA 1LQ2A 2NU9B 3GVXA 4A1FA 5B2FA 4Z4QA 1YB2A 2DGDA 4B7AA 4BVJA 2HJHA 2QAGC 4WLEA 1WZUA 1A8PA 5BXQC 2K87A 4URZR 1K86A 3N8GA 4YP6A 3TAHA 1E61A 1FYXA 1QPGA 2AFHB 5ER6A 5EWJA 5EZSA 2G9NA 4LC9A 4GL2A 3HA5A 2JFNA 4PGFA 2J0SA 3WA6A 1K8XB 5CLIA 4REOA 4H1WA 2HQRA 5JZMA 4AKTA 4DM4A 5K0BA 2VP2A 5DM1A 4F12A 4Z7OB 1VE7A 5JPIA 1DEHA 1AT1A 2YJ5A 3EOBI 1UJBA 4KLCA 3QYFA 5LMCA 1J20A 4W1PA 3UYKA 3GT0A 4EITA 3LXXA 3GFRA 4UUNA 2CDAA 5C7OO 1PBNA 3E22A 5GADl 3IA2A 5JO9A 2JLXA 4R7GA 1E3SA 4HXYA 5BWMA 5DULA 4BNKA 1YQEA 5FUMA 5JYEA 2KYRA 4FSHA 1OOEA 2ZSHA 4CIXA 4Y9DA 4Z0TA 2G71A 4PZDA 3NU1A 4HD8A 1T2VA 2IH5A 1RPTA 1B3BA 2CBGA 2NVBA 2YFQA 3HVHA 4KKVA 5EE5B 3GLRA 4ZU3A 3RRMA 1GGFA 2C9MA 4NABA 1PGQA 2E4ZA 3T3EA 3LLUA 3VA7A 1V8OA 3TLGA 2YQ5A 4R8VA 4QYWA 5MN6A 3RLFA 1L5FA 1P9WA 2AG8A 4HPXB 2FWMX 4DCPA 3H5LA 3GT7A 4YTEA 3O3NB 2V7PA 3QK7A 5EHXA 4QNRA 1P1FA 1CK4A 2AFRA 2I54A 7REQB 1MOPA 2J0UA 4C01A 2OAQ1 5TSDA 1D5CA 4D45A 4BO4A 4DLPA 1ICEA 5EWMA 2C58A 3GJSA 1JHDA 1GGHA 5HF9A 3TTSA 3EA0A 2AEFA 2QUZA 4JZKA 4YJ2F 5ICEA 3KU4A 3WSTA 4QARA 5I8WA 1UK8A 1K9SA 2QAIA 3IYLW 4GRIA 4KAFA 5CT5A 4JLJA 1KDRA 1ZOSA 4UMVA 4CMIA 3OLVA 5C37A 1R5JA 2FSGA 1XJCA 4PNHA 1OI7A 2ONZA 5HUHA 1LTKA 4B3SB 4ARUA 4BV9A 1HLFA 2QV0A 4A8JB 4E6EA 1U7PA 2J3QA 5FTNA 3NVKI 3IAS6 3R6DA 5D2CA 2QTFA 4D9GA 1M6VA 1QSGA 2H2GA 3LCCA 1FX0B 2OCYC 4FYJA 2X86A 4JXZA 1UPBA 2GNPA 2GVDC 5TARA 2M2IA 4C4ZA 4MWEA 3DT9A 2QRPA 3WQBA 2OECA 4F9EA 5BPHA 1T9HA 4YRNA 5F23A 1L1FA 1SKYB 2QTZA 3ICVA 4EEZA 1QAOA 2FGKA 2VH5R 4JP1A 1OV4A 1D1SA 1YZNA 1EWVA 3UJPA 2P6NA 5BSKA 4FIDA 3BRWD 2O6HA 3E2PA 4Y1EA 1ILEA 1X9HA 1XCBA 4B6GA 1G8SA 4W9NC 5L3SB 3NHLA 4B3RB 1K08A 1Z0UA 2CDNA 2PU7A 5CLFA 5JAUA 5AXDA 2QRVA 4QATA 4DRXB 5FI3A 4Q3LA 5BORA 4LXIA 1D4OA 1BWRA 1KZGB 5BSRA 1SQFA 3MXTA 5DX0A 1H1TA 2QGNA 4BO9A 2YZKA 2CFRA 2C3UA 3ONWA 3V4SA 1KJYA 2PMDA 5J3JA 4KQMA 3GRFA 3AESB 3H4VA 5F3WB 3TZHA 2SHKA 1P7VA 3GLQA 3ZS9A 1DAMA 1N6OA 4HAWA 3C6KA 3ZCUA 4DDVA 4YDHB 1PJRA 2O50A 2C99A 4BBPA 3WJ7A 3NWOA 1FSSA 1T1IA 2PLWA 1WSBA 3FZYA 1M1NB 2ZT6A 3Q10A 1YA6A 3EPKA 4R41A 4R1NA 4LF6B 1MJFA 4B3FX 1W9HA 2BEVA 3I34X 3PNSA 2I1WA 4KLZA 5IABA 4RDXA 4E5DA 3ZDDA 2PBFA 1KDTA 1MGPA 4IIUA 1AXRA 4IKPA 1QHNA 3ZCVA 1QPBA 2JC3A 4JQCA 4P81A 4X66B 1BCRB 2HCTA 3JATB 2PUGA 3SZRA 2YYSA 3UGJA 2NU8B 2AZMA 1HYGA 5DXAA 4Z3DA 3COWA 5JZVA 4X1IA 3I01A 4LJLA 4ALJA 3MJRA 4O4HB 4O1IA 3PS9A 1I01A 1CX9B 4PPNA 4YCSA 1GSHA 1R50A 2BP7A 1GZVA 3ZGNA 3PFIA 1N0VC 3GLVA 5L7WA 1U11A 1E2QA 2JAQA 1HLDA 2J7KA 1C81A 3C6XA 5FO1A 2AOVA 4XVRA 4G3XA 1NVXQ 3BGDA 4URHA 2CUTA 3EX7C 3BAFA 1QAMA 5GY7A 3ZJ4A 5HQ3A 4LECA 1TZMA 4B3XA 1EVZA 1COWA 1JQKA 1FLDA 4H4EA 1PGNA 4M1EA 5IAJA 3NVDA 4UNPA 1M2WA 4R68A 5K8VA 2NO7A 2QZ9A 3K8YA 2P5UA 1Y1RA 3SLGA 1T9CA 1U9IA 3QWHA 3DBVO 3GDFA 2VJQA 3BVPA 4W8GA 1K2WA 4Q93A 4XYGA 3Q8KA 2B69A 1N8SA 2B92A 2CZCA 2ZIFA 3OEYA 1TYEB 4RA6B 4ARAA 5KSOA 4QPNA 1ZUIA 2DP4E 3BMNA 3G6WA 5FL3A 5BSFA 2X4GA 1VQ1A 2W37A 2AJLI 1JG7A 3KQYA 4MKIA 4RACA 3RBAA 4HYYA 3QZUA 2XTJA 5U4QA 3VR6A 4DJDC 3NKVA 3V97A 1GHTA 4HGNA 3V1TC 4IVNA 3IV7A 4MO2A 1LDMA 5TY0A 4B33A 5L95A 1N8KA 2VJCA 4W5HA 5J23A 3E4DA 2O2CA 4H7IA 4EF6A 4LV8B 2P68A 4MQUA 4UJ5A 3K8OE 3RC3A 2VZ9A 2B61A 2EX1A 4UUMA 4XGNA 4TLLB 3DS8A 3OICA 4B5LA 4OTZA 5I4IA 5IJ9A 3QKWA 2DFTA 4CL8A 1Q50A 2O7RA 2TMYA 2A88A 3FLEA