1DP4A

Dimerized hormone binding domain of the atrial natriuretic peptide receptor
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
425
structure length
425
Chain Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
publication title Structure of the dimerized hormone-binding domain of a guanylyl-cyclase-coupled receptor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor receptor, lyase
total genus 144
structure length 425
sequence length 425
chains with identical sequence C
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dp4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dp4A01
5B3JA 2FMHA 5IC5A 5FWXA 1DZ3A 1URPA 5GOTA 5TQ2A 2FSPA 1F4VA 2GX6A 5KQMA 4Z4FA 3Q7TA 3DBIA 1YIOA 3JS5A 3P9YA 1APBA 3KTOA 5TPWA 3EAFA 3LMKA 1D1PA 4M88A 1GUBA 1EWKA 4FE7A 4MQFA 1DJMA 2FEPA 4RV5A 1CYEA 1QQAA 4MS1A 1QQBA 4LDAA 1ZHHA 3H5TA 1QO0A 3KKEA 4RY8A 5CNJA 1ZVVA 1ZITA 3EDCA 5FWXB 2HQRA 1JF8A 3HM9A 3ILYA 3OLXA 3LTEA 1QKKA 3URMA 4KK4A 4XARA 3OLVA 5TPWB 2V0NA 4KK3A 1ISRA 2R4QA 4G0OA 2F8TA 1RZRD 3KYIB 4MQFB 3GL9A 4N76A 4MR9B 5BRJA 1JYFA 3VNAA 4ETIA 4ZMSA 1USGA 4RXTA 3QLUC 1EHCA 4PEVA 5DTEA 1M2EA 3HCWA 3I45A 4NQRA 5D2CA 1Z18A 4EYKA 2FLWA 8ABPA 4JB2A 4MS3A 3A3KA 4G0XA 5EWMB 4GPAA 1J56A 5JNRA 1OXKB 2FQXA 3QELA 4WUTA 3KJXA 1I3CA 4G0PA 3SM9A 1ZAYA 4O5AA 3B2NA 3HV2A 4RK4A 1DBQA 1RNLA 2I6FA 4RY0A 2LUOA 6ABPA 2QR3A 3HUTA 2BGGA 3DGEC 3FDFA 4QYWA 2HPHA 3NHMA 4W5TA 1GUDA 1ABFA 1P6UA 4YWHA 1OXBB 4MS3B 2QSJA 2W42A 3KCNA 2X7XA 1Z15A 4KFCA 4IMIB 3H1EA 2NUBA 2PE5A 1PEYA 2ZAYA 2QVGA 2VK2A 4RKRA 5IULC 2P4UA 2VYCA 3QK7A 3UK0A 3BREA 5JS1A 2FN9A 3EULA 3C97A 3A0UA 4OTZA 1MB0A 1USIA 1HEYA 3HZHA 2IPNA 4ZYLA 3H5OA 1U04A 2AYXA 3E3MA 3LUGA 2PUGA 1L5ZA 3OO0A 4UHKA 5T3YA 4RK5A 2L17A 1C4WA 2PKXA 1FFSA 3OO1A 2PUAA 3EGCA 1DCFA 2QW1A 4RK0A 4WT7A 4D6XA 3KG2A 1Z16A 2MYNA 2MYPA 2E4WA 1Z26A 3KYJB 4ZMRA 3DLHA 2JVIA 4GNRA 1UDRA 4Z9AA 3FFTA 3NBMA 1SD5A 2VUHB 1QMPA 2HJ9A 4YV7A 5JNTA 3JPWA 4B09A 2DRIA 2NZVG 2QXYA 3DGFC 3FGZA 3S99A 4EYGA 1RXEA 1USKA 4EYQA 2A9OA 1DP4A 1JYEA 1PNRA 3HXMA 1EAYA 5CNMA 4EVRA 4JB0A 4PICA 1QPZA 4OLBA 1DG9A 2XDYA 5HKOA 1XWWA 2FW0A 1LJUA 3H6HA 1BDJA 4MLCA 3DLBA 4N0QA 4XASA 3KSMA 1U2PA 3O1JC 1SXHA 3Q15C 4Z9BA 2YHAA 3Q7SA 3C3KA 2FEKA 1NATA 4JP1A 4H3HB 4WZZA 3RQIA 4ETMA 9ABPA 5FWYA 3CTPA 4TN5A 3HJFA 5BQ3A 4MQEB 3TD9A 2PL1A 6CHYA 3HDVA 4P98A 2NZUG 2JB9A 3O1IC 4KRFA 3NNNA 3OM0A 2Q5CA 3H5VA 3SY8A 3LKBA 3LUJA 4ZPJA 4MS4A 1A0OA 2GI4A 2LP4Y 4YP9A 3NNDA 3CNBA 4DQDA 4EVSA 1D2AA 2JCGA 2GKGA 2QVCA 3HUUA 1P8AA 1U0SY 4Q6BA 4HNRA 3CZ5A 3MQ4A 3CHYA 4IILA 3BRQA 1TVMA 4MLDA 2E4VA 3OQMA 1M5UA 3O74A 2WMYA 3EJWA 2FTKE 1MB3A 3N8IA 4MRMA 2PJUA 2CD7A 3L49A 4ETNA 3N6VA 1VRVA 1JH9A 4RK6A 1F51E 5TE9A 4LZLA 5TQ2B 3QLVA 3RVMA 3JY6A 3F6CA 1NXWA 3KLNA 5CHYA 1W25A 3CS3A 4EYOA 4RY9A 3T8YA 1IIBA 2ID9A 3F6PA 4LE2A 3H5LA 1FFWA 1A04A 4MS1B 3IPAA 1ZDMA 4TMYA 4RSMA 1JFSA 3TMYA 4MR8A 3NNSA 2L18A 3C6QA 4W5RA 3JTEA 4RK1A 4S05A 4KNYA 3MIZA 3GBPA 5EWLA 4W5OA 1ZH4A 2WRZA 2FVYA 4EUKA 3LUAA 1A2OA 1RZRA 5KQGA 2OQRA 1YS7A 1D4ZA 2PUDA 3VNBA 2FQYA 5FBHA 1JX6A 1Z2EA 2FXIA 4EGSA 4EVQA 1E6LA 1MAVA 1AB5A 2FMIA 3IP9A 1JBEA 5HQJA 1NTRA 5B3JC 2PUCA 2A9PA 4Q7EA 2H0AA 1YS6A 3O21A 1DBWA 5ED4A 4MAAA 1GCGA 1D5WA 4LRQA 1QNLA 3HO1A 4D74A 2IOYA 3QELB 4LDZA 4G0ZA 1KRWA 3QX8A 4DN6A 5KI6A 1XHEA 1GCAA 2PUFA 2N9UA 1ZN2A 4TLMB 4HYEA 3HVRA 1FFGA 3SQNA 2PAFA 1H9CA 3E61A 2R48A 3CU5A 3MYYA 1VPWA 4N41A 2E4ZA 2H3HA 5F64A 5BRAA 2YHBA 4LE1A 3RVNA 3O1HB 7ABPA 5E3JA 1KGSA 2RGYA 2CHEA 3JPYA 4YO7A 1ZY2A 3OM1A 4H60A 3OQNA 3O2QB 4F11A 4S04A 2M98A 2B1JA 5ABPA 4OATA 4F3TA 1Z25A 5TQJA 2ZWMA 2CWDA 4RZSA 3NHZA 3W9SA 4MR7A 4IRXA 1QP7A 4N0PA 2HQOA 3C3MA 4G0YA 3G85A 2F8SA 1JDPA 2KYRA 4RKQA 3ILHA 4N47A 5DKFA 3D02A 3TX6A 3FMVA 5JNSA 5GQSA 4KVFA 1K68A 3LFTA 5KQLA 2WWVD 3EQ2A 1NXSA 3TO5A 4PZ0A 3HSYA 1TM2A 1CHNA 2FEWB 2RJOA 1NXTA 1YK0A 1E6MA 4MR7B 2L2QA 4PYRA 1PHRA 4LX8A 4KREA 4KQCA 1NXPA 4L85A 3RVJA 1JFTA 2MSKA 2WJAA 3OLWA 5HM6A 1JDNA 5JNUA 2VUIB 3HS3A 3BBLA 5TPZD 5I4CA 5IBQA 4MYRA 2PUBA 1NY5A 2JBAA 4YS6A 2O20A 5KC8A 4W5NA 3ROFA 1BVHA 3MMNA 1JHZA 1P2FA 2E4YA 1SRRA 2ID7A 4MGEA 1FQWA 1NXVA 2JVJA 4RXMA 3BILA 1ABEA 3CKMA 1WETA 2LPMA 5T7BA 2L19A 2IDMA 1Z12A 2LBPA 1JL3A 4QPJC 2RDMA 2JBAB 5EWJA 3K4HA 3RH0A 2E4UA 4L4UA 1KMIY 1S8NA 1TMYA 4E7PA 5JNVA 5KC9A 3EODA 3K9CA 3I09A 3QLUA 4FE4A 3H75A 2PL9A 3SG0A 1DRKA 4XFKA 5FWYB 4H3KB 5HSGA 1MIHA 4XXHA 5JNWA 5TQ0A 3GV0A 2LIVA 2OENG 3MF4A 3HK2A 2QV0A 3N75A 3N0XA 5EWJB 3SAJA 3H6GA 5IEBA 4MS4B 3F73A 4PE5B 4OBBA 3BRSA 3OLZA 4O1IA 1M5TA 3H1GA 3H5IA 3HDGA 2FKAA 2QU7A 1Z17A 5TQ0B 3IP7A 1QO0D 4G0QA 3UKJA 4Y9TA 1GLGA 1L5YA 5IUKC 3T6KA 1M2FA 4Z4HA 4CBVA 3JVDA 4RU1A 4MRMB 4F06A 4NV3A 2IPAB 1JFVA 4JASB 5CNKA 3H1FA 4MR9A 4D6YA 4FB4A 3O75A 4KZKA 1YTUA 2GWRA 3RVSA 3LUDA 4LE0A 1AB6A 1ZESA 1Z13A 3LUKA 1XHFA 2IPMA 4RK7A 2FQWA 1RPJA 3RVLA 1DRJA 4F8JA 4Z4CA 1LBIA 4NCAA 4ML3A 3N0WA 3JVIA 4RDCA 1E2BA 3D8UA 1YMVA 3RVKA 4OLAA 2NT4A 1DBPA 3C3WA 4MR8B 5EWMA 3IPCA 4JAVC 1T34A 3ROTA 3GA5A 1SXIA 4YLEA 4Z4EA 5EWLB 3QEKA 4HNSA 5BR1A 4YGXB 1K66A 1VKRA 3O2SB 4W5QA 4JA2A 2IYNA 3KLOA 1PEAA 3OMWA 1EFAA 4YR7A 4E7OA 3GRCA 3QX9A 3RVOA 4Z4IA 4IMJB 1ZGZA 1W9HA 2P9HA 1E6KA 3G1WA 5CNIA 1R8JA 2IPLA 2R47A 1NXOA 1CEYA 4WWHA 1BA2A 3LUFA 3N53A 2R25B 3A10A 3UUGA 1DCMA 3QLVC 4RS3A 3IP6A 4YRZA 5KQPA 2PUEA 1KRXA 4Q6WA 5PNTA 2PMCA 1DCKA 3CRNA 3RVRA 4XAQA 4KQ9A 3M9WA 3MM4A 3HEBA 3R0JA 3GBVA 4KV7A 3GT7A 1YVUA 4Z4GA 3OMXA 4O1HA 4WXMA 4KMRA 4EY3A 4RWEA 1QP4A 4HNQA 3OLYA 4QICA 1YK1A 2A9RA 2M1ZA 4KPYA 3LOPA 3A0RB 1NXXA 3M9XA 2QZJA 1U2QA 2JK1A 2JVKA 2J48A 3MA0A 3DZDA 4IGAA 5JS2A 1DC8A 1PNTA 3I5AA 1BDHA 3RVPA 3Q9SA 4Z0NA 3OQOA 1P6QA 3IP5A 5KWSA 5FBKA 1BDIA 2RJNA 1JWLA 1EWTA 1C0EA 3RVQA 3CZCA 4G0MA 1U8TA 4F12A 2AYZA 2NT3A 4N03A 2JRLA 3LUCA 3CG0A 1LJLA 1EWVA 2MYTA 2WJWA 4XLTA 1DC7A 3LKVA 1TLFA 4OG2A 3QEMA 3IDOA 5IUNC 1QP0A 3SNKA 1RXIA 1PUXA 1Y1LA 3KS9A 4Z99A 2E4XA 3QLTA 3T95A 1ISSA 2MSLA 4MPTA 2IKSA 5C5CA 1LBHA 2MSWA 4G97A 3GWGA 4NCBA 5C5EA 1FSPA 3FFXA 2B4AA 1SXGA 1BAPA 2TMYA 5TPZA 5DCLA 4DADA 3N0RA 3Q7RA 2FLKA 2GBPA 3O2JA 3QEMB 3TB6A 5IUJC 3M6MD 1Z2DA 3CG4A 2CHFA 3CLKA 1LK0A 2FN8A 4MQEA 2A9QA 1TJYA 2MYUA 3LUHA 2WB4A 1ZGGA 4JOQA 1MVOA 4IF4A 2FMFA 4UHJA 5DLEA 3KHTA 4G86A 3H5WA 3CFYA 1JLKA 3T38A 3Q41A 4TLLB 1ZH2A 4RXUA 3FFWA 3L6UA 1VLZA 5DGCA 5IEJA 4QYMA 3I42A 3GYBA 4ZJPA 2HQBA 3EQZA 4NICA 4YCSA 2HSGA 3F7NA 1D1QA 5IX8A 2WY2D 1YMUA 2FMKA 4WXEA 1B00A 4P1ZA 2PLNA
chains in the Genus database with same CATH superfamily
1WXGA 2HA7A 3C41J 1LQUA 1T9HA 2O8EB 2LKCA 1OMOA 1TCVA 4HLDA 4M83A 4L78A 2P9FA 1KZYC 3H4TA 1M1NB 3DLIA 4HK4A 4LJ4A 3LFHA 1X2EA 2JBHA 4QD3A 5FFNA 5LZ8A 4NZMA 3RS0A 1M2HA 1ECFA 3FOCA 2E89A 3ORFA 4F21A 5HDQA 4BVKA 2UZ1B 4OFWA 3THWB 1MEJA 5ARCA 1YOVB 2WNSA 3KU4A 5E38A 1XAHA 1Z0KA 2H1CA 3ENKA 3MB8A 1PZEA 4QFCA 1C7RA 2WV7A 4X00A 4JI5B 1N78A 1EINA 1MUUA 2IYVA 2Q5JA 4LVOA 4C08A 5JXGA 3FTNA 4R5MA 4CFSA 2OD2A 3W2GA 4R0NA 4FYIA 4BOYA 4WFQA 4EPYA 5JXIA 3OWHA 4NL4H 4F1JA 1P44A 5DASA 1UXIA 3JQAA 3PD7A 5C52B 2CV1A 5H82A 1JYFA 3C1UA 1LBTA 1U0GA 4DZRA 4KBFA 4ETIA 5DULA 1G64A 1N5IA 1MJ5A 1NYLA 3U4DA 3MVEA 5CFNA 4CDMA 1F2TB 2UDPA 5AICA 1QOPB 3CVJA 1EP1B 4RYLA 2QORA 1H5NA 3I45A 5TQVA 4N39A 4ZCMA 3EOAI 4GQBA 4RV9A 5L6MB 4MQLA 5THXA 3OQPA 2BBWA 3MS7A 1A5SB 1VP9A 3OCUA 5EWMB 4ENSA 5B2ZA 3IAM1 1W4AA 3QYJA 4P92A 1C1DB 3DZBA 3NKFA 2GPTA 2IYOA 1RRFA 2JLRA 3RVBA 4AMYA 3GFTA 3IOBA 4NEHB 1S2IA 5K01A 3GLGE 2FUCA 5M04A 1ORIA 4HQRA 4ZK2A 4HFMA 2LUOA 3E6AA 2QR3A 5BOSA 1C14A 3TD6A 5KWEA 2ZE5A 2ZT5A 4PGGA 3E5MA 1UBJS 1S8OA 4FHFA 4QRDA 3ZCRA 3KCNA 4UUNA 1E2FA 2RGXA 1PLLA 5KTPA 1MO3A 1TKBA 3FKSD 2YYYA 1PS8A 1V1MA 1PEYA 2XJ9A 2V4MA 1X13A 2Q2NA 4GL4A 3UTCA 3W2FA 3NAGA 1G21E 5IULC 2FPIA 2RD2A 5K3FB 2VQFB 5I7EA 3N0VA 2IP4A 2WKQA 1WBDA 1UPTA 3K15A 1ZEMA 2R7LA 4BCBA 2VVTA 4AULA 4YJ2B 1W4RA 1FYFA 3IBCA 1G2PA 3H5OA 1EFTA 1ZOIA 3I4FA 3IBYA 2AFVA 1EJ2A 3CN9A 3GRYA 3P5BA 4FNAA 1MG5A 4YJ3A 2W70A 1XCPA 3WMRA 4CM8B 2ZJ2A 3ZHQA 2V7GA 2J3HA 1J8MF 2J3QA 3EIQA 5F7JA 4ZVPA 3V46A 2E5LB 4ER3A 4YCAA 2HRZA 3TAUA 1B26A 1Q7GA 1QB8A 3IALA 3D64A 4LOHA 4A7PA 2H1WA 1ULZA 3CURA 3A6DA 3P1JA 4HHEA 2C3PA 3TZCA 4P4UA 2F3QA 5JZSA 5I9NA 1WSAA 4YCBA 5IXSA 5KB3A 4ACBA 1MA0A 3F49S 5HKAA 4JVSB 4MVJA 1OKKA 2C4MA 2EDCA 4I9HA 3LBIA 3WWCA 4DY4A 3ZE2B 1BOFA 2P2CA 4JOSA 5BPHA 1BX1A 3OQJA 3RAGA 1NI5A 3HMKA 4OYLA 3THSA 3B6IA 4JJGA 5TVKA 4CTKA 2AJDA 3F8WA 4LBVA 4D42A 5A9RA 2XUKA 2QM8A 5KDLA 2R2AA 2XBUA 3F6EX 2C9ZA 1I1OA 4I9FA 4DV3B 4BNKA 4K3UA 2QMHA 3ENQA 5CYOA 2ODQA 3EEBA 4CG0A 3A9CA 2MSCB 2V9ZA 3ESRA 1CQIB 4Y7CA 4P5EA 1YJCA 4MLCA 3QEAZ 3ZN2A 4N0QA 3KSMA 3UJHA 4YRTA 5DBIA 1REQB 5GZ1A 3FOFC 2QR5A 4EKEA 2E82A 4D0GA 5ALVA 5KYNA 3DKVA 1UM8A 2H85A 2O1WA 4Z51A 4XIIA 2D2EA 2GBIA 4RMJA 3N7TA 1JLRA 5JZVA 3OX2A 3CTPA 4TMZA 3N05A 3VYWA 2UYCA 5C7YA 2ORYA 2X0KA 3Q8KA 1FTSA 2C59A 1M1YE 1L5NA 3BRWA 2XB2A 3MRTA 1U3TA 5FT9A 2DG2A 3EYAA 3F5DA 1M8KA 3DUWA 3QPBA 4QU9A 3VHQA 2ZB3A 3LY8A 3OJEA 1KYZA 4Q1VA 5CX1B 3DAGA 3HUUA 3MWYW 3P71T 3OFJA 3E3AA 2GF9A 4HAIA 3GJXC 1JT9A 3FPLA 2B83A 5LQNA 3QUBA 4Y3UA 4NAUA 2JCBA 3X1WA 3PC3A 3EIXA 3O8DA 5EN4A 1VSTA 2ZXUA 4I4NA 5CA1B 1SXJB 1WUJS 2FQQA 2NXWA 4MZDA 3QIVA 4LQLA 5CH8A 5CEEA 4V0NA 2CD7A 4PYNA 5JJIA 1T26A 3HGTA 3OKPA 5ALUA 3O3CA 3THYA 2BFMA 2XMQA 5TQ2B 3VH4A 2G28A 3ZW8A 3FUTA 3SBDA 2OK8A 1Y82A 3PNPA 1IIBA 1WV0A 3L7CA 1D2CA 3CF2A 5FOVA 2VJNA 3G2HA 1PUJA 2KBEA 2FPPB 3UO8B 4HV4A 1BS2A 1A04A 1F8YA 2GS9A 2DLCX 4DLVA 4BGEA 3JAKB 1TI7A 4RCZA 2UZIR 4KNYA 3P20A 5CA0B 2G9ZA 3HO6A 2V1XA 2FE4A 4PGAA 1ZD4A 5CB8A 4L76A 5BT8A 3ER9A 3GEHA 1IPHA 3W8RA 2P9EA 4ARBA 3RSLA 5K2OA 3AEZA 1GCIA 1QVVA 3FUVA 1A96A 5EJEA 1IBSA 4MHSA 2WV9A 1XAJA 2MMGA 2X1MA 1KHHA 3KHUA 1X0XA 4DV2B 4G5HA 3B9BA 3JD3A 4OJNA 3U13A 5EZYA 3PHHA 3KLPX 2C4TA 2C07A 1I1QB 2R1VB 2XUIA 4DHWA 4CL3A 4D4KA 3O21A 5ED4A 1SKQA 3HO8A 4LRQA 1M6VA 1QNLA 1OI2A 3FCXA 1QIEA 1M75A 3A14A 5MGBA 2PG3A 3L0PA 3X1XA 2ZE8A 4BFZA 4JUFA 4PR0A 3TXXA 3GLQA 1Y0BA 2O2YA 1F14A 2OQIA 2QGFA 2ZIVB 2N9UA 3GGJA 2GEBA 3I8XA 2HYDA 3REFA 3RRMA 2IQIA 5ISMA 1UIMA 2Y0CA 3STTA 2ANCA 4I9NA 2G77B 2PBRA 3BMNB 4FWTA 1MZVA 1JKMA 3QTBA 4IG4A 4KE8A 3U4MA 2FRXA 1YQ9A 2CXHA 2RSLA 4HRAA 4JA0A 4EEXA 1Z63A 1H2AS 2PUHA 3B3JA 1K88A 4JLSA 2Q5EA 4WLNA 4PO3X 3MTGA 5H68A 2B8NA 2DH6A 1CUBA 4FK8A 1E0KA 4URXR 3GT3A 3U56A 4DR3B 2FW1A 1O8CA 2QZZA 3DV0B 3PB3A 1KGSA 4EA9A 1EK2A 2WP8J 3L9WA 3PT9A 1UMDA 4Q4AB 4JI3B 4EKDA 2C9CA 5JBQA 3HB4X 3O2QB 3P8ZA 3I9JA 4IJ6A 1HDRA 5E9QA 2ZWMA 2CWDA 3EA4A 4JROA 1K3TA 1A69A 4M0FA 3TEFA 2X9GA 3BD9A 5EIFA 5BT9A 4XI9A 2JGMA 4DSTA 4F97A 2OM6A 2WIBA 3BFVA 1NVGA 1ACLA 1BWQA 1L9XA 3DNMA 3RRNA 1O95D 4V2IA 2H1OA 1E1KA 3C7KA 3D02A 3MTJA 1I13A 2FZVA 1Q20A 2BEJA 2X6TA 5KQLA 3U3JA 3MW8A 2J4FA 3WKBA 1HKHA 1XA4A 4BRZA 2VZ9A 1E8MA 4E4RA 4L4YA 1ZN8A 1XTZA 4U8HA 1VFPA 4HNAA 4WNAB 1VXOA 3S2UA 1V6SA 3WMEA 2JZNA 4A92A 2A7QA 4KYTA 4OX9B 5ICFA 3P0FA 4X1IA 1CZOA 1JV2B 1XYGA 3G68A 3PFGA 1KSJA 3PXGA 5DX0A 1NVEA 4URUR 4I3GA 1L1RA 3BA6A 1A9XB 1V9SA 5F4BA 1OGJA 3Q6NA 2QRNA 2PRIA 3G0BA 1I5RA 1SRRA 4C5BA 2CV2A 1FQWA 4RX1A 3FNQA 3VU9B 3OQBA 1J0DA 4D4MA 2UUOA 4KYVA 1J00A 2UVQA 1Z0DA 2G40A 1U6KA 1OBOA 2CEAA 1MJGA 3ZI0A 2V7WA 3ANTA 2EF0A 4D8YA 2AG5A 2OAQ1 3FNGA 4GM0A 4NV1A 2OEPA 3H1AA 4JEUA 4TL8A 3HA7A 1KOLA 4E2YA 4E5KA 2JA2A 4DBLE 3EGXB 5FWYB 3BGWA 3IAUA 1JU4A 4BLQA 1YZNA 1V9CA 4QNNA 5ILQA 1T3SA 5K3OA 3O4RA 3HLKA 4TTSA 4PIVA 3HTXA 4URZR 3LYLA 2HCBA 1LV7A 1NV8A 2GARA 3DEKA 3CUTA 3INYA 4IEEA 5H9VA 4YMIA 4D82A 2DP4E 1Z3IX 1YZTA 3BZWA 1RABA 5DCYA 3ZEAA 1R6BX 1SD1A 3AJDA 1QP8A 3SZGA 5HVNA 1G55A 5CTJA 3ZXYA 4UDXX 3A1WA 2P4HX 3LQ4A 1XALA 4M21A 4R54A 1RQ7A 1BMTA 3I01A 4MKHA 5KNDH 1GLGA 5EL0A 4LV8B 5TSDA 4B6RA 4B74A 1NDQA 1F6BA 1NKTA 2B37A 4RD3A 2BTOA 3ZKWA 1KFBB 1IPFA 2QJRA 1L5MA 4G1EB 1VCIA 1YBVA 2IZ5A 4P4LA 1AXGA 1R0BA 3LT2A 1O6FA 2NQ2C 5IDWA 4KR2A 1KERA 4LE0A 1ORVA 4KO1S 1AU9A 3COVA 1HYGA 3F2VA 1OOEA 4NP6A 5I9SA 3UICA 4JJ7A 5BNIA 4DIDA 1E2BA 5CDFE 3EFEA 3LM8A 2X13A 5EPOA 4MJXA 2NU8B 3ES9A 4ZEWA 4QLBA 5KMGA 4LZPA 3UXHA 4A6PA 3DTTA 4YAEA 2BFFA 3KZKA 4YLEA 1I51A 1TCCA 4FZ5A 1UJ4A 3EZ2A 5FOUA 4PSVA 4R3UC 4D4LA 3H9BA 1OGYA 2J6IA 3AIOA 3EXHB 1I8TA 4BGVA 1SRQA 3AUJB 4R9VA 1P1KA 3RYCA 3IS3A 3PXBA 1MO4A 2XGOA 1IDOA 5HCIA 2JFBA 5ALMA 5IK2D 4DDKA 1WULS 2NYVA 4MPPA 1Z4LA 3OJCA 5FUQA 1E6KA 4H7FA 5IANA 1WE2A 2P1RA 1XBTA 4XGNA 4XJSA 3T54A 3ZD8A 1LVUA 1NQ5A 2Q6TA 1EXNA 3BMQB 4X90A 5EEHA 4MW2A 1P2GA 3D8NA 4IIFA 3R0IA 4MVJG 4YRZA 2QM0A 1DMSA 2C2OA 3QKWA 2FCAA 1PLJA 1AKQA 4DUGA 4EY7A 2PMDA 4NHEA 3ZIDA 2Z2YA 3R23A 1F0NA 1V5WA 1W1UA 1HT1E 4CU5A 2FH5B 1C9YA 3CZMA 5C8ZA 5KUTA 3CVWA 4K9QA 1F2UB 3UH1A 2XGJA 5DM4A 2VAPA 1NOJA 3CBQA 3KDPA 2DBRA 2P2SA 3D7MA 4OU4A 3TR6A 2DX7A 2RBEA 4BIMA 5EJ9A 4IJVA 2DSNA 1UWVA 2Y27A 2J46A 3RJ5A 2IHYA 3UAOA 2ZYTX 3KB1A 2WSYB 4N3AA 3DZKA 3V2UA 3TDNA 3MCVA 3OZGA 3BL6A 3DQZA 1NJ2A 4TV9F 4EM6A 3IP5A 2N0SA 1GZ4A 1SU4A 4NABA 4XM1A 2P9BA 3BCSA 1K2VN 3KHKA 3DDHA 5H02A 2PZAA 4EPVA 2RJNA 1QH8B 5IKPA 4FGSA 3UFBA 3RVQA 2JLZA 3QMVA 5D3KA 5IJ0A 4G0MA 4F12A 2ZJ3A 1VE3A 1QTNA 3AO0B 1UBSB 3DZGA 3K7EA 3GDHA 1P7VA 1HSOA 1K6MA 1RSZA 1SKYE 5BMVB 1ZUIA 4MLPA 1C0PA 3DXYA 2BSQA 1FOEB 5B4VA 4ZCTA 1DJOA 4I3FA 1K9SA 3LDHA 1RXIA 2MMCA 3FDJA 4K88A 2JFYA 3IOYA 1ISSA 4MPTA 2XB9A 1PQUA 1Z7YA 2FDRA 3C3AA 2MSWA 1EBFA 1S96A 1W5BA 1ZMTA 1EUDA 2PGAA 2XMCA 3MXOA 4R1OA 3WSVA 4ZYYA 1SOMA 3WJAA 1FP4B 4U2DA 2WC1A 1WUIS 2BP7B 3MPUA 5ALLA 3WKEA 1YWGO 4K9OA 1NZFA 2QOEA 3O2JA 3RYTC 3ZVRA 4MGZR 3M6MD 5I7WA 4BKRA 5LMCA 3SI7A 2AUTA 4K9DA 4HLUA 2JASA 1NBWB 1ZVKA 3OZVA 4AROA 3LUHA 4FZRA 3MJSA 3ZOKA 3BHMA 2P7HA 3RS8A 2FOLA 1BYIA 3KXKA 1A1VA 3GHHA 2GDJA 4FFLA 2ZAMA 1J25A 1DKLA 3CMCO 1CUYA 4FOLA 2O19A 5HQTA 4RXUA 4LYHA 1RYFA 1FZTA 2HRCA 1H05A 4PINA 1S3FA 2J6CA 2P30A 3KE9A 4Q66C 5LA6B 4L3OA 2JFPA 3CMMA 1G9TA 5IZCC 2WMNB 1FMFA 3GPLA 2I6QA 4YCSA 5INTA 4O4JA 1YA8A 4RELA 1II8A 1PTKA 2MSEB 3L1KA 2IBSA 2PNFA 5FTMA 2NP7A 3BZUA 5KSOA 2OFFA 2EBHX 3GRRA 4K1LA 3T0GA 4CLHA 2C7BA 5GOTA 4CM5A 1Z0SA 2RGNA 2W4MA 3AP3A 4IIGA 4C43A 1J2EA 3IPXA 1HV8A 1VA5A 1XN1A 2VWPA 4I50B 4WGGA 4B3RB 5CG1A 2TMKA 3WE7A 3M49A 1I1HA 4LF5B 4H6XA 3QVOA 1IC6A 3OJOA 3L7YA 1MAWA 3GB9A 4I7EA 4IEFB 1OW3B 2B4YA 4L2IB 5ENDA 5C2JB 1GZ6A 2ZVDA 4NENB 1RYDA 3PI6A 3UW1A 5KIAA 2RAPA 5HWSA 4ZCRA 3I58A 5DI3A 3STHA 2FWRA 3DV9A 3JZIA 4RTNA 4OREX 3RTEA 3URMA 4EI9A 3VU3A 1FIUA 4UTXA 2VRCD 4U7JA 4RQTA 1KQNA 3NHFA 3GGSA 4K03A 2G6TA 3SE0A 1RFGE 3TMKA 3WL7A 3Q7PA 3SIXA 4ZK6A 3ZZNA 1FFXA 2CN1A 2V96A 1G4HA 4B82A 2QD4A 3UN1A 2X8JA 1G20A 1I3LA 1USGA 1GPUA 2JGIA 4HUQA 2P2LA 2P5SA 1VE1A 4A4DA 4CEHA 1JT2A 2ATVA 2EQ5A 2HF2A 2IOFK 1U7DA 1XP8A 1Y5IA 3JATB 5FFMA 4D9CA 5DTIA 1OFUX 3E7XA 4XDHA 1A2BA 2YMMA 1DWOA 5JNRA 4ZYZA 3GEPA 4FN4A 4OV6B 2A92A 2ZUUA 3CQ9A 3D1VA 3R40A 4ZYWA 3U5TA 1L7MA 2WTEA 5AVYA 3EVFA 3ND6A 1R4NA 5FEUA 3NXKA 5C7IO 4XRRA 3VSAA 5ESWA 2WF6A 4HYQA 3QXGA 2VXCA 1R16A 1YIDA 5DGHA 6ABPA 3FDFA 4ZT5A 3VDXA 3O8LA 2NU6B 1UFOA 1TPYA 3PJRA 2UVDA 5FOWA 7REQB 1Z15A 2Q99A 4BNDA 5C3MA 1VMIA 2I3DA 4A0FA 4R83A 2Q9CA 1YT5A 4RF4A 3FNIA 3EZGA 4GFDA 4BBAA 3Q3EA 2VYCA 4NX2A 2JLWA 3N8HA 2OBMA 4RSRA 2QD5A 3JQGB 4ZT6A 1ISIA 2WAOA 3C5VA 1JMVA 4ATNA 3ANNA 1USIA 4R41A 3DHYA 1HX7A 4ZYLA 1QIFA 2C2WA 3BGSA 5E1BA 4UQLA 4JP8A 3VPCA 2NM0A 3SR3A 5BQXA 1IG0A 1XUOA 4EEKA 4YRBA 2WUEA 5AW1A 1W2GA 3RIXA 1PZGA 4HQ6A 1VL2A 3O8BA 2OCYC 3QKSA 5I9MA 4DLZA 3GC6A 4CMJA 4P4TA 4BGDA 2JJ8A 2G9QA 4R7ZA 4RGBA 1PP4A 5AK4A 3FWNA 2QW1A 2UV8A 3EBPA 4HDNB 2WF9A 4D6XA 1FZQA 5LDDC 4R16A 3R7FA 3HA2A 4EELA 1Z26A 1H4SA 1CUEA 1U31A 2QAGA 1DG1G 5FKJA 2ZCJA 1I3MA 4GP7A 4TUYB 1SZCA 3T1VA 1SD5A 4KC0A 2WUGA 3KR0A 4IXNA 3SJAA 3UWSA 4A0RA 4F3KA 3I34X 3NEJA 1H2RS 2LV8A 2V7TA 3KKKA 4PQGA 4TS9A 2F7SA 4ANFA 4QXAA 2V0GA 1RWMA 2ALJA 5JBIA 1MRSA 1ODCA 4NU0A 4TL7A 2C9YA 5F3RA 5LP6F 1XYVA 4FUQA 4TMVA 4D9IA 2NO5A 4KVAA 2DJIA 3H84A 2E87A 3DE1X 3FSGD 3KXIA 5F9MA 1T9ZA 3DE0X 2IV2X 4PICA 3WP0A 5FYDA 2AH5A 4QBIA 1Z68A 2RKOA 1RFLA 1GPKA 4HB2A 3LC2O 4ZYTA 5JWHA 3R7AA 3H6HA 3H8SA 2VN8A 4M8NE 3V8PA 4OHZA 4EMTA 1YJAA 4O25A 2PV7A 2VXBA 4B3SB 3AVPA 1X7GA 4P5PA 3WV5A 4IFBA 2CNWD 3DJYA 1EEXB 1FRQA 3LQFA 5JQWA 3IMFA 1RHJA 3BHIA 4KVZA 3WYAA 4D4IA 1QH9A 2PPLA 3PCXA 5DWVA 1M7BA 2FR8C 2IWHA 5IS2A 3IB3A 3FFBA 3Q2IA 5L40A 1K1EA 5AK6A 2PL1A 3WGIA 2VP5A 4CM9D 1DRVA 1SD2A 4R2MA 2H7VA 3HWX1 2CLEB 3Q3JB 5LZ7A 4P3PA 3TOVA 3QSGA 1ZK3A 2IU3A 3IQIX 3OLCX 3QUTA 4Q6BA 1Y8AA 2GKGA 1UQRA 2NUAB 1LNSA 4ENUA 2GH1A 2QAGC 4MWEA 1O95C 1CY2A 2WD9A 3HHEA 2OPBA 4X8HA 3S1LA 4TQ9A 2WZQA 4MVYA 1U8CB 2RH4A 3REGA 4QL3A 2FPKA 4S3MA 1M5UA 1TJ3A 3AGPA 4J7XA 3E7DA 4MQ4A 5FUVA 1MB3A 2B36A 4MRMA 4CMBA 2G82A 1CIPA 3A11A 1Y5MA 3A28A 4HDAA 4P22A 2ADFA 1MGOA 3FHTA 3GEIA 2G17A 4LXUA 4BYMA 3OOWA 4P32A 3OX1A 3D7NA 3Q7EA 1R5BA 1JEAA 1U0EA 4R7TA 3KZXA 2HOQA 3I6ZA 5TT0A 4LHYA 5K3CA 4DLUA 4FT2A 3MWKA 3R7WA 3AHJA 3S5JA 5BPFA 3ZXIA 1QJCA 4EPRA 1R3DA 3ELYA 3LK6A 3PXDA 1FXWA 2ZBRA 1TFUA 3L6CA 3CYFA 1SUDA 3QVWA 4FYWA 4HXYA 3REQB 4OPMA 4GRDA 1O6BA 1H69A 2M2IA 3TI9A 1BIFA 3NTVA 3ROPA 2GOYA 3DL4A 4ZOLA 1KI2A 1GUYA 4DUPA 2HBRA 1N5DA 3IIEA 3FGPA 4FLMA 4UHEA 3ZD9A 1EDDA 4TTPA 3DZ8A 2EATA 5HKKD 2ODTX 4K1XA 5FAXA 1JG6A 4N54A 1LJ8A 4JC8A 1HRKA 3TN7A 3IP9A 3D7RA 5EKTA 4ZCQA 4YDSA 2YN0A 3IBGA 1THTA 1TO2E 1NTRA 3EBLA 4B8ZA 1U8YA 5BXYA 4MCJA 4Y30A 1IEXA 1B43A 4NU8X 1RCTE 4MUYA 3CEHA 5K7SA 4MTCA 2R8BA 3N70A 3V3KA 2D06A 3PPVA 5FTJA 1KMHB 1IUPA 4LCBA 2O2EA 4JJ4A 3O2NA 2WWGA 2H2AA 5ALZA 5C81A 1KO5A 4MVXA 3WRWA 1UJ2A 2I67A 3PIIA 3F46A 4OEHA 2QWXA 1LBQA 3A8TA 2AFHE 1TTPB 3H86A 3DTVB 1TOAA 1CIJA 3WGKA 1CT9A 3I6YA 1QYIA 2CYBA 4PPQA 2ZR8A 3BFJA 1JIJA 1XMSA 2UXCB 1LVGA 3R6LA 2X1HA 1VIYA 4FXOA 4I4TA 4G01B 4QHTA 3SQOA 4XYMA 4U7TB 4UE3S 2DHDA 3O1HB 4XX1A 3PUWA 1LLDA 1ZNQO 2RHWA 3EVBA 3C39A 5DI9A 4E3WA 4RWZA 2Q29A 4YJ2F 1KVTA 3IKVA 4Y1RA 5I7RA 2F1RA 4PC7A 5ABPA 2Q9BA 3PZRA 3HGMA 4Q4JA 5TQJA 1NJ1A 4DG5A 4RMGA 3DHEA 1SBIA 1I4EB 3NHZA 3PL1A 1ZD1A 1K89A 2GD0A 3LWZA 5KWIA 1NW3A 3PIRA 4G5SA 2VTEA 3IKLA 3G85A 1KC3A 3KB8A 4GM1A 5A62A 1NE2A 3PJDA 4QTTB 4I8IA 4KVFA 3THXA 1FVXA 3TL2A 1O0CA 3GUZA 3WRYA 2E9SA 4D3ZA 4MITA 1Q0QA 1MPXA 1SQ6A 1BD4A 4IH9A 4OHMA 4Z86A 3OFVA 2AN4A 4LIPD 4NZZA 3WLPA 3KWJA 4PYRA 4X8MA 4ND6A 4AMBA 2DY0A 2YHSA 3WQBA 5E4TA 2XB4A 3NIFB 3BDVA 3H83A 1JDNA 1B2LA 1PDWA 2XOKA 4MYHA 4OOFA 4Q1BA 4Q3KA 3OOJA 4AO6A 1O8BA 3O4FA 3ZNPA 3GAMA 1HLDA 3QOXA 4MO2A 2JDID 4WSOA 3ZBPA 4JLWA 4PW0A 4W1PA 4BNMA 3GGOA 5LYYA 4EY4A 3HDQA 3WGQA 1EE1A 2ID7A 4KB5A 4RXMA 2ERYA 5IHXA 2IX9A 2Q0HA 3U4QA 4QGHA 2YW9A 1ABEA 4KXWA 4PO9A 3WNDA 5JJKA 4QUJA 2QKYA 2OZEA 5DYYA 3WGGA 2QNIA 4FEEA 4Y2HA 5A3JA 5A3VA 5U9CA 1DLJA 4UBLA 3T7DA 1Q15A 4MUNA 3I2FA 1MB4A 2XF2A 1QPGA 2X8LA 4DPKA 1IN6A 4JI4B 3VZRA 2PL9A 3TWOA 3KJZA 1W4ZA 2GN4A 1JFFB 1GZ3A 2IJGX 2GD6A 2FUKA 3LHDA 2H3EA 2WM9B 3NOXA 4Q0MA 4QU5A 3VTFA 2GLUA 4UAVA 5JDIA 2OXCA 2VJLA 3A06A 3QU7A 1N4AA 2FU5C 4QT0A 1DCTA 2A5LA 3GA7A 1LLQA 4XFJA 4U2FA 2IZ7A 2EJWA 2Q8QA 3AKEA 4IHJB 1R0SA 5AXBA 3RR2A 1A4XA 1DIOB 1WDMA 3FYSA 4LX0A 2TMGA 2XYHA 4O4HB 1Z0ZA 4PZ9A 5CGZA 1SIWA 2SICE 4BO1A 1KTIA 3KSBC 4KE7A 5D3MA 1UIRA 4PE5B 3VX4A 4CG2A 1FVHA 1WABA 4NH0A 5IDVA 5LJLA 2FOXA 5DN9A 5B30A 3WRYC 2R8ZA 1IEWA 1R2QA 3IMKA 3TOZA 4G09A 1OVGA 4PPFA 2QJFA 5CA1F 4QHSA 1W52X 3T6KA 3X2SA 4XYEA 4JI2B 2C82A 1VB5A 2GN8A 3OF5A 4NV3A 2IPAB 4H08A 5CM2Z 1XKQA 4GBGA 1NF2A 5FLKA 2WUVA 1QWOA 4EECA 3VAAA 4DCPA 1T9KA 2GWRA 2VRCA 2AOTA 5H8WA 1EK6A 4CT5A 3LHSA 1G18A 2XI4A 2C9BA 3CXRA 2XOEA 3R5KA 3D0KA 3EQ9A 4KR9A 1VJ5A 3N0WA 1N2CB 3OZ7A 5CB6A 2ZJOA 1XD9A 3ZY5A 3CH7A 2O3TA 1B8PA 2O50A 3HADA 1U8EA 1H2FA 3QNUA 3QFFA 1DWQA 1UQTA 1JKXA 5CA0F 4NYJR 2BTQB 1DOZA 4OIMA 1DQRA 2QN9A 3AR4A 4J29A 4PIPA 3SJCA 4JBWA 4RLFA 5E0KB 2NLOA 2FUEA 4J0KA 3SKVA 3WRVA 4WJKB 1EE2A 2QTCA 3KLOA 4M55A 2LGJA 2OBBA 3QOWA 4HOYA 3LQQA 4HAYA 4L73A 3V8VA 1EFAA 5KNBA 4AF6A 2R00C 2VT6A 3GO4A 5EMLA 1W9HA 3GGPA 1JAIA 4JKIA 2OXFA 3TTVA 4AZ3A 1OXXK 1WB9A 4EARA 4IGEA 4L6CA 3ANLA 2GN2A 1RWBA 4OB7A 3TW8A 3WDLA 3KQQA 1XHLA 1BO6A 1PSWA 1EDBA 2R6FA 4FCVA 2C7GA 4CCSA 4ZO8A 4B3JA 1KRXA 4XCXA 2XXAB 1LTHR 1U3GA 2II6A 4GO1A 4TWIA 3KV3O 2HIAA 2IPXA 1V6CA 2JK0A 3G6WA 4GXRA 5DM1A 3EJ6A 2V6IA 5H59A 3GBVA 1T25A 3WAKA 1R18A 2QX7A 3DD5A 1KL7A 2EZUA 3DEIA 1JKIA 1YNSA 5D1HA 5C53B 3WK6A 2QL7A 1XA3A 3LT1A 1D6MA 4NPAA 2OESA 1QIDA 2XUFA 2QSZA 3BD7A 3IIIA 5H0IA 2BZ0A 1M34E 4HEA1 4JGGA 2SECE 4W8OA 2Q45A 3PGLA 2CWWA 4GI1A 5LD2B 1EGMB 1VSVA 4HFJA 4YAOA 3HN6A 1VG8A 3JYNA 2JVKA 4Y9UA 5JVDA 4RHYA 2OCKA 4BVHA 1DC8A 1PNTA 1QORA 3AIIA 1VG1A 3P2OA 4IDCA 4JB8A 1UK7A 1QK4A 3LZ6A 1BYUA 1YFZA 1U1GA 3SJ7A 3AEUB 1HDZA 4XJXA 4IGKA 1TJPB 3ZWNA 2HNBA 4IOJA 4EI2A 1MR3F 3MOSA 4C06A 3L79A 1NRXA 1N3IA 3ASVA 4G4SP 4NYJQ 2GHQA 1GQFA 2CLIB 2WFAA 1THGA 1KBOA 4G37A 4IQ8A 4RCYA 3A04A 4UCXA 1F60A 1YL5A 1YB4A 3QH4A 2GNOA 4MQUA 4W7HA 1IM5A 4S1TA 4Y1GA 1E79A 4U5XA 3FSGA 3SSNA 2REXB 3N28A 3FCYA 1VZ3A 2P2YA 3E53A 1N2OA 3ETNA 3QEOA 4EDHA 3K5WA 3C3BA 3FFXA 3RUFA 1XA0A 3PNQA 5L7YA 4FYKA 3GFGA 1M6NA 4OH7A 3W8NA 3ZGYA 4DPMA 4UVDA 1JMYA 2AOUB 4XGQA 4R1TA 521PA 4QYSA 1PG2A 4NSNA 2G4CA 2CXQA 1ZGGA 2WB4A 3OHSX 4IF4A 1T4CA 3D1LA 4UATA 4UHJA 3R9XA 4G86A 1B41A 3I73A 5EP4A 2VUUA 4B34A 1EKXA 5CXUA 3EFBA 2P40A 4UUOA 2A5GA 4RTOA 3NHLA 3L1JA 2F3TA 1BE6A 1LPSA 3LY5A 4TTQA 3FVWA 3S81A 4TVKA 3QE9Y 1VLZA 1YS4A 1IBLB 4KXMA 3U4GA 4ND8B 3WP1B 4EPXA 2GCOA 1IVSA 1KEVA 3W5CA 1RXYA 4TXMA 1JR3D 1MHPA 4HNTA 4PLHA 4DC9A 2HSGA 3I9V1 4H7IA 4F3NA 1HOTA 2N1BA 2IHBA 4I99A 3FSRA 2Y3IA 1B00A 5JD6A 4ZU1X 1FBNA 2YKGA 1X8LA 1QBGA 3E9RA 3WNZA 4GQIA 5FTWA 5KQSA 2C00A 1N9KA 2JGAA 1PU2A 2VL7A 4BU0A 4DQUA 1G21A 4POAA 1QCZA 1H4QA 2RC6A 1XDDA 5HBRA 3T3MB 4ENQA 3T61A 3HL4A 2VOEA 4K9PA 3NIWA 4LDNA 4F7WA 5CIWA 3RABA 1I5OA 5ITVA 1OTYA 2VAVA 4RV5A 2NUPA 2H07A 2EGGA 3WLHA 2W8BB 4RESA 1DLIA 1HWYA 2P6OA 1WB4A 2ZU0C 4F56A 2AFIE 4EG7A 1NVKA 3E22A 5HJ5A 4BAUA 4OYRA 3IBTA 5KTMA 4PZYA 5ALNA 4DA4A 1ISRA 2ZSUA 4J1QA 3SIRA 4YQZA 1UT8A 1K75A 2ILTA 3RUIA 1YU6A 2ZCVA 1T2FA 3DUFA 4TXLA 3FWYA 3WGUA 4N6OA 2XODA 4P3OA 4UPEA 2XNSA 2DZDA 3TMAA 4P93A 1FNDA 3CCFA 3HC7A 1GAEO 3MWDA 3OPQA 4OP1A 3K8OE 4RXTA 5JAPA 4GEKA 1KDRA 2A88A 4MKZA 4RACA 5DBOA 5HKKA 3SS9X 1Z47A 4FEYA 1Z5WA 2HGSA 1OFIA 2Y1DA 4TMKA 3GPCA 4D8XA 4GYJA 1W75A 5E2IA 4X1YA 1W34A 4KLCA 4LDQA 1OROA 3ZJYA 1E9RA 4P36A 4GPAA 3K70D 4JC4A 1N2HA 2HMSA 2BL4A 5T41A 2QZPA 2B0CA 4OYHA 3SFTA 3SPXA 3T9CA 3SC2A 1I3CA 4HVAA 4X41A 4YIKA 3A1UA 4LJSA 1QU3A 1Z0AA 1ZQ1A 4YCDA 5F7ZA 5A3QA 4GYKA 4PSAA 5BV1A 2RE8A 4O02B 4K9RA 1HZJA 4IIVA 4G3XA 3SHQA 5HZHA 5BN1A 3AUTA 4PS1A 3U9TA 1RWNA 2PIAA 3A6KA 2L69A 5KQRA 1M1XB 2YXDA 3RHSA 4J76A 4KO8A 4ZV4A 3CO0S 4EKIA 4MWGA 2IQ5A 4A2PA 2J3LA 2P4UA 3DYVA 4HS4A 3WNVA 2FNAA 4CKCB 3QBJA 1R7RA 3RF6A 4LF4B 3S2ZA 4D02A 5BOSB 5JD3A 2HNAA 2O7SA 4HWRA 4TKUB 3EIOA 3RJTA 4DXDA 1WQ4A 1WXWA 3AERA 3JVEA 1YH3A 3ICEA 1M1YA 4GG1A 1RQXA 4KLAA 1D0SA 4L6AA 4LRUA 4UM9D 4RTPA 3C6ZA 1YHNA 1L4EA 4ARVA 3F47A 4WZAA 2FPIB 1J9ZA 1FFSA 1JAHA 3BIXA 7MHTA 1JG2A 1G5HA 5DM60 2P2NA 3UKOA 5IN5A 2RAFA 3KG2A 3LL7A 4W9RA 3UHAA 4F91B 1J0CA 1QFJA 1JDTA 3PRYA 4L5YA 2XD4A 4YP6A 1SVKA 5HJ2A 1FYVA 3A25A 4K05A 4YJ3B 1Q95A 2B8WA 3FFTA 4YMGA 3F7TA 5E4FA 2VDLB 4H18A 1I7NA 2HSJA 4IIDA 3R3YA 5CT5A 2GM9A 1HNWB 4D4HA 5DF1A 2J0QA 2JCYA 2UZ3A 4LTMA 4IICA 3KXLA 1AY0A 3BH7A 4FFBB 4QGSA 1CUJA 3T4PA 3UEOA 3H1PA 3VKUA 2GVZC 1NI3A 2BR3A 2QLMA 1IVNA 1H8HD 4QQRA 4RVFA 5COQA 5ITZB 4N8SA 2QTMA 4CZ2A 1TLTA 5BMVF 3AM1A 1N5KA 1OF1A 1UBCA 1BHJA 1T6ZA 1UAYA 1V71A 2HQ1A 3D9QX 4RVOA 3VR6D 4DIEA 4ESEA 3DC2A 2JFQA 3UJ6A 5A3RA 4I5EA 5HP4A 3QVLA 3LKDA 2G9VA 3HYSA 5IAJA 3RNLA 1O1YA 1WR8A 1JKJA 3TSAA 3UGTA 4BFCA 3VGJA 4BUZA 1XPUA 1TUBA 1A5BB 1G5TA 1SXHA 4JGIA 1RP7A 1BW9B 2XQGA 3CZPA 4N18A 5AVUA 4C2TA 2O0MA 2FMUA 2ZS8A 3LXMA 2H29A 4RJKA 1L3IA 4YRIA 4DILA 2EP8A 3PEFA 1N0IA 3HJFA 4DLRA 1UKBA 1PR9A 4ZOEA 4RTLA 3HDVA 3HFSA 3L02A 3PLNA 4XJTA 3W3AH 4XA8A 2F1JA 3V7WA 2FZLA 1V4VA 3FUWA 3IKTA 2YJ3A 1LPMA 1BN6A 3GLHA 4HH0A 4MS4A 4HAOA 4JSYA 5I9IA 2VJDA 1NC3A 1RC1A 3PPIA 4OBWA 4JOCA 2IHTA 2E3JA 1KI9A 1PQYA 2WLTA 3HU2A 3LLVA 4GZ5A 2C2KA 5LA6F 2ATIA 3GU3A 2J0VA 3MK31 4GLBA 3ZHRA 3PYLA 5EXDA 2PFSA 1C50A 1VSBA 2IBMA 4WQMA 2PZMA 1Z3CA 5LUAA 1WCV1 4YO8A 5CBPA 1CWUA 5B58T 1L5QA 1ZGBA 2O59A 3WJ1A 1UDCA 1N9GA 1X7YB 2GD1O 2R5NA 2GF0A 4H35A 4C87A 4ETNA 3U4IA 5KNCD 3N6VA 1MAAA 1J97A 4ZO7A 3X44A 2VF7A 3ZDEA 1WVIA 1OZHA 4DLBA 1QBKC 3F6CA 2DE0X 3FLBA 4GWGA 4I50F 4WK6A 3KPYA 3TZHA 1ML4A 1O57A 3R6GA 2O9JA 5EINA 4TROA 3V4SA 4RNDB 1LPAB 4AN4A 4GKAA 4UTVA 3E0QA 5JXWA 3Q2KA 2FSSA 8LDHA 4Z4QA 3OIVA 2B5VA 1P18A 3KOYA 4RSMA 2OYRA 3THYB 2L18A 1TYBE 1RCUA 2JGKA 1XTRA 3IUNA 3OG9A 3OKFA 4BE4A 1A8HA 1FBTA 2ZSHA 4WFKA 3FI0A 2AQ8A 1G66A 1WW8A 1UOPA 3NYWA 4KO2S 1NMSA 5JSYA 3ZDXB 5KQGA 3ADCA 1Y4ZA 4Q7JB 2I80A 4JQZA 4BAZA 2YJ5A 4ZDJA 3N6XA 5ECWA 4P53A 4FCTA 1YULA 2IH4A 4DPLA 5BVGA 2H2GA 1VCOA 2B92A 2ZSAA 4ZOQI 3EPLA 4I8DA 4KFUA 4O2AF 2I99A 4NOJA 4DLXA 5AWFC 4D9JA 3WL4A 1WEKA 2JCVA 1NDUA 4JJKA 4WBSA 2Z2JA 5ER9A 5AQ1A 1VPDA 4WZBA 1XLTC 1ZOSA 1K8RA 1RZVA 4HXEB 5AJXA 1V8DA 3ZTWA 1NM5A 2PKRA 3MUNA 1K0UA 2IOYA 4Q12A 2ZANA 5G3YA 4E14A 2QRKA 4F2GA 4E2FA 1SFRA 1NN0A 4X7RA 2IHNA 1NOKA 4GP9A 4B80A 5C37A 3C85A 4PWYA 4C7JA 2AUNA 2O6HA 1SBNE 4PSCA 4XR9A 1CYDA 2XE4A 3C8MA 4IIHA 1IAVA 2VDNB 5DM2A 3AWDA 2X8WA 1M6VB 5DTRA 5LIRA 1OXSC 4F3YA 5IJWA 1SVOA 2DYKA 1CJVC 2JIBA 5TY0A 5BRAA 4GWKA 4FGLA 2QTNA 5JAHA 5J2UF 1OVMA 4BTVA 4X85A 1I9CA 2AQIA 2YOGA 1JPUA 1SCIA 2OR3A 5JJ5A 1JEEA 4MGKR 3KPVA 2QBYB 3A9SA 3AHEA 5SZKB 3C3PA 2G36A 1RI4A 5KOJA 4FXPA 4MNTA 1CJUC 2X2EA 4U0KA 2QU8A 4OMFG 5TEVA 2DETA 4UZFA 4GPBA 3B48A 1KNQA 2UUPA 2IIPA 5HA5A 3SICE 3C3MA 4J0JA 4UDOA 3GVXA 5IHPA 4PHFA 2H0QA 2R68A 3CKYA 4QO7A 5DHUA 3TX6A 4E88A 3FZQA 1UMDB 1ZVJA 3AJAA 3HR8A 3VU1A 4ALMA 3AUUA 1BWSA 3JQRA 5JNSA 2QGNA 3P9XA 2A0YA 5JD5A 3VKHA 3HSYA 1YS9A 3T35A 1G4AE 3L41A 2IYPA 1J0BA 3SR0A 3HNPA 2RHBA 3NRBA 3U48A 1QHSA 2CDCA 2A58A 4ZZIA 1A2KC 2VT3A 2ZRCA 2WVJA 3VYTB 1N34B 1NM5C 3R8FA 2I9KA 1ZMXA 5IBQA 4MRAA 5DDIP 4EUSA 5HM8A 3DBOB 5KTKA 1L5LA 4B2IA 2PCJA 3RS4A 1CLEA 1MQSA 4BB5A 3UTDA 1YQWA 2E4YA 2WICA 5BRNA 5C1BA 3HCBA 3OQVA 1UOQA 4IOKA 4UHDA 4HNAB 3GFOA 3UGJA 3ZHTA 3GZJA 3OETA 2EX4A 3WYCA 2C84A 4PGFA 4GGMX 2Q2OA 4X1IB 2D0OB 1TAQA 5BV7A 5HK9A 2DKNA 4N3GA 2YC2C 3NDPA 5KYWA 2O8DA 1XSEA 3B38A 3OPVA 3ED5A 4OOEA 3UV7A 5JPDA 5KOIA 3VR3D 5KC9A 1MJHA 4NBKA 4N9QA 3W5VA 1GTZA 1YL6A 3L93A 4UNQA 5JNWA 2IYQA 2YV5A 2B5WA 2B94A 3OP4A 5K6AC 2ISCA 2V7PA 2Y0EA 4QVIA 1IRXA 3RIGA 1V1RB 1HNNA 3AH8A 3I6IA 4HLQB 3TTYA 1G5IA 1PX2A 1BEEA 2HQSA 3N0XA 1KDOA 3SAJA 2PH1A 2WWYA 1GPWB 1P9NA 4Q9HA 4EHBA 2Z8XA 3B3AA 5AI9A 2QTAA 3PHIA 4NDAA 2RHCA 4AJJA 4BX2A 1UC8A 2OO3A 4X66B 1PVOA 4F1KA 1XB2A 4JX9A 3BFKA 1R3UA 4PXSA 1SULA 1PYGA 2WB2A 1VZ2A 2I87A 1ND6A 1GNPA 3JSAA 2EBWA 3IB6A 1RS0A 2IP2A 1GHTA 3W0LB 5DEIA 2HGZA 3QQ5A 2H2FA 3EH1A 3UIEA 4DG9A 4KFRA 2GJKA 3CRMA 2LIPA 4EQ6A 1R37A 1ZJYA 4LUCA 1D2MA 4AY5A 1G59A 1P7CA 3PHJA 1XQ6A 4OLJA 2OHIA 4HI0E 4I1VA 4OFZA 4GPEA 1RPJA 2E37A 2ZSFA 2GB4A 4QBTA 1T9GR 1ORWA 4EHDA 3NHYA 2I6XA 2C3YA 2XTAA 2XTMA 3DFFA 2DTXA 3K9QO 4JR1A 4RM2A 3ZKWB 1GGJA 1W88A 4Q02A 3TPCA 3GA5A 4QREA 1V43A 2EW2A 4Q82A 1OWOA 3QEKA 4C7BA 1AGYA 3CUVA 3OQHA 3LT0A 5HBGA 4ZYXA 1ISPA 3R0XA 1X1BA 3MAAC 1M8FA 1C0IA 3PQ7A 3G49A 1WLYA 4EG4A 4A6XA 3F4LA 5K8IA 4X9XA 3BHJA 3FR7A 1CQJA 4P7JA 4HVTA 4OGLA 3GP8A 1R5JA 1ETHA 2WT4A 3ZDZB 1R0KA 3OSZA 4Y2GA 5I7OA 4PX9A 2J4CA 3KKPA 2ZG6A 1NG9A 5CNIA 4ZIRA 1KU6A 3KRTA 2J08A 5B7QA 5BR8B 3AOEA 4IEIA 1ESNA 3LUFA 1C3XA 1ENYA 1G8PA 2W37A 3KNZA 1GO2A 1G3MA 3EDYA 4IIBA 1IY1A 1KBQA 1OXVA 1X70A 2P5TB 5AI8A 1T24A 3VVMA 4KDEA 1RWOA 2VDPB 2EJUA 2FPLA 3KT3A 4H31A 4OI4A 4HC4A 4XYBA 4R1SA 2W9XA 2X4DA 3FHOA 3QYFA 1MQAA 4GLOA 4Z4GA 4UEQA 1MCZA 1MNQA 2KS6A 3MTDA 1KY5A 4MKIA 2ZUTA 3WB1A 5F4ZA 3EPHA 1GQQA 1QYCA 13PKA 4KKVA 4FFOA 5G0WA 4DEXA 1XMJA 1SQ0A 3LSTA 1ZXBA 2WA2A 3M6AA 1CZHA 2QW8A 1AKVA 3LJKA 2CKMA 3LU1A 2HA4A 2HC9A 3HA3A 3WHKA 4M1EA 4AW9A 4EHNA 5I9LA 4PIMA 1NONA 1QHIA 1CZUA 2REQA 2XMSA 3N2LA 4W5HA 5KINB 4WE3A 5BY2A 3BWXA 4AY6A 3L04A 3CLTD 1AQLA 2CMHA 1GNTA 1GGNA 1O89A 1QC5A 2Z5VA 3GJQA 3OCXA 2ZRGA 1KTVA 5ES3A 4R3WA 4ERNA 1ZO8A 1U8TA 4G6ZA 2DR3A 3O8NA 3DQQA 2UZ4A 3DWEX 3H0EA 4H3VA 4IRUB 3ZCQA 3F4KA 1J24A 4YXFA 4JL6A 3MJCA 3PUIA 2EL9A 4OG2A 1WXHA 5D01A 4EL0A 3T1HB 1E1DA 4RJIA 2X4IA 4OA8A 4DUZB 2I7DA 3II6X 3IUBA 5EJAA 4OQDA 3FM9A 4Q37A 4UD2A 5G40A 5GPBA 5IF3A 1ZD9A 3DMGA 2QUHA 5EG5A 5G41A 1ZUHA 4F8YA 5HK8A 1ECPA 1PRYA 3AOEC 3GWGA 3WJ7A 4B48A 1VECA 3TGLA 4NCBA 2B4AA 3P9NA 1IN8A 2V9PA 1LLFA 2XIJA 1K6JA 2QRMA 1QGUA 3KC2A 1W76A 1E3WB 1RJEA 3FMGA 3IDQA 4M37A 3VZQA 5MFZA 3SNHA 2X2FA 4IIJA 2O3SA 3E1GA 1MBZA 1EHYA 1YR6A 2Q5QA 3P4YA 4L5JA 3KJNA 3WGTA 4C03A 4QAJA 1BE8A 4JLPA 2XVAA 4FD3A 1EUDB 4TYYA 2D1RA 9LDTA 4H1HA 3T38A 1EK5A 5LQDA 2A1UB 1SUBA 4EDFA 2XMBA 1K5PA 3JU3A 4L9AA 4MQMA 4OGWA 4Y2VA 2XB8A 3U7QA 1GM5A 1J5XA 2DFKB 3KQNA 1CCWA 4DQVA 3D6FA 2JATA 5KTOA 3FBGA 4UNNA 4MDHA 1SKAA 1H2ZA 4LBYA 4Y2YA 1RU3A 3EQZA 3H05A 1SVUA 4EA8A 5KJ6A 2IDJA 5IX8A 2WY2D 4C0SA 1PL7A 3PQ2A 4CUJA 3O8CA 5D3ZA 5DNUA 1ESMA 1W19A 2J59A 1MX5A 2ZRMA 4ZZ3A 5A4DA 1L5SA 3B89A 5C4IA 5BV0A 2X86A 3G23A 2PSFA 4UBOA 3OWOA 1GKLA 1PR0A 5BVHA 4CQLA 4PAMA 5KNCA 2VAXA 3JQPA 1G2IA 4D92A 3V2GA 4U7PB 3FTDA 4O4JB 1JHQA 1BRTA 1QQBA 4JBLA 2BOVA 5DHRA 3KKEA 2ORVA 1KKLA 3DXZA 1ZITA 4JBNA 3TW0A 3DO8A 3HM9A 2C5HA 2GJAA 2HLPA 5EIAA 4ZT4A 5ALDA 5TB5A 2D7DA 3M70A 4LOLA 1XT6A 2R4QA 4Z0HO 1I24A 1BFKA 4AECA 1ZJJA 2R5WA 3I4LA 1T1SA 4MR9B 3GFBA 5IM4F 1H42A 3NTUA 1H8EA 2OQVA 1QOQB 2BGIA 2CT8A 3CR7A 1VHLA 1XTTA 5AVOA 4CG1A 1XU9A 2RGGA 2Y1EA 3NWPA 1PCXA 5BNWA 4QYIB 5IAOA 4J6FA 2HHHB 5IYZA 4BJHB 2AN3A 2OAEA 3UMFA 5GV8A 2Z2ZA 3MOIA 3SLKA 2I7CA 5JALA 4PZPA 2YIDA 1NPYA 5EAIA 1OXKB 2E1PA 1FUIA 4HZIA 4PZCA 3PCRB 3UWDA 1N0VC 3T1YB 2XE7A 4I2VA 5T6MA 4EGCB 1BWRA 2X8JB 3LDFA 5SY9A 1XRJA 1ZD5A 3K9NA 3FTPA 4PN7A 4YV1A 4CMHA 1SXJE 3B7WA 4QARA 5DOVA 4CEHB 5CDTA 1YVDA 3K9HA 1J8VA 1ABFA 1MFPA 4FKMA 4YWHA 4AMUA 4IAOA 1U65A 2C4HA 3DOHA 4KFCA 1A50B 4A8TA 2PE5A 4IDNA 1KK1A 2JJ1A 1GQOA 1R4NB 3E9QA 1NBAA 4B87A 5TLSA 2FFBA 3GNQA 2V55B 4FYVA 5CU7A 4MVJH 3RC2A 1EUCA 5CEFA 4BZWA 2B0JA 1EGHA 5LQAA 5IJ9A 4BQNA 4HGOA 1U04A 1MJNA 2BZGA 3HBJA 4JL5A 2ARKA 4KN9S 4CJXA 4BC0A 1JJFA 3GDOA 3HYTA 1HDIA 4RIFA 2UU9B 2LD4A 4ZOAA 1X6VA 4Q1DA 1COWD 4UPDA 4RPCA 4XSGA 3EGCA 1Y9AA 3WQRA 1DAGA 4WT7A 2Z43A 3NHSA 4ID9A 3ZGLA 1VM6A 1CNFA 2HJSA 5MF6A 2Q5LA 1IYZA 2M9MA 2C5LA 1TYAE 3KJHA 3EZ9A 3WLIA 4XYLA 1UBKS 1YRYE 2YHIA 1QQ5A 3GZNA 3QKSB 5E3HA 3TG2A 1Q0LA 5JH7A 2H0RA 5K0EA 3KQHA 3WLTA 2NGRA 5CP8A 2PZJA 4RKEA 3ONEA 3G17A 2ZRKA 2QAGB 5AI0A 3SP1A 4X64B 2Z5GA 2VF8A 1F9AA 1ICEA 1IJFA 1FDWA 2EWVA 4WPGA 3EA0A 2XVYA 4LXTA 5B1HA 2XKBA 3ZWCA 4BL5A 1NF3A 1XLUA 3ESYA 4NH4A 1BU8A 1D5CA 1KH2A 2BGNA 2BHSA 2G0TA 4IV0A 3T06B 3VMMA 1JJAA 1U4OA 4Z3DA 2BLLA 4JV5B 2CVPA 4LS3A 3WWYA 1E0DA 3H87A 1UWCA 2BHRA 2ZVQX 4LFBB 2PKQP 3EGIA 4ZT3A 3WBJA 5EIEA 1O4WA 4D9MA 3G89A 3CZRA 4MIYA 1QRTA 3T7AA 3T3OA 1A77A 2X22A 1SVWA 2GRUA 2XTJA 4PTZA 1C2YA 2WIJA 3ADKA 3CX8A 3E9CA 5ENZA 2R65A 4C4PA 1DKRA 2JLSA 2NO0A 3BWVA 3NXSA 4WZZA 5G2OA 4DJJA 4O4IA 5CEJA 1BTOA 4AJHA 5CIQA 2V5VA 3VR3A 1TQ4A 5EE5B 3TD9A 3UANA 5DYGA 2JB9A 4RFSA 4BV9A 5BSRA 4EKNB 3AVYA 3V55A 2Q3LA 3E18A 5GIPE 3R4VA 3ZDRA 4DLTA 1GTRA 4ZPJA 4PHTA 4PC3A 2GI4A 3G82C 4Z53A 5EKDA 3BIFA 3RT7A 2GASA 2VATA 3PIDA 1XPOA 3GEDA 4P83A 2W98A 5IG2A 4Q3EA 1K3FA 1GGKA 2C4WA 1A71A 1A8UA 1YC2A 1SQSA 2OZPA 1UUFA 3AKCA 3H5NA 3NO4A 5CJJA 1XU7A 2V7EA 2RHMA 3AFGA 3EJWA 2AFHA 4BNGA 4TQAA 3CA8A 1RLIA 1Q57A 2WIGA 4QEKA 1KJIA 3UWMA 4NFLA 4D4JA 2O2IA 1NXWA 3DVQX 2NNWB 4YAJA 3OZBA 4UM5A 1W85B 1YR8A 1W6RA 3H5LA 4OAOA 4LRTB 3H5RA 4QRIA 2B8TA 2ZTUA 2FWAA 3KQWA 4TV8B 1NA5A 3AKDA 3PA6A 2P65A 1XQWA 3SVZA 4FOOA 1OZAA 3C3CA 4MR8A 5FB3A 3SXUA 5IPFA 4OFXA 2JFWA 3ZGXA 3MIZA 4W5OA 2QLTA 1LPOA 1PL0A 3ZHBA 1FP1D 3HL0A 2G9RA 2QPOA 1D4ZA 3DE2X 1TZJA 2C7VA 5EP2A 4C1NA 2B1IA 3R7WB 5C1DA 3P52A 4WFJA 1E7MA 2PO7A 1JG7A 5KVSA 3JYLA 2NSYA 1KIFA 4GHWA 2ODEA 3SDSA 3WGOA 4BB6A 1BQ3A 3GT0A 5DSXA 1WW3A 4R8MA 4RENA 5JSKA 5HQJA 4KYIB 5AM3A 5KYKA 1IDN1 2FN3A 2XAAA 3ONVA 5LL6P 1J22A 1QG6A 1YONA 2H0AA 2GYYA 3L05A 4S1VA 3B8HA 4ZOLB 3PFHA 4KI0A 2ECQA 1JIVA 4LGMA 2JHGA 3QVJA 4GMDA 5JSUA 2H8KA 2QEQA 2VYVD 1JMKC 1PWEA 3U37A 1ZD3A 1XZPA 1R9MA 4TLCA 5AM4A 3RUAA 1CB0A 4V1CA 4XSHA 2AG6A 1K4KA 3JXEA 1IBCA 2A33A 3P5SA 3TJRA 3RJ9A 1XNQB 2QQGA 3K4QA 4I46A 2GN6A 3N2YA 1GGEA 2IU4A 1F20A 3AW8A 3TQHA 4BQFA 3FVQA 3ORSA 4LI0A 1IATA 1O6GA 2AA3A 5H5JA 4D1YA 4RPIA 1U3UA 1XVIA 3RFCA 2YH2A 4BNYA 1QAQA 5B2FA 3BB3A 2C2ZA 2OCLA 2ZYGA 4URYR 1Q2UA 1OFUA 3DW3X 3UH0A 4Q01A 5CVTA 2RGYA 2YNMD 5T4HA 5EMMA 3W9UA 4Z0PA 1ZY2A 4QX6A 4ZODA 2QD1A 3MTBA 4AI6A 1E9BA 4PG5A 1XL1A 5JYBA 3K30A 2QJOA 1IZ7A 3WBBA 3GFVA 4BP8A 4GWLA 2RHJA 2H1IA 3E0XA 2DH5A 4KNWA 3GARA 4I4TB 4C9BA 1XZIA 2P4EA 2BW0A 3ACDA 4KAXA 3ZLJA 4Y9DA 2VDOB 2P69A 2IYFA 2JANA 1LQ2A 3M89A 4G4SO 4Y1RB 3VSEA 2BCEA 3D6HA 3DOUA 3ITNA 1YVEI 2NX2A 3A4MA 4FW9A 1EZZA 2Y6VA 2W2KA 3I37X 3JASA 4OXQA 1L4NA 1KMQA 3CR3C 4YJ3F 5FPTA 4TQGA 4BQQA 4AIIA 4I6JA 2REOA 3TNJA 4X93A 1ARZA 3QVVA 5ARBA 2I4NA 1JSZA 2VUIB 4GUAA 4XWYA 1KARA 4MYRA 1YI0A 5K0ZA 5A2GA 2QTZA 3R7SA 1JI0A 3HPQA 5JE8A 3RIYA 2NAFA 5FI3A 3CN7A 3AONB 4YT2A 1YE8A 2R84A 1AZWA 1PJ3A 1N5MA 1JPNA 3EOBI 2D5IA 3F3YA 4MVJF 3NOOA 4RQAA 4YJKA 2B4KA 1TYDE 4PGMA 5IBRA 3IXQA 9LDBA 1HYBA 4MB2A 2DCMA 1F5NA 2D2IA 2HT6A 5L3VA 1MT3A 3T5PA 1Z62A 5FOQA 2O54A 4ODIA 3ZUGA 4B2LA 1GL7A 3OZFA 2Q1YA 3IJEB 2OP0A 4TYNA 1S8NA 1UFRA 1R9JA 3BA1A 2FX5A 4REQA 1OFVA 1Z6AA 1RWQA 4XDZA 3TLJA 5DNEA 4BASA 1L7OA 2FYTA 4P3YA 4CCWA 1Y9DA 4XFKA 4Q3OA 5AUOB 4HXFB 2ZVJA 5JATA 3U4QB 2P3QA 3MG9A 3CV3A 4C01A 3PYMA 1R4ZA 2ISSD 2HKIA 4H9GA 5AKZA 1GYPA 3CLTC 4R6WA 5EUCA 2QV0A 1BCSB 2EU8A 5J4VA 1JEYA 2F2TA 2O5VA 2QRZA 4DWOA 3V34A 1X7WA 2F4VB 2O23A 5E9AA 5J43A 3LY7A 4MUBA 4RD6A 1PR6A 3TNDA 4HFRA 5K0GA 3UMCA 4R81A 3B3QA 3RAFC 3WXBA 4BFSA 3BAFA 1PYOA 2WYOA 3UUFA 1DKUA 3IL2A 5HKLA 4E46A 2CE7A 3KM0A 1GXSA 3PGXA 2O5EA 2P68A 4DT1B 3L4EA 5T64A 2AKEA 5JCOA 1YKGA 4TTVA 1AHPA 2ZIUB 4LV5B 4BQEA 1EXVA 4BWFB 4HG2A 1CIVA 3HG7A 1J5PA 3F67A 2Q3HA 2ZJBA 3Q3CA 4C6TB 5B1EA 2QE6A 2QN8A 3DAFA 1T0HB 4LMBA 5D3MB 1XCBA 4NK4A 1ZNXA 2A1TR 1TJNA 2OZLA 3IBFA 3EMKA 1M34A 3QHAA 4WKOA 3TW4A 3WLJA 2GN9A 3IT3A 3M7IA 4YACA 1NJSA 2OHHA 1JTEA 1Z5NA 3K8YA 4IDPA 2X2PA 5AXAA 5L3RA 4Z4CA 1KYTA 4F4IA 5J23A 3LHFA 3O1LA 3RV4A 5I7FA 2Y99A 1XN4A 3WG9A 2QI9C 2YXEA 3EUWA 4K6CA 5DYWA 2J8ZA 1YMQA 2D2FA 3L8FA 4NG5A 5KNLA 2AOTB 3UHPA 3ORYA 1UC5B 4L8VA 821PA 3NHUA 3IUYA 4JA2A 1DDOA 1I32A 1ONPA 2VNAA 3KAKA 4QQKA 2ZB4A 3K6SA 2AMVA 2VNIA 4GEGA 3QXJA 1NRWA 1QRDA 4I1SA 4E7OA 3UMJA 3EIUA 4WCFA 2TSYB 2BFCA 4X7BA 3W2EA 1NRIA 1HQKA 3LQRA 2Q4RA 1UEJA 3KT0A 2IPLA 3RFVA 2C8KA 1LDBA 4D46A 2R47A 4EJSA 5A6VA 4RPHA 5U1PA 3C3EA 3WGHA 1KPIA 5EE1A 2NU7A 1NW5A 1Y3BE 1YAJA 1YA6A 4ECEA 4J91A 4MRRA 2IKQA 1TA9A 3G1TA 4RS3A 4C20A 1NP6A 1QRUA 4JCCA 2JJYA 4YAWA 3FZGA 4AWXA 4DBZA 5CFOA 5B1IA 1YE5A 5J63A 4AZ3B 3C4QA 4OH1A 1FDRA 4RS4A 2XD9A 3BSWA 4YN3A 4YUAA 1EFPA 4DC0A 4GOKA 5EZYF 4RANA 2B99A 3TW8B 2OOKA 1FYDA 3BXFA 4ER7A 1F8GA 4RWEA 3QUQA 1NX9A 3K71B 1QP4A 2I54A 3OJXA 4FX2A 3OLYA 4J3JA 3ACBA 1MHTA 1KYQA 2JIQA 1XD8A 3JQBC 1AKYA 1E1MA 2X3YA 4RLSA 4LC9A 4QDKA 1COWA 4L07A 4UJ5A 2EOAA 2Y0PA 1TIPA 3L4BA 1R8SA 2ECOA 2NVBA 3OQ6A 4GR5A 2B4TO 1NG1A 2VHEA 1ZUWA 2WABA 4ZU3A 5AUPB 1XNJA 1WHSB 4XD2A 2JIZA 1P6QA 4F84A 5KVAA 1OYYA 3LC0A 5D5PA 3OIWA 4KGVA 5GAJA 3QYAA 1I3NA 2JKVA 1KFEB 3CNLA 3FXAA 5F5XA 4B4KA 3E4DA 1WX1A 2F64A 2I2FA 2CLDX 2AYZA 4YAKA 2NT3A 2X9LA 1EH5A 5JCXA 5LVAA 1QP0A 2W93A 1FNMA 2PDAA 3EASA 3ZY6A 4J03A 1YE3A 1Y6RA 1EU1A 4U3JB 2FFAA 2HXGA 1W47A 3IHWA 1WU7A 4I6GA 4RW0A 3ZU4A 4EHHA 4EMBA 4YHHB 3OFKA 4KAFA 1USWA 4EJSC 3MRSA 2BJVA 2DWQA 1SCQA 2VDUE 4YRGA 1YAHA 1XMPA 1J2TA 3C8ZA 3TEJA 4CIAA 2GUGA 1HXHA 1E96A 1CDEA 3R3ZA 3CWZA 5A5DA 2OGSA 1IVYA 1VI5A 3U6KA 5TPZA 5BW6B 4DDHA 2YWEA 1CRWG 4X6UA 3VHXA 1XZQA 2C54A 1PNQA 1NYQA 2YV3A 2HCTA 4YRNA 3FMFA 3WKAA 3C87A 2I78A 4J0IA 1IG3A 4MUKA 3D5TA 1VE9A 4U2BA 3TTTA 4OSPA 3OU6A 4BO0A 3AVWA 3QITA 2XLBA 1F48A 1PD0A 3OPXA 4KN6A 4RJLA 4G25A 1ODFA 2CJXA 1SQGA 5A0VA 1C9KA 3ASUA 4E5DA 1UK9A 4TRNA 1GDDA 2AN9A 4KWTA 4DA0A 4L5AA 5IEJA 2A6PA 3I42A 3GYBA 4YMVA 4MGHA 3VBCA 3TG8A 4KGZA 1I7DA 1OI4A 1N5OX 1GNQA 3VHLB 2OQ2A 5AW8A 3NVMB 2WF7A 4Q24A 1JAXA 5ICCA 4YYEA 4DMRA 2ACEA 4X1KB 3CUUA 1NOIA 2FEXA 1KWKA 5KX5B 2XCQA 3NDJA 4F45A 3EXG1 4GU5A 4B40A 5LQUA 2ZUFA 3I04M 3T15A 3Q7TA 4IDOA 3RRXA 3P9YA 3U3KA 3NTRA 4UDYX 1EAMA 3I2JA 1TF2A 2GCOB 5FA5A 5IZ4A 4H59A 4E22A 4CQMD 4F9TA 4J43A 3QWBA 2GESA 4KXUA 1QR2A 2VBGA 1KEPA 3QPCA 1NN1A 5HIMA 1W94A 4MMZB 4FGWA 1TCUA 4FONA 1WVGA 2ZBVA 1ZIYA 5CNJA 3LOUA 4HWPA 3U19A 2VP9A 1W73A 1GG9A 2P5UA 1ZYUA 4E5UA 3ZBTA 1SBQA 2YWRA 1PS9A 5ICEA 3N58A 1XVAA 3G0GA 4GXTA 2I8CA 3BAZA 3NFYA 1P5HA 4HPJB 3ZU2A 1NSFA 1CZKA 1GIAA 1RKXA 4BKUA 4DJ5X 4P4NA 2AHRA 3UT6A 1E3QA 3QVGB 1TT5A 1H94A 3KK0A 4QOHA 3VKWA 1Q14A 5JNLA 1T2UA 3LXUX 3E22B 4L15A 1UBHS 4WCVA 3X3HA 4YB8A 5KU7A 5LJIA 3GUHA 4PLCA 3SWWA 2ZSBA 3A3KA 3O0TA 3JV7A 3NBQA 5A9SA 5SY4A 4C7XA 2WIKA 3DUFB 4FGZA 2CLMB 4RTSA 1UPBA 3DE4X 3BMCA 3MWDB 3L1UA 2O8CA 4BMVA 1VOTA 1CY0A 1PT9A 1SEVA 2OILA 1PJLA 3FHLA 3IQHX 4LZZA 4Q18A 3DGEC 1K98A 5EMNA 4HEQA 2R44A 3OEED 3V8BA 4BMCA 4D44A 4AN0A 1XMIA 4O2RA 1SKUA 3FYDA 5JC8A 1VLMA 2Q07A 3SLGA 3NANA 1ZKDA 2QG6A 1AQYA 1U9IA 4LHZA 2XKJE 4M1SA 4QUGA 1SUAA 4O29A 3QK7A 2IYTA 2BMEA 3I23A 3QXSA 3GH3A 5AI4A 5EXEA 4IY1A 2A8YA 3FIJA 5C8YA 4DR6B 1XNRB 4TV9A 4DAEA 1I2ZA 3MWGA 2K2WA 1OFGA 2BFEA 3FETA 4ND3A 3CW2A 2N1MA 3H0KA 4JELA 2G4VA 2OKCA 3QY9A 1Z7WA 2CK3D 5EZQA 2RH9B 5G4KA 3T1QA 4UXHA 4DA6A 2YUTA 3M4ZA 5IT5A 1SQ5A 2A78A 4X3OA 4II3A 1YRQA 2WTAA 1KFJB 3K0KA 3OESA 4WXRA 1HT0A 1LSUA 4IHKA 1A76A 4NMHA 1OZFA 4JY7A 5ALHA 2MYPA 3E7WA 3HZZA 5EUQB 3AERB 1BA3A 2FWMX 1D2GA 1UDRA 1WRBA 3HJRA 5JSZB 1A97A 1QIIA 3KT8A 4AT1A 1LEHA 1E9FA 3PFIA 1YL7A 1DV2A 1WNFA 1CQPA 1V3VA 1LRJA 5FWNA 4IM7A 4J0HA 2G9UA 4WZAB 3L1VA 2A67A 4EYGA 3WWOA 3RC1A 1USKA 4FMDB 1E9SA 2C96A 1T91A 5AJHA 4P0QB 2CY0A 2W6IA 3I12A 1X42A 4B3MB 5EMHA 4B5LA 2AE1A 2H65A 5DX8A 2BM8A 3ZV3A 2Q6IA 4MV5A 1Z4OA 1LLUA 2P91A 3LP8A 3MJVA 3AF0A 4K0RA 1BU5A 4O2BA 4U0JA 2WQ6A 4JB0A 1B0UA 2GBFA 3FGNA 3NM4A 2J3IA 3VJLA 4N5DA 1ONSA 5AIBA 4IS2A 2MSNA 4IZ6A 5HKOA 2V9CA 1HZZA 1J2YA 1K0FA 1L5FA 3NT5A 2QAIA 1CY6A 1E2UA 1N2GA 1WG8A 3AT1A 3Q1KA 4J7UA 2J6BA 4GICA 4PCAA 3V4VB 2IK8A 4MUAA 3L7BA 1KH1A 1T2DA 1CUSA 3T99A 3TOXA 4JLKA 4H3HB 5K3EA 1AZLA 2IXAA 2YNMC 3C24A 5ALJA 5AYVA 3AG6A 3CONA 1ZS9A 4R2LA 1RRKA 5KTTA 3JWPA 1E99A 2D0PB 3IVAA 2VAMA 2R85A 4XH9B 3KOXA 5L7TA 4KRFA 1MV5A 4JU9A 3PD0A 2HA3A 4KIFA 4DLYA 1JKJB 1NVTA 5JCJD 2CBGA 5JISA 3UV3A 1DO8A 5F5LA 1AN0A 1E1RD 1CJKC 2IF2A 5BQOA 4D9FA 3L0ZA 4N12A 5F21A 1G17A 5GZ3A 2IS4A 1ONOA 3L0DA 3FUUA 1TJ4A 2HLDD 1C80A 4EY8A 2B5OA 1E7QA 4EJMA 4XD7A 1XZKA 3BRQA 1NQTA 5TF0A 3RKRA 3VZCA 5F23A 5DBFA 5E1DA 1VSUA 3D4LA 4V0ME 3NV7A 3RARA 5JCPA 3FHCB 2FI1A 4IKOA 1TQDA 1NE7A 2RKWA 3KU1A 5CH3A 2GPSA 5DNYB 1VRVA 4X61A 1JH9A 3HUEA 1U28C 2OFXA 3AI1A 3JY6A 2WE7A 3HYCA 4I36A 1JDZA 1JHVA 3H7IA 3EK2A 4B7XA 3N07A 4HQLA 2V7UA 2ZUWA 3HHPA 1NNSA 1TGVA 2FF7A 4TRJA 3RUCA 4GMHA 1FFWA 2J9ZB 4O4JF 3LO8A 3JQ9A 4LF9B 2J3JA 2D6FA 3IOMA 3JQDA 2O0JA 5A6SA 3WWEA 3KUKA 4CMIB 2GEVA 1UJCA 3JSXA 3OE5A 5IBCA 2ZS7A 1Z5PA 1Y8ZA 4CGYA 2NSLA 3B70A 3MXTA 1HEUA 3P0EA 6AT1A 2WRZA 2QQ0A 1K97A 4NFSA 2H1SA 2MT9A 4G85A 4N1AA 2JAWA 3H2SA 4KWIA 3ULKA 1RC8A 1P2SA 1YS7A 2C83A 2D1QA 4G8BA 3TCKA 4F4UA 1EWRA 3ZK7A 1YQXA 2XVXA 4FSHA 4R9NA 3B7GA 5DM70 1XJ5A 4MW6A 3QENA 3I8SA 5DT9A 4LI3X 2GFIA 1PGNA 2ZIZA 4R8RA 3KAQA 2ZR0A 3G2LA 1A9PA 1V8OA 1MOPA 2CW5A 3BERA 1DMRA 1TD1A 3L9XA 2P79A 3KKNA 1G8KA 1RYNA 1UBNA 2EBUA 4R0VA 1OH8A 1LD3A 2W58A 3NG1A 3Q9LA 4XZ3A 1JB1A 2N3ZA 5GADl 3HSKA 4G0ZA 4EX7A 4Q4LA 1ZN2A 3DOEA 3C2QA 2BKEA 1PSZA 1U7ZA 1GN8A 1MO6A 3M5PA 4GF5A 5DHQA 4ZGBA 1ZX1A 5B7NA 5AHRA 1OLSA 2NZ2A 1SC1A 2FPOA 3VJRA 4HB0A 4UTNA 2W43A 4WZBB 2B82A 3N6RA 1RDFA 1O54A 2C3MA 4HR7A 3HY4A 4IXWA 4JBIA 5DRYA 1KZ9A 2XRMA 4N41A 3MMZA 2X5XA 4M9CA 1ADBA 1Y1KE 2Y9MB 4L4SA 2XKKA 4K0KB 1BEUB 1N2SA 5E3JA 3PLAE 4UVEA 3PKJA 4OHVA 4PF1A 2BFOA 3TRFA 3PEEA 1N2CE 3WNBA 4F11A 1KI1A 1E4OA 2VPTA 2BJWA 3JX9A 1P0PA 1KAQA 5JFOA 3LT5A 1ZL0A 4P3XA 4UFPA 1Q1NA 1R0YA 2VWGA 4H7DA 2AR9A 2J7PD 1EM6A 3PI7A 2COEA 5DN6D 2ZSEA 4K8RB 3LZDA 1MX3A 2OM2A 1KVSA 4ZI3A 3MBOA 1O9HA 3SHTA 1E3DA 2VBCA 2KYRA 3AI7A 1R74A 2G07A 4GECA 4E94A 2GBCA 3PG5A 5FLXA 2QTHA 2Y2VA 2G04A 4GP6A 1J8QA 2FEWB 5KOJB 4OHWA 3MBKA 2XCRB 3NORA 1E6MA 1G8AA 4U7DA 1V95A 3A36A 3NHKA 4M0CA 3PSAA 3GLIA 1E6CA 4K81B 1TB4A 4RUKA 3L0BA 3D3EA 3EGOA 3QPDA 4B4WA 2XUDA 1EVEA 3RUDA 1YFJA 1WXQA 4RL6A 5AUNB 1QH1A 2JAQA 1SOWA 4QQNA 5CITA 1JQBA 4G1VA 1E60A 3H65A 4CIYA