5BWNA

Crystal structure of sirt3 with a h3k9 peptide containing a myristoyl lysine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of SIRT3 reveal that the alpha 2-alpha 3 loop and alpha 3-helix affect the interaction with long-chain acyl lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide/hydrolase
molecule keywords myristoyl H3K9 peptide
total genus 82
structure length 274
sequence length 274
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5bwnA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5bwnA01
4UTXA 1YC2A 1U31A 4UTVA 3K35A 4BVEA 3JR3A 1YHYA 4FEEA 2PANA 4BVHA 2X7JA 2IHTA 2NYRA 3GLRA 1T9DA 2JLCA 2VBGA 4UU7A 4K9LA 4JU8A 4GM1A 1V5FA 2AG0A 2Q5JA 1EFVA 4GG1A 2HJHA 4JUFA 1M2KA 4ZZIA 4V1CB 1POWA 1Y9DA 2VK8A 1O97D 4K9PA 3GLUA 5EJ4A 4JUDX 4JU9A 4FEGA 5FEMA 2H4JA 4UTRA 4Y6QA 4C78A 1PI3A 4F4UA 1PYDA 2FR8C 2OO5C 2W93A 1DJLA 2H2FA 4JSRA 1D4OA 3D81A 1M2HA 1PNQA 1U28C 4L2IA 4GM0A 2JLAA 4BVBA 5DGDA 2VBIA 2Q29A 1S5PA 4V1CI 1YBHA 2V3WA 5EJAA 2JI7A 5AHKA 4D5EA 1OVMA 1XLTC 1POXA 4QELA 4R8MA 3JWPA 3GLTA 4UU8A 2Q5QA 5MFZA 1M2NA 3RIGA 2H2GA 2BRUC 2EZ4A 3CLTD 1T9AA 1YTLA 4HDAA 2EZ9A 3IAEA 1T9BA 2VK1A 4JUCA 4K9OA 5EJMA 2Q5LA 4O8ZA 2DJIA 1PT9A 2H4FA 1U2GC 5EJ5A 1Q1AA 3FZNA 4BVFA 3EA4A 3EYAA 3E9YA 4KXQA 3HWX1 4K9NA 5K3SA 1PVDA 4FZ3A 2PGNA 1YI1A 2H59A 4MQ5A 4QQ8A 2JI8A 2OORC 4HD8A 3CF4G 2IHUA 4MPPA 3D7KA 4Y6LA 4Q9DA 2WVGA 3RIYA 3PDHA 1UPAA 4GPEA 2IHVA 1Q6ZA 4JUBA 3U3DA 2WVHA 5MFPA 3U31A 4X3PA 4G1CA 2EZTA 4IAOA 1QPBA 5D7NA 1HZZC 1U2DC 2WVAA 5MGNA 2H2DA 5FYQA 1MCZA 4COKA 1JSCA 4UTZA 2VBFA 5BWNA 5K2OA 2UZ1A 1Q14A 4BV3A 1SZCA 3LQ1A 3D4BA 1V5EA 4MPRA 4F56A 3EY9A 1ZPDA 4MPJA 5EJ8A 3ZGOA 3PKJA 4K9QA 1UPCA 4RJIA 4JUAA 4GP9A 4QPZA 2A1UA 2AG1A 3HWWA 5EJ7A 2EZ8A 4K9MA 4BV2A 4C7BA 4JT9A 1T9CA 4MZXA 4RMIA 1SZDA 2JI9A 4KGDA 4RJKA 2JI6A 3ZG6A 1Z8NA 4L3OA 3F6BX 4KPUA 4D5GA 5IMSA 1V5GA 1PO7A 1PTJC 4FVTA 2FRDC 4BN5A 3FSJX 3ZGVA 4RMJA 1BFDA 1OZFA 4TWJA 4IF6A 2OD7A 5BWOA 3CLSD 2Q28A 4GM4A 3CLRD 1OZGA 5EJ6A 4I5IA 3FLMA 1PNOA 1EFPA 4RJJA 2PGOA 4J1TC 1E3TA 4BVGA 4RMGA 4V1CA 1YC5A 2C31A 1N0HA 3GLSA 4IG9A 2FWNA 2A1TR 1O96B 4ZP1A 2H2HA 4RMHA 1YI0A 2QQGA 4JT8A 2H2IA 3F6EX 4UTNA 1S7GA 3IAFA 2EZUA 2Q5OA 5MF6A 3PKIA 2FN3A 1M2JA 5DEIA 2QQFA 5BWLA 1J8FA 2Q27A 2UZ1B 4K9KA 4J16C 3OE1A 1M2GA 2OD2A 2OD9A 1Q17A 1NM5C 1UPBA 1OZHA 1YHZA 1MA3A 1ICIA 1YNOA 2JIBA 5K6RA 5DGTA 4TWIA 4Y6OA 4BUZA 2VJYA 2H4HA 4BN4A 2FSVC 2NXWA 4JD5A 5K6TA 2B4YA 3CLUD 5EJ9A 4UUAA 4X3OA 2VK4A 4UUBA
chains in the Genus database with same CATH superfamily
3KEGA 1YC2A 1YRHA 1WABA 3PJRA 2DLDA 3JR3A 1GYRA 4CKWA 2X7JA 4QELA 1CP3A 3FFAA 3K20A 4KQXA 4D9MA 2PM8A 2XWJI 3JQAA 3TAHA 4B76A 4CMIB 1DJMA 5HRCA 5D5PA 1E2KA 2SBTA 3KJXA 3N28A 1WDKA 1G6KA 1K8RA 1Y1SA 2ETXA 3AHFA 3RRNA 4B17A 2OYCA 4DBLE 3NT2A 4BNUA 3RBXA 4KSCA 3HFRA 4RL6A 1MQ8B 1FNMA 1EDZA 4GM0A 1DOHA 4WOKA 3E3AA 1AUXA 5KC8A 2JGRA 4FFSA 5AYVA 5FTNA 3FCEA 2HYIC 5JVDA 2QR3A 3OUUA 4LY3A 4DIUA 1BDHA 3FWKA 1I6KA 5IVDA 3T7KA 1IJEA 3ENQA 1E2NA 2B1GA 1OBCA 1KE2A 3LY7A 3MCUA 2D7CA 1KO8A 3CZCA 3QE3A 3QUQA 1G7RA 1T9AA 1Z38A 3GXBA 4Y7CA 3A6DA 3CWQA 5K3FB 2GPNA 4M0MA 1R0CA 1RJEA 2PX6A 1L7DA 2O2XA 4MWDA 3E9RA 1B16A 4IXWA 1RBQA 4ZVNA 1KOJA 1P0PA 5CLHA 1PNTA 4WLEA 4V0NA 1HL7A 4QDKA 3CF4G 2PFSA 4IOMA 1J42A 4OHWA 1E4VA 5GJCA 3W9SA 4JIGA 5JECA 4JSYA 2GO7A 1ZJWA 5FOWA 1SC9A 3KOYA 3LUAA 1XTBA 4GOND 1L7XA 4Q9KA 4ZOLF 3M3DA 4DY6A 4Q4CA 1BC5A 1EVZA 4X6LA 1D2CA 2DWQA 3D8BA 2F3UA 4ZHQF 5BSGA 1V6AA 4RTQA 1GUAA 5ESWA 4MGHA 2VPWA 1OFUA 3VYVA 4GI1A 4O4JA 5JPCA 5T8KA 2G08A 5K2OA 2K7ZA 5G0TA 4E5SA 4LXIA 4WFJA 4I36A 2QMUA 4D0LB 1X1DA 1KXJA 2H11A 1C8BA 2AFHE 3QKTA 3GLHE 5EJ9A 1GM5A 3BWEA 3GLGE 3I2HA 1MC1A 5AKEA 1RJDA 2FV8A 3K9WA 4WHMA 3GD5A 3KLNA 5CHEA 5AJXA 2XMCA 4M2LA 4D5GA 4EHBA 5ADUS 4TMTA 1NVVR 3GJ5A 2VQEB 2ZKLA 3GVIA 4DRXA 3KJHA 1I2MA 2Y05A 3I2YX 4WESB 3E18A 1VPTA 3OY2A 5HA5A 1P2DA 3FZYA 1IZ7A 3AO0B 2ZS8A 3L8DA 2FEWB 4M9XA 5D1HA 1TGVA 4GZMA 4MPDA 4FJ1A 3Q72A 3QVXA 4HI0E 1DQSA 4WDQA 4YIHA 4W1PA 1L4UA 2C83A 2J9GA 3B3GA 2DPXA 5DBHX 1BTOA 3N6RA 4OLHA 2ZAYA 4NBVA 2ACEA 4WLOA 3T3EA 3Q8KA 1J2TA 1K7XB 4XTRA 3WK6A 1WBDA 2P8SA 5IBQA 2MHCA 4KB5A 4OSOA 4YRTA 1QGUA 2DBZA 3DMDA 3N2IA 1M5UA 2IDZA 1HG1A 3OF2A 3PIIA 5FO0A 1T5SA 3DTTA 4LISA 4E3WA 2XCSB 4JI2B 5LU9A 2ZG6A 3VRHA 2Z2JA 3JW8A 3COVA 3M70A 1RLIA 2UU9B 3IXLA 1ECFA 2ZRGA 1QV9A 4ZHQA 4ZWNA 4BWVA 5K3DA 1L5OA 3RS9A 3TKAA 4KQ1A 4FYXA 3GJQA 4O4JF 1O6CA 3C3CA 1OZ0A 4XQ9A 4B4OA 5B58C 2QK4A 3ORHA 5IXYA 4AKIA 5M04A 1MPTA 2JNWA 2BFDA 4UHBA 1A82A 3DDSA 3CBQA 3K1AA 4YPFA 1ZIPA 4LJKA 4QJ4A 1DWPA 3CF0A 3VOBA 5IUJC 3UH0A 4UUOA 1N3BA 4W8GA 5CFLA 4CMKA 4H7IA 4FW9A 4OXIA 2CWWA 1TT7A 4GS5A 1JG2A 3BF7A 3LA6A 4R68A 4DM3A 3UGKA 3SC2B 3IE0A 4KR9A 4IOLA 5JXGA 4ZGBA 4KR0A 4BX9A 3KOWA 2B78A 4FC6A 4LF7B 2OXEA 2TSYB 5DHFA 3B5EA 4EY5A 3VYSB 4FUTA 4X71A 1IN1A 4JLJA 4O1MA 3BRCA 3L7BA 4X41A 4D74A 4ND6A 1QFXA 5I8WA 1XWFA 4Q24A 4U9HS 4H4CA 1OCEA 2WJYA 1FLDA 4A1OA 3ELDA 2VSNA 3ENVA 8GPBA 3REFA 4L4ZA 1MV8A 4FGUA 7MHTA 3TZCA 4EGJA 3AFOA 2CE2X 1BIFA 1EB8A 2GERA 3UKJA 3VZBA 1ZCAA 2W2LD 3Q41A 1K98A 2X0RA 3D8UA 4J0QA 4TKVB 4UVHA 4WV3A 4ESEA 4M0CA 1U8YA 1YDMA 4JXKA 1GUYA 4XQGA 1XLTA 1NA5A 2MWMA 3E70C 5H4GA 3ZE1B 2ILTA 3OZ7A 4LHWA 5FBKA 4ZDKA 2ZJ1A 1QB7A 4WNAA 5D87A 5BY2A 1LPAB 4IINA 3ZC3A 5GM2A 1OPRA 3FYCA 2BGTA 1WS6A 4LXGA 1Z2EA 3G9UA 4DIEA 1USVA 3IOYA 2PZLA 4J6FA 3UAXA 4ENPA 3B9RA 2F8TA 2WPNA 1ZITA 5FF9A 1CJSA 2XCRB 3R3SA 3BDAA 3IXQA 4JUAA 4DLTA 1TCCA 1XTZA 3OM8A 4E32A 1KI9A 1U2ZA 3DLHA 1SVIA 1LK7A 2BHRA 5F2EA 3CR8A 1NATA 2HJRA 3EMVA 1U98A 4U7FA 1PO7A 2AC7A 4FOOA 1R9MA 2H1SA 2F48A 4JVNA 1NBHA 4LZAA 3RRZA 1TD1A 1DKNA 3QFRA 2B1IA 2FN9A 4EJSB 1KEEA 2VZ9A 3G0BA 1DTEA 1B4DA 4X92A 2P6PA 3BXPA 1QQBA 3V6MA 4DR3B 1IU9A 3EEBA 2VSYA 2HBYA 3IAS6 4JA0A 4QOFA 3GEMA 3LAWA 1H1LA 4OHXA 1CZRA 2WJZB 2OB2A 2QNBA 4PLTA 3AZQA 4UJ3A 5DASA 4EJ0A 4G89A 4B6OA 3CZ9A 4RQTA 1EQ2A 3SQWA 3NOVA 3HXQA 3JQ7A 2YW2A 4EI7A 1YJCA 4HS9A 5B53A 5FL7A 2O8BB 2O2YA 2PT9A 3WDMA 1USWA 1CUWA 1Q77A 3LQRA 2UZIR 3KD2A 5J63A 4QOIA 3W5DA 1U7PA 1Z4LA 1NNSA 4JI4B 2IOQA 4OJMX 4RGVA 1OTHA 5C1IA 3SSAA 2QMHA 1MQ9A 4E22A 4E21A 1I6LA 1PIWA 1GZ3A 2CUKA 2I4IA 3PF8A 4Q66C 4XA8A 4YAOA 4CG0A 1W5TA 1DX6A 3AF4A 1C3JA 1EH5A 2VAWA 1TYDE 3B8HA 4O33A 4Q18A 3H5AA 1TI7A 4AT1A 2W42A 3DFKA 3CQ9A 4ZOEA 1JN0A 2I1QA 4OP3A 3DZKA 3V9PA 3KQWA 3N59A 2R8EA 1T6ZA 3BHMA 1T13A 1LC0A 2VK8A 4M1ZA 2GPYA 4Y2VA 1WZNA 3FVRA 1M7HA 3HDVA 3EEOA 3R3XA 4DLSA 2OO5C 1PJ2A 4REQB 1RSZA 4XRGA 5G41A 1T2CA 4OJKA 3LP5A 4MI6A 2C1XA 3LOUA 3HN7A 4HXFB 4NZPA 4H1WA 1BCSB 2YN2A 1X6VA 3H11B 3K15A 4PIMA 3W78A 1O9BA 4HH1A 5KYUA 4BNNA 3MWYW 1MA0A 2HA4A 3GIWA 4F5WA 2J07A 3ORQA 3NO4A 1VCNA 3WO0A 1LZKA 2QRVB 1UOOA 2A58A 2VNSA 3G2KA 2VP4A 3NNDA 3OE5A 4WJKB 1I3KA 1KETA 4EFMA 5AJUA 4GP6A 1NN0A 2HCRA 1QZUA 1GCGA 2WF6A 2YN4A 4EGSA 2QP4A 2PSFA 5AI5A 3DEAA 3MYRA 2MCFA 4O2AA 4KN5A 4QGHA 4F3YA 5L7WA 2IH2A 2ANCA 5T57A 3GO4A 3FI9A 3WA7A 5JANA 5MN4A 1RWMA 3PI7A 5I5EA 5GZ3A 5L4NA 1N77A 2RAUA 1BDBA 4XSHA 1ISSA 1HQYE 2DULA 1IFXA 1J70A 2CD7A 2LIVA 3DZJA 3IMKA 3IRUA 4GVXA 4NIMA 1SG9A 4E12A 3QBDA 5A3RA 5KQSA 3AG6A 2EYUA 2YNMA 1W47A 3ZZMA 4XYMA 5AOBA 2XDYA 3U7IA 5K0JA 2KBFA 4E88A 2Y1DA 4RE6A 2FN4A 4Q00A 4ZVRA 3KLBA 1TZKA 1FFCA 4L0QA 4ND7A 4Q03A 4EAQA 5JBQA 4E2XA 1RACA 4QYTA 1GP2A 2UZ3A 3E03A 5HXAA 4ND8B 4E5KA 1IC6A 1GR0A 4MPJA 3DMTC 1BXGA 3JRNA 2HHJA 5CXUA 1BGWA 3FCAA 3GCWA 3GH3A 5A9SA 2AV6A 3RADC 1YCHA 2YZNA 1KBZA 3REQB 1J8VA 1BU8A 5CX1A 3AVWA 2WQZA 3EXHB 3FZQA 2DYKA 5BYBA 4BTLA 5BOSB 3FRIA 5JJBA 3NVKI 2ATVA 3CUUA 5LDGA 4N9QA 4ZYYA 5I6DA 3P2EA 3B1VA 1NI4B 1P3Y1 2NXJA 3B6JA 4E5YA 1ACMA 3HB9A 5KKCA 2QN7A 1NBMD 5F3WB 1RMQA 1B8OA 2HT6A 1VCMA 5DBFA 2WMNB 5LZ8A 3UAGA 1E6EA 4RV9A 1GO2A 2P90A 2HMAA 2YV1A 2C31A 2CLFB 3K0SA 3BKXA 4O2AF 1JLMA 4ZP1A 1JPNA 3Q3VA 5AW9A 5EWLA 1F1BA 4NAHA 2WKQA 2B35A 3RB8A 3ZD7A 1Q0QA 4FYWA 4MS4A 2FGKA 4XWTA 3AU8A 4LECA 4MUKA 2ZREA 4R31A 2M2IA 2FH5B 2FN3A 2XADA 4YCBA 2FEKA 3VPAA 2WHYA 1Z7YA 2VXCA 4CMIA 3A6JA 2V58A 4MP6A 1Z26A 3G0OA 4ANFA 1BU5A 1QK5A 1VIMA 1C50A 3DZBA 3D2BA 1OXSC 2G04A 1ODTC 1VBMA 3QELA 5JDCC 3SP1A 3WGMA 4Y6OA 3THWA 5EHQA 1IQUA 3GP5A 3BG5A 5KYWB 2CLDX 1WEHA 5DCUA 3M49A 4BAGA 3F6PA 4HP8A 1T2EA 4R6WA 4X6UA 1CY4A 3CH6A 5E0OA 1CV2A 3A4VA 4FE4A 2HH9A 4QU8A 4X7MA 2Q3BA 3JVEA 1DDIA 1LX6A 2GN4A 1YUNA 4D7AA 4IL5A 1FDTA 1QRDA 2D6FA 4B6RA 1OGIA 5E3IA 5HF9A 1P0FA 2O8EB 1YB2A 2H8KA 3VNAA 5HIAA 3GCXA 2IZ1A 2HU5A 5HVNA 2VP6A 2IYOA 1U2DA 1M1XB 1WW3A 1YB6A 2C4VA 3FDXA 3LBHA 3P4UA 5ESXA 4M0EA 3ZHXA 2Z30A 3M6LA 3SHVA 2ZWOA 3ZTWA 1NHGA 3E3LA 3LPMA 5P21A 1WU8A 1HQDA 2PZ8A 3MJFA 4OGKA 2WTBA 4PLVA 1F2DA 3NBZC 4WXEA 4BNIA 4J3FA 4CLRA 3IYLW 3EGXA 2OPBA 4XGIA 1Y42X 1F51E 4XVCA 4J4HA 4QDJA 4QEZA 1N92A 3JWPA 4HFMA 1LLDA 3PYXA 4QHTA 4YO8A 5LA6B 1LFDB 4G5YA 4QREA 1TYCA 1GDDA 1NVAA 1LDNA 3VO8A 1SA0B 2JLQA 1SQ6A 1IEVA 2DQKA 3FWYA 4GEKA 4P4NA 5EGNA 3BH6A 4RAOA 2JZOA 5EJ5A 3DBLB 3BULA 3EA5A 3DMPA 4HVAA 1WZCA 5AVQA 1NVEA 4YIKA 5CG1A 4XB1A 3WAGA 4MPPA 3PUVA 2X7HA 4QLBA 1P6QA 3ORSA 1Y8QA 1GRVA 5CLJA 1PFVA 3LPAA 1J39A 1LW6E 1YS7A 4GMFA 4MVJF 1K8QA 3NIBA 4KW7A 3L7OA 5B57C 4QU9A 3PC8C 3PQ8A 4JQOA 2CW5A 5IEBA 1W35A 3GA5A 3HBLA 4FK8A 3VR6A 4JI1B 1ZQ9A 4XTCS 5MGNA 3TXYA 3U80A 2VAXA 2W2TA 3I42A 3M2PA 1TKCA 5E3JA 4D3XA 1C0KA 3FNRA 1HX7A 3BMCB 1UKBA 3JWIA 4PY2A 3TPFA 2FCAA 1XF9A 4YAGA 1JEOA 3L4JA 4ZQIA 1VE1A 2I1VB 4XQEA 2FSSA 2YQ4A 1T0IA 4DLPA 3ZWYA 1TTQB 4HQRA 2WBLC 2FUG6 2HCBA 4HUTA 1W5BA 1RYHA 3HB5X 1XMPA 2XSZA 4GX5A 5KYNA 2PUDA 1IOZA 1DV2A 3R75A 5GONB 4AO6A 2PSEA 3PUYA 1ACJA 2ZULA 3LUDA 1AZWA 1OJ7A 3E5HA 2CCJA 3A3OA 3MWJA 1FU4A 4PXYA 4Q34A 5CH3A 5KYXB 4JYCA 4K9SA 3U4DA 3H87A 5AXAA 1SKUA 3PFNA 4INAA 5DLPA 3UOWA 3P45A 1FVFA 3BTOA 2UUCB 5K09A 4Z7NB 2ALJA 1Q21A 3SFTA 1YXMA 2ZE7A 3AQ4A 2YQZA 1E2QA 3CKKA 3MUOA 5C4GB 4MCIA 1EEXB 1P39A 1II8B 1PGNA 2BRUA 2DLNA 2JFNA 4JL8A 4M76B 3L1UA 4QYMA 5AT1A 3TLXA 1XTJA 1LTQA 3LY5A 4EARA 3G0CA 2UZ1B 3ESXA 2Z6VA 3FCOA 3H6KA 3W3AH 3WLAA 3ZI4A 1JDBC 4ZEWA 4ZI3A 4XEUA 5FA8A 4XSVA 3K5PA 4M7OA 4AK9A 4HQOA 5FV4A 1Y8AA 1ONSA 4CMBA 4LOLA 2OFXA 1F4LA 4LZOA 4C6HA 5ICSA 4HVLA 2XPCA 4EMTA 1HLGA 3NHBA 3HUUA 3QWIA 1IY9A 5IP5A 4GOKA 4TL9A 1L5YA 3HCFA 2HLHA 2G9RA 3RS5A 2IKSA 1HQCA 1UDWA 4MAMA 3O95A 4MDYA 4AN4A 1KHTA 1FFBA 2H0RA 4FYIA 4LOHA 3VUFA 3IQXA 1PX0A 3KAJA 5DLDA 1YV9A 3ED5A 2C2OA 2HJHA 2RI6A 1POWA 5FORA 1U1EA 1AV7A 4MZDA 1JB9A 4UTRA 2A4MA 1UXJA 3PZBA 2GASA 4AKEA 1JFSA 5DSXA 4LS3A 4K2AA 4YRGA 2MOKA 4JGIA 4ZU1X 4H7KA 3QOYA 2OAQ1 4YECA 4C5CA 4DG9A 4EGCB 2DUNA 2JDIA 4PWYA 2B8JA 5LOVF 3W06A 4OKNA 2B5OA 5HDQA 5KOJA 2CB9A 2G25A 3N0WA 2V6GA 3Q7SA 4NZMA 4TTJA 5ALVA 4UJ5A 1G6OA 3I5YA 4R8VA 4FMDF 1TCVA 3PQDA 4Q4AA 4WCFC 1KJNA 1W4LA 1GNLA 1YD7A 2ODWA 4WNAB 4CZ2A 3DO5A 4QQKA 4QQNA 5JDCA 3UAZA 3W5AA 3LGXA 2QTNA 1Y0BA 3VM6A 1CF2O 2YYYA 3UAVA 1N8KA 5JY1A 5AKLA 1TF7A 2BBWA 5DI9A 3T7JA 4BB5A 2C7VA 3GAAA 3AR4A 1AOXA 1Z35A 3I52A 5I9LA 3OH8A 4X62B 4RDXA 1INLA 2IHUA 4TYYA 2YBEA 3N2EA 5I4BA 3PEFA 1UXKA 3W5JA 4BMZA 2PZBA 1FVXA 4GZ5A 4QRDA 2BEUB 1X7DA 3WKCA 2D4HA 2OZLB 4CBVA 4Z4HA 2IHVA 2PMBA 4JEUA 2J4DA 2FCRA 4OM7A 1SOAA 5HJ2A 4PBTA 3L7IA 1FLAA 2IPOA 4OAOA 4ZZ2A 3V34A 1VA4A 3VR5H 1KEEB 4KYTA 1DFHA 2RHCA 1MAWA 3KQPA 4CM4B 2E1RA 3D3KA 3QP9A 5TQVA 3PITA 1COWD 3OOEA 5F1YA 2AHRA 2XKAA 4D8XA 2QL7A 4D79A 1UAAA 1E5XA 2NYUA 4KDFA 5CB6A 3MVEA 5E1OA 3AG5A 2ZAIA 4HH4A 3PC2A 3VBEA 1UBCA 2FG6C 2ZJOA 3OZDA 4X00A 2CNDA 3S2UA 1VBKA 3SBEA 2H06A 4R7TA 4WESA 3WKDA 2Q1TA 4YJHB 4LDNA 4FDLA 2OBYA 2Y93A 4B8WA 5ALUA 4WACA 4X84A 3KNZA 4G3XA 5CVDA 2J46A 2W90A 2YYSA 3VR1A 4ALIA 4RVNA 1P1HA 2NTJA 1M0SA 1XZEA 3BMQB 4J75A 2GVZC 3V2UA 4O08A 2WD7B 3SFVA 1WV1A 3FMGA 4GI5A 3SBDA 2K2QB 1AKEA 4G5XA 1HMPA 2MSWA 3FPGA 3IXMA 3QKUA 3HO1A 5DT2A 1JP7A 4H18A 3ZKWB 4FKMA 4HAWA 4KWHA 5EZYA 4IIVA 5DLQC 1Z6TA 4ZVLA 5DM70 1VLVA 3MJ4A 4I99A 3X0DA 3KT6A 3H2IA 4FOSA 1E1QD 4YJ2A 4OV6B 1R0YA 1P4GA 2ZYGA 4O3MA 3N8IA 5DVZA 1M72A 1SM4A 2C3YA 1S02A 5EXXA 4C4ZA 2P5SA 1BOOA 3KQSA 4IH4A 1QPGA 2WYOA 3B2EA 5FWXA 1ZUNA 2OVFA 3WS7A 5KTMA 3SZLA 4RABA 3L02A 5DHQA 2FTKE 1V43A 5BOVA 4YCDA 1SBYA 5T8KC 1EX7A 3PNKA 4R2KA 2GJSA 4HF7A 3MWEA 2V0NA 4JZKA 1WCIA 2GNPA 4B3FX 4HAIA 3LECA 4RV4A 1XTPA 1X74A 4N3BA 2RKBA 1IZZA 4URWR 3QUCA 2AVDA 2AJBA 4DILA 1CY1A 4NQRA 4W5RA 3OQMA 2RGYA 3NKVA 1DFGA 2ZPAA 1CEXA 2H1VA 3GLVA 5KSWB 5JCJD 1PVOA 3EOZA 4H1VA 2SKEA 1NP3A 1CQXA 1WZEA 3QJYA 1PG0A 1PYGA 5AVRA 4TZ6A 1AKTA 3A4TA 2A5YB 2OAGA 2ZIGA 4L0DA 3QBVA 1MAVA 3ZBQA 1WUHS 4BNXA 4DZTA 2J9YB 2BFOA 3RJTA 4JOSA 5ICCA 1OLXB 2OB1A 4AJPA 2D0PB 5EMLA 2C5EA 4OGWA 1ZU5A 3SQNA 1KYVA 1MX3A 3SMQA 5IRCD 1KH2A 1WVGA 3BFKA 3LPLA 3VHQA 1E2EA 2M6RA 3HA2A 4I0WB 2PWPA 3LF1A 4RH3A 3SF8B 5G3YA 2A35A 4MEAA 2RK3A 3DL4A 1BX0A 3FZNA 4HZUB 3PRKE 2O2DA 2ZB4A 4KG7A 4TKVA 1HV8A 3N0RA 5A1TA 3CH5A 1Q0ZA 1RP7A 1GPDG 2OGSA 2WB4A 621PA 3E9CA 1L1EA 4Z53A 1V8ZA 4D41A 1IUPA 5IPFA 3GJRA 1TZBA 3T95A 5BOSA 4NFYA 1DC4A 4BO3A 1X3SA 3ZJ5A 4PFSA 1JYSA 5HBRA 1NI4A 1UFQA 1ODFA 3ZDYB 5IS2A 2DJ5A 2NU6A 3E84A 4II3A 1SUIA 3FTNA 5EZ6B 3UMSA 1E77A 4F45A 1LRKA 2CC2A 2EDAA 1DG3A 3F3MA 3NMUF 1XQ9A 1ABEA 1OREA 3AVOA 1Y34E 3ETNA 2O3UA 2AG6A 2IE0A 2MDTA 4IILA 1BDJA 1P0IA 3NBYC 4AUEA 2HZBA 1Z4NA 2C0CA 2V55B 2WF8A 2HWXA 1KJYA 4WCFA 1VCHA 2JI9A 2RONA 4ZOQI 5H3LA 3EBOA 4KQ2A 1CRZA 3EHEA 2B5VA 4IDEA 1RWQA 1P33A 2PDAA 4RFVA 1Z16A 3I53A 2G63A 1M2OA 4KYUA 4JI0B 2HCTA 1LVGA 5AW8A 5HRUA 3IO3A 4TWJA 4IF6A 4B33A 4I5IA 2Z2YA 4ENQA 1C1YA 3DLAA 3N74A 3OX4A 5ESDA 2XBLA 4U39A 3NBMA 5FLEX 2C5AA 3A1TA 3H1PA 4PG7A 1GRCA 2LP4Y 5DGXA 5EIXA 2D1RA 5HSGA 1DV1A 3DO6A 1LW7A 2IHBA 1LY1A 3B6EA 2A3RA 3L79A 3R5HA 2CGEA 5D00A 3BRQA 3SGLA 4UM5A 4OA5A 4LF5B 1A9SA 2N42A 2AKEA 1N2CA 3CTMA 3G8DA 4PZPA 4H4DA 5HG0A 3G9TA 3KUXA 2Q27A 4I1PA 5JJ5A 4YT4A 4EX7A 4INJA 4DPKA 2JD1A 3WL7A 4FFVA 1V3UA 4ZT5A 4ZCIA 3SHFA 2GRUA 3HPRA 4X1OA 1N2ZA 4IIHA 3KQQA 1EPUA 4TUYA 5L45A 1BMDA 1THMA 1TIKA 5I8PA 1MU0A 5L4LA 1J0BA 1L5FA 1A5SB 3O73A 2GHQA 4PAGA 2C03A 3SPXA 3DBHA 5EMMA 1VBFA 1NFFA 4AMUA 4IS2A 2EW8A 2XRFA 3DZCA 1I4EB 3C43A 3FZEA 3FMVA 4CI0B 4EG1A 1WF6A 4CTMA 1THTA 1WL8A 4K9LA 1YMVA 1N6NA 4DWOA 5CLLA 4OUDB 1EQUA 5FHQA 3KM0A 2E4XA 1U3VA 1UP6A 3WNQA 1GCIA 3U9TA 2QRMA 4BNYA 2E85A 3G2QA 2JPDA 3CZAA 4U7WA 4IKEA 4Y2TA 2F1IA 4F8EA 1XXHE 2ADOA 1LLQA 3BBLA 3TAUA 1L5HA 2HRCA 3AHGA 3V1LA 1XT6A 3DJYA 4Z9XA 3QVVA 5ED0A 1UBFA 4EK9A 2Z8YM 2A57A 4E5PA 2BC9A 1VMKA 3Q1KA 3U48A 2X22A 1X1RA 3KWLA 1NQ5A 2XWSA 3LV8A 1LNQA 4J6EA 2WM8A 2C9BA 4KKXB 2QTRA 4FSDA 4V3BA 3LY9A 1KGSA 1SVLA 4K9OA 1Z5PA 5IAAA 3W6NA 4DMUB 5J4HA 3EVDA 2CFCA 3W2HA 3EYWA 2JD2A 1F8GA 4Z7JA 5JRJA 2KQUA 3Q3IA 2XCQA 1QQ6A 4G24A 4OJNA 1I2BA 5B58T 2C7GA 4ZT6A 2B30A 2BDUA 2WYVA 5BSHA 1CXZA 2R00A 2YBDA 2PWYA 4YDHB 1NJ2A 4KGZA 1PZFA 4EQ6A 3MRVA 3VVLA 3HFGA 4PTLA 4Z4FA 1HRKA 1SXJB 3I4CA 3UJNA 4ND8A 1MOQA 4Q01A 4H7JA 3FJ1A 3HMKA 2ZSKA 2SNIE 4BV3A 3MS7A 3PDIB 4RSHA 5BQ5A 2FE4A 3WIEA 4DCPA 4BWYA 2C5GA 3AW9A 2XIJA 3DL0A 2D06A 1UBLS 4YC7A 4RH0A 2RHTA 1L7MA 4EPXA 3F2VA 2P9BA 4P08A 4X20A 4RJKA 3V4LA 1G18A 1EX9A 3QY9A 3C8MA 3IDSA 3ZI0A 3QEMB 4C4YA 2QZ9A 4RLSA 4DKXA 4KPYA 3ONFA 5JVDB 2OQVA 3PD0A 1J9ZA 3C1OA 3VR4D 4ARVA 2Z2ZA 1OZFA 1AX9A 3K9GA 1N6RA 3FHOA 4D9JA 1I2CA 2VHWA 3NHSA 2V7QD 2ASEA 2NP7A 4O63O 1QO7A 3LQ4A 2DE0X 5EHNA 3BXEA 1RIIA 1G8FA 1JEEA 2ZKIA 4K86A 1V8PA 4P83A 2VDKB 3TM5A 4W6ZA 3X1MA 4C2BA 5IG2A 3FYDA 3SX2A 4V02A 3WDSA 1GUDA 1U0FA 4B5KA 3JD3A 2BLNA 1ZFNA 3PG5A 1UOQA 3KQUA 2QAGC 1SB8A 4OD0A 4I5FA 5JO0A 1B42A 5DHRA 4CF7A 5JZBA 3B48A 4Y9TA 2RB5A 4XFDA 4QBGB 3EUEA 4P6VF 4CF4A 4FNGA 4J9UE 1Q1GA 2YRFA 3NIDB 1UMBA 3VU3A 1RCUA 3JAWA 4RANA 2GCOA 1H4VB 4JJIA 4M6WB 3IQWA 4EUFA 3KG2A 4Z0NA 2GAOA 1ZGGA 3FYUC 3RG2A 3SM9A 1U8EA 3K5WA 1P75A 5PGMA 1CDOA 3H2HA 1YJAA 3D0OA 3DW3X 1E1RA 3R4VA 1WB6A 3NM6B 3PQ6A 1OYWA 4DB4A 4G25A 5D7BA 1FPMA 1JJFA 3DTYA 2ODTX 2EYQA 3GJ6A 4WXYB 4V39A 5CM2Z 5JDIA 5G1OA 1YDGA 1Z2DA 1ZO8A 1TUBB 3IBGA 1OFIA 5KTRA 1W0KD 4BVHA 4J43A 1U90A 2XTNA 1QX4A 3RJ9A 4HL6A 2PGIA 3OT4A 1Y8RB 1VLQA 1G7CA 4HNAA 3AFNA 3BWDD 1T10A 3E3MA 1WUIS 2R97A 2A33A 2GAIA 2R6HA 3LD9A 3TW4A 1U2TA 2REQA 3OCWA 5KX5A 5FBLB 4HWTA 5C2JB 1R15A 4NK4A 3LY8A 3TEFA 1U7HA 2P9EA 1HQKA 3KOMA 2XNCA 4E94A 1DCKA 1PL8A 2JCVA 1Z12A 4R3NA 4YPOA 1KPHA 1L4EA 1W87A 2FWAA 2H92A 3CPHA 1EXMA 5TVKA 3SQOA 4F5YA 5JOQA 1YVRA 4QPPA 3O4VA 2DWPA 2XQFA 1NAIA 4UCXA 4YRZA 6LDHA 1AMUA 3J81k 3TFQA 4HDNB 3V1TC 4DMFA 4DLBA 3L1KA 2RGDA 1CEYA 2ZSEA 2FMTA 3JQCA 1EG7A 2OCBA 2AQHA 4DLKA 4PO3X 4MS3B 3UYKA 3IMEA 2WU4A 3BD9A 1E7YA 2XV1A 1D4FA 1P3DA 4BX2A 3MWGA 2QS9A 2VDWA 3PX3A 4HK4A 4IV5A 4MUFA 2HF8A 3NJRA 3A9CA 3W0LB 3AMVA 1CRLA 1KI2A 3ZY3A 3WB2A 4TN1A 1XDDA 4QAQA 2X5KO 4ZEOA 2VWGA 4DSZA 1HDCA 2FUCA 1PT7A 1W2GA 4TLDA 4NPHA 4W7SA 4YREA 1OA1A 3MUFA 2QX4A 4LBZA 5ER9A 2GRAA 3IVXA 3D6VA 2R8RA 3BMCA 3DOUA 1RLMA 2NZYA 4ZC1A 1AB6A 1KJWA 2CMFA 1RM0A 2WD7A 1QC5A 3AB3A 3R7WA 1ZONA 3TD2A 1XQWA 4TZKA 4BB0A 3KAPA 3KB2A 1ILEA 4KTTE 1CFZA 1OU4A 3PHBE 1EM8B 2Q6TA 3D4PA 2XQIA 2PJUA 3B38A 4G1FA 4KPUA 5LUAA 4ND5A 1FU8A 4IV0A 4Y1FA 2ATCA 4HYYA 2PN1A 1SAYA 2YXPX 3L6EA 4KHZA 4QFDA 1JWLA 5ES4B 4ZICA 1VE7A 3LVBA 4D4JA 2PSJA 2PQ2A 5KYXA 4P3YA 1C0EA 4LZPA 5SYMA 3K0AB 5A2QA 5AVXA 2PXAA 1FE8A 3FMIA 1RXCA 4D8TA 4DQ0A 3PTAA 2ZT7A 4W5JA 4KBYA 3I9LA 2OZVA 1CFJA 2VRBA 1DL5A 2AQ8A 3ZVRA 5E7IA 2B3DA 4NYMR 3U81A 4NU8X 2G7MC 5B7PA 2ZRMA 4HTAA 4BLOA 4C6TA 1XZMA 4D4IA 1F0YA 1OHHD 4U4AA 1JI3A 5DISB 3DQZA 3QU9A 3TLYA 3L6OO 4ADSG 4Y9DA 1ZA2A 1I0ZA 5TMPA 1XTUA 2HIHA 3PQ2A 1ZD9A 3QNWA 1OX6A 2IPAB 2TMKA 5HK8A 1ID1A 4ZQHA 3UCEA 2I54A 2IP2A 5H8WA 4DCVA 4JD5A 5B7NA 2AKAB 4UVIA 2VRNA 4TKZA 4DR7B 4B80A 4LZLA 1U7WA 4NCAA 3UJCA 1FXWA 2FZCA 2VNKA 3F4LA 1PR6A 1W5EA 3FGNA 5BWCA 6AT1A 1UIRA 1D6JA 4IDPA 4ZCSA 3VPSA 2W2NA 1A7AA 1NQUA 2GZ1A 4PRLA 4MV1A 1L7PA 1ORTA 1YUBA 2Z5VA 3DG9A 4U7DA 1AGYA 4AW9A 1BKSB 4LOKA 2IPMA 6YASA 4MVJM 3HVUA 1OI7A 3BMNB 2V7BA 5DYNA 4W5QA 3ESRA 2IBMA 1LDEA 3MYYA 2I7DA 1UJNA 3P52A 3RG8A 2W6OA 1CW2B 1TAQA 4GC5A 1K9VF 3MBKA 1RHMA 4WZAA 1A0OA 2J30A 3KR0A 3OZGA 3BVPA 1K6EA 1X1TA 4D4HA 4HXGA 2UXBB 1GA1A 2UYYA 3L06A 3MUEA 1Y81A 1BEEA 1KH1A 1TQ8A 2MINA 1NF8A 1ODCA 3CNLA 3GUZA 1HYQA 1PWZA 3I9NA 1ODSA 1VSTA 5LMUB 2WUEA 4YUVA 1BWRA 2WICA 3PGKA 1YIDA 3VX3A 5C37A 1UUFA 1VZ3A 2XOKD 4NNPA 4X6XA 4DSUA 1W4CA 4JBYA 3O8LA 1SHKA 2HSWA 4PINA 3M6MD 1PAUA 4K0RA 1ZMOA 1EUDA 3HNRA 1MAAA 3NX4A 4LRWA 4NCIA 5FXMA 1V1RB 3PQ7A 2C5LA 2JL1A 2ORYA 1E6KA 1IHYA 1KO4A 2X8AA 1S9DA 5AHOA 3WP1B 5KTSA 4P0PB 3ZWKA 3AI2A 1RQLA 1FDWA 3ZHRA 3G68A 5BWNA 4JKOA 4PNPA 3GF4A 4ZT7A 3OEYA 4NEHB 1QG2A 1KEPA 2VWHA 2R4UA 1YGPA 2ZTUA 4Q48A 2VVTA 2FMFA 2Z6AA 3R3JA 2I4OA 4YN3A 2Z8YA 1C7QA 1U3CA 1JG1A 4KFUA 1DARA 1TM1E 3GEHA 3RYHA 4CQMA 5KWSA 1M6NA 1UBKS 2JFWA 1F0NA 5LR6A 3KDAA 4DV3B 2NIPA 2I78A 3VDXA 3CE9A 4I1VA 1C0LA 2VZLA 1G9TA 2PBZA 2NVWA 4FS3A 4KUEA 4PZYA 3FSJX 1RXEA 4ZPXA 2C29D 1H8ED 4G86A 1LQ2A 1JKIA 2ZIXB 1F9EA 4YRDA 3S44A 4AJIA 1KRXA 3ZGLA 1U2RA 4U7GA 2XB9A 3C3BA 5AVWA 1DZIA 1HSZA 3QG1A 2H4YA 4G9BA 4WXHA 1SD5A 2M9MA 1A77A 4X93A 1L9KA 2X5XA 4R98A 4B47A 1QKIA 1MABA 1W8IA 3D3WB 3CUWA 3IV7A 1RKXA 4C88A 1IBKB 3HKEB 1NLUA 1BYUA 3KZXA 4ZRDA 4JR1A 4DR5B 1Z62A 5KMGA 1AXEA 3N53A 5T6BA 1AJEA 5IAJA 3A70A 3WICA 5F33A 1GUFA 4FS8A 4UD2A 4OUDA 4BAZA 2AOUB 5TQ0A 1SC3A 2GXAA 2JBAB 4MR8A 5JMOA 1N2GA 1MG0A 2Y1LA 2AJLI 3M33A 4TL7A 2CV2A 4MGIR 3SD7A 1JMYA 4QXRA 4P86A 3QSYA 3QKIA 1J0XO 3ZJUA 5JISA 4XASA 2JAPA 4CM6A 4RF5A 3D6JA 5B55A 3TM4A 4B6GA 3ZWWA 1C3XA 1M0WA 3HY6A 4RY8A 5EKXA 5H80A 4UBMA 3OFNA 2XWPA 3NIWA 2NZWA 5I9TA 1K5PA 3KKMA 5IUKC 2CMGA 1UKAA 4K3VA 3GZ4A 3HGQA 4Q4HA 4MYUA 3SXUB 3OC0A 1DIAA 3VOTA 3WOVA 3FAZA 4AQYB 2R4TA 1E1KA 4AKHA 3VV2A 5KU7A 1JR6A 1A7UA 4Z2YA 1FMLA 2RE8A 1GPJA 2BKUA 2CDRA 3LKZA 4F86A 3TBKA 4NENA 1JIVA 1GZSA 1Z5UA 1KMCA 2OHHA 2B4RO 5ENZA 5K3BA 5DCLA 3I61A 3UK2A 2NZ2A 2ZRDA 1FUEA 3PX2A 1OROA 2W2QA 2YRWA 2W6ID 2AX4A 2PZMA 3KSMA 2EERA 2ONYA 1J56A 2H2GA 1GITA 2N47A 5E7QA 4P31A 1IIRA 5EE3A 3BHJA 3SF8A 5AD1A 2PJRA 1XC7A 1KVTA 2QZ4A 2CLLB 2W48A 1XD2A 4BUJA 1OWMA 1QHGA 1ZICA 2P5UA 1BFKA 2PTGA 4ZOLA 1JAYA 1E94E 2ZETA 4P4GA 3AHEA 2HRDA 1H2ZA 5LQCA 3WWCA 2FN8A 2W2PA 3FWNA 4GPEA 5GVRA 4ZAXA 4U7HA 2XAAA 1ZIDA 3PDCA 3T5AA 4N8SA 5AVTA 3OCUA 1IY8A 4RHUA 3WMFA 4J16A 1U9YA 1EP3B 3QG5A 1WB9A 3DT9A 3K0EA 5CVVA 1Q0SA 1DUSA 2IHKA 4IF4A 3SC6A 3AZOA 5IAKA 3FJYA 3HHEA 3PSHA 4ZVKA 3A05A 2N1BA 4O4IA 4MH0R 2QA5A 3P20A 4OAQA 2YWJA 5JQWA 4GKVA 1IE3A 2D3TA 3FBTA 4US2R 3LE8A 3INNA 3H2SA 4GSYA 1SVUA 1BE0A 2HMUA 3RARA 3RRXA 4F2WA 1R5BA 1RAIA 1SA0A 1IMOA 1VGVA 2QGZA 3MOSA 3CG4A 3RSHA 5A02A 4TT3D 4IG9A 2VYVD 1O6GA 1RQPA 2BMFA 4HMQA 4H3VA 3RTAA 1AUQA 2BTEA 4TTAA 3L4BC 1SZJG 1I3MA 3KFVA 3NBXX 721PA 3S7ZA 3C5HA 3T0FA 4PPQA 4ZO8A 1IOVA 2CVHA 3NHYA 3JWHA 4QECA 2ZBQA 1DXOA 2IXAA 5G02A 4PZEA 1ZSYA 2RB4A 1BHO1 2FRDA 3R7NA 2JLSA 1KRWA 1FNNA 2QSUA 4NY1A 4DVGA 5JE8A 3QPUA 3B9PA 1YA4A 1VTKA 5BRJA 4C89A 1Q5PA 3PD7A 2YHBA 1X7ZB 1MAUA 1EDDA 3K9LA 1G5TA 4M1WA 3LP8A 3SLRA 3I4LA 1U31A 5FV7A 5C4MA 2W6CX 2VDJA 2Z0MA 1THGA 3G2LA 3GJ0A 4QOHA 2EKZA 4CQJA 3EXIA 4AMYA 4JYBA 1JHQA 2DOKA 3WK7A 1QCYA 4AIIA 2Z08A 4TRRA 4ALLA 3W6PA 1NLZA 2RK4A 3IIKA 1M2KA 3GRPA 3NU1A 3UTDA 2G0TA 1QJ4A 1HNNA 4HGRA 3BEOA 4M4SA 4WAUA 3UQYS 3V1YA 1E63A 4Y6QA 4AZ3A 1V5IA 2H29A 2PZEA 2Z58A 1EUQA 2A9RA 1YZUA 2XWBF 3X43A 2YS7A 4WUTA 4XX1A 4NCKA 1F2UA 5DI3B 1PNVA 1L2TA 2Q6VA 3COWA 4KMSA 3UC9A 5KUTA 2H7CA 3ICWA 3OQNA 4ZDIA 2OHJA 4BNJA 1UH5A 2ZJBA 4CWAA 5JSFA 1WY5A 3IJPA 2Z6UA 3DC2A 1J23A 1J2UA 2QNRA 1QK3A 2ODAA 5EMHA 2V6IA 3OPYI 3STVA 1T3SA 3JS5A 3QFHA 1UM8A 4PGAA 4XVQA 5JFTA 3GDWA 1PK9A 2VK2A 1P8AA 1BN7A 2BDEA 4JP2A 1U9CA 4NHEA 2FRXA 3U1VA 5JMTA 4JMPA 3H2ZA 2YY7A 5DSZA 3TOCA 3OE7A 1GOTA 4JL5A 1G3IA 1PV4A 4QULA 3I6QA 4CODB 4BQNA 1TGYA 4MK4A 3ER8A 2GT1A 2SKDA 3D7KA 1G55A 3FWPA 4O2BF 1HYHA 1E9RA 3ILYA 2BF4A 3MWLA 1PL7A 1THZA 4KAAA 4U6QA 5DM2A 3L8FA 3TJZA 3WNVA 4DDHA 4MRPA 1GAXA 4G1CA 1JKJA 4CG2A 4H0FA 3ZU2A 4IPTA 2BONA 3EC1A 3HEBA 1QGYA 1YB5A 2B1JA 2PSSA 3PRYA 5D01A 3TOSA 4R8SA 2Y1GA 2NXNA 1MEEA 2Z95A 2QY6A 3R3YA 2ZYSA 4J7CA 1ESCA 4IICA 3WYAA 4MSUA 1TIBA 4BCDA 1GAEO 1JG7A 1RRPA 3NOXA 4J7AA 3FYSA 2A0WA 3CG0A 3FVVA 4JLUA 4YS6A 5K0BA 2AN1A 3NBUA 1JFFA 3VKFA 3G0IA 5IH3A 1UBGA 3SWWA 2I2DA 3D8NA 4PS1A 3PT9A 3RYCB 2WZCA 1Q20A 2NVUA 1WSBA 3P9RA 1E5TA 4C7OB 4D4KA 3HCBA 3AL3A 3FA2A 4BNLA 4JBHA 2AXEA 1NVUQ 2OZEA 4QBKA 2I2FA 5EE5B 3C5WP 3S1LA 3QKSA 3RPEA 1MAHA 2YKGA 1YQEA 1O96B 4WUVA 4DUGD 4ND2A 1W5SA 3SYTA 2RHGB 2O1SA 4LJLA 4ONEA 1WSDA 3SMVA 1E8MA 3ADKA 2F43A 2HU8A 3Q5DA 5AUPB 3R9XA 5BYKA 4DEVA 2QTGA 3HC7A 3LHFA 1MH1A 3GRKA 3ISTA 2NUAB 1ORWA 4TVKA 4F9FA 3HO6A 2AQKA 4WERA 4ZYXA 1WBBA 4M6WA 1T9KA 3SSNA 3BXOA 4Y0VA 1E0SA 2ZDHA 1GLVA 1OX4B 3PF9A 2J4FA 4CNQA 1J7KA 2IXDA 2G5PA 4MB2A 1FYXA 5I9NA 2DFPA 1FFXB 4C4AA 1DEAA 3RFFA 2AW3A 1M6HA 3JVIA 2P8JA 5BR7A 3G23A 4M9QA 5A7GA 4ENUA 2WWFA 2X2PA 3DUWA 4HUQB 1HE4A 1SD1A 3G85A 1JDZA 1H9AA 2E4AA 4MS1A 2DPLA 1YS4A 2OZKA 4JEIA 1K08A 5DDIP 1J5PA 4CT5A 5BSWA 1AKUA 4C2UA 4RVHA 4XVHA 1KAMA 2D5CA 4C6SA 4BRWA 5EJ4A 3MSCA 3KR9A 4JU9A 4RL4A 3ZQJA 3ICPA 4RELA 4G5FA 5CVUA 4R8KA 5IC5A 5E9WA 2R11A 4QNNA 3CXRA 3LTNC 4J7XA 1LLFA 4MAFA 1A9ZA 1WKCA 3OEHA 5ADWA 4IGFA 3I09A 5KNDD 3H5VA 4HQKA 3OOHA 5GGXA 1DBSA 2QTHA 4WNYA 5IAOA 3LYHA 3PEYA 1U3UA 4RIEA 2XMZA 4HVCA 5J43A 2LRHA 4JNCA 3RYTC 2WW8A 3UW3A 3BGSA 1VYTA 5G1PA 2Q3LA 5J2TF 4LYGA 2GPBA 2JZCA 1MMFB 5EUQB 5EJMA 3W4IA 4TXMA 4URVR 3RROA 2PYDA 4JWKA 4JCCA 1Q7TA 2Z57A 2QGFA 1AY0A 2PX0A 4OREX 1N0WA 1WDWB 4DNPA 1N5IA 4OI1A 5J5AA 4ABTA 1XO1A 4LNHA 1FS6A 1STOA 1WCXA 4I5GA 4EVIA 1MOZA 5HE8A 5JRZA 3UQZA 1JL3A 1CY8A 4A9AA 3WGHA 5CNIA 4C7KA 2HMTA 3FPEA 1E2HA 1AV6A 3B3JA 1Q50A 1G5RA 2JCYA 1J5XA 1W0JA 2VF4X 1YR9A 2POCA 4OBWA 1ZAYA 1VL8A 4EH1A 3HGMA 1PFGA 5EP1A 4KITB 5M2QA 3TG2A 1YR2A 2J0UB 2VDRB 1Z8DA 2WSSA 3MLEA 2OR3A 2NXCA 3D4BA 2QRZA 2XNKA 1ECGA 3S2EA 3TQQA 4UHFA 5K6AA 2YZ7A 4PW0A 3LCVB 2DH5A 2ZB8A 3LW7A 2CCGA 1K8ZB 2AJTA 3ECCA 2LCIA 3ZBUA 2IWHA 1OGJA 2WEKA 1EDOA 5A4DA 4MP8A 5DO9A 1SGWA 1VE6A 3EN0A 3HKEA 4NV3A 3PNPA 1A96A 4NYIR 4BBZA 2W8BA 3BIWA 5EPUA 4BWGA 3KZVA 3TMKA 5TQ2B 4DMLA 1BMFA 1PTJC 1SHLA 1V4VA 1Y7LA 2GLUA 3D8TA 5A1JA 1W581 2JKVA 3FPJA 3TR6A 1XA4A 1JEQA 4JLPA 2J85A 1X1AA 2XA2A 4GOMD 1RM3A 2O05A 4JWTA 4JH0A 3HFJA 5CVTA 2AR0A 3IP9A 4TLCA 1E3TA 4B81A 3A2NA 2O19A 3B8EA 4RLHA 4C01A 2WWVD 4ZOAA 3CSUA 1G5FA 3E2PA 3QW4B 2L0XA 4NJEA 3FOBA 1XHFA 4Z9AA 2F62A 4D26A 5EFZA 3VYWA 2JD0A 1YVUA 2BGJA 3NHZA 5LOVB 4HAZA 4R0VA 2UXDB 3BZUA 4UBOA 1AGNA 2JEZA 4G5OA 3N7TA 2DBQA 1T0PA 4ATNA 5DCWA 2FZGA 1Z4PX 1JUDA 1GKYA 2Z04A 1ADYA 4DNFA 2HSJA 2IXFA 5GIOE 2P3QA 5K0LA 1XROA 3RK4A 1LI4A 3VKGA 1KO7A 3I30X 2ACVA 4AB1A 2IYPA 1JQAA 3S2SA 3TFWA 5LMZA 1SXGA 1V8DA 4S3MA 1ZMBA 3IUEA 1P2BA 4B73A 2AA3A 3GRYA 1WXGA 3K5HA 4QJBA 4LDZA 5J4LA 3F5FA 1U11A 3VPFA 3W8NA 4QRHA 4CEHA 1N5DA 4AROA 4F0JA 1K8YB 4HXYA 4I8IA 5FQNA 2X3UA 1YWGO 4BEVA 4DA6A 1E60A 1NNEA 1QQ5A 1I2AA 2BFWA 2NYRA 5L9AA 1IN5A 3BIOA 2GZSA 2D2IA 1C7FA 4GE0A 4U3JB 4CKWB 1ZK2A 16PKA 4LC0A 2HC9A 3WBJA 3HXLA 3TLKA 4MEJA 4DARA 8OHMA 3QTTA 3OCCA 5CH5A 4EX6A 1XU4A 4E11A 5CCBA 1IY1A 3KHKA 2OPHA 4J07A 2ZJ5A 3ZWQA 3RREA 1U5CA 4IBOA 2REOA 5BV7A 2RCYA 2ZSJA 5EE1A 4OQEA 4GWGA 1DRWA 2NYAA 2XODA 3CB4A 2O23A 3WRWA 2C2BA 5DX1A 1A9QA 3RAJA 1L4FA 4QXMA 4KO3S 4YONB 2C4NA 2JCGA 5THXA 3RKRA 4LYYA 3OPNA 4BGIA 2BRUC 4JN6B 4B3MB 4GDFA 3V2GA 4Z49A 1YFLA 1CEEA 4LY0A 2JCBA 4BP8A 1UEJA 1ZMTA 3FGZA 1UIMA 1O6ZA 2FF7A 3CPEA 3RU2A 3ULKA 4JHXA 2W11A 1QX3A 1H69A 4W9RA 1LKZA 4XPIA 4CVNA 1CS4C 3O8DA 2X1MA 4PYNA 3BCUA 4KQKA 1L3CA 3ZE6A 2CFTA 2FHPA 2PV7A 2Z43A 1KYTA 2FMUA 4MYCA 2DUMA 3HYLA 1KMHB 4GR5A 2CNWA 3BRWA 5KYKA 1K06A 5H02A 3GDGA 1HT0A 5FYDA 2IIBA 2MT9A 4CJXA 1XRQA 5BXYA 3KQNA 4IEIA 4N41A 4MVJD 3FOZA 1KZ6A 4MW6A 3RFVA 2I91A 3NP7A 1D2MA 1M6WA 4K46A 2PMWB 3KXIA 2P2YA 4MPRA 3MWKA 3RC1A 3SI7A 4OYHA 1SXJE 4AYTA 1KP9A 5A6VA 1E9DA 1IJFA 2WOJA 5KTNA 2GPAA 4G1VA 2HHLA 3L40A 3V97A 3OMWA 3ZD8A 1JHYA 3JD0A 2QLNA 1DTWB 1IWOA 4I9GA 4IFIA 5DTEA 9LDBA 2ZUEA 3VUEA 4OP2A 2QM3A 2JGDB 1CUCA 2P67A 3G88A 3NM4A 1RTTA 2HWKA 5D3MB 5J1SB 3VNVA 1GSAA 1XHLA 1PR4A 3U60B 1TA0A 1QGED 3G82C 4LFAB 4QOJA 4HLDA 2P2SA 3PHJA 4GXTA 4ZU6X 2BCGY 1PQUA 4RJJA 2R6DA 5DW0A 3RSLA 3VKVA 1P6UA 1E9EA 1YDWA 5JARA 4UUQA 2NU9A 2J8ZA 3JQ8B 4RVGA 2G1KA 5AJVB 3ZJTA 1FTSA 3LRXA 3KVRA 3V1MA 4E1BA 1MTZA 3HRHA 2XB6A 3C4QA 1M33A 3L7LA 3OO0A 1S7GA 1KKLA 3NYQA 2VQFB 1DMRA 2XMGA 3OP4A 1WXIA 3C5EA 4HDMA 1JQEA 4RJ2A 5BSKA 2YHAA 3S2GA 2DB3A 5F77A 4QXQA 2ECQA 1XZFA 4HG2A 3EWSA 4EQ6B 3IDZA 1ZC3A 4A8PA 2Q3MA 1SXHA 5BUZA 2ZR8A 3K0FB 1XQYA 4LKRA 4J0FA 3IB6A 2BBSA 1RHJA 1ETHA 1N8SA 2QLBA 3EXEA 1SWWA 3CLVA 3UFBA 4EPVA 3CX4A 5K4GA 1LSUA 1NE2A 3CVUA 5C8YB 2BM1A 3OEED 1X7YB 3QE2A 4TYMA 5B1EA 4DPLA 1CZOA 4X20B 5AICA 3P0RA 4BMNA 4AP5A 4EYEA 4DR2B 1OXTA 3A8TA 4WBNB 1E2GA 1H3NA 1TZ2A 2J0VA 2X9NA 3LUFA 3QEMA 5DHUA 2X86A 3ETCA 2QRNA 1I1HA 3CEPB 1RYEA 3IBSA 2AI2A 2F17A 2V96A 1VCOA 3LC7O 4FDAA 2I0FA 1ARZA 4RUKA 3SC3A 3CB2A 2H5LA 1Z5NA 4QGGA 3U3JA 1TZJA 1BDMA 3MBOA 4XEHA 5AJHA 2F64A 1N75A 3NDIA 4IRMA 3AR5A 1RDFA 4RKWA 3S1SA 2FKNA 2QUKA 3LLSA 1EFDN 2BHTA 2ZYTX 1P2SA 5IDYA 3KKEA 1XZGA 5J2UA 5JJKA 2WHXA 4FFPA 4OOEA 2XKKA 1K3UB 1BE8A 3UH1A 1AUPA 3L7KA 2EKPA 3EAGA 4ON9A 4ZQGA 5CFZA 5LU8A 1JR3D 1HT2E 1F06A 3W5CA 1GNQA 3O26A 4NZYA 2VRWA 2GCOB 2TRSB 4AJLA 1Z6ZA 1RXUA 3FVWA 2I76A 4M1KA 4CU5A 4XYGA 1W94A 4EGQA 4FX2A 3OBBA 4PQEA 4F72A 4DDUA 4AKGA 2AEFA 1L5NA 1P29A 1GSIA 2B1QA 3BH0A 3RUEA 1VMAA 3NORA 3QY0A 4UXIA 4Y2XA 4F6LA 5IT5A 1OV4A 1NY5A 1R00A 2J7KA 5H68A 5C5DA 3GFVA 2CJWA 2WAXA 1XNGA 3EGCA 4YCSA 4YV7A 1XRMA 1U5BA 4LHEA 4QLAA 1BX1A 3LKVA 4OQDA 1WKBA 1ORDA 4J2HA 2KHZA 1EFLA 4BIIA 3STHA 3RS3A 2XTZA 5I47A 2P4EA 3OAAA 4PFQA 5FFFA 3W2GA 1V9SA 3AESB 2GAFA 3GRFA 3IVAA 4MV7A 4URUR 1G4UR 4KXUA 4AG6A 3R3HA 3UJ7A 4C1NA 5H7XA 1DUIA 4BEBA 3HQ4O 1YR7A 3AGPA 1S2MA 3QPAA 1IQ0A 2VJAA 5EJ7A 4PFKA 2DHDA 2KW5A 2XTAA 2PPVA 3WRYA 1QU3A 2I3AA 2EWMA 2GN1A 1D7AA 4F3KA 3ESBA 1DQNA 2HOQA 1FRZA 1TF5A 2EQ5A 2D1SA 1JALA 1EK5A 4HZGA 5HFJA 2OCGA 3N5CA 2ECOA 1VB3A 4TQAA 5K0GA 1ZG3A 5EIBD 1G5HA 2ZRPA 4DREA 1IOLA 1CUSA 2OWEA 4PC3A 4Q5IA 5E1MA 3IT2A 4ZAFA 1L7VC 2C5HA 4MS3A 4D9EA 3WFIA 5KPJA 1NTRA 1ST2A 3L7NA 4OU5A 5FLYA 4PTZA 4GLFA 5CIYA 5B3AA 3STXA 2R85A 2H2IA 3AUAA 4FOPA 5F7JA 1H2RS 3UYLA 4JXXA 3ETJA 4ZYZA 2GH1A 4TGLA 2X5OA 4C0KA 1ZU4A 5JSKA 4UMVA 2DERA 1OFGA 1IWPB 3AF1A 5CFNA 2V54A 1NUQA 2WJ4A 1Q12A 4KXWA 5KKAA 3KVNA 1H93A 4FLMA 3W1WA 3SJUA 5BRAA 4L5CA 1B0AA 2ZT5A 5KNBD 4L73A 2GUWA 2C4WA 2I7TA 3PA8A 4RDHA 4RK6A 3U7RA 5FLKA 1YMQA 4DNQA 4OHYA 2ZAOA 4AJJA 1T9ZA 1QC5B 2R66A 3A9RA 4UHHA 3EVAA 1GTVA 2X8WA 1QUEA 2YMPA 3LHIA 1QGUB 1YK1A 3EARA 3STTA 4IZ6A 4M53A 3INRA 3LMKA 4MUIA 1ECPA 5FNVA 5CD9A 1T8TA 4NDNE 1NW7A 1DAEA 2YWBA 5JCZA 1HMYA 2F1HA 5HJEA 3CT4A 4AZ3B 1BAPA 1O97D 3BREA 5IHPA 4RESA 5B1DA 4NXMB 3AJDA 2XYRA 2I9PA 3U4QB 4EABA 1KIAA 1PD1A 1U1CA 2Z3VA 1HFEL 1NMYA 2XYGA 3NC0C 4OK5A 4RYLA 4WNIA 3UM9A 1PG2A 3JWEA 5B7QA 2J3MA 3P0IA 2P7HA 5JNLA 1P60A 1V2HE 2A5FA 1ZM2A 2BEWA 3BSWA 3SJ7A 4XI9A 3U7QB 5A4MS 2BMWA 1R64A 3ZU4A 1E9CA 3EHDA 1II9A 4EVSA 4C6TB 4IW3B 5CMLA 4EGAA 4MIEA 4L75A 5KNCA 2ACWA 1GDTA 5J4KA 3CPJB 3CY6A 1CE8B 4HB2A 2FPIA 3KV1A 3DXYA 4A5OA 3NHJA 4I50A 4CV1A 1EWQA 4B6EA 3G5LA 2PMDA 3DP9A 4KXLA 4Y2HA 2H4WA 1XTVA 4LVCA 3UG6A 1VOTA 5LM3A 4RE5A 3OQJA 1QYXA 2NT4A 2ZTHA 1NRJB 3V7WA 3TVTA 3WLRA 1U80A 3PDWA 1NW4A 4P8RA 1XHEA 1H6CA 3I1YA 4FKZA 4HPXB 1YMUA 3U31A 1S6YA 3H2JA 1ESEA 2ZATA 5GQSA 1J06A 3W5HA 5B4UA 2FF5A 3VAAA 1GZ5A 3JALB 5JNWA 3I76A 3EY4A 5CNMA 2GCIA 1N9GA 4YUZA 4AUNA 5CB4A 1FF9A 2A0FA 5EJ8A 5I51A 1R4ZA 2Y99A 3QYFA 1DOZA 5G0UA 3TBFA 1B23P 1YR8A 2BF7A 4KIWA 1HT1E 2B61A 3CUEF 3C3KA 1O97C 3DKIA 4WZAB 1J49A 4E09A 5KTTA 4PG6A 1F8UA 1KYIA 1OJLA 3ZG6A 1W30A 4NNOA 3KYJB 4M88A 3I1IA 4W5NA 2AS0A 3QUAA 3CUSA 2CDBA 3LUHA 4UNNA 2V03A 3HBJA 4MWCA 5E8RA 2FMIA 1T4MA 2QUJA 3AVQA 4A6XA 4KE9A 4N12A 4KREA 2WYWA 1DCTA 2TMGA 4N5MA 3LQ2A 4G4IA 4JVOA 4JI6B 4BFLA 1MRZA 2CL5A 2I6FA 4QDOA 3GQBB 1ZDMA 2CNOA 3E6AA 3K05A 2JEOA 4ZVPA 3VH4A 2DEUA 4K9KA 3A4IA 4K9RA 2ODEA 2V4ZA 3HA5A 3CMCO 2L42A 2YV4A 1JKFA 5D3KA 5EWLB 4F9GA 2WJWA 1XQVA 3QXJA 4NG4A 1Y82A 5H4HA 2YXEA 1YI8A 4CMEA 4JBGA 4TWBA 1F8XA 1V1RA 3AY6A 1KEKA 1OX4A 1UBJS 3GT7A 4J16C 5DHPA 1RPAA 2OV8A 3G2NA 4LF8B 2IU3A 4YCJA 3FKSD 1SH7A 3WTBA 5JW6A 2NZ8A 2ZBEA 3C15C 1YACA 3W04A 4CCAA 3A3PA 2PYZA 1ENZA 4UNSA 2GCPA 2IZ0A 4YQYA 3NT5A 4ZQBA 1YQUA 3D6HA 3FLAA 3TW8B 3EG9B 3H1FA 3X2EA 2FQWA 1L5KA 4F93B 3E8MA 3S8YA 3D4IA 4KBFA 3JY6A 2D74A 3F0TA 3I2FA 3KKLA 3KPWA 4DUPA 5B1IA 1WVMA 1G16A 1K8XB 2I33A 1R8JA 4A8HA 4HO1X 4UPDA 4H17A 4B46A 1NR7A 1W4ZA 2W4IA 4WW0A 5KVQA 2OM6A 5HTKA 4YX9A 3BK7A 1P4SA 2NUTA 2PK3A 1ULAA 3TLEA 5BUQA 3ZHBA 3LGAA 1HUQA 2VPTA 1F1JA 2HUNA 3AERB 3AEQB 1B76A 2O8FA 1J9EA 3IHWA 3AJAA 4HWRA 2Q5IA 3M81A 3RYIA 3GPLA 2CCKA 2VBIA 3L8ZA 4PN3A 2RHWA 4KUHA 4UW9A 1N9ZA 5T64A 3T1VA 1HEYA 3E0XA 3AEXA 4YAFA 4A5SA 4B44A 3ZEIA 2HSZA 1FLNA 1G66A 1NUHA 4U8HA 5KJEA 3F73A 1OFHA 1SFRA 5J47A 1TKRA 4Q1DA 5E4YA 4GBMA 2PUFA 2IZ7A 1REQB 3BPSA 4OHFA 1MDBA 4HHEA 3O38A 3PE4A 3WDLA 4GRDA 4MR8B 1QVZA 2P68A 1Y7IA 4BZWA 2Y8EA 4PC7A 4U7JA 4YDSA 1NUTA 3FFBA 2B8TA 4F3NA 1R0WA 2FFAA 3ANXA 5JZSA 1BCSA 4BFTA 3DVQX 1DG1G 1UBSB 4R1QA 4RA9B 2GPSA 2X8LA 2JGDA 3B85A 1BRTA 3G3EA 4KR6A 2XR1A 1IYZA 3WP0A 3X2FA 1J0EA 4UAGA 2WIBA 5I7OA 1PS9A 2FFRA 2E6UX 4NLLA 4WXPA 3C6YA 4PWZA 4AX8A 3SXJA 3EXFB 4DV1B 2F3SA 1DKLA 4B85A 1PJ3A 4K6OA 4BPBA 1P19A 1QYRA 2H6EA 5C35A 1YQXA 1QP8A 4DMGA 2C92A 1G60A 3K1JA 5DNDA 4EY7A 5JC8A 1GY8A 4EGFA 2NU9B 1QLHA 1ECLA 3DPSA 3BD6A 2C8KA 4C7BA 4L3WA 5CT6A 1AF4A 3ZLTA 4XIFA 5AW3A 5HKBA 4PSUA 3H1AA 4AJEA 1V16B 3WKBA 3TL2A 4DCOA 1OLUA 4KX5A 4YV2A 2VN8A 4X63A 1K1EA 3GT0A 4LNUB 2H0QA 4S1PA 1NRIA 4QUKA 3V8NA 3ML1A 2ZI3A 3MXOA 3K0FA 1XCOA 1K7FB 4CTKA 1JG4A 2QF7A 4R1TA 2E2WA 4R9VA 4LXTA 3S2ZA 3I6IA 3RBZA 4FOLA 3Q0TA 1E1CB 4HJRA 5C8YA 1DIOB 3MSXA 4OI2A 4F4DA 3QVLA 3TQSA 2W00A 4EEXA 1AIPA 4B4UA 2LDBA 1LH0A 1VQ1A 4L95C 2EBFX 1N57A 4I9FA 4EHDA 2JHFA 4RS4A 3IDQA 4LXXA 1A9RA 3U3OA 1EWVA 4DS3A 2WDZA 1Z5WA 5IC6A 3WIVA 1MA3A 2RHJA 3BERA 3OEWA 2VDNB 4AM8A 1F0KA 3EOAI 2CHFA 3P9YA 1TT5A 5JR3A 3WWEA 3RVLA 2G06A 1GGJA 4KJZA 1QWSA 1KI6B 2VF5X 3G5UA 3X1ZA 3TI7A 5K6TA 3L0SA 4ACAA 2FW9A 1I6WA 2RHOA 3EGWA 3NG1A 1A9YA 1LWNA 3UWKA 3ECAA 4UEQA 4BBPA 1G6HA 2DKNA 4NEQA 3S8MA 3UWOA 4N3GA 4G41A 2CLEB 4O4IB 2F3RA 1ZIXA 3AOEA 3H2YA 2HHCA 2IPLA 3VZQA 4BQFA 4NHOA 1U7XA 1NZJA 3SK0A 5KYGA 4BO1A 1TPYA 1YQGA 1OGYA 2ECKA 4CXMA 2O0MA 5I48A 4EYSA 1S1MA 2IYZA 1GPBA 1VI6A 2ZIZA 3IP6A 3RYFB 2F1JA 4YI5A 1BVUA 4RPIA 3TNDA 3AIOA 3WLJA 5F3DA 1M2HA 2QXYA 3Q15C 1RMYA 1B6GA 1KQPA 1L5QA 2FPOA 2NYVA 1IUNA 1S5PA 2X4LA 4AQ7A 4ZDJA 3TX6A 1XCPA 3KHSA 3KRTA 3WIUA 5A5EA 2C2KA 2QMZA 3ACDA 3IERA 4K81B 4QLOA 1NURA 4R8MA 2P75A 2P35A 4GKBA 4DM4A 5HIKA 1BHQ1 4HLQB 1Y7TA 1I30A 3USZA 5REQB 1W9HA 3V9AA 1GTG1 1KI7A 3PQCA 2I3GA 3CONA 3E81A 1NPYA 4UEWA 4UFNA 2QUZA 5DOZA 2VXOA 1F2TB 1ZM7A 4BKPA 4H6XA 1V96A 3WGNA 1UPTA 3G8BA 5T6MA 4G0YA 3UICA 1Z2CA 5JSHA 3VNUA 4ZDWA 3VJMA 4KV9A 4L4XA 1Z22A 2HMWA 2IT1A 3A2MA 3D6TB 2WZQA 3EGXB 3PD1A 3BGWA 3H4IA 4HRXA 1W48A 2BEUA 2WVHA 5LIRA 1IUKA 2WVAA 1M34E 3SF0A 4BUCA 1Y4DE 4X8LA 4E4TA 3HZRA 4BFUA 1SC6A 2Q4BA 3ILXA 2YHUA 3INYA 3LI2A 4MCAA 3WRVA 4UXHA 3TN7A 1LK0A 3MINA 1FSFA 3L7JA 3ZY6A 1ZK1A 4LYDA 5ECGC 1LNZA 3PVSA 1XN1A 4EUEA 3FZGA 2KMLA 3OLQA 5DYIA 2A9JA 1DIRA 4LYFA 4RHFA 2GCNA 2WJGA 1HEUA 1L7EA 3HBAA 1RP1A 2BFDB 5COBA 5FFMA 4MICA 2GRJA 2HDHA 3U40A 1Y1LA 3OLCX 1WDLA 5AJTA 4TKMA 1LGYA 5LBTA 3KYDB 2C3MA 2JK0A 2HDOA 4E5VA 5K4HA 4DDVA 1MJFA 2MJLA 2Y1KA 2JC3A 3O3CA 5BV8A 4NV1A 5DGCA 1WPQA 2P2LA 3DOOA 3IAM6 4K6GA 3DGFC 3KVVA 4FKBA 4UBNA 3RC8A 5JASA 3UMVA 3OETA 3L1IA 1ENOA 3VH1A 2QVYX 2VDUE 4DYHA 1GZVA 4I9NA 5C81A 1GG9A 3JWGA 4F2HA 2BKLA 2FK8A 4KC0A 3HDQA 3GYBA 5IKOA 1P9OA 2ZS7A 3OZBA 3VR5A 1FSPA 1M2GA 2QD2A 5JADA 4D8VA 4RD3A 1CP2A 4IIJF 3MIZA 5GONA 2IDKA 4AP6A 1N2XA 5IUNC 3R0XA 4ITRC 3QI2A 3ZIUA 3EQ9A 4HYTA 4UZFA 5EXTA 3RNOA 3TZBA 5GGYA 2XZPA 1YCDA 4RVDA 2HREA 5F52A 3BZWA 3LC0A 2BJVA 1NDQA 3B6IA 4DMCA 3S1AA 1XZAA 3RK0A 3U7QA 4CF6A 3MHPA 5TJHA 3WYBA 2VG8A 5C32A 2QJWA 3LT1A 1O9HA 4M9UA 4G1EB 4X9XA 5HUQA 3CLHA 5ELLA 3TKYA 1H0HA 2ZI9A 3R5JA 3WB1A 4HNVA 1YQWA 3B60A 4FN5A 4CPDA 4OQZA 1LPOA 5EUMA 1VI2A 2IVFA 3GLFB 2IF2A 2BSQA 4NOLA 1BKDR 4C7OA 3Q3GE 3ZE7A 2QW1A 4LSMA 2BN4A 3O21A 3I5MA 3VR6H 4CL3A 2JJ8A 3KT0A 3BHIA 5EEHA 1O4VA 5SYAA 4NS4A 1SQ5A 3T7TA 3MB8A 2PUBA 1GQSA 3IHLA 3A0UA 4ECAA 3RSGA 1DX9A 1G8JA 1ML3A 4I4TF 1NBEA 5KO2A 4NKRA 1L0BA 1UXOA 2BEVB 1VECA 1EQAA 2R2GA 3MT8A 4C0BA 2FLVA 2P9GA 4KQWA 3CLTD 4RGQA 2K87A 3IJ5A 4GSKA 1E2IA 2J3EA 3DVAB 3B1WA 3HUDA 4K88A 2B7LA 4FJ0A 2PBFA 4KI0A 4PS0A 1H0KA 2JFOA 1NDHA 1DPFA 2CFRA 3O4RA 1F20A 2AYXA 4O0LA 1S9HA 4WOCA 1YAJA 3KJNA 4OFWA 3MT0A 1FMTA 3VR2D 4H7FA 4YRCA 2PAFA 1XPJA 1CR0A 1BX3A 2QYTA 1AG9A 2Q5EA 1OWPA 5J5VA 4GX2A 5AM5A 5C18A 4PNEA 4B3DA 2AC4A 3AESA 4Q4DA 1QHYA 3EZNA 4G0MA 2GTIA 4JT2A 1Y89A 4X1IB 4YVFA 3AY7A 3AR7A 4BQPA 1EP2B 3IQGX 3R5KA 3QVGA 2I3DA 2IEBA 1VSBA 2C1ZA 2QT9A 4Q6WA 3DYBA 3ZI7A 4EW1A 4UOZA 1KTVA 2QE7A 2YHIB 1ORRA 4KQ6A 3ZZ1A 4ER6A 4ERXA 4YR9A 1HYBA 4R2MA 4XWGA 1L9XA 4YRQA 1GEGA 1SVSA 3GWGA 1E6MA 3CGGA 4Z0PA 3L01A 3OF3A 1ZJJA 2FUG1 3C4JA 4GXQA 4L15A 1X19A 3QBJA 2AX3A 2HK6A 4CM4A 2ZE8A 1SUCA 4ODIA 2AOVA 3V7FA 1W85A 4REQA 5FT9A 4D8YA 2NU8A 3PEUA 4UTNA 4JC0A 4ZK6A 1PR9A 1GNPA 1EWRA 2QRHA 3BXHA 3LP6A 1RRCA 2VSXA 3UNXA 1E98A 1PW7A 2H07A 2QTWB 2FZWA 5BRNA 4DMMA 5G1NA 1PWYE 2JGLA 2RJOA 4TMFA 2I71A 2QVXX 2R8XA 4L9AA 4OF4A 1A1VA 2O2GA 4D3FA 1TEVA 4PQYA 5DM0A 1YHZA 4D82A 2IELA 2QL5A 1G98A 2R8OA 4D8WA 1SU8A 2WJJA 2HI0A 3DKRA 3KJQA 3PFWO 4LYAA 2IOFA 2OBFA 2V7EA 1SOVA 3OM0A 3T5TA 1R8XA 4UTXA 3C7TA 1UDRA 1ZGBA 2JIPA 3KTAA 3OMLA 5F1PA 5IYZF 3SVZA 1XAHA 3UJDA 1U4OA 4BKQA 1B14A 4B3JA 4ETIA 4CKZA 3ZZNA 3F8TA 4LQLA 1OWOA 4KAJA 3OQBA 1ZL2A 5IM5A 4AX4A 4YJ2B 1KK0A 1KVSA 4M37A 4EHIA 3NH9A 5TQ2A 1Q1QA 4GOLD 1E1YA 4V1CB 2J7PA 4Q7MB 3PJDA 3VPBA 3K8YA 2G8LA 5C5EA 4NJMB 4QGAA 4OHVA 3L2OB 4JSRA 5EKDA 3T9CA 4P54A 3IQDB 3C24A 3F5SA 4Z0TA 1BJTA 5JHGB 1LCIA 5BW6B 2OV3A 3ZQKA 1V1MB 2BCJQ 2BEWB 1V4BA 9ABPA 2ZLBA 3TMYA 6ADHA 4DV7B 3GFTA 4I1IA 5LOVA 2DZDA 2ZE6A 2BMDA 4ZIRB 3EXHA 2GJ9A 5D6NA 4GX0A 1MV5A 2G80A 2ORED 2FYTA 1MGOA 1PTJA 2XNJA 2ZJ4A 1T3HA 3JYOA 3PCXA 4NE9A 1G0OA 1O95D 1OFVA 1PJBA 2YVKA 1T43A 3LRPA 3HDYA 4M8SA 4M99A 5DLYA 3EYAA 4TT8A 1JIJA 1N8NA 4KXQA 4MWZA 1C4WA 1B8NA 2A9OA 2CNNA 3ZWVA 2JK1A 4KVAA 1I3NA 1V3TA 2QP9X 5BQ3A 1E7RA 2Y71A 1D2AA 1AZTA 3EFOB 2ZRLA 3AJEA 3CC8A 5HRAA 2W9XA 2CL7X 1QCDA 4JROA 3T4EA 2JGEA 2OCLA 2AFHB 2O8VA 2JEYA 2Q1UA 2VT3A 3HVKA 4ZZ1A 1KQFA 1OH7A 1WRBA 2D3WA 3DYIA 3OE4A 2OOKA 5CHYA 4E46A 5B64A 2B25A 5CB4B 2Z1MA 1B8PA 3EZXA 1XEXB 2PKWA 1V6CA 1V9LA 2W6NA 3WGYA 4AN0A 1ZPDA 1H5UA 1YKFA 2ZK7A 4MV0A 4PLCA 2PGJA 1LEHA 4K6KA 4YA6A 5KTKA 4R9RA 4NAUA 1FL9A 3P0EA 2AF3C 2D0OB 3RT1A 1PQPA 4LCJA 2P9TA 3NDPA 1XJ0A 2LIPA 1PFUA 2A14A 4CTNA 3ELUA 4MUHA 4POOA 2I4RA 3ZVMA 3FKQA 3FTCA 2FQYA 3AUFA 1NY6A 1ZEJA 4RAQA 4RV5A 3LK7A 4K8RB 5LP1A 5GMOA 1SMKA 2QN6A 3CZ5A 3I64A 3VDRA 2D1FA 1XVLA 3TSZA 1R7RA 4RVUA 5ALEA 5ALLA 3KWFA 4G0OA 4D43A 3OP1A 5DN9A 4EY8A 5A0TA 5D5HA 5A3SA 2B69A 3O8QA 4M1MA 1OZAA 1Y3CE 1U81A 2OCYC 2I2CA 3NWOA 1J0DA 2C2HA 3LLVA 3MJCA 3F6EX 3ZGYA 2AHOA 4IUDS 1BGVA 5E38A 1K2WA 4BMCA 3IEIA 4B4VA 1NT2A 5F51A 4PYKA 2DUWA 3TQFA 1G8PA 2AC2A 3PFIA 3OX1A 3QW2A 4CT4B 2J1LA 3LQFA 3WLPA 2DFVA 3ZQUA 1UPBA 3KS9A 3EQ7A 1NG9A 1E4OA 1F7VA 4KE6A 4RX1A 1UMBB 3WR5A 4CN8A 1C5KA 1Y63A 3ITKA 2BHNA 4N40A 4LYEA 2G88A 2IY7A 2OYSA 1SBHA 1U9IC 2NXWA 1OX5A 1U3GA 1YZFA 2FPPA 2FUEA 2HFKA 2J87A 3LBNA 2FPXA 2QM0A 3NANA 4BIMA 2AMJA 5A5DA 2OQ2A 2IIQA 3IKLA 5IAEA 4IS3A 3TLJA 3WK8A 2ZUVA 2XLCA 4QOGA 3QIAA 1N2CB 1UK9A 3PXUA 1P2VA 1Q84A 4G8CA 3ZV6A 3C3PA 1SU7A 3AYZB 4XKJA 1FMJA 2WABA 2ZIUB 4ZANA 2QE6A 2HYDA 4GG1A 3ICCA 3Q3CA 4M9CA 3ZK7A 1XRJA 2AUTA 1E9VA 1UWVA 1FFWA 1QH0A 1RE1A 1T6NA 1VPLA 3EF0A 4DT1B 5BMOA 1X86B 1O89A 3M6WA 5JYEA 2WKWA 4E2FA 2XE8A 1IQPA 4DNOA 1XZ8A 3M6AA 1OYOA 1G8MA 4QPNA 3UGQA 3JASB 4C0JA 2WYUA 2J41A 4FQ5A 1G291 3DBHB 4EJFA 2GK7A 1TNDA 4M54A 5JS2A 1FP2A 2WP8J 2VIIA 1WA5A 2HGZA 1XD9A 4FD2A 4WXRA 3AHCA 2JJ2D 1EEHA 2GZ2A 1AB5A 3EDOA 4UU1A 4ZO9A 2BMEA 5B1HA 5EUCA 4OMCA 5IXJA 1RAGA 3BJZA 3QNMA 5TPWA 2FJPA 3P0HA 2BGUA 3G0GA 4Q9JA 2IV2X 2PNJA 2EX4A 1VRWA 2P91A 5KU1A 3KKQA 4C1BA 2I1WA 2XUFA 1ZHFA 2WAMA 5LNK6 3RGWS 4J1TA 2ZJ0A 4RA9A 1ZN9A 3TTSA 3WQBA 2PFKA 4UREA 3HKBB 2OE2A 1X7YA 2D7JA 4O4HA 4NMWA 4WEOA 3TEMA 1WVIA 2JGFA 2P41A 3HCDA 3NS7A 2O1WA 1X8KA 1ZEMA 2YHSA 4M22A 4WKOA 2PT5A 5MFPA 4B4KA 4GNKA 2PKQO 1YR6A 2FOLA 3MT7A 3EC7A 4RD2A 4RSMA 2VDOB 2VTVA 3QENA 4BASA 1B93A 3AQIA 4QC2A 3OFSA 1P9LA 3BRSA 1G63A 4C14A 3B70A 1JZTA 3OJLA 2QN8A 1PG5A 3I45A 2VWPA 3D2LA 3CYFA 1YJ5A 1EWKA 3C74A 3I83A 1UBUS 5U4XA 4XUEA 2ID4A 3FFWA 2DR2A 4HWPA 3DWGA 1RABA 3RUAA 1DKQA 2JHPA 1Z56C 1XGKA 3F6RA 4GGOA 5EUBA 3D2AA 2FRDC 1IB6A 5IXSA 1ZRNA 2JFBA 5EVCA 1X1BA 2UZ0A 5BWOA 2B1RA 2FSVA 3L0DA 3ZW8A 2J3IA 1PZNA 2H1WA 3Q0IA 4HGZA 3ZHOA 1T5IA 2Q3CA 5SZHB 4D96A 4PC6A 5JQGB 3UBTA 4BVGA 1W46A 4JSTA 3IVRA 3IUSA 4MVJE 3E1SA 3UB2A 5KIAA 5EZYF 5HFNA 2QTLA 3K0AA 2FSIA 1IRXA 4LSWA 3CO0S 1DQYA 2JAXA 4W8OA 4Q9IA 2E4YA 2AFIE 2C42A 4J1SA 1U7OA 4LCEA 4DZZA 3S8EA 3GMSA 5H5JA 3UV3A 5HDBB 3U2QA 4ZYUA 4OHOA 3SZMA 1B00A 5KOJB 2PUGA 2IH4A 5B4VA 1RI2A 4DBLC 5IJZA 2BKXA 3E7FA 1K4MA 1MH9A 3VYTB 2MIIA 4P4UA 1UT5A 3MMPA 3QMMA 3LIIA 2NSYA 2QLLA 3LU1A 2HLNA 2WU3A 5JXWA 1GG2A 4FTWA 3MT9A 4LNAA 4QGFA 3SYKA 3LWDA 6REQB 3FVTA 4N65A 2OXTA 2JFVA 3LHDA 5TQJA 4LY6A 4UTVA 3U17A 2PNFA 1EE2A 1KTIA 1W96A 2XUHA 4BY9E 4ZV4A 3ZIAA 4BQIA 2VRCA 3M2TA 3A6PC 2BEVA 2PZGA 2R6R1 4JEHA 5GOZA 3QVMA 1NXXA 3L3BA 4FJ2A 5DX0A 3MZ0A 3FRHA 1WTCA 1KC3A 3HJBA 2GN2A 3O8RA 4JXJA 1XB2A 3OIDA 4ARIA 4KOAA 5IU6A 2W93A 1ZNZA 1UKCA 3HCCA 2RMKA 4MYRA 3S55A 3D81A 3WIBA 4W6QA 1AH2A 1J97A 1RAAA 3LUPA 3OLXA 1J24A 4ES6A 1YIOA 2PE5A 2HJSA 1NL3A 2VSOA 3SEZA 5H16A 5JI2E 2X7XA 3MCZA 1TUBA 2OSVA 4AO8A 4L78A 4BFWA 1APBA 1HDXA 1Y3IA 1ZJYA 3COPA 3DFZA 4ENVA 3CXUA 2IEGA 5REQA 2G5CA 4QTXA 2YFHA 3CLKA 4C2TA 4IQ8A 4X1IA 3AR6A 3EISA 1TU0A 3M5CA 4RU1A 1LLCA 5KX5B 1JWAB 3ODGA 5BO5A 4O3FA 3ORYA 1N4AA 4ER7A 4FONA 1P5ZB 2W0SA 4UEKA 2ZYVX 3UUGA 1V5WA 4OHKA 2C7RA 1FDUA 3P9XA 1ZOLA 2C88A 3CLTC 5EG5A 1TK9A 2X1VA 1BQ3A 4CLDA 4B79A 2BGNA 3W05A 2RGGA 3LO5A 1EUDB 4HDNA 4BMYA 3R6GA 1VIYA 3RVNA 2O14A 1TF2A 1QPBA 3PGXA 3C6BA 1E9SA 3H2KA 1EFHA 1MHPA 3K0BA 4BXOA 1KY4A 1EB9A 1GA4A 2AFVA 3GLHA 4LGVA 2D5LA 4E13A 1Z08A 4R0MA 3P32A 2CXRA 2WTMA 1IJKA 1RC1A 2KM1A 2IYUA 4FX5A 4JNKA 4QO8A 4BLPA 5B2FA 1S2NA 2JA1A 4CI9A 4OQFA 2Z6QA 1Z7WA 4Y6RA 4NSNA 4DBZA 1DBIA 4EKEA 1AQYA 3FIJA 2WIKA 4MZXA 4BQOA 1QP0A 1IN7A 4LHXA