5BWNA

Crystal structure of sirt3 with a h3k9 peptide containing a myristoyl lysine
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
274
Chain Sequence
b'GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myristoyl H3K9 peptide
publication title Crystal structures of SIRT3 reveal that the alpha 2-alpha 3 loop and alpha 3-helix affect the interaction with long-chain acyl lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide/hydrolase
total genus 82
structure length 274
sequence length 274
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5bwnA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5bwnA01
4BV2A 1PNOA 5MGNA 1YHZA 4GM4A 3RIYA 1POWA 1ZPDA 4UTNA 2FSVC 1UPAA 4IAOA 4UTXA 3GLRA 5DGDA 2EZTA 3CF4G 1V5GA 4COKA 1NM5C 5EJ6A 1JSCA 2IHUA 3ZG6A 4GPEA 1YC2A 4C78A 5EJ9A 4UTRA 4MZXA 2VJYA 4X3PA 3IAFA 4K9LA 2PANA 4FVTA 3ZGOA 1M2NA 1V5EA 2JI6A 1EFVA 4MPRA 5DGTA 1UPCA 1PVDA 2IHVA 4JT9A 2H4HA 1EFPA 3F6EX 2Q28A 2UZ1A 4UU8A 2QQGA 4Y6LA 1PT9A 2OD2A 2Q5OA 3JWPA 2Q27A 2FWNA 2H2IA 4JU9A 5FYQA 4ZZIA 5EJ4A 4IF6A 1T9CA 1YHYA 2X7JA 2Q5QA 4C7BA 2EZUA 4V1CA 4BVEA 2A1TR 5K6TA 2PGNA 4FZ3A 1D4OA 3K35A 5DEIA 1N0HA 4BV3A 1O96B 2W93A 3ZGVA 1T9DA 1S5PA 4FEGA 1U2GC 1ICIA 3GLSA 1U28C 2OD7A 5EJ5A 4J16C 1YI0A 2BRUC 2DJIA 1OVMA 4Y6QA 4BVHA 4JUBA 1BFDA 5EJMA 4HD8A 2A1UA 4RJKA 3FSJX 2AG1A 3U31A 5K3SA 5BWLA 2C31A 5MFZA 2Q5JA 1PI3A 3EA4A 4I5IA 4L2IA 1OZGA 2JIBA 4G1CA 1YC5A 5D7NA 4JSRA 2VK1A 1OZFA 1PO7A 4K9KA 1J8FA 1PYDA 1MCZA 4JUFA 4Q9DA 4KPUA 4JT8A 4GP9A 3F6BX 4K9MA 4GG1A 1Z8NA 1E3TA 2H2FA 3D81A 1QPBA 2QQFA 4Y6OA 4FEEA 2H2HA 3CLUD 3CLTD 3IAEA 2OO5C 1U2DC 4IG9A 1PTJC 4BVBA 1PNQA 5AHKA 3PDHA 5BWOA 1Q6ZA 2B4YA 4F4UA 4MQ5A 2H4JA 2VBIA 2H2GA 2V3WA 3PKJA 5IMSA 4GM1A 2NYRA 4UU7A 2UZ1B 1Q14A 4KXQA 1POXA 3LQ1A 4J1TC 4UUBA 2FR8C 1Q17A 4K9QA 5MFPA 5K2OA 1U31A 1T9AA 5FEMA 3GLUA 4RMJA 4D5EA 2EZ8A 5EJ7A 1V5FA 4MPJA 1HZZC 4RJIA 2EZ4A 2NXWA 2FRDC 2JI7A 3EYAA 4UTVA 4TWIA 2OD9A 3HWX1 3PKIA 3D7KA 2VBGA 4V1CB 1O97D 2JLCA 1YTLA 1YBHA 4HDAA 2JI9A 4QELA 4JU8A 4K9PA 2FN3A 4K9OA 1SZCA 5K6RA 1Y9DA 2H2DA 4RMIA 3OE1A 3JR3A 4BN5A 2IHTA 2OORC 2Q5LA 3RIGA 2AG0A 4UUAA 5EJ8A 3CLRD 4JUCA 4MPPA 1YI1A 4RMHA 1M2HA 2H59A 3D4BA 2VK4A 2WVHA 3E9YA 4QQ8A 2JLAA 4JD5A 4L3OA 4BN4A 4ZP1A 4RMGA 2Q29A 5BWNA 4JUAA 2VK8A 1YNOA 4BUZA 3U3DA 4F56A 1SZDA 5MF6A 1MA3A 1OZHA 2PGOA 4KGDA 2H4FA 2JI8A 1S7GA 4BVFA 4K9NA 2WVAA 4R8MA 4O8ZA 2EZ9A 1XLTC 1M2KA 1T9BA 3GLTA 4D5GA 3EY9A 4QPZA 5EJAA 3FZNA 4RJJA 2WVGA 4X3OA 1M2JA 1Q1AA 1UPBA 4JUDX 1M2GA 4UTZA 4V1CI 3CLSD 4BVGA 2VBFA 3HWWA 3FLMA 4GM0A 1DJLA 2HJHA 4TWJA
chains in the Genus database with same CATH superfamily
2PK3A 3N9IA 3Q7RA 1RYDA 4UHBA 2B4RO 3DW3X 4U2DA 3Q88A 5B7PA 1IVNA 5B5SA 3QPBA 2XUZA 1K8ZB 5ALPA 1P33A 1J8MF 3ZDEA 2FNAA 1PTKA 4QG7A 1CUBA 2GAAA 2PX6A 5ES4B 2DQZA 1P2UA 2XB6A 1T1SA 1CUUA 1I3LA 1WPXA 2CZCA 3LW8A 1JQBA 2ZANA 3HWRA 1FDVA 1TPZA 1N0VC 2PVCA 3B6EA 3HZHA 3I28A 3JQ9A 3MQ2A 2YOGA 3OH8A 3DAHA 4IFBA 1AS0A 3CF4G 4OXYA 1GZSA 2D8MA 1SHUX 1O3YA 1GL6A 2H7XA 1FFAA 1GCOA 3LFUA 3PXBA 2QMOA 4NEGA 1J97A 4O4JB 4ER6A 1P9RA 3WQQA 4MARA 5BXYA 2MCFA 2KX7A 1JE1A 1Z0AA 2VPQA 2LUOA 3IKTA 4ILKA 3G88A 5FOVA 4EH1A 1W4RA 5EUBA 2WKPA 3D2CA 3VAYA 3DQZA 3H5LA 4ALMA 1M1ZA 3K1TA 4GYKA 2BSAA 1E7SA 3BRSA 1WNTA 3FTDA 3E18A 3Q1LA 4NVRA 4TT8A 2G7ZA 4XM2A 5ITWA 3D4NA 4CMIA 2P2SA 3FNQA 1KERA 4OHKA 1PJSA 2YC2C 1NUPA 1SU6A 3P0JA 4M36A 4ND5A 3FJYA 3ZWQA 2PGJA 2VH1A 5J2TA 3CO5A 2ONZA 4GZ5A 1SUAA 2JLSA 4ZIRB 2FP4A 5JOQA 3IP6A 3TX6A 3OA0A 3L4KA 4L28A 1BXZA 4AUEA 5FKJA 3AU9A 3HS3A 1PTJA 3I4CA 3K9QO 3QUSA 4AN1A 1Q7GA 5JD4A 5GM1A 4FKMA 4QRDA 3G82C 4CF6A 4G23A 1FNNA 2X5KO 2I29A 1ENOA 1HE2A 3L1KA 2FUG6 3DXZA 3PFKA 4UEWA 5HKLA 5FJIA 3RSCA 4DHEA 1RBQA 5JSYA 5ICFA 3FM9A 4EJSC 3DWEX 2CXNA 2D74A 2AJBA 3R5XA 3UH0A 4Z4EA 3BF7A 3U48A 5A5FA 2PM8A 3E3LA 4WNAB 5GV8A 3O2QB 2ZVQX 2DPGA 2Q5FA 4X6YA 2H2IA 4PG8A 1T8YA 3VC2A 1A2QA 4G0PA 2HA0A 1O94C 2H7YA 3EAFA 3G9QA 3HJCA 3PHIA 4M9RA 4UARA 3C3MA 4YRLA 2HU5A 4H1VA 1RI4A 4BB9A 1RXIA 1KMNA 1UF9A 3JQEA 3K9CA 3CRMA 1STOA 1JQJC 3NRCA 5LLDA 1QIHA 4CIYA 4NI5A 2D54A 2O5VA 5A0TA 4FP9A 3FJ1A 4J94A 3F78A 1JFLA 3HEBA 5I7WA 1DDIA 5HPYB 4OXKA 2ONJA 2VYCA 3RI3A 3BWXA 3T94A 2FUCA 4BEBA 2WW8A 3OUTA 2V7BA 4CTJA 4W1RA 3EXIB 2PL9A 2FWPA 3ORHA 4WASA 3O95A 1PL7A 2Q3FA 5JXJA 1AT1A 3JVIA 2VDKB 1DJNA 4IIXA 5LDGA 5A3SA 4N47A 3FBWA 5AW8A 5JVDF 1WXGA 5H59A 3AR9A 1Q6YA 3ETCA 1R27A 4E4RA 3AR8A 1BVRA 3C0KA 4F5ZA 1ZI6A 5MGBA 1X3LA 2IPMA 3NM4A 4FQ7A 3KBOA 4CMGA 1IPEA 1YR6A 5K9ZA 2C7PA 2CK3D 2XMQA 4IOKA 3RYTC 3HXPA 5K4AA 4XVHA 1DAOA 3I73A 4CLOA 1BFUA 1KPIA 3WQHA 3E70C 4R0NA 1QH1B 1Z7GA 2E18A 4D45A 5TSDA 4CTOA 5J2UF 1AURA 1BD3A 4LOHA 3MYRA 4ERNA 1I24A 2YVAA 1IM2A 3QLTA 2JARA 4XXHA 5CLFA 2VT7A 1DAGA 2CK3A 2JDID 4N9WA 3TPZA 2EFEB 2H6EA 3CPJB 3I1IA 3NIWA 4XPIB 2EQBA 1IJBA 1BXRA 3CZPA 2Q62A 3LDUA 3NR2A 4GNKA 3T5CA 1MJGM 2AC7A 1XNRB 4KQWA 4MUKA 3RDPA 1IU9A 3LT2A 4X61A 5F3DA 5FORA 5JYCA 1VKZA 1NBWB 1E5VA 2R7LA 3DTVB 4P84A 2JDIA 4WCVA 3NWJA 1C4WA 3TBKA 2F3QA 2GDJA 5IEBA 4EVRA 1PWZA 3EBLA 3UWSA 1P7YA 4X1IB 5KU1A 2AE2A 3A3OA 3H9UA 4PICA 1O5IA 3W5CA 1NOIA 2XGMA 4BB0A 3C3YA 3HFGA 3ZD7A 2QZPA 1EH5A 3NHLA 2FA9A 2C31A 1FW6A 1NM5A 1W2GA 2OG2A 3VPSA 5C1PA 2XWQA 3NYIA 3AHJA 3OZSA 5CPBA 5LQUA 1WD7A 1LK5A 3TE7A 2ROQA 4XLLA 3TZCA 2CBXA 3SZUA 2G25A 3EQ7A 5C3UA 3X2SA 5K0LA 2ZDHA 2YV3A 1OZAA 1U0SY 1JB9A 2EYQA 1X94A 3PK0A 1DI0A 5ENVA 4NDAA 3UUGA 1SELA 3GLIE 4HNQA 3GLGB 5GQSA 4LVUA 5DXAA 5TEWA 4P0PB 3QFRA 2I9KA 1B15A 4DLWA 3E9QA 3PC4A 1OH6A 1FSSA 3A6LA 2A3RA 2XXAA 3CFYA 4DPKA 1LBQA 2XCUA 1QUFA 4YHHB 1P0MA 2Y6VA 2FX5A 4JC4A 4GXQA 1GUZA 2B30A 2R84A 3U7JA 2IP1A 4BLVA 1AZTA 3PIDA 4KPUA 3GDFA 3FDIA 4KZPA 4ECEA 5CIYA 3W2TA 3NETA 1A5BB 2ATEA 3OPVA 5B1SA 4DB4A 4BO4A 1TMYA 2C9CA 3RYHB 3AHCA 4X97A 4XQGA 3R41A 4O63O 4Z99A 1JAZA 1B73A 1EE9A 3B1JA 3GJYA 3GLQA 3TLKA 3KV1A 1II8B 4EPXA 5CFOA 3JVUA 4OHUA 4PCUA 3PHHA 5FV4A 3I6QA 1AQJA 3A9CA 1NRXA 2PKEA 2NX2A 2Y8EA 3NTLA 2WF5A 3O6VA 4OQPA 4R7ZA 3E7DA 3PVZA 3MM4A 4UEJA 2BR3A 4ZO6A 4QXMA 2PH7A 4Q9NA 2RH4A 1C7FA 1XO1A 3AEKA 3RUHA 4K28A 2FUKA 3X1XA 2V1UA 3GMIA 1DTSA 2GJ8A 4B0PA 3I39X 4MPDA 4OXQA 4ZVUA 3GC6A 4GOOD 3S81A 4KGZA 5F33A 5IWCA 3JSAA 1CP3A 2XBUA 4IJWA 3DBHA 5K8LA 4AZ0A 3DQQA 1JJBA 2PL3A 3HVUA 5B55A 1OLOA 5DULA 1EZ1A 1OC4A 2FHPA 1G60A 3FAKA 4ZXPA 3WP0A 4POAA 2QQFA 2O4CA 4QHYA 4UBLA 2IS6A 2BBOA 5F52A 1AM4D 3CKKA 4GOND 3H2YA 3LGXA 1ESNA 1YBFA 2V7PA 4B2IA 1GN9A 1YQQA 5J40A 2KBEA 4XYLA 3WRVA 3IAEA 5J2TF 2DT5A 2J3QA 1UDAA 3DV9A 3FR8A 4DDHA 4CG3A 5EA2A 1M66A 3WWYA 1SBNE 2AEMA 1UBSB 3NIDB 1KZGB 4EIWA 1AQUA 3MJHA 1Q12A 4L5IA 2AN5A 4RUKA 1RKBA 3TLBA 3CYFA 1CR2A 3WK7A 2PHZA 3VZRA 5C2JB 1QTRA 2XDQB 3OQVA 1DBWA 1HDCA 1ZK0A 4BO7A 1Y5RA 1ACJA 1GV0A 4AF8A 4WBNA 1V5IA 4LZNA 3TQIA 3PQDA 3GBVA 1M1XB 2WOJA 3IUYA 2F1HA 1WU7A 1ZW1A 5JWOA 1XJWA 3LO8A 2NYRA 5DW0A 3FYSA 4U7JA 2QRPA 1PNTA 1YGPA 1J9ZA 1YO6A 2A5JA 4U9UA 1FXWA 2YW9A 1V16B 1F5NA 2Z8ZA 1Z0IA 3WJ1A 4CCSA 2YWDA 3ANMA 3W5HA 1JG6A 2RHOA 4EKGA 1DRWA 4F7WA 1SUBA 3CW2A 3ZZNA 4F93B 2ZE6A 3LE8A 1YIAA 2HK8A 2FLKA 4U5QA 4DE5A 2ZJAA 4TWBA 2D1YA 1LZLA 2VN8A 5L3SB 4C6TB 1A88A 4YRRA 1NVMB 4L5CA 2F1OA 4O4JA 4D96A 3ENZA 3L0PA 4BO1A 5DU2A 3PR2B 3LY7A 2IBTA 4JBHA 4BX9A 1YRHA 1YKGA 2A0WA 4JKYA 4AROA 1B93A 1ZCZA 3A4TA 3ZY2A 1VGVA 4S3MA 1R9GA 4PX5A 1NYRA 1NN3A 2AB0A 1NI5A 4WLNA 1XU7A 4DZZA 2FZWA 5JZOA 4E46A 4DV0B 3S5JA 2NVOA 4YUWA 1C5KA 3F4LA 1QHGA 2R6DA 4UUQA 3VV3A 3HJTA 3RCBA 1EQUA 1NUSA 1U8ZA 2VJMB 2VUUA 2Q2VA 2WTBA 3KQYA 4MK4A 5IJAA 4C21A 5E9QA 1BG6A 2VBGA 1UMKA 1JIIA 3O7MA 5TF0A 3EPLA 1W0CA 2AX4A 7YASA 1RWXA 3T7JA 5BW5A 3U49A 3A1UA 4G5SA 2HSJA 3A6KA 4Z3OA 3LQFA 4C43A 4W9NC 4B6OA 2R8XA 2YNMC 3M5CA 5T4FA 3KZKA 3IAAA 4HNAB 1RSZA 1AV6A 5C5IA 2GDZA 2AZDA 3TD9A 3WRYA 1QCCA 1QXSA 4G85A 3PQEA 3T34A 5E9AA 4RKEA 1DAFA 1NHWA 1SQSA 4YJ3B 4G6ZA 1GZUA 5EEGA 1EXMA 2AXQA 3IC5A 2ZT8A 3CEJA 3U2QA 2JZNA 3SHWA 2CWDA 4J2OA 1XTQA 1GFWA 2GLXA 1YJBA 2ZVJA 4MDHA 3EFOB 3FNHA 2H1RA 3G9TA 4WNAA 4XQ9A 4OHFA 1IHYA 4LVOA 4OHWA 4CEHB 3IKVA 3I9OA 1EM8B 1TEXA 1Y81A 1ZQ9A 1PK7A 2NVBA 3AW8A 4XRRA 3TL2A 3WIVA 2CVOA 4OGGA 3UOWA 1O9GA 2VDLB 3PGA1 3WJ7A 4BAUA 1XTUA 3UENA 3A1SA 3COJA 2XLCA 1YCHA 4JXZA 4NHOA 2AG0A 5JZ9A 3E61A 1A8SA 4R2XA 3QQPA 3MW8A 4UUAA 1GAQA 4IS3A 4R5HA 1JEEA 4XJVA 1ZUNB 2I6SA 4JUIA 5A06A 3OF2A 4CTMA 4D9FA 1ZN7A 3PXEA 3HCPA 1Q15A 2J7PD 2GA9A 3EXIA 1ST2A 2C7OA 3TQOA 4Q24A 2E4YA 3R3UA 2ZRGA 3NNNA 4XDYA 2OUIA 1MC5A 1PZHA 2JCYA 4ZAFA 2ZRJA 3R74A 4DM7A 1ZC4A 2QLNA 3EF0A 2HUNA 3HBJA 5FBKA 4Z4QA 2J7PA 2DWOA 2AYZA 4W5QA 4OQYA 4BN4A 5EIOA 4ZAZA 2GKOA 4F4CA 4D4JA 2Y1EA 2C3UA 3GI1A 1KH3A 1VL0A 5FFMA 1QH1A 1R6BX 1WTCA 4FW9A 4RIIA 3RC2A 3ZHTA 5KQGA 2A5LA 1S2DA 2O5RA 5BWNA 1WO8A 2B0CA 4OHCA 5C81A 5IVHA 1F7UA 5ALRA 2NMVA 2H18A 3LKZA 3DTVD 5ESXA 4QOFA 1ZK2A 2VK8A 3BQ9A 3OZAA 3PU6A 5J5CA 2YMMA 1ACLA 2QT0A 4XWAA 1WRBA 2GHQA 4XPIA 1CLEA 4RSMA 4EQ6B 3ZUPA 5B58C 2VPTA 4QIHA 1N3BA 2W6ZA 1HURA 1KDRA 4L4XA 2GHIA 1SZDA 4MX8A 1Z62A 1E7QA 2QQEA 4FOPA 4UQOA 5EMKA 3DTVA 4LN1A 5AKGA 5HWSA 4O25A 2FSGA 4WKPA 4C7OB 5KYXB 2EFYA 4HDNB 4KO4S 1ZSNA 3DE3X 4X1IA 5FP0A 1NSFA 4UFNA 3T9AA 3NWBA 3OFJA 3VO8A 5KHAA 5I4IA 1I3KA 3QZUA 4FS3A 2J4DA 3NB0A 1DHRA 1EGMB 2FFAA 2JLUA 1JR4A 1HTTA 2FZKA 3F8TA 2AFHE 2CDNA 3EVZA 1XDDA 2GWHA 1YZLA 2QXTA 1GG8A 2Z8YM 3OSUA 1IJKA 1NFFA 3DEAA 5L3VA 1TC2A 3JCZA 1PR5A 5FBLB 2C98A 2PZLA 5CLHA 4RVHA 1M0EA 4C4ZA 2L19A 2WFAA 5JANA 2YYAA 4Q4LA 3AFHA 2HLPA 1F4LA 1AV7A 1E9CA 3Q9SA 3SLKA 5LOVB 4P83A 2XA1A 5JC1A 4ZV7A 4A0FA 5TGTA 1I33A 2XPCA 3BWMA 2RI0A 3GLGA 3Q7TA 3KCQA 1RM4A 2PZFA 5D51S 1V7ZA 1Z4KA 2D1TA 4KQ9A 1Y3AA 2QTLA 4ALLA 1RYHA 3VH2A 1LXCA 3HYSA 4B8WA 4XAQA 1XVAA 2XTAA 3D2LA 2Z43A 3SU8A 4RGVA 3BSSA 1KK2A 1N0IA 2BKLA 4PU0A 4JJKA 4QGGA 3ZDZB 3MTJA 4W82A 4ZYUA 5BOSB 2Q3DA 3PXCX 4WZ6A 4DREA 1VBMA 1G8PA 5FUBA 4G0ZA 1Y6ZA 3H9JA 3CWQA 4LOIA 4BBAA 2VO1A 3RUPA 4BVGA 1DQPA 4JAVC 1B1CA 3LWZA 1XRMA 3BIFA 4BNMA 1FXWF 3RYHA 1Z2CA 4NNPA 2J0EA 4EY7A 1FNMA 2A7QA 4V3BA 1II8A 3BTOA 1TVMA 2IHBA 2FKAA 4D3FA 4IIGA 2EGUA 3HO1A 1N2JA 1QX4A 3DT8A 1V43A 4PLVA 2XMBA 1C1DB 3E5RA 4U2BA 1VLQA 4DJEC 4KGXA 3DULA 4I50B 2PDAA 3N5CA 4MGKR 5EQJB 4FIDA 4B80A 2K4MA 1OH7A 4G0QA 3PFBA 5CX4A 1EGQA 4B3HA 1DDOA 3F97A 3L6EA 2GARA 2J3IA 3QWHA 4L75A 5KOHB 1VLLA 3DM9B 5FADA 1T36B 5IZCC 1XB2A 4NU5A 3UMYA 3VSAA 1UC8A 4HG2A 2WE8A 2B34A 5CCBA 3HCAA 5C0OE 3L6CA 1Z2PX 3NBFA 3WK8A 2E4XA 3ZUGA 4XIYA 5IAJA 4DKJA 2V54A 3ENNA 3EIFA 3DCNA 4JA2A 3GP8A 3DE1X 1ESMA 2P1DA 2C1ZA 3I9KA 2GJAA 3KDPA 5DGDA 4FHCA 4LZLA 2GPNA 4G9BA 4OQNA 3L0OA 1KTVA 3HYNA 5IHXA 3I3OA 1GZDA 4M0FA 3ILVA 5C52B 5TMEA 3KTOA 2XAAA 3LX6A 4G26A 3ZVKA 4AJ9A 1I36A 5PNTA 2BE9A 3HN2A 3I2JA 3M5WA 4WBSA 3H1AA 4YRTA 5DT2A 5AUPB 5H82A 3TUJC 3N7UA 3M3PA 3MWYW 3GJ5A 3E53A 4QU0A 1GFIA 2XDQA 1SBQA 1W34A 2BUAA 4EG8A 1RWPA 4KYTA 1N0WA 1W47A 2QR2A 5E9JA 3W90A 3N74A 4B3SB 2FZVA 2H4HA 3UKDA 4ME6A 1TM2A 1V8FA 1VZ3A 1XE3A 2IGTA 2D8AA 3WO1A 4DBVO 5HX7A 1USWA 3D4OA 1KPGA 3GG9A 3TLZA 2HD4A 4B84A 1V16A 2DY1A 1I5RA 2I8LA 1GPBA 3AWDA 4WN3A 1BIFA 5JD6A 1ISHA 4PZAA 1JV2B 2VOEA 3I8XA 3WMRA 3GXOA 3RUDA 1T8RA 4MJ7A 5BYKA 1D1TA 4PC2A 2UUCB 1D2HA 4PO9A 2FN9A 4O2BB 5L3SA 4AN0A 1ZJWA 4BVLA 4C6TA 2Y68A 1U7HA 2FPMA 4BKRA 4CCWA 5DPMA 1MV8A 2ADMA 2MYNA 4K2AA 2JGRA 3LQYA 4WTOA 5ADVA 2R3SA 2R97A 5I9TA 4J0EA 1D8AA 3OU7A 5DHQA 3BCSA 3RWMB 1QORA 3QELB 3C8HA 5IJXA 1UH5A 3RAFC 4NZMA 4K1LA 1TZKA 2YWEA 2VTDA 1EDOA 5K0CA 1DMRA 2HCRA 5HR5A 4R2WA 1ZOPA 5EP4A 4RPJA 4H6PA 4JEHA 1O4WA 1WLSA 2H0RA 1PN3A 3LX8A 3OF3A 3ZKWB 5ITSA 4ZKEA 1K7XB 1J00A 1PCXA 2B8JA 3D8SA 3F5MA 4RD0A 4MGHA 1HBJA 2VJMA 2Z95A 1Q22A 4CKBA 1DT3A 1H05A 3OFSA 1K2VN 1Z6QA 4RNDB 4YWJA 2OV3A 1K4KA 1JR6A 1XDBA 4KJXA 2A9OA 2ZYDA 5FUXA 1TECE 1II9A 5IN4A 4MDYA 1AOXA 1ESCA 4V02A 3DOHA 3NOOA 4PPQA 2PGNA 4FIZA 4HNAA 2GYYA 4JBNA 3L1UA 4B4VA 4EP1A 1JKIA 1E2KA 1V3UA 4GVPA 5K3CA 2Y1OA 4DNFA 2AI3A 2HF9A 3D1VA 1K0FA 1ZI8A 4KFTA 4R54A 4YJ3A 5ICMA 1NU8A 5EMJA 2FRDA 3RSQA 2TSYB 3IKLA 1F1BA 1T34A 2D5AA 3MCVA 2QZSA 4M53A 3D0QA 5K3OA 5KTOA 1FY2A 3DOEA 1N2XA 1Z8DA 3KTAB 4W7SA 5A3VA 1UMDB 2JC3A 2XODA 3B12A 3EFOA 3W5SA 4CMEC 1R3UA 4CEHA 1SRRA 1U2GC 4UBMA 1YFZA 2AWOA 3C5VA 1EM8A 2ICAA 1U9ZA 3B52X 4BB6A 3EIHA 4KFUA 3GLSA 1YH3A 1L7AA 4FGZA 4WV3A 3IQGX 3H1FA 4D57A 5B57C 1G5TA 1LEHA 1RTKA 3ITKA 3MUFA 3KQOA 4J16C 3B20A 4UDXX 1Q44A 1N8SA 3NVDA 2XNDD 5A04A 1JI3A 4U5XA 5JFGA 4M1WA 3VVMA 1QLHA 3EZGA 3GFFA 3M1YA 2HMYB 1YL5A 4FILA 3SS9X 4B71A 4QM6A 2DU8A 3H2HA 3ZEAA 1HYQA 1ZUNA 3DVQX 4UMDA 2G04A 4EHIA 3CMMA 3U6KA 4Q9IA 3RF6A 2XNDA 1OJLA 1NF2A 4TQ9A 2OXCA 1I3MA 4PX2A 5K0NA 4MQFB 4EKDA 2FXIA 2E0IA 2F2TA 2V6IA 3EOZA 4Z0TA 2G17A 5DBHX 4BVAA 2FMTA 2YQ4A 4RH0A 3L0SA 2CXPA 1RDFA 1W94A 1QFYA 1EJ6A 4ZI2A 5C5DA 4JLNA 2Y99A 2OO3A 4HPXB 4HQRA 3SHOA 5I7VA 2WD7B 1N2EA 5GINE 1D0VA 3IR7A 1KBOA 3MTAA 2HWKA 4JYCA 4FU0A 4P4UA 2DQSA 5JD3A 4CFSA 4JLBA 2CDCA 3MT0A 5CR9A 2II6A 3BFXA 2IY9A 1PZNA 1QKKA 2X1VA 3L4EA 4UREA 4YAWA 3EZ7A 3OEYA 1QWSA 4AF7A 3F71A 1QAQA 3BE5A 3JX9A 4K6GA 3W06A 4MITA 3T7EA 1TNDA 3D6UA 4LBZA 1E9BA 1BU8A 4XVQA 1AJEA 5D7NA 4CM6A 1XA4A 1ZRMA 1MBZA 3H2GA 3I9JA 1ENPA 4XLTA 1N2BA 2SBTA 1VSVA 3WNVA 1DKPA 2JFFA 3VX4A 1YVEI 4EQ6A 2CFRA 2P4HX 4ZCQA 1OASA 1IULA 3AX6A 4LRXA 3ZLUA 1NASA 5AM5A 2A59A 8GPBA 1FUYB 2FETA 2GSWA 3RLFA 3I5YA 4J07A 5KYXA 4PQGA 4BNTA 4DDMA 3PWKA 4H1TA 2VQFB 4HDNA 3RRBA 1GARA 1JWAB 3U7IA 3NHMA 1TT7A 1GL7A 3UJ8A 4RFVA 1J7JA 3DE4X 4K9MA 4LRYA 2D3TA 4JV5B 2QLTA 3U3JA 3O1IC 1YCDA 1GY8A 5L95A 3BB3A 4LF4B 2QLLA 4LXQA 2XTMA 2CLMB 3TQQA 2PXAA 3FIJA 4ZYVA 2R25B 4UZSA 5DLQC 5ESWA 2A0KA 5F76A 1T6XA 2H2FA 4UBNA 4HWRA 1WPRA 3EDRA 4AP5A 1C3JA 3GJRA 1OXXK 2O1EA 3NM5A 721PA 2K7FA 3ICEA 1C9KA 5L9AA 3G9UA 1E77A 2H07A 3L6OO 4H18A 5FFFA 3K8YA 1Y9EA 2IRWA 3TG2A 4KE9A 4HWPA 9GPBA 2J5BA 4TOIA 1G2IA 2O0HA 3EUAA 2F90A 2L18A 1R0ZA 2DSTA 2ZR8A 5AM0A 5EQDA 1K66A 3PLRA 4NWIA 3DTTA 1SUDA 2EHJA 3WHIA 1U5BB 1M1YB 1SBYA 2XGGA 2F3TA 3EARA 4PVCA 5BOSA 1PR2A 1AKUA 4L8VA 3S1AB 3X3HA 2IWHA 3LT4A 1NLMA 3GCXA 3NX4A 4DLKA 2CSUA 2REBA 3IBYA 1G17A 4BYGA 1GRQA 1VJ0A 2QYTA 1J0EA 1Y7PA 4DQLA 4P36A 1T9GR 5LQKA 2X77A 3Q3CA 4PLCA 3UG6A 4F9FA 2D0PB 3I01A 5EUQB 2EBFX 1TLTA 2NUAB 4WLUA 1M0TA 3WS7A 1QO0D 1E9FA 2X2PA 3KJFA 1BMFD 1G20B 2B6NA 2AC2A 2M1ZA 1C1DA 4DA0A 2CXUA 5JQWA 3TW6A 4I50A 3WWCA 3GOHA 4LI3X 4GWKA 5DBOA 4A8JB 2HFKA 3N0XA 5KOHA 5I8ZA 2G5CA 5K01A 2QU8A 3C48A 1B26A 1L4YA 1QO0A 1TPYA 4DTCA 1T36A 1BMFA 2BGLA 4YPOA 4N5MA 3M82A 4LZAA 4R84A 1UT6A 3TI9A 1L4EA 5J4LA 1RMYA 1PS0A 3WYCA 4GKKB 4CMHA 1RAFA 1QP0A 3PE4A 2LR0A 2WF9A 1J70A 1Y3FE 1ZM3A 1U1EA 3KQSA 4TS3A 3ONWA 2FVYA 1QNLA 2QJWA 2QV0A 1JXMA 3JQRA 4FSHA 4XLZA 3TXXA 4Z1OA 2JFZA 4HRAA 5MFPA 1ULAA 1PZGA 4IP0A 4XZ3A 1ABBA 1U31A 2R8YA 1KBQA 4ENVA 5FA8A 1I4OA 1MX9A 1FDTA 4LZJA 3WSTA 1OSNA 5B4UA 5FOQA 1NJFA 3LM8A 3AONB 3HH8A 2FP3A 1NTRA 5FL3A 1X8XA 4I81A 2AKAB 1KYYA 2B4QA 1J24A 4H16A 4XX1A 1GGMA 3A2LA 1FDRA 2OLKA 3D59A 2NYAA 2P3QA 3GGDA 3F7MA 2P4UA 3LF2A 4QUJA 5HIAA 3COPA 1Y8CA 3COVA 1W1WA 3FF4A 3H75A 3IQFA 3NEPX 4KN5A 4D25A 1TF2A 1Z4JA 4JOSA 3TX2A 2WWFA 4CQMB 4OFXA 2CVHA 4MV3A 1Z6TA 4UXIA 1E2NA 2GASA 3HYTA 5CB4F 4HXYA 2TMKA 2VF2A 3GEIA 4OHPA 1NURA 4PSUA 4MW9A 5AOCA 2XCIA 4W6ZA 5TR9A 3VTZA 2CHGA 2BIFA 3D3EA 3WAJA 3G7NA 4S2EA 5H0IA 1ZNQO 2GZRA 2EKQA 1KIMA 3E2PA 4QXQA 2VEOA 3ZVRA 1DIBA 4O2BA 2JCGA 1FS5A 1ISSA 2VHEA 4KYUA 4LMPA 2VP0A 2QNIA 2OQIA 5EZYB 3BGVA 1RQ2A 2A8YA 3IEUA 3OM0A 5CXSA 5E2IA 3WA7A 1P31A 4E5SA 4FLEA 1EA7A 3V42A 5C32A 3J7AC 1OZ0A 3JQQA 2GBCA 3DEHA 5DTMA 1L5WA 2DT8A 3HXMA 2KW5A 2JH3A 3QELA 3RJMA 2Z9CA 3RJZA 1U65A 1LRLA 1X8KA 3ZTWA 4ESHA 4F8YA 1R0KA 2IL1A 2NO6A 3BJEA 1I9GA 3T0GA 1FSZA 1QKIA 2YW2A 3I05A 4HQ0A 4KXVA 4QATA 3ZKWA 2H2DA 1VG0B 4PGMA 3V1UA 1KC1A 4F11A 3LJKA 5HRCA 3JW8A 1CY4A 5EGNA 2GFIA 4XQ0A 1E0SA 1WZNA 1IBLB 2G9ZA 5TVGA 1D6JA 2LV8A 1NYQA 1E2BA 3MT7A 3A6DA 3CG4A 3HDVA 3UT5B 3TE6A 1JG2A 4MCJA 3G1UA 4W9RA 2XB4A 3L0YA 3DMYA 4RJTA 3BGOS 3DOUA 4IV8A 4QDTA 4CG0A 2HMUA 4ZVVA 5JEDA 4HN9A 2OHIA 1CDDA 2WEKA 1PLKA 4EB6B 2KWIA 3ZK8A 4MGIR 1GPWB 3IULA 3HJNA 3O2NA 2RK4A 1I4TD 1WPQA 2G72A 3E3MA 1T24A 4LG1A 3S2ZA 1YGYA 4GQAA 4N54A 2FW7A 2C5FA 3TH5A 2X4GA 4BP1A 4CYMA 1MC8A 2PGIA 2Z2XA 4L3OA 1UMDA 5ADWA 2I4LA 2VHUA 3IEPA 1GA4A 4I6GA 5CVCA 1VMDA 1LV7A 2JGLA 4MHSA 5CA1F 1PSZA 1LSUA 3KKMA 3CHYA 4HY3A 4IM7A 2OA0A 4H3SA 3WGTA 4V03A 4KLCA 3DEYX 1KJYA 4L9WA 4MWDA 1IEWA 5JC8A 3M2PA 1G5FA 4LX8A 5BUSA 2HC9A 4QO7A 1SR8A 2GN0A 2V4MA 1Q11A 4BTEA 5KOYA 3V4VB 5HCUA 3UGTA 1G4UR 1A69A 2GPYA 2DULA 2VKQA 3AWIA 3KEGA 3QYJA 4GOMD 5ISMA 3I62A 5MF6A 3ESZA 1H6BA 1YQWA 3Q8XB 3TEMA 3PEYA 2GM5A 1LLQA 3BAZA 3DNFA 2A0XA 2IU3A 2HB6A 3AY3A 4DCJA 1BO6A 5CT8A 5C4MA 1J20A 2YUTA 3R2JA 2CLOB 2BBTA 3NBMA 4KGDA 1YZHA 2YJ3A 4L7VA 4ARZB 5LOVF 1S7GA 2X42A 1K6IA 1E2PA 2R6JA 2ZBDA 4M86A 4MQFA 1ODJA 2R44A 3PCTA 1UMBB 2R8BA 4YCNA 1P72A 4N48A 4G65A 2MSWA 5CTJA 5KB3A 4X7RA 2UXCB 5IABA 2I1LA 4H6WA 2M6KA 3B38A 3W1WA 2GCPA 2WD7A 3BK2A 4DCTA 5D6OA 4E5VA 2EZ9A 2AJDA 2RIPA 3E15A 4OI1A 4JN6B 1I2ZA 3NHJA 1D2AA 2QM8A 4ZZ0A 4A27A 4BNFA 3NDRA 3PPWA 4PYLA 4XSGA 2JLRA 1WKVA 1QGYA 5EJAA 4D9MA 1PL0A 5IBQA 1C30B 4RJJA 1AS3A 4X3OA 2PBRA 4PRLA 1ND5A 3H6GA 4F2HA 3UW1A 4TVBA 3WQRA 2Y0EA 1PJ3A 1RJWA 5F77A 5JDCA 3K71B 4GR5A 1P74A 4FE4A 2WG0A 4MWZA 2PGLA 5DWQA 4B9EA 2JLYA 4JUDX 3H86A 1O9BA 1U02A 4F91B 1H0RA 1CUAA 4I50F 2N3ZA 1XVLA 4HUJA 3VSCA 3ZD9A 4ADSG 2C5HA 4Q18A 4ALIA 1NVFA 2NSJA 2R6HA 3A9VA 1TVCA 2OILA 4LZPA 4M8KA 4QFMA 2PZ8A 4TMTA 3W5JA 3NJ8A 5FBZA 1E58A 5IMBA 3T4PA 3OECA 1Y5MA 4WNYA 5DNDA 5IF9A 5IS2A 4GI7A 1D2GA 1FTYA 2J9RA 3HBFA 1WU8A 3HWWA 3QEJA 4NBSA 3FMPB 2ZSKA 3ZH9B 2HRZA 2Z4RA 2BMJA 3DCIA 3IDQA 5FIUA 3RVRA 4CLDA 1L4GA 2DP4E 4J9VA 4NPCA 3OQNA 4H31A 4PSKA 2OBFA 3G8YA 2LW7A 4AO7A 2HJHA 4O0LA 3FPCA 4FFWA 3TK1A 2W2LD 3LDHA 4JFRA 3KYBA 4C7MA 2JGNA 3KQKA 1QJ4A 5C31A 1ZGAA 1Q0UA 3KL2A 2R1TB 1LDMA 3TWOA 3NRJA 5LIPA 3H2IA 1M76A 3HKCB 3QOFA 4MI3A 1P2GA 3T1QA 2KM1A 3L01A 3ZGLA 4QVGA 1E62A 3JQBC 2GSDA 5L4LA 3OT4A 4D8YA 1ZA1A 1IAVA 2W2LA 4DZRA 3GT3A 1V71A 5CDFA 3LDAA 1NWCA 3MCUA 4R2HA 3K1ZA 2P78A 4EECA 3FWNA 3G9ZA 4CPDA 5U9CA 2C1EA 4IIJB 1U5BA 1M1YA 4MTLA 4RH1A 3T7CA 1S2NA 1PR6A 3S1AA 3VQTA 3DFKA 4KFSA 1JSCA 4RY2A 2YVQA 2YDYA 4Q7EA 2EIHA 3WJAA 1Y0BA 2BDEA 1GYQA 2IA5A 4QHSA 4OGFA 2BFFB 1PFWA 3G0BA 4GMHA 2IHUA 1QHYA 3REOA 4C9BA 5BSTA 2IQ5A 4TX1A 5AW6A 3FZEA 3LSYA 1SVUA 1ST3A 2FMIA 2XNKA 5I5EA 4C03A 1PF7E 4TROA 2CDBA 1UODA 4PG4A 4NS1A 2NUAA 2QRQA 2XQJA 4WK0B 1GUDA 1PR4A 1PJRA 4WADA 1G20A 4X64B 2GK6A 3B78A 3IPYA 4O2BF 2JI6A 4EELA 2R8PA 4A8JA 4WA7A 3ILXA 4R8KA 3ZDXB 5LMCA 2BFDB 2X8BA 3AVPA 2G9NA 1XEFA 3VO9A 2DF8A 3K5IA 2IW1A 1GGEA 5H4GA 2ZIFA 4ZDWA 1RHMA 1EI9A 4PHCA 3QXJA 4UUPA 4LJ8A 3BD6A 3Q7QA 5DEOA 1W1IA 3E1GA 4GLBA 4MV1A 1EM6A 3EQ9A 5TMDA 4A0QA 3THRA 1EWKA 3PVCA 1VA4A 3AFMA 3KD3A 2BFBB 2JATA 3ETEA 1S1CA 4P98A 3AKDA 4I2NA 4WKGA 5A0FA 5JPIA 4HVTA 4DSAA 5JPCA 3EGCA 2EC5A 3PEFA 1SCJA 3QP9A 4JNKA 3DUWA 2XDWA 4IXTA 3M6LA 3SXPA 4DF3A 2RGDA 5GVRA 4B17A 2HNAA 3K70C 1JFTA 2F8TA 3JQFA 2NO5A 3U62A 5HZMA 1AXGA 1W30A 2XBLA 3NV7A 2YY6A 4JZKA 1K5DA 4MQLA 2PRJA 4LTMA 4WCFC 5D00A 3IEXA 3X1WA 3ASVA 5KWSA 1TE2A 2XUIA 4LNUB 3L8DA 4CQMD 3CA8A 3SJUA 2X0RA 3BRQA 4JYAB 5F23A 3DBLB 3WAGA 2H06A 3CLRC 2VNJA 3BFVA 4B74A 4D80A 3WGLA 1L3BA 5LQNA 1LLCA 4J1TA 5FPPA 4YJGB 3F3YA 2YHBA 3LIPA 4JP3A 4CQMA 2ERCA 2J3EA 3NHAA 1K68A 2Q5EA 1J21A 1HWYA 2QPLA 1J0AA 4MVCA 3BE6A 1ESZA 1QRSA 1ZKMA 4LMBA 3A27A 4EJ6A 4R1OA 3KPJA 5K6TA 1TCAA 1GRVA 4BLRA 3GN1A 1GNVA 4LWZA 5EHNA 3AI1A 4N6GA 2OFXA 2PZGA 3P9ZA 2WR8A 3B7PA 1QYDA 1EDBA 3UPDA 5KJCA 4WGGA 1GZ4A 3LVBA 4US1R 3W9UA 4C6HA 1KIAA 1RCTE 5DEIA 3U4MA 1GGFA 1V1RB 5EZYA 2W6OA 2C7VA 4PVDA 4YRQA 3WY9A 2ZJ3A 1T5OA 1OGJA 3EUWA 3R3VA 4I36A 3TFQA 4DV7B 3CURA 5IAEA 3PVSA 1YF3A 3FKSD 1DC4A 1QH8B 1YJAA 3LP8A 1RXCA 1X7ZB 1WEHA 2UV8A 2ZM5A 1LF0A 1GRRA 1S2MA 3C3CA 5CK4A 4D0SA 3QNWA 2ZAGA 1YV9A 4PBSA 4E11A 4OMUA 3A2KA 5AW7A 2RDMA 3QPUA 3K8OE 1EFAA 2RG1A 2KE5A 2PKWA 1SC3A 3FKSA 2XX3A 4MKGA 5ALEA 4HQNA 3UQYS 3MBOA 2VJNA 3F5SA 4I66A 1Y7IA 3UT5A 2CHVA 4MYTA 1W36C 1E6WA 2WM2A 4L0MA 3IQDB 2PVPA 1KY5A 1TIKA 5EFOA 2Z98A 1JT9A 3S68A 3C6BA 3DGEC 3QVMA 2R1VB 1FNDA 3AHFA 5GV7A 4EB6A 5EPEA 3M83A 1MVNA 1NVVQ 3H04A 3L46A 3ROXA 3R6GA 2NU7B 5ECGC 2CVPA 7ADHA 2ZRIA 3FNIA 1A5ZA 2E85A 3EVDA 4UBIA 4BMYA 3OZBA 1JP7A 3LZ6A 4L8GA 3OD1A 4AJKA 3EX7C 3E9DA 3I72A 3MIIA 1T2DA 4GOXA 2EV9A 4YP1A 4A4DA 1IOVA 1P0CA 3P9CA 2P9CA 1GKKA 3QVGB 1EU1A 4NAVA 2GOYA 3PGVA 3GRUA 4QNMA 4RCZA 4UCWA 2GBIA 2C92A 4KG7A 3UMFA 1H5NA 2L82A 3FF1A 4GU5A 3X1ZA 2QMUA 2G40A 3H0EA 1DAEA 1V95A 5CRIA 3W5VA 2XUGA 3QW2A 4ISCA 4CE6A 1AKTA 3W2IA 4UHKA 1SCIA 3CRW1 3BWYA 3I76A 4RHYA 3PC3A 3EMKA 2EF1A 4N0PA 4R1PA 3TGWA 5KNBD 5LMZA 1CS4C 1RAHA 4K9KA 1U4SA 4B75A 2Q1XA 1LDNA 1XHFA 2IUTA 4Y1EA 4YUYA 1D3AA 3G2KA 2ECOA 3BQNB 3OP4A 1Z4NA 2JAUA 1FFHA 4HBZA 2RBGA 1V8ZA 2NUPB 3TF5A 4ARZA 4G0WA 4LTNA 2IF2A 1JEOA 4XQEA 5KNBA 4ZVQA 1ULBA 2WOOA 5JZBA 5KVAA 3SR4A 1UMBA 2UAGA 4RY8A 4C14A 5IU6A 5AI9A 1YQEA 1M2OB 4HZIA 1NN5A 4HMPA 5G1OA 3RREA 1XCJA 3VR4H 1CUXA 1T0PA 2JLVA 2WFZA 4J0FA 3P2IA 3KHUA 5DNEA 1KVTA 4JLUA 3RT1A 4YX9A 1TIBA 1I2BA 4LJKA 5F9MA 4B6JA 3ZYCA 3EBOA 1OUMA 2MIIA 3R6LA 4KKVA 1QRUA 2Q5HA 3L7MA 5AJWA 2RK3A 1C30A 4IH9A 3WTCA 1FCJA 2AG8A 4BWGA 2WJWA 2I71A 3PENA 5CCXA 3GGPA 4U7FA 3FGPA 2C5SA 1XROA 3W04A 5CLIA 2BISA 2Q7XA 4BBJA 3OEWA 4UASA 4KXXA 3K20A 3EPJA 2ANCA 1QDEA 4QO8A 3ZWPA 2QX4A 4C7XA 5FTNA 2R5WA 5EZSA 4FBLA 1QRRA 4K3VA 4O08A 4P33A 1W1UA 3V34A 3TQSA 5LD2B 4JFAA 1SAYA 5K45A 1NIJA 4AKIA 1JKMA 1MB9A 3IOEA 5AVVA 3LTNC 1QJCA 2VP9A 4JXKA 2W6JD 4MW4A 5DM0A 5I7RA 4FLFA 4BAZA 1BZYA 3DLPX 4Q1EA 1X7YB 5KYWB 2Q21A 3TSCA 4BX3A 4FYMA 3QHQA 4ZFNA 4IX9A 4RPLA 3VMFA 2DQKA 4DY6A 3E8MA 2RGNA 4EARA 3D4LA 4CMCA 1QYWA 2NV6A 3KSUA 2HT1A 2VP5A 3L4SO 4B81A 1Y82A 1X19A 2W6JA 1QQAA 2AN1A 2WIJA 1VTKA 2BBSA 3H9GA 2YQZA 3D8RA 5AM3A 3WOHA 4TTIA 3K0AB 3WVNA 1EK6A 4DIUA 3JYNA 3QX9A 5LQAA 4LOAA 4RSHA 2R1TA 5IVKA 3QEMB 3ZWMA 1ODIA 3GZNB 5D6NA 4LWOA 3HKCA 4EI8A 4Y2GA 3BWBA 1G2OA 3EGOA 4URWR 3NYWA 1VFNA 5ARCA 1C7EA 2Y1CA 1R50A 3AR5A 1CYDA 3O2JA 3R0QA 4EKNB 4NXNB 5B7QA 1RPAA 1GAJA 3SMVA 3SM9A 4B47A 5MN4A 1D07A 2CHUA 2ATCA 3V8QA 2ZQYA 3NBQA 5GJWC 4IIJA 2VXBA 4UATA 3UGJA 5HF8A 5JAHA 2QENA 4S1PA 4X8HA 3EIUA 2ETVA 1DBPA 2G8NA 3TW4A 3P7MA 4UPEA 1UFRA 3DPUA 3GO4A 3MRVA 4HEHA 3OT5A 4JL8A 3KS9A 1KI9A 4OIFA 2BFFA 4N6OA 4UTPA 2AF3C 1K9SA 1RMQA 1AXEA 2OGZA 5AXBA 1RWVA 1PKXA 4IO0A 2ZCJA 4LRSB 4PAMA 2FGJA 1K08A 1NLZA 3ZHBA 8ADHA 3V3KA 4GI5A 1PHPA 3ISVA 5AJVB 2N46A 4MUAA 2HMTA 5JS2A 2HSZA 5CK5A 2EZ4A 4PIMA 1ECPA 4WK2B 4DBLE 3NP7A 2JGFA 1CF9A 1I0LA 1VPEA 5FQOA 3F73A 1Y6FA 1Z4LA 3WV5A 5EZYF 4F9TA 4R71A 1EDEA 2BFDA 4WY5A 3A1TA 4CVNA 1PV1A 1WS6A 1F14A 1W49A 4BWVA 5FULA 1Z7EA 1DV2A 3CEHA 1F48A 2YYZA 3A4LA 1NQAO 3RM3A 3HP1A 2O3QA 1MIOB 4ID3A 5GY7A 1DEOA 3F96A 4I1SA 4WACA 4R1QA 4CHTA 2D2EA 1P1RA 3R0IA 2EX0A 4K46A 4AY6A 3H7IA 1H6DA 3OT1A 4IF4A 4YJ2B 4J91A 3WIDA 4BRUA 2BFBA 3T41A 4YFVA 1OX5A 1L4UA 2OXFA 5AHWA 1VMKA 4C7KA 2IUSA 2FVXA 3IA7A 3K1YA 3V46A 3FPFA 4NENB 2YR0A 3IE0A 4CETA 4HLDA 3WC4A 2ORYA 5DM4A 1E63A 2CFCA 3FCSB 1LFAA 4KCGA 4P5PA 2X1MA 1RLJA 1C14A 2R7KA 3OI7A 4JEIA 2AOUB 4KP7A 5A5DA 4ID9A 3UK2A 2IHNA 1DLIA 2C0QA 1P7PA 2GZ2A 4LNUA 1O7JA 4JDUA 5K05A 3RSFA 1DJQA 3SPXA 1FYWA 2YH2A 4R3WA 2C4VA 3BN3A 1OXMA 3DBLA 1BEUB 5EAIA 2PUWA 1LPNA 3L1IA 3FWHA 4I5DA 5LA6B 3ZWXA 1P8AA 2Y4OA 4N9QA 4YJGA 3DJYA 2OXTA 2DVMA 2JFNA 4KQIA 5BN3B 2Y9MB 2BF4A 3TI7A 4RPCA 4PGHA 3NORA 1VSQA 3AGQA 3GLGE 2ZSHA 4HCJA 4Q9KA 1J0XO 5JSFA 1QHHB 3QLVA 2O2EA 1VG8A 3UXHA 1ADGA 1VXOA 2WJ3A 4BGDA 5KIAA 4POOA 3KJEA 2GO1A 1NG1A 1Z5VA 4JUCA 4QBHA 4MPPA 4QPPA 5HGXA 3VGPA 1XRSB 3GP5A 3T9FA 1X39A 3FCXA 3H0KA 3TTWA 5K5EA 5FOWA 4DR6B 3O92A 1GU7A 3DQPA 4E12A 3WNCA 1TVEA 1Y42X 1ZD4A 2DHDA 2PYZA 4N7BA 1V1RA 2O50A 4FUTA 4J2TA 3IDOA 3SX2A 5GGYA 2XRYA 3AJ8A 4YP6A 4DUPA 4PZPA 1G1MA 1TDJA 4RYDA 1Q3HA 1H2BA 4L4RA 5AKEA 3UAXA 1W87A 1LDYA 4KAAA 4ZP1A 1QH8A 3FZYA 3PZRA 5BSRA 1X7ZA 2W2TA 4QVKA 2WAOA 5E3IA 3SP1A 3VM6A 2XWJI 3T9CA 4D0GA 3HRKA 3T3IA 1Q91A 1OIWA 3CXRA 2FWJA 3CNBA 1CUDA 4BX0A 4KPEC 4EOGA 2V58A 1T0JB 1M5TA 3A6HA 3DXYA 4RK0A 1ZFNA 1C0PA 2KYRA 2PKQP 3R0JA 4DIOA 6REQB 3OLQA 1PNRA 3BRWD 1L1QA 3C3AA 3I4LA 4ENQA 1JAIA 3GNSA 3VSEA 3E9CA 5EJIA 1XRLA 3DTNA 3JXEA 4W8OA 1MA3A 3WL5A 2W00A 2OAQ1 3F90A 2HQ1A 3L41A 5A05A 2R1VA 2P6PA 4F1JA 5JEEA 2MSLA 3ZDDA 1MPTA 3BRWA 3OTQA 2AQIA 2O23A 2NU7A 2PUTA 2QAGC 2E5WA 1YUNA 2HTFA 2WP0A 4CTKA 2GA8A 4UCXA 4WUTA 5TB5A 3S27A 2QM3A 2IS2A 3AHHA 3KVVA 3AI3A 4G4JA 4MR8B 5T3YA 3REGA 3LMKA 1GQRA 1NXWA 3RRFA 3T61A 5ALKA 4AT1A 3G5AA 3QVGA 3CG0A 3A7EA 1IAQA 2CL6X 3DOFA 4Y6SA 5HW0A 1UBOS 4JB2A 4JIMA 3QTBA 1LI5A 2EP5A 2ATIA 3H8VA 5I7AA 4NCAA 4QXOA 4OD0A 4KOEC 4E2ZA 4HDQB 2CYCA 1L5HB 2PSSA 2YICA 3HU2A 1FJXA 1L7OA 1XZLA 2C58A 1BGVA 4J9UE 2YRWA 3BICA 4H3HB 2BCJQ 4O4LB 4G36A 3BTUA 3V8PA 1FRNA 3O8OB 2WT4A 5D5PA 4AS1A 4EF5A 2VWGA 4CXMA 4B3XA 3GBSA 2NUPA 4NLLA 3K05A 3FUUA 5DCYA 1YCGA 5JMOA 2JGAA 1NW9B 2DBZA 2WSSD 3LY8A 3WK9A 4B73A 3OY2A 5BMVB 1SU7A 5DBIA 3TNDA 4O0MA 2BF7A 2WT8A 4D9CA 2KSQA 1M2OA 3E1SA 1R2QA 3WL3A 4QQKA 4JBWA 5BP7A 4V2UA 1O6BA 1KO8A 1FX0B 1DTWB 4J3NA 3CJRA 3MVEA 3WB0A 4MUFA 1HE1C 2VDMB 1N6IA 4AF6A 5JI3E 2FKNA 2WSSA 1XA3A 1ECLA 2ZAYA 3E2IA 3JAWB 1YQDA 4BV8A 1KDPA 4M1EA 4ZZ1A 4E88A 1OA0A 1B43A 5AR1A 3ZOKA 3QTLA 4Q1FA 3ZY3A 4DDTA 4ZYXA 5LJLA 2P11A 3HSSA 1LI7A 2KHZA 4H0FA 3NKLA 3ET5A 1R10A 1KI8A 2BCGY 1IHUA 3B6MA 4IEFB 3OPYB 4RFLA 5HIKA 3KQUA 1U7OA 3TB4A 1PQ4A 1NR5A 3U4AA 3P2MA 2VCYA 5BNTA 5CDUA 3R7NA 3C4QA 5KTMA 4LCJA 4NJEB 5B53A 2YRFA 2RGXA 1LLFA 3MD0A 2BGUA 1T5HX 5JZSA 1UAAA 1Z6PA 4FFLA 1KO4A 3NBUA 4DTIA 4RTOA 4G81A 5TS2A 1DFHA 2CSXA 1EVLA 1V4BA 3BL8A 5KTYA 1SOAA 5KYWA 4FBGA 1H9AA 4XJXA 1X7YA 1WEKA 3D8NA 2PR7A 3LK6A 3K1AB 5D84A 5EJ9A 2I2CA 3OQOA 3OD5A 3LYLA 4ZEMA 2ODBA 4Z5XA 3K2BA 5LSAA 4B3MB 2I91A 5C80A 1JGTA 3ANLA 5DSXA 1L5OA 3KTFA 3UANA 1KZ4A 2ISSD 4I9FA 2C59A 5IKEA 5JCOC 1C8BA 2Z5FA 4Q0MA 4R9VA 1J9EA 3U09A 5FUQA 5AH0A 3K0AA 1B3BA 3KJQA 4PNHA 3QLUA 3P0HA 2IHVA 2OLJA 4JT9A 3QEMA 3R5TA 3AEZA 3GZNA 1MR3F 3KQWA 3NLLA 4R0VA 3SYKA 4BE9A 5A3JA 1KZ7B 4IIBA 5FI0B 1ZXXA 3OZXA 2VF4X 3KQMA 3P52A 4PBRA 4KVZA 4R98A 3ZLTA 1OFVA 4JI0B 5FV7A 5JCPA 5H80A 2CLSA 2HSDA 4E2XA 5BQXA 4MRMB 2WLSA 1ZNYA 2Z1MA 2PSJA 3EEIA 3KWLA 2IXBA 2UYGA 3D6TB 5EEHA 1WDMA 4AKTA 4B2YA 1XTPA 4RQTA 2DLDA 4RYLA 3TAXA 3VKFA 4GZ6A 4OOFA 4BMNA 4HDCA 1AHIA 5ER6A 5JSHA 1Z4QA 4MV7A 2IYNA 3R7WB 3U7HB 4RM2A 2BFEB 4BNGA 5IT0A 3NTVA 2Z56A 1CRQA 1H94A 2P91A 3K53A 2Y71A 2RHTA 1JFVA 3QFFA 2JAPA 5B3LA 2Y0DA 1HQDA 3HP4A 3LXXA 5HVNA 4W5HA 5IKPA 1MRSA 1M2EA 3RTAA 2P30A 2I1VB 1JBQA 1MP0A 4PAQA 1Z5PA 1Q3KA 3FYDA 1DVRA 4UEQA 1GDHA 2CBZA 4YAIA 4ZZIA 2AXNA 2IZ5A 1CEYA 4OB6A 5JRZA 5B3JA 1XK7A 2LDXA 4KMSA 1ABFA 3FZGA 3PC8A 2OPHA 5K0EA 4JLVA 1FBTA 4J1SA 4M54A 4RIEA 4B32A 3GD5A 2QD2A 2X7JA 2YOFA 3DM5A 3QG5A 4G1BA 3WL6A 1NUTA 1GTVA 4JJIA 1EVQA 4K7JA 3QVWA 1QFJA 1MIOA 1Y3CE 4JBYA 3WGJA 4EKIA 5EVJA 4JLWA 3MPUA 3FPEA 2ZIXB 3BGSA 4BFWA 4EMSA 4MS4B 4A2CA 4YJ2A 3QBTA 3SZLA 2O4UX 2P3SA 2ZITA 3IO5A 1X6VA 3SQXA 3IOMA 4WEOA 2RHGB 2CXHA 3K35A 1YMVA 2B4AA 3KEFA 1J2YA 4MUJA 4NENA 4EO7A 3FDXA 3RVQA 3OO1A 1O96B 4BV3A 1NUAA 3SE0A 4DDWA 4YMHA 1CQIB 1RI3A 3ZGVA 3I0MA 2QVXX 3IFSA 1X42A 1RCFA 2AOUA 5CYFA 4OH7A 3TRIA 1YRWA 4KUEA 2HQRA 3W5DA 4W8GA 2VWQA 2GVNA 3CVUA 1A95A 2ZSDA 1W88B 4LYEA 1MABB 1V3TA 4PZDA 1P19A 2ZBQA 4MVWA 4JL6A 5LA6A 2PGDA 1DAIA 4MVJF 2BKVA 3RB8A 4RHXA 3V1LA 5BN3A 3PT5A 1CB0A 3AL2A 3HB4X 2CT8A 2CMGA 4HD8A 4QREA 1QHHA 1Z6GA 2PS9A 3ND5A 2WP8J 1YBMA 1V4VA 2VT6A 3DCJA 3FI9A 1ZJYA 3TQFA 1ZIXA 3UAGA 2BCEA 3HB7A 3RWOA 4EGQA 1JTEA 3P19A 5EIWA 1I6KA 1IC6A 2DY0A 1UFQA 2AG1A 2CVFA 2DC1A 2V5UA 3F4KA 3I01M 3B3AA 5AW2A 3QOXA 4MIEA 1PWXA 3A1NA 1SPXA 1GTL1 4KI0A 3FOAA 3IR5A 1A8IA 3DE0X 4CNQA 1F2VA 1FYDA 1I7LA 1HV8A 1TGVA 4NMMA 4PLHA 4EF4A 5G0VA 3ILSA 3A1DA 3EYWA 2GXSA 5HK8A 4OBBA 3ZE2B 4CIXA 3BTVA 1L4KA 821PA 3UVEA 3RADC 4W1QA 5CIQA 4JMLA 4Q3CA 3AVVA 3H5VA 3RFXA 3CLSC 3NHSA 1ULTA 4G1CA 2G09A 5HFJA 2UZIR 1AGYA 3TMYA 1KJIA 1FJHA 1GP2A 1T0UA 1AQYA 3PQ4A 3OURA 1VKJA 4YJHB 6REQA 3IMFA 5LNK1 3OIWA 1DBQA 3GPDG 1PT7A 3CX6A 3UAOA 5B30A 4R9RA 1QG6A 1DFIA 3B6KA 4Y30A 4XVCA 1BHO1 1RE0A 3LFTA 4LBYA 3DE6X 1Q1QA 3ACDA 2YJZA 4HS9A 1EG2A 1QR6A 4CKCB 1GO2A 2NTNA 3GZ4A 4IUCS 5GZ6A 3F67A 2VZEA 4EPTA 3JQ9C 1NKSA 3L8YA 4B3CA 1OH5A 4A23A 1Z5ZA 4HQ6A 1JR3D 3B8EA 4AQ7A 1DKOA 1OV4A 1V2HE 2F9MA 2J30A 4NE7A 4PZCA 4N5DA 1NDQA 4L07A 4L16A 3LXMA 4MR8A 3RVSA 1G21B 3DAFA 1BQEA 3P9YA 2Q6OA 4P82A 2BGMA 2XUQA 1Q95A 1EK0A 2M98A 2YJ4A 3C7DB 3F7NA 2GERA 1QYCA 2VTKA 3NUGA 3N5KA 5J1TB 1NW7A 3WGNA 4QLBA 1JR3A 4BUCA 3VX3A 4BLPA 2X4IA 5BQ3A 3C14C 3KHSA 2VC2B 1XEWY 1QDUA 1GILA 4K03A 3UJCA 3C3BA 4W7HA 1MA0A 3KPYA 1I7QB 3QMMA 1X1TA 4HLQB 2Q4EA 2QRHA 1WLYA 2J6CA 1YZFA 2WUDA 3W8DA 4RTQA 1BJRE 1L5HA 1V11B 3LO5A 2HRCA 2W4IA 1YVPA 4IFIA 4L1KA 4YXFA 4HFRA 4O4LA 3BAFA 2C82A 4IYRA 3O8OA 3D8UA 4MLPA 5EUCA 4C5BA 3QY0A 1P3Y1 1YDEA 1MC4A 3MOIA 4FSDA 4OP3A 4BQPA 5LP6B 4LDAA 3JQ8B 1XLTA 3ENWA 4FN4A 4FR2A 5KTNA 3GOQA 4KE6A 5FLKA 2C5AA 2AOVA 2INGX 3HFJA 3I23A 5J5VA 2C8LA 1TK3A 2ATXA 2CB0A 3FHOA 1FFDA 2OBNA 2VDWB 1PTJC 2I3DA 3IILA 1VPDA 4PC6A 3Q12A 3ZWVA 4Y2PA 3ZCQA 3HUEA 2IY7A 1NVXQ 2DR3A 1L8AA 1C7JA 1KAQA 1MO3A 2OCAA 1JQ3A 1NW8A 2PT5A 2ZS9A 3PDHA 1DTWA 1FX0A 2LE0A 3WKBA 3GJTA 4ZI3A 1OWOA 3OJOA 3FFWA 3ZD8A 1W44A 2QVYX 4U7WA 2X7XA 5ILOA 3JAWA 5H9WA 2CEAA 1FRQA 1M73E 2QNBA 3I58A 2ISQA 4DJ5X 4XYEA 3OLYA 1U7ZA 1BCSB 4TMYA 3IUBA 1IBCA 2D7JA 5BUQA 4BQEA 2BLNA 3OPYA 5KS2A 1WR8A 1TT5B 3PQ8A 2UXDB 3OWXA 1Y48E 1ZUWA 3GXBA 4MKFA 4MV0A 4D9KA 2D13A 2D06A 1R7RA 2HMWA 4NJEA 3ZE7A 1NUQA 2DFVA 1FPQA 2CD7A 2W70A 4CT0A 3K9HA 4QX6A 4EJMA 2AJTA 3CJTA 1G6KA 2NXNA 1S8AA 3EQ6A 4Y7CA 3ZTYA 2WF6A 4RABA 4G2NA 4Z6KA 4KODA 1W75A 2EG5A 4DWJA 1SVLA 3RANA 4M7RA 2BH9A 3BGWA 3F5QA 4QOJA 4RF2A 4F6CA 1EKXA 3K1AA 4RZ3A 2IELA 3H2SA 5AI4A 4ZZ2A 4DLRA 4QAQA 1XVIA 2WJ4A 5JYBA 1KAMA 2XNJA 4DNXA 4L08A 1NIPA 2EW8A 3EJ6A 1V96A 1BXKA 3P2KA 4MPJA 1Z29A 3IDFA 4N18A 4XJTA 4YJ2F 4KRYA 5F51A 3STTA 5FBQB 3TB6A 1B1AA 3NI2A 3QGMA 1GTMA 2CUKA 3JWGA 4X1KB 4DEXA 4F2GA 3NHBA 2WMNB 5AI0A 2IOHA 1LNZA 3W2GA 1KVUA 5AO9A 3C3WA 1IATA 4FNGA 2OD9A 1HQCA 1N5IA 4G41A 4DS3A 1KS2A 4DABA 1E0KA 3O9MA 2HSWA 4KQFA 1D5CA 2NGRA 5IG2A 4OJYA 1PRYA 4BCBA 4IQ0A 3E5MA 5FR1A 4GF5A 3N8HA 2FPPB 2J85A 4DR5B 4MRMA 3I6BA 4GDMA 1XCGB 2JLCA 3NT4A 4JQOA 3ENVA 2IDKA 1KJWA 5LA6F 2R6CA 2C57A 2HZBA 1A1VA 4LRTB 1W96A 3R7WA 2BFEA 3GFVA 4H1UA 3OZWA 1XZBA 2AXPA 3A25A 2C8VA 2GJ4A 1XCPA 1K8QA 4HSGA 2IH4A 1EUZA 4DNPA 3MTBA 4MUNA 3FGOA 1WOMA 4HX5A 4K6KA 5EKDA 4C3ZA 4KVGA 3UKJA 4PZZA 4DLYA 5EHZA 1E0AA 2B8TA 2G82A 3KZNA 4IH4A 1KWGA 3QI7A 1NMXA 4D9HA 2P2ZA 4AVYA 2N0SA 4NY1A 3KBBA 4RMNA 4RZIA 1HSOA 1E9DA 4OTZA 1P0PA 2IPNA 1EZ4A 1UBGA 3G89A 1L4MA 3VNQA 1C3OB 4NBWA 4X8OA 4AS2A 2EARA 5LLTA 2ZGVA 1UKZA 5LB2A 5J47A 3AUSA 2ZIXA 4IZ6A 2GCIA 5JUWA 3CZRA 2OHOA 4MS4A 2IOFK 3MJVA 3PC6A 3IIEA 3IOBA 5EL0A 1G8GA 2UYOA 1TL7C 4JBXA 4PNPA 3TTXA 4I1PA 3SDSA 1DB3A 1O96A 3TEFA 3OQMA 2VLBA 1CQIA 4NYIR 3LNTA 3VH1A 3OQBA 3BC1A 5HILA 3FR7A 4PHTA 4Z9FA 1NAHA 2O19A 4CN9A 2F17A 1NVKA 1E66A 4DIFA 1L6RA 1L7PA 1EP2B 1KI1A 4I9NA 4ARUA 4M8SA 4G9GA 2R9VA 3B6IA 3NZEA 3GJ7A 5BORA 1W88A 1DOHA 3ZS9A 3B3JA 4RZ2A 1GKIA 1YNOA 4Q47A 2ZSIA 4QTTB 2BAGA 2J3KA 4MW1A 1PLJA 3DB1A 3OCZA 3DF9A 3O83A 2J6IA 2PS3A 5AW1A 2VEDA 2ZJ2A 5DNVA 3ZZUA 5CDFE 1NRIA 1XZPA 1CZKA 4BE7B 4FXPA 4DV5B 2PJRA 1JTVA 1Y4SA 2B92A 2C1XA 1M1YE 5HSGA 1DCKA 4AG6A 1TX4B 1P1IA 3VDXA 1L0BA 2Y4NA 1SVOA 4OJNA 2GKSA 3ORFA 2I66A 4URUR 2CYBA 3T5MA 3TR0A 3L8MA 5KTSA 2A0FA 3TOVA 3REQB 4IV5A 5HZKA 2YWCA 4TMXA 2PO5A 5JS8A 1CU1A 1LLDA 4ZVPA 4AUNA 5HM8A 5F7ZA 5IBCA 2FQXA 3WLFA 1NHGA 3AVQA 3FXAA 2BRUA 3ML1A 3O0TA 3RKRA 3VDQA 4I7EA 3NC0C 5I6DA 4TKUB 3MAGA 4K9SA 1G20E 5FL7D 4F4DA 3U26A 2Q1WA 1XJQA 4XRGA 5BMVF 4P4NA 1P4RA 1DZIA 3RE1A 2C4MA 2IHZA 2JBWA 3HJUA 5C5EA 2OT3B 4M87A 1UWVA 3IP1A 1BSVA 2UYCA 1QTQA 4YR9A 4ZXFA 2Q0HA 4QTYA 3TINA 5FL7A 5K8UA 4BWYA 4MR7B 5AYVA 1WUIS 2J3DA 3IV6A 2YIJA 4HUTA 4UTZA 1U7XA 1QE5A 1D6SA 3FSGD 1TOAA 1WW2A 3TVYA 4CM8B 1XRRA 1JS1X 1JW9B 1O89A 3SFZA 1U7WA 4CKCA 3OLZA 5LKRA 1UOEA 3HSYA 4MAAA 1E1RD 4BEWA 5L40A 4XDHA 1R4NB 1U3CA 2HTEA 1N5MA 4JJ6A 3O94A 3MS7A 1DO8A 3IBCA 1KVQA 3KRTA 3FSGA 3EZ9A 2ABWA 3E7FA 1NY6A 2PA3A 2RD2A 1KI2A 1KGSA 2R8ZA 3GD7A 1XQ1A 3WQSB 2PU5A 1E1RA 2QTVB 4PPNA 1G21A 2UVDA 2H17A 2C88A 1EDZA 2V45A 5AVYA 3DO5A 2X9LA 1HGXA 2VDPB 2WIBA 5KQRA 2CHFA 4YIKA 5JCZA 3QSGA 5G41A 1C2TA 3QPCA 4B34A 1WB6A 4Y6PA 2AT1A 2ZBEA 5KWIA 5M7EA 1R6DA 2LBPA 3SR3A 4HRXA 5FTJA 5LZ5A 4H7HA 4ENWA 5LZ2A 3RVJA 2YJGA 3AVOA 3JZFA 4JQYA 3UK7A 4QXRA 3M1AA 1AHNA 4KO8A 3BXOA 5KTKA 1HEIA 3EIWA 2ZS7A 1NV9A 1POWA 4QJBA 4ABYA 1Y4AE 5TT0A 1JQLB 1ZPDA 2FPXA 3SSMA 4EY3A 3HVIA 4C3OB 1V11A 2RCNA 3GLRA 3CUWA 1BN6A 1GGJA 1AUQA 1RXEA 2GHTA 3E35A 4F5DA 1OBVA 3WZ2A 1WD5A 4PQRA 4RPHA 3ZU2A 1EX9A 4DV6B 1NONA 1S2IA 2NLOA 3GWZA 2UZ4A 3B1XA 1ND6A 1FSPA 5LP6A 2FZLA 1GPH1 5DBFA 1RM3A 3NCTA 3JQ8A 1VG9B 2FPSA 3LV8A 3VAZA 4F3YA 1ONOA 4K86A 3ZG6A 1BH2A 4Y2HA 5BSEA 1MV5A 2BL4A 2CNOA 3C1AA 5CW2A 4P7KA 2VDWA 3Q8WA 4WLVA 3QXCA 4FDTA 3FVVA 4IQ8A 1P7ZA 4PPYA 1CZUA 2QL6A 3UBTA 4ZVOA 3LRPA 3WRYC 4EY5A 4KQGA 1U9JA 2FEPA 5BSWA 4LF9B 4NCNA 4FNAA 3FBGA 4DIMA 3CBGA 3R4CA 4BLTA 4EITA 1ODTC 4J43A 2ZXEA 3THWB 5LUBA 5C1DA 1QHFA 4S1VA 4CDNA 5A4AA 1GGHA 3GVHA 3KUDA 4WOJA 2O7VA 4YCBA 1B23P 4UJ3A 1BCSA 5CT6A 1RFLA 1WCIB 2IW3A 4LJSA 2C03A 2NT4A 5AP9A 1TT5A 4EFNA 1KMQA 3KAKA 5FWXB 1NNSA 1J06A 5BQFA 3OIUA 3OTWA 4V0OA 4HT3B 1TK9A 3NTOA 3W8EA 3GPBA 4MV9A 1JMVA 3A9WA 3ZK7A 2E21A 3G2JA 1V9LA 2BTOA 5DYIA 1ZU4A 3AW9A 4YLGA 2HX1A 2CLCX 2FB9A 3JYLA 3T38A 2IDJA 3UFXB 1EEXB 3ER6A 1D1QA 2F9FA 2LNDA 1VPVA 2BMWA 3K0CA 2C8KA 2J3MA 3V2UA 5HF9A 4B3FX 4E1VA 3CJQA 1B74A 4GLLA 3RGGA 1FZTA 3OOSA 4FMCB 5SYAA 3NBYC 2P62A 1QBKC 1YZNA 4HX2A 1FRFS 4DR3B 3UMGA 2C3OA 3QBJA 2WB2A 1K5PA 5L3RA 3I52A 4X1KA 2MSCB 2RGUA 1JHQA 2ZBRA 3WHKA 2QLJA 4MH0R 3OOWA 2YZMA 1X9HA 5HF6A 2F8MA 2R85A 3ACCA 1TO2E 2K7ZA 3V8MA 5FAKA 2WWHA 2B7LA 3KPWA 1T9CA 5KVVA 3HVHA 4JVLA 1IN5A 3EGEA 3C8MA 3JVEA 4DBLC 4ND2A 4DRXB 5ICCA 5SZKB 5AI5A 1IWOA 4CQLB 2VLIA 4EKEA 1EYZA 3MTIA 4JH0A 5CTAA 4D8XA 3VPHA 5CEFA 2I34A 5HDQA 2FPPA 2KLBA 3HDYA 3PUVA 2IYOA 1QOZA 3DL4A 4N6NA 1U3FA 3CB2A 3E7WA 1SHTX 1GKUB 2WK1A 3OFVA 3S99A 3TTVA 3E8SA 1KOFA 4C3UA 1MB0A 3KXDA 1Z6AA 1VRCA 4ND6A 4CLHA 1XMQB 1SMKA 2JEOA 2BZGA 1QV9A 1SIUA 2QTCA 4ZRDA 4X63A 4CKBB 1KEEB 1O87A 4Q6BA 5ALUA 5D01A 3B5EA 3URKA 3V7UA 1JH9A 1GDTA 2C84A 2PXCA 1J90A 2I6TA 1CY0A 1EAYA 2LCIA 2OAP1 3IUJA 1CK4A 1DHTA 3SMQA 4G5OA 5BW8A 1LJ8A 3IMEA 3RRNA 4BFLA 4X90A 4CL0A 4RAOA 4J6EA 1ILEA 3Q5DA 5CP8A 1VCIA 5EZ6B 5IVDA 1OROA 1R6AA 2DJIA 4JJZA 3SDZA 4D7AA 1BCRB 1MAHA 2W0SA 1C3OA 1JQEA 3LZDA 1HDRA 1D03A 3G3EA 4OQMA 2J0QA 3WXMA 4E7PA 3IA2A 2WJPA 3Q9LA 1PJTA 2OCKA 4IINA 1XMOB 1WHSB 4PQYA 1B8PA 1HYHA 3GGOA 3EDQA 4QM7A 1MKYA 2NO1A 2XE6A 4TVOA 1UWKA 3O84A 3P2YA 1K7EB 1YK1A 1HLPA 4RJKA 4Y7DA 1N3IA 2CZGA 4C6SA 1K4MA 3D31A 1EAMA 2WHXA 4EY8A 3ZXIA 3QOWA 2VHYA 4ZVMA 1PGJA 2I0FA 2LPMA 5IFKA 4JI8B 1AKMA 3HV2A 4K26A 2W6PA 3NWOA 1MX5A 5CVTA 3ZJTA 1BKDR 1CJKC 1VJ5A 1VB3A 1OBCA 2I2BA 3C7CB 3I9V1 4QDZA 5CAEB 1DXOA 1R5JA 2DE0X 1ZCJA 2CNBA 4OB7A 1BS2A 1T3TA 3HXTA 1FFXB 1WZEA 2FTKE 1E2LA 3OQIB 1DADA 4JX9A 4Y0NA 3ZU6A 1GQ2A 3WFZA 4WDRA 5KZMB 1Z18A 2B36A 2PD4A 5FLEX 1RMTA 2IP2A 5KDLA 2G67A 2E1PA 4UZFA 5TX7A 3O1LA 2ZWVA 1IXYA 5E6SB 1XEAA 2XE4A 5CGQB 4D4MA 2PCJA 4XSHA 2H3HA 3R3YA 4BZZA 1A5SB 1MCZA 3ZQKA 4LECA 5B36A 5CXUA 2ZCUA 3QE9Y 1NR1A 3U4QB 4BEVA 3HO6A 4NQRA 3FPSA 2G6BA 2VAXA 3OIDA 4OKSA 1I7DA 1OPRA 5DIZA 2VHZA 1ANKA 1YDMA 3Q6MA 1EXNA 2A9PA 5BN1A 4H27A 4ER0A 2PD6A 2BHNA 4FGWA 4H08A 3REQA 2PPLA 1C4XA 1KKUA 1HG0A 4IR7A 5DYTA 3NBAA 3HZRA 2UUAB 4O4HB 1GTZA 1L7XA 1NVDA 2E6KA 3A32A 4X7MA 4KXUA 5IC5A 1M8PA 5CM8B 3K2IA 4B4DA 4MRAA 1C0LA 1DAMA 4TKUA 2G4CA 3BZBA 4FHEA 1AB5A 3JD4A 3LBIA 2JI4A 2JW5A 3WRWA 4U2FA 4ENTA 3E84A 4FOTA 2ON6A 3SM3A 4ENSA 2AZXA 5HIIA 4PX3A 4AJNA 3Q8KA 5J9FA 1O57A 4RHUA 4LOJA 2Y1KA 3LL4A 1CUIA 2WTNA 4CKEB 4MR7A 4EK9A 1PL6A 5DHSA 2AJCA 4BKQA 3V2HA 3THXB 3VYUB 1MC1A 3FSEA 5DIFA 4EA6A 1W93A 4A0HA 4CM8A 6YASA 2ETXA 5FBVB 1FU4A 1NKVA 2XNHA 5I7SA 3AM5A 4N0MA 3VYVA 3KVNA 4ZTUB 1TUIA 4RHEA 1R4NA 2WWWA 2ZJ8A 1W5BA 1FJ2A 3MBIA 1F8FA 5AVXA 3JQCA 3UJDA 2Q2OA 3C16C 4BVBA 3D7SA 4AX4A 4EI2A 3AHDA 2SECE 1TI7A 3EOAI 1EUCB 1KJZA 1B6TA 4DLLA 3D8TA 5SV2A 5ALFA 3BE4A 1M0WA 4C1BA 2QTVA 1G9XA 3FCYA 4DQXA 3BORA 4ND1A 4X95A 4L8WB 1EFVB 4NESA 5CIWA 4NEHB 4I19A 1GJRA 4R3UC 1W4AA 3KWJA 1CYEA 1BA3A 1WXHA 2JCBA 4PS1A 3LLUA 3PE3A 4L6IA 3U6BA 4KO2S 4D3ZA 2M6SA 5FOUA 1R9JA 5EXPA 2YVLA 2AZMA 1AY0A 5TC4A 4ZZ3A 2HQBA 1VL6A 1WZ2A 1K4YA 1YCFA 3SGLA 2VP3A 4II2A 4YRFA 1N2CE 1CJSA 2X3YA 4YLEA 5K3EA 3FTFA 4YECA 2H1HA 1L5RA 1DKMA 1Y7HA 2GUWA 3BXGA 3LDFA 1Q17A 4PV7A 1I10A 2WINI 2Y3IA 2AQKA 4HATA 2HA2A 4ZU3A 1TXGA 2WV7A 4RW0A 2R751 1FTNA 2Q7OE 5FTWA 2Q99A 3H0CA 4MB0A 4C22A 4D4KA 2JGEA 3FYHA 2HI0A 1AE1A 2V1XA 1BJTA 3IEIA 3KFXA 3UQZA 1W9MA 3TR5A 4ZI7B 5KQSA 3PZBA 4MLDA 4BY9E 2QS9A 1OIVA 2XOXA 3GJQA 1VPTA 3RHSA 3QFSA 5FHRA 3QUTA 2HEIA 5JXHA 1NQ5A 5EE5B 2F3SA 2NXWA 1N6PA 2R2GA 1T4CB 2O3JA 2FRDC 1GUAA 3VISA 1FOEB 3CUTA 4KQEA 4R2LA 5KWJA 1N4DA 4NCBA 2YJTD 1EFLA 3THWA 1KZHA 1TZJA 4PNEA 2YXDA 3PHBE 2HDHA 1X7DA 1ZOIA 3X2FA 3FIUA 3NAZA 3CISA 4IOLA 4RPKA 3DDHA 2C2ZA 3PFNA 4WXMA 3CE9A 2YTZA 3TSYA 2XCSB 1M7GA 1WCIA 3PCRB 3G5LA 1Q7RA 4J7UA 5BOVA 4HMQA 5FWXA 1A8UA 3QMVA 3WYDA 1EIZA 3M5PA 3DB2A 3QI2A 2PGXA 4EB0A 1D7AA 2OV4A 1S01A 4U7DA 5BT8A 3RRZA 3R3WA 2PKCA 5GONB 3NIBA 1WMBA 2YIDA 4P5DA 2X2EA 4UD2A 2MWMA 3ZDBA 5J3JA 3CZ5A 4B6PA 2WAXA 3CIOA 3UFXA 1JDZA 1Q2XA 1XCLA 2F3RA 2ODAA 4JGIA 1CEEA 4MP6A 2JCXA 1KNQA 2NXJA 3HA3A 1UMCB 2NU8B 4FMDB 5HTKA 3RJTA 5GVSA 2Q6IA 2ZWOA 3RSLA 4JBGA 4NZOA 5C7OO 3UN1A 2WU8A 1ZD9A 3OPXA 5J23A 3LKDA 3E1KA 3HN7A 4BJ1A 1HDIA 5CDTA 4AZWA 4DG5A 1T6YA 3NT5A 1Z2EA 1WBJB 3PI7A 4U02A 2QL7A 1F2UB 1JUDA 7MHTA 3DMHA 4GKBA 1O9HA 1SBTA 1AUXA 1SD5A 4L78A 5L6LB 4RMIA 2NP7A 4IJKA 1AQLA 1YRBA 1W5SA 3FTPA 3O3NB 4XGQA 1FA9A 1RLMA 5AKKA 2PNJA 2GILA 2ARKA 1U2QA 3SZGA 4WOPA 3S8YA 1UWLA 4IVPA 1VIMA 2Q46A 3LPDA 4YCAA 4B4OA 3QXSA 1IFXA 2Q5LA 4DRXA 1DC8A 4EX6A 2OAGA 4MS3B 5H83A 4CQLA 5GADl 4QICA 4DT1B 2REQB 1QIMA 1WUKS 1IONA 2CMDA 2R1ZA 1DEKA 3R77A 4TVKA 1QHNA 3BILA 4OBWA 2ILVA 3MC1A 5H02A 1XZGA 5IM4A 3GEGA 4XX0B 1W9HA 2Q6TA 5AESA 1M2HA 3CLKA 121PA 3DZGA 1N7GA 4FB4A 1C8LA 3D6AA 1YZGA 5A6SB 4RXMA 4MWCA 1KEEA 1RQRA 4KLAA 2WMDA 1FMFA 3DZFA 1OBOA 1WUJS 1TYZA 4OQZA 5LZ9A 2FF5A 5FPYA 1YB5A 1AIPA 221PA 1D5WA 3ETNA 2FMFA 3ELYA 4O3FA 4L2IB 2QY6A 4IJVA 1S3GA 1J2RA 3EC1A 4ACBA 2JHGA 4WECA 4LK2A 3SVTA 4TKLA 3WNQA 4NHEA 2JIDA 6PFKA 5IK2D 2FDCA 4X94A 3UT0A 2B9EA 2R1UA 2QU7A 3I6MA 3L1HA 1BH6A 3LIIA 4HAWA 1BCRA 2AI2A 2IKSA 4NYMR 1TCUA 4DHWA 4FCTA 5M5BA 3NW9A 1N7IA 3FD8A 4IUYA 1ODFA 1WHSA 2TMYA 5IK2A 1QYIA 3AI2A 4Q1AA 5FPSA 1TW3A 3D6MA 4HNHA 4YI5A 5E8RA 3UNXA 4HDSB 1VPWA 4KPGA 2CXXA 4DKXA 1SUEA 3D8HA 3DMGA 1U2RA 2AGVA 3FA2A 4K9NA 4FTWA 4RESA 3I2IA 5DHRA 1TO1E 1L5KA 1E2HA 1V8DA 3BSYA 2KI5A 4IEIA 3W7VA 2OHVA 3LCCA 3T5BA 4EG5A 1FQWA 1ZBDA 4LQLA 4LF7B 1U28A 2XJ9A 3HLTA 3WDSA 4NL4H 2AI1A 3PL5A 1VCOA 4MV6A 4UUOA 1TO6A 2C96A 5BVGB 3R5HA 5CAEA 3ZBPA 5T64A 5A5VA 1VBFA 2N75A 4M0DA 5EP2A 4FMPA 1WPGA 1TZBA 4ZODA 3VKWA 4EG3A 1XJCA 2C99A 3GAAA 3TXAA 1ZRSA 2W6ID 3MNFA 1FFXA 3FLAA 3O9VA 5DGHA 1I32A 1YHNA 3OQIA 4FFVA 1KO5A 4AG5A 2O8DB 1M2JA 2QXYA 2FZ5A 1QHSA 2V4UA 5JO9A 3PFIA 2YC4C 4W1PA 4XJSA 4DADA 4EHFA 3D64A 4O33A 1A4UA 4BNWA 1UKVY 2OUKA 2QQ0A 5E6SA 4F5EA 3CF4A 2W6IA 1LWOA 3RVLA 3J80A 4B7XA 3B3QA 2HSGA 1L9XA 4HB0A 5D3KA 3V4FA 3CLHA 3MEQA 4Q9LA 3PRHA 2QD4A 5JNVA 1DJOA 1ZKDA 1RRMA 3PFWO 5LZ7A 3FHTA 2XVXA 4ZO8A 3U4QA 3GG2A 3TD6A 2QW0X 1AMOA 2EWWA 1Q0PA 1BWQA 1HUQA 2BGNA 5EE9A 1P91A 3TZBA 5JBIA 2FPLA 2G9QA 2Z9BA 4CIWA 4L57A 2QM7A 5G40A 1XJ5A 1JI0A 1Z3IX 4M0MA 3N0TA 1P17A 3N2GB 1G16A 1GPKA 2PFGA 4DARA 3DDWA 4KREA 1P7CA 4O4HA 2VF8A 2ZT5A 5H9VA 1W73A 1L5GB 2GBPA 1NJ2A 4CODB 1KBZA 3L8FA 3ZCUA 2QM0A 4NICA 2YS7A 5JSUA 1ZIYA 4RDXA 4CDRA 3AKCA 4B4KA 1A97A 1Y33E 1P18A 3R9WA 1XTJA 1XI2A 3PS9A 2OHJA 1ADCA 4KLZA 4LHSA 3K8QA 4Q4AB 4YRCA 1VLMA 4XE5A 4AIRA 3OEHD 1F7VA 5I8WA 3GY0A 4CKEA 5B4TA 3OZIA 2WIDA 4QTUB 4RZQA 3CQ9A 3THXA 1HE5A 3SZRA 3CNOA 1Q2UA 3DAGA 3BXXA 3ME5A 2OLEA 1RYFA 1ISIA 1NBAA 1JMYA 2YXPX 3IUEA 2C94A 1Z0FA 2F7SA 2QZ4A 3D7MA 3OEHA 3OZGA 2ALJA 4HDRB 1VHJA 4Y9TA 3D6HA 3R7BA 1X13A 4CV1A 2GRUA 1S89A 2O2YA 2RKOA 4IOJA 2RKBA 4QZVA 3IAS1 3B36A 3KNZA 5F3RA 1KTIA 5EIFA 3OX4A 3GLKA 1U0OC 4U7GA 1EUCA 4UHCA 1U8FO 2PD3A 3PJFA 4U7TB 1LBHA 4HR7A 1KYVA 4BLWA 2V6GA 1E3MA 1V5EA 4CEJB 1EFVA 1KPHA 1YB6A 1OLUB 3FKJA 4LTDA 1V8OA 1T1JA 1YD7A 3FOWA 3W9SA 1U0EA 4BX2A 1IOWA 3V48A 2BFPA 2X5OA 2A2ZA 5E4JA 2GNPA