1J7JA

Crystal structure of the hprt from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
163
Chain Sequence
b'HTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGSFMFMADLCREVQVPHEVDFMTASRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQRYRHLPYVGKVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine phosphoribosyltransferase
molecule tags Transferase
source organism Salmonella typhimurium
publication title Crystal Structure of the HPRT from Salmonella Typhimurium at 2.3 A Resolution
rcsb
total genus 51
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j7jA00
1VCHA 1I0IA 1TC1A 5JV5A 2P1ZA 2AEEA 1JLSA 5JSQA 1UPFA 5EUCA 3OZGA 1L1RA 3M3HA 5ESXA 5HKLA 3N2LA 4M0PA 3LPNA 2PRZA 1QK4A 3GGCA 1I0LA 1I5EA 4OHCA 4RQAA 5BRNA 4RQBA 4RAQA 3EFHA 1XTTA 3MJDA 1G2QA 1HMPA 4P86A 1BZYA 5K51A 3DAHA 4RHXA 1Z7GA 1VDMA 5E38A 2JI4A 4QRIA 1DKRA 5ESWA 4P82A 1OROA 1BD4A 1QCDA 4RHYA 4FYMA 4ZFNA 1CJBA 3ACDA 2EHJA 3NAGA 5KAPA 3GEPA 1OREA 4KN6A 2YZKA 4S2UA 4QYIA 4JITA 2PS1A 1DQNA 5BQPA 5HIAA 1W30A 1XZ8A 1G9TA 1QK5A 1Y0BA 2FXVA 5BSKA 4RHTA 1D6NA 1IBSA 1VSTA 4RADA 1PZMA 2VFAA 1G2PA 1DBRA 4RAOA 1P18A 4M0UA 1QB8A 3DMPA 2PRYA 1GRVA 4X45A 4WMLA 4P3KA 2H07A 3ACCA 1A4XA 1P4AA 1V9SA 1STOA 4IJQA 4RANA 4X44A 4RV4A 2JKZA 1U9ZA 1WD5A 1HGXA 4P84A 1O5OA 1OPRA 4WN3A 3S5JA 4LYGA 4RABA 5BQOA 1FSGA 3ACBA 4LZNA 1YFZA 4P80A 1A97A 4LZAA 4RHUA 1QCCA 2E55A 1ECJA 3H83A 1A96A 3QW4B 1XTVA 1DQPA 1I14A 3MBIA 4TWBA 3OHPA 5IAOA 4LYYA 2WNSA 1JLRA 3GGJA 3OZFA 1GPH1 2JKYA 4F8EA 4Z1OA 2H06A 1ECCA 1ECGA 3HVUA 4LZOA 2GEBA 1TC2A 1G9SA 1XTUA 4MB6A 2JBHA 4P81A 1DKUA 1NONA 2XBUA 1UFRA 1U9YA 1ECFA 1ECBA 1QB7A 1ZN8A 5KAMA 2HCRA 1P17A 2IGBA 1AO0A 2C4KA 3G6WA 4PAWA 1MZVA 1ZN7A 4PFQA 1LH0A 1P19A 1A95A 1R3UA 1ZN9A 1QK3A 1XZNA 1A3CA 4P83A 4QYIB 5IPFA 1NULA 3KB8A 2DY0A 4JLSA 3LRTA 3O7MA 4M0KA 1J7JA 4RACA 1A98A 1O57A 2H08A 1BD3A 3DEZA 1I13A 1UPUA 1L1QA
chains in the Genus database with same CATH superfamily
4RQUA 5ELMA 5FIUA 4DB4A 4DUYB 3BD6A 3MTDA 1NIPA 2PXXA 4TRNA 4HUJA 5FJJA 1HH4A 1Q0SA 3FDZB 3OFNA 1KQGA 1KZ4A 2IH5A 1WHSA 1WCYA 3ZG6A 1THTA 5FWXB 3ASUA 4W9NA 2OVFA 2XWSA 5CX4A 1WF3A 3U3RA 5JCPA 1MLDA 2JFHA 4JUCA 5AH0A 1FMJA 5DLDA 2OP0A 4D3SA 5JSFA 4HGOA 3OCVA 1DEXA 4HGPA 4KTVE 3DCNA 3IE0A 4A8PA 1XZKA 3AB8A 3BSWA 2QVBA 5FULA 4MRMB 3I2JA 2Y71A 4OUDA 3MINA 2GMWA 3CRRA 4EG8A 2EIHA 1ZAYA 5DXJA 1JKJA 1KH1A 2O50A 3E22B 1T8PA 3OQHA 1O5IA 2CJFA 2R48A 2R1TA 3BXXA 3W2FA 3U9LA 1GRRA 2QTWB 3IHLA 3NAGA 5EP1A 1KE1A 3CLTC 3W06A 5J23A 4WEQA 2J6CA 1HG1A 1KU0A 4RL6A 2WUDA 3VX3A 2L69A 5JR3A 5BR7A 5CG2A 3PI7A 5EJ4A 2P0EA 1SXJA 2ZYRA 5AVJA 1RT9A 4EKYA 4GMXA 1KK2A 3O2JA 2UXCB 1T5LA 4HDNA 3PS9A 4HB0A 3QLVC 3DT6A 4CF7A 5B2EA 3TX6A 3OECA 4JK3A 5LQCA 1WRBA 4RFSB 1UOPA 4IVPA 2IYFA 1ONSA 2OMKA 4PTZA 3EZNA 1ENPA 4U4AA 1U1GA 1YR2A 1CZNA 2A33A 1TVKB 2B8NA 4MGKR 5EJMA 4BX2A 3CY6A 2WMDA 4BQSA 2O5CA 3RC9A 3WLJA 5KYYA 1NWCA 2PR7A 4RULA 4YJKA 5CIWA 2JK0A 4FLFA 1JVSA 3ZVMA 2O54A 4WUTA 7REQB 4L02A 4L9AA 2W6JA 4J0HA 3I0NA 4CLXA 3KQKA 3U81A 1JFLA 3E0XA 1TD9A 2X5JO 1JB9A 3WICA 5CB4B 1UMDB 2IRWA 3L4EA 4O4IA 4ZAVA 2XQKA 1FXSA 2EQAA 4AD8A 2Y1KA 2GRAA 3N28A 4IOJA 2I3ZA 1KRWA 2FRDC 3CUTA 4ERNA 2G4LA 3DP9A 4N8SA 5CNIA 1Z6XA 3EF1A 3GLGA 3P71T 5H8WA 2BFPA 4M0LA 5C7LO 4FR5A 2AOXA 1WCXA 1OGIA 2J6BA 4Q7JB 1CQZA 4MCIA 1RLJA 4UE3S 2VDMB 3LX8A 4MICA 1RJWA 4J0IA 2ERXA 3OU7A 3UYKA 4FB5A 3A6PC 4G0PA 3HEBA 2OAEA 3ZLTA 3HRHA 1JTVA 1EFLA 4RW0A 3LBHA 3AEZA 4B34A 4BNXA 1N8TA 3C15C 4TXMA 4UULA 4D8YA 4EB8A 2I6TA 4RDHA 3MWKA 3UC5A 4OSPA 1APBA 3R0XA 1Q0QA 3Q6MA 4ZVRA 2GK7A 5G4KB 1H5QA 1IUOA 4EZBA 1YR8A 4DA0A 4WNCA 3DZBA 1GPMA 4YV1A 3W2IA 1XDZA 2XIQA 1YZ3A 1U0HC 5D5PA 2CL6X 2P6UA 4N3CA 1Y4UA 2QTAA 1J8VA 3AK4A 4EITA 4M1MA 1WB6A 3P32A 2O7SA 4QARA 1PW7A 2CXTA 3I8OA 5EUCA 1TQ4A 1RRPA 4DLNA 1EK2A 3A4NA 1BTOA 2FGJA 1XDGA 1YZNA 2BKVA 1TJ5A 1SRQA 2R8OA 2BMAA 3LYLA 3PF8A 3PJEA 5LA6B 5FBHA 3ERCA 3A10A 3DZ8A 3U1TA 4QU5A 4GL2A 4XEUA 5DM0A 4YJ3F 2PRSA 3CEMA 3GAMA 1FP4B 3VOBA 4BX3A 3L84A 2IJGX 3MJCA 2HNKA 4KC0A 4KZPA 4M1OA 3IT3A 1V5IA 4X95A 4JQYA 4LDNA 1SVMA 2Z57A 2QN8A 1YDFA 3GVHA 1DARA 2BHNA 5JH7F 4D26A 1SR8A 1JL3A 2ZE8A 3K1TA 3OCWA 4HXFB 3IVAA 1RAGA 4J1TC 1E0AA 1GKIA 1N7JA 2V7QD 4A10A 1X38A 2YWRA 1CUEA 3ZWMA 4FD2A 4P22A 4PW0A 2PYZA 3PLRA 4YAFA 1NHGA 2SHKA 1UQTA 3DEYX 3ENZA 3O90A 2WE8A 4G85A 3AR4A 1THZA 1YQ9A 1VG9B 3ZE7A 4RJIA 3CVXA 4ITRC 1VLQA 2FW1A 3PHJA 3ME5A 2QZJA 1EYZA 3EN0A 1WV1A 4K03A 16PKA 2ZXFA 2ZWPA 3KB1A 4CU2A 2AC4A 4B4WA 3LQKA 5TX7A 2FW8A 1K6XA 4OHUA 2CD7A 9LDBA 4MMXB 4COKA 4N5IX 2OCLA 3L8EA 4BLQA 2Q6KA 1HGXA 1RLUA 1UFQA 4JIMA 3PD7A 4ZAYA 3ZK7A 4DCJA 4F4FA 2B4QA 3KOXA 1IDOA 1QHXA 2KSQA 1XMJA 1JFFB 4BC0A 5C1DA 1IBLB 2QW1A 3QVOA 1HX7A 4RABA 4RSHA 3VDQA 2R8YA 3AF3A 3FKJA 5LFAA 1N8NA 3A28A 5IDVA 2OCGA 4QU0A 3VV2A 4Z4IA 4AY3A 3BSFA 1FFYA 4BO6A 4O4IF 3C4VA 3GPIA 3VH2A 4FYKA 4BKPA 4AUEA 3E7FA 1MH9A 1VI5A 3BHNA 4W5RA 3DW3X 4LRSB 4EHIA 3A04A 2XGMA 4KUHA 1H0KA 3SDZA 1ZCJA 1TJNA 2D5LA 3GFBA 1B8UA 3ANXA 2FEMA 4ZOCA 3LO8A 4NFHA 3LC1O 3LT0A 4FDTA 2PH1A 3HEAA 1M54A 5K9ZA 4ZEWA 4P08A 1OBHA 3UXYA 4C4RA 2H4FA 1ECFA 1RKXA 3D8NA 1QZUA 2P68A 4OIFA 4U2GA 1G3IA 5JNTA 2H85A 2AOTB 2IGBA 3HXQA 1ZMBA 5ALSA 3KKNA 3ZXYA 2YQ5A 1N3YA 2VTDA 2HKIA 2P78A 3BE4A 3TDKA 3FJYA 4HQNA 4FK8A 4ZDIA 5JNSA 1KORA 3B3GA 3TDNA 3ETJA 1N2SA 4BRZA 1KI8A 4CM7A 1FF9A 1RRMA 3W34A 3QEAZ 3SK0A 2QM0A 4JC5A 3TW0A 2V0GA 4J0QA 4NONA 1P62B 4OY3A 3KP1A 5DMXA 1KJIA 1L4UA 3L0OA 4DXHA 3ADDA 3E0QA 5B6JA 1AIPA 2WIKA 1SQFA 3T9AA 8ATCA 3A2MA 1HDZA 3PXAA 3VR6A 4GR9A 1OVGA 2ZKLA 3JZIA 2VT7A 2W2QA 2FX5A 4O2AF 1JAXA 2JEZA 3EIUA 4HXEB 3DKPA 1US8A 3ECSA 1R18A 5DNVA 3SEAA 5BN3A 2DP4E 4XGKA 4V0NA 5AVKA 2WVAA 5IF3A 1KOJA 2CMDA 4BCCA 2C0QA 3EOAI 1QR6A 2GFIA 5EY5B 4FC6A 1F17A 3IV7A 4P35A 3ZGYA 4RQBA 1J8MF 1KXZA 2W4QA 3EIEA 3MIZA 4P86A 1NKVA 3W5SA 3M1AA 4BVLA 1C0IA 2XNHA 2G4CA 5DHRA 5CFLA 5K0TA 1NTRA 4C0LA 1YVEI 3FWHA 1FX0B 2PY6A 5IK2D 3DH0A 2JI4A 1ZEJA 1DIRA 4UHKA 1XZEA 1J70A 1FTQA 4LTNA 2CDRA 4WE3A 3VKUA 2SECE 2NU9A 3I6YA 1JSZA 4CM4A 3ESQA 2IVFA 4K6OA 2FUG1 5GONB 1QOZA 2XCQA 1HE4A 1C1DA 2HWUA 3F4LA 1PDOA 5HEKA 5I5GA 1X7DA 1WBBA 2J9YB 1A8QA 4CMCA 1X7WA 1HOXA 2AKYA 2X8WA 2HSWA 4HYQA 3GVPA 4ZQBA 1P39A 2R6DA 3BKXA 2HPZA 4B84A 1HQCA 3TTTA 3RVRA 5BV2P 5IBCA 2F1JA 5MN4A 2CMHA 4G6ZA 4MCHA 4V0KA 4L0QA 2EF1A 3ITDA 1XJ5A 3U4DA 3CRVA 2O8BA 2JFWA 1R8JA 2OPHA 3WFJA 4PYLA 3BZWA 4IJQA 2Q6OA 4POAA 1W6RA 4L74A 5JCZA 3O8BA 4BTLA 4G0NA 3VXKA 1M0SA 1QDEA 2C7VA 2QLNA 4D0GA 5ECDA 1WDTA 4K87A 4PFSA 4F7DA 3LLVA 5EGSA 2Z6VA 1WQ1R 2FPGA 2ISQA 3WLHA 4HLDA 4PRZA 1RXEA 4JI2B 1QQ5A 2PGJA 3OQJA 5AJTA 1RWQA 5GZ6A 1NUQA 3VR4A 5K3OA 3OJFA 2ODWA 2CV2A 4OH7A 4QNNA 1GLGA 4I6EA 4QNRA 1CEXA 2FUNB 2QAGB 1QLJA 3NTUA 3IULA 1TJPB 3PFBA 1C9YA 2QMUA 1E4OA 4GYKA 4BFWA 3BF7A 3CTPA 1IPHA 3DE5X 2EHDA 5A9RA 1ADGA 2HLDD 5A71A 2E3JA 2AJLI 5E9QA 3RRXA 1AK9A 5A5DA 1XQ9A 3LP8A 3WGGA 1I1OA 5JEEA 1AK2A 5CURA 2AOWA 1XXHB 3A9RA 1GIAA 1W4BA 2WUEA 3GJ7A 4GDMA 1EXMA 1IOZA 3PRJA 4G67A 2XDWA 2FQQA 3TNFA 1JMKC 1GNTA 1COWA 1XEAA 2V6FA 4Q39A 4FGUA 4P6VF 4DM7A 5ALVA 5CK5A 1M2WA 2X0KA 4B3GA 1K63A 1T2CA 4JR1A 4K9KA 2PSHA 3W2TA 4B2IA 5JDCC 2C5FA 4O5OA 2WT9A 2N3ZA 2P9TA 2VLIA 3DSRA 1CDZA 4PU0A 4DHWA 4IEFB 2ZAOA 3HGTA 4GP9A 3E9YA 4BN0A 1TLTA 4EL0A 4TVSA 3B48A 5D85A 4CQMA 1E6WA 3ASVA 2W37A 4QYXA 4YYZA 3EBPA 4N18A 4RTOA 3GBSA 2QSUA 2ZRNA 3A1EA 4JI7B 2ZS7A 1L4MA 4MPTA 1SBNE 4MO2A 5TXGA 2XODA 1TL7C 4FWTA 3HJCA 3KS9A 4FOTA 4GOOD 4BNLA 4DA9A 2JGAA 4BUJA 1UFKA 3O3MB 3CXRA 3FIJA 2JATA 3IKTA 1WTCA 4NKRA 1DX9A 1GSOA 1XMSA 1R0WA 3JATB 4O3FA 3HBFA 1RAHA 4F3CA 3B36A 5AK0A 1YMVA 1XU4A 1SVNA 1IY1A 2MR5A 1KK0A 1W1WA 3QOYA 5HA5A 5TF4A 4QELA 4QX6A 3TIXB 2PT6A 1GQFA 1NJ2A 2OSBA 4HT3B 3BCSA 4MV5A 1IPEA 4HYEA 1E2KA 1Y5RA 3CEHA 1E9DA 3LT5A 2G3YA 3OWOA 4GGPA 4RKEA 3HVHA 4UARA 1O94D 5FPPA 1MX3A 1N5RA 2ZOSA 3B5JA 3R3ZA 3RIGA 3THWA 3VR2D 4DXAA 1OV6A 3M5PA 2IXGA 1S2GA 3KE9A 2Y0DA 3ROXA 4G1VA 4D6YA 1BXGB 4J4BA 3QE9Y 3TIFA 1XAGA 3WMRA 1T4GA 4IDQA 2BBOA 4FGKA 3CUYA 5A3SA 2X13A 3N76A 4NBLA 2MSLA 1R1DA 1E3WA 3B1JA 3LVBA 3TB6A 4BLPA 2O2IA 1FZQA 1E9FA 3AC0A 9ABPA 4G1UC 4B3SB 3SJ7A 3NHUA 4G8CA 2FJPA 1ZUNA 1PQWA 4R9NA 3FGZA 5E7MA 2Y66A 121PA 3X1DA 2M98A 1ZH8A 1E1QD 2ORWA 2M1ZA 5A6VA 3OQ1A 1VI2A 4LC0A 3ANMA 4XB2A 3S55A 3C4QA 3NHZA 1VKRA 4RUKA 3ELYA 1LXCA 2BBWA 3BL5A 4FHZA 1OV4A 5KUTA 2RKWA 2OUIA 4FKZA 3LT4A 4C6SA 3W5CA 1C4KA 2YNMC 2ZSJA 3C7DB 3QPAA 2LCIA 4DCVA 2A1UA 1A97A 2FLVA 5CD1A 2Q6VA 4DIDA 4JJKA 1U28A 1Z18A 3Q8XB 5EC8A 4YT4A 3AONB 3D6VA 1B1AA 3BIWA 2I76A 5ISMA 1Z4PX 2BH9A 2NT4A 3KTOA 3TD2A 3B5IA 4H7KA 2XXBA 3VPAA 1CF4A 2IBTA 2GN0A 3NHPA 1R8YA 1Z0KA 3AEUA 3IUYA 4X7BA 2KB0A 1HNXB 1VPVA 2WDZA 5CJ2A 1GGFA 5BQ3A 3H0CA 4C87A 1XQWA 3ABQB 3MD0A 1OZ0A 2IX3A 1EGQA 4AMBA 5DLYA 1RE0A 5MN5A 4MV3A 1VYVA 3T1VA 4NC9A 1I6WA 1HUQA 4AJ4A 5I7WA 3GROA 5KOHB 5JYBA 3LGXA 5JPCA 3CA8A 3ZHRA 3SM9A 1UXIA 3IURA 4JI4B 3H8SA 1BU5A 3ZGLA 3W5IA 1NI4A 4CLOB 4DDUA 1NVAA 1IM2A 2OESA 4LHEA 2UZ1A 2OQRA 3AZOA 3IDSA 3GFTA 4CHTA 5E1BA 1TECE 4HP8A 4DQDA 4NV3A 1PRYA 5ALOA 3KJEA 4UJ5A 4M1QA 4NVRA 2FEXA 5KNDA 3HR7A 1N3IA 4KXQA 1ETHA 2ZBDA 1HL7A 2VDKB 5GMOA 2DTDA 2ZB3A 1VQ1A 4R2MA 2HNBA 4IH4A 4YIKA 1P2TA 1ZIOA 1B15A 2WW8A 1QZXA 1Z08A 3OJXA 4Q0MA 1H0RA 2I91A 4L0CA 4PICA 5E9JA 1L7AA 1PQPA 4AVYA 3EOBI 1Q3KA 4BNGA 4XVCA 4KMRA 1DELA 1D2CA 2C2YA 4BB9A 1Z2DA 1GGVA 1ZH0A 2QA5A 1FYWA 2OMEA 3CLSD 1SCQA 1UXHA 3KALA 3M4ZA 1ACMA 3MUFA 3MCUA 1DZ3A 3Q7IA 3E15A 1MU0A 1Y3AA 2BFMA 1UK8A 1FY2A 2XTAA 3JD4A 1E3WB 3F3MA 3I30X 3NG1A 1JEDA 3CRMA 4I9GA 3E35A 4EVQA 4FNOA 3WY9A 3KT3A 1YFKA 4WNIA 4MEJA 1CJKC 3W4JA 3H1AA 3HVKA 4CCYB 5HRUA 3JRNA 2XX3A 3TFOA 2PVCA 3LHDA 4MHSA 4ND6A 3DXFA 5JNUA 3ZJ4A 1GG8A 1K4KA 2ETVA 4YROA 4US0R 3KJIA 3HV2A 3B60A 1DRUA 2UV8A 3SCZA 3KETA 4KQIA 1AY0A 2FR8C 2W7TA 1J0BA 3VYSB 4PY2A 1GTJ1 3A4IA 4DQVA 1A5ZA 1PWYE 3AHDA 1U0JA 4XLLA 6ABPA 1GTG1 3GZTB 2HR1A 1MNQA 2I7VA 3PC2A 2JLUA 4RLHA 1WCIB 1JJFA 1FK8A 1XVIA 2WJIA 5GINE 3O91A 3PKJA 3MBOA 3KU1A 4RYDA 4UC0A 5JJKA 4G0MA 1U5BA 3E5HA 1KQFA 3ZTYA 3C3EA 1OXUA 2HM7A 2V7XA 4TXJA 5CEFA 2JGMA 3EEQA 2A5DA 1CY0A 1M1NA 3O31A 2FZKA 1IZZA 2I8AA 1SKUA 3E9EA 3MJ4A 1DC6A 4H08A 5ABPA 2X8JA 1FSGA 1U94A 2J08A 2ZB8A 3IT1A 4X24A 5REQB 4EJFA 2IV2X 2PUHA 3HUTA 3DE4X 3NGLA 1M8KA 3ZBPA 4QBFA 1EA5A 4UKDA 1W0CA 3NU1A 3N9IA 5CH5A 5T5QA 4HGRA 4KPUB 3RK1A 5FDFA 4UDOA 1FTGA 1KYIA 4ZCIA 4BCDA 1II8B 2J48A 4L2IB 2PCLA 4DTCA 2W11A 3NHWA 3BDAA 2BGKA 2OV3A 1KYYA 1C2YA 1A2KC 1DBPA 1F6WA 2OV4A 2JFXA 1N2EA 3FI0A 3IVMA 3L7DA 2F1OA 3MMPA 3R0ZA 1JXOA 4GPIB 4I1PA 1HEYA 2NACA 2NU7B 4GXRA 4MVJG 2WE7A 3I9FA 4M9XA 4RVNA 5AYVA 5LBUA 3TMYA 4G07A 3MW8A 1QVZA 2J5BA 2ZFUA 1VHWA 3BMQB 4NMHA 3N3BC 2P35A 2X77A 3ZLUA 1CNFA 1C3EA 1R5NA 1V96A 1ZA2A 1U2SA 1IONA 3L5KA 4IJVA 3SSAA 4BLVA 4FLMA 2G0NA 2BLNA 3O2NA 3PSAA 4E5KA 5JECA 5BUCA 4W4TA 1Z3IX 2H2IA 3TLZA 4UQPA 2NXWA 2ODNA 1IFXA 4TWAA 3SG0A 3UF0A 1KO7A 5IWAB 4MS3B 4WA7A 4B1FA 3T7TA 1Q16A 1OX6A 3ZCSA 4BUCA 1FNNA 1XKTA 4CLRB 3EVAA 4E5NA 5LU9A 2NQ2C 3DE3X 4JUFA 2BEWA 4DDHA 1L1QA 4E08A 1BE1A 2DZDA 2FUKA 2G6BA 4QYMA 1U0OC 2G76A 5CD9A 4FHDA 4MWTA 4I9FA 4RZQA 4D3XA 1O0SA 4LXTA 4GBJA 4CM6A 1NVBA 2ZIXA 4HDOB 2WKRA 1XELA 4L8YA 3RREA 4FW9A 4RK7A 3BIXA 1HR0B 1E0JA 1YQWA 2QN1A 1RI3A 3B6EA 3FWPA 3OETA 5AUQA 1KH3A 4F3KA 5BV8A 2NWQA 1IUKA 5HBRA 5EZ6B 1MBZA 3D9QX 1PTJC 1IWBB 1X80B 4OQDA 4K8RB 4XQGA 1XKXA 3RIYA 1BW9B 1JAHA 2ZPAA 4DZZA 3DB1A 1XHFA 3F6BX 2JIBA 4JB8A 1DEAA 3SC2B 4WLEA 4XX1A 2C3YA 5IC5A 3GJSA 2Q3BA 4MWBA 2OHOA 1SU8A 3E1SA 3B6JA 3PQ8A 4DSAA 4ZA2A 2F3SA 2OZVA 4WZZA 5GVSA 1YR3A 3T5MA 1RWKA 3HKDA 4LC9A 5GQSA 1L5HA 4UQLA 4LQ4A 3FLMA 5JD4A 3C8MA 5LQMA 3HK2A 3JQBC 1N1EA 4F3NA 5KWEA 3B1XA 5E8RA 3ZK9A 3UQYS 2A9PA 1H69A 2J3JA 3T7KA 4EMTA 4XEHA 4C29A 1DTEA 4ZJPA 4H9GA 2HBRA 4NX2A 4CETA 1SBIA 5EJ5A 1L5QA 5TEVA 2VBFA 3IA2A 4XIYA 4ZTUB 4QSMA 1DXQA 1A82A 1RVDA 4V38A 5CT4A 1X0XA 3W3AH 2V5UA 1P3Y1 4CDMA 2Q1XA 4UBLA 4PQGA 3ONNA 4WMLA 2GM4A 4RY8A 2DGDA 5ECGC 3H0EA 1LPOA 1Y7HA 3U31A 1K7SN 1KVTA 1RHRA 2CYCA 3HZOA 4FQ7A 5E8JA 4XGNA 3SXUB 5A5VA 3PI6A 1WEHA 4KPUA 5FUWA 4DUPA 3FNHA 1GVHA 2QL6A 3PQ4A 4R7TA 5DBEX 3LXXA 2DF8A 5DEOA 3SLKA 3OEYA 3W4IA 1ZLYA 1ULAA 3CTMA 3HJAA 4GICA 2BE9A 5M2QA 4RVUA 1J20A 1U4SA 2DPMA 2JGLA 3AF0A 3EQ8A 5JPIA 4BAUA 4WKBA 1L7NA 3BCUA 3MQ4A 2P27A 4RMHA 4AO6A 2YV1A 4B4DA 1GLNA 1ST3A 4EB6A 3I05A 3IQHX 3HM2A 3IUEA 3M2PA 3KKQA 4HQKA 1P75A 3ZK8A 1ZJ4A 3WBKA 2IY9A 3H1FA 3NDBB 2H52A 4K9DA 2OCDA 2Z1DA 1EUQA 2VP9A 4E14A 3I76A 2PKCA 2G07A 1GUDA 3OCXA 4RTLA 3RH0A 4DV3B 4R4JA 4R0VA 3V8QA 2I6UA 1REQB 1F9AA 2RBEA 4MA5A 5EXSA 5C0OE 1Z45A 5YASA 3V8BA 1ADCA 2VOEA 4KXWA 4UU7A 2PKQP 3SX4A 3ZQUA 1FUYB 2CXUA 3HYCA 3ZWQA 4BFTA 4UD6A 1KKLA 1EB8A 2F1RA 3CGGA 4DV0B 1UFRA 1XPUA 4KKVA 3LW7A 4QUAA 1HQDA 1X1SA 2AE1A 4RJ2A 3GB9A 3RSQA 2Z3ZA 4H6VA 3ZWOA 1ESZA 4DPMA 3EXAA 1WSDA 1ZVKA 3OLCX 4XSHA 4DC9A 1NZDA 3ABOB 1JECA 3FPGA 3KEOA 4MUFA 4QBKA 4BWYA 5JISA 3OPYI 2QE6A 3A3OA 5HDQA 1B0UA 3GJYA 1XU9A 1YH3A 3MWFA 3P9QA 2J3KA 5DSXA 3T3OA 1AB6A 1SGWA 2FJ0A 1S2LA 3RG8A 4G1FA 3IAUA 3U4MA 3V3TA 1RQLA 4RPGA 3T7SA 4IDHA 4F6RA 3DEJA 3GL9A 1HURA 5IANA 3IO5A 1FTYA 4HZUA 3DLBA 3QH4A 2FZLA 3QW2A 2PZ8A 4A2QA 4H3SA 4U9IS 1P80A 3PNKA 4II3A 2HGZA 3AHCA 4PCAA 3S2FA 1SXHA 1JA0A 2BHLA 5AI9A 4BIIA 1CDDA 5CDHA 2D6FA 1ZDMA 1VJ5A 1JXAA 1GGJA 2OILA 3JARB 4DJFC 2F3TA 1ZLXA 5JNWA 1E9CA 2QMZA 2OAGA 2JW5A 2BMVA 3M6MD 1D2RA 1FUKA 3NC1C 3L1IA 4M87A 1A9TA 2D1QA 2V7GA 4NYMR 1ZXLA 4F2GA 3LC2O 5G1NA 4YALA 3ZV3A 5J4HA 4EJSA 3RM3A 4BDTA 2GYWA 3MMSA 4AW9A 3HP4A 3O8RA 1H93A 4PHHA 2ZYIA 2PGLA 2BI4A 2GZSA 3DHNA 1FFHA 4CTOA 3V55A 3LT2A 4UMEA 4KVFA 1ZA1A 3SC3A 3HO8A 3VZCA 1X92A 4BNDB 1KAHA 5A02A 5FTLA 4JR0A 1BYUA 1JJAA 4Z4QA 3ZGNA 2P40A 2HHHB 4HX2A 3R3HA 2CUTA 4K0KB 4PLVA 3RBAA 2A7XA 1T6BY 5E2AA 4YFYA 1V11A 1PT5A 3WIDA 1J33A 4KQ1A 4CCAA 4JITA 1PF7E 3R7DA 3WGJA 4ZXPA 4K86A 4PCLA 3V32A 3WLIA 1YDWA 2QE7A 1ESMA 4K7JA 1OYYA 1X0VA 1I30A 2DFLA 2XQJA 3PUWA 1PUJA 4HS9A 3AOEA 4RF5A 3TEJA 1SG0A 1WW2A 2JLVA 1A9ZA 2XBMA 1M5UA 2P9EA 4M0UA 1FUUA 2B5VA 3FFTA 1ZJJA 3EPKA 1ZI6A 2GD1O 3O4RA 2ICAA 3GMIA 1PNRA 5F64A 2XE6A 3ACCA 4MVCA 3IMKA 4KDEA 3LGSA 1P4SA 4UDYX 2XXAA 1UC9A 1G5PA 2RCNA 1II9A 3SAJA 4C7XA 4RV4A 5KJCA 5C31A 1YNOA 1GYQA 3GFVA 4MRPA 1Q7BA 5CMLA 1REQA 5FORA 4Z0TA 1L5KA 3TPCA 3UK7A 1LPMA 4A6EA 1DTWA 3O38A 3K9WA 3X0DA 4ZRNA 2AOUB 2JCXA 5EL0A 2OVBA 4J3FA 3S3TA 3ZHCA 3FCYA 4HAOA 5G4LA 3ZEIA 1C8VB 4BV3A 1DTSA 4TLLB 4WA8A 4ILKA 1K5DA 4Z4CA 3EZFA 3EA0A 4YC7A 1VCOA 3NPAA 1PR5A 3NM4A 3I62A 3L1UA 1JE0A 4MEBA 3GAZA 5FR2A 4R1PA 2RJ3A 3SHWA 2ZUWA 2ZRQA 3WV4A 1I6LA 1LJUA 3JQFC 1R8QA 2NO9A 3ETLA 4XGIA 2R7MA 4BP8A 2QY6A 4I1SA 2JAPA 1CY4A 3KUUA 4KUGA 2IF2A 4ZV9A 3ZE8A 1X74A 3WLSA 1QAMA 4NU0A 1HT1E 3A1SA 3ZJUA 3FZGA 1O95C 3LLCA 1I8TA 2V4MA 4N39A 5EJ9A 5F98A 4D56A 4PC3A 1J21A 1WG8A 3H9BA 3MEQA 2PXHA 3TJMA 4F6RB 3U39A 1HORA 3NM5A 2G5CA 1ZC4A 2PK3A 1P17A 2VEOA 4MR8A 2GEFA 1T26A 2J30A 3LBAA 4H3KB 4PZ0A 2J3HA 3WLEA 1TJYA 4NEQA 2Y1XA 3DE0X 3EEYA 1ODLA 5G41A 3TQQA 3WGUA 5BMVF 3OOSA 4TROA 5HKKA 3GRAA 4E94A 2CVQA 2X4IA 1BQ3A 3WAKA 4BO1A 5KNLA 1G20A 3ZXIA 3HCFA 4KAXA 5IBQA 1OWNA 2V3VA 4BMPB 5IHXA 1YHYA 821PA 1I1HA 2PUTA 2FUG6 4TSFA 1RXSA 3EVZA 1ZINA 1NW8A 2IDMA 4FQ5A 4KO2S 4QOJA 3CNEA 2CBZA 2XVAA 1PYDA 3RT1A 5ITSA 4EY4A 4BYGA 1G8SA 3FFXA 3WLFA 2DUWA 2B25A 2PA3A 4JKIA 5E4YA 4EATA 1BDJA 4RBNA 4R1UA 1NJFA 1GT91 1SXIA 3ZGXA 2A7QA 1H2XA 3OQBA 2POQX 5TDHA 3WQQA 1ULZA 5BVHB 5LP1A 4MWDA 4TL9A 4II7A 4HWOA 4KQKA 1YDHA 2RK4A 2QGZA 3S2ZA 3SQMA 3QPDA 3VUFA 1ENOA 5AMXA 4LGVA 5J4YA 2Y3IA 4I81A 4BX0A 2R84A 3C5EA 4UXIA 1GDDA 3DBHA 1KMNA 4UAVA 1IHYA 4GPD1 1SPXA 2Q46A 2YJTD 3FR8A 4FEEA 2Z1NA 4EARA 4E07A 3MMZA 5SZHB 1EFCA 1Q44A 2XDQB 3GQBB 1Q12A 4FDUA 4F72A 1B6TA 2JVJA 1BS2A 3Q87B 1S96A 4D44A 2OENG 2WG2A 4Q4AA 3FOAA 4GU5A 4F5WA 4C0JA 3DDOA 5EHGA 1H2ZA 3O9MA 6CHYA 5ADWA 4J43A 1D6NA 2O4CA 2Y1WA 1K89A 2DHDA 3OCZA 4Y98A 3PWTA 4F85A 2PX0A 3SYMA 3L7IA 3NIDB 2QQGA 5FUYA 3WGTA 1SC9A 4IH9A 4JLWA 3U17A 3BQ9A 1UJ2A 4COOA 4URZR 1PNQA 1L5RA 1UOEA 3RE1A 1U5CA 4ETNA 3NAQA 2UUBB 4IH1A 3HJBA 3BWCA 3AQ4A 3G59A 4OFBA 4R98A 3H2SA 2H2HA 4UTRA 1J22A 3O8QA 1HEUA 1M3SA 1YZVA 3AFMA 2FMIA 4G37A 3VH4A 2XUZA 3M70A 1SHLA 3P96A 5A7HA 4O02B 2HIHA 3QTTA 2RHJA 4MX8A 4RTMA 2V8OA 5I47A 5FD8A 2VJYA 1WVGA 3RJZA 4AAYA 1FQWA 2EYQA 3E9NA 3WL3A 4NNJA 2JAQA 1E9AA 4XQEA 3N59A 3KNZA 1X15A 3ICCA 3RFCA 1M8GA 1W1UA 4A8JA 4A9AA 2G28A 2X4DA 2ZULA 3GJ5A 3QYAA 1FXUA 1KBZA 3EGXB 4J7CA 4QOEA 2B3TA 3W5UA 4Z1OA 2Y2UA 3PJFA 4ON9A 4PC1A 4G56A 4Y67A 3WYGA 3VJRA 1W19A 3QTLA 2G63A 3PL5A 4LNAA 1NT4A 3UMFA 4DRZA 4HNQA 1TZBA 5IG2A 1P31A 3QKSB 2OT3B 4G84A 1NBHA 1J0EA 4FDMA 3KUXA 4X91A 2EIXA 3OJOA 4OHRA 1ETUA 4RCYA 2PKRA 2H4HA 2BFFB 3GLIA 4XARA 2F1HA 4URUR 1SHKA 3L1VA 3A6FA 4G5RA 1SXJE 2XWPA 4ROSA 1VJCA 2AKAB 3SNKA 1FRNA 4FB4A 1Y8RB 4MP8A 2JHFA 1XEWX 4ODIA 3IDQA 1RP7A 5JANA 3F73A 2RHGB 3G8BA 4TZTA 1G7RA 2R6GA 2AWOA 3GDHA 2JPDA 3L7JA 4F1JA 4OU5A 3ZIUA 4A5OA 3H16A 2CF6A 4CT4B 1XTZA 5JC8A 2AVNA 1V0JA 5JVDB 4MYSA 4E22A 1GAEO 3GRFA 4EYKA 1UMDA 1FP4A 6ADHA 4LF4B 1BMTA 1CRPA 3TECE 1T1RA 1UXKA 1GUZA 3L4BC 1PEYA 3FGPA 3T8YA 1PJSA 3WSTA 1W46A 2VQDA 4YRTA 2E5LB 1E3SA 3A05A 4LMRA 3B8EA 5TV2A 3I2FA 3VC2A 2ZETA 1L9KA 4ENSA 4RWEA 4OBEA 5HX7A 5JJLA 3AL2A 1S2OA 3LPNA 1JFVA 1T6YA 4HPJB 3REFA 3T99A 2OHHA 3RRBA 4LZLA 3R75A 2VDVE 5KC9A 4IBOA 4UOQA 5BO5A 3UGTA 4QWMA 1T4CB 4D9BA 5C8ZA 2CLIB 4JLAA 4RHXA 1RHUA 2WPNA 1S8OA 3IDFA 3IBSA 2G9RA 4C7VA 3W2GA 3H9UA 3O1LA 2O3QA 3H2JA 5FPKA 2FVYA 5K0SA 5J1TB 2ZI3A 3CV3A 4GO1A 3G2OA 4FZRA 2RI6A 1IY2A 1SHJA 3H4VA 1P77A 4Y2JA 1M6VB 1I5OA 1YVDA 4QJ5A 3NHRA 3MZ0A 1ECPA 5EIHA 4Z9YA 4WERA 1JN0A 1K08A 5C32A 4YMLA 4TS4A 4TSKA 2OQVA 1N2GA 4U7JA 1XZ8A 1Y1LA 4UCXA 1JF8A 1O77A 2WC1A 3HHEA 4I9UA 5KDOA 2ZLBA 3NGMA 6NULA 1R0YA 4HEHA 5LUBA 4R8VA 1U2QA 1TMKA 1ODCA 1GPBA 3RSHA 1A1SA 4LNUB 1F8UA 4Q9AA 4FMCF 3BL8A 2G1JA 1TAUA 1I2BA 3USES 1PQYA 2BPOA 4RDXA 2PZKA 2QPOA 4ISBA 1PFKA 1FSSA 2D0PB 1PJ3A 3BH6A 3KSRA 5FA5A 3GN2A 3D0KA 3TRDA 4EDFA 2X3YA 3PHCA 2O8CB 2LKDA 1VYUA 2C5HA 1A7JA 1KPHA 2EW2A 3IV6A 3NP9A 2ZS9A 2BUAA 2I65A 1N75A 1RHJA 4FJ2A 1S5PA 1MQ8B 3RIXA 1PDWA 1F0NA 5JQGB 4EKIA 1EXWA 2QJRA 3RAPR 2OHJA 1JAIA 1F2UB 4MVJF 1XZBA 4PAGA 3Q7QA 4CFYA 3ZDEA 5CIYA 3I5UA 5B55A 1QC5B 4ABYA 1EFTA 2QLBA 3W6PA 2OV8A 4C07A 3C5WP 1ZUD1 1JR6A 2FETA 4N5MA 3P2KA 4RM2A 1WABA 4EL5A 4XJVA 3JQ6A 1WXFA 3PICA 3LOQA 2FOXA 3C5CA 1RM0A 1IG0A 5J4KA 2ZTSA 1QYIA 4NESA 2Q5OA 4N7MA 4A6DA 2IHYA 1T3ZA 1YBAA 5KNBD 5ALFA 2X3FA 4D4HA 4D80A 4MRAA 5AVSA 1BDHA 3WMXA 3C5VA 3W1VA 4PC6A 1JVNA 2QTZA 3OQVA 4TTIA 4WESB 4HI0E 4IGEA 1AA9A 5TVKA 3HYNA 3KB8A 3KAJA 4IRXA 4YRBA 4BATA 1U2PA 2R85A 4I2VA 4IHKA 1GITA 5AKXA 5IH3A 4NXMB 1EG2A 3AESB 1FJHA 3OT5A 4JJAA 1XNJA 2IDZA 4B9EA 3ZKAA 4EGSA 3E9DA 1XBTA 3E82A 2H0QA 4ZGGA 2YIDA 4MAFA 4EAQA 5AI4A 2QVGA 5KIAA 1EUYA 4ZCRA 5JUWA 2Q2NA 4UEOA 4LCJA 2WQ6A 5BWBA 1QV6A 3B2QA 3O1JC 1NBMD 3QF7A 4S1OA 5A5FA 3HY3A 1UJ6A 3C3JA 3KX2A 2RH8A 4K6CA 2F62A 3L01A 1R9NA 4NBNA 1NF8A 4WZAA 5TY0A 3COJA 2C8JA 1MOQA 1SXJB 5JMWA 2JCSA 3TJZA 4M55A 3WWYA 3U5TA 3IUNA 4GH5A 5ELLA 1HMPA 5KJ6A 3RVBA 1IBCA 3T7AA 5TPWA 3AVUA 2XMSA 4C0SA 4LY3A 5IDWA 1Q0TA 3GFGA 3BQNB 4U7FA 1QR2A 2OBLA 3DMYA 1G21A 4PXSA 1YDGA 2JCGA 2NADA 4V0QA 3SYKA 2X0FA 3N07A 3VR6D 3FCCA 3UHFA 4TWJA 1WF6A 1MRNA 2FRVA 1E2QA 1EZ1A 2Z8YM 1XU7A 3KEQA 3NAZA 5B4VA 1HF3A 5CFNA 4GECA 4JS0A 4OYRA 4S12A 2ZCJA 1OX5A 5EKXA 3G5LA 5H16A 4MW2A 3CEJA 3LLSA 3ROKA 3WMEA 4DWJA 1XNRB 4FE3A 4JEMA 4D57A 1A04A 1VMAA 2FN4A 2ZVDA 2I2DA 5IMBA 3X1MA 2OYCA 4AECA 1K6JA 4CKZA 4JB2A 2E37A 3VR6H 2F4VB 4JOQA 4Z3DA 3CCFA 3KOOA 2WP0A 1TAQA 3H2IA 1DX6A 4NNPA 4V0OA 4UU1A 1TEHA 2LIPA 5SY9A 1DG9A 2ZITA 5ALPA 3GLHA 4RA9A 4Z7QB 2X8BA 3PC7A 5BSGA 5HQJA 2Y92A 1FBTA 5CPFA 2YASA 4OOFA 4FPXA 3ZV4A 2QG9A 2I4IA 2O59A 3EIXA 2WJAA 1MAUA 2VT3A 3I73A 1WMSA 3ONEA 3R6DA 3MLBA 3TZQA 3UOAB 4GDFA 3CRW1 3QXCA 4XVUA 5IM4A 4WEOA 3LVRE 5C34B 2A0KA 2PUGA 1V8FA 4L73A 4AS3A 4OXKA 4XQ0A 1VIVA 2K7ZA 5LVAA 1IQUA 1ZYUA 2NSJA 1DQPA 2ZTVA 5IAOA 1YR7A 3X1YA 3MTQA 2HQRA 1IOWA 4JVMA 4ZO9A 2OG2A 2W2KA 4MUYA 3IPAA 1GFSA 1Z6PA 2ZBRA 3AVPA 1ZHHA 4GMKA 4V3CA 2J85A 2QOEA 5IKOA 1Y3CE 4BFYA 1V4BA 4YXWD 3AUSA 3C8DA 1EIWA 3IQEA 4OPMA 2BF7A 4X7MA 1VRWA 2JBHA 1XTBA 3KXPA 4B2PA 2AYYA 2NO1A 1N2XA 3G9UA 4FR2A 4C3ZA 2VF8A 4HN4B 4INAA 1UT6A 1M1ZA 1V95A 2NOAA 4N7BA 4MA4A 1U9YA 1WHTA 3CPEA 2AR9A 1NVXQ 1XD2A 2DCMA 3OHMA 1S8AA 1J0DA 5H9WA 3ZU3A 1ISHA 3DMHA 4YQZA 3ZJVA 4TTQA 1XTKA 2YQ4A 1IQPA 1WVMA 3EGWA 2ZAIA 3HB1A 1KO4A 4LVOA 3KLBA 3VC1A 3FH0A 2IS2A 3OZAA 3JQAD 4EHNA 2FCRA 2JS7A 4CUZA 1K3TA 4CPDA 2P0AA 3DEFA 1FVHA 1HKUA 1SBQA 4V3BA 3ZDXB 4C4ZA 2ZRFA 4KI7A 4FM9A 4XOUA 5CB4F 1P0FA 4RGYA 3U0VA 3X2EA 3EVCA 5DK6A 4UOEA 3OY7A 1PJ2A 1L5LA 4YQFA 1NXXA 4W9MC 2BTEA 5G53C 5BMVB 5IJZA 1PZNA 4D0SA 2B1JA 5I4BA 2SKEA 1MORA 2OY0A 2H4ZA 2GPBA 5ALEA 5CA1F 1D3AA 1VZ3A 3LPDA 2Q4DA 4AIIA 2IBSA 4ERXA 4EI9A 2FSIA 3LH5A 1LDNA 2JDIA 2IYYA 3RVDA 2HT6A 3I23A 1XWIA 4DJDC 3PSHA 2BJWA 4L76A 2WMOB 2BSQA 1DAGA 3K92A 4Q4JA 1ZMTA 2X7HA 4Q9DA 1TEXA 2Z98A 1U02A 4MSUA 5ILGA 3TKYA 1TIPA 5C7YA 5KINB 3KUDA 2DLDA 2WT4A 4EKEA 1A2OA 1H2AS 3NEPX 5DGXA 3GPCA 4CQLB 4DLKA 2DB3A 1NQ5A 1WAMA 3LBIA 1ZUIA 3V4ZA 2QVLA 5KQRA 1NOJA 1YQEA 3MJTA 3Q1LA 4WKNA 1NBEA 2PNJA 1WCIA 2HK7A 3TZEA 1TUGA 3K6SB 5KAPA 2ZR0A 1RQXA 3IV9A 2XNDA 3V2HA 1WXIA 5EQTA 1DQNA 2JFNA 3OHSX 3IUMA 4OHMA 1ZL2A 2JFQA 5IRCD 3GEEA 3OX2A 4L8FA 2V59A 4PINA 3F97A 4R9SA 3NQ41 4QAJA 4ADSG 1E59A 4YS6A 3TIIA 8ABPA 2JFZA 1K6EA 1OT5A 1HM5A 4AF8A 4CLRA 2HU7A 4W1PA 3DWEX 1XALA 4QLBA 3W5DA 4MKZA 3D6NB 2BI7A 3H11A 4PPYA 2V45A 1YC2A 1POXA 1ULSA 1ICEA 2HY7A 3A6EA 4WCVA 3REQB 2WMNB 2JLZA 4U7DA 3WGVA 3P9NA 2IHZA 1YA6A 2A9OA 3PR3A 5A3RA 1IDN1 4B3HA 4KDCA 3QLUA 3ZC3A 7GPBA 3AEUB 3VDRA 3MRVA 3RC7A 3DA8A 3PNSA 4LG1A 4X1YA 4LZNA 5KYUB 1B41A 3TYXA 2GJ9A 1NP6A 1AUOA 4QO7A 3ORFA 3TIVA 5J40A 1WDKA 1QRDA 4WI1A 4ND7A 3Q6NA 1P7CA 2ZT8A 4YJDA 5B1HA 5CVVA 1RW4A 1KP9A 1PQUA 3MOIA 2BWJA 3QJYA 4D9MA 4DUGA 4B5KA 3PGA1 1LC3A 1MO3A 1MP0A 5U4XA 1L4YA 3B53X 2P1RA 1Z6GA 2XYQA 4P93A 5AW3A 2HV8A 3LF2A 5ALWA 1NN5A 3SZRA 3TL2A 2IXTA 4CBVA 3EEIA 1ZN8A 2N1MA 1BCRA 4V0LA 3LQQA 2O07A 4TT3A 4QXRA 5C1IA 2DHCA 3GGOA 2MIIA 2XUFA 3EY4A 1EB9A 4US1R 4Q3EA 2QL7A 4EX6A 1SEVA 1ULUA 2CK3A 4HLQB 4PQEA 4DMGA 4XLZA 2WOOA 5L3SA 4L28A 5BSWA 3T41A 2HA2A 4KO4S 2CFCA 2YHSA 2PX4A 3DZGA 1G7SA 3GPLA 3IBGA 1TMGE 1MVLA 4CMGA 3VJMA 3G0CA 3LHKA 1DBSA 2P3OA 4PX3A 4CIBA 5JJ5A 4ASUA 3CEPB 5E4JA 1FDRA 1UBNA 4B2YA 6YASA 2WM2A 3VSAA 4G23A 2EERA 2V6BA 3DOCA 4L8GA 2B35A 3G89A 2EL9A 4M9QA 5K4HA 2XE8A 3PFHA 4H2DA 1D1QA 2YXBA 4RPHA 4FGJA 5DGCA 1D2AA 1M2VB 1GQSA 1QUFA 1SULA 4Z8XA 3B3QA 3KCQA 4S1WA 4K28A 3D59A 3Q7SA 1KE2A 5K01A 1HNWB 4QGGA 2C3UA 4ATNA 1VECA 3PP8A 5I45A 3KHSA 2BD0A 1XF1A 1CR2A 4HH4A 3A1VA 4EPXA 2YRXA 4DV5B 3WSWA 3IBTA 2RBGA 5I51A 3AIKA 2D1YA 2KYRA 5FYQA 3H17A 3O9ZA 3FWNA 3CX6A 1ACLA 4UUMA 1U3DA 2AN3A 3G5TA 1HDXA 4Q6WA 4X60A 3J81k 1TM7E 3TQSA 2QMQA 2P6MA 3WGYA 1SOUA 1D5WA 1Y3BE 1X8JA 2GVZC 5D86A 3VU1A 4O4IB 4RGQA 1EE1A 3ND7A 3BMXA 3TRIA 5I7SA 2J0EA 5IC4A 2ODQA 3I52A 3OKAA 2FPGB 2J5QA 5FAKA 1E6EA 1RKUA 4NL4H 3BFJA 1AM4D 4GPZA 4M7OA 2I2BA 5J58A 2PR2A 4TXHA 1Q77A 3STUA 1M1NB 3NS7A 4Q4DA 4EA6A 2C4UA 5IT4A 1UBMS 5KQMA 2X23A 1DV2A 5I9LA 4X1YB 2YFKA 5F7OA 1EA7A 4I5EA 2IWHA 4G3XA 2XDAA 4DARA 1EBUA 4Z6KA 1MC8A 2D1RA 1VLMA 1DWOA 1CRZA 1WY7A 1G98A 1EU1A 4GQBA 5EP2A 4EEXA 3P2OA 3PDWA 1O0BA 4HN9A 1N3LA 1WHSB 2AW5A 2IX9A 3UT5B 4HUTA 1O5OA 1R00A 4YRDA 1TA4A 2XAUA 1GZUA 3GGDA 3MOSA 3S5JA 3HGQA 3LCRA 3GD7A 1EUCB 3CZCA 1CR1A 1GR0A 2GASA 2P2SA 1J2JA 1GQ2A 4GEKA 4KI0A 4MW0A 3Q11A 3KOYA 1Z56C 3OLZA 4QOHA 5F2NA 3GCGA 4RY0A 2DHQA 4MPPA 4Y8VA 1NUTA 1UBFA 1YRHA 3CW9A 3LY9A 3CB4A 3W4KA 3YASA 1AN9A 2IHKA 3HJRA 3SIRA 3SS7X 1TJ3A 1X9GA 2JZOA 4IDNA 3UT6A 2PXAA 2I9PA 2SCUA 5ER9A 1KY5A 3D1JA 3LTEA 1JS1X 4BE9A 1J8YF 3EQ9A 1Q7CA 2VWGA 5J2UA 2IIQA 5KX5A 5JXJA 1RRCA 5FR1A 3AERA 1R8XA 1L7QA 4DCUA 1UC4B 4X7PA 5DO9A 2O05A 5J43A 2CMKA 4AUMA 2R6CA 1DUVG 1S3GA 2HFKA 2E4ZA 1SC4A 4QUGA 4FCWA 2ZQYA 5FFNA 1U63A 4PNZA 2MYPA 1B0ZA 2R8BA 1S3IA 1ZN7A 3O73A 3NEAA 2A1IA 4RFSA 1QGZA 1EFVA 3S7ZA 1IXYA 1MAWA 1XMPA 3WKDA 3O8LA 3RUEA 1YJQA 4WCFA 2IOFA 4F3YA 3BGOS 4LXGA 3CUUA 4NU8X 2ODPA 1UAGA 2AF3C 3L7LA 3ZVRA 2HMAA 1IB0A 4QJBA 4I9NA 4B47A 3EODA 1T6XA 2REQB 2W71A 2WJ6A 3D6FA 2IYAA 4I36A 4DJ5X 2FSSA 3OEHA 1DQZA 4I50F 1A5AB 2PKQO 1G8JA 5JWHA 3W3ZB 1CB7A 1YD7A 2PBZA 2HMVA 3ICVA 4WD3A 4QZVA 4X1KB 3SHOA 2QR5A 1D2MA 5BSFA 1QONA 3AEQA 1E1RD 2R79A 2GF2A 4L15A 4WBNA 3PUJA 5HP4A 1QU3A 1I80A 1GY8A 5EYPA 1RXYA 2X0IA 2ZUUA 3KUKA 3QNUA 3EZLA 4ZOLF 2VIIA 4CKWB 1S1MA 1U0SY 5J2TB 2PBRA 4UHFA 1F6DA 2VZLA 5EEGA 3TMKA 2I7CA 4BAZA 4BEJA 5CVCA 1RPJA 2PG3A 1KETA 3EFHA 2JEYA 1DQRA 3R3JA 3FUXA 1YMQA 3UXEA 4X85A 4AWXA 3IHTA 2MOKA 4A16A 2Z6QA 3OKPA 2EFYA 3U61B 4U2BA 4BMVA 2DMRA 5GZ1A 4F3RA 3AW8A 3JQ8A 1JG4A 1HQYE 4HDNB 1E7YA 4M60A 1F8GA 1YZTA 2EKQA 3B20A 3IQIX 1T9KA 2GA9A 4Y2HA 5AJYA 3MRSA 5I7OA 1U1FA 2GPAA 4ZCLA 3CF4G 4C5CA 5LYJB 3C6YA 3S81A 2ORIA 1F06A 4AQYB 1SXQA 1XTJA 1VGVA 3QENA 2E4WA 2PKWA 4HPXB 1J23A 2D59A 3RVOA 3HC7A 1YJXA 3OCCA 4LMBA 5CA0F 2VNSA 5HIAA 1F3LA 4IWXA 1NNLA 1XZLA 2Q0QA 2VRCA 5JBNA 4QGHA 3WVNA 5EWLB 1XGKA 1BMQA 1GUBA 4BP3A 2UUCB 4O3MA 3N7AA 1LPPA 1PE0A 3W04A 5A4AA 3Q9SA 1Z62A 3T7DA 2P7HA 2IS4A 1ZIXA 4D46A 2EFJA 1DKOA 3KQWA 4QDKA 4KPFC 1P9WA 4EW6A 3AJRA 1G8YA 2UKDA 4BN5A 3TCNA 5BV1A 1RYEA 2RK3A 3R44A 1V43A 5AVVA 3V9PA 1R9GA 4ZU6X 1ORVA 2VBIA 5IEJA 3GJ3A 4AUNA 1OPRA 3WHPA 2DWOA 2D0IA 4KGXA 3SR0A 1J5EB 4YI3A 4V39A 1IMOA 1HRKA 1U3FA 3FIUA 1C0EA 3ND8A 3B85A 4PYIA 3VU3A 2TSYB 1FU4A 4ND4A 5KYWB 3IAHA 1QGOA 2PQMA 3VTAA 4C5AA 1L5HB 3FTDA 4GLBA 2E55A 4P0QB 3RT7A 5FWXA 2KBFA 3EPLA 1RC8A 4DANA 4QFBA 5F7ZA 2PANA 4IIFA 1FS4A 1A8SA 2RHMA 3A6KA 4WFIA 5AKJA 2RJNA 3SQDA 1R12A 1VHDA 2O6HA 4K9LA 3K1YA 1IJBA 4LUCA 1YB4A 3T0GA 1KYZA 2RI0A 3AL3A 4BRWA 4Q9HA 2IYOA 3BYZA 1EXDA 1I4WA 2QTHA 2IHUA 4PIVA 1NDQA 2CXHA 1U7UA 2Q9UA 4AN4A 3THSA 2VAMA 2VPWA 4P36A 1JPVA 2WABA 4NBUA 4XRRA 4MRVA 4PO8A 4R7ZA 4Y2QA 3C5HA 1AQUA 2NVUA 1JJIA 2DTEA 2PFSA 3JPWA 4RKRA 3KJZA 5AT1A 3IIKA 3U4AA 1WPXA 1OYVA 2X0JA 2FA9A 1E2UA 4B3BA 1M33A 1PGQA 2F8TA 4ZHSA 2GN9A 3D43A 3OQIA 1OBCA 5FXMA 4M4SA 4I4TF 2YMMA 1E2IA 1M5RA 5T4HA 2DBQA 2FY8A 2WTAA 2J1LA 4O29A 5DOZA 4B45A 2C1XA 4BO5A 3TW8A 4ZK6A 4R54A 3FETA 3VNUA 3K71B 4QE3A 4DM4A 4ARCA 4DAOA 3LUDA 2XCIA 3O4FA 4BFCA 4EYEA 1TAGA 1ZKDA 1VG0B 2CJYA 2AW3A 2YC4C 5FOUA 3WRXC 5LN1A 1JG1A 2DPHA 1XCMA 3HDTA 4O2RA 3GCZA 4LGMA 1T36B 4XWTA 3HQ4O 2COUA 5GV7A 1CB0A 4ZD6A 4YPVA 2YYSA 5JQGF 1WPQA 3MBKA 3EC1A 3WISA 3WGHA 1Z5WA 1X39A 4NBSA 1USWA 3FPEA 4N65A 5CNMA 1RXIA 8LDHA 2J45A 1QQBA 3EBLA 1THGA 4KO8A 3R7AA 3ZHZA 4DJJA 1IVSA 3TQFA 3L6OO 1R0KA 1TA0A 3RGGA 2ODAA 2A5FA 5CP8A 5IJXA 3NHSA 1A9QA 2Y67A 3NYRA 5DTJA 2A3RA 2JAHA 3P2YA 5FUXA 5CBPB 4B32A 4RXTA 5I01A 1IXSB 1J9GA 1E7WA 2XBLA 2QAIA 1RFLA 1XDSA 3HDHA 4IDBA 4OYLA 2IU4A 5ESWA 4GQIA 1KZ7B 4I1OA 4NFYA 3PD1A 3KYIB 3PFGA 1JHPA 2PZFA 1BWPA 2BTOA 3MC1A 4URYR 5MFZA 2IZ7A 2NUPB 1V6SA 5E7JA 2X8JB 3OIUA 1Q3HA 2R1VA 3O5AA 2X1MA 4KQ2A 5ADVA 3QJ5A 5FI3A 3AM1A 1DOHA 4IFBA 4UPEA 1E66A 1QTRA 2ESRA 1G2PA 1OQAA 2FAXA 3DO6A 4FCCA 1GJRA 4LI0A 4QECA 3RG2A 4KXNA 4LV6A 4X61A 2G0TA 4A7PA 2ZP1A 5IT0A 1YNSA 4MTLA 4KHZA 5CFMA 3TXYA 1FDUA 4EQZA 1JSCA 1V9LA 5KYTA 3QFHA 2XVZA 2GQ0A 3OT1B 4OIMA 4KWHA 4N9QA 3R9KA 4D45A 5K5EA 1Y7LA 2PT7A 1VE3A 1W0KD 3H5RA 5BN4B 2WTXA 5EHIA 4LJ9A 4KREA 2AC2A 4JN6B 4BIMA 2BEJA 4WQMA 2ZUSA 2QE7D 2VNIA 5I8WA 3DOIA 1YFZA 4ND8A 4MDEA 5EZSA 3UHJA 5HM8A 3LG2A 3WL4A 4MUNA 3GRYA 2FPPA 1FX0A 4P4TA 1WMFA 2PFKA 1C3OA 3KR1A 1UPTA 1X87A 3TLKA 2HXSA 3RTGA 1J8DA 3QHAA 2JLCA 1G63A 3IAFA 4QQRA 3ONDA 4ID9A 1Z7BA 3TFQA 4E5YA 1GDHA 3D3WA 3FYHA 3PQ5A 1U0NA 2QRQA 1FS6A 3K0SA 2XPCA 4E5PA 5DT2A 1MJGA 4QTXA 4RD1A 3D8TA 3LTNC 1YUMA 1C7FA 1CR0A 5IVKA 1FW8A 1IN4A 5KBYA 2EWWA 1P9RA 1ENYA 1W6UA 1PGPA 3HYTA 4C2AA 3O8OB 3L6DA 1WXHA 1JPJA 1NLMA 3QU2A 3T6KA 5KDLA 4LBZA 3I53A 1JJVA 4E5UA 3K9HA 4RHFA 4P83A 1U3CA 3OM8A 4GBGA 4B8YA 2XZOA 5LXTA 3H87A 1BHQ1 3KB6A 4PVDA 3ILVA 8MHTA 4YCMA 1L7PA 3PNQA 5HYVA 4BQIA 5LP6A 1O54A 1QIGA 1L7OA 4ZCPA 4L50A 3R3WA 4AG6A 4EP1A 1P8JA 2QM7A 1T4CA 4ETWA 3E22A 3DL0A 3GIDA 5TR9A 3MN1A 2UYYA 4R7GA 5I7HA 3INTA 4LTMA 1J5XA 3GRUA 1U3WA 3FWYA 4PXAA 5JH7B 2NZ2A 4YO7A 1O3YA 1Z7YA 5L4LA 4EQ6B 2C99A 2Z58A 3VYRB 4CFSA 4BNUA 4ZEOA 4DWVA 1V7PC 2ZT5A 3U7IA 1AS0A 5I6DA 3WKAA 1YS9A 1ZD2P 3LKBA 3PEEA 1CX9B 4O2BF 5HFAA 4OB8A 2P9FA 3A9SA 3OX4A 1G8GA 3PFIA 4IHAA 2QS9A 4TRMA 2H1OA 2WJVA 3WGLA 4CIDA 1NATA 1WP4A 2NZVG 3KK0A 1KJWA 2NO5A 1W87A 2Q4EA 2QGFA 4GOJA 1JZSA 5E3JA 3C6ZA 3I32A 4PYRA 1G42A 3EVEA 4W5WA 3RUDA 1NYQA 5LOVA 2XQGA 2XTZA 4IVNA 5CLGA 4N8DA 3USZA 2YZKA 3IAM6 2AG8A 4BY9E 2VF5X 5EERA 3U7GA 1QORA 4FS8A 2R5FA 1ZR2A 2WWFA 5A5GA 2ODTX 4FSDA 3CVOA 4M37A 4W1SA 1D03A 5F2KA 2Y1FA 1U6KA 1DINA 4ZT6A 1YKSA 2QW8A 3WGZA 2R0QC 1VOTA 4PYKA 1P60A 2F43A 1QUEA 1Z8FA 2P79A 2WKSA 4YNBA 4U6NA 2OGSA 3FNRA 4W6ZA 2RBKA 2QBYB 1SKYB 1X7XA 2FV8A 4PZUA 5ADUS 3CX8A 1PG2A 1S2DA 2AQ8A 2GUWA 1Z4NA 1E8DA 5DDIP 1OXKB 2PMDA 3HI6A 4RV9A 2QYTA 1SA0B 3FYUA 1XTIA 3EG9A 4ZYVA 5JXGA 2FSGA 2AI3A 4JUIA 3EQ6A 5EHNA 1L3CA 1F0PA 3D3WB 1X6VA 5LSAA 3GLIE 2B37A 1AQIA 5B58C 3PUKA 2GZ2A 3W90A 4GF5A 5KS2A 3D7LA 3UK2A 4B33A 1Q0PA 2IYZA 4IZIA 4Q1CA 2Y0BA 4Z0PA 3ROTA 1KC3A 3QXXA 1RI2A 2W6PA 3HZRA 4EM6A 4LSWA 1L4LA 2ZATA 1AKNA 2BF4A 3K16A 4FGWA 4Z99A 2J3DA 3C48A 3AHJA 3KV1A 4BLSA 3T5BA 1E2NA 2LZ0A 4FFBA 4S2EA 4LZWA 4WZBA 1U9IA 4X20B 4F2DA 1VJGA 1YS7A 1THMA 3VVCA 3CN9A 4HD8A 4OKIA 1JAYA 4P81A 2C4WA 1ZJ5A 3GOHA 2IODA 2ALJA 1WDLA 1M1UA 3IIJA 5FNZA 2IQIA 5HIIA 3E9ZA 4AO8A 5K6TA 1K92A 2QTGA 4GM0A 1R6AA 1UP7A 2XY4A 5BWCA 3NP7A 4JR2A 4YAKA 2XVYA 5CDSA 5SV2A 1FDTA 4ZPJA 1ZN9A 2JGNA 1ZSVA 3G2JA 1ZPDA 3M5WA 3LI2A 4OK3A 1KOFA 4GM1A 1Q1NA 2FFRA 2XMRA 3EXIB 3FNIA 3ZHSA 3IERA 3M9XA 4QBHA 2Z6UA 2K4MA 5CX1B 2WUGA 3E5RA 3PNLA 1RYYA 2WJ4A 1F2DA 1T9DA 2HHLA 4CR8A 2CMGA 1LD3A 1XAIA 4G1BA 1U6JA 2VT2A 4LBVA 1P29A 4HB3A 1V25A 3W7AA 4AZ3A 4ZOQI 4M0FA 5CTJA 2BN4A 4NBKA 3RB8A 3TD9A 3T3DA 3VR4D 4GSYA 4LSGA 1CUUA 1Z6AA 1SXPA 2RIRA 1PVVA 3QG1A 4EKGA 4F21A 4AC9A 5JAPA 2ZEJA 4BNVA 1QX4A 2YWXA 1N6OA 1XRLA 2H31A 2Z09A 2PL1A 4E2XA 2PUAA 2NZJA 1X42A 2YWGA 2C8KA 2A86A 4M22A 1A7KA 2HCFA 2D54A 4RU1A 1T91A 2O20A 3I9NA 4ZAZA 2ZU0C 2PGOA 5KSWB 1N9KA 3OF3A 2D2XA 3AR3A 3PR1A 4H15A 5AK6A 3DDZX 3V46A 2L82A 3MJVA 3WNQA 3CPHA 1U7TA 3HA2A 2AMYA 2VP0A 2W0SA 1V48A 2GFHA 4TS3A 1QU2A 3AVQA 2ERCA 1GA1A 4S1NA 1UEJA 3BHJA 4NYJR 2RH4A 2Q6IA 1ISIA 2BI8A 1NY5A 1C9NA 3H9EO 1JP7A 1N2JA 4AY2A 4D4LA 1S3FA 4G0VA 1X7XB 2JK1A 3IP5A 2VCHA 1K7XB 4OHBA 2ZRGA 4LWQA 3ORRA 1EVQA 4D9GA 2Y0PA 3IH5A 4OK5A 2CZQA 3ZWWA 4JJFA 5BSKA 3B2NA 3EVTA 9ATCA 2IU0A 1ODJA 4NZ9A 4UCWA 3UPDA 1U99A 1QHGA 2QXUA 3O2QB 4LCBA 2O8CA 3R74A 4E7OA 1Q7TA 2DQKA 2MJLA 3NOVA 2XXJA 4IINA 2C2HA 3IRUA 1ND6A 2AMFA 2OFWA 3KJQA 2W6OA 3GEHA 3T3NA 4XJXA 2QVYX 1PL6A 1XVTA 1D0SA 3ED1A 3KHKA 4EFKA 3COSA 3C3DA 4N40A 1GCAA 3V34A 2BEKA 2CEAA 1JXMA 2Z3VA 3DBRA 3V7FA 1ZVQA 3PUIA 2BBTA 3DOOA 2WWIA 3I3OA 2WAOA 1CR4A 2IZ6A 4FFBB 5G0UA 1FYEA 3TLYA 4DC1A 3CX7A 4BVEA 4TTAA 2GXAA 4C04A 2PSSA 3K0HA 1SB9A 4OLBA 1W4AA 3S28A 3VNBA 3VSDA 5CVTA 1IUNA 2ZBUA 1TTQB 2ZDGA 2X0RA 3M3PA 5ILOA 3EH2A 4H18A 3KYJB 4Y2PA 3P0RA 1EK6A 2HXYA 2ZJ0A 3WRXA 4B3MB 3A7EA 5E7IA 4PCUA 5TGDA 3IEVA 4NWIA 5C5DA 3O84A 2GYVA 1YI8A 3AR8A 3DFKA 2PO5A 1GPNA 2CCGA 3QELB 4N5DA 4YJGB 3ON5A 2B1QA 1GZ3A 5FLKA 1O6BA 5I9TA 4MGHA 4CMAA 4DBLC 4JXXA 1TO2E 2J9XB 2Y77A 3ISJA 4CT5A 1UIMA 3KDAA 1CU1A 3TG2A 1PT7A 2WPDD 1H22A 2NV2B 4RF2A 4A1FA 1XX6A 3SC4A 1XVUA 3B12A 2IW1A 2VJOA 4KZKA 1SM4A 1CUWA 2VHCA 4B3XA 4PGAA 1UQUA 3OY2A 1AO0A 2NP6A 1TF5A 3DXXA 2BGNA 2C29D 1T8UA 1M8PA 3CUKA 1A7UA 1X19A 2CDBA 1Z0IA 5TMBA 3PG5A 3RLIA 1RMQA 2A67A 2ZJ6A 3ZTWA 1TZ2A 1KH2A 2XTJA 3NDJA 3U3ZA 5BSEA 4IQFA 4JXZA 4ZU1X 3BHMA 1H3EA 1N5DA 3OD1A 1NLZA 3JWJA 1I7QB 1AUXA 2XKAA 1D0IA 5DNCA 1CY7A 2ST1A 1Q92A 3HS3A 2UVDA 3JSAA 1CETA 3IOEA 4B3RB 3N2YA 1KIAA 3L6UA 1EK0A 5BW6B 4GZLA 1GFWA 5BOVA 3UZUA 1WOMA 3QIVA 4BKRA 1JWAB 2H2WA 2D0OB 2RHDA 2R751 3F3SA 1K8RA 2OHVA 4IJ6A 1DQYA 4TMZA 4YJ2F 5HF9A 4KNYA 3DDWA 2G04A 1PLJA 1OZAA 2GI4A 4DBLE 1EKXA 3E70C 4QTZA 5K99A 1MOZA 3V1TC 2HF9A 4BFLA 5AJWA 3O3NB 1C3LA 1SCKA 2HEIA 3CE6A 3OG9A 4IQ0A 2O5RA 3UY4A 1ORRA 3N0XA 4CVNA 2AJBA 1M2FA 2OGUA 4M1ZA 3K8OE 1OVMA 3WL5A 4EPVA 3ZW9A 3DAHA 3W1EA 3HWSA 4MV6A 2DRIA 5KYYB 4MJLA 2O3SA 1J56A 2WHQA 3CSUA 2VUHB 3OEED 5EXTA 4JL8A 4CMBA 4DSNA 4RPLA 1P5ZB 3TTUA 3IILA 1I1QB 4G1CA 1UEIA 1RHMA 1U6IA 2GRUA 1DBWA 1GUAA 4P7FA 3RFXA 4YRGA 1EWQA 1J0AA 1NJ8A 2QLFA 1LGYA 1QLWA 2F3UA 1YASA 1JEAA 1NA5A 4G0YA 3KR2A 4HHEA 1QYWA 3EIWA 1P73A 1SCUB 1K3UB 3ZWXA 1V16B 1TKBA 3KHTA 3IVRA 2YIVX 1LBTA 5ADHA 4BASA 1R6BX 5JAHA 4ESHA 3BFXA 5KTPA 1JSXA 4I08A 1UKAA 3BCHA 4FBGA 3UWOA 1VHJA 3HCCA 3LK6A 2HF7A 5A6SB 4Y0NA 3DKVA 4PBRA 1E1NA 3GAAA 4L5JA 4A8HA 1NMZA 2VG8A 5DHUA 3SM3A 2PSEA 2C7RA 1LPAB 1KTIA 4Z4EA 3VR5D 5IBPA 2WICA 1V1RA 3VYWA 4B6FA 2I4LA 3P0IA 1PAUA 4OKSA 1T9GS 5TMPA 2AZXA 1A9OA 1GEGA 1OJLA 2P91A 1KSJA 1ZXBA 2VTKA 1U3UA 3EGEA 3OOJA 4TTVA 2H48A 4WJZA 5C80A 3RQIA 5A2QA 3JU3A 3MERA 3GT3A 3X1WA 4KSBA 2Y4OA 1VL6A 2PZBA 5HIJA 3SN6A 1JQBA 2Q0XA 3AFNA 3D2BA 4JLPA 4WFJA 3PFNA 3TSCA 2B1GA 3VR5H 2EGGA 4ZDKA 1BRMA 3E58A 2QJOA 4WXMA 2WHPB 3UFXB 3W2HA 3R8CA 4DXDA 2Y1GA 2Q1SA 4I1UA 4WK0B 3THXA 1T6NA 1VIDA 4FN5A 4P5DA 3TNYA 3MWYW 3WYFA 3B3AA 2JIZA 2PXCA 3F2IA 1G21E 3FMFA 3SBEA 5LM3A 2ID4A 1TIKA 1YVRA 4NIMA 3LL4A 2NQTA 3QKWA 3LA6A 1B42A 1LLUA 1LNZA 3MCAA 4J2OA 2IEGA 1W36C 2Y68A 3D64A 2A9KA 3RADC 3CKKA 2I1WA 2IYEA 1N25A 1DKLA 2XUJA 4GMDA 5DM4A 4AB1A 2AZMA 4P5EA 4G9GA 2ZVPX 3QVGB 1R3UA 1UJCA 4IYRA 4X7RA 3OZBA 3VH3A 4JYPA 1CRWG 5B6IA 5AVRA 1QM5A 3HPRA 3SYTA 2HRRA 3DBOB 4RJJA 1DRVA 4ZDWA 4D9JA 2Z04A 5M29A 4HX5A 1HBJA 3NWBA 3ABIA 5EIAA 5BN5B 4D8TA 1CEEA 5C7OO 4EA7A 1RNLA 1ZCAA 2NNWB 4K6KA 3TLXA 1QTQA 2HPVA 1U04A 3G2KA 3BE8A 5BNFA 4GVXA 4MIOA 4IIVA 4Q1EA 3JSXA 5KTNA 3HCOA 3MF4A 5K3SA 3WIBA 1QFZA 2E1PA 3M4JA 1EFPA 3AP2A 3KZ1E 1XXHE 5HZKA 5JEDA 5LYJF 1SVSA 3HACA 3JRXA 3UJ6A 3STYA 4OBBA 5SYMA 4OK6A 1Q57A 3WDKA 1R6DA 2WTEA 3F1LA 1ZM7A 2VPQA 4R2HA 1MJHA 2YWEA 4FYYA 4JXJA 4KODA 1T0PA 4CYMA 1LK7A 2ILTA 4E46A 2RHHA 4DSTA 2Q2OA 3DUWA 3CLTD 3LUAA 1NFQA 2OC4A 4K6GA 4Y2UA 3B9RA 1CY1A 4F8JA 1Z7EA 3P0JA 1N2IA 3OU6A 1XCLA 1DL5A 4BQNA 4EMBA 1GPDG 5H83A 3MRTA 1W4CA 4EJ2A 4JOBA 5CT8A 3CXUA 3Q7EA 1GRCA 3LUJA 3ZH2A 1O89A 3MWGA 3ZE1B 3QEJA 1X1RA 1K8QA 5K8VA 4YRFA 3L92A 4INJA 5ECWA 1NI4B 2HDHA 3CNNA 2CVPA 3JWHA 4I5FA 4ZQIA 1QHFA 5EWMA 3LCMA 1DS6A 3ZV7A 4BQPA 1R4MB 4H59A 2ZANA 4FKBA 4I66A 3K6KA 2HLDA 5SZIA 3DMTC 1SKYE 1Y82A 2REOA 3IQXA 3OC6A 3PFFA 1O6ZA 4ENPA 3AV0B 3GVCA 1YS2X 3R5FA 4LKOA 5DI9A 2QU7A 4BBZA 4DNOA 5DGHA 5LLDA 5EIFA 4K2HA 5KHAA 3PUVA 2FE1A 4QGAA 3FHCB 1EP2B 3HBMA 4P2BA 4UJ3A 4XB6B 3ECCA 4FKMA 4ALMA 4E1VA 4XUCA 4M53A 1GRVA 1Q17A 1VJ0A 1DLJA 2NLOA 4P3KA 4UHEA 1YR6A 1TKRA 4FNGA 1ZP6A 1SOMA 5FQOA 4D4KA 5IDXA 4NJMB 1H2EA 3JVIA 2DM6A 2HSZA 2AN1A 4RFVA 4CG3A 5FOVA 2GYYA 5BVHA 2J5KA 3NLLA 2VHYA 3DNFA 4PE5B 4KMSA 5TNXA 4JYMA 2O8EA 2NO4A 3W8EA 3WL8A 1A71A 2UZ3A 4E3WA 3B5EA 1F48A 4CLOA 3K70B 1BEUB 1XKLA 1ZMXA 1NR1A 4RTQA 5ETJA 4DLTA 3VDNB 3WLKX 1D04A 2IEDA 4XM2A 5JZOA 2WDPA 2WLTA 1CIPA 3JQ8B 1NUAA 3TB4A 1O94C 1TRKA 4ARZA 4OXXA 1YVPA 1UK6A 2H06A 4OAOA 2DG2A 1NX6A 1IEVA 1TM5E 2JI9A 3I6ZA 3FMIA 3WNCA 4M8SA 3JQBA 4QTUB 4W8HA 3A4LA 3AFHA 2RGDA 1V39A 5AKIA 4OX9Y 4O1MA 5IWCA 3K05A 4EG3A 1FFCA 2RFLA 3DZFA 4G0XA 1H8ED 4ZXFA 3L6BA 5LZ9A 5C8YF 1Y1KE 2YKGA 3M6UA 4S1PA 3SR3A 1DDOA 3PQDA 1R8SA 5LUAA 3C3BA 1K8XB 1V8DA 1I2ZA 2CJPA 3ASZA 1P9LA 4AP9A 4XYMA 1H4VB 5EIWA 1MA0A 1U8FO 2J9GA 1TMOA 3OZXA 1Z25A 5KNBH 4QPNA 3Q12A 4X64B 2R3SA 4G0ZA 4O0MA 1ZU4A 2CVZA 2WF5A 2FQXA 3D3JA 4KITB 3H4TA 3DOJA 2HWYA 2P2ZA 2O48X 1MABA 1XZAA 5TPZA 2YVKA 1IXZA 3BWXA 3QU9A 2PSJA 2XMZA 1BJRE 4WLNA 3VTZA 4Z53A 1NQXA 4IGAA 3N6RA 4RTKA 1ZICA 1W581 4MHOA 1GKKA 1OXSC 2W2TA 2VA9A 4NI5A 1Y9EA 2IPOA 4OI4A 3R9WA 3H5WA 1VKNA 3D8SA 2BAGA 1N33B 2XIJA 4MVYA 2JARA 5EWMB 3UKDA 1CNMA 3EGXA 1TB4A 4DMKA 3Q7PA 1VBFA 1L4GA 2WPDA 4IWNA 3D4LA 1WNFA 1KP3A 1DDIA 1QH9A 4DPKA 1WNTA 3EGDB 2OYRA 1E1DA 3KZXA 3K3PA 4PHTA 1K8ZB 3F98A 2GXSA 3OE7A 1YGPA 3GGGA 1HYEA 1TZMA 3JPYA 3QX9A 3FRJA 4YECA 5DXAA 5LYYA 3U56A 4MMYB 1MIOA 3RRYA 3VPXA 2P90A 4DYDA 3LZ6A 5C8XA 2D4HA 1QLHA 4N7JA 3V2UA 5INTA 3GJZA 3FRIA 4QFDA 5M3BA 3GEPA 4LTDA 5JSZA 1T1EA 2O2GA 1EDOA 3A9WA 4HNVA 3QPVA 1ZH4A 2W83A 2VJAA 3VPGA 3CRQA 1D7OA 4D02A 3T1QA 3R7WA 3NWEA 3A6LA 4EY3A 4JYZA 5K6RA 1P18A 2ZJ3A 3IB3A 2H5IA 3TZKA 2ZIXB 3S99A 3ITKA 3KJNA 1T13A 4HNRA 1ISSA 1QFMA 5LZ5A 3VNVA 4MS1A 2W70A 3DC7A 4CKBB 1NW7A 1W1IA 1ZIPA 2FVXA 5J1SB 1CPYA 1WMBA 2X1HA 1HZZC 3BMCB 3L18A 5CIQA 1JEQA 1R15A 5EMMA 3SFZA 2HLPA 1O6FA 2ZYGA 2J59A 4G0UA 1L5SA 1TIBA 1MX9A 1B8VA 1QO7A 5EHQA 1XZJA 3KM0A 3U7HB 3I6IA 4R83A 2C78A 4TWIA 2WOJA 3I09A 5ECYA 3IQWA 1SVUA 3I42A 2FE4A 4GI7A 3EPPA 5DIFA 3WNDA 1MTZA 4PG7A 2ENWA 5K2MA 4C7JA 5IM4F 4MUGA 2BUCA 2FWNA 2QL5A 4IXNA 2J41A 3UK0A 2B20A 4UMDA 3H83A 1T9CA 2BGIA 3WGNA 4YV2A 5JS8A 3PEWA 2H2GA 5M5BA 1NVUQ 3VVBA 4U7PB 3R5XA 4MW9A 2EEZA 3HVUA 3NV7A 2O8VA 1UINA 2CFIA 5JO0A 4TQUS 5JNRA 2A57A 4FE4A 1U2ZA 4L5IA 4XPIB 2XF8A 1MB0A 3EXHA 4KE7A 4YCAA 4DR5B 3EEBA 1CQJA 1F2VA 2IYVA 2O7RA 2X40A 3N86A 3GDWA 4QBTA 5K0LA 2ZYTX 1X7WB 2WJYA 4YMUA 1OU0A 4N6OA 5J5VA 1VRVA 3H1BA 2P69A 2ZJ8A 1G20E 4NBTA 4R16A 4HAYA 4NV0A 1EBFA 2II6A 1CRLA 3QZUA 4P3XA 4V2UA 4HNGA 4ZYYA 3AUYA 2XWJI 1LVGA 1UP6A 3WTBA 1KJJA 1ZVMA 2OGZA 3LVQE 4MQ4A 1K2WA 2ZRKA 5C8DA 1N92A 3GZNA 1EDZA 4OHYA 3NT2A 7REQA 1C7ZA 3FUUA 3H1EA 5IK2A 2CXSA 2JBAB 4ZT5A 4H6PA 3FCSB 3TN7A 1X9IA 1KMHB 4PO1A 2BFNA 1RYFA 2EQ5A 2J0VA 4LRXA 1M34A 1Y6JA 4Y2VA 4QOIA 5H59A 1DAPA 2JJ8A 1W25A 4R8SA 3U7JA 3QEMA 4O2AA 4ALLA 4E2ZA 4R5HA 5KSZA 1HTBA 1L2TA 5C35A 4RS3A 4KRGA 4L5BA 5AI0A 4TTSA 2A3NA 3T15A 2QRLA 5L7YA 4XTCS 1G6KA 1MHTA 4ZGBA 3U37A 4YV0A 2WWWA 1LDMA 3L05A 2G70A 3ZUGA 2HWXA 2R6R1 1UT8A 4UHDA 1IM5A 3V4LA 4CLEA 2HK6A 2RAFA 3DO8A 2RARA 4YHHB 2FTKE 3WC4A 1B6SA 1AV6A 2I2XB 1IJEA 2DJIA 1UDXA 2EXXA 3I64A 4KRXA 4ROTA 5E6SA 2BSAA 3TPFA 3EAFA 2D1TA 2AR7A 3PFKA 5CXQA 2XT9A 3D1LA 2HQOA 1XMOB 3AFOA 3I12A 1TAHA 1LI5A 4QYTA 2O5VA 4PYJA 5TC4A 2QZPA 2OK7A 3R4VA 5ICMA 1HE2A 3GUHA 2VQFB 2VQ3A 3VZSA 2B8WA 1I7LA 4RSGA 3ZVKA 1T5BA 5F9HA 3M6FA 3FYDA 3LWZA 1IXRC 3MCTA 2P4EA 4IL5A 4LOLA 4PEVA 4IMIB 3T3EA 3UWMA 5ITZB 1PEDA 2UVPB 4WESA 2JRLA 3PLNA 2Q2VA 4FOSA 4LXXA 4MR8B 2G67A 3DOFA 1RM3A 4ZKDA 5BUQA 5HKKD 1BJKA 2LP4Y 2HC9A 2BFDA 2D62A 1MX1A 4XJSA 3FFWA 1N6NA 4XQCA 1Z06A 5L3ZA 3WDSA 3WJAA 3QBEA 4QEZA 2RGBA 4B4VA 3HSKA 1IZ9A 1L1EA 3U4HA 3NVKI 3QUTA 1D07A 2BOVA 5KCMA 2ZPUA 5I8PA 4XWYA 1Q7GA 3LL7A 1YUBA 2H1SA 1KOLA 3CU5A 4XVQA 2VF7A 3VKFA 5AJXA 2WSBA 1SQ0A 3KAQA 4H0NA 4X6YA 4IMRA 1EVYA 2ZAYA 4B7XA 1KJNA 4XDGA 3BEDA 1CQPA 3CNOA 3H05A 4WZAB 3A1CA 1ZGHA 4RFLA 4TV9A 1ABBA 4KAAA 1B43A 2QRMA 3DDSA 3RHFA 2F7SA 4YCDA 1PHRA 4BNIA 4KLCA 2I4NA 1YIAA 2Z8YA 3FG9A 3TCXB 4BOYA 1VSVA 4DRXB 4ED9A 3H19A 5FBVB 2LDXA 1NMXA 1HDRA 1ILWA 4TUYA 4KQJA 2C3OA 2P62A 3KLOA 1RJ9B 1V1MB 1W2HA 2HDWA 4HO1X 1JQLB 4NDAA 1LLDA 2ACWA 4C08A 3OIWA 4LRYA 1U8EA 2ZKIA 2RGUA 5KHLB 2ZRBA 1I2DA 4HDMB 2B4AA 5AQ1A 2FB9A 2QY9A 2JFUA 2O8NA 1Q0RA 3JAWA 4CMKA 5BN1A 1H42A 1X77A 4L8LA 4IUBS 2OB2A 1NBIA 2IU6A 4UHBA 5G1OA 1NMEA 1W49A 4KBFA 3SZ3A 3V00A 3HL0A 3K15A 3H5LA 1QH1B 3ETDA 3HZZA 4WNAB 4LZZA 3FMGA 4LC1A 4Z51A 3GRRA 1MO6A 3E2IA 3IC5A 3LFUA 4HZIA 5C81A 5HGXA 2HJSA 3CMMA 421PA 4DLUA 3NHYA 4BEVA 4IJWA 3LA8A 4RKWA 2GAOA 1GTRA 2QWXA 5HUQA 3H9CA 2WJ3A 2HPAA 2YYYA 3N6VA 1ODFA 1JUDA 4F38A 1QZZA 3RVQA 2HMYB 1NDUA 4QKQA 4FC7A 5I48A 1G66A 1VMEA 3F74A 3Q3CA 3VKGA 1P1HA 3KJFA 3GRZA 4TV8B 3GDFA 2GFQA 4H0CA 2OCXA 3VDXA 1WU7A 2WYHA 4IHJF 3CC8A 1Z15A 3R7LA 3VR2A 3FZEA 1DMRA 1DRJA 1MPXA 1CUXA 3OIDA 2WZCA 5A1TA 3G2LA 4F4UA 1R27A 5JQGA 1F0YA 2Y1LA 1K88A 1LLFA 4YRCA 2LCFA 3VHXA 1QYDA 3MQ2A 2R68A 4GYYA 3WRWA 1I0LA 1KTVA 2ZS8A 4CQMB 5FTWA 4E33A 1CY6A 3KG2A 3JQAA 2FMFA 4D92A 1PFWA 2GTPA 3EDRA 4ND3A 3L8HA 3WOVA 2BFDB 2HDNB 4CI0B 3ADPA 1G8MA 5AOCA 2VXYA 4Q05A 4ZGWA 3L0YA 1TLLA 2VDQB 1P8AA 4AZ0B 5F9MA 2GB4A 1M6HA 4A2PA 1B6GA 5L40A 1FTWA 5F77A 1SY7A 1GGNA 1W36D 2EWVA 4ER7A 2EHJA 5LNK6 1WJGA 3L0IB 2K6GA 3LIIA 4BB5A 1WS6A 1Y34E 4KN6A 4OFXA 3N58A 3UH0A 2V0NA 3OT1A 3GD5A 4TKLA 1OI7A 4RD0A 2WYWA 3ZKWB 4LX0A 2AL7A 4WY2A 5CYPA 1PJCA 5KTTA 5E1MA 3AF4A 4CRWB 5C7IO 5IT9A 3WB0A 3D6TB 1W47A 3CG0A 1QH0A 1NVKA 4PLHA 1T9AA 5FBWB 3ZNNA 1XCPA 2Q3EA 5K6AC 3R41A 5A62A 3ESAA 5ES4B 3INRA 2QTFA 3E7WA 3GGPA 1JDTA 3ETHA 4B17A 5HJ5A 4ZICA 1PG0A 4RZUA 1YR1A 1RPAA 2H59A 4MW4A 1N34B 1YB2A 3MAAC 5T3UA 2A78A 2QN3A 4KAJA 1VSQA 4D0RA 1WA5A 5FOXA 2IOFK 3F5SA 3P9XA 5UKDA 3UMVA 1E9EA 3N8IA 2ADFA 4AG5A 1CFZA 3M3DA 3P19A 3CCCA