1J7JA

Crystal structure of the hprt from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
163
Chain Sequence
HTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGSFMFMADLCREVQVPHEVDFMTASRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQRYRHLPYVGKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine phosphoribosyltransferase
publication title Crystal Structure of the HPRT from Salmonella Typhimurium at 2.3 A Resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j7jA00
2E55A 2IGBA 4QYIA 1A96A 1W30A 3LRTA 4IJQA 3DAHA 5KAMA 2YZKA 1HMPA 1DKUA 1NONA 3KB8A 1YFZA 1OREA 1I0LA 4P81A 4P86A 4RHTA 1DQNA 1UPUA 3OZGA 5BQOA 1CJBA 3GGCA 3OZFA 1Z7GA 2P1ZA 1BZYA 4RACA 4RHUA 1IBSA 3S5JA 4ZFNA 1ECFA 1G9SA 1P4AA 1JLSA 5KAPA 1U9ZA 1XZNA 2C4KA 1UPFA 2JI4A 4MB6A 1I14A 2PRYA 1A4XA 3ACBA 4F8EA 1PZMA 1VDMA 4RQBA 4PAWA 4LZOA 5BSKA 1G2QA 1QCDA 1I0IA 4LZNA 1L1QA 1ZN9A 3ACDA 1GPH1 2H08A 5HKLA 1DKRA 5EUCA 3HVUA 5HIAA 4RAOA 1TC2A 4M0KA 4P3KA 3EFHA 4JLSA 1JLRA 5K51A 4X45A 3M3HA 1QB8A 2DY0A 1QK4A 4RHYA 3DEZA 4OHCA 4RADA 4RV4A 3O7MA 2H07A 2JKYA 1A98A 2GEBA 3GGJA 2EHJA 3MJDA 4JITA 4M0PA 1FSGA 4P82A 1P19A 1HGXA 1A97A 1O57A 2XBUA 1Y0BA 1G9TA 5E38A 1STOA 4RHXA 5ESWA 2PS1A 5BQPA 5ESXA 4Z1OA 1ECBA 1QCCA 1AO0A 4TWBA 3OHPA 3H83A 1BD3A 2FXVA 1BD4A 1G2PA 1A95A 5JSQA 1J7JA 1ECGA 1OPRA 2H06A 1P18A 1VCHA 1GRVA 1QB7A 4P80A 1OROA 4QYIB 4RAQA 4M0UA 1VSTA 1XTTA 3ACCA 2VFAA 3MBIA 4FYMA 1O5OA 1P17A 1I5EA 1I13A 4PFQA 3NAGA 5IPFA 1TC1A 2WNSA 4QRIA 2HCRA 4S2UA 1QK5A 1DQPA 4WN3A 1QK3A 1UFRA 1L1RA 4LZAA 1LH0A 1ZN7A 1XTUA 5JV5A 4KN6A 1U9YA 1A3CA 4RANA 1MZVA 1NULA 1DBRA 2PRZA 2AEEA 1V9SA 4WMLA 4LYGA 1ZN8A 3DMPA 1R3UA 3GEPA 5BRNA 3N2LA 1ECCA 1ECJA 1XTVA 4X44A 1XZ8A 3G6WA 1WD5A 2JKZA 3QW4B 4P83A 2JBHA 4LYYA 5IAOA 4P84A 4RQAA 1D6NA 3LPNA 4RABA
chains in the Genus database with same CATH superfamily
1QG4A 3PGKA 4BNNA 4CW7A 2KW5A 4PPGA 3DBLA 3A0RB 3ZZ0A 4B3HA 3GNLA 3T7RA 3G88A 1ZNQO 1V3TA 2NSDA 5AKKA 5IT0A 3PV0A 2C5FA 4PZPA 4AQ7A 1VPLA 4AY5A 1FYVA 3R5XA 2XGSA 2HB6A 2B61A 3DBHB 1Q7RA 3PE3A 4QFDA 4FD3A 2YR0A 3AQIA 3EXEB 4D3ZA 4XGQA 4KC0A 1ENOA 1U0FA 4N5IX 3DZBA 2ZYAA 4CE6A 1VPWA 1I1OA 2ZCVA 1QF6A 3CNHA 3OCWA 1U2ZA 3O0DA 3L7KA 1SBNE 1USUA 1BWRA 2WF6A 3IQXA 5EE3A 1P1KA 3H8JA 5JD3A 5E6UB 2WG0A 5DCUA 3DEFA 3AFNA 3I9LA 2IDJA 1F2TA 3DNFA 1VL2A 3HFGA 1P75A 1RHQA 2WEKA 4Q7LA 2Q41A 4R1TA 2NYRA 1E94E 2PUFA 3EMVA 4EVQA 2AD1A 1ZMOA 5BWBA 2IVZA 3KXDA 2GM3A 4A6DA 3NG1A 3FRIA 3IMCA 2JFOA 4JYPA 3T34A 4TMZA 2WHPA 3B7PA 2OOKA 4HLCA 4AXXA 2IXTA 3WGGA 2X13A 2YV5A 1SXGA 1GHTA 1T0PA 2IZ0A 2Z2KA 1F4LA 3I05A 4IGEA 5L9AA 1J07A 2ZUDA 4KK3A 3G8AA 3QKUA 4OQFA 5BT9A 3AVPA 3MUFA 1J5XA 3AEKB 1IZ9A 5DDIP 4EW3A 1X7WA 1A4UA 3HUFA 4G23A 3FB4A 4GLLA 4HYTA 4AJ9A 4I19A 2AV6A 1SUIA 1E9AA 3L8EA 4CMGA 4E4TA 1VPTA 4QXOA 1YCHA 1LVGA 4A91A 1KEEA 5LL6P 2Z2IA 1H1LB 1AKWA 3BF7A 4B1FA 1Z29A 3OTQA 2XI4A 4ZVVA 2P2SA 1P1JA 3IE2A 5BN4B 5LUAA 4E4YA 2IH4A 3RF6A 4DMLA 3LQRA 3TW8A 2XITA 3IEVA 4IZHA 1VSTA 1W94A 2O2HA 2X8WA 3ACCA 4FP9A 4PONA 4DQ0A 4M6WA 1S7GA 1Z7EA 2JH8A 3IQWA 4KFRA 4CR8A 2O06A 4CM3A 4L3VA 5D01A 4ZHSA 3IS3A 4AMVA 1HQKA 2X23A 5A5FA 3PGJA 4RPKA 2F9LA 3FKSD 4DV6B 1BKDR 2YW9A 4EG7A 3BBPA 3UA3A 5J2TA 3G17A 4K9LA 1LH0A 1QDLB 4DB4A 1HYEA 2C83A 2Q7OE 3EH2A 2P40A 2W22A 1GUBA 4N5DA 4OAQA 5ALTA 3ZE6A 4EHJA 2XSZA 1CUGA 1AKQA 5CA0A 1PNTA 4FU0A 3PQ4A 4OA8A 5EG5A 4YT8A 1Q91A 1DXHA 4OU4A 2A9KA 4V0NA 5CP8A 2GKGA 3DDCA 3I12A 4LWQA 3VSAA 1RKVA 1XK7A 4RESA 2O6LA 3LHKA 1XN4A 4DF3A 2W2QA 1CQXA 4ZYWA 3GH3A 2Y1XA 3IEMA 1R6XA 2QZPA 4QDXA 2V54A 1SHZA 4NDZA 1UBLS 1ZJZA 2YL2A 1XG5A 3O3OB 1HXHA 4X92A 5AVQA 5F9HA 3RJMA 4C7OA 3D64A 4MIKA 1NU8A 1R18A 2HIGA 4U2EA 3W1EA 1FP4A 1RAGA 3LHSA 2QJTA 5AKXA 5AOBA 1ZCAA 3N6RA 3SX0A 1YH3A 2XMPA 4A8JA 2EU8A 3R3SA 4EUHA 5KHLB 4DA6A 1FS6A 4E51A 1LDNA 1M2OB 4XGKA 4A9AA 2C42A 2XADA 2RARA 4KSYA 5E6RA 1DCFA 1UEIA 3IAAA 4H2DA 5CNKA 4CDMA 1ZVVA 4O4JF 5KJFA 4JQOA 2EFGA 3OKAA 5SZIA 1CB7A 3AUSA 4O2RA 5D7BA 3E9EA 1V16A 2RK4A 3GGOA 3MN1A 5G4LA 4HQ0A 5CFLA 2HWXA 5HSGA 1YDWA 1XQ6A 3AG6A 3HHEA 4MROA 3VX4A 3PNVA 4UHJA 3AJRA 1UMBA 2M6LA 3L3BA 1QFMA 3A7DA 2C7RA 1G5QA 4G07A 4IDHA 3PGA1 2OO3A 5IABA 1T0IA 4OG2A 4EJ0A 3HACA 4DXDA 1TW3A 1ENYA 3CTPA 3IRUA 1Z2AA 3ANLA 4M1ZA 5ELLA 4Y1RA 1M2JA 3JARA 1ZVJA 3HCRA 2I6TA 2QYHA 1OXTA 1PI3A 1SUWA 2LDBA 1AS3A 5FIUA 1L5YA 3A11A 2A57A 3LZ6A 4EB8A 3I2IA 2FG6C 2QRPA 3DDWA 4BTVA 5BSEA 1ZUNA 2CV1A 2HZBA 5ALXA 2AA3A 2R00C 4R2JA 3IB3A 5CEFA 4RADA 2NU7A 4KNYA 2JGLA 2B9EA 3H5LA 4RD4A 4RHEA 1TW2A 5AKJA 5DM4A 1MC8A 4D4GA 2Z30A 3DH0A 2HNAA 4EG1A 1CUXA 5GP1A 1KRWA 3E9YA 3MB8A 1Q14A 3UCXA 1B41A 5F5XA 3JSXA 4YHBA 3SD7A 3VV3A 3L7AA 2ZDHA 4DDKA 3X1KA 5MHTA 2OEPA 3M2PA 4Z1OA 4MKRA 4TV9A 4WA8A 1JFSA 3UA4A 1AO0A 4PCLA 4EARA 4DANA 1IY8A 1JR3D 4QRHA 1NVTA 1YAHA 5FD8A 4X64B 1R66A 1OPRA 1IU9A 3KTFA 5LBTA 3OBIA 5GADl 5HHTA 1OH7A 5K2OA 1VRWA 3ZGLA 2IPOA 1TFRA 2X0NA 1XAGA 4B7UA 4Z5XA 3FOEC 4IVRA 2B0CA 3OCUA 2BCGY 3LQ4A 3PVZA 4HDMA 2UZ4A 3OPQA 2UZ0A 4B73A 2OM2A 3AUAA 2XA2A 1IYZA 1WQ1R 3P9IA 3WGTA 1DCTA 1OLUA 3CB2A 3RDPA 4I3GA 5CFPA 4PLTA 4TLDA 1BA3A 4XA8A 1UBFA 1QAOA 1QGUB 4DNFA 3IEUA 3A32A 2BN4A 3HKDA 4F21A 2ZTSA 4YCBA 3HS3A 3R7SA 4NBTA 3HK2A 2FX3A 3WYEA 3CNBA 1Q16A 5DN9A 4CV1A 3TQRA 4KPUA 1SD5A 4FYPA 1Y6RA 5FPKA 5JBIA 3DF7A 4XCXA 3O9VA 2VHCA 4Y98A 4M49A 4CCAA 5H81A 1XI2A 2YWDA 2R8EA 4RD2A 1Q7GA 5AM3A 3W5AA 4QOFA 4U7PB 2LCFA 5LZ5A 3HCDA 3G2LA 1WUHS 2FRVA 1MDBA 2WVAA 2YVQA 3BIFA 3DS8A 1GV0A 3H5OA 5IDVA 4B3FX 5LQDA 2ZPUA 2EWVA 4YCAA 2XYQA 3QVLA 3DQQA 5HFNA 2ZIAA 3LUAA 3FG9A 5HWSA 1SCUB 4WVFA 3E2PA 4J0EA 1LPNA 4PXYA 4YRSA 3T1OA 3SSMA 4FMDF 3ZGYA 4GWGA 4W5WA 4EI8A 1KS9A 3R77A 3R6DA 4X8OA 5EHGA 1A5BB 4BWGA 3MD0A 4U7DA 1P7WA 4B3GA 4NOJA 4AS1A 5AIAA 2X22A 2J3LA 5I7FA 3KUKA 3NVKI 4JBYA 2DE0X 3U61B 1PEYA 2TMGA 3AB8A 3BXZA 3UWOA 1A5ZA 4KWEA 3HJRA 4P2BA 1FFAA 3TD9A 3VJKA 1OZGA 1UWLA 1V35A 3VYVA 8ADHA 1BYUA 5JYBA 1FZTA 5AW8A 4F86A 5EZQA 2Z8XA 3N75A 1Y34E 4IF6A 4L28A 4EPTA 5ERGB 4X8MA 4HADA 3V00A 4BS9A 3G13A 3JQ9C 4GP9A 1IUKA 1KYVA 2ZI7A 4BJ3A 2JC3A 4IIJB 4U0KA 2PRYA 2R62A 4K0RA 4YJHB 1MF7A 5CGQB 4GT1A 4DCNA 3DP7A 2EIXA 4DQXA 4PC3A 2I55A 3HZOA 1PD0A 2C9YA 2CLIB 5FPSA 4DSNA 1G6HA 3E9ZA 3VSBA 1N5DA 2C9BA 3PBKA 4BPBA 3K9GA 1YQ9A 5HK8A 5TJHA 3WTCA 1U7PA 1V45E 4JKYA 2Z4RA 3TLGA 4PLVA 1UADA 5HCIA 3VH2A 4BNZA 1D5WA 3PRHA 4LMRA 1N8NA 5EE0A 3WHIA 1IY0A 1K9VF 2BF4A 2HCJB 3IQEA 3L0ZA 5J1SB 1D1QA 4MQFA 4B40A 1E5DA 3DVAB 4CEJB 2IY7A 3I72A 3QKSB 5IZCC 1X7XB 3ZPXA 2RGNA 2GAOA 5BN1A 2WU0A 2XMZA 3CONA 2RIRA 3HL4A 4WWHA 4AJKA 3N5KA 1U81A 1G8HA 3HJNA 4I81A 1JDJA 4LN1A 1TTHA 3U40A 3UN1A 3GPDG 1WKCA 3M6UA 2YJNA 4UNPA 2HA2A 2IU6A 2D1SA 2FSHA 5EEHA 3FMVA 1P2GA 3DOCA 4C89A 2FPGA 5BVHB 2P2NA 2IYNA 5B2EA 2QY9A 3JD1A 4IDGA 4CMEA 3B82A 4H35A 4FTWA 1QHHA 2UUOA 4OXKA 1YVDA 3D7KA 5HF8A 5LYYA 3NHRA 3EXHA 4H1VA 1DG3A 2OBNA 3N07A 4HT3B 5A3QA 5C8YF 2P9EA 4FFBA 5H4GA 2DZDA 2VJPA 1MBZA 3OEWA 1FE8A 1K3TA 2FN3A 2REQA 3ABOB 3BIOA 3BXOA 4M55A 4P5EA 4RJKA 3LCVB 4URXR 2D2XA 2I8LA 3SS8A 2X1MA 3WSVA 4LPKA 2C7BA 2IX9A 2INGX 2WYOA 4R1UA 4BFTA 5JV5A 1A04A 1T6XA 4ZT5A 3T9FA 1HM5A 3OWHA 4PZAA 5AKHA 1XZQA 3KVOA 1EH5A 3R3UA 4MWDA 4XI9A 3JQPA 1ZH8A 1OX6A 3H9GA 4IQ0A 1VLMA 5BOVA 5DHAA 3VDMA 1IXRC 3FKJA 4PTYA 1Z74A 3FUVA 5IM5A 3ZV3A 3PE6A 5IKXA 2IP4A 4ZOLA 1ECCA 1H6CA 2C5LA 4J1SA 2ZJ6A 1GEEA 3UC5A 1EFCA 1NQ5A 3H6HA 2XVYA 5H70A 2L17A 1RYDA 4LYYA 5FWYB 3O47A 3KELA 1XL1A 1CZRA 3ROEA 2EDAA 1D03A 3UHJA 3LWNA 4HHEA 2Q3BA 4JJFA 4I2VA 1E63A 5IARA 3I1FA 1ZGAA 4F3KA 4V0MA 2Z09A 3E9NA 3KKKA 3GR6A 2XRZA 1QH8B 4OHUA 1JEEA 2WNIA 3FH0A 4WSOA 3I9NA 5HKAA 3GJ3A 1AE1A 2IYVA 3HR4A 4MKZA 2GTHA 3GGDA 2HPZA 1Z7WA 2WF7A 3LQ2A 4JB3A 1N2ZA 4QEDA 2C4MA 1VYHA 2R11A 1BU8A 2ZYVX 4JBHA 4MR7A 4TMYA 5K7SA 4DA8A 5LB4A 3TRHA 1HBJA 1YXMA 3ZBUA 2JBAA 2VH2A 5DE3A 4Z3DA 4AK9A 3GEEA 4W5OA 4WZBE 3BK7A 1UM9A 3VAZA 1JLSA 1VM6A 2G9VA 2LKDA 3QF4A 4IIUA 4CM1A 4YJGB 2C4KA 4P1ZA 2AXPA 4F60A 1EEHA 3PFWO 3EK2A 3HDYA 1DKOA 1QE5A 2GZRA 3FJYA 3LGAA 1T8RA 2NW6A 4GQAA 1GAQA 5FPTA 1M8JA 3TDKA 5CBPB 3ZVKA 3U3OA 3P94A 3LDFA 1WXDA 4FW8A 4ENPA 1JFFB 2D3WA 3LNTA 3F3SA 1P0MA 2G1PA 1ISIA 2QGZA 3BIWA 3EG9B 1HO3A 2F90A 4BVAA 3KKOA 5LJLA 2OQVA 3DEZA 3NWBA 2ZI5A 1KR2A 3TW4A 1XU9A 1C3OB 1GTL1 2F6RA 4GBJA 2NO0A 2YZNA 1SD2A 3OJWA 5CLQA 5AVTA 3U3DA 4Z4HA 2RHDA 3VHXA 1WLYA 3GCWA 1LI5A 3RU7A 3K8QA 3O95A 4OHBA 1E1RD 1ZWLA 4GGPA 4Z7JA 2B30A 1BRMA 4MICA 3EN0A 2V3CC 4ADSG 2IL1A 1DJNA 1XLVA 3DOJA 1XNGA 2EZUA 4XEHA 2QVBA 1SHJA 2J5QA 2PO7A 1ORRA 3DD1A 4NOLA 5JAMA 3GLGA 1XVLA 2Q50A 1SKMA 1G98A 3MINB 2VZ9A 2QTVA 2F1OA 5BXYA 4E12A 3QI2A 1G4UR 2R7KA 1ONNA 2JLWA 2IU4A 1BE8A 1S3SA 4O4IB 4P7KA 3RNOA 2HSJA 3SOZA 1NZFA 3RU9A 1UKBA 1OI2A 4BB5A 2Q07A 1H5QA 5JRZA 2ZUEA 4UM5A 4W82A 1K7FB 2P65A 3NATA 3NDJA 4KUGA 4KSBA 4DLTA 2DMRA 1SXJD 2O5EA 4CCYA 2H54A 1C5KA 1NX9A 1XAJA 3QPCA 4KR9A 8AT1A 2Z57A 4FE4A 3R9KA 3T7SA 4KREA 1ZSNA 4L08A 2XCIA 2OAEA 2XT0A 2HJSA 3NHKA 2E18A 4JVOA 1R6AA 2JVKA 3D8UA 5JH7A 1Y7IA 4FKBA 4Q3OA 2XUAA 4MRSA 5CK4A 4YCMA 2NVUB 1NULA 2QMUA 4E5DA 3B3QA 2A1UA 2O5VA 1GU1A 2ZIVB 1BDHA 2R8XA 3MHPA 4AG5A 2D3TA 2V45A 1K06A 1VHDA 3ABIA 5FOUA 2VSXA 2FA9A 2VVTA 5IJ0A 1Y9EA 3O2QB 1FRNA 5KTMA 2D0DA 5JZSA 4BJ5A 1H3EA 1XELA 4INOA 1ULBA 8GPBA 4JZKA 1LY1A 2GYYA 4W7SA 2ZQ5A 1M5UA 2WYWA 2JAHA 4G36A 2DHEA 1MTOA 1SIOA 2GAAA 1JG3A 4BNKA 2ICAA 4W7IA 3FTCA 4AZVA 2RAFA 1KA9H 1AUVA 2WOJA 3NXSA 2ZTUA 1EVZA 4YROA 5MGBA 5HZHA 2E85A 3VJLA 2SBTA 1WBDA 4M88A 1WD7A 2PXCA 3IBTA 1EX9A 3L8FA 4M87A 2CLHB 1U2RA 4NS4A 4RACA 4TN5A 3BFJA 3KC2A 5JXJA 4HX9A 3NV9A 3WK4A 3M3DA 1CUCA 1L5HB 4QU0A 1ECFA 4K3VA 4WZAA 1BHSA 2I29A 4M1QA 3U4HA 1E8NA 2ZITA 1JALA 3BEDA 2OMKA 3F6YA 5HFJA 1V37A 1Z63A 2XDQB 1U7HA 4JGIA 3FUTA 4BO7A 3LWZA 4PVDA 3I5MA 1UAYA 2EL9A 3DM9B 5ENVA 1NR1A 3FPJA 2Q3EA 4QU5A 3ME5A 4DTIA 3IILA 1TRHA 3VXKA 3F96A 4RAOA 5D2CA 4F96A 2BHNA 3JQ8B 4XFJA 5TQ0A 3N05A 3R4VA 3IOCA 5DYTA 4Y2JA 2O8DB 2ZIEA 3HWRA 1XVVA 5K4GA 5M29A 1J09A 3KUDA 1HNWB 1U8AA 1VRVA 4D25A 1Y7TA 2JKYA 2O23A 2P30A 4F6LA 1M1UA 1R0YA 3QHPA 2WM8A 1FUIA 4LHWA 4WT7A 1O0CA 5E7JA 2C9DA 2V03A 3FZNA 3KPWA 4EGJA 3OBBA 1GFIA 2OBFA 3NAMA 5JI2E 1DOZA 5EHQA 1DARA 1ESDA 4YXWD 3KSAC 5CM9C 1BROA 2X7XA 4HX2A 1XPUA 3SXJA 1P9LA 3AI2A 4B17A 2P2CA 4L5JA 2ZAOA 4PG6A 4YCSA 1LBIA 3SJZA 2RHLA 1DBIA 4I66A 4RIEA 2FP4B 1ZCFA 3WWYA 4FLEA 1PDWA 4FMBB 1QPZA 1RYFA 2ZBVA 1B74A 4IRMA 5KTOA 3EIQA 3J7AC 1G42A 4UUOA 1T9HA 1PS9A 1QYDA 2V6GA 4I5GA 2EJBA 4KXFB 1BO6A 4YV2A 5JYEA 5H3HA 2B3DA 3BE5A 1E2QA 1LBSA 1QV7A 3E3LA 1QQBA 1RU3A 4J9UE 4XUCA 3CUTA 5EERA 2F00A 2WZCA 2ZR8A 2VUSA 1OMOA 4RE5A 2Z04A 2Q9BA 3HKEB 4ZC8A 2SCUA 2Q6IA 2YFHA 5DBGA 5FPPA 4HWTA 3RQSA 3L46A 4E14A 4GX5A 3CQ9A 4WQMA 5FH9A 2IKSA 5DHPA 4BP1A 5DBEX 1Y7HA 3C15C 3KLNA 4CQMB 4L4UA 2O7RA 1UBKS 5LP6A 1YQUA 3R41A 3PQ3A 1TF5A 3C1OA 4QHTA 1JI3A 3KETA 3H1AA 4RJ2A 3NUQA 2AVDA 3D4IA 3L8HA 4J1TC 5HE9A 3GJTA 2IUSA 1ZDMA 2W93A 3O8BA 4CLDA 3IVMA 1XPJA 2GJAA 4M21A 2OAP1 4K8OA 3IKTA 2XTZA 2JK0A 5AQ1A 3V8EA 3U31A 3O2NA 1XROA 3KVRA 5TNXA 2GNAA 2Q62A 1BVYF 2WVJA 3FVQA 1Z0AA 3PHLA 4AIIA 1AV6A 4HWRA 5JAIA 1WB9A 2X2FA 4R8KA 3NHAA 4YP0A 3SHQA 1FU4A 3OJFA 2AMFA 1U0EA 3GFBA 3Q85A 3R6GA 1OXKB 4KO3S 5D85A 2VTEA 4JR2A 3HB7A 4A8TA 2VPPA 3Q40A 1M34E 4UUQA 1DCMA 4BGUA 4R81A 1CUWA 1RVV1 1O95A 2E5LB 1GNSA 3AWDA 1CQWA 1V95A 3EW9A 3UHOA 2PXXA 621PA 1E9SA 2JCGA 2A0XA 1M8GA 4CODB 2G5GX 5KAPA 2UU9B 1RI4A 2O3SA 1IUPA 3NWPA 3NHWA 1V1JA 3TSYA 2B92A 2VHJA 2W6IA 3OE7D 4CTJA 4EYKA 1N0UA 5DP2A 4YMSA 3L0BA 2IZ1A 4FN4A 1OZHA 1KXJA 4R8MA 3SLKA 1NZJA 3PCXA 1PR2A 1Z15A 5IDXA 1QNFA 1K5DA 1RZVA 2ST1A 3OECA 1NG9A 5E1OA 1XJ5A 4V03A 1TC2A 5CX4A 2Q1WA 2EQAA 1GAEO 3FWYA 3V1YA 3O9MA 1B3BA 1ZZEA 4G4IA 4GU5A 5DTRA 4MWCA 2EG5A 4CKYA 3FLAA 3NBUA 4MWOA 5U4XA 1HTBA 3UT5B 3A8TA 3H3JA 3K0AA 3DHNA 2QZ4A 2ZJBA 1SB9A 5ITWA 2EHJA 2DUWA 3VR2D 2MDTA 1QO0A 2Z3ZA 3D02A 4KWHA 3ZYCA 4XVRA 5FOTA 1DRWA 2JIPA 2XDAA 2YCLA 3QE9Y 2IFTA 2QLLA 3AB7A 3GF4A 1JF8A 3IRVA 2YKGA 4NF2A 2EBFX 1ZNZA 4N3GA 1LKZA 2XF8A 3R5TA 4NJMB 1K92A 5AJUA 3Q7EA 3SC2B 3FF4A 5JSKA 5DBIA 4CLOB 1BXRB 1QZXA 3TXXA 5DEOA 1TTTA 1PD1A 3L5KA 4HMQA 1ONSA 4N12A 3RARA 5BR8B 3KHTA 4Z7OB 5D7NA 5AHOA 1FUYB 1IJBA 1LRLA 2Q2QA 3AR8A 3GA5A 3GDOA 4H7FA 1L5OA 3V1NA 2D5CA 2FEWB 2FJ0A 1XTTA 4PBSA 3WLEA 4EVRA 5FA5A 2IVFA 1LSOA 2ZZNA 1JSLA 4PG8A 5SY9A 3RS5A 1V41E 3VR6A 4UU0A 3BT7A 3TD2A 1KJZA 2FSVA 1P2VA 1ZIOA 4DQKA 1KEUA 4ZQBA 1IZZA 1QFYA 2O2CA 3CN9A 2AJTA 3DA8A 1GPDG 1THZA 3DEIA 3L84A 4IXTA 5D5PA 3VNSA 5BNWA 4OLFA 1BSVA 4MVJP 3DUFA 4HJXA 4JMPA 1D4AA 3QUBA 4U3JA 5FUWA 3PDWA 5JCOA 4IDBA 5HJEA 3EEOA 3JYOA 4J3FA 4K88A 3ASYA 2Q3HA 4OHVA 4GUAA 4CI9A 4RANA 4NBUA 3BM5A 4QYMA 1LLUA 2GN2A 4TZTA 1IJFA 3EOBI 1O77A 2GF2A 2VAMA 4HOYA 4R0MA 2Q6TA 2W48A 4MS4A 3PICA 4WESA 3N28A 3PJFA 3TUJC 3ZV6A 3C7TA 4HQFA 2P41A 1VCMA 1Q1AA 3I6YA 3RUEA 5JADA 2QTHA 4FCCA 1YZFA 3Q5EA 1NVWQ 3WRWA 5IH7A 3ZZMA 3HLTA 4RCZA 4H0FA 3UMVA 3HGQA 1WEKA 3EGXA 3G0CA 3SI7A 2J0VA 3ZIDA 4M7WA 3ONEA 4BN4A 4YUAA 1C8KA 3FUXA 4FIDA 5E0OA 5HA5A 2W58A 1DE0A 2G80A 1DKUA 4R2IA 3UJNA 2Q21A 1C9JA 2ZYTX 1NF9A 1Z12A 4RF4A 4KE8A 3HP4A 3M4JA 4LOIA 4UHDA 1IAVA 1P2FA 3OFVA 4O0LA 2XOXA 3VPAA 5KS2A 2HBYA 3PTAA 1GT6A 4CF4A 1NXQA 1RPNA 3PKZA 1VB3A 1XFDA 3HR8A 5IKOA 4AJEA 3WLSA 1M1NA 4E31A 2B4AA 1AGXA 3KKLA 2VO1A 3E4CA 4ZGWA 3IEXA 4M99A 4QNMA 5FLYA 1HFWA 3R3VA 4ZTBA 2OCXA 2BMEA 1BDJA 2AQ8A 4KXXA 3WQHA 4Y1EA 4WKPA 1PR4A 2ZTLA 3T5GA 4DAOA 1HKUA 1I14A 3LUCA 4GWKA 2G9ZA 4CM4A 4DWVA 4A6PA 4BVHA 4BX0A 3IHKA 4GYYA 2NU9B 3RFUA 4JI3B 1PRYA 4O2AF 2JLVA 2GZ3A 2KE5A 2BFCB 4WUVA 3U0VA 3V48A 4EFKA 5JZMA 2C9OA 1NNSA 3MG9A 1C0EA 3DW3X 5BV8A 5BUQA 1FTWA 3I1IA 2XZDA 3KQHA 3BSWA 5LD2B 5EJ9A 3M6FA 3E8SA 1BWQA 5EKUA 5ECYA 4LWPA 3TL6A 4YUYA 3A9SA 1UWKA 2Y4NA 2ZDQA 2CYBA 4B4UA 2Q99A 5JO9A 3ZDZB 3GRYA 5DX0A 3FNEA 1ZD3A 5T3UA 3C4QA 4BP9A 2BZGA 3BL5A 4OHCA 1T1EA 1MJGA 1OJLA 3OWOA 4TVBA 2QDKA 3TJMA 4DHWA 1JSZA 2OHOA 4HPXB 1BMQA 4PGGA 4CRWB 4YREA 3RO7A 3IEPA 4UUMA 4L9WA 2QRQA 4RD0A 3ZW8A 2O8EA 2EDCA 1MVNA 3AKYA 3Q9SA 4JXKA 1M1YA 3VZDA 2G7MC 4XIIA 1E3EA 3QE2A 4FQ8A 4HDRA 5C5IA 4C4AA 1PYOA 4KFUA 1Y82A 2RHHA 5KO2A 4ID3A 4MO9A 2QMEA 5BWCA 1GYQA 2JI8A 5JD5A 1YRHA 4X94A 5I3CA 2H29A 2NM0A 4WJZA 1P9RA 1T9BA 1WTCA 2GEJA 1PGQA 2WIJA 4B3TB 4XH9B 5HRCA 1NBOA 2HUPA 3MBIA 3IYLW 5FI1B 1PWYE 4B09A 4EJSC 5IVKA 2R8ZA 5F2EA 2QGNA 1ZKDA 2IE8A 1E3TA 3PNBA 5A5DA 5CYFA 1DIGA 3OFJA 2AJLI 5ALUA 1A1VA 1JZQA 2G4VA 3ILYA 4J2OA 3QUAA 4G97A 5IC5A 2EYUA 2HMVA 4LJKA 3WI7A 4F4UA 1YBHA 4TROA 1JMYA 1JHVA 1G16A 1B8VA 1Z2CA 1P2TA 4LBZA 1Z6GA 3RM3A 3SMVA 4DPMA 4EM6A 3B1FA 3F2VA 1LPPA 4L9RA 3TEFA 2XVMA 3R7NA 4NZYA 3UAZA 3K0SA 3WO1A 1KSGA 3MOIA 3SK0A 4CDNA 3RADC 4REQA 2G9NA 3KTAA 1JDPA 4HMOA 1YVPA 3E05A 5CR9A 4Z86A 2RGUA 2OPHA 2VHEA 5EHNA 5T6MA 2OG2A 4S04A 1BHJA 2QM8A 5CUQA 1WIWA 5TQJA 3V4ZA 3F3MA 2DT8A 1SXIA 2YOHA 2I2CA 3M1LA 3A1TA 4QYTA 4CM8B 1L7VC 3GJ0A 4EQZA 2WD7B 1SHUX 2W42A 1QHSA 4IDDA 3TUZC 2KM1A 5I48A 3BZBA 1QG0A 2DM6A 4RGQA 3C1UA 2VLBA 4LZPA 3QWBA 4XPIB 1MJ5A 4INAA 5KEIA 4PLGA 4U7GA 2CJFA 3IALA 4MR9B 5LQUA 1VIVA 2HLPA 3VYTB 4D96A 5B6JA 1YBMA 2V5VA 4B31A 4TV8A 4WA7A 3LTEA 4OFZA 1AX9A 4CLEA 5JHHB 4MGEA 1GKLA 1E9VA 2HLHA 2PRSA 1XZNA 2GZAA 3HGTA 4HRVA 3TJRA 4Z4GA 1SZJG 1RXYA 2N1BA 3PFGA 2YRFA 4C6TB 4E2YA 4DMGA 2WLTA 4OBWA 3WRVA 1V43A 5L3SB 2YOGA 4HPJB 4MYCA 2XXAA 4JXZA 1UDBA 1BS2A 1E1NA 1T24A 1QKKA 9ABPA 5EWLB 2R8PA 2Z43A 3KFVA 3QX7A 4J4TA 3ZDXB 2BR3A 2H5LA 3EFHA 3DZFA 4Z3KA 3O4FA 1WPRA 4V24A 4ICIA 4B48A 3JQ6A 1MIOB 4HLUA 2PLFA 1T9KA 3DBIA 4GVXA 1NBIA 5E2BA 4ZDJA 1JLMA 1JQAA 4PSKA 1YE8A 1EFRA 2AXQA 3L6CA 4LXHA 3QEAZ 3U7EB 2I9KA 4E70A 4D0LB 1CLEA 1YI1A 1THGA 1WSBA 1W0KA 2PWBA 2XY4A 3FFAA 1SBQA 2CDRA 2HQ1A 3B9PA 3RUFA 4LKOA 2Y9PB 3L0YA 4P9NA 3KQYA 1O3YA 3AH8A 3V8BA 1RRMA 2JGJA 2X8AA 4MVJM 3UMBA 5AOAA 3D81A 1ORTA 4G8BA 1QRSA 2C4HA 4YALA 1ND5A 3EZNA 3V2UA 5LZ2A 2CJWB 2C5EA 5D1HA 3A3YA 1RWKA 4ZVNA 4ZI7B 4RA9A 4HQ6A 1H2ZA 3V9AA 3KU4A 3GFVA 1WXQA 4W8GA 3G2HA 3GOHA 3K4HA 4MQ6A 2C2WA 3FVTA 4V0QA 2DOKA 2YWRA 3BL8A 3H8VA 5EGNA 4B4OA 4RXUA 4M38A 3BMOA 1G8YA 1HOTA 1TEHA 2D4AA 4Q1FA 4DG9A 2BH2A 3SM3A 1QQ5A 4ZAGA 3AW9A 3BK2A 4MKXA 1I6LA 4WLUA 4K7JA 2XTNA 3E22A 3AQ4A 4Z1MA 1BE6A 2PFKA 3IUYA 2A8YA 3NANA 1CP2A 2RGGA 5EJ5A 4BYGA 2UXBB 2EATA 1ZCZA 3R6TA 3QV2A 4IHKA 1NVMB 2O2IA 3DMPA 2F9FA 1T6YA 4N47A 3TAXA 2WKRA 1IN5A 2RJ3A 3VHQA 3RYHA 2GM9A 1TA9A 3CX3A 4MV0A 2IXBA 5JIBA 5BURA 3O1LA 3FYSA 1A2QA 1ZRMA 3D6NB 2IHUA 4L5YA 3ZLBA 4EPVA 3RIYA 2JAUA 5LZ9A 4KDFA 1D6NA 4JWTA 1J8QA 1RM4A 2UYYA 5WRFA 1SOAA 5JJKA 3FPLA 3AILA 4QUIA 2HIMA 4CKBB 1KYTA 1T43A 2WTBA 4EA6A 1TJ5A 5AVXA 3GMIA 1J20A 1FVOA 4H59A 4ZI5A 3VH1A 1BMDA 4RTJA 4J4BA 3JVDA 3OJXA 1GZ7A 4GBED 1X7YB 4R16A 3KYJB 1G6Q1 1KWKA 1YDGA 1CZHA 2OB2A 4EATA 3MWDB 4HQOA 3HZHA 1HDIA 4RK1A 3DV9A 1G9SA 2IWHA 1T1JA 3LRXA 5KJ1A 4AQYB 3LPLA 4JENA 3RYIA 2ZT5A 4AIRA 2R6CA 4DDHA 4GX1A 1P72A 1YJBA 2HDWA 2PUAA 5GGYA 1KP2A 1QO7A 3KQKA 3B53X 3TTTA 5JYCA 5TQ2A 3X2SA 5C5CA 1OH5A 1GPAA 1FVFA 2FPPB 4KX3A 4LX8A 3RD5A 2PUBA 2G71A 3B3GA 3R1IA 3PHJA 2N47A 2ATCA 1EQAA 3G82C 4DV2B 3KCQA 3UH1A 1NBHA 3RG8A 1TMOA 4GKVA 4ZVSA 3TQTA 5JWRA 2ILTA 4XOUA 1T10A 2QXTA 6ADHA 2L82A 4GMXA 5JJCA 1W5TA 2B20A 2ZJ5A 1OB2A 1EAYA 1NW8A 1NOJA 2XRMA 5CYOA 3QLVA 1JAZA 2G76A 5FP0A 1QQ6A 3TL3A 1Q0QA 2C8JA 3I1YA 2IYLD 4KYTA 2BM0A 1O57A 6Q21A 1M7HA 5C37A 1J24A 1K88A 1JR4A 3KOWA 1XLTC 3U6KA 4OLHA 1LC3A 3DDNA 4NTZA 2BEUB 1SC1A 2N42A 3OZCA 3GHHA 3BJIC 3ZWBA 4JODA 2OECA 5FTKA 1Y4DE 3TXAA 1DWUA 4Y9SA 3MTIA 3UTDA 3ZLJA 1JDZA 1SVIA 3L7DA 1U0LA 3CLTC 5HS4A 2E21A 1KAHA 1QR6A 3BAZA 4AJLA 3OKFA 3VYUB 4QGGA 4R83A 4W1PA 4HQKA 1GPKA 5MN4A 1P17A 3UMRA 1B8PA 4JI5B 1S9HA 2ZGVA 4GZLA 2YNMA 1Q83A 3H2BA 4QJIA 4UM9D 5I51A 2HJVA 3MRTA 4TKVB 4B85A 5K6TA 1GZ4A 3DDSA 1EP3B 4JHXA 2UUPA 4FCVA 2CVZA 3OUZA 3KJFA 3A3PA 5E1MA 3O8OA 1YJAA 2QORA 4IJVA 2ONJA 4YMTA 2BEKA 2JGDB 3J7TA 1ISFA 4ENUA 4ZAWA 1NBMD 4QREA 2W6ZA 3UCFA 3PWZA 2ZROA 2HU8A 1P0PA 3O75A 5KX5F 1MO4A 3TEJA 1MW8X 2AOVA 4MKHA 3T5PA 2JD2A 1DEAA 4G65A 2YASA 4WXYB 5FI0B 1LDMA 4H3SA 1N25A 4R84A 5ADVA 3KS9A 4ERNA 1RRGA 1T2CA 1ECJA 3DMFA 3EOAI 1B26A 4PPNA 4X44A 3OOYA 4A82A 2OD2A 1NIJA 5HOEA 1ZS9A 4E1BA 3SNHA 2H7YA 5DI9A 4FZVA 4HRYA 4LSGA 1OVMA 4NBLA 4HMPA 1G8FA 1M0SA 5BYBA 5EUQB 4ZCRA 3DLBA 1UQTA 5ICSA 4IDOA 3EPPA 3FBWA 1R15A 3MWYW 1P0IA 5ALHA 3Q8MA 4UU1A 2Z1NA 2QZ9A 1FP7A 1HMPA 4XQGA 3WXBA 4X7PA 1Z4MA 4OQYA 5EIBC 4FGUA 3GLSA 1UPUA 2DPLA 3BICA 1H2XA 3WNQA 5FL3A 1VXRA 5FQNA 1X7ZA 5REQA 3X1XA 1F8GA 1CTQA 2FFAA 1UBCA 1ND6A 2HCFA 4TZKA 2CVFA 3JASA 4DV0B 3O8QA 3K0FA 2PT6A 4E46A 1CU1A 3FF1A 1CB0A 3D2BA 4YIHA 2JJ1D 4LYFA 5EXEA 4ZZ3A 4HVCA 2WYIA 3IAS6 3IR7A 2AR7A 4WCFB 5CHYA 4CMJA 2LRHA 2VXCA 1C2YA 4KXLA 3TG2A 1VLHA 2O9JA 3PCRB 1RXVA 1F1JA 2COKA 3A1CA 3V1TC 3GWGA 4L2IB 2FZWA 2RJNA 3B13B 3C7KA 1XTBA 4IXDA 1Q6ZA 4KXUA 5B3LA 1OASA 3P5BA 2VP4A 3G2QA 5EUCA 1JG6A 4P92A 1PBTA 1CUBA 1Z4LA 2I3BA 2WAYA 2YWXA 1QFJA 1RYYA 2VJMB 3COVA 1PUXA 4O29A 1KTIA 1DELA 2VRWA 4NJEA 4F6RA 4PLZA 3I83A 4N0PA 5KOJA 2E4YA 3UMFA 4LX0A 3PL1A 4IOMA 1R8YA 2B4YA 1U2PA 2D8MA 4DLZA 3L9WA 4K1XA 3G0GA 3JQCA 4MLDA 5CVEA 5KINB 5ESDA 3PLRA 2ONKA 3SVZA 2FDRA 2WF8A 1MABB 3MCZA 2YXPX 2QRZA 3E5MA 1OE0A 4ZOQI 3PLNA 1T2DA 5DYIA 1IAQA 3HLYA 1OLSA 4YUZA 2Z95A 3I9MA 4TYQA 4OUDB 3UENA 1VJCA 1A95A 1JTVA 3UWDA 5IZ4A 2H16A 3V9PA 3T7IA 3N2YA 5EIHA 1L5RA 1HLPA 1WSAA 1YOBA 2CLOB 1AB5A 2ZYIA 3HU3A 4A0SA 4TTSA 5JZOA 2J85A 5JYDA 3LQKA 1A7JA 3M6XA 2C8VA 1F8UA 1HNXB 2AXEA 3ZDFA 4PO9A 1KO1A 2WBLC 4UTOA 3OPXA 1X1TA 3PTZA 3W7AA 1HE2A 3DTYA 4N6GA 5I7EA 2WV7A 3E5RA 3UK0A 4MVJE 3KXPA 2G83A 3NDPA 1UFRA 4OAOA 4EEXA 3LDUA 3M6WA 3ANMA 1XZFA 1WXEA 2FOXA 4UCQA 2PE5A 3PXCX 1NI5A 4I4TB 2QROA 4PX2A 3NP7A 3LY7A 4QO7A 2V4ZA 2CXPA 3D0QA 2F43B 4K6MA 4JBXA 3SSOA 2DFPA 1DQZA 4KI0A 5EOVA 1DAKA 3K92A 1DKPA 2ZJ3A 3GEPA 3E84A 4L4ZA 4KL8S 2WJVA 4LY6A 5CW1A 2OFFA 1Z7YA 1NTOA 3FYTA 4RZ3A 1YHYA 2FSSA 1WL8A 3FIJA 1IIBA 1J1UA 2NQTA 3RC8A 3KZCA 3DKPA 3E1SA 2FPKA 3TLEA 3NO4A 5CJJA 1N3BA 1DLIA 3QQ5A 2YQ4A 3WLHA 1S1MA 3N8HA 1RAHA 1V2GA 3VR0A 3H2ZA 1ZL0A 2ZAYA 3PXDA 4Z7NB 3DBVO 4QUGA 1I2DA 4D82A 3OZIA 4D9BA 5K6AA 5CAEA 3M9XA 3HKCA 1PQUA 4HCJA 4WPGA 3JATB 1UKZA 3L7CA 3MMPA 4D80A 5U9CA 3KQTA 1UXIA 1N9GB 3CLVA 2DYKA 2ZR9A 3NHMA 3NTOA 4CEIA 4Y1GA 2PU7A 3AM4A 3AONB 4QWWA 1EFVB 4N8SA 3N0TA 5MGNA 1C30B 3DV0A 1JQLB 4U4AA 5H4HA 5J4HA 5LOVA 1FJGB 2IT1A 1M2WA 2PZKA 3W4JA 3HJFA 1X8LA 1LD3A 1EMDA 5CPBA 2E82A 5IH3A 3SBOA 3TW0A 4H4EA 3C2QA 1D7AA 4U0JA 5K3FA 1UXKA 2LGJA 1ZITA 1H85A 3RJ5A 3NBQA 1V8PA 2ZTMA 4RVCA 1QO9A 2Z08A 4YY3B 1P0FA 5AJTA 3WDKA 1NMZA 1H3FA 1Y5RA 3X2EA 3RSSA 5I9LA 4N6NA 3E9CA 1JECA 4GXRA 1CJKC 1GCUA 1X0VA 2FSFA 2H2WA 4XB6B 4DC9A 3ICQB 4YRJA 3Q7RA 2WWHA 2VH5R 4BGIA 3QBEA 4M8IA 5EWMA 5CDFA 1VLZA 5H83A 3EJWA 1NW7A 4TTJA 2EKLA 3IVXA 1ZRSA 2C94A 3MZ0A 4D0NA 5A06A 4ABTA 4QHSA 3RSOA 4IV5A 4JQSA 5BNZA 1E77A 3R8CA 1FNDA 2K7ZA 1CQJA 2ID9A 2WHRA 1T5LA 4ENVA 2JH3A 2Y3IA 2ZIXB 1BDIA 1H5UA 1UBSB 3GQBA 1XEWY 3GZNA 1DXOA 1M9NA 1R9MA 4TS1A 4RZHA 1WW8A 3NVDA 3VI4B 5LQNA 5DGIA 2PZGA 3NKVA 3RQIA 2I2BA 2J48A 2KLBA 2AN5A 4GM1A 3GBPA 4GL2A 4URYR 3AF1A 1ACLA 5EXTA 1BXGA 5HPYB 3QVSA 2VF5X 1NI4A 4MQUA 4NESA 4QASA 4Y6QA 3X1WA 3PNYA 3PDJA 3ZWNA 2WUVA 3VPDA 5BR7A 1SU6A 5IHXA 3KDPA 3UNXA 3WYAA 4AW9A 5A03A 4CTNA 2BBWA 3I9FA 3PTLA 3VNUA 3HDGA 3CB4A 4GOND 2YXNA 4M83A 4UHFA 5IYZA 1JXAA 3BMQA 3JQBC 4DLAA 2HGZA 5F33A 3DBLB 3HUDA 1X87A 2Q2NA 4MUAA 3H2JA 1YIAA 4C30A 5I47A 1QG6A 1N1MA 4OHXA 4BV2A 3QY0A 4W7HA 3GRZA 4NR0A 2IZZA 1EDDA 5AK5A 4KTTE 1WCWA 3TRIA 3OKPA 2JFQA 1GGFA 3VR6H 1YJ8A 3P2IA 4TV9F 3ZR4B 3OCJA 2O59A 2P5YA 1XCGB 2V7EA 4ZO8A 3UUFA 4QZVA 4DCSA 5AW1A 4G56A 1ZOPA 2FUKA 3CINA 3PUJA 1P39A 3LQQA 1J97A 4G84A 2VBFA 3ZGVA 1MC5A 4QARA 1VL6A 3PD7A 3RCBA 2P6RA 1YV9A 4ARIA 4U5XA 1MZVA 2PT5A 3NBFA 3R0QA 1Z0SA 1NLFA 4N0MA 3DEJA 3R0ZA 5CTJA 4FS8A 3CEJA 2O8NA 1CY4A 2YHIA 5F77A 4BVJA 1MQ8B 3O21A 5CA1A 3QU5A 3U4QA 4JA0A 5IT4A 1YAJA 4H6VA 1O94A 5FOSA 3RIMA 4BOYA 1KHHA 2M32A 4YRIA 3NRJA 1Z75A 4QXMA 3V80A 3LO8A 4EI9A 1EX1A 4L22A 5K3OA 3BCSA 1OY1A 2HF2A 4ZZ1A 2XCUA 2EZ8A 1A77A 3R0JA 1GIAA 1VA4A 2X15A 4Q9LA 1GNLA 3T5DA 3GCGA 3I6MA 2XUPA 3FMGA 3QBJA 2CNWD 3V3KA 4CKBA 3KQLA 4L4SA 2G08A 4ZJPA 4IINA 2CFRA 2JRLA 2QE6A 1C1XA 1PQYA 2NO7A 2XW6A 1Y6QA 4HY3A 4NEHB 3ASUA 4O1IA 3PK0A 3ZE9A 1A72A 4JZYA 2Y67A 4LDQA 1PFKA 3EB9A 4PX5A 4DWJA 2HF7A 3RSLA 2CNNA 3LNCA 2V8BA 1M74A 1IL0A 1D9XA 3IJRA 5LR6A 1TPZA 1EUCB 3HCEA 3WL3A 1KEEB 3O94A 4TT8A 4ZODA 1RVDA 4Q01A 3QU4A 3A1UA 1WU7A 2RG7A 4LOAA 3WKCA 3R2JA 5CB0A 3PZBA 1GUYA 3ZHOA 3NALA 2CC2A 3TW8B 2ZSHA 5A4MS 2QIPA 4M6WB 1SU7A 2H17A 3SZLA 1T26A 2GK6A 4NYMR 1I01A 4QIHA 2P9GA 2MYUA 1TO6A 2HBQA 2VNKA 4YQEA 1LRKA 1C7ZA 1RD4A 2E4WA 2VOJA 2ZB4A 5JAUA 1W52X 4MW5A 2QQFA 1KORA 4FHDA 3TN7A 4EB0A 2VCYA 3WNDA 5HIIA 5J2TB 1RQ2A 3VNBA 2ZSJA 1G60A 2PUHA 4H27A 3TE6A 4S1NA 1AS0A 1QIMA 4Q9AA 4PN7A 4CKWA 3JALA 2X4DA 3BTVA 3IIEA 5IUJC 5CA0B 1FMLA 5GGXA 3CGWA 1KO4A 3KXKA 1M83A 1J06A 1R8XA 3B3JA 2VBIA 1J21A 1C81A 3IBYA 3K0BA 4PAQA 5AKLA 4LF7B 4QOSA 1BX3A 1O2DA 5ALMA 2VF4X 4K3UA 4OIMA 4G63A 5TB5A 1FYWA 3U13A 3V33A 3QOFA 1N2CE 1KEZA 5ELMA 1C29B 2VHZA 3T3DA 4CM9A 2GAFA 2Z56A 1M8KA 4OY3A 1EFUA 4OH7A 5HZGA 1XMJA 1UJ4A 1GCIA 1DAPA 1WW2A 4ND3A 2HXSA 1OXSC 5AICA 1QFXA 3C4VA 4C3UA 1UR5A 1TA4A 3NKFA 4JJ4A 4H3KB 4JVLA 1IZYA 1AMOA 3ZDDA 3IIJA 5IN4A 4A0HA 1FP4B 1CUFA 2JHGA 2ON6A 5H7XA 5E95A 4A8JB 1NATA 1F51E 1CUYA 1T9AA 3TZEA 1W36B 4G5FA 1U31A 1SWVA 3P20A 2EFYA 4B6SA 1JN0A 1L4FA 2EJVA 5JS6A 2CSXA 2XAAA 4QG3A 1X1QA 3P2EA 1GQYA 2QY6A 2ZEJA 4XTRA 4WEOA 2GRAA 1BFKA 2QW8A 5KTNA 2AF3C 2WIKA 3LLCA 3SHOA 4MUIA 5JFOA 2MINA 1V16B 4INZA 4UDOA 1UZLA 3FFBA 5DKFA 2H4FA 5B4TA 1OR8A 3BWVA 4UD2A 4A73A 5JDIA 4Z4FA 1USWA 3BSYA 2OUIA 2ZRCA 1UMBB 2GEKA 4AQDA 5IDQA 5KNCA 3E9RA 2V7VA 1TRKA 1A9PA 2IDKA 4LVUA 2QVZX 3CRRA 1UBHS 5JVDA 3ORRA 1ZAKA 3AVWA 3P2OA 4WKNA 2XB8A 4BCCA 5KVCA 2JLYA 4NZOA 3B3AA 1GDDA 1TJYA 2JCVA 3G2PA 1VSQA 2V5UA 5A5GA 2YHUA 4Y1RB 2QVYX 1WDWB 2QW1A 3JARB 4LA4A 5EFOA 2PV7A 4KN5A 2XJ4A 4TWIA 2IOHA 4F4CA 1GL9B 3ZU6A 1EIWA 2W2PA 2AJ8A 2I03A 3NPMA 5FTWA 2D62A 3KFLA 2V7WA 3KZ1E 3MTJA 4EPWA 3HB0A 3TFOA 3K71B 1FFCA 3PC6A 2ZLBA 5AM0A 3BG5A 4XGNA 5H68A 2NU7B 2EJTA 1XE3A 5LM3A 1EFPB 3GL9A 1EJ6A 2QZSA 4BFUA 5I9MA 1E7SA 1Y3IA 3WP0A 3CYFA 2F3SA 3IUQA 1KYXA 4GOOD 4KOEC 5AW0A 3VUFA 5F52A 1GQRA 1G59A 4ZOLF 3BK1A 1PT9A 1WUIS 3OZUA 2FUCA 4LDZA 5HUQA 3CWCA 5DSTA 2PKWA 4MW4A 4TV9B 1TEVA 3AZPA 3KQNA 1IONA 3R8FA 1TM5E 3CG0A 1IOLA 1PJSA 1Z39A 1YQGA 4KIWA 1SOMA 4DCJA 1LDGA 1KEPA 3EEYA 4N0DA 5BR4A 3RS3A 4G0PA 3CG4A 5HGJA 1W59A 1VGQA 2A9OA 4EY4A 1YR9A 1DB3A 4PEVA 1RZRD 5I7UA 1XWWA 3KSRA 3NAQA 4MV6A 1R50A 2I0FA 5B1SA 4UE6A 1Z6TA 5F2OA 1I2CA 1KC1A 1NMYA 1CF9A 1DKQA 2VPWA 3PQ5A 3NEJA 1PF7E 4BIMA 4DFDA 4WNIA 3SF8A 4R9VA 3AR6A 3ZUPA 4DWWA 2C59A 4RH1A 4BY9E 1SCJA 1HA3A 4G5XA 2P2GA 1RRKA 3EVAA 1XKQA 2QD3A 3HKDB 3NTRA 1UWCA 4ZZ2A 4A92A 3UANA 2M6RA 3CW2A 1DADA 3GRFA 3BIJA 4QFCA 4YI5A 1UKVY 1L8AA 4KPUB 1ZY2A 2GPWA 2HF9A 3WA7A 1PW7A 5A0TA 4NV1A 1WDMA 2V6JA 1PP4A 1OXUA 4BRUA 1KVSA 3DNMA 4P82A 1UC4B 2RSLA 5FR2A 4Q3DA 3VJMA 3ROZA 4Q37A 3ZI0A 1RRCA 1TOAA 3ICPA 5ALPA 4RFVA 1Z8DA 4CHGA 1SVMA 2OSVA 3AWIA 2WJ3A 4BE9A 4ES6A 2J3DA 1X0XA 4OU5A 1L4NA 1A2OA 1GV1A 4K28A 4MTCA 3EA5A 4Y0NA 4DSOA 5CBKA 3G3EA 1OF1A 1PT8A 4LY0A 1HEUA 3KWLA 3CLKA 1YB1A 2GXAA 1FSZA 4IDAA 4DXAA 5HKOA 1EWYA 5HJ2A 4C5BA 4DVJA 4H18A 3Q1KA 3CX6A 4NU5A 5AJZA 5K2MA 4J07A 2Y0BA 3SP1A 2C99A 2VT2A 3WFZA 5JSZA 1Q74A 3HYNA 1QONA 1LNQA 5ECGC 5A0VA 3F1KA 1EA7A 2MHCA 3FSGD 4KMSA 3PIDA 1RQNA 1M2NA 3PQ8A 2X9VA 3G02A 1RE0A 4OSOA 2W6NA 2ACKA 1I4WA 2J5RA 1TM2A 2PRIA 3QA9A 2OGTA 3ITDA 1EUDA 1SULA 1VFNA 2V55B 5KB3A 2VTBA 1UC8A 3OOSA 4BDTA 1MEJA 3NZEA 2IYUA 4QYWA 4Q24A 4UVIA 1JHAA 4WY5A 3URKA 1EUZA 4IH4A 1M6VA 3D4BA 2C98A 1CJVC 1K7SN 2IK8A 2PU5A 3WV5A 1A9QA 2QG6A 3IXMA 1D5CA 2F3UA 1V6AA 3PVSA 1E2KA 3AF2A 3K5IA 2XUDA 1T8SA 1WV0A 4DJEC 3A27A 2WA2A 3N8IA 4P84A 3MILA 2PXAA 2XD9A 2E6UX 3TLGB 2ISQA 3BB3A 4HSGA 1SC9A 1TUEA 3OD5A 3JQFC 1WVGA 3N2EA 4MUXA 4O02B 4Q4HA 4QYIA 4OK5A 2BP7A 2MWMA 2O2DA 4MQFB 1Y9JA 5TEVA 2QRNA 1M6NA 3OTIA 3ROGA 4DKJA 3L7NA 3LGSA 3LT2A 1E3QA 3I8SA 1V1MA 1WB6A 3I53A 4F72A 2AMJA 2EP5A 1UBRS 4K03A 5F3RA 1RXWA 3A0UA 1B6SA 3O38A 1IDN1 2GKOA 3OZFA 4BWVA 3LF2A 4PE5B 1ZD4A 5JE8A 2C8LA 5J3JA 3CVWA 1NW4A 1OXMA 3ILXA 2UYCA 2WJPA 4FYXA 1ZJ4A 5B1IA 4E3WA 1QIHA 1QH1A 1XT6A 4DG5A 2QK4A 2QUIA 4KITB 2UVDA 4JI6B 2JJ8A 4PW0A 3STYA 3ZHXA 4DBVO 5KKNB 2AD5A 1XDDA 4TSRA 4C4TA 3HCPA 5CH3A 1LV7A 1HLDA 3IPAA 4QPZA 1ULUA 2FPGB 5KNDA 3MXTA 4IIGA 2OO5A 3WQQA 4L15A 2NVOA 1KE1A 2WY2D 5G1OA 1QHHB 1QYCA 3QTBA 4RVSA 3AUFA 3F97A 3Q87B 2RAPA 3EXHB 4WN9A 3HNPA 4BTEA 2DSNA 1DKRA 5K0SA 4D44A 3C6BA 4FFBB 3D2CA 4CKCA 1QH0A 3DYIA 4OQQA 2REQB 3D1JA 1F3LA 3EEQA 1UK8A 4LISA 5SZHB 1MEEA 3D7NA 1LX6A 1QGAA 1Y6GA 3GG2A 1G8AA 4NU6A 2IP2A 3DBRA 2Q1TA 3LDAA 3HO8A 3C0KA 1HDCA 3SJUA 1A27A 4YGXB 4M9UA 4P0PB 2O4CA 2XKAA 1AC5A 3SX2A 2BVNA 3GEBA 1U90A 3VOSA 2BTQA 1PHRA 2PYDA 1ZGGA 4ZOLB 3RJTA 4LVOA 1MPXA 1PQWA 1RPAA 2DPYA 2QENA 3EWIA 3MJTA 5E8JA 3W2HA 1USVA 4N0QA 1TZKA 3DXFA 3ZY2A 5BPHA 1NQOA 4P93A 3E1GA 1W6UA 2G3YA 1V7CA 3QEMA 4D2IA 1NGSA 1MKYA 3I2FA 4BFZA 2DR2A 1BVUA 2D6FA 4ILEA 4RTPA 1C8VB 1PEKE 2I7TA 4MEAA 5BQFA 5EJEA 5DBHX 4L50A 2H9AA 4KQ1A 3UPDA 4PYJA 5D00A 1E8DA 3QBTA 1RP1A 3LZCA 1C1HA 1PEAA 4QOHA 5BQ5A 4RD1A 1IXZA 1I5EA 1RHUA 3AIIA 1T2AA 1QJ4A 4KZKA 2BBOA 2NYVA 2Z2XA 3GJSA 3ZK8A 3TNYA 1SCKA 2W2MA 2ZAGA 4OJYA 3L1JA 5IPFA 3JZMA 3F98A 3GZTB 3QVJA 5DXAA 2E9SA 3FSEA 2AEJA 1NKSA 3RFCA 1PYDA 2HJHA 2Q6LA 3AIMA 1UKAA 1G8MA 3VSCA 2OO7A 2JBAB 1UZNA 2O2ZA 4PC7A 4ZCMA 1ZJ5A 2IKQA 1IWOA 3R24A 4IIDA 1UM9B 1ES9A 2BFDA 3PHBE 3QF4B 3UYKA 5JJBA 1LSSA 3M6MD 2FMFA 1T35A 2PRJA 1LTQA 3DZCA 4I99A 5LBUA 3WIEA 3U56A 1JJFA 3FOWA 1CNEA 1J9EA 4BNMA 2NIPA 3IQHX 4XX0B 4QEZA 2QR3A 3QU9A 3C3MA 1JWLA 2CZCA 3N2LA 3QWFA 2IY8A 4DV5B 2WFZA 1OH8A 5EA2A 4QBFA 1BX0A 3WRXA 3E53A 2PX4A 3ID6C 1EYZA 1MP0A 4ZEXA 4BLPA 3U4MA 7MDHA 3V7UA 2EKZA 3LU1A 2W0SA 1X1SA 3JTMA 2B2XA 3EPRA 3ND9A 4YIKA 1VHLA 1BMFA 2IPLA 1H2HA 3P0EA 4I4LA 4QOEA 5ADHA 5B12A 3K1YA 4GRIA 3PCTA 4RK4A 5FKJA 3RSGA 3N59A 5K9ZA 1U63A 2HMAA 5CB8A 4EKGA 2IUEA 3VHXB 2FWJA 3C85A 5LP6F 1QIIA 3OAAA 1QCZA 4M8LA 1RMTA 3SQNA 4B4DA 3PA6A 1IBLB 2NYUA 5FXMA 5IVIA 2HTFA 5CT4A 2RHOA 2QE7A 2PT7A 4GMGA 3VKVA 3E3OA 3I30X 3BULA 2HC9A 1ORIA 4G1EB 1YHNA 2H1FA 2V96A 3D0RA 4NZNA 2JEYA 2Q4OA 1DI0A 4JEUA 4A03A 5HMMA 4YDRA 4YXFA 3GLGB 4A36A 2QTVB 1PR3A 1E6LA 1TAQA 1E2IA 2W4QA 3M33A 2R7MA 4PR3A 4WW0A 4ZMBA 2QAGA 5DSZA 5B1HA 1CEXA 4AP9A 5I4CA 1ZH4A 2OBXA 3CT4A 3RK0A 4UPVA 4JMLA 5B5SA 3G49A 1I3CA 4KRYA 2C0QA 3WRYC 3RWMB 5C4IA 3EC1A 4AN1A 4CCYB 4AZ3A 3HCAA 2ZBFA 5FNVA 1LWOA 4FGSA 2YJ4A 4WZZA 4EZEA 2PL9A 3Q98A 1IC6A 3GNTA 3HUEA 2I91A 1M2FA 4PQFA 3MOSA 2FPXA 4C14A 1BDBA 2I4LA 1W0CA 1D2AA 2X6TA 2D74A 3A1NA 3IAUA 3DT8A 2VTVA 3FMFA 4HGQA 5JH7B 3UV3A 3OM1A 5SZKB 1W6RA 2ZDGA 1D2HA 1WP4A 3KEQA 1XX6A 1RI1A 2XIQA 3C97A 3EXG1 3N5CA 4QJ3A 3QITA 3ZG6A 2A1UB 4BX2A 2ATEA 4B6OA 1RXSA 4UASA 1EDOA 4ZVLA 1V5FA 4NFYA 1CEQA 4OB7A 4YRPA 3GA7A 4QXQA 5IJ0B 4EG5A 3AC0A 1EUQA 4US1R 4XE5A 2AL7A 2OVBA 3A6LA 4JOQA 2QNIA 2VRCA 3AEYA 3E18A 3NKLA 5LIRA 2ZW9A 4S1PA 3SPXA 1CFZA 2CXHA 3RGWS 3AY0A 1MVOA 3HWSA 4MCHA 2CL5A 2FMHA 3C3DA 3C5CA 4LJ7A 1R3DA 3CUVA 5T8KA 4U2CA 1L5GB 4O8CA 2X8JA 1RKBA 4DL9A 1GEGA 4L02A 2O3RA 1E96A 4LOLA 7AT1A 1I7LA 5CDHA 1CZUA 3ETEA 2QVGA 3H1PA 1LPMA 5DHSA 1EZZA 3OHMA 3LUKA 3OOHA 4XDYA 1DQPA 3C6XA 5FPQA 2YWEA 1WJGA 2XCQA 2CLCX 4E22A 1QNLA 5IW8A 1ZN7A 1U7WA 2G40A 3HV2A 4WDRA 1L3IA 4RDHA 3W5IA 4EGFA 2ZQZA 1Y6JA 3A6KA 1Z0UA 4OHKA 1D2RA 2BGJA 1ILWA 4CFSA 1PX2A 3LYUA 4YMGA 4HH1A 4QU8A 4J43A 3SC6A 4CG3A 1OPXA 3ZCRA 4JSRA 2DAPA 3DMNA 1IM2A 1OX5A 2FFJA 3VSEA 2A35A 1I9GA 3W6OA 1NMXA 4FNAA 1T9GR 1XZ8A 2WUGA 2W2KA 2OZEA 2D13A 3KOUA 4EX7A 3UXMA 1QORA 3RT9A 3QLUA 4PNEA 4M9SA 3L7YA 1U3DA 3RAGA 5TQ0B 5JANA 1JA1A 1OHHD 4E2XA 1RPZA 1H2YA 1KI6A 4BNWA 5IWCA 2PSSA 2C20A 3MW8A 2AQIA 2CGEA 1MOSA 3KKNA 4IDQA 4II2A 3V8VA 2I6GA 4WKBA 3TFQA 3ZI7A 2A0FA 1AQJA 3GYGA 5JT1A 3SX4A 2VUIB 3MYYA 1OYVA 1T9ZA 3KDSE 1Y4AE 1G5FA 2BKXA 2PMKA 1IJEA 2A84A 5K3AA 2OXCA 3OZGA 1UF9A 1YS2X 3G59A 3RTAA 1YTLA 2FEMA 2YUIA 1VOTA 2P9BA 3W2EA 1Q2UA 1NE7A 4QTYA 4GP6A 2I8CA 2H7CA 3M6LA 1U7TA 2XNDD 1PG5A 1XTQA 3MYRA 4MP6A 4NKRA 4D41A 1OU0A 1AV7A 5JMWA 3ZWCA 1E2UA 1CJCA 3ND8A 4J3JA 3QLEA 2D0PB 3D9QX 3SBEA 5TLSA 2TRSB 4F3TA 4Y6PA 1KKUA 1QHFA 2FFRA 4UBKA 2VDVE 2ZSDA 1I8TA 3I0ZA 1V5IA 2P11A 3NMUF 3MJSA 2AFHA 2XE4A 3W9YA 5AVSA 1CJUC 3ICEA 1ZW1A 4QQ8A 4DE5A 3ZQKA 2D2EA 4MP3A 3ZDRA 4HNGA 2AK2A 1ZI9A 2F7SA 2J3MA 1OBHA 1UZUA 3HRHA 3P0IA 1ZISA 5DYNA 5M04A 1H93A 1E1MA 5HK9A 2DLNA 3O6VA 3PFIA 4NNJA 4K6HA 5DLPA 1RIIA 3T9EA 1DZIA 1QH9A 2SCUB 4KQFA 5A02A 3C7CB 3NHFA 1GGMA 2HIHA 2ZJ0A 4LYAA 2VYFA 2I7CA 4HWPA 5IC4A 4UNRA 2R8BA 1KQGA 1GUFA 3KOMA 1JAYA 1WB5A 3NGLA 3LCUA 1JB1A 1NY5A 3CLTD 3U0BA 4EYSA 5GZ3A 5JXHA 4ER5A 5FPHA 4FNMA 1P3DA 5E2AA 2AG0A 3KOOA 2NZJA 3EBOA 5EVJA 2IU3A 2A7QA 2WFLA 5L95A 2G9UA 1JSCA 1LZLA 4DC0A 1H9CA 2FQYA 1BQ4A 2E1RA 4XYGA 1XD2A 2ZSUA 4DNPA 1KK0A 4PZ9A 1UOEA 3DE3X 1E79D 3L4BC 3LBHA 3QYJA 4MPPA 2CJPA 5FV7A 2I87A 5FTLA 5JC1A 4EJ2A 1G17A 4MKFA 4YV7A 4Q7MB 5A7GA 4GWLA 2PJZA 3SN6A 2J3IA 5LNK6 5CM2Z 4FS3A 1WEHA 4D74A 3CKKA 3CMCO 4AU1A 3HH8A 3VC2A 1O0BA 3MWKA 7GPBA 3L0PA 3M4ZA 3TKLA 1NVXQ 1SG9A 3BXHA 4I36A 4TL6A 3EEIA 3T38A 4Q7KA 3JWIA 4N9WA 1YCFA 3FJOA 1VJGA 4OXXA 1G8SA 4G0QA 4MZXA 3RS7A 1W1IA 4A2WA 2QA5A 2QLBA 4W8HA 3TIXB 4WJLA 5A6SA 2OM6A 1IEVA 4GMDA 4KN8A 1Q0PA 4RV5A 1PUJA 2QX9A 1VE7A 1YMUA 3CUWA 2X7JA 4UOQA 3DKIA 4O8ZA 3CVUA 1RC8A 2PGLA 4IY1A 4L73A 4PTZA 5CFNA 4FQ5A 3FWHA 5BSWA 3R3YA 5GQSA 1EK5A 1MQ9A 4V39A 2H18A 2QAJA 4ZARA 5KKCA 3CF4G 3E3NA 1FBNA 5T5QA 4AY2A 1Z6PA 1PZEA 1XP8A 2YWFA 4OHOA 4RSGA 2O2GA 3G5TA 4D9NA 1N8KA 1I1HA 5K8UA 1F9EA 4AYWA 1NN5A 4EUEA 5EIBD 1RXIA 2VDLB 4TL9A 1MAHA 4EQ6B 4QTTB 3P52A 5AW3A 2JBHA 1AZTA 4RY0A 3BOSA 2QT9A 3EUWA 1FMCA 3FE2A 1OAOA 3R5KA 1BFUA 2DH5A 1J2JA 2EJUA 3FRHA 1I2ZA 3CR8A 3ECCA 4IMPA 4M9ZA 2H6EA 5FWXA 3DMHA 4C08A 2E55A 1CVRA 4TTPA 4MWSA 3OT1A 3K0AB 1JU9A 3SEFA 1SVOA 4OB6A 1Z17A 2A1TR 5DVZA 2A0UA 4RHTA 3OF3A 4UTVA 2BGNA 1BCSA 2FR8A 2RCNA 3BXFA 3FMPB 1N0WA 2ZJ8A 2I7VA 4ZRNA 2JLBA 2UAGA 4WGGA 2XMGA 1EXNA 3DMTC 1M66A 4QDTA 1I3KA 1Y4ZA 3AEZA 2Y6VA 4Q9NA 4PZCA 1OI3A 3THSA 3PGVA 1FNBA 4LDPA 3QXCA 2H4ZA 3F7NA 3U7QA 4KIFA 1RJ9A 3MJRA 4NAUA 4WBXC 2CXSA 1Z2PX 1HDZA 1WKVA 2G63A 1ZM4A 2O6HA 2XPCA 3ACBA 2BGRA 3QPDA 4HSEA 3DWGA 4TSKA 4X6UA 4YP5A 1RXCA 1TTQB 1U5CA 4ODIA 4EKIA 2WILA 3OEEA 2EFHB 1L1QA 3GIWA 3PSAA 4RDIA 3CRQA 1ABBA 2FK7A 4MA5A 1IEQA 1T8UA 1DFHA 2GCOB 2P77A 5JSUA 1PKEA 5EP1A 1DIRA 1QIEA 3PDHA 4D45A 3ENWA 2GF0A 4N48A 4D43A 4RV9A 2GRJA 3DUFB 3IODA 3M0EA 4LI0A 3OIUA 4U3JB 3ZWOA 1LSUA 2GHTA 1O87A 2HWUA 3OJOA 4ESOA 1FS4A 2RHBA 1R0XA 1Z5PA 3EVEA 1TVCA 1DFGA 1NUUA 1FP6A 3SFZA 2DU8A 3G2JA 1J0AA 4BJ6A 4N54A 3C3KA 1Z47A 4MS4B 4WESB 3S2EA 2A1IA 4N82A 1H0HA 3H0EA 2C2YA 4JASB 1HQYE 1ID1A 2FQ1A 4HNAA 1QMPA 3ENVA 1PGNA 4KGDA 4NEGA 3OX4A 3LAWA 3Q6IA 3P2JA 4M9RA 5IKPA 2VF7A 3MGGA 4NK4A 4C87A 4CU5A 2C61A 5AJXA 4EITA 3PXXA 2AX3A 2JD0A 3EGXB 4EG8A 2ZZMA 3MRSA 4OGLA 4I5EA 4JFRA 4OI4A 3RAFC 3VKFA 2IEYA 4RMHA 1OYOA 3WGLA 1A8SA 1KU6A 2R6ZA 3HNOA 4G0NA 1PFGA 4IKPA 1PK7A 1TDJA 1QDEA 3O4JA 2PJRA 4LV8B 4FI3C 1F2DA 4YPFA 5D6NA 4DRZA 1SG0A 4D9GA 1E1QD 2QLNA 1X7GA 3RSQA 3PS9A 1L8LA 4WN3A 5GM1A 3A9WA 5A3VA 3D7LA 1M1NB 3K5HA 1NW9B 4XD7A 2RKWA 1FDWA 2BKAA 2P4HX 3EBLA 1N5MA 1BC5A 4OV6B 1ODJA 4PM4A 4XZ3A 2VNHA 3DP9A 3IFSA 5FUQA 5CFQA 3BRWA 4OYYA 3GLTA 1IN4A 1SOUA 2FX5A 5HILA 1NASA 4TS3A 2NO6A 3GLHA 2H5JA 4RH0A 3RJ9A 4CM4B 4DDWA 2CFIA 2J0SA 5KNCH 3DR5A 4YB8A 3AY3A 1SO8A 5LLDA 5DJ5A 3OO1A 5EY5B 3PFBA 5ER6A 5FO0A 1WD5A 2IOFA 3C6MA 2ZSEA 4YP7A 5HBGA 4ND5A 2YICA 2H1SA 2CJYA 1PSZA 2OCBA 4IIYA 1EQ2A 1SBCA 4KTVE 5HMLA 3ZVRA 3IUSA 4C7VA 4E5MA 4JI1B 5BN5A 3DLHA 1G4AE 1BU5A 5IBCA 4UBMA 3THRA 1HNNA 1IWBB 1W1UA 2ODAA 3LUBA 1UM8A 4CKZA 2G7ZA 5FRDA 3UWMA 1M54A 3CE9A 1EM6A 4PLWA 2OBYA 3BMXA 2HA4A 1K75A 1FDUA 4A26A 3C70A 2LIPA 3HPRA 3IBFA 2HBRA 3VDRA 4DV7B 2Q4EA 2O8EB 1I32A 2ILVA 3QMPA 1N6PA 3H97A 2ZBDA 3THWA 1G5HA 3AR5A 1Q77A 4HDRB 1U8YA 5B58C 2FLWA 3EEBA 5DASA 3O26A 4OHMA 2JGEA 2P4UA 3U80A 4M1EA 2RI6A 2GO1A 2GXQA 3AI7A 3CWQA 2BTOA 2RGAA 1ZX1A 2W2NA 4KKVA 4DUYB 5CLJA 4NIMA 3SHFA 1FXWA 2RK6A 4QSMA 3S2IA 3HVHA 1VCNA 2X4GA 4OQLA 2NZXA 3W6ZA 1ZOLA 1WMAA 2QW0X 5HOQA 5AVOA 3N7UA 1XB2A 4GYKA 1IEWA 4XYLA 2J7PD 4DUPA 1P5HA 2GUGA 4KO2S 1MUUA 4FOLA 1E0SA 1E1YA 1ULSA 2JIBA 2CL6X 4N6OA 4JI4B 2XYHA 4D97A 4AY6A 4NCHA 3I58A 3MXOA 3U7HB 1XEFA 1WZCA 1WV1A 4RVHA 4B3JA 3OOWA 2Z1DA 3ESAA 1PZFA 4EG4A 2VH1A 3F9CA 4HH0A 4J3NA 3F9RA 4PC2A 4QPJC 1YFJA 4I8XA 2F8LA 1U5BA 1J99A 3FNIA 3CH5A 4EL0A 2YC4C 1NF8A 3JQEA 4R1NA 3TLBA 4HN2A 2HRRA 3B6ZA 1FYEA 4REQB 5GTDA 3KTAB 3EMKA 4EGAA 2HA0A 4XIJA 4BXOA 4FOOA 5B37A 3BD7A 2IP1A 3PFFA 1GRRA 3UJBA 1BHQ1 2IXFA 3WAGA 4OXQA 3T54A 3SHTA 2ZRQA 3ZE8A 4FBMA 4DWOA 1TZBA 2HKIA 2GBCA 2QLJA 2QN2A 2WSSA 3VDQA 2XWQA 1T34A 1UANA 1HZJA 1UT6A 2PH5A 4FMPA 1NRIA 3G9UA 4K6FA 5ESRA 3UJPA 1PAUA 4ZALA 5K8VA 1BS1A 1BWSA 3QW2A 5ISMA 1VHTA 2ZVPX 1G5PA 3K0CA 4QJ4A 1TMKA 4DRXA 2WSLA 4M9QA 4IHJA 2YXDA 3JY6A 4IMRA 4BP8A 3LK7A 3DPIA 3A3OA 1GSIA 2IHVA 1WUJS 2QPAA 4CIDA 1OLXA 4NCNA 1SELA 1X8XA 2MSCB 2X5XA 4TV8B 3RODA 421PA 4GOKA 4U5QA 4UVGA 2FN8A 3SF0A 4UTPA 1N5KA 4BVLA 2F4NA 1R6UA 1EHYA 1VI6A 2GCGA 3T1QA 3WC4A 4M60A 5CFMA 2O7NA 2PZBA 1Y3BE 2D1FA 4AN4A 5JTTA 3DC7A 1Z4KA 3PYXA 4AKTA 1PWZA 1DQYA 5TMDA 5ADUS 5CB6A 4F93B 1CETA 5BRNA 1DC3A 2P2ZA 1DPGA 1R5BA 3KAQA 1SC6A 2XXAB 3KSBC 2I99A 2A78A 2GLTA 4HJRA 4PR0A 4BO1A 4UMVA 5B3AA 4IEIA 2F8SA 1XCBA 4LF6B 4HWKA 5F78A 1Y3CE 3REGA 1OWLA 4AT1A 2M9MA 2AX4A 3JWEA 1EM8A 1GPYA 1Q12A 2CZQA 2DUJA 1XR3A 3ELWA 3HJCA 4RMJA 4UNQA 3AP1A 3AUJB 4C22A 1JFRA 1EPUA 2PT9A 1IQUA 2VWPA 1YRYE 1ARZA 2WM3A 3FZEA 5FUVA 3W7VA 4QUHA 2CD9A 2QM3A 1V6CA 1KK3A 1JHQA 3A31A 3F5MA 4IM7A 1G63A 2PDAA 2QX6A 2GBPA 3EYWA 3ZXSA 4B6GA 4E5KA 3FFWA 1E6CA 1SA0B 4UQOA 1OFVA 5BXQC 1T5BA 1XZAA 5LKAA 1PQ4A 3GVCA 4G25A 1X6VA 2YZ2A 3FYUA 4TLAA 4D79A 1AQNA 4UAGA 1RJGA 2IA5A 1G3IA 4OQZA 4YAOA 4JLDA 1KI3A 4JC4A 3R7AA 3KNZA 4RA9B 1WE2A 2RFLA 2UZ1A 3SLRA 4ENWA 1JFVA 1XP5A 1ZCBA 2CXOA 1JQ5A 2X19A 2P75A 3PQCA 5KNDH 2O4UX 2X0IA 1MU0A 2GTPA 5FI3A 2C3YA 4F8JA 3ZZUA 3WXMA 4DR7B 1H1TA 4EG6A 3I9V6 3Q3GE 1KIMA 4MHOA 4BUJA 2NOAA 3EWSA 3HYCA 1FDVA 1I51A 4Y30A 3SCZA 2FUG6 4MW7A 2YS7A 3CTMA 4XQCA 2GAJA 4R0NA 3BMOB 1V8BA 3OG9A 1HRDA 1N2CB 1HYGA 1KAQA 3OC0A 4P36A 4E15A 2Q9UA 1NZDA 2VSNA 3B6KA 3KLBA 4ROSA 5HDBB 3G7NA 3TZHA 1I9CA 2CHVA 4MJ3A 2Y1OA 4AUMA 3WOVA 4KGZA 5DNUA 3K1AA 2FB9A 5KVAA 4GI7A 5AR1A 1ZUWA 1EDBA 5CNJA 4LJ5A 5KTYA 2V97A 3LBAA 4F71A 2WFAA 1H2AS 4YR9A 1X7HA 4TM7A 5C7YA 3RYHB 4QPNA 3TS1A 4K40A 4MAFA 3QELA 4R8LA 1CYDA 1GU7A 4LHZA 3HXQA 4MGHA 4YFVA 2B7BA 1TX4B 2QN8A 4MUFA 1IWPB 4XB1A 1YK0A 4CLXA 2A86A 5L3VA 1P31A 2BTEA 3A6PC 4XFDA 5K3BA 3JAKA 1ZOIA 5JDCA 1B6TA 1QIKA 2FU5C 4GOJA 4OP2A 5EXXA 2V5AA 3IVAA 4AX4A 2C57A 1RXEA 4O4JA 4BCDA 2PGIA 4KNVA 5CTAA 2I2FA 1I1NA 3HO1A 2OORC 2PBLA 2C97A 3HBMA 3KPVA 3M5PA 4TLEA 5KQGA 4O08A 2J9FA 5CGZA 4NWIA 1OGJA 1SVUA 3PPVA 2NWQA 4NBSA 4Q9JA 4XVHA 5FL7D 4KFSA 3EMBA 1E6WA 4ND1A 5HNKA 4XB2A 1ZUIA 3ZHRA 1XD9A 4BN0A 1BXZA 1HF3A 5B36A 3ETHA 2WF9A 1SCNE 4MYTA 3LO5A 4JKIA 2CW5A 3HTXA 2NLOA 4L9AA 2Q5IA 1OBVA 3VZSA 4KQKA 4RF3A 3D3EA 3HU5A 3GH1A 5TQ2B 1QTQA 4DLLA 3NTLA 1SXHA 3NDRA 2O0LA 2IHTA 3CMMA 2OAGA 3EA4A 3GDHA 3DOOA 1G2OA 2NADA 1PFWA 3BH6A 1DEKA 1Y7LA 4U2BA 3TMKA 4RTKA 4AJJA 4RJLA 2ZUWA 4PO1A 5LYJF 5DWVA 5AH0A 2QTAA 3K9HA 4Q1EA 3UAGA 1U9CA 3TQQA 2AFHE 2BHRA 9GPBA 2CK3D 2AN4A 1HL3A 3O9ZA 3QWHA 1KZ1A 2J0UA 4UDNA 3W6UA 4ZYVA 2J5BA 1NN0A 1AZLA 3R3ZA 4B45A 2Y1GA 4UDXX 1MO2A 4L75A 2WTUA 5CNIA 1LZKA 3B85A 3NYWA 4DBLE 3RE1A 3IR5A 1KYZA 4MLPA 2IYYA 4PIMA 3D2AA 3A06A 4R3NA 1KZ4A 3GJRA 3RRJA 1G7SA 4GDFA 1W2HA 2WJHA 2BI8A 1DG1G 1PQPA 1XZPA 2R8YA 3R7FA 4ZFNA 4GZ6A 1C0LA 4FVTA 4NOMA 5TV2A 1WDKA 3QUTA 1AA6A 1P4AA 4ZOCA 4F9GA 4FX5A 3LP5A 3MJHA 1TIPA 3Q0IA 2PNJA 4X1YA 3DE0X 1KY5A 4KX5A 2MSKA 1K7EB 3IEIA 4LTMA 2R5WA 2ZFUA 3QVVA 1KNXA 3U09A 3ICCA 4K1LA 2NVBA 4YJ2F 5A9SA 3V34A 2XE7A 3VI3B 1IB0A 2HN9A 1BCRA 4WDQA 1GPH1 5AVJA 2BOVA 3NOOA 3NOQA 4OUKX 4RS3A 5ERYA 5HIJA 3V3TA 1RM5A 1GPNA 3PNPA 4JT9A 5AVUA 1DBQA 5GJCA 1JHRA 2AZDA 4YQZA 3ZI4A 4UXHA 5JFGA 2BFBB 3RS0A 1ZMTA 1WZUA 2HY7A 4KRXA 4Q15A 4YRLA 1J70A 4WK6A 4B34A 4E08A 1PR0A 3Q12A 4JR1A 1NOIA 4JLJA 3SSNA 1ZGHA 2VDNB 3UOWA 1IXKA 1R6TA 1Y1SA 4HZUA 2ZRJA 4C6SA 2WU8A 3TIIA 2PO5A 1NNLA 5F23A 3F5SA 3RABA 3BVPA 1V5WA 4GI3A 3JRNA 1P0CA 4ND8B 1WCYA 4FUQA 3BJZA 5ES4B 3PC8A 1QCCA 3KB6A 4QM7A 1D2GA 1ZD8A 1DCKA 2L19A 3H4TA 4MI9A 1G0OA 2OBMA 1S3GA 1KZHA 2ZAIA 1K3FA 4C0HA 3T3OA 2H11A 4JEMA 5B2ZA 2QP3A 1VI5A 1I30A 1KAEA 2YYZA 3EZ2A 4H7JA 1K8QA 2QZJA 3V7NA 2JZOA 2G0NA 2NSLA 3M34A 1YZ3A 3PF8A 3LYAA 1VPVA 3LK6A 4IQ8A 4H1HA 4Q4LA 1XNHA 4EUSA 4Z4IA 4EY6A 4QBIA 4UVHA 3CO5A 3ODGA 1FFHA 4XWGA 3KWMA 4Z2AA 1X7ZB 3L6OO 2BIFA 2Q0HA 2G82A 5KDOA 2QD2A 1ZSYA 5KNBA 3JASB 4X1KA 3PUHA 3O8QB 3K0FB 1QK3A 4HNRA 3N3AC 3N53A 4KPYA 2E5FA 1ESNA 3ZDAA 3SU8A 2Y0CA 4U6QA 2C82A 2ZWAA 1M72A 1TVKA 4AMUA 1A5TA 4ZCQA 1MH1A 1Q1GA 4ZU1X 5IWAB 3D3NA 3NJ4A 4LVNA 3L4KA 1XDGA 5SYNA 4GVLA 5IYZF 4KO1S 5ALZA 3H13A 5J2UF 5CNMA 1MLDA 3FHJA 4ZHQA 1IY2A 2AC7A 3PWSA 2WT9A 4TVKA 4N3NA 4BBAA 1UINA 4LBYA 4P08A 4BX8A 1QP0A 5HKKD 1TIBA 4LC1A 4NJEB 2I4NA 3N7AA 3OCZA 5BSHA 1ZD5A 1Z18A 3RLIA 2WKQA 2ZYDA 4UJ3A 2FEPA 4UC0A 4G0WA 4EW2A 1FSSA 1CW2B 2NTNA 2REOA 4LJAA 3ZD7A 4D46A 3BDIA 2XOKA 4QUKA 5FR1A 3C6QA 3TOVA 2YQ5A 1NM5C 4GR9A 5AW9A 5CA1F 3TVYA 2W6JA 5BYKA 1MIHA 2OK8A 2EHDA 4BHTA 5I7RA 3I9V1 1BIFA 1NUPA 1IN8A 1FLVA 1NMQA 3GVXA 2G09A 2A9FA 3PX3A 4H7PA 1ZD9A 2FUG1 4L0MA 2FEXA 4RHUA 1OLSB 3IJ5A 4PICA 4B4KA 1YKSA 2VPIA 1YK1A 1DAOA 2BONA 4ZZ0A 5EJ6A 4UU8A 3S29A 2ZBGA 1CR1A 3R0IA 5C8YA 1C4WA 4OL0A 2D1RA 4LZOA 3TTXA 1Q95A 1Q22A 1YQQA 4PIPA 1FRVA 1F38A 1YBFA 1LI4A 3BERA 5FORA 1PTJA 1QOPB 2E48A 1PN3A 3GXOA 3H5TA 3KKPA 2GASA 3LLMA 3PUYA 3R5SA 4U7WA 4QDOA 3UKDA 5LXTA 3IHLA 2ODNA 3DHEA 4DDTA 5DX8A 3ZCTA 2J6CA 4WFIA 4DMFA 4WASA 1WHTA 4G5OA 5CT8A 4EIWA 5ITZA 1E9RA 2BKUA 1PFVA 1XCOA 4QLOA 4Z4EA 4Q93A 2P78A 3UUEA 2PX5A 4K26A 1YR7A 1PG0A 2B8TA 2XLCA 3K5WA 1NP3A 1U1EA 2CB0A 3DAFA 2B37A 1YACA 4I6GA 2YCBA 3FGPA 1I4DD 1NJ2A 1K89A 1PJ3A 2CNDA 2CMFA 1WHSB 2XYPA 4ILKA 2A94A 3H2IA 2E1PA 1XXLA 2HDOA 4KQWA 4YRDA 5AK3A 3STTA 2QL5A 4MDHA 1CZOA 4RIGA 2G4LA 4P2GA 4U8HA 2JDIA 2TECE 3PIIA 2P0EA 3A6DA 2YWGA 4J76A 2P2YA 4N65A 4DM4A 4YRGA 4RHCA 3NDBB 4RU1A 2PQ0A 4I55B 1AY0A 1TCCA 3GLHE 4HL6A 2VATA 1P1CA 1PEDA 1DV2A 3G8BA 2QRJA 4H7IA 3TR0A 2DT5A 4YMHA 5BV2P 1OXVA 4RCYA 5J47A 5AYVA 3IQGX