1J7JA

Crystal structure of the hprt from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
163
Chain Sequence
HTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGSFMFMADLCREVQVPHEVDFMTASRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQRYRHLPYVGKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the HPRT from Salmonella Typhimurium at 2.3 A Resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords hypoxanthine phosphoribosyltransferase
total genus 51
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j7jA00
1QCCA 1XTTA 1P17A 1BZYA 1Y0BA 3ACBA 3LRTA 5KAPA 3OZFA 5BSKA 5HKLA 1ECFA 1DQPA 1QB7A 2GEBA 2XBUA 4TWBA 4MB6A 4LZAA 1L1QA 4RHUA 4QRIA 4QYIB 4LZNA 1TC2A 1QCDA 2AEEA 3H83A 5ESWA 1HGXA 2H06A 4M0UA 4P86A 5JSQA 4PAWA 1GPH1 4RV4A 3ACDA 3ACCA 1NULA 1OPRA 1NONA 2C4KA 1XTVA 1A3CA 3DMPA 1IBSA 4WMLA 4WN3A 4RAOA 3MBIA 1QK4A 4LYYA 4RQBA 4S2UA 4P81A 1P4AA 2P1ZA 4P80A 4QYIA 1TC1A 3GGCA 1VCHA 4M0PA 4RHTA 5IPFA 3KB8A 4RQAA 2JI4A 1DQNA 3LPNA 1UFRA 5BRNA 3OZGA 1JLRA 4RABA 5EUCA 1I13A 1ZN7A 2PRYA 1L1RA 1UPFA 5BQOA 3S5JA 1G9TA 1I0IA 3MJDA 4M0KA 5KAMA 2JKZA 1ECJA 1ECGA 2DY0A 4RADA 4F8EA 1R3UA 1A96A 1LH0A 2H08A 4RAQA 1D6NA 2PRZA 3M3HA 1A98A 1W30A 1I0LA 1P18A 2JBHA 1O5OA 1BD3A 4LZOA 5K51A 3DEZA 1WD5A 3GGJA 5ESXA 4RANA 1UPUA 3OHPA 1Z7GA 1XZNA 1FSGA 1MZVA 1OROA 1DKUA 1ECCA 1XZ8A 4JLSA 5E38A 3NAGA 4P82A 1AO0A 5JV5A 1O57A 1P19A 3EFHA 1BD4A 4Z1OA 1G2PA 1QK3A 2H07A 3GEPA 1I14A 1A4XA 5BQPA 1QK5A 4P3KA 4IJQA 2IGBA 1ZN9A 1PZMA 1GRVA 1DKRA 1CJBA 1I5EA 4FYMA 1V9SA 4ZFNA 1A95A 2JKYA 1ZN8A 1A97A 2PS1A 5HIAA 5IAOA 1ECBA 2FXVA 4X44A 4KN6A 1J7JA 1VSTA 4P83A 2YZKA 4LYGA 4RHYA 3N2LA 4X45A 1HMPA 1U9ZA 4JITA 3QW4B 1XTUA 1DBRA 1OREA 1G2QA 2HCRA 2VFAA 4PFQA 3G6WA 4P84A 1U9YA 1JLSA 4RACA 1QB8A 4RHXA 2E55A 2EHJA 1VDMA 1G9SA 1STOA 3HVUA 1YFZA 3O7MA 2WNSA 3DAHA 4OHCA
chains in the Genus database with same CATH superfamily
1MAAA 4F21A 1JA0A 1JLKA 2UUPA 1Y0BA 4G2TA 4XW2A 3ILXA 3T06B 2Z6VA 2OYCA 4JBYA 4BE4A 3SWWA 4F46A 5J2UB 4J7XA 1O77A 4R6XA 3D7KA 2V7QD 4EQ6B 3U0VA 4ER5A 1CVLA 3H87A 3UK6A 2JLUA 2NUAA 1NBAA 1H6BA 3FUWA 3RU7A 3VYVA 1MJGM 3C14C 5DZSA 1J0BA 3A1WA 3ZU6A 3C16C 3KJFA 1ID1A 3MMZA 3SICE 1GL9B 4CGZA 4BMDA 3H2HA 3L7YA 4L27A 2JFVA 4L4UA 4XQ9A 4EI2A 1GITA 2ZUFA 3LLSA 2X9VA 3THXA 2NXCA 3AUXA 3H3FA 5LKAA 3A4MA 2H0AA 2XVYA 3OU6A 3OFJA 4XH9B 5E3HA 2X1HA 4AY2A 1JSLA 3ZNQA 4C01A 5KWSA 4C4RA 3ELUA 1ZIDA 4EGSA 1RPAA 1TM7E 2C5GA 5LXTA 3H75A 1H3FA 3OZVA 4DDVA 3GJZA 3NUGA 4TUYA 1JALA 1LQ2A 2VHEA 1CV2A 4N7MA 1HZZC 3UQYS 2BZ0A 3DAFA 4FHGA 2X3FA 4YXWA 4AF8A 3OT5A 4BLPA 4BNXA 4DIEA 1NW8A 2CLOB 1WHTB 1G8GA 2DC1A 3M6IA 3KJQA 3QX9A 3NTXA 2DR3A 3VA7A 5CA1A 3A3KA 3PXXA 3PEFA 2GO7A 4ACAA 2R1UA 3PS9A 2Z8YM 3EARA 3JV7A 4LBZA 3N8NA 5A7HA 2WPDA 5IAGA 4V1CB 2PM8A 3FE2A 4M99A 5IT4A 1Y8QA 2CXHA 3TMAA 5JZOA 2QVZX 4HATA 3EBLA 4NYMQ 1OA1A 1TEVA 1EXWA 1JSRA 4D8TA 4Q4LA 2AR0A 2ORVA 2ET6A 3DMFA 1N3BA 5CXUA 3TG2A 3VAYA 1FPMA 2J59A 1JFTA 1M66A 4OMDA 3GUCA 1S4QA 5HSGA 2QQGA 2G5GX 1QPBA 4BO7A 3G1TA 3UUFA 1N2SA 4A3SA 5HCUA 2VUHB 3IDSA 5BXYA 5KVCA 2JBAB 3GPDG 3LWNA 5ERYA 1THMA 1ML4A 2X15A 1U3GA 3IBCA 3SEZA 5K0JA 1RE1A 3K1TA 4ECAA 5BYAA 4FXOA 3MQ2A 3MPOA 4HWSA 4TXJA 2C20A 1XLUA 3EZNA 3O91A 2YMQA 3QUQA 2YASA 4MV9A 2A5JA 4GR9A 4ZHQF 3TQRA 3KDAA 2XYVA 4U2EA 4B9AA 4OBBA 2GO1A 1LTKA 3D1LA 3P9QA 3T5CA 3PZBA 3VNRA 4F6RA 3BAZA 1VKOA 4HVAA 5DTRA 5BV8A 2WNHA 3L7JA 4WH0A 4YS6A 3ZZ0A 3UJ6A 1VE9A 2Q50A 2ZFUA 4GGMX 3S1AA 5AW3A 1XQYA 1PK7A 2HJWA 3F3SA 4LHZA 3WI7A 4L72A 4FDVA 1Y8RA 5TY0A 1UOOA 3C4VA 1T5TA 1U3WA 3V1UA 1NU8A 2DM6A 2XDYA 4NBUA 1SZDA 1VDZA 3SCZA 1EVQA 4GYKA 4C6SA 4HNVA 3JRXA 3FMFA 3VDXA 1QS0B 2GEKA 1QX3A 2POCA 3GJTA 1SHKA 3NJ4A 3DSRA 3UBTA 3RC2A 3GT7A 2OBYA 3DXYA 5LZ8A 2VJDA 3KC2A 4MDHA 4C87A 1N33B 1XVLA 3VYRB 4BFCA 2OFFA 2XTMA 4RU1A 4Y2VA 2A67A 1RRFA 5NULA 1BS2A 4HNHA 2A94A 4BP8A 1DMRA 4OATA 3T3OA 1KY3A 2JK0A 3AKYA 3BILA 1MG5A 4YH1A 1WVIA 2CF5A 4ZVQA 2IBMA 3SAJA 2VG8A 1UAYA 3RIMA 3U5TA 4B4DA 5KEIA 4UDNA 5B30A 4WKPA 1RJGA 1E58A 3JZAA 2ZI3A 1BAPA 4QYXA 2PS0A 2TMKA 2VQ6A 4WXMA 3A8TA 2J09A 1G8PA 1NT4A 1RU3A 4J3JA 3U3XA 4G5HA 4J0HA 1ZVVA 2E48A 4ZQBA 4OLAA 4R1NA 3IKLA 4IEEA 1Q6YA 4PYKA 3WGGA 2H3HA 1M1NB 3LE8A 3L05A 2IS6A 3UK0A 1RAEA 4YDRA 1AD2A 2H29A 3FJYA 1P9LA 2MJLA 3KZVA 4Q3EA 2FG5A 2QB5A 4DJFC 4URYR 2P5TB 3FKSD 3W3AH 4CMBA 5IF3A 2YQ4A 1ORVA 3VYSB 1E20A 4MI3A 2OV8A 2R4UA 3KB6A 5CH3A 1NIPA 3U44A 1K4MA 1VB5A 2AFHB 1F3OA 3ZOZA 3C48A 4R54A 1RQGA 4ECEA 1C1YA 3IP6A 4Q9KA 4EEKA 2VNSA 2BEUB 4ZGGA 2PT7A 4LF4B 2OYSA 3NBAA 1LXCA 1MQAA 4KC0A 4ZMSA 1BWSA 3I0NA 3G89A 3MWDB 4JLBA 4Y2UA 2FLWA 1CNMA 1GLVA 3CJTA 3FHCB 3ORFA 5T67A 3BFJA 1ISIA 2VAWA 1CU1A 1FFEA 3DZBA 4CEIB 2JLVA 2ZBQA 2PYDA 1AKTA 3H1TA 3L1UA 3OJXA 5ELMA 2W2XA 1JHZA 2Z2KA 3Q5GA 3V48A 1MH9A 1PZGA 1VCMA 2O8NA 1AKWA 5REQA 1LPBB 2XVZA 3NBUA 3PX3A 4M0KA 3DMDA 3FR8A 2V03A 3WNVA 2F9MA 3L8DA 5JCPA 5JH7F 2RGYA 1FB5A 1VL8A 3P9SA 1OH5A 2ZKLA 4R8KA 2CNKA 2ZAGA 1F1JA 2FB9A 4H3SA 1NYLA 2CUNA 1DQSA 4MUFA 1E63A 2LXNA 2NGRA 3WSVA 1K6MA 1NUTA 3FDZB 3SJAA 3H9CA 1DOHA 4AROA 5C5CA 4Z4FA 2VR1A 1VRVA 1L7AA 3LKBA 3LLCA 3KTAB 3F3KA 4CU2A 4K9NA 1JG7A 2B4AA 2O8FA 2QTWB 4RA6A 3HN2A 4FGKA 1ODFA 2QX6A 2V7QA 3FHLA 4LI3X 4DCUA 4B09A 4H31A 5HQ3A 2XKBA 5BSEA 1U8XX 3GWGA 3EA5A 4GWKA 4XPIB 3AX6A 1ZEJA 3JTEA 5LYYA 2QG4A 3HHEA 1U1IA 1X1TA 2UZAA 4G86A 4B35A 5IT9A 5F1PA 3OFKA 4RQTA 4XB6B 2ONJA 1HQDA 1A5AB 2LDBA 2BEKA 4H60A 4MAAA 4B47A 5I4IA 3AVYA 2OZPA 1DKRA 1FUUA 1QIEA 1YGPA 4LXYA 4CMCA 2GD6A 2GZ3A 3X2SA 4BCDA 1TJPB 2W2OA 1Z08A 5JZVA 1KAHA 2DKOA 2C9YA 4QUIA 3D9QX 4MVWA 4A5OA 1CYDA 5A7GA 1Y6GA 1RWPA 1K8XB 4IEIA 1UH5A 4IG9A 2WJYA 1U7PA 2IU4A 1CLEA 1T1IA 1PDVA 3C6XA 5DEOA 1S8NA 1EP1B 2N9UA 1U2ZA 4NNPA 4A15A 5C53B 2VTKA 2XOKA 3G0DA 3ZE8A 3NAQA 5JYDA 2B8JA 3VNQA 3DGEC 2LIVA 4Y2SA 5U4XA 3WK8A 4DLVA 5T6BA 1KZ9A 1ONPA 1QVVA 2ISCA 3FAZA 4BAUA 3IS3A 9LDBA 1GT91 2XVMA 2HLHA 3H5OA 2EFGA 3W3AD 2XEXA 4DC0A 2DWOA 1RVDA 1FFXA 3K0CC 5CRIA 3AKDA 3PC4A 1MOZA 2E4XA 4J94A 1F8XA 4C4XA 3MUNA 1VE6A 2O7VA 4QOSA 5BURA 1EUDB 1VRCA 3BMCB 3GRZA 4IQ0A 1X70A 5B1DA 2QD1A 1U2GA 5L3SB 3BXXA 3GJ0A 4PY2A 2PQ6A 2ZJ0A 4HAUA 5ALJA 3PXBA 4EG7A 2NUTB 2B1QA 3IAEA 2PQMA 3V4ZA 2HIGA 3BL6A 1JSCA 2I76A 1VLQA 4XR4A 5AVVA 2IUUA 1FP2A 2H2GA 2HN9A 2QQ5A 1A9RA 3ECCA 4QGFA 2OXIA 3A4LA 1P0PA 1NONA 1EQAA 2XYQA 3H8WA 4BNIA 2RGNA 2VAPA 2ZSBA 2B1RA 4WBXC 5A3RA 4OXQA 1JQEA 1ZPDA 2Y1FA 3QYJA 1B0UA 3WB1A 3UC9A 2JB9A 1UMKA 3K5WA 3QXXA 5IEJA 1E6UA 1GGFA 4RQBA 3K53A 4DXDA 5KO2A 3K70C 1IRXA 3C4QA 1VQ1A 2NU7B 3CUUA 1VPVA 4ZV7A 4D3FA 4R1MA 2IDKA 3AIOA 3E61A 4AMYA 2FZGA 3UYLA 3G13A 1ZSYA 4I4LA 4Y2JA 4EABA 4IIGA 3JXEA 1QOPB 3NKFA 5AVOA 1JHAA 2D00A 3EZ2A 5FPQA 4URXR 1QV7A 5F5XA 4M1YA 3I8SA 2AXPA 2NV2B 2HSEA 2WR8A 4GOJA 1KETA 4NENB 4S3MA 3H5VA 4E2FA 5HUJA 3SPXA 2ZIWB 3TBKA 4D8XA 5C1PA 1WKVA 5GZ3A 1FY2A 2ZVPX 3LF2A 1EIZA 1TYAE 2YNMA 3GMTA 3QFHA 3IEUA 4IQGA 2HDWA 3O9ZA 2VKTA 1S0UA 3JD2A 1TF5A 1MDFA 1YV9A 1K6JA 2A0XA 2DBRA 2QRVB 3ANTA 3EB9A 3ITNA 3Q3CA 4GLLA 4D9BA 4AJOA 1XYGA 2CDNA 4NOMA 5JJKA 4F8YA 1UBLS 3BCSA 3VKFA 1M1UA 5JT1A 3F1LA 4HGNA 4ZRNA 1L8OA 5IT0A 2ZTMA 2X6TA 3PC8C 4I1SA 4ZEXA 2YS6A 2RHOA 1M6NA 3JRWA 3L4BA 2XYHA 1C2YA 2H7XA 2XY4A 3NM5A 3OE4A 4U00A 4ZMBA 2HHHB 1FX0A 1Y5MA 2EWVA 4DV2B 3FYCA 3K1ZA 2HDOA 4JOSA 5FPTA 1KBZA 1E4EA 5DV9A 4M1MA 3PFHA 1S3FA 5U4QA 4EATA 4CDGA 1Z6XA 5THXA 4TLMB 4TLEA 1OXKB 2RBKA 4EECA 1NI5A 1USWA 4HXEB 4MKHA 4K0KB 1G42A 1TI7A 1AUOA 1E5QA 4GI2A 4XUDA 4TVSA 1A97A 2B5VA 2QJOA 4ZKDA 3WO1A 1ZNXA 1QP8A 4L28A 4QAQA 3TAHA 1QYWA 2VWQA 3CISA 4FGUA 4J0EA 4JLNA 4PFJA 2D5CA 2Y8EA 4RESA 4ZYYA 4Y2XA 1D1SA 3NVDA 3TIIA 1LW7A 3QWIA 4OX9B 1UKBA 1XK6A 4Z9YA 4J29A 4UVEA 5GVRA 3B20A 4KLCA 1ZH6A 4O4IB 1RHMA 1XA0A 2ZG6A 3TGLA 3AESB 4BC1A 4ZAWA 5I4BA 3VAAA 1JH9A 2JGDB 1NYQA 4HUTA 5I01A 4QLOA 4YXFA 3I9FA 4IZHA 5C34B 1G9SA 2R7LA 3ED1A 2EFDB 3KKZA 3O26A 4HQFA 4I9HA 4XYMA 3ISJA 3A36A 3OIYA 4H7JA 3LNCA 3WIUA 4BGDA 3GBPA 3DKRA 2YS7A 2VJMA 3O4IA 3QJGA 5EJ8A 4L8LA 1O8CA 4YQFA 3H6KA 3GLIE 5K6RA 1XMJA 1FFBA 4MICA 4QVGA 1GR0A 2O07A 2XAUA 4N6NA 3G7NA 3WLAA 5JAMA 2WWYA 2IPLA 4RD2A 2XLBA 3LQ4A 5K7SA 1M2JA 1QG4A 3AERB 4PM4A 4DQXA 2ZGVA 5CIYA 2EFJA 1N1DA 1EFHA 1N9ZA 2QYHA 3GMSA 3NEJA 5BWMA 4JMLA 1Y8CA 1DI0A 3PICA 4K03A 4A2QA 4DQUA 2UZ3A 2ZT5A 4D4LA 4KU4A 2OOSA 3ZJUA 1DXQA 4FD2A 4HGYA 5GIPE 2RGWA 4Y1RA 1NP7A 3IQWA 3B7PA 2EFHB 3C5EA 4WD3A 1T5BA 5DYWA 3RJMA 3W79A 4C5AA 1I2MA 1OX6A 2GBLA 2I6FA 2PBZA 3GEGA 1ULUA 1JTFA 4EX7A 1JR3E 1SKYB 2OGUA 3KSZO 4ZRDA 4EUNA 1YCFA 5ULLA 3F6SA 4CFSA 3IMCA 3RUEA 5CXXA 1IHPA 4JEMA 2AHOA 2IEYA 4O4IF 1ONSA 3ESYA 1L5HA 1OU4A 2FUG1 4QAJA 3B1KA 4OGWA 2LKDA 1ZJJA 1WXDA 2REOA 4HI0E 1BQ4A 1YRQA 3DZGA 1PV1A 4K9OA 2Q5JA 3BKXA 3P9XA 1ZIPA 1XP5A 1X6VA 3FDJA 4POAA 3JAMA 3TRDA 1MD9A 3TNJA 3PPYA 3D02A 2D0PB 3HJBA 3PWKA 1E79D 1TT7A 4OHOA 3IODA 5ES3A 3MCVA 4ZC8A 5KWEA 1QU2A 1Z25A 1W46A 3UGJA 4WW0A 5EKUA 5K3FA 1Z2EA 2FUEA 2VHXA 3WGIA 2JAQA 3K2QA 3CVXA 1RACA 4XM0A 2REQB 4N03A 3BT7A 1M2OA 4YJGB 1RYZA 1V6SA 1GL3A 1WUTA 2CZQA 2Q5QA 1ZUIA 3ANSA 1E61A 1LK0A 4LE2A 5JY1A 4LE1A 4BTLA 4FTWA 3HL4A 5AHXA 1X80B 3EXG2 2I29A 1ECCA 4YP1A 1A2OA 1T6NA 2ZB8A 2ODWA 3ADOA 4CLDA 1XXHA 4X24A 3I2YX 4KVAA 1PBTA 4QQNA 4EPTA 5K3OA 3LC7O 4OBEA 1E98A 4KRFA 2ZM5A 4IJMA 1CR4A 2CKMA 4U7WA 2Q7DA 2DUWA 3CUVA 2YFHA 4IVNA 2IT1A 4J9UE 3AKZA 4DPMA 2PPVA 3ZE2B 3GA0A 1UWCA 3KD2A 3FLBA 1QRTA 4LWPA 5AHRA 2O2XA 3GFQA 4YT2A 3ROQA 2ZR9A 4ZVMA 3NWBA 3PKJA 1M74A 2B2NA 2FH5B 2WIGA 3QY9A 4M4SA 3HDGA 3PI6A 1QYXA 3KQVA 3VC2A 4KFCA 1D7AA 4J3NA 1VIMA 1V26A 4MLDA 4LV6A 2GUWA 3WK5A 1NVKA 2G9NA 3HB4X 2J32A 3UWOA 4BNGA 1QFSA 3N2LA 4DL9A 3BIJA 4DMGA 2DHDA 1U2TA 1DBRA 2YXEA 3FOAA 3W6UA 4GEGA 1XZFA 3QA9A 2ZYGA 4CMGA 1UDRA 3M89A 1P2TA 5LU8A 1WBBA 16PKA 4NBVA 2RGAA 1STOA 4CWAA 4HTAA 3H1FA 3A9RA 3PDUA 3HB0A 3NALA 2V7VA 3VBEA 1YE3A 3A3YA 4J7AA 1Y1SA 1YZUA 3AU9A 3Q7EA 3THOA 1PWEA 3AUJB 1JLLA 4NDNE 1KSFX 2IOQA 4I4TA 3TIVA 4C76A 1CDEA 1V11B 1W1UA 3PVZA 1N9GA 1PK8A 4O4LA 4O2BF 1NJ1A 4OQZA 2OQRA 2V9ZA 5TVGA 2A88A 3BGWA 2TS1A 1AM4D 1DRWA 4RZ2A 3EXAA 1JKJB 4ALLA 5LQSA 2BL4A 3JQEA 1LNSA 3CNNA 1VL1A 3PDWA 3SZRA 3ZV3A 1X80A 2C4WA 1NVMB 4GQAA 4BV8A 2WYUA 1YB6A 3WAGA 3LY7A 3H2ZA 4MWCA 1RCFA 4RH0A 3S1LA 4AK9A 2QXUA 1WPQA 4I3HA 1ZJ4A 1FNSA 1ISPA 1DFGA 4FW8A 4BNJA 3A1NA 2XE4A 3DBRB 4MYHA 2OB2A 2OV1A 2BKUA 2RH4A 5JS1A 3D5EA 1E2LA 3LAWA 4ZA2A 2KM1A 2ZTSA 1C7IA 1JQLB 1TIPA 3W5UA 3L0IB 1FVXA 4C4YA 2BCJQ 3RVDA 2D0DA 2XCUA 1F4PA 4GUAA 1NJSA 2NV6A 2WAOA 3H5LA 1HNXB 2Q45A 5IVKA 1Z75A 3LW7A 4MROA 3CT6A 5ICCA 2FSUA 3WV5A 5I4CA 4OP1A 2AE1A 3ZXIA 1KDYA 4QECA 4BQRA 1E59A 1KZ6A 4LNHA 2HRBA 1THZA 3IUMA 5HGJA 1FZQA 3OFND 1PG5A 1GP2A 1PZEA 1EA5A 2FKAA 3PQ2A 3MXOA 1IRIA 1D8AA 4F5DA 3PHLA 1M8KA 1ZNQO 4B8WA 3NKVA 1FNBA 4F8EA 3I0ZA 4UD2A 4MKGA 1MC8A 3DT8A 5AJZA 5TLSA 3IC5A 4JXXA 1CUYA 3OPYA 3SZOA 4Y1GA 2QRJA 4JLAA 3H3JA 4U9UA 5IMSA 3D2BA 2I2AA 2XVAA 2ZI6A 4II3A 3RFXA 3IX7A 5KVSA 2XZTA 1T9KA 2C03A 1FYEA 3IBTA 2FMUA 2W6JD 4NJMA 1EVYA 3KSRA 5EIWA 5HHTA 2Z6UA 2DPLA 2WU4A 3ILSA 2YRWA 2FETA 3MWEB 4QYMA 4R05A 1WG8A 3BDIA 3KQWA 4MXDA 3TOXA 4JLSA 2JFWA 3UHOA 2WIBA 2Q5FA 2ZJZA 1EFAA 5DK4A 2IYEA 4GE3A 3W5SA 4C1NA 2O2ZA 3WQBA 5H5JA 2C58A 2I2FA 2HKIA 2D8MA 2J9FB 2QENA 3UWDA 3JQAB 4UTXA 3RVPA 2Z4TA 2PVSA 1P1HA 3JWIA 1JWBB 1KARA 2QP9X 1Y5RA 2XQIA 2ODEA 1CJBA 3LA6A 4NCJA 4ZAZA 5B3LA 3KWMA 1YBVA 5KKAA 3E9YA 4URFA 3R7AA 3ZHQA 5CLLA 5BXQC 2BMVA 3B52X 4C7OA 3VPBA 2Q1WA 3L7AA 1E5DA 1NATA 1Y9JA 3H65A 1XF9A 4L4ZA 1VSTA 1TVKA 4HDQB 4N7BA 1Y80A 3IUSA 4DBLE 1AQIA 4JWKA 1HMPA 1OLUA 1QYVA 3NBYC 4I3FA 2VI5A 4R9NA 3K9QO 3OF2A 1O6ZA 4CF5A 1P91A 3H9GA 3AR9A 5EXXA 2WB4A 3K7EA 4PW0A 2XD9A 4DLKA 1GN9A 2YXLA 1U5BB 3SJBA 7AT1A 4OHYA 2X14A 2QYSA 4P4SA 3RO7A 3E03A 3CONA 3MFQA 4H16A 1W9HA 1E79A 2QLBA 4HD8A 4DDKA 2IZ1A 5GM1A 3H2BA 1UFVA 1YB7A 1MXFA 1CQIA 3RAGA 3L07A 2ADOA 1VCOA 3GLHE 1LJUA 2HLNA 4GLFA 4MYTA 5E1DA 1JEAA 1P0MA 4B3DA 1LV8A 1L1QA 5AXDA 4NS1A 1W48A 2H5IA 1AF7A 2W2LA 5B6PA 1DXYA 1QZTA 3C5WP 2SKDA 2GJ8A 2NUPA 5BYBA 3BIFA 1XXHB 2FJ0A 4BVAA 3GIWA 3ZDAA 1DEKA 1XA3A 2C7VA 1EI9A 3AY6A 4H0CA 4M7RA 5EE9A 2YZ2A 5HCNA 2B25A 2X8WA 3G2LA 4JSRA 3TX6A 2G4VA 1JFSA 3R3HA 3DBVO 4RSGA 1PLKA 3MINA 2NVWA 3D8HA 4TSFA 2ZAMA 5B1SA 2ACEA 3P0IA 1BWRA 3KXIA 3MBKA 4KAXA 1E2NA 2WC1A 4ZI3A 5A2GA 1SQ5A 1Q0TA 4EYQA 3TG8A 1DBWA 3L1HA 1XDBA 1C3JA 1XDWA 2KB0A 3OIDA 3KE9A 3MRXA 4GSKA 2FPKA 2OD2A 2QN8A 1CHDA 4QYIA 3EPPA 3LXRA 2GD1O 5DNCA 3NFRA 1ADFA 3DM5A 2HPVA 4ND2A 2P9QA 1EEHA 4L74A 5TB5A 3SI7A 2QPAA 5LXTB 4FCTA 5K2MA 1YS6A 1KC3A 1S4MA 4DWVA 4X61A 1E2PA 2ZAOA 2IY7A 5KMGA 1FS6A 1KFKB 1J2JA 4IVQA 2ZYSA 3ROFA 3E9MA 3RWMB 1JIKA 3JQ7A 4JLVA 4CMJA 4HRVA 1KAOA 1R6DA 3NGLA 1FQOA 1GTJ1 2QUZA 2E4AA 3DCJA 4YO8A 3ROPA 4YMGA 4DV0B 1PEDA 2QT0A 3U40A 1BMFD 3IPRA 1UKZA 2R6HA 4C6TA 3DEZA 1KYZA 1I1QB 3QIVA 2C9CA 5BN5A 1U4NA 4GM0A 1C30A 2H4ZA 2OWEA 3DB2A 2DG2A 4AXBA 1W5FA 2HMUA 5EZYF 3C98A 4R69A 4KWIA 3H04A 4OKSA 2J0EA 4K6HA 4N76A 2JI7A 2VEOA 2D54A 4Q3NA 5IJXA 2DCMA 3I9OA 1S02A 3NRJA 1YS4A 3RHTA 4LXIA 1HEUA 4DEVA 2CMDA 1KYXA 1GU7A 2CVQA 3M0EA 2B92A 2EW2A 4IVPA 1VLJA 3S2IA 4J0JA 2O14A 4NZZA 1VGVA 5DYIA 3JARA 4IUYA 2J6CA 2CL0X 1XIVA 5D7NA 4N41A 1Y5IA 1P7YA 3OY7A 5ALIA 4D42A 1F2TB 1WULS 3FNBA 1NUQA 3GOQA 1PDOA 2P6MA 2ZI5A 4IDAA 4KPUB 4QJBA 5LOVB 3R9XA 4H6XA 3W7BA 2E5WA 3R0IA 4OKNA 4HL6A 1N25A 1ULBA 3GLFB 3KYBA 2XMGA 2I4RA 5EUBA 5T8KC 4ERNA 3BF7A 4PVDA 1WABA 5IG2A 3IHTA 4LOAA 2JFHA 1US8A 5IN5A 2KBEA 3O6VA 1CZNA 4NV1A 1AQYA 5FOVA 1E3WB 4E4YA 3QVTA 3QU7A 1Z83A 1PJ8A 5CNIA 1NBWB 1NLMA 3KOXA 1XJCA 2G17A 5HM8A 3WA6A 2ZB4A 4NMHA 2VSFA 2VC2B 2VAXA 1J0AA 2P8JA 1JWLA 3KQMA 3K1AB 4KRYA 4BB5A 5ICSA 1VJ1A 3U7EB 4NI5A 2Q3HA 3V7FA 4D4HA 3N2KA 3SFTA 1ZZGA 3WLOA 1G8AA 4EY6A 1LS6A 2PX8A 2A5GA 3BN3A 1RJDA 1Y6JA 4HDKA 1ECFA 2AYXA 4WTOA 3A3OA 3UGTA 2O3QA 1T4GA 3BGIA 4MPPA 2XUQA 3H0KA 1J8DA 4CTMA 1LDGA 4QDKA 3TL2A 1NUHA 5T4HA 4CEJB 2P0AA 1N92A 3C8UA 3KD3A 1EG7A 4IDQA 4IAOA 4ML3A 3WSTA 1GHTA 2XNJA 1DPGA 1X1EA 1Q17A 1GTVA 1LVUA 3KB2A 4R8MA 2RB5A 5AUPB 4ZCMA 3HO8A 2V4MA 3IBYA 2WRZA 3O82A 2QN9A 1GNSA 1OPRA 2WJ6A 3BK2A 3JQAA 1X38A 4MCHA 4IOLA 1QTRA 2QUAA 3S6JA 2FK7A 3CY6A 3E2PA 3U39A 2C2OA 5EQFA 1WSBA 5KS2A 3JQBC 3G8AA 5CVUA 2BRUA 1RQNA 4G5XA 1UADA 2GBGA 2P67A 3KP1A 4MW9A 4K05A 1MQSA 1M2VA 3BZBA 2XDAA 1GQYA 3DBHB 3SSNA 4DJAA 4X85A 3EGCA 3EN0A 4MW4A 2GPJA 1C9EA 2D06A 4R1OA 1BRMA 3DEAA 2OUKA 4D0GA 1YS9A 2GDJA 4GECA 4MYRA 1JR6A 3WLQA 5C4IA 4XOIA 2AFIE 1HQYE 1X1DA 5BWBA 1EUCB 3V97A 2ZR8A 3PRKE 2VN8A 2HRRA 2J4CA 5JPDA 2JA1A 2A1TS 2VZ8A 4MS3B 1Q0QA 2KPOA 2X0EA 5BUZA 4H15A 4CQNA 4I50F 4D82A 4R5HA 4YP9A 3KEOA 2GJ4A 3AR4A 5CDGA 1XDDA 4Q7QA 3BA1A 4PSKA 2HPAA 2IUYA 3QKSA 2C4MA 3QMVA 3TZ6A 1E5VA 5K8LA 1K08A 3BXHA 2FHSA 2QUHA 2OM2A 4OFXA 4W1PA 3FMPB 1X1RA 2NW6A 1GNQA 3LCCA 3NM4A 3SDZA 4IHJF 2XUKA 1K4YA 1LX6A 3PE6A 4G1MB 3IAS6 3AR2A 3VO9A 1TMGE 1ZRHA 4BRUA 2GJSA 3OKCA 5CJPA 2C5FA 1SPBS 3RYIA 5AKKA 1ZXXA 2FNAA 1C7FA 2AXQA 2CLCX 2QPLA 3QX7A 4AG3A 1JKMA 2IA5A 3HB1A 1O58A 1SXGA 5JAHA 2QRPA 4LMRA 1EINA 4M7OA 3L46A 4M8KA 4TV9A 1Z47A 1V1RA 2PYIA 3NT2A 2H8GA 1R10A 3RGGA 1YTUA 3R5FA 1RKUA 4C9BA 3R5XA 2J7PD 4Y1FA 1CY6A 4LOIA 1OVMA 1EESA 4TZKA 4URHA 4RY8A 1KI6B 1W76A 3O38A 3E5RA 1Z07A 2D7JA 2ZCVA 3RS5A 2GEDA 3DT9A 4DM7A 1GDTA 1MRNA 1YHNA 3H5IA 5EMLA 5SZHB 4ALIA 1L7QA 1ZD4A 5KNCA 2YV5A 1FVHA 4HWGA 3PT9A 1RYMA 2CZCA 4IYRA 5D3MB 3TTWA 4A10A 4OF4A 4BFTA 3EBOA 4DBVO 2XIQA 3T61A 4OJTA 3C6QA 4R31A 4B3HA 1U2RA 5EL0A 5BWCA 1CUHA 5LQMA 1GL6A 2YW9A 1W87A 4K6FA 3X1ZA 2Y1XA 4AJ9A 1QLWA 2A4MA 1GFSA 3TCXB 1DXOA 1ND5A 1AH2A 3NV7A 2GKOA 4TL7A 1YMQA 5LYJB 4KNYA 2H2DA 4FLFA 1K9VF 5KPJA 3TZQA 3CG4A 5IT5A 2PT6A 1NXQA 3EC1A 2H17A 2MMGA 2R60A 3DV9A 2PZMA 3ZCTA 1SA0B 2G76A 3BE5A 3EE6A 4MLCA 5ESDA 5JJCA 4LE0A 4NECA 2JJMA 1E1RA 1UFOA 1V3VA 3ETEA 2F43B 2LE0A 3T1TA 2JD0A 3B1FA 4BDSA 4LPSA 2YN4A 5BN3A 2BM1A 2POQX 5FL7A 4TTRA 2OCGA 2BFPA 3MWGA 3VU0A 3LQ1A 1GTMA 3TL3A 3MLEA 2Q3LA 2IIVA 2Q41A 2WZDA 3U48A 2M1ZA 4TKMA 1ONNA 2GLXA 1M54A 2XWJI 3QQ5A 4RIHA 1IJKA 4ZOEA 4EJ6A 1FJXA 3RVJA 5EP3A 2X0IA 3CPEA 2HREA 3DDZX 3FI0A 1QQTA 4ADSG 1O9HA 3M82A 4PAQA 1XVTA 3COVA 3L4BC 4MR7B 1I13A 1LLFA 3K0FB 3KQYA 3KYDA 5FO1A 1XNQB 3OOSA 2P6OA 2NVUA 1QBGA 4FMDF 4U2GA 3UCEA 2XI4A 3ZDYB 5LPNA 4P0QB 2ECQA 3NLLA 3QF4B 5C7YA 3BWBA 2QEQA 3RFVA 1DX4A 2REQA 3EXHB 1GTG1 4JBWA 3PGMA 5TF4A 3WZ2A 4D4IA 4DC1A 4YPFA 4Y67A 4NHOA 2YL2A 1AGXA 1P9WA 1XEFA 1XZQA 2J3MA 4GI1A 4GHWA 1JDNA 4RCVA 2AKEA 1A9QA 1I0LA 4GZ5A 5DNVA 5EMHA 3RWBA 5JADA 2HU5A 4L8GA 5EJIA 4DRXA 5LOVF 3Q72A 5CYFA 5L53A 3WRWA 4L5BA 3IVAA 4L4YA 4N8DA 5IYZF 1GAXA 4F3NA 1DRUA 3PFCA 3R2JA 1SY7A 3HMQA 1V16B 2PX0A 1IB0A 3DEJA 1R5NA 3GMIA 4MITA 1L8QA 2ZSJA 1BDHA 1KFEB 2DFKB 2ZSEA 3FMVA 1LLQA 3A6HA 4LV8B 4G56A 1IUNA 4QICA 1BKYA 2B9EA 2NSDA 1R27A 1Y7IA 4YRTA 5DM1A 4B2YA 2UZ4A 1G8SA 1Z4QA 1LLDA 4Z0TA 5JVDF 3KVVA 5LYJA 3VH2A 2BSQA 2WU0A 4HMOA 3H11A 3KQHA 3AU8A 3CEAA 3UJ7A 3ZY6A 2ZUEA 3A11A 3UF0A 1I5RA 1H1LA 4Q3OA 3T3PB 2PGIA 2UAGA 3FSRA 4LSMA 2IPOA 3KQKA 5AJYA 4ZT6A 1JVSA 3LFHA 1I3LA 4P92A 1PFKA 1WEHA 1WW8A 2NXNA 4RMHA 2QT9A 4X8HA 1WY7A 1WXGA 3OY2A 3WNDA 1Y3CE 1T3LA 1R4ZA 2HMTA 3MM4A 4OXYA 3EULA 4YMSA 1U2GC 1C8KA 2EGUA 1HV8A 2AKYA 2YIMA 2H1CA 1AQUA 3EZFA 5FR1A 2NP6A 4FE7A 3FMIA 3HN6A 4DABA 2H1RA 3NHFA 2CXTA 5JS2A 4CQLB 1IIRA 1YB2A 1CP3A 5DTIA 4V02A 5B7GA 1LPSA 4EA7A 2B20A 1FRNA 1PYGA 4NQZA 3EZGA 1HX7A 1UMDB 1EZ4A 2RI6A 1Q0HA 3TDMA 4ER0A 4O1IA 5E9JA 4V0KA 5FPSA 2IPAB 3C97A 2FPLA 1PGOA 3OA0A 4O4JA 1P0QA 1QIDA 3BTOA 3CLTC 1L5ZA 2LDXA 5KNBD 4ENVA 3VSBA 2WFZA 1AF4A 2OORC 2EZ8A 4FKMA 4HDRB 1Z12A 4HLQB 4UHEA 1JZQA 4HPXB 4B3CA 4MQEA 2DOKA 3HZRA 5JFOA 1MVNA 1MA0A 3MA0A 4ID9A 4JXZA 3T94A 1Z74A 4KOAA 4OHMA 3SDSA 4JL6A 5JMWA 1SUIA 2K7ZA 3HVHA 3HP1A 4KFUA 4R3NA 5DXFA 1G3QA 3L92A 3A6FA 4RVGA 1QKKA 4WN9B 1DRKA 4UM5A 2CLIB 1X2EA 3K6JA 4JJAA 4IG4A 4PPQA 5CHYA 4W5TA 4E6EA 5IJWA 4OI2A 2PX2A 2V58A 2YYAA 2ZBGA 4CUZA 1ZD9A 2AL7A 2AR7A 2CWWA 2ZRFA 3DZIA 2W2MA 4AQYB 2O7QA 3I9V6 4JP2A 2GNPA 1YS2X 3S55A 1Q1QA 4A1FA 1DCKA 3DCNA 2QXTA 2YFYA 1PK9A 3RS0A 1PJLA 1QO7A 3GBVA 1II8B 4QBKA 1QDUA 4CBVA 1KJZA 3R7WA 2ZRHA 1HDOA 3KOOA 3CZAA 3I0MA 5D86A 5ARDA 1E1YA 2O4UX 3PQEA 4MI6A 1K9SA 2VNIA 4US0R 3D3JA 3UHJA 2YIJA 3HP7A 4KSCA 4Z2YA 3TTSA 2G4CA 1VZ2A 3FSJX 1HDXA 1HYBA 2DTXA 4HX5A 4AYTA 5CA0B 4MVJE 1KKMA 3PR3A 3CXUA 1D2EA 3EXIA 2JFXA 4IDPA 5A7FA 3EC2A 1U04A 3BRCA 2WP8J 2NXJA 3DE4X 1EAYA 2B5WA 3FBTA 3H9EO 3NBZC 2WA2A 2Q3JA 3SFVA 1ODTC 3KVYA 1NVAA 1KNQA 3EJWA 4GDMA 4P82A 2KE5A 4LG1A 1P1CA 4OB7A 4WVLA 3RFTA 4EG4A 1L9KA 3GLGA 2C9BA 4I1PA 1UXKA 1AQ6A 3TLAA 3JWPA 2IITA 2G07A 2XQVA 5T4EA 2PU5A 1I14A 1ZIYA 4CEHA 5JAPA 3PC2A 2GF2A 1V5GA 4QGGA 1OXUA 3GDFA 3FBGA 3PCTA 4LN1A 4OP2A 4WDRA 3VU3A 1BGVA 1EGVB 3BREA 3T9AA 4GKKB 1I5EA 1IXKA 1XEWY 1YVDA 3JR3A 4JB0A 5EXPA 4O25A 5I9MA 1KGDA 3UT6A 4YDHB 1NL3A 1GA1A 1K06A 1L0BA 4MQEB 4WLOA 4X44A 5COBA 3HWX1 3BRWD 1HFJA 2P78A 3NHSA 2GHIA 1XLTC 3HKEB 4XWYA 5CM2Z 3GP3A 1YZLA 1DHTA 1Z82A 5LNK1 3LF1A 2DT5A 1DV2A 4LZPA 4NOLA 4DLPA 1XEWX 3EVBA 4HSEA 1Q1AA 4U9IS 5I9NA 2BTEA 4YYEA 2R86A 4JQYA 2BFBA 4INZA 3LY5A 1YR3A 4BNVA 2AUMA 5JSHA 3AC0A 5KOJB 3R7SA 1IUPA 4U7FA 3IPLA 1WXXA 2MYUA 3SS9X 2O0LA 1EJBA 1ZK2A 4GR5A 1PSDA 3GDOA 1CUXA 2PJUA 5TJ9A 1IZZA 2G5TA 4C7MA 4C0JA 3EIFA 4XVRA 2HK9A 3TSOA 4QT4A 2AW5A 4H4EA 1J8YF 4ZGBA 2OV3A 4DMHA 3EWNA 1UINA 3CKMA 5I3ZA 2HA5A 1QH1A 4P53A 3IESA 5HRAA 5KSWB 3H8VA 3D3NA 1HOXA 3W2IA 5K9ZA 4G89A 2O7NA 2QV7A 2Y1OA 3AVQA 3L0OA 3QFFA 1EK2A 1J90A 3AF3A 4KRXA 5FKJA 3SJ7A 121PA 4LSZA 5JY6A 2HA0A 5KNCD 4DWWA 4NJMB 2OFOA 1CJKC 4JEHA 1N7GA 3C41J 1CFJA 2AK2A 2G72A 4I14A 4FX5A 4IIVA 1L3CA 3AI1A 1Y63A 4FUQA 4HHEA 1UM9B 2BMDA 1R0BA 4BXOB 4CM4A 2QM8A 2ZDGA 1YFKA 3UAXA 3N8DA 4NRDA 1WW3A 4UC0A 4D8YA 1JAIA 2CMFA 1KYVA 2Q8PA 1E1CB 4ENPA 5AW0A 1O0CA 2RJNA 2YNMC 5ADVA 4AAYA 1O9GA 1IATA 2OE2A 4PZDA 1TCBA 3INNA 4MP8A 4LKRA 5DE3A 5EKTA 2FRXA 2IYXA 2QTVB 3C6YA 3GN2A 3IAM1 1S3SA 4JBGA 5F1OA 2C3OA 3T3IA 3VDQA 4CIBA 5B7QA 2F90A 5I5GA 1GCAA 1VJRA 2IU3A 1CUZA 4TKVB 5E6UB 2AEJA 1R0LA 4EHLA 1MRZA 3W4IA 3MN1A 1XJ5A 2FFJA 2EKPA 1HLPA 3EXHC 1GUZA 1ZS9A 1J07A 1FDVA 4HQRA 4MV6A 2EF0A 1IBRA 1RI5A 3SZMA 1C81A 3AG5A 1GFZA 3O8NA 1SB8A 2ANCA 2JJ1A 5LQJA 2PWBA 4DB4A 1LH0A 2QTFA 3SY8A 4WPGA 3PLNA 3L4SO 2JL1A 1NXWA 4TMKA 2DPXA 5EMKA 1EFVB 3IT1A 4LZJA 5FFMA 3INTA 4JUBA 4B5KA 1PJ4A 2COEA 2QD2A 4A8JB 1QMGA 3ECSA 3EQZA 3UB3A 3NIBA 2PLNA 3LUPA 2XF8A 1TA9A 3GGDA 1HXHA 1MZVA 1UAAA 5K3AA 4JS0A 1GGEA 1Z3CA 1LDEA 1X1AA 1O4VA 3BH7A 4IZ6A 4QRDA 3C15C 3LCRA 4U7GA 4W7HA 4YJ2A 5IKXA 1NW6A 5M29A 1PYDA 1J09A 1CULC 1TZMA 4E30A 2OMKA 3CKYA 4N8EA 1B73A 2AN1A 2XBLA 3H1AA 2PE5A 3NHWA 1UODA 3R3WA 1T13A 3NCHA 2FE4A 1UKCA 3GEPA 2KYRA 4FD3A 4LNUA 3RBXA 1Y9AA 2YWDA 4ITUA 1JXOA 5LMCA 3ZVNA 3JZDA 4R1SA 3PGXA 2H63A 4CKZA 2O8BA 5DPMA 1EFCA 1JEQA 2BMEA 2IYLD 3KHSA 5J2TF 1A8PA 1K6EA 3LXUX 2BEVA 4ZVLA 4U2DA 4BZQA 4L9SA 2QAIA 3E1SA 3ILYA 5JDCC 4EITA 1KDVA 3IKMB 1TMKA 4LXXA 1BJRE 3TZKA 2X41A 1ZGJA 3TGPA 1H1TA 1Q0RA 4M8SA 3BIOA 1HK7A 1GNPA 1EXVA 1SC3A 4LTNA 1AS3A 1LI5A 4ODIA 3KAKA 3GJ7A 1X7XB 3HLTA 3HNRA 4XLTA 3RNLA 2BGRA 2J45A 2J67A 1IWOA 4N5LA 1W5BA 3OMXA 4RHXA 1KEEA 3PD0A 3HDYA 4QBGB 4X8MA 2ZB2A 1WZEA 3R8FA 3FF4A 1NJ6A 3NHUA 1ZW1A 3SJCA 4GF5A 5BSFA 4YRNA 3CBQA 4IXTA 5DM2A 3SN6A 5HZKA 3DWGA 4BQSA 2HF9A 2Y0DA 3ZZUA 4LEIA 3SR4A 4C3ZA 3TJRA 1SIWA 2CLKB 2W2QA 2YNMD 4PSVA 4Z8YA 4DA9A 3ZDQA 3ZDDA 3DMNA 1QHSA 2VHTA 4C89A 3FZEA 2X1LA 1E5XA 5DGDA 4DS3A 4EFNA 4XVCA 2R6ZA 3I12A 3U7QB 3NXKA 3WICA 1XMPA 2FKNA 2GPTA 4D6XA 1ZW6A 2BE9A 1VKRA 2YC2C 1YI8A 4AXXA 3BQ9A 5AKLA 4YC7A 3GUVA 4X91A 2FYTA 3BXOA 4RE5A 1ICIA 3FPKA 2VQFB 1ZX1A 5F9MA 1CR2A 1NQXA 1W0KA 2GN6A 2FPPB 2WSSA 3MLAA 3MT7A 3H9UA 4MYCA 4D9FA 3VR6A 1Q19A 3PXCX 4F6LA 3GCGA 4TN1A 4U1RA 4L6CA 3FETA 3EUEA 4L75A 2X77A 4ZANA 4CJXA 4LDNA 5K8UA 1BE1A 2GN1A 4MTLA 1DKLA 2VDWA 5FF9A 1BA2A 1MO2A 3LPMA 3X0DA 1CNFA 4FSDA 4HFNA 3OPYB 1O7JA 3K70B 2PT5A 4GBGA 1RQ7A 1PNTA 1PZXA 2Q5IA 3EPKA 1W75A 3KIPA 5HF6A 4HDNA 1FLAA 2G5PA 1Z45A 3KJZA 3W6ZA 4Q7KA 1IY1A 3B1XA 2DMRA 4H1HA 1D3AA 2WM3A 3LPNA 2PVPA 2SKEA 4HN2A 3VXKA 5FOTA 1NN1A 3G2NA 1YZQA 1K0FA 2ECFA 3FWYA 2FOIA 3HH8A 1TPYA 1RZRA 1UBGA 4J2OA 4BHTA 4QQKA 4OB8A 5KU7A 2JIOA 3T6KA 1SD2A 1JHMA 4N3AA 3DNPA 3RS7A 3OH8A 1TK3A 1L1EA 3E4DA 1F7VA 3ASZA 1E9FA 4LXTA 4CKBA 2AFRA 3RF7A 3ULKA 1ZC4A 1O3YA 1ZOOA 4L1KA 4MS3A 4NLLA 4Z0HO 4COKA 4YRZA 3OC0A 4BNUA 2VDVE 5JSUA 3AY7A 4UDXX 3GG9A 3RV4A 5CUQA 5FBZA 1KMHB 1FUKA 5IBPA 4BWGA 4YCCA 2M2IA 3TPZA 4I81A 2VCYA 2WSYB 2XMPA 1GLNA 1NASA 1F0KA 1C0PA 1AQLA 1NVGA 2II6A 1ICEA 1ZSVA 4G4SP 4ND4A 2V7EA 1ENZA 4G26A 4JEIA 4C3UA 2YWCA 3RC8A 3MPUA 3HWSA 4E3ZA 3JASA 3N8GA 4UBNA 5GGXA 4KR3A 4RORA 3KKKA 5JV5A 1XCBA 3IPYA 1I7DA 2E3JA 1QK3A 1XI2A 2P2SA 3VHXB 5LZ5A 4MWGA 3GJ8A 5HKBA 4LRQA 3TW0A 4HVLA 1Z5PA 2JIRA 3F9RA 3LUAA 4BGIA 2DE0X 3BVPA 2XWBF 3OQHA 4DLWA 5KSZA 2WAYA 4P3NA 3I92A 3IDZA 5F7JA 5JSFA 1Q7GA 3OZIA 3BBPA 4AECA 2ZIAA 4FYVA 4K3UA 4QASA 3TW6A 4UHBA 4ZFNA 2EZ4A 3I9KA 3BJRA 2HWKA 2JKYA 3L8MA 1XBTA 3N7TA 2HV9A 2J6IA 3BMXA 2B94A 3Q3IA 4LVCA 5ALLA 2OAQ1 2P9JA 4KBFA 5JMOA 5D00A 1ZWLA 1KQNA 2VJYA 3MMPA 5AW6A 4L16A 2AUTA 1P4SA 4XASA 4BE7B 1W49A 2N0SA 2CDBA 3C3MA 2GF0A 1GPAA 3EDCA 3HU5A 4Q7MB 4B44A 1TU0A 3VR4A 5IBQA 2PKQO 2BV3A 2HBZA 3ZHOA 1GDHA 1QBKC 3OX2A 4ZDKA 2JBWA 5BW6B 3K3PA 4WAUA 5FFFA 2YWRA 1T8YA 3JQRA 3NNNA 5TGTA 1F0PA 1NP3A 1SOVA 4FB5A 1V47A 2O2YA 1EFPB 2XH8A 4G5OA 1U6KA 4IR7A 4XOUA 5EPOA 1D4ZA 5K20A 3RS4A 2H1FA 2QY9A 2AOUB 2ATXA 3O2QB 1GPBA 3PA8A 5KAPA 3K70D 2QU8A 4JL5A 1XTZA 2HWXA 2AOXA 2ZJ6A 3IJ5A 1YA8A 2BZ1A 3COWA 4HR7A 3X2FA 1DTWB 2BDUA 2HMAA 2HU7A 1JW9B 3P96A 5SICE 1Z06A 4BX8A 4U7DA 4EHKA 3HVIA 1BVYF 5FBKA 4DMRA 1ZM2A 3L6RA 3BWVA 3OPNA 4DHEA 3HK2A 1L6IA 3IIKA 2QZJA 4JODA 4JVOA 4YJDA 2DB3A 3W34A 3DKIA 2AV6A 3HKBA 2NG1A 3FN4A 2H31A 7YASA 1O5TA 1H42A 3ZDCA 4JQSA 5K0EA 1E3EA 3MTGA 4NBNA 2XSZA 1ZA2A 1NUPA 4CCYA 2RKBA 3VKGA 3I72A 3FHJA 1U0BB 1E7SA 1B4DA 3B2EA 2C0CA 4X1YB 2OPHA 5IJ9B 4HK4A 1NC3A 1WM1A 1G7SA 4RLQA 2UVDA 3IOMA 4MR9A 2EJBA 4RGQA 8ADHA 5GTDA 3WK6A 4PX2A 4UU1A 5BSWA 5LQAA 2PL1A 1RPTA 4P4NA 3U80A 1I36A 1JHUA 1X7ZB 1AHHA 3LXXA 3CURA 4KE6A 3WO0A 2OA0A 4ZMRA 3VKHA 1WQ1R 3OICA 1NQVA 1T2VA 4EQ6A 2B99A 4EG1A 4F04A 2R8RA 1S3IA 1PP4A 2ODAA 3UOWA 2GEUA 5EWLA 3E9DA 4D45A 2O0MA 4D26A 4O8ZA 4HUQB 3B70A 1KEKA 1RC1A 4RVDA 3SP1A 2ZCUA 1ZCAA 3PTAA 4UAVA 1FIUA 4PYRA 5DIFA 5AVQA 4RH3A 4M54A 1Z68A 2J9ZB 3L5OA 4OCZA 2GCOA 4FZVA 1N6HA 1K5DA 1UBKS 1Z0FA 2YOGA 3PPIA 4MVJH 4CR6A 2XRZA 1BWPA 1KK1A 5A6SB 3KT8A 4U39A 3T1OA 3QIAA 3NEPX 3WGJA 4LF9B 4LBVA 3BWXA 1EX7A 4Q1DA 1GZ7A 3ER8A 2P9ZA 4MKXA 2E9SA 5CDSA 4IIFA 1H2RS 1TUBA 3DTNA 1OY1A 3R6WA 2COUA 2I3BA 5EHZA 3Q0IA 3MHPA 5LWHA 2ZEJA 4Z9AA 3K9FC 2X0JA 1R6XA 4ZEOA 1IMJA 3QLTA 1T5HX 4ZHQA 1TZ2A 2NN3C 4M9ZA 3BYZA 5HXAA 5LL6P 4L3OA 3IXMA 4P3XA 3TECE 2EGGA 4MA5A 4V0MA 3EFOB 4JU9A 3RTAA 1DAEA 3AEQA 3DH0A 5C37A 4BO2A 1GV0A 4R4JA 1F38A 2VJCA 3AB8A 3KOZA 4RLHA 4AZ0A 4CHTA 3NC1C 5E0KB 4DCMA 2QPOA 3EPHA 1SPXA 3HA5A 1E1NA 2BZGA 1TA4A 2VYQA 3JATA 3Q85A 4O2RA 2WPDD 4QDOA 3ROXA 5LVAA 1MAWA 3JD4A 5JALA 1T4CA 1PL0A 4CKEA 4IJKA 1T4CB 4LDJA 4MUIA 2W2LD 3R5TA 3OPYI 4UCXA 5AJUA 5CPFA 1SGWA 3AEUA 4KDRA 5AHWA 3NEAA 4R3UC 3WLMA 5JW6A 3F4BA 4G36A 1ABFA 3DXXA 1KFJB 4HAVA 1DC3A 5ITZA 2ZANA 3WRXA 3ITKA 3UO8B 3K09C 3LJKA 1ZD2P 3Q0EA 4BQQA 5KTMA 2XUPA 1NMEA 5BV2P 1CK4A 4ZO6A 4OYHA 3JQ7B 4ZQEA 2Q4EA 3ZGLA 1O96A 4FOTA 1OLUB 1I4DD 2V3VA 3PENA 4Q9HA 3H2SA 3UFXB 3I34X 4D98A 1ENOA 3N75A 1G5IA 5FBVB 2BJHA 2W6JA 3TIXB 4F7WA 1A9TA 4HDMA 3GUUA 4K9QA 1B7GO 5FCDA 1WX1A 2ESRA 1XXLA 2ZJ4A 4YJHB 2IH2A 2VRWA 4YDQA 2BCEA 4GZ3A 1H2FA 1N2JA 2C7GA 2RHTA 2WIDA 4UPDA 4GPBA 4ATNA 1W2HA 1WA5A 4QUDA 1REQB 2BBOA 3DS8A 3X1JA 2QVGA 4Z4IA 3R5KA 3QUCA 4ZVTA 3LOPA 1E1KA 3KPUA 3RK1A 5LD2C 3VPDA 4DB2A 5A3SA 4RF5A 5HZHA 2J46A 3AUKA 4XRGA 3A6PC 2VNAA 4P3PA 1MEJA 1M75A 1TKCA 3ZDEA 2ZP1A 3HXKA 4WZAA 4HH3C 3TXYA 1N2IA 4GPEA 4E03A 3GFRA 4M1EA 1NV9A 2FLKA 4G1UC 3P52A 1P4HA 2GJAA 2IYFA 1AUVA 1ZVJA 3FUVA 3WWOA 2I2CA 4RKEA 1WD7A 4E7PA 1TDJA 1UPFA 2AWOA 2NUPB 3O8QB 6LDHA 3K32A 4KWCA 2P90A 3IAFA 3CRVA 2R5NA 1B2LA 4A03A 4UE3S 3O92A 3CINA 4KJZA 4EHHA 1H0SA 4UQOA 1UR5A 2NV0A 3R7FA 1GKUB 1R0WA 2ZOSA 4QPPA 4RADA 2V59A 5DNDA 3K0SA 2DQKA 2A0WA 4MB2A 1T8RA 4MPRA 4Q9DA 5F9HA 4X60A 5DM4A 3K9GA 3NASA 5JH7A 5CVTA 2AOUA 2ZWMA 1U3UA 5FOXA 3VR4D 3WHLA 1U7UA 4LQLA 1COZA 4A73A 4C78A 1KK0A 1PL8A 3BMOB 3DV0A 3D0KA 3CW2A 3JAWA 4BVEA 4NBTA 2X9NA 1AXEA 1QGUB 3O21A 1KERA 1XKXA 1B0AA 3JZIA 4X63A 3EXFA 2A58A 3ROKA 4YMVA 4DR4B 3PRJA 3ZHUA 3K73O 4MGHA 1D2HA 2R6DA 3FKSA 4DV7B 1TQ8A 1E6CA 3EHDA 3KL2A 3L1KA 4O4JB 2NTYC 4UU0A 4POOA 1H23A 3L7DA 4I9NA 1CTQA 1NR5A 2VAMA 3F7NA 4DIKA 1I4EB 1AJEA 4I8DA 5JJIA 2J30A 5B6JA 3GLTA 4JUAA 2C57A 3AUYA 1R0ZA 3O3OB 5CK4A 1G2OA 3RKSA 5AIBA 3FOWA 4B1FA 3K2IA 4IP0A 4X9XA 3S70A 3UT5A 3V3KA 4ZCTA 4KN6A 3T41A 4BCCA 2H1SA 2WZQA 3T1NA 5ITVA 5JQGF 4AKIA 2IL1A 3BD6A 4L6AA 3AGPA 1OREA 1BEEA 4UM7A 4PZPA 1Z36A 4ZIRB 4MJXA 2QX9A 4D25A 1TKAA 1TQ2A 2JI9A 4FP9A 3T0FA 5CXSA 2E4WA 2BELA 4G3XA 1T9ZA 2DU8A 2W8BB 4R1QA 3QELB 4M0MA 5AK4A 5C0OE 4V1CI 1LV7A 5ADWA 4CXMA 3L49A 4BKRA 2CLLB 1D0VA 2Y66A 2ZYIA 3LZDA 3QE2A 3ZIAA 4INPA 4ZRMA 2J85A 4A2CA 4C43A 1OXBB 2CJPA 2AZDA 4EFMA 1J2UA 2PXAA 1GUFA 1TLFA 1WB6A 3V4PB 4GO1A 4RKWA 2BHRA 4DZZA 5L3VA 5LQRA 3IPAA 3GRCA 1L7XA 2NZVG 3LWBA 1H05A 2QWXA 3NTRA 1JT2A 1WCWA 1Z6AA 1ZMOA 3KLOA 3WYFA 5H82A 4CUJA 1FCJA 1O6CA 5J63A 4ZEVA 2XNDA 1IPHA 3KKNA 1JP7A 5D85A 2JIBA 3ONVA 3GL9A 4KGXA 3LU1A 4PCUA 2CNWD 1UOEA 2FWJA 5ALYA 3DYVA 3KDPA 2OZLB 1SRQA 3U3JA 3VJLA 3MUEA 2CV2A 3OJOA 4OSEA 3W4JA 5M2QA 1KHTA 2RHDA 4BKMA 4TVBA 5TARA 1KRXA 1W0KD 2WSSD 3D4PA 2A2ZA 4IF4A 5HILA 3ND6A 4NPAA 4FVTA 4UCWA 5A4DA 5AD1A 4QL3A 2GRAA 4CNQA 1TTTA 2ZB7A 1T34A 4GVXA 4XVUA 1IZYA 2I33A 4DSZA 2V65A 2PWYA 3OT4A 1R50A 1D07A 3DAGA 3ETHA 4BO8A 4R5MA 3U7RA 2BEUA 3LPDA 1HLDA 2PD4A 3GPLA 7MDHA 1E9AA 4UM8B 3ONFA 2UZ1A 4ZCSA 2JGIA 1YJCA 1VL6A 1KYQA 4D43A 1ST2A 1J56A 1VP9A 1YO6A 3EDQA 1I5OA 1RJEA 4MGEA 4CKBB 4UBKA 5IU6A 5C18A 3N2IA 4G9BA 1ZCJA 2I8LA 2VJKA 1F0NA 2WUVA 3LYLA 2BSXA 3IDAA 3P1JA 2G82A 1R4MB 2QYOA 5H1YA 4F3CA 1B74A 2TMYA 3VJRA 1AK2A 1CG6A 3U6BA 3A6DA 1O94D 1T43A 2P5SA 4MCJA 1NVTA 2BW0A 1QGAA 3QSGA 2PGNA 1VYVA 2ACVA 2QNIA 4GE0A 5L45A 5ESXA 4MVJI 4J4TA 4NZPA 4D4MA 1UPUA 1L4HA 1ECPA 1A88A 2YYZA 3TTYA 1NR7A 2ZATA 4W8GA 3VMFA 4L0QA 3DKVA 3EYAA 3KWFA 3NV9A 4XX0B 3UWSA 2JATA 4K1XA 4HZGA 3IALA 4K6CA 4YYZA 4C7KA 1CJUC 1U7WA 2YFKA 1BH2A 2QRMA 1W85A 3M5CA 3OIGA 4YK7A 1SQGA 5DP1A 5ETJA 2Q9AA 1L4GA 3PEVA 4JLMA 3LKZA 4Y30A 3LDHA 1L7BA 1CZOA 1PJSA 1VFPA 3NFYA 4FGJA 3DQZA 1M83A 5F3DA 5I7RA 4FFBB 2ASVA 4BVHA 2WPNA 1IYZA 4JC0A 1HI9A 1IM2A 2BEVB 4N0MA 3ZG6A 2RD2A 4BB6A 1ZNYA 4UFNA 4CV0A 4IHQA 4MGIR 4AWXA 2E4UA 1DJLA 2DH6A 3E3OA 4L78A 4YDSA 1OAKA 4E2XA 3TQTA 4UBIA 2XWPA 1UF9A 3EF1A 4JC5A 4DJJA 1U94A 4OFBA 2Y76A 3L41A 5I7UA 2H92A 4MUJA 2B8TA 3WK7A 1FPQA 1UANA 4WKGA 3C3YA 4WZZA 2HCTA 1HDZA 4HRAA 2YV4A 1N3IA 3ABSB 3I04A 1ESEA 2DX7A 3D5TA 1KEUA 3SBEA 3UCFA 4PBRA 3SE7A 1I3OA 3NIDB 5AM1A 5KTSA 2X58A 2VYND 3EY4A 4DUGA 3MWJA 1JDSA 5CVJA 1E0JA 1KY5A 4K9MA 3QPWA 4Y6LA 2DFLA 1M34B 2JI8A 1BGXT 3NPMA 4UDOA 5F2EA 2WINI 4LY3A 5B36A 2I7DA 4UOZA 1QB7A 1EGQA 4BMOB 5ALEA 3PI7A 2O1EA 4CMIA 2OVBA 4TROA 1XD2B 2PG3A 5AOVA 2ZRAA 5GONA 2PXXA 1W34A 3EXFB 3GK3A 4Z3KA 4S04A 2OL4A 2V45A 5E6UA 3MAJA 5F78A 3DLIA 5JCJA 2VSNA 4HEJA 4IEFB 3QK7A 3QVVA 4L22A 4ND8A 4XQEA 5FTKA 3VZQA 5C2JB 1UT6A 3ANXA 4JHXA 4Q3LA 1KJWA 1X14A 4IFTA 3RS9A 4UPVA 2UXBB 4RSMA 1T8UA 2E85A 3AHFA 4W1RA 1FYVA 4PFSA 2VWPA 4U6SA 5GP1A 5DM0A 3OHSX 1NQOA 3HA3A 1UQTA 4FGWA 4TQAA 5B3JC 1S2OA 4RIGA 2VK1A 5J4VA 5ICFA 2H4HA 4R3WA 2OV6A 3C3DA 1RXIA 4YGXB 4AG5A 2XB9A 2CLFB 5JDIA 1C8VB 4RQAA 2JC3A 4LBYA 4RXTA 3H19A 1P2GA 2ZDHA 5CNJA 2LIPA 1QTNA 4EKYA 4AP5A 1VG0B 4NZYA 1SVLA 5IC4A 1AVTA 5JJLA 2PH7A 2Z0MA 1KK2A 2EP8A 1MR3F 1Z6TA 2P2DA 1XAIA 1IZ0A 3JQAD 3LNTA 4BX3A 3UMRA 2G1UA 1LZKA 1NSFA 3TLMA 5EZYB 4KW7A 4FFMA 4UZEA 3SK0A 4J6EA 2NXWA 3DT6A 1D7OA 2DULA 5E2AA 4JC4A 3KR2A 4I1OA 2ATVA 2YJ3A 2ZRLA 2FDXA 3A9TA 1RWQA 2YOFA 4JC8A 5JCZA 3WISA 2BHNA 1F14A 1JIVA 1PNVA 3DULA 5JVDB 5LBTA 5IEBA 4YVFA 3ZTWA 4B34A 3F8WA 3Q9NA 5FNVA 3RU3A 5CURA 1DQYA 2V5AA 2G25A 4WRRA 3ZXYA 4AG6A 4E4TA 2JLYA 3IE2A 2A9OA 4HNAB 1JHDA 1RFGE 2FI1A 2QW8A 5EP4A 2ZWIA 2IEIA 2YFQA 3LVQE 1SURA 1W6RA 3NC4A 1XO1A 5JISA 1KBQA 2W4MA 4KPGA 1XQWA 2R1VB 3HFRA 4RUKA 1U98A 3VSDA 4R71A 1YJXA 3D6MA 4PG5A 1GNLA 4W6QA 3PU6A 5D3ZA 3VKUA 2B6HA 3T54A 3UB2A 4MAFA 2OO5C 5CCDA 5IHPA 1EXDA 2VH5R 5E7QA 1SD1A 2HSDA 3D6FA 1CUAA 1I33A 3TOVA 1JXMA 3ZKAA 2BFFB 1NG9A 1UEJA 1WDLA 2OEPA 3HBMA 4FWBA 3WNQA 1IVNA 3ML1A 4EOGA 1E5LA 3B38A 3ABIA 4DPLA 1CZRA 3N2YA 1GWNA 4JI6B 3EIUA 4PYNA 5D1HA 3WLSA 3X43A 1FNMA 1SG6A 3HUUA 3WLKX 1GPUA 2OCKA 1FFXB 2LP4Y 2EHDA 5KDDA 2VHYA 5DSTA 1KQFA 3WGZA 2YJ6A 2HJGA 2HPZA 1JKXA 3F73A 3DOOA 3VU8A 2ZSDA 3H86A 1A8QA 4QTUB 4C7JA 2VPPA 3LLMA 5EMNA 4L73A 1OTYA 2YTZA 4FIZA 1O8BA 1MLDA 2IEDA 2BYTA 1JHQA 2GTPA 2I5PO 3H5TA 5EZYA 1BC5A 2H9YA 4DGSA 1SUEA 5IASA 3OQIB 4ESVA 1LVGA 1GR1A 4BKPA 2AMJA 1Y34E 1XC7A 3YASA 2NADA 4K2AA 5DTQA 5EKDA 3DOEA 3O3MB 3P0HA 4U7PB 1A9YA 3LHKA 3TIGA 4AVYA 5JNTA 1IBMB 2Y4OA 1AIPA 2WYVA 4UVDA 4OGFA 3RVMA 4F4FA 3I5XA 4IJ5A 3HEAA 5JNSA 3ND7A 4I19A 3A0UA 3HJUA 5EUMA 3V4VB 5IZCC 1G41A 1K6IA 1RXCA 3MOIA 2HIAA 3E48A 5AJXA 2Z4RA 3ANNA 2NSLA 2G0TA 3I64A 4GS5A 4MHTA 2YXPX 2QSZA 4V0NA 4Z7NB 1OYVA 5DHRA 1D2AA 2JJQA 1JPNA 3DDNA 4LQDA 5DCYA 5T8KA 2PJRA 2KSQA 3MMXA 2NPIA 5EJ2A 4ER6A 3UWMA 1FDUA 4OY3A 1GA6A 5IKPA 3RYFB 2G70A 3H3XA 4REMA 3UW3A 1V96A 1Q11A 2GYWA 1ZGAA 2WUEA 1XN1A 1YKSA 2AT1A 3AVOA 1G6OA 2EJWA 2VBGA 4X90A 5F33A 2B4QA 3TUJC 3CLHA 2C9ZA 1VYUA 3I6QA 4H08A 1M3SA 3I1FA 3O84A 4HDRA 5DBOA 2FR1A 1I7SB 1GSAA 2NU6A 1VKHA 1OFVA 5L3SA 2FZKA 5IBRA 1FYXA 5A0FA 2ZWVA 5LM3A 1JR2A 1YA4A 3QEMA 1NDUA 2XJ4A 4G1FA 1QQBA 3AR3A 3M3HA 3RSOA 3ZBQA 2VP2A 1M34A 3AZPA 1DVRA 5DU2A 3QE4A 2IYQA 2QS9A 4I5DA 4LZOA 3GLUA 3GZNB 3MRVA 5DW3A 1IQ0A 1H2ZA 4WFKA 3W5CA 5HMMA 4C03A 3KL4A 3NTUA 3JVEA 3OUZA 1QF6A 3QBVA 2QMYA 5HWSA 1IN6A 1LBEA 2JDID 3D8NA 5TT0A 3WGVA 3G2MA 3GRKA 5JO0A 4FZ5A 1EDBA 3GT3A 3QNMA 1GAQA 1IOLA 1MENA 1PV2A 3PC3A 3X2EA 2W4IA 3MGCA 3OPXA 3UMSA 2HFKA 4ZQHA 5IDXA 4TV8B 3DKKA 5JNVA 1BX3A 4TSKA 3KQUA 3EEBA 2B61A 4EWLA 1BD4A 1U0RA 1BN6A 3LRXA 2BFOA 2Z3VA 4M3NA 4QBIA 2E2WA 4NYMR 1EPUA 5H3HA 4J1QA 5AW9A 2OHGA 4F4HA 2XX3A 2JG3A 4D6YA 1D4FA 4KXYA 1LTHR 5I4KA 2V7WA 3DVAA 3WZMA 1BVRA 3VFDA 2RG7A 2VCEA 3PC6A 2YY6A 4IQ4A 4NMWA 4IZOA 2DBYA 2W98A 2PX6A 5G4KA 2Q2QA 2F3SA 4TYNA 5DN6D 5IDWA 4OQMA 3THWB 2FW1A 1PR4A 1HKHA 1PQYA 2IOFK 4EB8A 1K1EA 1C7JA 3FGOA 2JGKA 4IDHA 3ZD7A 3QX3A 1GZ5A 2QNBA 3SDBA 3S0JA 4PHHA 1EEXB 4OJQA 3F8TA 4OU4A 4DMKA 1G4HA 1ZICA 2VTDA 2QSUA 2CFRA 4LXHA 3QVMA 4NHEA 1SUDA 3P8ZA 4Q82A 3V2GA 4URVR 2FZEA 3ETGA 5AK0A 3LT2A 4GGOA 1M9NA 5K5EA 3KOYA 1YFZA 1YFLA 3RKUA 2XPCA 4V24A 3R3SA 4IGKA 5IVIA 4D81A 1BMTA 2I67A 4NCNA 1CT9A 4O3FA 1AOXA 1CRLA 3LRTA 3UAWA 3TFOA 1TD1A 2C0PA 5J2UF 3A04A 4QGBA 3TQCA 4Q0MA 2FQXA 3X1YA 3NT5A 4RY2A 2XNHA 1EWTA 1QHIA 1SQSA 3PIIA 2ZXEA 4M1KA 5TGDA 4UJ5A 3KQLA 4Q12A 2H4FA 1Z0IA 3CRQA 2Q4OA 1OXSC 2DCUA 4B17A 1KI6A 4DQDA 1PEAA 2EP7A 3HSSA 3JYNA 3I9V1 4XYGA 4JI3B 4JT9A 1MDBA 2MTBA 3K0FA 3KYDB 2C95A 3EW7A 4E31A 2RGCA 1G6KA 4LZWA 1E9BA 5CB4A 5CEEA 4NABA 3RRNA 3ZQJA 1W4ZA 3EDMA 4TVKA 4XVQA 5JOQA 2JH9A 1NULA 4R51A 4F4UA 5IZCA 2FP3A 2DBQA 3AHCA 5FUBA 5LSAA 2FZWA 1Z38A 3GX1A 3K8YA 5BMOA 4CHGA 1U31A 4WMLA 2HK6A 1QFZA 2AK3A 3AUTA 3I30X 2QOEA 4IIJB 3I1YA 4MO2A 5A9TA 3DL4A 3EIQA 5AW4A 3FD8A 3HFJA 4JUCA 4NEHB 3U31A 1SBIA 2SECE 1BX1A 1BTOA 2WHRA 3DDUA 3HNPA 5FI3A 3T4UA 1AGPA 4S1VA 1T4BA 4L8FA 1B41A 5AW2A 3FPBA 2B37A 1GQOA 4MX8A 4PR3A 2QTMA 2WFLB 3BHMA 3DO5A 3OZ7A 4KAJA 3GLIB 1BFUA 2HI0A 2VHZA 1NDHA 1KY4A 1W59A 2QRNA 4Z0PA 1UEXC 4ZCPA 1Y3IA 2EVWX 1TYBE 4YRPA 2F3RA 2OR3A 2AG0A 2X9LA 3GJ6A 3U4HA 1P1IA 1BG6A 1U4OA 3HCNA 3K9HA 4IO0A 4J03A 4K8RB 4B6EA 4C6TB 1WR8A 4ZODA 4EO4A 1X19A 3I62A 3O73A 1BCSB 1O94A 1IVYA 1U8TA 3G7SA 3L01A 4H3KB 3HG7A 4O08A 3S2GA 4CIWA 1SXQA 2H2FA 3O3NB 1ODIA 3IRUA 4PINA 5CAEA 1SCNE 3L7MA 4X1IB 1VE1A 1G3UA 2ETXA 5HX7A 3FRHA 4XWOA 4CNBA 4PO9A 4V0ME 1P0CA 4YQEA 4RPCA 1HE1C 2Q1UA 2XGJA 1HNNA 2AB0A 3IIEA 3WQHA 3RUFA 4DV3B 1I2DA 2F9FA 3RS3A 5B6IA 1NYTA 2JIPA 5I6DA 4DCJA 2P3QA 4UAUA 2PH1A 3EGDB 4NAVA 3OE5A 4B3MB 3COZA 4ITVA 4WUTA 2XD4A 3R0ZA 3AF1A 1KAEA 2FWNA 2ZETA 1P45A 1RKBA 3E7PA 4HJXA 5A9SA 3QEAZ 3CS3A 1VJ0A 5EJAA 4ZI5A 1DC5A 2J0QA 1EVLA 2XTAA 3JQFC 1NP6A 5CT8A 4M7WA 5AICA 1AUPA 2D2XA 2EJCA 3KVRA 4JAVC 1KJYA 3FA2A 5K6AA 1BJTA 4K9PA 4AP9A 4AY5A 2HFJA 1LPOA 1JBKA 5BW4A 5IKMA 1OWPA 5EHQA 3TLBA 5BMVF 1U5CA 1ZIXA 3LP5A 4YRFA 2C77A 3SYKA 2RAVA 3VVMA 2BDTA 3WQRA 5IVHA 1C0LA 1I51A 1QFYA 2E21A 1U9ZA 2K2WA 3K09A 4KTVE 4QOHA 1J5PA 1ZNWA 2PKRA 2CSUA 3CLTD 5DNWA 3ZX5A 4BO9A 2FDRA 4AO7A 4ZYTA 4GNRA 1ZOSA 2M98A 2IH4A 4H1WA 2FQQA 2YINC 1WCIB 2O57A 2QA5A 2QZ9A 3AEZA 3KTDA 3TM4A 4REQB 3KZXA 5KWJA 1AGYA 3FW1A 5AI8A 2W2PA 1YIOA 2ZR0A 4DG9A 4ZCIA 2VJLA 1RMQA 2A14A 4AU1A 1NMSA 2B3DA 2XUDA 4Y9UA 2FHPA 1A8HA 4M60A 3WC4A 4ZK2A 3FXAA 5AVRA 2C7RA 5DMHA 2PQ0A 4KBYA 4JXJA 2R2GA 4M0DA 1QCCA 3RKRA 2GHTA 2C2HA 4L4SA 2CCKA 1X94A 3BRWA 5ALUA 1P60A 2OHFA 3HA2A 4MRPA 3UT5B 3NEYA 3I61A 3K0AA 1YUBA 2Y9PB 3J81k 2CXOA 3JQ8A 1NLUA 2C2XA 2WM2A 1SCUA 1QOQB 3IQXA 4IDGA 4L3WA 2PUAA 1QYRA 5JCJD 1XZLA 1QAOA 1WPGA 1YH3A 1XTPA 2BAGA 4QC2A 1Q7EA 1KKUA 4JYPA 2EOAA 4QXMA 4TL8A 5ALGA 2Q9BA 4A6EA 3TBHA 2H59A 3G68A 4TWAA 1I4LD 3TPCA 5DRYA 4L8WB 4P38A 3GGPA 5LLSA 4BQOA 2O3RA 5FWYB 1JHRA 4B83A 1W52X 1AZTA 1SU7A 3UYKA 4D9EA 4YX9A 5KOIA 1FRQA 4BQPA 3CUKA 2O2IA 4OUKX 4YJ3B 4E5SA 3SQMA 1YL6A 1BMDA 2GCOB 3RUAA 4LYDA 4PX9A 4DM4A 1SXIA 2H2AA 4FCWA 3RHFA 3AEYA 1QFJA 1R2QA 1E3TA 1BEUB 2JZCA 4KWEA 1B3RA 4S35A 1GUBA 2FLVA 2ZBFA 3CN7A 4P33A 4MYUA 3OCJA 4KGDA 3VJKA 4M1OA 5DWQA 3ZGNA 3OOHA 2W9XA 3S5UA 3GEEA 3GLHA 5A4JA 3CQ9A 2I3ZA 4S0XA 4HQNA 3QYPA 1E1QA 1OFUA 2A9VA 4FBMA 4IPTA 5TDHA 3K9WA 1KH3A 5BN1A 1IMOA 1TA0A 4ZPXA 4O2AA 1T9BA 4DFDA 4Q9LA 3E4CA 1KI1A 3CE6A 3GBSA 3BMQA 3OD1A 4EF6A 4P6VF 4DPKA 5A2QA 1M6WA 1A50B 4GMHA 5CGZA 5E38A 4FONA 5E7JA 5EE0A 4J0KA 2JGFA 5IP5A 3D3EA 3TCKA 1BKDR 4ZYUA 1GA4A 1CIPA 4RS3A 1T6BY 3NBQA 1PUXA 1F1BA 1SD5A 2C2GA 2P77A 1AV7A 3WIOA 4BE9A 4B9EA 3VNBA 3ONEA 1KRHA 5JU6A 4EMUA 1E0KA 1QK5A 1RPZA 1CETA 4L51A 4RPIA 1JX6A 1R9NA 1T5IA 2FZCA 3CZCA 4QDXA 2GXUA 4ZICA 3O4JA 1JIUA 1ZN8A 3DMTA 1V43A 1XVUA 4BNTA 2GEVA 4S1PA 3HYCA 3HRKA 3A05A 4GI3A 4RDHA 4EYOA 4ZV4A 2VXBA 2VUUA 1H9CA 2GMWA 4YCJA 2WK1A 4E32A 5LKRA 2IOFA 3S2SA 4NCXA 5FLXA 3PDIB 2ZT6A 4XUEA 2I1LA 3GFVA 2PFKA 2F8SA 3FMGA 4D99A 1J42A 1ZMXA 3QG1A 3TWOA 2Q2WA 3AP3A 1OFTA 4BX0A 3WB9A 2CF6A 4G4GA 3IP9A 1PQUA 3TZLA 1A7UA 1JT9A 2NZUG 1MPXA 3M6WA 3PHBE 1T0HB 3VR0A 3FYDA 3WDSA 3ICOA 4H77A 2WNSA 1DZ3A 4AB1A 1Y5NA 4F84A 5L7TA 2ZT7A 2YJGA 1LDMA 1FTQA 3LT0A 4MW1A 5ADHA 2F8MA 5TNXA 1RZ3A 7GPBA 1UPBA 3OM1A 5ALMA 4CF4A 1XB2A 3OVMA 3PDJA 5HKLA 4KX5A 1LW6E 3UCXA 2H1OA 3FZGA 4LRSB 1C0IA 3EGOA 1EK5A 1UAGA 2BSAA 2IYAA 2P3OA 3CU5A 4WUVA 1Q12A 2Y1DA 3CUWA 2QL6A 1V39A 1YD7A 3O0TA 5I8ZA 3MNFA 2RHRA 1Z5UA 4B4KA 1QCDA 2FOXA 5T6MA 4EB3A 2PNJA 1AZWA 2FWMX 2ABWA 1EJ2A 2JLSA 2KJQA 4HNRA 2I91A 4MGKR 5TVKA 2P6PA 1P29A 4UJ3A 1JGTA 2HZBA 2C42A 5FLYA 1ZJWA 2J7PA 1N78A 3CIFA 4QDZA 4RVFA 4WN3A 4IX9A 3EPLA 2RH8A 2D5IA 1V8DA 1F8YA 4TRNA 3AW8A 4GX2A 2J0SA 2CHQA 4U0JA 3KFXA 4P80A 5BV7A 4BMXA 5TRTA 4D2IA 1OC4A 3D59A 1PNOA 2P9GA 2NAPA 2WU8A 2R97A 3D4IA 5FJJA 5IM5A 1O96B 4F8JA 3UN1A 3LUHA 1IEVA 1M1YB 2ZZKA 5LUAA 4N48A 1Z5GA 5KNDA 4QEDA 5AKYA 1UJ4A 2Y67A 4C3VA 1UZNA 3N2KB 3IR5A 1YQGA 3MQFA 2XMBA 1DT5A 3BDAA 4OL0A 3VSAA 3DONA 3ZI7A 2C1EA 4QNNA 3LUFA 3K92A 3N0VA 1M2GA 1BYIA 2C7BA 3E7WA 1ILWA 3ON5A 1XXHE 3SHVA 3THYB 3E35A 3DOCA 3L0CA 2NUTA 2G9VA 4KIUA 2CUKA 4EJ2A 4JJIA 4KIFA 4LFBB 1X15A 1DADA 4DQLA 2G67A 4HADA 1C3VA 4US2R 1A2KC 1LLUA 3H5NA 3D6TB 3WFJA 4DBZA 3SF8B 4ARCA 3R0JA 4IHAA 1FSGA 1WUHS 3ZWNA 3GEMA 2ODPA 2P9BA 1XF1A 3MRSA 1KDRA 3GD7A 2RDMA 3TLEA 5C7OO 2FFHA 1VKNA 3LDGA 2FZ5A 4LDZA 1A8UA 2FW9A 3LQ2A 3OOWA 1KJ9A 4JY7A 4ZOLF 1KC1A 1C3EA 2CXXA 3EIOA 3PSAA 4DLXA 5ICGA 1KYYA 2YXNA 1Y82A 2O2HA 2ZBDA 4PYOA 1YTLA 4N5IX 3V55A 2WQZA 1KZYC 3S3TA 5JEEA 3Q9LA 1TVKB 4YA6A 1OOEA 1DCFA 10MHA 4DR1B 1ZRSA 1YS1X 4JLDA 2Q4TA 4D46A 3JYPA 4NH4A 3V1YA 4Y2YA 5ITSA 1L7MA 5LYJF 1L5RA 1EFDN 3K5IA 4L08A 3PTLA 4QDUA 1H2WA 3ZJYA 2CLHB 1RI2A 1DG1G 3EGIA 1RCTE 2LV8A 1DWOA 4CKWA 2PGLA 4EVIA 3U7QA 3PNLA 1XZJA 4X45A 4JITA 1FXWF 1DJNA 1XTUA 1LS1A 1QHFA 1WETA 3N3BC 3WGOA 1N9GB 5DLEA 5B58C 3LBYA 5SY9A 4YLYA 2WJPA 4FYKA 3U56A 1S8FA 3S1AB 3VZDA 1VPLA 2HLDD 2VNJA 3IP8A 4LJYA 4QUBA 2BGLA 1N4DA 1QZ3A 2CNOA 1YULA 4KNVA 3IEPA 3SKXA 4DKJA 1SBYA 5HJ5A 3MERA 4DJDC 2WLSA 3PUJA 2JHFA 3N74A 1DBPA 4MQBA 2VCHA 2X6QA 3PNYA 3SXUA 3WHPA 1GXSA 1TFRA 4OAQA 3DLBA 3NYWA 4E5NA 1DQPA 2WWRA 2YCLA 4AN0A 3ZVMA 4ABTA 4UBJA 4P32A 4MB6A 3G5TA 3IURA 4HQ6A 2BF4A 2P9CA 2V1XA 3BSYA 5EJ6A 3E5MA 4PZLA 4UUMA 4HYTA 3PUZA 4GBMA 4NFYA 1P7VA 4Q3DA 5DI3A 8AT1A 2HWUA 2NNWB 1LU9A 1TUGA 3W2FA 3UK2A 3UM9A 3QNUA 2ZS8A 4E70A 3MWYW 3NDIA 3QF4A 3CHYA 4CIVA 2EG9A 4PC7A 5K3CA 4MRMB 4DSAA 3FOEC 4M9SA 1YU9A 3KAJA 3KQNA 3O83A 1JJFA 4I55A 1D1QA 3LHDA 3ONWA 4IOJA 4TLBA 4TTAA 3WGYA 3FWZA 3P9IA 5TC4A 5HFNA 4RPGA 1TO2E 4KYIB 2OLEA 1FUEA 2H11A 1T5OA 1DIBA 2FWBA 3D8TA 2DR2A 3M83A 1WSAA 2X8JB 4V3CA 4EY4A 4ZYWA 5I7HA 4TYPA 1WKCA 3UK7A 3GRYA 4WCFA 1HZZA 3K94A 3BXEA 1H65A 2Y0BA 1JH8A 1J0CA 1EFKA 1N8KA 1FVFA 3IQHX 4BNZA 1JR3D 4A0QA 3A9SA 1JHOA 3SQNA 4JJEA 1NZFA 3U44B 4CL3A 1J9EA 4EW6A 2O5EA 2YJ4A 2DSNA 2FMTA 1P44A 1EFVA 4DQ0A 1LQTA 5HNKA 2PGDA 1RWWA 2NYUA 1HWYA 4KH1A 2OZLA 5B3JA 4RTJA 5AUQA 5J4YA 3UC5A 1PF7E 1NLZA 3M7IA 3N07A 3VOAA 5AVUA 4EEZA 4G0UA 1XRNA 5FQOA 2F3UA 5BQ5A 1CF2O 2LW7A 4R2XA 4R1LA 1K7XB 2FY8A 3LYUA 4FZJA 2Z95A 4RWZA 4FHZA 2YHUA 4JZYA 3B5IA 4BNNA 4LOLA 4F12A 1XDGA 1OR8A 1EM8A 1DARA 4CG3A 2Z8YA 1J0XO 4UUBA 2ZUVA 5D6NA 1YDEA 2JVKA 4XD7A 5K6TA 3UY4A 4WNYA 3JVUA 4WX2B 4IDNA 2DR0A 2RGXA 1QRRA 3K2BA 3M6AA 4MQ5A 4W82A 3U7JA 3EC7A 2GESA 1W19A 3T1HB 4ARIA 3GCDA 1X86B 3QNWA 1ISSA 2VSXA 2GHQA 4UZFA 4M1ZA 4MVJM 1XK7A 3ME5A 3GY0A 3SZLA 3JAKA 4OO3A 2P3SA 2C4UA 3WGUA 1J49A 4NC9A 5CLIA 2WKQA 2XDQB 1E1QD 4BP9A 3JY6A 3ADKA 1L8LA 1ZN9A 4XIJA 1FMLA 3ZTYA 1IZ7A 1KQ3A 2H7VA 1N6LA 3H6GA 5EHNA 2IJGX 2N47A 4CV1A 3G2OA 5AI0A 2X0DA 2OO7A 4ZO7A 2HRZA 4Z99A 2V7BA 1P74A 4F2WA 1NWHA 4X97A 5KZMB 5IJZA 1MXHA 2TRSB 4MIEA 1M72A 1SVWA 3LK7A 3MAAC 3VQTA 3DHYA 3RRZA 1GZ6A 1QJ4A 1QS0A 1DBVO 4LPKA 3DWIA 3C4JA 4LYHA 3LT1A 4BVJA 4EGQA 1CJCA 4MUBA 1GG5A 1GV1A 4EZIA 4BPBA 1DS6A 2Y68A 3KX2A 2V7PA 4IKEA 5DNAA 4DUYB 4JN6B 3HJRA 4LHYA 2Q21A 2PLRA 4YAJA 1VG8A 1LFAA 1YCGA 3T38A 2UYCA 4CTKA 1KIMA 3HWRA 1SEVA 1L9XA