4YPOA

Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
325
structure length
325
Chain Sequence
MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketol-acid reductoisomerase
publication title Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 129
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.86: Ketol-acid reductoisomerase (NADP(+)).
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4ypoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ypoA01
2IZ1A 2NVUA 1E6UA 1CETA 3FBTA 5ENDA 1P1RA 2HMSA 1MX3A 1RPNA 4DMLA 4Y67A 2BI8A 1F06A 4PIVA 3E6AA 3WTBA 4UVEA 1NX6A 3GFGA 1E1MA 1O5IA 2IZ0A 4UAGA 2R00C 3PEFA 1EVYA 1KEWA 5G0VA 5THQA 4LGVA 4KUHA 5JMPA 3AU8A 5EERA 3PRJA 3RBVA 3VZQA 2XXBA 1M75A 4OOFA 3Q2IA 2V6GA 1VL0A 3CH6A 1HE2A 2X86A 5TRTA 2ZB8A 1XU7A 3TPCA 3KYCB 4UVIA 1QRRA 1ZSVA 2XXJA 2GF2A 4QFCA 4XGKA 3K2BA 4YACA 4CQMA 4RF3A 2DM6A 7MDHA 3GPIA 1UR5A 4NH4A 1FMCA 3BMNA 4BO7A 4B3IA 3A28A 5EIOA 1OC2A 3DFUA 3QVTA 3H7AA 3RC9A 1K5HA 2AQIA 3IL2A 1JKFA 9LDTA 4XA8A 2HU2A 1XKQA 3SLGA 3GMSA 4II2A 2X9VA 3QVXA 1U2DA 1YXMA 4UEJA 2AEFA 1M67A 1UXHA 4OKIA 3EHEA 1F0YA 2O4UX 4J2OA 3CZMA 3L9WA 3MEQA 2HRBA 2QYTA 3PJEA 3Q6IA 1Z7BA 4ILKA 1RKXA 5IDWA 3BHIA 1H2HA 2ZCVA 4ROSA 5AXCA 3VPFA 3Q11A 1B7GO 5KJ6A 4ZQEA 3RKRA 3ZWNA 5JDIA 3E18A 4PN3A 1X7GA 2IODA 6ADHA 3R6DA 4OJNA 4A0SA 1NPYA 3QSGA 4L8VA 5KKAA 4CUKA 4R51A 1BWSA 5EINA 1ISMA 1YONA 3TJRA 2VUSA 3PQFA 1TI7A 3K96A 1HT0A 2BFMA 4Q3NA 1VRWA 2ZTVA 3P2YA 5JLAA 3GN1A 3SEFA 2PGDA 1V0JA 4I5FA 2AQ8A 1JVSA 5CDUA 1Z74A 4YJHA 2AE1A 3W4JA 3NV9A 3OQBA 9LDBA 4EJ0A 1C0IA 3RD5A 5THKA 4FJ0A 3AK4A 1OOEA 2CDAA 2P5UA 4IS2A 4BNLA 4XDYA 4IS3A 3DTYA 1VL8A 4F3YA 4LW8A 3WDSA 4FBGA 4EDFA 4JK3A 4B4UA 1JVBA 1PSDA 4PCVA 4DLAA 3C1AA 1LQTA 2I3AA 4IDCA 1GTMA 1W0CA 1LLUA 2BGMA 1ARZA 1XQ6A 3NUGA 2X9GA 1G6KA 2FWMX 1L7DA 3AI1A 4RVHA 3ZW9A 3CEAA 5A4DA 3NGXA 2VRBA 4A10A 5TS3A 3ZH2A 2WYUA 5BSGA 4HNHA 4QX6A 1U9JA 2VN8A 4R1TA 2YFHA 4QTZA 1LX6A 4RZIA 2UDPA 1AN9A 2E48A 3WXBA 2GZ2A 2NWQA 4MVJH 4KOAA 2WYVA 1E5LA 4N54A 3INTA 1D1SA 5A03A 1ISJA 4EJMA 3WJAA 2ZK7A 2P9EA 4TRNA 1UXGA 3GC6A 3VHRA 5JBIA 3OP4A 4FJ1A 2NU9A 3U3XA 1ZXLA 3WYCA 2B69A 3T4XA 4JBIA 4K28A 4HADA 4BNGA 2V6FA 2I6TA 1LRJA 1MG0A 3M6IA 1UJMA 4BNZA 5KIAA 3WQSB 4MP8A 3JQ6A 3KTDA 4I8XA 1K2WA 3KV3O 2OO5A 2DU8A 1LQUA 3E82A 3PIDA 4L4SA 1MC4A 5G2OA 1HDXA 4AJ4A 2FR8A 3ETGA 4NJMB 4JXKA 4PG7A 3WGHA 2VCYA 2GERA 4N5MA 1T2CA 2VWPA 4BNIA 2YHIA 2Q4BA 3RASA 2QHXA 4WEQA 2C5AA 4XDZA 1J49A 3EUWA 4X54A 2EW8A 4CMHA 2OBNA 3V5NA 5TJHA 1E6EA 1N7HA 2D5AA 2X5KO 2Y05A 4A73A 4AVYA 2Y0DA 2WDZA 4AJJA 1Q1NA 1ONPA 1ZVMA 4O5OA 1K3TA 5CAEA 2DPHA 1SNYA 3U9LA 1R4NA 3I6QA 1CERA 3KSUA 4R5HA 3A06A 1BGVA 1Y8RA 2GUGA 5A05A 3V1YA 1GZ6A 3OFSA 3JD4A 1PEDA 4RDIA 4EUHA 5FFFA 2PZJA 4XR4A 3H4VA 3OHSX 1C1XA 4WLNA 4RPKA 4LN1A 3WNQA 1A5ZA 2PD3A 1UDAA 5IG2A 3PZBA 4AL4A 1JDJA 1LRKA 4E33A 2WSBA 3B1FA 3TWOA 4ZU3A 1JLLA 1R4MB 2Y1DA 1GADO 3NJ8A 3W8EA 2BLLA 3DBRB 1H93A 3IP1A 2HMTA 1BXGA 1CYDA 4K9DA 4YPOA 1PJSA 4RF4A 3TDKA 4QO8A 1H6AA 1BRMA 1AE1A 3RUAA 3LYLA 2O3QA 5TC4A 3ONDA 1B8VA 3S1LA 1P1JA 1LDMA 1YGYA 5F5NA 1B15A 1X7HA 2EP5A 3AI3A 4MO2A 1NQ5A 4A2CA 4AJ1A 1A9YA 4Q9NA 4NK5A 1SOWA 4EGFA 2GNAA 1GCUA 4NR0A 3H3FA 1C0PA 4IGEA 1VJ1A 4GLOA 1J6UA 3RI3A 5JW6A 2HAEA 2PD4A 3QWAA 4BNHA 2P68A 3KETA 4U0KA 4WCFB 3IMFA 4RPLA 1WP4A 5A04A 5L4NA 3ZWVA 4FC7A 1LRLA 2OHXA 1Y8RB 1DPGA 3UOGA 1U2GA 2D4AA 3F5SA 1T26A 4M8SA 4BNUA 4IJKA 3GF4A 3WWZA 5KVSA 3GR6A 3L07A 4YJFB 3WSWA 4GQAA 4RPJA 4RLHA 4BVAA 2NNLD 5JCJA 1GQYA 1OC4A 3G0OA 1TEHA 2PR2A 3QRWA 1TT5B 1LXCA 1HF3A 4D3FA 3ITDA 1JKIA 1GEGA 3DXFA 3F4BA 4D0RA 4L4RA 3KRTA 1V6AA 4P22A 4D7AA 4EUFA 5FF9A 4CPDA 5ER6A 4IZIA 1BXGB 1JA9A 4FJ2A 1PR9A 4OL9A 5DOZA 3ZV6A 2OMEA 4NBVA 3ZU5A 4BGUA 1SB9A 1V3TA 1RM3A 3TZQA 2VHXA 3QHAA 4QXMA 4J7UA 4JJGA 3AJRA 5KJCA 2GLXA 3JQAB 4EYEA 4E2ZA 1RYEA 2I99A 4RQUA 3HE3A 3U4IA 4HP8A 4UVHA 5I7EA 1CF2O 3MJVA 4CJXA 5ITVA 3TL3A 1Y5MA 1W4ZA 2AG8A 3OA0A 1P44A 5DBIA 4GAEA 2OL4A 2QRKA 3EVNA 1LSSA 4S3MA 3S55A 1V35A 3RIHA 2QX7A 3QVOA 1ENYA 4M87A 1N2SA 4P4NA 4W99A 3RUCA 5BSFA 3MJCA 2I65A 3WICA 4IDFA 4DYVA 3PXXA 1FDUA 4BGVA 2YZ7A 1KERA 3VDRA 2Y68A 2ZTLA 4LMRA 1M2WA 3GQVA 1RM5A 2C82A 1DC5A 3OEWA 5AYVA 4W82A 2QQ5A 2V65A 4LRSB 5A5EA 2O3JA 4W6ZA 4YR9A 5ER9A 3O03A 4UEOA 4RVDA 2NQTA 2JHFA 3ZWBA 4YRBA 1ADCA 5A1TA 1VJTA 2AG5A 2GZ1A 1EK6A 4MIEA 1O0SA 4M1QA 4RPHA 5DDIP 3S2IA 1NAHA 4Z0TA 1TT7A 4BNJA 1LA2A 1ZEMA 4YXFA 2PGJA 3OIDA 1CQJA 3E9NA 4NNJA 4WJZA 1IZ0A 3PJFA 3SJ7A 3VVBA 3M2TA 4LSMA 4B3HA 1GAEO 3ZWOA 2XF8A 2H63A 2ZB4A 3GY0A 4D43A 4DLBA 3JQBC 2D8AA 2NV6A 5CPFA 4BO5A 3I52A 1Z75A 3O4RA 1NTOA 1CIVA 3PPIA 2GCGA 2ZCUA 4N5LA 1TVEA 3NDJA 4NZ9A 4R4JA 4YAIA 4YT5A 2DBQA 1VKOA 3FHLA 1ZK3A 2AMFA 1W73A 4E5NA 1I3LA 1SC6A 1J0XO 1DEHA 2C07A 3JYLA 4CLOA 2X0IA 4QFDA 3CUKA 4J90A 2TMDA 2ZB3A 4NIMA 1P45A 1T2FA 3DHEA 5ES3A 5BSEA 5TNXA 3WG9A 2WJPA 5T64A 1JWAB 3H2ZA 4LMPA 4CMEC 2B37A 4OQZA 1MGOA 4DQVA 1LU9A 2Q1WA 3RVDA 4TKMA 4R1SA 4UUNA 3JD0A 3HNPA 2CDBA 1LDYA 1ZKMA 5DULA 4P38A 2UAGA 5AVOA 4J3FA 3NTQA 3DMTA 4BO2A 5L53A 5CEJA 4CR7A 1NR7A 4LCEA 3O38A 3PFFA 3KYDB 2E82A 2QW8A 3LT4A 2C0CA 1ZH8A 2QZ9A 3DZKA 3I9MA 3WGTA 4CQMD 1B14A 1O8CA 2YDXA 3A9WA 5IAAA 2D5CA 2GYYA 1ZSNA 4N5NA 3PDJA 2JD2A 4FFOA 4FOOA 1SPXA 3DZFA 1GZ3A 4J2HA 4O0LA 4B4OA 2DKNA 4RJTA 4DTIA 5L4SA 4E5YA 3IC5A 4QQRA 3ZNPA 2Q1SA 1R12A 1YKFA 3GNQA 4DRYA 3EDMA 3NTOA 3PP8A 1K6JA 3ITKA 1P33A 2GO1A 2Y1FA 5BNFA 1GQQA 2ZTMA 4L0QA 1VSUA 2JKVA 4R68A 4PG4A 4D0SA 5CP8A 5DBFA 5KCZA 3N74A 1LLDA 4ND3A 2X4GA 4J4HA 4IMRA 3KO8A 2VRCD 4U0JA 2W2KA 4YJDA 3LT0A 4XB2A 1ZW1A 3RROA 2P9CA 1YB5A 1DLIA 4IBOA 3OEYA 3F3SA 3WNVA 2CSUA 4CM5A 1XQ1A 2IXAA 3VPXA 4UVDA 1DJQA 5JO0A 1HE3A 5KVQA 2ZJ1A 1GZ4A 1T24A 1DB3A 1I36A 4OKNA 1IPFA 3PJDA 4NK4A 2Q50A 4E4YA 2RHRA 1GDHA 4JJFA 3ZU3A 3FWNA 3TZKA 3KM0A 4PFJA 2I3GA 3IJPA 3GAFA 3ZNNA 5BR7A 2IXBA 5T5QA 1UZNA 4GGPA 4XB1A 3JQ8A 1ZZEA 4ZA2A 2A9FA 2Y66A 1JW9B 3WMXA 1M76A 3JD2A 4CLRB 4R01A 1ULSA 1Y81A 3DZJA 3O9ZA 2C20A 3GH3A 2YV3A 3JQEA 4D42A 4AJKA 3W6ZA 4WNIA 3NRCA 3QVWA 3WGYA 1NP3A 4CUZA 5JY1A 1T25A 1Y6JA 1QYDA 3SJUA 1UUFA 1C3VA 4G81A 3P7MA 1QORA 5GY7A 1SCUA 3G1TA 4Y6SA 4RGBA 1Q0HA 3PGXA 1U7HA 4IM7A 2DFDA 3TFOA 1UH5A 3SX2A 5COQA 3U0BA 2PWZA 2C2XA 3AU9A 3D3WA 3ZGYA 3DHYA 2NADA 3TQHA 3GVXA 4OM8A 1RJWA 4TQGA 3LC1O 3K30A 3NT5A 4BL5A 3HDHA 4J0EA 1WZEA 3DC2A 1UXKA 3D1LA 1ADGA 1YBVA 2LDBA 4ALJA 3PGJA 2VTEA 4BO4A 1H0KA 2GASA 3CINA 3LLSA 4G5HA 4E2XA 1Q7GA 1TA4A 1E1KA 2PD6A 2WD7A 4DA9A 1CJCA 2TMGA 1QV7A 4L75A 1MB4A 4NMHA 5EQDA 1PGNA 1MA0A 3Q9UA 4WOKA 3UGKA 2ET6A 5TJ9A 4Y98A 3WOHA 3WB9A 4D3SA 1W8DA 2X5OA 2VT3A 1IHXA 2I66A 3RAJA 4JP3A 4AJHA 1BXZA 5JDIC 3K92A 2YW9A 1ZSYA 4MKZA 2FOIA 3EGOA 3GZNA 2Q2WA 5TIIA 5FEUA 2LDXA 1N92A 3DZBA 4CMKA 3U4DA 1A9ZA 4BGEA 4JP2A 3EMKA 4OYRA 2OGUA 1T4BA 4E6PA 1F12A 1R0LA 1I01A 4H16A 2HSDA 2HCTA 4FDAA 1VE9A 3DOJA 2X0RA 5T67A 1E77A 2J3HA 4O1MA 4CM9D 5L3ZA 1Y9EA 2O3RA 4OXNA 3WLEA 2YDYA 4AJEA 3BMQA 5C7IO 4BNFA 4JCOA 2AQKA 1YE3A 4NI5A 2Y1GA 3D4OA 4UULA 4M55A 1U5AA 3FTNA 4CR8A 5JAZA 3LT2A 4PGFA 1G0OA 4ND4A 4FCCA 1LDBA 5A9TA 3O8QB 3F9IA 4RF2A 4CV1A 3OJOA 2VNSA 4GX0A 3E1KA 5IF3A 1VJ0A 1Y1PA 3L4BA 3N58A 1QMGA 4WLEA 4J91A 2FR0A 2Z5LA 2DAPA 4DIOA 4DGSA 1HTBA 1MFZA 1EEHA 2CF6A 2VHYA 3FR7A 8LDHA 1LDEA 4ZQGA 1KVQA 2J3JA 4FFRA 2J8ZA 3ANNA 3JQAD 4WE3A 3S2FA 3HFGA 3ROKA 3VOSA 1CWUA 2V6BA 2ZJ0A 1PIWA 1ZXBA 5HWSA 1SAYA 4PG6A 4IUYA 4CL3A 1F8GA 5IXYA 1ZEJA 1DIGA 5KJEA 1YBAA 2JCYA 4DPMA 3HFSA 2DBVO 2W4QA 4P8RA 4Y9DA 5GMOA 1JWBB 2FZWA 4EZBA 3NYWA 3KYCA 2RH8A 4YJGB 3JSAA 4DXHA 2CZCA 4IDBA 3DR3A 1HDYA 4JJIA 1HDRA 1FDWA 1HE4A 2X0JA 3HUDA 5B12A 4E32A 4G65A 5TGDA 4QECA 1ZK4A 3WBFA 4IZHA 2C59A 4J0FA 3W8DA 3JTMA 3H5AA 5L7TA 2PZMA 4PG8A 2ZB7A 5AXDA 3GRKA 3PYLA 4GGOA 3ST7A 3KLPX 5CEEA 4ZVVA 3KBOA 3GEMA 3OJEA 3RJ5A 3VDQA 3GHHA 3ETDA 1HEUA 3G1UA 3HDYA 5B37A 3FN4A 4EI2A 3LF2A 4HXYA 1FDTA 4TVBA 4RL6A 1I2CA 4O6VA 1SEPA 4KWHA 1YOVB 2NU6A 5IDYA 5B4UA 4YVFA 4LK3A 3V8BA 3ICPA 3SXPA 3FWZA 3K9QO 5F5LA 4UREA 4ALNA 4E0BA 2X22A 3SC4A 3PLNA 3Q9NA 3DBVO 4NFYA 1WXDA 4GSKA 4Q3EA 1PS9A 3AY7A 3E5MA 4KMSA 3QV1A 4CQLB 1RM0A 2FP4A 1N7GA 4IGFA 3ZWWA 1LUAA 4YAJA 1NVGA 2O3TA 3L6EA 1W6UA 3VC7A 4F46A 1SOVA 3RUHA 1BDBA 2Y99A 1ZK2A 3N7UA 4RPGA 1JAXA 1PZFA 4TRJA 1ONOA 5DN9A 1HWYA 3V2GA 2CUKA 3MJSA 3DTTA 3WYEA 2DTEA 4FOSA 5AXBA 1WPQA 4LCJA 3BTSA 3DBLB 1X13A 4GBJA 4XKJA 4I5EA 3AOEA 5JC1A 5CEFA 2ZYAA 5G0WA 4DMMA 4XD2A 4CODB 3RU7A 4CMGA 3GRPA 1IHYA 1WWKA 2W2LA 3IAHA 3L0DA 2AXQA 3UCEA 1KIFA 3NKLA 4TRMA 3WR5A 3NDRA 3PVZA 3H9UA 4BIIA 4L4XA 4KZPA 4PLPA 2RIRA 1P77A 3JQFA 4NG5A 3NT4A 4FIZA 3EAGA 4FGWA 4BOYA 5I8ZA 3G79A 4CMCA 1YBMA 2VRCA 3QVSA 1E7WA 2V6MA 5L4LA 3RUIA 3UHAA 3ZV5A 3SC6A 4CR6A 3KYBA 1WAMA 3I9NA 3RKUA 3U49A 3KVOA 1O95A 3RFXA 1NASA 2FSSA 2PH5A 5KKCA 1NAIA 4XJSA 3ZNOA 3GGPA 2O2YA 3G3EA 2J3KA 1Y7TA 4KDFA 3L6OO 3CXRA 4HV4A 3STHA 1GCOA 4BO1A 3VPSA 4MVJE 4MVJD 1XDWA 3D5TA 4NBTA 4G2NA 1S7CA 4YTEA 3U5TA 3IJRA 4NJMA 1YH3A 3MTGA 3K2EA 4J1TA 3TZ6A 1EMDA 3C7DB 4OOEA 3ZHZA 2H9IA 5FWNA 3PK0A 3TN7A 3QWBA 3LU1A 4GX5A 4CV2A 1T4DA 2EWMA 3UAGA 1QYVA 3DAFA 2E49A 2H1SA 3AI2A 3F4LA 4D79A 1P0CA 3TL2A 3PYMA 4AJ2A 5GZ1A 4ZD6A 3JV7A 5MGBA 3ICCA 4BKQA 3VPGA 5FYDA 5DF1A 3H9JA 4E2WA 4DL9A 2VHZA 4MPDA 3WFJA 2ZYGA 4C7JA 2FN7A 2BI7A 4K26A 5FI5A 3JQ9A 3NEPX 3PIIA 4NBRA 3ZHYA 1HDZA 2I9PA 4XEHA 1R4MA 5EPOA 3DBRA 4E31A 3TNLA 2RAFA 4XRGA 3BIOA 1RM4A 1PQPA 1X15A 2Y1OA 3M1AA 4XGIA 5I9MA 3B1KA 3PTZA 4ZN6A 4Q39A 3UFXA 3K6JA 2X8LA 3BTVA 3FNGA 2O23A 1MC5A 4HX5A 3EY4A 3D5QA 3IQDB 5U1PA 1C0LA 1LBEA 5T57A 1UZLA 2ZQYA 4RZHA 3WWYA 1I8TA 1NR1A 1ZBQA 3RFVA 5JC8A 3VVCA 3FNFA 5IZ4A 1AUPA 1ZK0A 4XIJA 3UW3A 4BGIA 2BD0A 4MVJF 3I3OA 3MZ0A 3ON5A 1LSOA 1NFQA 3GEDA 3L77A 3NX4A 4WCFA 4WKGA 3HWRA 4CM9A 3FBGA 5B1YA 5CPBA 3WGQA 2OFPA 3B70A 3JD3A 1WDKA 5JMWA 2B4QA 4HFNA 1L7EA 4LVCA 4BKUA 4YJFA 4BO8A 5IFLA 1MV8A 1LSUA 2V7PA 4J1NA 2IDZA 5K9ZA 5I9LA 3OBBA 1C1DA 3ZN2A 1EVIA 1P3DA 4KWIA 4OAQA 4WUVA 1TT5A 4BNNA 1I2ZA 1KBZA 3AM4A 4CMIB 1I3KA 3AFMA 1JAYA 1DRVA 2X9NA 2X58A 4XYMA 8ADHA 5T8KA 4YAEA 3RUFA 1E7RA 2JFHA 1IYZA 3E48A 5IN5A 5KJ1A 1R0KA 4XGNA 3TSCA 2VYVA 5ILOA 1LC3A 3OECA 2QRLA 4GX1A 4RVUA 3WQQA 1HDOA 3ZDFA 4BV8A 1ORRA 2G17A 3ETEA 4WLFA 1G0NA 1QKIA 5IDQA 3JQAA 4IJUA 1CQIA 5JXWA 1I2BA 4C4OA 5B4VA 1DHRA 4DPKA 4DQUA 4I1IA 5A5FA 1NFFA 3ASUA 5JE8A 4EEZA 3GFBA 3EW7A 2NTNA 1BSVA 3PI7A 5CHEA 3ADOA 1EFKA 3BMOB 4YWJA 4J7CA 1DOHA 4O59O 3VAZA 5BT9A 3MOIA 2OOSA 3GAZA 4PRLA 3NTRA 2HMVA 4WEOA 3KHUA 3INGA 3W4KA 5ICMA 2G5CA 3MWDB 3ZWYA 3DMYA 5KJFA 4FN4A 4CMBA 2RH4A 1U4SA 4BKPA 1ENOA 1C1DB 1GUFA 1PJBA 3PHGA 5JO9A 1FF9A 4HFRA 1NBOA 3IOYA 4A27A 3EZYA 1PS8A 2J3IA 1KVRA 5JSFA 4NFHA 2WE8A 2IYOA 3FSRA 3UKOA 2FPPA 3K5PA 1DJNA 4IIVA 4J6FA 4BNYA 1FK8A 2HO5A 4ITUA 2RCYA 1YDEA 3ONEA 2Y67A 4MVJM 2GD1O 2IZZA 3I6IA 3K73O 4IQ0A 4XZ3A 4C7KA 1E92A 1QLHA 2G76A 2BFAA 3F1LA 1PWXA 4FS3A 3Q1LA 1EFLA 2Y0EA 2JHGA 1GV0A 1PJQA 1P31A 4MKXA 2FY8A 3W6UA 1ISIA 2NM0A 1WLYA 4TWRA 3FI9A 1VPDA 2NU7A 1PJ3A 3QWFA 3E9QA 1HETA 3NAQA 6LDHA 3VH1A 3VTFA 3TRIA 1VKNA 1QYCA 2R2GA 4EJ6A 1V3VA 4BNMA 5K6AA 1MP0A 2AEMA 5G4KB 2PZLA 4RF5A 4ND2A 4GWKA 1GV1A 2H6EA 4BMVA 1HLDA 2H5LA 2EXXA 2JCVA 4FGSA 3HB5X 2VTDA 2A35A 2DLDA 4ND1A 3D64A 4E2YA 2BFOA 1OBFO 1UAGA 2CMDA 4WGGA 1QLJA 2Q2VA 3I4FA 1ZK1A 4J43A 5EJ2A 3MCVA 1HYEA 4WPGA 2PKQP 3SBOA 5HTOA 3S2EA 4U5QA 1KOLA 4JNKA 5DP2A 3V1TC 1PL7A 2B0JA 3KYDA 1H6BA 2VWQA 3GPDG 5T6BA 1NPDA 3LZ6A 3KXDA 1U1IA 3WFIA 2HJRA 5AQ1A 2E37A 3JQCA 3EYWA 4HUJA 4XYBA 4I9NA 1SB8A 1U5CA 5H82A 1B16A 3R1IA 5JS6A 4MVJG 4XJTA 1EE9A 3V1UA 1UXIA 1V9LA 1PQWA 3GVHA 4CV3A 4YB8A 2P91A 2HMUA 2JJYA 3IIEA 1E0DA 1FDVA 3INRA 4ID9A 1U8FO 3DDNA 4Y8VA 1PTJA 2DUUA 3QLJA 1ZFNA 4BO0A 5G0TA 3OJ0A 1MXFA 5TT0A 1F17A 4GVXA 1Z73A 4D45A 2PV7A 1HXHA 3PYXA 4BNTA 5KOIA 1YL7A 2WYWA 3GDOA 4N18A 4Z9FA 1R16A 2RHCA 3LK7A 4BQRA 4OGWA 4B7UA 4MVJA 3PZRA 4YRAA 4GI2A 2BH9A 3OQ1A 4II3A 1EUZA 4UUOA 2P2SA 4OMUA 4YQZA 3QP9A 1XG5A 3QWIA 3RBXA 1R15A 4FPXA 3ULKA 3L4BC 4DC0A 2ILTA 1RYDA 3V2UA 2O2SA 2PH3A 4AJIA 4MIOA 3VZPA 3PHJA 1EDOA 4TKLA 5GZ3A 3RQSA 1BW9A 1JTVA 2P9GA 5A3VA 3GGGA 1XGKA 2B4RO 3A1NA 1G1AA 1KVSA 4PVCA 4R1NA 2EKQA 2QG4A 3DHNA 5L51A 2G0TA 4CLRA 5HBRA 5CDTA 3CTMA 4OH1A 1QYXA 3G17A 1R6DA 1P74A 1Y8QB 2HRZA 3VH2A 1KEPA 1FDSA 3NGLA 2W2LD 3ZW8A 2RBEA 3RUDA 1GFSA 2EJVA 1Z7EA 2I5PO 5L45A 2Y93A 3LF1A 1M66A 3W4IA 1E3SA 2VHWA 4M86A 1B26A 3EZLA 4XYLA 1E7QA 3S8MA 4OXYA 3HQ4O 5TF4A 3JQDA 3K8ZA 4XRRA 1IB6A 3W1VA 2Q1TA 3QIVA 1A72A 4D41A 3HB4X 1YWGO 3ADPA 4HWKA 1HL3A 1D3AA 2YY7A 1ZUD1 3ROPA 4AJPA 1LDNA 3BYZA 4GMGA 1PJ4A 1LSJA 1BW9B 3G49A 3GNTA 1IOLA 4J4BA 1NXQA 1WNTA 4CM4B 3ANMA 4MVJI 1IUKA 1XSEA 4JGBA 1DIHA 4PZDA 3H8VA 4PLHA 3GMDA 3GT0A 1L1FA 1H94A 4KTTE 5EL0A 1T2DA 2WTBA 3OICA 1EVZA 1UDCA 1T2EA 4HBGA 3ZNQA 4I5DA 1LEHA 2NUAA 1D7OA 3HG7A 4FC6A 5A9SB 4W7HA 1XELA 1LLCA 2FPIA 3NDIA 4Z9XA 3WS7A 3VZSA 1YS4A 1ZO8A 1NWCA 1KC1A 3W8FA 1X0VA 1HZJA 1WMAA 1VL6A 2BHLA 1BG6A 1PJCA 3OMLA 4IDAA 1E1LA 3V2HA 3ANLA 4E12A 2E4AA 3AW9A 3O26A 1YL6A 3AOEC 4KUGA 1QG6A 4TROA 2VQ3A 1NFRA 2DTDA 2F00A 3O8QA 2G1UA 4MJLA 4A03A 4DIFA 2I76A 3AUAA 1LNQA 1X1EA 4QUKA 3CZRA 1PL6A 4BNWA 2PTGA 4XWYA 1ISHA 3JQFC 2BF7A 1C14A 3VH4A 2BGKA 5C3MA 4WASA 5H81A 2EIHA 1CRWG 5JYDA 4XX0A 4I08A 3DO5A 3I1JA 4J4TA 1MUUA 1K89A 3P2OA 5CDGA 2WD8A 1A4IA 3B6ZA 3QWHA 2W90A 4PLVA 1XCBA 1DLJA 5H83A 4GL4A 3TFQA 3IUPA 4CLXA 3GZ4A 4ZQBA 2VHVA 1JN0A 1H9BA 1EBFA 2B5VA 3L9XA 4J9UE 2CD9A 3D3EA 4INAA 4BHTA 1H9AA 2EEZA 4YJGA 2JD1A 5HRUA 2O48X 4XYEA 3HN7A 4IJWA 3S2GA 3JQBA 1A71A 2YHUA 1EZ4A 5F3RA 1HRDA 4B4VA 1ZIDA 1E7MA 2DVMA 1LDGA 1XEAA 2BRUA 4GWGA 4ZGWA 3I5MA 2IYPA 2FPGA 1ENZA 5IZCA 1NHWA 1U3WA 2JFFA 5C7LO 3HDQA 1PZGA 4IMPA 1A7AA 1I32A 3KEQA 1PGOA 2UYYA 1XHLA 5COAA 5J23A 2DT5A 2VYVD 1IL0A 1E3JA 3PQDA 4E21A 1DIBA 2J5QA 3AY6A 2WM3A 4BV9A 1X0XA 3C85A 3BMCB 3BTUA 4DLLA 1E3WB 1OI7A 3VKUA 1YOVA 4KTVE 1I33A 4OHUA 2Z1NA 3RC2A 1NNUA 4Z6KA 3P19A 2AEJA 3JQ9C 3IDSA 1Y9AA 1NQOA 3KZVA 1U3TA 3WX0A 3WGIA 2A92A 3PJGA 4I9UA 2B35A 2GZ3A 4B8ZA 4CQLA 2BGLA 1H5QA 1B3RA 1KY4A 4BUCA 5I9NA 4CM3A 1EUDA 3AUSA 4OIMA 3WYBA 5L40A 3HJAA 3JYQA 3HZZA 4R3WA 3X2FA 2O7QA 4IDGA 1U3UA 2GN9A 1Z6ZA 3A14A 4RVGA 2FR1A 2Y1EA 3Q3CA 3FRJA 3GDFA 4XQ9A 3LSYA 2FMUA 3JQGA 3DBLA 3KEOA 1QP8A 4RDHA 1LI4A 1UP6A 2NTJA 1EK5A 2FSVA 4PLFA 4ZQFA 4MP3A 2CVQA 1N5DA 4IDEA 5A06A 1YB4A 1YQXA 3M1LA 2GN6A 4MP6A 4WCFC 5DOVA 2D59A 4OO3A 4HNGA 4BNVA 4ESOA 3OSUA 2PK3A 1X7DA 4XCVA 1DC3A 5LDHA 2NLOA 4M89A 2W8ZA 1YRLA 2B5WA 4MIYA 5JPIA 2SCUA 1U3VA 1N1GA 3JYNA 3ZU4A 1JKJA 1YB1A 1NVMB 3JQ7B 4HY3A 4URFA 4LISA 5CG1A 5CG2A 1DC4A 4YAKA 4F6CA 4ZRMA 3RU9A 2GN8A 5T8KC 3GVCA 2UUOA 3DEYX 2Z95A 3FTPA 1WW8A 5KVCA 1ZMTA 3DBHB 3ZI0A 2Q2QA 3VPHA 3ASVA 4GKBA 1YQDA 4CV0A 2CFCA 3ZWAA 4OSPA 3OIFA 3DQPA 3PLRA 1NQTA 4M54A 2GRAA 2JAPA 4Z0PA 3TOZA 3JQGB 5HS4A 3R3JA 1B2LA 2Q46A 4DWVA 4PRKA 1Z82A 1HZZA 1E3EA 3LVFO 4QT0A 3WLFA 4YT2A 1E5QA 2EW2A 1PGJA 2DTXA 4RO0A 1GR0A 1J5PA 4RLSA 4BS9A 4DBVO 5BQFA 1N9GA 3QW2A 1WZIA 3PWKA 4NU6A 5ENVA 4AJOA 1A4UA 1QR6A 4EITA 5ICSA 5CFZA 4XQGA 4NBUA 3D4NA 1ZNQO 3ENNA 4JROA 3GUYA 1PWZA 3GVPA 3PQEA 4K1LA 4FB5A 5JDCA 1X14A 4EW6A 5G0UA 2NVWA 2Q45A 4D44A 2NVUB 2HK9A 4YQYA 5TQVA 2I67A 1EVJA 2JD0A 5I8WA 4IIUA 3U62A 4ALIA 5BNTA 1ML3A 1PZHA 3L4SO 1GUZA 1HE5A 4H7PA 2X6TA 2EP7A 3BXXA 4W9NA 2P5YA 2J6IA 3C24A 1DSSG 3Q0EA 3C8MA 4PLGA 3F47A 4JN6B 5G4LA 2CDCA 3IP3A 1M6WA 3DFZA 3GG2A 1ZCJA 2C29D 2CF5A 3C1TA 4LRTB 4TRRA 4JLWA 1O6ZA 4RCVA 2ZTUA 3MJEA 1TXGA 2W98A 4CQMB 5K6AC 2QRJA 1N9GB 4GH5A 3CIFA 3TOXA 1LLQA 5KWEA 1JU9A 3BMNB 5EN4A 4KUEA 3UUWA 4H15A 1MLDA 3DOOA 1ISFA 4XR9A 1HYGA 1N8KA 2AE2A 5EESA 4JX8A 2NACA 5BNIA 2D1YA 3AY3A 3BAZA 5DCUA 3C1OA 3DONA 1BTOA 2Q1UA 4Z3DA 5F1OA 3AM3A 2AQHA 2IEBA 4GKVA 4HFMA 5MDHA 3QJ5A 3FD8A 4UVGA 4CMIA 3F1KA 3FNEA 1ENPA 4TMFA 1GU7A 3ROMA 1H6DA 1AXEA 1F8FA 3H2SA 3PHHA 5LCXA 5TX7A 4YT8A 2PZKA 3AUTA 4IY1A 1AHIA 1ID1A 1N1EA 3R3SA 1P1HA 1PZEA 1R0SA 1Q7BA 3H5NA 3UCFA 4E30A 5U9CA 1E7SA 4YYZA 4BMNA 4L9RA 4R5MA 1YDWA 5I7SA 4QEDA 1Q0LA 2HJSA 1HKUA 1U8XX 3I9JA 1Q7CA 1PQUA 4FFPA 1VM6A 2HDHA 1LC0A 4CL8A 3NJ4A 4B7CA 3BMOA 4YJHB 5LC1A 4CM8A 2O3SA 4HFJA 2XAAA 1H2BA 1ZJYA 2EKLA 5HS6A 1TLTA 1GUYA 1XLTA 5A9RA 1QV6A 1Z45A 2DC1A 4NBWA 4NFSA 5KVVA 4YAGA 1IULA 3M2PA 3OQ6A 4J7XA 1BVUA 4WOJA 2ZIZA 4Y6PA 3I83A 5IJZA 3DMTC 1T1SA 2VNAA 5LDGA 4NDNE 5EQFA 4Q3AA 1BMDA 1O89A 3H5RA 1E3IA 5F21A 2ZATA 3RC7A 3WMWA 4P4GA 1H6CA 4JBGA 3QY9A 5G0SA 3UVEA 1I0ZA 4WLOA 2QIOA 2NU8A 1T2AA 4A26A 3I4CA 5U4QA 1VLLA 1KVTA 1ONNA 1O9BA 1IY8A 3RWBA 1B8UA 3JYOA 2Q99A 1UP7A 1PGPA 1YQGA 1D8AA 3UCXA 2R00A 1WVGA 3COSA 1D1TA 1GD1O 2JL1A 2OXIA 3HADA 2X1HA 4ZRNA 4BO3A 4YT4A 3I9KA 4FD3A 4DYDA 3GVIA 4PLTA 5ADHA 4Q3BA 4DBZA 2DUWA 4NQZA 4UUPA 1EQUA 2VYNA 1SO8A 3MJ4A 1O94A 3FPCA 3ZWXA 4BMSA 4CM8B 3IKVA 4DVJA 2FHSA 2YFQA 5C37A 2EV9A 1SBYA 1BXKA 4IPTA 4WCDA 1DIAA 2CY0A 2YV1A 3KUXA 5BSHA 5JY6A 2AHRA 5G4KA 2YHIB 3T7CA 2CNBA 2X5JO 2YUTA 2GSDA 1AHHA 1OZAA 1U28A 1GYRA 3RCBA 2OP1A 3DZGA 3PHIA 4PLCA 1DRWA 1GY8A 2OUIA 3E8XA 1PX0A 2X7HA 4L74A 1ISGA 4QSMA 1UAYA 2PNFA 4RQTA 4DC1A 1NHGA 2Y0CA 1R4NB 3UXYA 3X2EA 1FJHA 3GA0A 4LVUA 3AWDA 1GEEA 4E3ZA 1Q2XA 1PJ2A 2EGGA 5TT1A 4OSOA 3I9LA 1C1XB 3IUSA 1GL3A 3OH8A 1I3NA 2POQX 1KYQA 1MFPA 2P4QA 2WE7A 4WNCA 3VZRA 4BNKA 2PY6A 3GUCA 2F1KA 2B4TO 3BHMA 2DBRA 5CDSA 4XQCA 4CMAA 1PL8A 4D3DA 1I10A 1ZMOA 4NJOA 3GG9A 3OJFA 3E9MA 2HKIA 1HDCA 2WEKA 3H3JA 5I7VA 3ZHBA 4CM7A 4BQPA 1SEVA 3LT1A 3C3XA 3GK3A 3KSZO 4AJNA 4R9RA 2GDZA 3WTCA 1GPDG 1R37A 3WGZA 3L6DA 4H3VA 4TZTA 2A94A 3BZUA 2X23A 4IQ8A 4FSHA 4MDHA 3RJ9A 4PZCA 4DQXA 4AG3A 1CDOA 4YBZA 5IN4A 5DCWA 4RV9A 5L7YA 4U8GA 1LTHR 1P1IA 5C7OO 2ZYDA 3ONFA 1UP4A 3HN2A 3RC1A 1KVUA 2OZPA 2J5RA 1UXJA 2WWRA 2PGLA 4P4LA 4GMFA 1MXHA 2O4CA 2UV8A 3E5RA 3I23A 2HMWA 3AFNA 4CLEA 2Q3EA 1NPTO 4YCAA 3U4CA 1DAOA 2R6JA 2GR9A 1IZ9A 2VOEA 2HUNA 1MG5A 4R1UA 2J5KA 3C7AA 4Z9YA 4K6FA 3DWFA 2XOXA 4EUEA 4J16A 2B83A 3R0IA 1DDOA 1AXGA 1XWFA 1E7YA 1WMBA 2GN4A 4RVFA 4DPLA 1LJ8A 2IRWA 5F1PA 5ITWA 4B4WA 1HSOA 5GZ6A 1T1RA 1Y8QA 1DIRA 3GNSA 1DHTA 3PWZA 1PS0A 3OJLA 3U4HA 1KEVA 1NYTA 1DRUA 1GPJA 3WQRA 3ZHXA 4M49A 2X0NA 4HKTA 1IPEA 4A7PA 3MOGA 1XYGA 2A4KA 2CVZA 4R54A 1EDZA 1XIVA 4CMJA 2C2YA 4CUJA 5L95A 1NVTA 1I5RA 2D0IA 1ZJZA 4JQCA 3PHLA 2XPCA 4JIGA 4R16A 3ENKA 3GN2A 1HSZA 3EK2A 2B36A 5B4TA 1C0KA 3JCZA 2PLAA 1F14A 4XIYA 1YJ8A 5IZCC 4YEDA 5I7FA 3F5QA 1KY5A 3CSDA 4IJVA 1HLPA 2GGSA 3H9GA 5CDYA 4AFNA 3Q2KA 4CLDA 1PJTA 2O3UA 1DC6A 1PJLA 3OA2A 3BTOA 2EF1A 1EQ2A 4JBHA 3ZCXA 4ALKA 4BKRA 3MWEB 2DPGA 3H9EO 2Q4EA 2NTVA 4YDRA 4F45A 2NSDA 3TZHA 2BMAA 3QQPA 1B8PA 2O7SA 1KEUA 4ZICA 4CM4A 3UICA 4AICA 3FR8A 4MINA 5DZSA 1DAPA 2VWHA 1UDBA 3AUUA 4N7RA 4PG5A 3OIGA 1U4OA 3JD1A 2AW5A 3JYPA 4PVDA 3DAGA 3AM5A 3HHPA 4PZEA 4LSWA 4I9HA 4IXWA 1VC2A 4E5PA 4J1SA 3UN1A 3OM9A 3PWSA 3DB2A 5A9SA 2C54A 2UUPA 3VTZA 1I3MA 2BKAA 3RSHA 1UZMA 5A02A 5JAIA 1DO8A 4WECA 4FW8A 4WK6A 2JAHA 2YYYA 4RVSA 2P4HX 4AJLA 1NQAO 4BB6A 2VZ8A 4KQWA 4DREA 1A27A 1P1FA 3ZV3A 2G82A 4B8WA 4OXKA 4CLOB 5C5IA 4EEXA 1ULUA 3CMCO 1GYPA 2IE0A 4FFLA 4E13A 4F6LA 4ZHSA 2EG9A 3KLMX 1A7KA 4ALMA 1NWHA 2BELA 2Q49A 4NPCA 1DBVO 2HK7A 4ZJUA 3BHJA 2OBYA 5ILGA 3QE3A 1JQBA 4YRDA 5K0ZA 4S1VA 4A5OA 4MKRA 1DFGA 4FFNA 4J49A 2HQ1A 2VOJA 4IXTA 2QYSA 1XA0A 1HDGO 5KTKA 1GQ2A 3LDHA 2DQ4A 3LLVA 1U7TA 3A4VA 3WGOA 1NM5A 1BDMA 3WBBA 3FCOA 3MJTA 1KC3A 3ROQA 2DFVA 2YV2A 1KS9A 4ONEA 3ZU2A 3TF5A 2YJZA 3GEGA 3D0OA 4PLYA 1AGNA 2OP0A 4TZKA 4TVOA 5DNAA 4TSKA 2VUTA 1I30A 1K6IA 2GPTA 3FF4A 1Q0QA 4Q3CA 5JAQA 3RFTA 2QZZA 1SMKA 2AA3A 3CE6A 4FR5A 3FNHA 1PU2A 1V3UA 3WSVA 3EC7A 1K6XA 4OQYA 1P1KA 2O50A 1B3BA 1KETA 2FRDA 4NU5A 1QYWA 3ZWCA 3CKYA 3H65A 4L76A 1OFGA 1YL5A 3GHYA 1WDLA 2PA3A 3LQFA 3UF0A 3C7CB 2JCXA 1TB4A 1XU9A 2CVOA 4IQGA 5FI3A 1BHSA 4B7XA 4BO6A 2W2KB 4MVJP 3GLQA 4E5KA 4QO7A 1YJQA 1XR3A 4J9VA 1M6HA 2EGHA 3WIEA 2VT2A 4WLUA 3GOHA 3FPLA 2UVDA 2VZ9A 4W4TA 1YVEI 2Y1CA 3BMCA 2Z1MA 3DOCA 4U7WA 4U6QA 4IINA 5JDCC 3T7EA 1E3WA 3DZHA 3LC2O 3K31A 3EVTA 1QXSA 4GPD1 2BFPA 4CM6A 4CM1A 1FXSA 1YO6A 3H6KA 4GSLA 1PR3A 4GX2A 2WMDA 1I24A 1K0UA 3VH3A 7ADHA 1ADBA 3JQ8B 3P5SA 3DAPA 1E6WA 2HLPA 3B1JA 3ZV4A 4U6SA 2C5EA 1CEQA 4W9NC 4IDDA 2D2IA 4R41A 1E3LA 3DZIA 5DBGA 2YQ5A 3ZWPA 2OORA 3MTJA 4YA6A 3SVTA 3WIDA 4W7IA 5KNLA 2EERA 1IE3A 3HSKA 4FFMA 1VI2A 5COBA 5JAMA 3KB6A 4KP7A 5IXSA 3WJ7A 3NT2A 5TLSA 4BKOA 5JCXA 3D3WB 3OF2A 2PKRA 2PKQO 1EUCA 3ZWMA 1P0FA 3BA1A 1X1TA 3RBZA 3D4PA 4Z3KA 2VUUA 1DFHA 5HA5A 4FQ8A 1DXYA 4CMEA 4EBFA 4Q3DA 1HYHA 3IS3A 5L7WA 3ORFA 5L9AA 5IDXA 1D4FA 3U09A 2WD7B 1OAAA 5AXAA 5A3JA 1S6YA 5JFOA 5TSDA 2IEDA 3F6YA 4ND5A 4KDEA 4PLZA 2VYND 1EE2A 2C7GA 3JQ7A 5HM8A 4WLVA 4CLHA 1BVRA 2E6UX 2ZKLA 4R69A 1P9LA 5F1KA 2EHDA 3QA9A 4XQEA 3VKVA 5DCYA 3F46A 3ZZNA 3OETA 3PDUA 1PGQA 4R9SA 4Z0HO 4UUMA 4L73A 2YQ4A 3GGOA 1VSVA 4PLWA 1R66A 3E03A 4O63O 3HDJA 4XYGA 3GZNB 2D3TA 3DBHA 5EMHA 4DIBA 3DL2A 2HK8A 1V8BA 3GDGA 4I5GA 4Y6RA 4B3JA 5JNLA 2FZEA 2VZ0A 4NHEA 5DP1A 5JYEA 3KSDO 2VWGA 3CMMA 4UEKA 1QSGA 2EJWA 1J4AA 3AOGA 3TZCA 1ADFA 3WGGA 3ABIA 3CPSA 1SZJG 2DBZA 1RWBA 4KQXA 4RORA 1WDMA 3UH1A 1GYQA 3BMQB 1DFIA 4B79A 3LC7O 4ALLA 2EKPA 4DUPA 2NVBA 4BNXA 4R3NA 3D7LA 5AOVA 4E5MA 4ZQHA 2PFGA 2JFGA 3IKTA 1B0AA 2ZQZA 3PFWO 4BO9A 5JCJD 2NQ8A 3T4EA 5DT9A 2C7VA 3B20A 4K6CA 3KOUA 1E1NA 1OMOA 4J1QA 3H9QA 4BB5A 4D46A 4GLLA 4GVLA 3RUEA 3SLKA 4MOWA 3I9OA 1EBUA 1Y5RA
chains in the Genus database with same CATH superfamily
4P92A 3FBTA 2B61A 2AR9A 5A6VA 1YJXA 1KI9A 1NG1A 3L7KA 2HMSA 3E3NA 2NX2A 1RPNA 2P2YA 3IV7A 3CF6R 1QLWA 3QH4A 2AG6A 3OTGA 4MROA 2RGGA 4UVEA 1X8LA 5FQNA 1ST3A 2JVKA 4E1AA 3SY8A 1CR4A 3IHKA 4I3FA 4QULA 2IQ5A 1IMOA 4MQFA 5AK0A 5ECDA 3SBEA 1EVYA 4N0QA 4Y7CA 1EAMA 2RBGA 3NC4A 1BWQA 3T54A 5KNBH 4OHWA 5EERA 1I1HA 1ZMRA 5DW3A 1PK7A 3RBVA 1ZR4A 5T3UA 4OLBA 1M75A 3IFSA 4AMVA 2V6GA 1VL0A 1TJNA 1Z0ZA 4GECA 3EUEA 2AUTA 5AM5A 5FA5A 1SWVA 4LXHA 1R8JA 4OQMA 1QZUA 5E1DA 5TRTA 4CKBB 2IUTA 3KEGA 5LU8A 1H22A 2GKSA 4GSYA 1Z88A 3JVVA 2GCIA 4PXAA 1ZSVA 3R74A 2XXJA 3UHPA 4DNFA 5JZVA 1ZN7A 5IS2A 5KYVA 2ECQA 2IYYA 3EXG1 3AEUB 2R8RA 4JJEA 4QFBA 5IJWA 7GPBA 2JIOA 3ABOB 4PANA 4RF3A 1CZRA 3C98A 1B0UA 2HDWA 2W7TA 1UR5A 1QX3A 3HXPA 3H4TA 5BQPA 2L2QA 2J0QA 3R2JA 4KN6A 4HATA 3UAOA 1S2GA 3JZDA 4IDNA 3BB1A 4AKSA 4HEJA 1ATZA 2CW5A 2EFYA 2YQZA 4QQNA 1G3UA 3QVTA 4KO8A 1JT2A 3AF2A 3IAUA 4TUYF 1TZCA 1K5HA 2AQIA 1HLGA 1XE3A 1JKFA 4ZCLA 3HVRA 3ZLJA 2XMBA 3ICEA 3LFTA 1GNLA 1KAQA 1SXIA 1YU6A 2JLZA 1S2MA 2H2FA 4BVKA 4QIHA 1RIIA 4UEJA 2YWCA 1MDBA 4WSOA 1EVKA 2WNIA 1M67A 4UAJA 1UXHA 1C2YA 2EP8A 2H52A 4OKIA 3ROZA 4AU1A 721PA 2RARA 2B1IA 3CZMA 3L9WA 3MEQA 2HRBA 3U3RA 4ILKA 4M38A 1ETHA 3EXHB 1H2HA 3VPFA 2NU6B 5AXCA 4PZLA 3C7KA 2O2JA 4BGDA 4KQEA 2BEJA 3H1EA 4MDYA 4KXFB 1Y48E 2QD1A 3RKRA 1H1LA 1GTJ1 4QGHA 5JDIA 5AKJA 1TU4A 1WUJS 2G9UA 1QC5B 2QN2A 4GBED 4Q7MB 3L0SA 2J3EA 1UJBA 5CJ2A 6ADHA 3IAEA 3QSGA 3DVLA 1MV5A 4H08A 3DDZX 1KU0A 3P71T 3VAYA 4F4IA 1I4LD 3I2YX 3TJRA 1WPXA 4P54A 3PQFA 3EEYA 4N39A 4QQFA 4ZZ3A 3HXLA 4QXOA 4OQQA 4Q3NA 3SKYA 1PO7A 1FNDA 1M33A 1OKKD 4ZDWA 2NSHA 4TPKA 3GN1A 3EXIB 3CO0S 4QOSA 1A82A 3IAM6 3UHOA 2LV8A 1TMYA 2JAQA 3CG0A 1JVSA 2DQSA 1L4KA 1NMEA 1QWSA 4H6XA 4JEUA 1EK2A 3SYTA 3U56A 1W1IA 4X8OA 2AKAB 3RD5A 2QD2A 3ZBQA 3GLIE 1V47A 3DTYA 3ND6A 4LW8A 2DKOA 4K9QA 4KKVA 1I51A 2HCJB 4MI9A 4UTXA 5AICA 3UUEA 2BKVA 4JK3A 3VDXA 2DFNA 4L9AA 4ZCIA 1JVBA 4PCVA 4DLAA 3C1AA 4IDCA 1GTMA 1W0CA 1LLUA 4TGLA 1EFTA 4V02A 5AI5A 1ARZA 1XQ6A 4QDXA 3ZE9A 4GP7A 4AUKA 2WJHA 1ZUIA 2D74A 1ZUNA 3UZUA 4I19A 3ZW9A 2X4LA 1KRHA 2NGRA 3DVAB 3NGXA 3V8VA 1XV5A 2EAUA 3WMEA 5CFMA 4Z8XA 1E2DA 2BGWA 1JHZA 3H19A 5TS3A 4NU8X 4HNHA 1XOIA 4QX6A 2Z4SA 4MUHA 2ZPUA 1L5LA 4EJFA 4QTZA 4RZIA 1Z56C 1AN9A 2UDPA 3IODA 4Q82A 5CDHA 3SQWA 5DX1A 4FMDB 4KO1S 5GJBA 4RM2A 4QGSA 3SZUA 2KM1A 3EAQA 4MUMA 4QOEA 3D59A 2PX3A 4UU0A 2G4VA 1XDSA 4PNEA 1XNHA 5K0FA 1N0HA 4J16C 3WJAA 1S9HA 3EDYA 4CRWB 4D6PA 4D4KA 4UFNA 3OP4A 4WI1A 3DV0B 2XTJA 2YJNA 3R9IA 1SBQA 1ZHOA 1W5SA 1E2QA 2B99A 3CWZA 1ZXLA 5AT1A 3U3XA 1TEXA 1J97A 1RYZA 3HCRA 1MB2A 3D8SA 1IHDA 2BLNA 3FI0A 2AOUA 2H4XA 4G36A 4QUDA 3KWLA 4XVQA 2G09A 4BNGA 2I6TA 2J33A 3N2GA 4UQPA 3M6IA 5T6MA 3ILYA 2OO3A 3P0HA 2BZSA 3JQ6A 3KTDA 2ACKA 1ID8A 1K2WA 2G28A 1ZOOA 1LQUA 4PF1A 1D2MA 1KZ6A 2FR8A 5KMGA 2QN6A 4EMTA 1JILA 3WGHA 2VCYA 3O8BA 2HIAA 1JG7A 1QS0B 2VWPA 3CPEA 2L18A 4N5MA 1Q12A 4IGKA 2QRPA 3VR6H 4BNIA 5BYJA 3UA4A 1TZMA 4C2AA 2Q4BA 3RGWS 2QHXA 3BS4A 4WEQA 1OIVA 3O1JC 4L0MA 2JJQA 4DCNA 4LJYA 3E7DA 1E6EA 2X5KO 4MW9A 2CBXA 4A73A 3KQSA 4WZBA 3GP3A 4Z9BA 1NDUA 1FFDA 3JZFA 4AP5A 4DWWA 5K0BA 4RV5A 4AJJA 1ONPA 3E84A 2IUFA 3VYSB 4FZ5A 1K3TA 5CAEA 2J85A 1O5OA 4R5HA 4EFNA 2BDEA 2GUGA 3AJ8A 2PKEA 4L6IA 2J0UA 4EY6A 3H1AA 3ZDCA 4RDIA 4EUHA 2C1EA 1O03A 2WJ3A 1M2KA 1C1XA 3NU1A 2H1CA 2OHGA 4J3NA 1WRBA 4B31A 1PFVA 3KQPA 3CUTA 3NCHA 2B5OA 1RXVA 1JDVA 5JLJA 3OKFA 3AFHA 2GKOA 1ZGZA 3KB1A 1SR8A 2PD3A 3PXUA 2IHKA 4IOKA 4JEMA 1ZNXA 3OX4A 3OOHA 4DMFA 4HPWA 3IQFA 3G7UA 3OY7A 4B9AA 3PEWA 1LRKA 2ZAYA 5EZYF 4FDUA 3L7CA 3VSCA 3B9RA 5ENZA 3M5CA 3K35A 1UQUA 3UBTA 2Y1DA 3ED5A 1J8YF 2BEUB 4RFSA 1FFHA 3IAAA 2WWFA 3MBIA 1ACLA 3NB0A 1FZTA 3IP1A 2ZJYA 3NANA 2HSJA 3RYIB 4CF6A 1UBNA 3IVXA 1CUDA 4ZTZB 3FYHA 4G84A 3AKDA 2CNOA 4BNDA 4DR4B 1LDMA 3IDOA 1FY2A 4MUFA 1X7HA 2EP5A 2G5GX 2JH3A 4A2CA 1KNQA 3FIUA 4AJ1A 2PUFA 1A9YA 4NK5A 1X77A 5JRDS 4LZNA 3I42A 4IJ6A 1V8OA 5JCOA 5JW6A 1N5OX 2PD4A 3MW8A 3PQ5A 4EEKA 4U0KA 2SHKA 1WKBA 2C4MA 2DLNA 4UFPA 1ZD5A 1F7UA 2RHDA 1QQ5A 4RHYA 1LRLA 1SZDA 4TUYA 2OHXA 2XT0A 1Y8RB 2OUKA 3AF4A 1DPGA 3HPQA 4L8YA 3UOGA 1T26A 4EY7A 1M0WA 2ZR7A 2AMVA 3GF4A 2Q5LA 4JVOA 2ZLBA 2ZI5A 4YJFB 3ROTA 5B3AA 1G7RA 4GQAA 4DCSA 2AX3A 4F2DA 2QR5A 4IDQA 1AN0A 3Q5EA 4O4IB 5GAJA 1CVLA 2P9TA 1E9DA 2V7BA 1Z83A 2XMCA 5TB5A 4C5CA 3MBKA 4O33A 5BW4A 2VVTA 2PUEA 4XGRA 3PGVA 2GLUA 3ITDA 4DLYA 2EFGA 1JKIA 2XCQA 4KQ2A 4U3JA 5UKDA 1D0SA 4BVHA 1XD8A 3MC1A 1E94E 1M54A 1YI8A 2NPOA 3BWMA 4NEQA 1AXRA 3RTDA 4EUFA 1RS0A 5ER6A 4CCYB 3A6HA 5AW2A 1GCAA 7MHTA 3FVTA 1BXGB 1FP4B 4GW3A 1EJ2A 2DWQA 4OL9A 3GCXA 1HYQA 5DOZA 2ZEJA 4HRXA 1M2JA 5SZKB 3TCNA 4B76A 1V3TA 4XIGS 2EHJA 2VHXA 2W2TA 3NM4A 4ZVSA 2P3OA 4JJGA 1VJ5A 3AJRA 1DAGA 3JQAB 3H5LA 4E2ZA 4I4TF 2MSEB 4HP8A 3TW0A 5I7EA 1CY8A 4P80A 3MJVA 3GJ6A 4KPUA 3AV3A 13PKA 4KR7A 3EVBA 2AN9A 2YN0A 4IJ5A 5EWJA 2E5WA 1TAUA 4FZJA 2EU8A 3E8MA 3KOYA 4MW6A 5D85A 2WZDA 5I7WA 1EXMA 3R9XA 3QLEA 1QU3A 3T99A 3DO8A 1V35A 4R9UC 2QX7A 1DZ3A 3QVOA 4TYMA 1ENYA 5E9WA 2P2NA 4CFSA 1AV6A 4EATA 1FDIA 1N2SA 4P4NA 1OA1A 4M7WA 2OFFA 1OTHA 2Z0MA 3MJCA 2IYUA 1E2JA 1QDUA 3MPOA 1CB7A 5GGXA 1O97D 5JPCA 4KE6A 3PQCA 1QTQA 2KB0A 1MQSA 3D2AA 4FKZA 1KJQA 1TLFA 4KRGA 4ITRC 4K6GA 1DWQA 3FSGD 2CLDX 3MWEA 3M4ZA 4R2HA 1QQBA 4U7FA 1DC5A 4P83A 4H59A 5B7GA 1K8XB 1PF7E 2QQ5A 4XSGA 2A2ZA 2OXRA 1KU6A 4ZEVA 1OFTA 1QAOA 1DG1G 2O3JA 5KREA 4W6ZA 1MRNA 2V4ZA 3L8GA 2VPWA 5BN5B 4YR9A 5JJCA 2JHFA 4GQIA 1ADCA 1VJTA 4AYWA 5I4KA 1EK6A 3MGBA 1O0SA 2ANBA 1VBMA 3S2IA 3IEKA 1QG2A 1ZAYA 1OJ7A 2R1VA 3A2KA 1XBTA 1ZEMA 2ZSEA 4EHIA 4QDUA 4B3TB 4W1SA 4LGCA 2G25A 4TYQA 1IZ0A 3FYCA 4G5RA 4QYIA 4TMZA 3WLIA 1V37A 4LSMA 2P3QA 2XTNA 3O1HB 1GGKA 1X1BA 5CT9A 2MMGA 2DHQA 2XF8A 3GY0A 2WKRA 3WIUA 2D8AA 1OZHA 3TVTA 1IATA 2WWGA 3CX6A 2OXCA 3QUBA 4KVGA 2VRWA 2HLDA 4QDTA 4CN8A 4UM5A 3O4RA 1NTOA 3VHLB 3WYNA 3VR4H 3MINA 5F7JA 4N5LA 3MERA 3ROXA 1MQ8B 5ESDA 4DV7B 4YAIA 3BKXA 5SY6A 5NULA 3AY0A 2IVFA 2Y9PB 3MMZA 2AMFA 2W6QA 2REOA 1J0XO 2QZPA 3GT3A 3M5PA 4CLOA 1GFWA 2X0IA 3MMNA 3CUKA 4N41A 3FNBA 4J90A 3TQRA 2TMDA 1C81A 1E0SA 4QA9A 3FPGA 5A62A 5TNXA 4MR7B 3WP1B 1ZN9A 1NURA 4CWAA 4TMTA 3VOTA 4BJ6A 3RVDA 4EA8A 4TKMA 2PUCA 2CDBA 1RE0A 1VJGA 4QAJA 1WQ1R 2W6OA 2YW2A 3BILA 1AK2A 4YRCA 2QL9A 6REQA 3K0BA 5AVOA 2WU8A 5B2ZA 5L53A 1QGUA 1NVDA 3L46A 4K03A 4KW7A 2Q5CA 2A0XA 3IAS6 2VF7A 3K32A 1R3UA 2Q6OA 2EX4A 2KLBA 3W5CA 3KYDB 1V5GA 3A9VA 1GAXA 3MRSA 2E82A 2C0CA 1UBKS 2QZ9A 3DZKA 4MS4A 4PPNA 1NU8A 3T0IA 3FMGA 3SS9X 2GAFA 2YZNA 2QR2A 4H6VA 4U2FA 4ZWNA 3A9WA 2X5NA 4CQMD 3LLUA 2RE8A 2C7QA 4D5EA 5FBLB 1ZSNA 2JJ1D 2GZDA 4FOOA 1KIMA 1UEIA 1YNOA 2Q7OE 3VPDA 2O5VA 4J75A 2HCFA 4L95C 3V97A 2C2WA 4B4OA 2DKNA 3MXTA 2BFCB 1N9ZA 1G3QA 1OBHA 5L4SA 3EPLA 4E5YA 3EIXA 3IC5A 3NHRA 5IRCD 3ZNPA 4AS3A 2Q1SA 4ZCRA 2WV9A 3HU1A 3EDMA 3NTOA 3P9NA 2X3YA 1OZGA 2J30A 2OR3A 4KHZA 2I3DA 4UBIA 3ESRA 1BA2A 1ZU5A 3RF7A 4GMDA 2XUIA 4IHQA 1WQ4A 2C2ZA 3CISA 1P80A 3BFJA 2ZYVX 4OHBA 1AUOA 5ALVA 1V1MA 4CKCB 2J0EA 3TRFA 2CT8A 1BGWA 1P62B 2PYDA 3N74A 5EJFA 1PR6A 5I3ZA 5KCZA 5KSYA 2G0AA 3NHAA 3PC4A 3VNUA 4IMRA 4OHPA 4U0JA 1JTFA 3J80A 4XB2A 3GBPA 4C0LA 1BA3A 1KHTA 1KP3A 2HSEA 3F3SA 4IBOA 4FI3F 4IYRA 4CM5A 1GVHA 4RE6A 3O4VA 3VPXA 4BZXA 4A2QA 2GEFA 3W2TA 5E4TA 5KVQA 5EMKA 4BMDA 5BUSA 3ORQA 1MW9X 2ZJ1A 4ID3A 1LBSA 4QT4A 2OFOA 1WX1A 3HFRA 1P7CA 4EX6A 2WTNA 4F0JA 2D3WA 1ZC4A 3QOFA 4B3BA 4A5SA 1J2TA 4MRPA 5CITA 3GMTA 3GO4A 3PICA 2GFQA 4J0KA 4TQUS 1QK3A 5L3SA 1C4WA 5I7AA 3PX2A 4YJKA 3ONVA 1E1DA 1FLAA 1UZNA 4GGPA 3AG5A 4RD0A 1A9XA 1N8NA 2K87A 4PAQA 3HI4A 3B1VA 3DH0A 1JW9B 3I6ZA 3WMXA 1M76A 3GZJA 3UMRA 4C7BA 2NAPA 1SWWA 1Y4SA 5AM4A 3A7EA 3RV4A 1NRWA 2DUNA 1M1NB 2OC4A 2PHZA 3DZJA 4JAVC 3SSAA 2BKXA 3IXLA 1AQLA 2XE6A 3ER8A 1HQDA 4D42A 5CYOA 2BW0A 3KLNA 4KYVA 4TL7A 4DV3B 1T0UA 2J6HA 3THYA 3GYBA 3TTSA 5FWDA 3LXUX 3LQ4A 3E3MA 3R7FA 4BCDA 4PQRA 5K8LA 4AYTA 4UQOA 2CYCA 4C5AA 4RGBA 2BSXA 1Q0HA 4CNQA 2D06A 3OJCA 4I4TA 1PDVA 5DNCA 3WL4A 4AJ9A 3TFOA 3U0BA 2C2XA 4LXYA 4G0XA 3RRYA 1Z13A 3G8AA 3BG5A 4ZT5A 4OM8A 3DLPX 1K06A 2AVDA 5AI9A 3REFA 2OLJA 3OO0A 3B5IA 2OSVA 1K3UB 2QUIA 2WF5A 3HCAA 3NT5A 3QU2A 1Q1EA 4FE3A 4YRRA 5DI3B 1G18A 3AHEA 1E1CA 1YBVA 3PR3A 3VKFA 1S4QA 4KR6A 4ZMSA 2JFYA 3N2LA 4BB0A 1VPVA 2XQJA 1H0KA 4BO4A 3CINA 1C7FA 4FCTA 5HFJA 1A9RA 1H8HA 3LLSA 4DMRA 4WKBA 1LWNA 2ZIXA 3B3JA 3FM9A 1HFKA 2PD6A 3FYUB 3KTOA 4UARA 4C3OB 2XX3A 3X1JA 4NNPA 5JWOA 5FX2A 5T4EA 1QMPA 3N59A 4L75A 3KXPA 4A1OA 3GGDA 4FMDF 3KJEA 1Q91A 4C4SA 2GPBA 3A3YA 4GZMA 1GL6A 1KYYA 3Q9UA 4F5ZA 5HTKA 1DQRA 2ET6A 3MYYA 4DLWA 1P3JA 3WOHA 1E0JA 4AMBA 2XNDA 3FMPB 3MNFA 3BICA 2BTQB 4QPNA 1B0ZA 2WIFA 3KHSA 5IP5A 2X5OA 4IH1A 4D3SA 1N2BA 2K4MA 1C7IA 4BVEA 5IT0A 3FCUB 3K1AA 5GJCA 2AMYA 2X5XA 1RPJA 1T8SA 5CLHA 3W79A 2YW9A 1ZSYA 3OPNA 2A9PA 1H23A 2FOIA 3L7BA 1RLTA 1XVUA 5FEUA 2LDXA 5HJ5A 1N92A 3DZBA 2O6LA 3F7OA 3HB7A 3ML1A 4MPPA 1HK7A 2XCUA 1T4BA 2R6GA 4DBLC 2N75A 1R0LA 1NLFA 4RDXA 2HSDA 2XGMA 4QWMA 1SU7A 2W6NA 5T67A 3PCRB 2J9FA 5L3ZA 5D3QA 2BM1A 1E1QA 1ZCBA 2ORIA 4OXNA 4I55B 3K0SA 1P39A 2WUVA 5C7IO 1I6WA 3RODA 3KT0A 1Z34A 4BNFA 4F84A 1QOQB 4F4CA 5AVTA 2AQKA 5EJ9A 5EIXA 4UU8A 4GPAA 3SN6A 4JEHA 4BMXA 3G6KA 3M4YA 4UULA 4D9FA 3GRCA 3W05A 1QIIA 3JX9A 4ZCTA 4ZXPA 2FWJA 5LKAA 1G0OA 3TD6A 4N9QA 4FCCA 3LWNA 2FFBA 4PQFA 3T3EA 4DQ0A 5EJ7A 4DXDA 4KLNA 3EZ7A 3U2QA 5DGTA 5K05A 1RBQA 5B53A 4DQLA 2VNSA 4G56A 4GX0A 1RYBA 4KLRA 5JAOA 3GLHE 1VJ0A 1Y1PA 4IWYA 1ZITA 2A5DA 3N58A 2Z9DA 2ZYWX 4LXUA 4J91A 2GARA 5B55A 4DLKA 1MFZA 3FR7A 2VDVE 4ZQGA 3EMDA 2J3JA 1PVVA 2X3UA 4OAPA 1SRQA 2ZSFA 3ANNA 1VPLA 2C3UA 2VDWB 1K66A 4HN9A 4IFIA 2QP9X 3DFMA 3S2FA 4B5KA 2HUPA 3P9SA 4DCOA 2DWPA 4V0MA 4D8VA 1UFVA 5DWVA 1NKTA 4BPRA 1K27A 3E81A 3LY8A 1R6AA 4PG6A 4IUYA 1L5ZA 4RS4A 3G2LA 5E3HA 1OV4A 4LMAA 1ECGA 4WK2B 2NUTB 1OXBB 3OEEA 5KJEA 1YBAA 4DPMA 2BEVB 4JU9A 2VEDA 1QOPB 4CKBA 2AFIE 3H8WA 5FL7A 2RH8A 1ECLA 3TD9A 2YWFA 1AF4A 3JSAA 4DIUA 3VNRA 4DXHA 2PVCA 1SK9A 1HDYA 2YWJA 4LBWA 4CKWB 4JJIA 3AYXB 1FDWA 1ESCA 1XLTC 2Y27A 4EFMA 3CUUA 4G65A 3AEUA 4MMZB 4LDPA 2EW1A 4P7JA 5AJXA 3WBFA 2C59A 4LYJA 1A8UA 4HPJB 2QPLA 4MV3A 4OLHA 5CM9C 3DEFA 5EIBD 4C6RA 2ETXA 1U0BB 3BN3A 1PNRA 5AXDA 3A6PC 3FMVA 4O02B 2GAOA 4GGOA 1V2HE 3FA2A 4E5SA 5IK2D 4FFBB 1DAHA 2C9OA 4RD6A 1TZKA 1XUOA 3GEMA 1IZYA 1H4VB 3OJEA 4FYYA 3VDQA 4YRIA 2MT9A 2Q8NA 2QPOA 3ETDA 2OXTA 5LOVB 1LV8A 4HDQB 4Q6BA 5FNVF 1CHNA 1CNMA 2BEWA 4KITB 1EI9A 4O4IF 1Z6YA 1FDTA 2NXCA 2PVSA 4TVBA 4OV6B 1X8XA 2HN9A 1SEPA 1RP1A 2G83A 4MRRA 4KSCA 3EXHA 2K6GA 1YOVB 2NU6A 5IDYA 3T5DA 1EHIA 1I5EA 2AJLI 1VMIA 5LZ5A 3NIBA 3TK1A 2CBGA 4ERNA 1X2BA 4HG2A 4Q4JB 4ZOAA 4XVUA 4ARIA 1KPGA 1T29A 3V8BA 4CCSA 3ESBA 3CR8A 1QC5A 1E1RA 1DKPA 3K9QO 1U7WA 2IEYA 1OUMA 1M83A 4M1ZA 3SC4A 3OCCA 2PIAA 2QV7A 1JU4A 2OESA 2OGZA 2WKQA 3QEAZ 1N0WA 4Q3EA 1V2GA 2XZPA 1UK9A 3QV1A 5J9FA 4ZAFA 5KTSA 5EWLB 4LTMA 4IGFA 4LYDA 2R1UA 4L28A 2O3TA 3RF6A 4CXMA 2J31A 3MTQA 3PPVA 3VC7A 3VNQA 1JQ3A 4B6OA 4BTEA 1SOVA 3CHYA 3F7NA 3T9AA 5ALWA 2HW8A 1Y1KE 2Y99A 4POAA 5LXTF 3W5IA 1NC1A 3C15C 2JKYA 1G5HA 1ONOA 1XCGB 1HWYA 1P0QA 2OWEA 1OW3B 1ZKDA 2PL3A 4R7TA 1L7BA 1KJ8A 2QSZA 3GMIA 3Q7QA 4YP7A 3WYEA 4J7AA 5ALZA 4FOSA 3OOWA 3GJTA 1OI3A 1WPQA 5AXBA 3SHVA 5HQ3B 4LCJA 2FUNB 1JHAA 2ECOA 3DBLB 4N5DA 1X13A 4XKJA 4D3ZA 1G8YA 2AFHE 3CN7A 2E85A 2IVZA 2OCGA 3SZ3A 4CT5A 4DMMA 3ETCA 2KJQA 2QW0X 1Z6PA 5CFRA 2NZYA 3PX7A 1PE0A 5FB3A 4KR2A 4IGAA 2IX9A 3GRPA 1BMFD 1WWKA 4RADA 2ATEA 2ZYRA 3IAHA 4WKNA 1NI5A 1CJSA 3A6LA 4LA4A 3DVAA 4LE0A 2XUOA 1G5FA 1U2GC 2WR8A 2KS6A 4PLPA 2CUTA 3T7RA 4C21A 4CU2A 2VNJA 4NG5A 1BQEA 2OHFA 3EAGA 3NT4A 1L7OA 3QYJA 5EJ6A 2GBPA 4S04A 1Y5IA 3SYRA 5REQB 3OZIA 2QK4A 2KPOA 2ODAA 2YWXA 4OL0A 1VBNA 4TTJA 4AM8A 5JJ5A 3HM9A 3A4MA 3CE9A 2V6MA 4NBKA 4ZT4A 3RUIA 1VKHA 4FYKA 5L6LB 2JIDA 2ZIVB 4YPFA 3EF3A 2NO6A 3MFQA 4KE8A 2MYPA 2H2DA 3DV0A 5JJLA 3OQPA 4X8HA 5GV7A 5F1YA 2C00A 4EUNA 4BCBA 1XCMA 2Q3HA 2PMEA 3TRDA 2KBFA 3EIUA 2O2YA 3QKWA 1TOAA 3GARA 1IN4A 1DQSA 4PWYA 2E4XA 4URUR 1M7BA 5E4JA 5I8PA 1ULBA 2MTBA 1Y3FE 1Y7TA 2CXUA 4KL8S 1RPTA 1WXWA 2HLNA 4JR0A 4L50A 5AM1A 3FUXA 2RIPA 2Z1DA 2P9ZA 2SKEA 3FIJA 4MVJD 3GQBB 2HHJA 3D5TA 4MVJE 4NBTA 4DUGA 4YLEA 4YTEA 4PZPA 4DZRA 2WB4A 3BZWA 4ND6A 2W5UA 1QS0A 1FW8A 2PZFA 4M98A 1CUVA 3IT0A 2E4ZA 5J58A 2HA5A 3G0GA 5HF9A 3TZ6A 5HRCA 1EMDA 1U7PA 4EYKA 4OOEA 4DN6A 4LDNA 3HA5A 3NHKA 5T4HA 3OD1A 3OTOB 1C1YA 3H5VA 3QWBA 3TCKA 3LU1A 3N1UA 3LVBA 4O8CA 1X1RA 4CV2A 4G97A 3IT1A 3QJYA 5BPFA 4HQ0A 1RYMA 4I8DA 3UAGA 4TYNA 2O8FA 3NHJA 2NZWA 1N2CB 2IOHA 4PQGA 4V0SA 3UG7A 3ZCRA 1L5FA 5K09A 4HQ6A 1FX1A 3JV7A 3ICCA 2GTPA 3W8FA 1XTRA 5HZHA 3VPGA 5FYDA 3O8LA 5KC9A 5BSUA 2WOJA 3IELA 4E2WA 4Q03A 4JSTA 4Q19A 2V3VA 3DULA 3GJ0A 1KI3A 2E21A 4X90A 1CIPA 4G4JA 3MCUA 1CR2A 1PP4A 3R8CA 1I4DD 2X2OA 1Y33E 5IWCA 4WESB 1J9EA 1HDZA 3OX2A 2NYVA 2XSZD 3UV3A 1TA0A 5DISB 2C4VA 4B85A 2BEUA 5EIEA 3U0VA 1RQGA 3V46A 3BQMB 2I71A 1ZMBA 3IPCA 4IV8A 4LJ5A 4E31A 1UCFA 3EQ9A 2HHAA 4F7WA 2RAFA 2UXBB 2G9QA 2Z5GA 4CKXA 2BBSA 3RYIA 1JG3A 5CM2Z 1GP2A 5ALRA 3PTZA 2JEYA 5JZOA 1P2VA 4TKUA 4URHA 1R0YA 1F2DA 2P0AA 4HUQB 5KNCA 4MV7A 1KR5A 1UK8A 1PR0A 1RWMA 4L5CA 3SOPA 1J2UA 1ZJJA 3NRJA 5C1IA 3IBGA 5LIRA 3R75A 2ZJAA 5EY5B 4AXXA 2JEOA 5JU6A 2YTZA 1I8TA 3L7DA 1LZLA 1YZFA 4TMYA 1H0RA 1N1MA 4A16A 4BPBA 1MJGM 3H83A 4YJ3F 1YR3A 2IZOA 3IO5A 4RIIA 1D7AA 5GONB 3IP8A 5G1PA 4WFKA 2G40A 4YDSA 3MS2A 3ZZ0A 4PO9A 4Z4IA 3I3OA 4WKGA 2WP8J 1NFQA 1JEQA 3NX4A 4K9PA 1MGPA 3CEMA 5I6DA 1EUQA 1QKKA 1JL3A 2YXDA 3JAKB 1YULA 3M89A 4WFJA 4DMUB 3LECA 5AW5A 4C3UA 2VJLA 2YRWA 4ICIA 1ZLYA 1S2LA 1EE1A 4P2BA 3HZOA 4TWBA 3KXLA 4WJLA 2VIIA 4YJFA 3RFCA 1OR8A 1L5GB 5FNVA 2IDZA 4O4IA 1FBNA 1MVLA 4AKEA 1LPOA 3DBOB 4DDHA 3BBPA 4OAQA 4CMIB 3TDNA 3AM4A 1KK3A 4DV0B 3R6GA 5DHRA 4P6VF 1J7KA 4TKVB 2Z6AA 4AWAA 3HA3A 1EFPB 1XQWA 3A9CA 1MNQA 3RUFA 5IBPA 1RI1A 4PTZA 3LYUA 3P9KA 4LYAA 1EFVB 4HS9A 1R0KA 5AW8A 3F6PA 2XUFA 2IPOA 3GRAA 5ED4A 3K9WA 4GX1A 4BV8A 1LLFA 2L82A 3BSFA 4GBMA 5KNDD 2DH6A 2WG2A 1QFMA 2RG7A 3JQAA 1LCIA 4IJUA 2PQMA 2P9QA 1CQIA 3W2IA 3WLOA 3TZBA 4ANFA 4KWCA 4D97A 4EL5A 5JXWA 1GSOA 4A8JC 4DPKA 3GP8A 3ASUA 1BDIA 1DJLA 4A36A 2YVLA 4EEZA 1Z2PX 1B0PA 2PSFA 1HLFA 1JNXX 3O8NA 5KPJA 5K1ZA 1U63A 1RWPA 3RLFA 3QOWA 2J46A 2WQZA 1NYQA 4UOQA 4AF7A 3BMOB 3LDAA 4J03A 1P17A 1UM8A 4W1RA 1GGJA 2V96A 2R62A 3MOIA 2WJAA 1EB8A 1M3SA 1WOYA 2F90A 2UYGA 3MGKA 1T9CA 4K9OA 2DQYA 3BWCA 1Y37A 2G5CA 3L8HA 2H7YA 2R751 5AJHA 4WVFA 2VAWA 2ZW9A 4FN4A 2KI5A 2VSNA 4RQBA 1H3NA 1ZJ6A 4DVGA 3K3PA 8MHTA 1GUFA 1PJBA 1NM5C 1M2EA 1NDQA 2JNWA 2O1XA 4GLJA 4L5JA 4A27A 3VC1A 4C4AA 4PX5A 1KORA 1P19A 5BN5A 3AKCA 1A9PA 5H5JA 5JSFA 2ZBGA 1KMCA 1L8OA 3BXPA 2ZRMA 3PSAA 1A96A 4C43A 3H4MA 3FSRA 4NVRA 2OZVA 1DTWB 2Q6TA 3SJBA 3WZLA 3F3KA 1YS7A 1WD7A 3QU9A 4PX9A 5ALKA 4R8LA 4ITUA 4MNTA 1CY6A 3QXHA 4PM4A 2RCYA 4BCCA 4X3PA 4U2DA 2GD1O 5JAHA 3AVYA 3I6IA 3ERCA 1IZ7A 1J06A 2R48A 4IQ0A 4M53A 1RI5A 1E92A 1QLHA 4RH1A 1IJEA 2BFAA 2NO5A 4FS3A 3Q1LA 2H1OA 1A8PA 1TUBB 2NO0A 2ZS8A 3ZE0B 1VHJA 1RMQA 1GV0A 1PJQA 4JB0A 4K3UA 5LMZA 4MKXA 3H5OA 2WT8A 7AT1A 2ETVA 5CBPB 2W83A 3HI6A 1ISIA 3FGNA 1WLYA 2WIAA 4TWRA 2IYFA 4IIXA 3RVPA 1XMQB 1VPDA 4YRFA 1PJ3A 1Z3IX 2GZMA 2JZCA 2ZT6A 3E9QA 3NAQA 6LDHA 4FKBA 2ANCA 2ILVA 3NIDB 3GI1A 5E95A 3IP5A 4EJ6A 3KLBA 1JR3A 4N49A 4QPDA 2Q6KA 3HJTA 4G85A 4RHXA 4UXHA 5G4KB 2XWBF 4YXWA 4MR7A 4GWKA 4YAUA 2DFPA 3ND5A 3FETA 2H5LA 2QL6A 1Z6AA 1DPFA 5CT4A 1YRBA 1RQPA 5A5VA 4UNPA 1FBTA 1ZN2A 4U63A 5EMNA 3THOA 5BMVF 3KVNA 4AMUA 3D64A 3S8EA 1N6PA 2YL2A 1OBFO 2FE1A 4DSOA 2HIMA 1J8DA 1MO3A 1WTAA 3RRBA 1UJNA 3ZXYA 4RTLA 3SBOA 3LXXA 1U0TA 5HTOA 4PYJA 4H35A 3R0JA 2JJMA 1G2PA 1KOLA 3P20A 3U13A 5DP2A 3EEIA 3CO5A 3FB4A 1V8DA 3ZDYB 1KAOA 3KYDA 2X9QA 4O1IA 2KYRA 5FLYA 4LMBA 3M8KA 1NPDA 3HSSA 3LZ6A 3O2SB 4C14A 4YO7A 1ODTC 3KXDA 1W9HA 4P33A 1BDHA 2C03A 2OZKA 2ATCA 1GG9A 1FNCA 1PFYA 1Q7EA 2K2QB 5DEOA 3AL3A 2ASVA 3EODA 1GCIA 1SB8A 5JS6A 3QFFA 2OAEA 3PXCX 4B44A 4MVJG 1AZWA 1KDPA 2G63A 3OC0A 4XJTA 4MPJA 4L5BA 1U31A 4JOQA 1EE9A 2ZBFA 3V1UA 3HEAA 4HGPA 1YBFA 2BFCA 3TSZA 4BBAA 2HMUA 1KI7A 1E0DA 2APJA 2DFLA 4ID9A 1NLMA 1XKLA 4QUEA 1J20A 3A9RA 1PTJA 2DUUA 4P7BA 1ZFNA 2ZSUA 4BO0A 1P9NA 4KSBA 4C0BA 3U9SA 1JHRA 3D6AA 3ESAA 4DT1A 1VHLA 4DSNA 4HVCA 5HKOA 5KWSA 3ET4A 2PV7A 1K9SA 2R79A 3PYXA 4MRNA 3TLGB 4BNTA 1Z25A 2EC5A 2BSAA 1GAWA 4LNAA 1XU4A 3DCNA 3VU3A 1FTYA 3PZRA 4ZCQA 1W0KA 4YRAA 3OQ1A 3CA8A 2V1XA 5LIPA 2C7PA 2QA5A 2FPRA 3PEEA 3W3AH 4E7OA 2BFWA 4LECA 3QE9Y 2OPBA 3ULKA 2FXIA 1ZUWA 3L4BC 4QGBA 3HRIA 2ILTA 5FRDA 4DC0A 4DFDA 4X8MA 5CTAA 2JH8A 4MIOA 1RU3A 1COZA 1DRKA 1EDOA 4OYLA 4FMCB 3ZE7A 1U94A 1JTVA 2P9GA 1PNOA 1NXTA 1L1RA 1O97C 2F9MA 1KMHA 3V1LA 3QU7A 1XGKA 2B4RO 1K68A 4BTVA 2FWBA 2A7XA 2RHBA 5H4GA 2VBFA 2GESA 1F60A 2ZRHA 4LV8B 5HBRA 4C4RA 4EMUA 1M1NA 3A0RB 3FWYA 3DMNA 3GJ7A 4K2AA 2C31A 4U2EA 3DLIA 1VBKA 1KOJA 1QIMA 2PMCA 3ETHA 4PX2A 4G4SP 2H51A 1KEPA 2HL6A 3R7NA 2WPDA 3NGLA 3M49A 3MWGA 1LBHA 2ZBQA 3CZAA 3I32A 4JVMA 1EP9A 1G3IA 1OAOC 1N5JA 1W5EA 2EJVA 3SSMA 2JLQA 4LC9A 4ETMA 5L45A 5LFAA 2R2AA 1M66A 4OQDA 1E3SA 2CXHA 4ENRA 5HVNA 5KWVA 1D6JA 1X19A 5GTDA 4B3RB 5C53B 4YP9A 1E7QA 4YH1A 5C34B 3S8MA 3EWIA 1SIWA 2JI8A 1MAHA 4KOEC 3HQ4O 2XB6A 4P82A 5LD2B 5DI3A 4C87A 3MGCA 4RNDB 5ARCA 1Z28A 1PDOA 2G71A 4XRRA 1IB6A 4A2WA 1JJIA 1CEYA 4XDGA 1DADA 3K5WA 3A4TA 1LF5A 4FX5A 2UYCA 1CUSA 4BP1A 3C41J 1T0BA 4F12A 4YQFA 5LQKA 3X3HA 3FYUA 5DHAA 2Z9BA 1FSSA 4F3RA 3DOIA 1OU4A 3HM2A 3RK1A 1TO2E 3GU3A 3B3QA 4M8KA 3M0EA 1GTG1 1P9OA 3ZGVA 3FOCA 2C8VA 5I51A 3GNTA 3BRWD 4XE5A 3TJZA 5JI2E 1C1HA 1EFUA 1WNTA 3G5LA 3C5EA 1DBQA 2RHLA 4QTYA 1IBRA 4CM4B 5KWIA 2CLKB 2BTQA 2DPXA 2NO4A 4PZDA 3H8VA 4P32A 3UK6A 2QGFA 2WDPA 3QVJA 3GMDA 3R7AA 1EM8B 1RHRA 1H94A 1UPAA 2HIHA 2IP2A 5EL0A 3H5TA 2XWQA 4EF4A 3A9SA 5JWRA 1JFRA 2P9FA 4JOCA 3CR7A 3NBYC 4ZK6A 3SIRA 5LR6A 2AX4A 1RC8A 1NJ6A 1XCPA 2JCSA 1DG3A 2OV6A 3A6DA 3BB4A 1J0AA 3V80A 4BDTA 1K2VN 1P0IA 2FEMA 3QXSA 4JXJA 4NF2A 1DX6A 3M9XA 3VPBA 3GJSA 2EFCB 3L49A 2NUAA 1D7OA 2RB4A 4FC6A 4X6XA 5CJPA 3ASYA 2R7KA 3W9SA 1OX5A 2J9XB 4W7HA 6CHYA 1T5TA 1XELA 1JSCA 3O0TA 4TXLA 4JI2B 3WS7A 1C8VB 1YS4A 1LVUA 3EW9A 3FX2A 4DCUA 5B1SA 2QSJA 2IW1A 3L2OB 1BG6A 3WNDA 3TS1A 1F0NA 5SYAA 5ESWA 3TLCA 4E12A 3D9QX 3HDTA 4P58A 3L5KA 1H2XA 1Z6GA 1E20A 1Z8FA 2X76A 3I04M 5C5DA 3JTEA 2CXOA 3SKXA 3QMMA 4K40A 4RACA 1VG8A 5KUTA 1LW6E 2DFKB 3EIOA 2OECA 1YRAA 1KSFX 2IDJA 2F00A 5DV9A 3RREA 4A03A 4A23A 5CLGA 1U2DC 2A5FA 1MAVA 3EOBI 1LNQA 1X1EA 3TMYA 4QUKA 4FM9A 4BNWA 1L4YA 5BMVA 2OEPA 3DAOA 5DRYA 3T9FA 5JNRA 1M8KA 1WBJB 5CFOA 1D2GA 2FU5C 4PC2A 2WQ6A 2VQFB 2ACVA 1XZAA 3VH4A 4EY5A 1AZTA 2BGKA 1B6SA 3CGGA 1B73A 1CRWG 2VDWA 3Q41A 4I08A 1EG7A 2REQB 1QONA 4FYXA 4K86A 4LPSA 3AILA 3SF0A 2ZJFA 1XHEA 3B6ZA 3NI2A 1FU4A 1XRRA 2WAAA 1DLJA 3IMKA 1DDGA 5AVVA 5HFAA 3H1GA 3W1EA 2H9AA 3GZ4A 1A2QA 1AURA 1EXNA 1PBTA 4ZQBA 2BEVA 1H9BA 1P5FA 521PA 2EBHX 1AZLA 4Q02A 3WZ2A 1EBFA 2C9YA 5A4MS 3IKJA 4DHWA 1M1ZA 1U8ZA 2EEZA 1RJDA 2VP6A 4FU0A 5LQJA 1FP6A 2JD1A 3TN7A 1V1RA 2QMZA 4E6EA 2O48X 2B2CA 2RK6A 3HN7A 3HBJA 5LQMA 2FSGA 2AKEA 3JQBA 1A71A 1ESZA 1EZ4A 2XKJE 2YHUA 3KYIB 1YIDA 3ORRA 4LGYA 3C43A 4TMWA 4KQJA 5F3RA 4B4VA 1ZIDA 1GSHA 3DOHA 1G5QA 4QTXA 1XEAA 2V7XA 3UAZA 2BRUA 2QPAA 2IYPA 4YQEA 4MYRA 4NCIA 4GLBA 5IZCA