4YPOA

Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
325
structure length
325
Chain Sequence
b'MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketol-acid reductoisomerase
publication title Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 129
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.86: Ketol-acid reductoisomerase (NADP(+)).
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4ypoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ypoA01
4GX0A 1GYPA 2C54A 4DRYA 4DLLA 1EMDA 3ZNPA 4FJ0A 3GG9A 3FNGA 2VYVD 1EE2A 1E7MA 1ZMTA 1WMBA 3K96A 5L7YA 3RUDA 1E0DA 3DO5A 2Q49A 3WTBA 3RQSA 3VDQA 1BDBA 1KVUA 3CXRA 2RAFA 5A9SA 3E18A 5IFLA 3JQFA 1KY4A 4RPLA 4ID9A 4CQMD 4CQLB 4HFMA 3G17A 5EQFA 1N9GB 2QRLA 2GD1O 3GGPA 2YV3A 3I3OA 1D1SA 3NJ4A 5G0SA 2J6IA 1UDCA 2QHXA 1LDBA 3LSYA 1MGOA 2ZK7A 3I83A 4TKMA 4Z0TA 3ETDA 1MA0A 3UH1A 4P8RA 2GRAA 1EVIA 3GGOA 1ORRA 2O50A 4M54A 5TLSA 5L4SA 4MKRA 4GWGA 1ADFA 1PR3A 3JSAA 5DCUA 5IF3A 2B5VA 2EKQA 4ZQBA 1VPDA 2B37A 1ZSNA 2XPCA 2CDCA 1BXGA 3U4IA 4W9NA 3RFXA 1PGOA 3RI3A 2NU6A 3UOGA 4D45A 5G0VA 3JQ9A 1E7YA 3TNLA 2OBYA 4K6CA 4BNGA 4IM7A 3EZYA 5C3MA 5JFOA 1DOHA 1QP8A 4PZDA 1UAGA 2O7SA 1XSEA 5JYEA 2ZYDA 3TL3A 4DC0A 1B3RA 5FWNA 3AOEC 1LI4A 1T2FA 1IY8A 1ZXLA 5A5FA 1A5ZA 1I24A 1D4FA 2AQHA 1BXKA 4GVLA 2PWZA 1P45A 3IOYA 3ETGA 1N7GA 4MKZA 4OQYA 3AI2A 1NWCA 4PG5A 4M89A 2WMDA 4IDGA 1TXGA 2XF8A 1S6YA 3TOXA 2UUPA 5EMHA 4K1LA 5JSFA 4ILKA 5DZSA 3V1TC 4AJOA 2BF7A 2HMVA 4YJGB 1ADCA 1DSSG 4XJTA 1NAHA 4WUVA 2J5QA 1K6XA 2X9GA 3A28A 4CMEA 3DR3A 1YJ8A 3AUTA 3NT5A 1ZW1A 4Q3NA 3K6JA 2RIRA 2EHDA 2TMDA 4A27A 3HJAA 3NGXA 3MOGA 3LF1A 1X0VA 2C7GA 3DEYX 4IPTA 2FZEA 5ENVA 1HDOA 2GUGA 4XWYA 3PFWO 1YQDA 3FTNA 4R1SA 1HE3A 3GF4A 3GAZA 4DUPA 1V0JA 4GAEA 4XQ9A 2D3TA 4B3JA 1D3AA 1PL7A 3DFUA 4YAJA 2DUUA 3D3WB 3TFOA 1VC2A 4CM9A 2IE0A 1HE2A 4HNGA 4WLFA 1JAXA 1I2BA 2JL1A 2PZLA 3C7AA 4CM5A 3RBZA 3OQBA 4BKQA 4QQRA 3AY3A 4QEDA 3VPSA 3RCBA 3RU7A 2YUTA 5K6AA 1XWFA 5FF9A 4K9DA 1UR5A 5CEJA 4LGVA 4BGVA 1PGJA 1E3WA 1QMGA 3HFGA 2VN8A 2X6TA 3OETA 3NGLA 2DBZA 2B0JA 1GD1O 2JJYA 4G5HA 5TS3A 3I4FA 3STHA 4B8WA 4XYMA 4BUCA 1VSVA 4R69A 5EQDA 5KVSA 1LDMA 2NADA 4R5MA 3GDOA 4GKVA 3RKRA 2WYVA 4FC7A 1ZXBA 2HO5A 1KS9A 1E6UA 1E3IA 3BAZA 3F3SA 3WGTA 3JQBA 1GAEO 1LDNA 2JCXA 2Y0CA 3IDSA 4R9RA 5A9RA 3A9WA 5EESA 2V6BA 3F5QA 1WZIA 3QP9A 3S2IA 5J23A 1PJCA 1BW9B 4NU6A 5H82A 1GQYA 3PJFA 4GPD1 2W8ZA 3JQAD 2W90A 4S1VA 4BGEA 5TF4A 4A26A 3EAGA 1XGKA 4TROA 4GGOA 4ZJUA 1P9LA 3UICA 4Y6SA 3E5RA 5ES3A 2C82A 3DBHA 4F45A 2BD0A 3CEAA 1SBYA 3ST7A 1MC4A 3IAHA 4FFRA 3MWDB 4PLZA 4RVHA 3A06A 4P4GA 3WGYA 2QZ9A 4U5QA 1YB5A 5JC8A 1C14A 1NASA 3RC2A 3VZSA 4AL4A 2YFQA 4BNYA 2NVUB 1D8AA 3H6KA 2RH8A 3GAFA 3OA2A 3OJOA 3KEQA 1E1MA 3OP4A 1DC3A 5EPOA 3EGOA 4OIMA 2J5KA 5AQ1A 1DLJA 2ZIZA 1HE4A 4B8ZA 4MOWA 3PP8A 4ZQEA 2HMTA 1MFZA 1T2CA 3HN2A 1DJNA 1DEHA 2FP4A 3UW3A 3AW9A 2WE8A 3DOJA 4BV8A 4PGFA 2O2SA 1NPTO 4AJNA 1YL6A 1BWSA 2GR9A 2VWPA 1H9BA 2R6JA 3S2GA 2O3JA 3IMFA 1T2DA 4I5GA 4CJXA 1HF3A 1PQPA 2YHIB 4IMPA 3KO8A 2HMWA 4YAKA 2BKAA 2NV6A 2IYOA 5I7EA 4IUYA 3L0DA 4NFYA 3VZQA 2EGGA 2XXBA 1FDVA 1WDMA 1LXCA 2EGHA 4DXHA 2ZATA 3GC6A 3KZVA 4JP3A 3WTCA 1I30A 2FWMX 1GR0A 1N7HA 1WP4A 1U3UA 1I10A 4OHUA 4YQYA 1DFIA 1UP7A 4MKXA 3KETA 4P4LA 1RM3A 1IPEA 3RUIA 4LMRA 3ZU5A 1OC4A 3F5SA 1E3SA 4R5HA 4NBWA 2EP7A 4FDAA 3HB5X 3VDRA 1ZH8A 2G17A 4OOEA 1PGQA 4M55A 3WQSB 3HDJA 3RC1A 1LSOA 4E33A 3PQFA 2VYVA 3PZRA 1K2WA 4YTEA 4A03A 2IZ0A 3DAGA 1XR3A 2XOXA 2O23A 3ANLA 2VTDA 3L4BA 1A27A 3JQFC 4GWKA 4LCEA 3JQ8B 3M1AA 3ZW9A 2DTEA 3ZWWA 7MDHA 3KTDA 3F6YA 4KUEA 3P5SA 1K3TA 1ZK0A 4CL3A 1NTOA 4CQMA 1XEAA 4AFNA 3FWNA 5U1PA 1UXIA 3D4PA 2PD3A 1LLCA 3ETEA 2W2LD 3PHHA 4M86A 1KYQA 2DAPA 2X0IA 3IIEA 4QT0A 2Q45A 1CQIA 3INTA 1NP3A 4G65A 4BNXA 4JNKA 4EEXA 2UYYA 1EE9A 4J7CA 5L3ZA 3D5QA 4XIYA 2JFGA 2CZCA 4P38A 1PX0A 5JCJA 9LDTA 1P0CA 1LRLA 2X58A 3BMOA 4JGBA 4W9NC 3KEOA 3JQ9C 3ZWYA 4AJPA 3SC6A 2Q1UA 2D59A 4ND2A 2AA3A 2DU8A 4DA9A 3R6DA 5DOVA 4WCFA 3G1TA 3TWOA 4FD3A 4Y67A 1VL8A 3PHJA 3Q9NA 3FF4A 4RF3A 3DBRA 5TGDA 3PGXA 4KWIA 1C1XB 5TIIA 3JYNA 5C7OO 1CF2O 3N58A 4CMAA 1FXSA 4YT2A 4XDZA 4PLVA 4BS9A 1TT5A 1ISHA 1E3LA 4TWRA 3LT1A 4OH1A 1H0KA 4QXMA 3JQ7B 1U8FO 1I2ZA 1BVRA 1P1FA 3B70A 1YE3A 1WW8A 4W82A 4QTZA 4BNFA 1NR1A 4B79A 2FPPA 5CDSA 2GLXA 1GUZA 2Y0DA 3IP3A 3P2YA 1Q0HA 2B4QA 2Q1TA 1QYXA 1WVGA 2Q2QA 3BHMA 4DQUA 4ESOA 3IUPA 4CMEC 5A9TA 4XD2A 5G4KA 3MZ0A 4MDHA 1E6EA 5DCWA 1T4DA 2OHXA 1MLDA 2UV8A 1LBEA 3GMSA 1YB1A 2D2IA 3LQFA 4BNLA 4R1UA 4BNHA 4WLNA 3DZFA 3ANMA 3OJ0A 2EIHA 5ICMA 3BYZA 3UUWA 2PR2A 4WK6A 3K5PA 4TVOA 2YQ4A 1ONPA 1VKOA 1GPJA 3IL2A 4DC1A 3O38A 4I5DA 3E8XA 2B83A 1N1EA 2Y67A 1XCBA 1WXDA 3X2EA 4Z9YA 3AFMA 1ZUD1 1AGNA 1WDKA 1Z75A 1DB3A 3ON5A 4ND4A 2VOJA 1P31A 4UREA 5AXDA 5K6AC 1UXKA 4PLHA 1G6KA 2CNBA 3W8FA 1KIFA 4FOOA 2VHVA 4KTTE 1KEUA 4XGIA 1WWKA 1YQXA 5ER9A 4E30A 2CF5A 3WICA 3OEWA 4YEDA 3RBXA 4LISA 5A4DA 4CODB 1GDHA 2NTNA 1R4MB 5JNLA 1KC1A 1QLJA 1K6IA 4XR9A 2FMUA 3QWHA 3JQBC 4UEOA 1UDAA 4BVAA 4ZN6A 1UJMA 4F6CA 3BA1A 1LC0A 4OJNA 5HA5A 3CINA 2QZZA 4NNJA 2C0CA 2VRCD 2UVDA 3DOOA 1GPDG 1OAAA 3DHNA 1T26A 1YB4A 2PZJA 3QVWA 3NDIA 4G81A 3V5NA 5TT0A 5B4TA 2D5CA 2BMAA 4J6FA 4TKLA 2Q2VA 4D42A 2PH3A 3T7EA 1UP6A 2I99A 3ZWXA 2VT3A 1T25A 4OSOA 2RH4A 3DDNA 4BNIA 4XB2A 3FRJA 1F8FA 1DHTA 2CD9A 3H3JA 3VPHA 4YACA 3MJCA 4FW8A 1FK8A 4BNVA 3BHJA 1B7GO 1DRWA 1HETA 3EY4A 3GRPA 3QA9A 4Y6PA 5T57A 3WG9A 3FI9A 4EUEA 1TEHA 1ZZEA 4PG8A 1EZ4A 3OM9A 1BVUA 2XAAA 2YY7A 2ZB7A 4INAA 3F1LA 2Z95A 3GGGA 3PHGA 3MJEA 2DBRA 4ZD6A 4CM7A 4PRKA 5GZ6A 2D4AA 3Q6IA 1EVYA 5DDIP 2OOSA 3WIEA 1VJ0A 2EW2A 4OL9A 1DC6A 3H65A 3PWKA 2IZ1A 1LSUA 5KVQA 4L0QA 4RPKA 1Y5MA 1U7HA 4R9SA 3G1UA 4HV4A 4II2A 3WNVA 2Q1WA 1WAMA 3E5MA 4O1MA 1Q0LA 4D46A 1A4IA 1HLDA 2IODA 1HE5A 3LLSA 4IZHA 4YJFA 5A3JA 4R51A 5JDIA 3F9IA 2Q46A 3BMQA 4JBIA 2CVQA 3NX4A 1UP4A 1G0NA 2W98A 4I5EA 4CL8A 4N5LA 3WB9A 2H5LA 2F00A 1K5HA 2QIOA 2YFHA 1TA4A 1DLIA 1ENZA 1Z7BA 2OP1A 3IQDB 3H4VA 3O8QB 4XRRA 5HS6A 5L7WA 1OI7A 1DFGA 4HUJA 1PSDA 4ROSA 3WYCA 1JVSA 5B37A 4YJDA 1V3UA 3ENNA 1FDUA 3PTZA 1XA0A 2E49A 4BNWA 1KEWA 2H1SA 2OP0A 5L95A 2J3KA 3RJ5A 2FRDA 4BQPA 1ULSA 4GQAA 5LDHA 2Q99A 3QY9A 1SB8A 3DMYA 1U3VA 5CEEA 1HRDA 1UZLA 3AI1A 4N5NA 4O59O 4CM8A 2PZMA 5JLAA 1NVTA 3GPDG 1Q1NA 4HKTA 4O5OA 2H9IA 3GZNB 2YYYA 1C1DB 3PYLA 4AJJA 4BO7A 5IDQA 4GSLA 2VNSA 4CMHA 4IJVA 1U5AA 3GDGA 2VYND 5C7LO 3KVOA 5JBIA 1X1EA 3L4BC 5L4LA 5HS4A 4ALLA 1F0YA 4OAQA 5I8ZA 1AXEA 4IQ8A 4F3YA 3ROKA 4YWJA 2VNAA 1PL8A 2OL4A 4XYGA 3W4JA 3U0BA 5B4VA 2HKIA 5EERA 2TMGA 1BHSA 1SB9A 4BL5A 1LU9A 3RASA 1SNYA 5G0TA 2JHGA 3TDKA 4I5FA 3ZWBA 2DUWA 3FNFA 3GVHA 1YWGO 2EF1A 4Z9XA 4CLXA 2PD6A 2YV1A 4F46A 3MJSA 3H9EO 3VH4A 2W2KB 4IIVA 3DHEA 3KYCB 2ILTA 4O0LA 3FSRA 3H3FA 4E3ZA 3R0IA 4KDEA 4MP8A 1U5CA 4F6LA 4Q3CA 1Z73A 2ZCUA 4J49A 1P77A 2J8ZA 4I9UA 4ALIA 2Q4BA 1PQUA 1ZSYA 2DBQA 1JQBA 4JP2A 5BSFA 5HM8A 1XIVA 4Q3DA 3SJUA 1DDOA 4IJKA 2I3GA 3I52A 4WCFC 4B3IA 1RM4A 4TRMA 4YQZA 3OJEA 1BGVA 2POQX 2ZQYA 1SAYA 5KVVA 4D79A 4I9HA 2OBNA 1P3DA 4XGNA 4Y98A 2VCYA 4TRRA 3ANNA 1JVBA 3OBBA 2SCUA 4PVCA 2HMUA 1PZEA 4D3SA 5A5EA 4DPKA 4Z3DA 3K92A 1V35A 1B0AA 1JA9A 1RWBA 1YRLA 4M87A 3W4IA 1V8BA 1X7GA 2JD0A 4U0KA 1R6DA 4A10A 4YRBA 3ENKA 4OM8A 4B4VA 4RPGA 3I1JA 5JPIA 3D4OA 3KHUA 1HYHA 3MCVA 1ZJYA 4QSMA 4L4RA 5DN9A 3ZNNA 3M2TA 4GGPA 4DMMA 5T67A 2WD7A 3FR7A 4R4JA 1EVZA 4LVCA 2AHRA 3ZHZA 1LEHA 3V2UA 4MVJE 4IS2A 4IDDA 3U4DA 4WPGA 1J4AA 3HQ4O 3CTMA 5JS6A 2FR8A 4BO3A 5THKA 3AM5A 2BELA 5A9SB 1B8PA 2DTDA 2FSVA 3RC7A 4XB1A 4FFMA 1M2WA 2HU2A 2Y99A 1AXGA 1B16A 3DB2A 4BKUA 3CUKA 3IP1A 1VSUA 4WLOA 4BKRA 1OC2A 3JYQA 3FBGA 3TZHA 3KV3O 4EDFA 4DQXA 3SC4A 1KVRA 1KERA 3H9GA 3O4RA 1XU9A 3QVOA 5JDCC 1L7DA 3UGKA 3SLKA 4XQEA 2IZZA 2VZ8A 5KKCA 1H6BA 4NPCA 1HT0A 2P68A 3QLJA 2CUKA 5KJFA 2AG8A 2GN4A 5JXWA 4UUPA 4XRGA 4RLHA 1ZK4A 2ZJ0A 3H5AA 5EINA 2YJZA 5IZCA 4PN3A 4YCAA 4ND3A 4NIMA 4ZQFA 6LDHA 1KVTA 2ZB8A 4IDEA 2C2XA 2GERA 3BTVA 3DXFA 3OJLA 4LK3A 4CR7A 4DLBA 5ITVA 2AEFA 1DIBA 4HXYA 1KEVA 4E5MA 2GPTA 4TVBA 1XHLA 1KY5A 1AHIA 2AE1A 4YT8A 1HLPA 4W7IA 1YGYA 2FY8A 1WNTA 1ARZA 3F4LA 1HWYA 5GY7A 4GBJA 2VRCA 1A4UA 1EK5A 2Q50A 4EZBA 1UUFA 2QRJA 1XELA 3B1KA 3F46A 4IS3A 3ZV4A 2PFGA 4TRNA 3PJGA 2CSUA 1O6ZA 1GADO 3UVEA 4NI5A 1P1JA 5CDGA 3NTOA 1I3KA 4OXYA 3HFSA 1WZEA 3NJ8A 3GNSA 3NAQA 4MIYA 5GZ3A 1ZNQO 3LK7A 3DAFA 3TOZA 2P9EA 2O4UX 1NVGA 1BMDA 2G76A 4NMHA 4CQLA 3KSDO 3LU1A 3Q1LA 5IJZA 1B2LA 1PGPA 4WECA 3GRKA 3KUXA 4GSKA 3NDJA 3DC2A 1PWXA 1QR6A 3BMCA 4HFNA 3I23A 2GF2A 1V3TA 4FFPA 4DYDA 3OSUA 1BRMA 3TZCA 2VHZA 4CMGA 2VRBA 4AVYA 1IHXA 1QLHA 3DAPA 1I8TA 2V7PA 2G0TA 4IQ0A 3JD4A 2AEMA 2JKVA 5JDIC 4U0JA 1P33A 1PQWA 1T24A 4XR4A 3B20A 2FN7A 3OHSX 4Q3EA 1LRKA 3QV1A 4OO3A 4YAGA 3PDJA 3INRA 1DO8A 5U4QA 3PLNA 5JYDA 1GEGA 3ASVA 3RUFA 5KTKA 3KLMX 1RYDA 2VTEA 3KYDB 1N1GA 3FBTA 3AWDA 3GEDA 4QO7A 4DIBA 3NT4A 4B7CA 4EJMA 2H63A 1O94A 1H6CA 3B1JA 2C20A 1E3WB 3OIFA 1Y7TA 3Q2KA 5JC1A 4IDCA 4PLFA 5I7SA 2I3AA 4XX0A 1X7DA 1MB4A 3O03A 5I7FA 3AUAA 2BH9A 2R2GA 2PLAA 2FR1A 4OMUA 4CLEA 3PQEA 2ZTUA 4JXKA 1E5LA 3ZWOA 4J43A 4DPLA 3HWRA 1K6JA 4H16A 1IHYA 1XG5A 4AJ1A 1PS0A 1GUFA 1I5RA 1ZVMA 3QJ5A 1VE9A 1P1HA 2I65A 2HCTA 2VUSA 5BNTA 2VYNA 2JD2A 1YOVA 3NUGA 5L9AA 1Q7BA 3RIHA 1O89A 3DL2A 2YV2A 1KEPA 1QYVA 4R3WA 4RF5A 3UCFA 1JKJA 3DBHB 2ZTMA 3OJFA 3ORFA 3E9QA 4JJFA 4NQZA 3WJ7A 4QX6A 5A02A 3OFSA 2ZJ1A 5CDTA 1SPXA 1GUYA 2NU9A 3JV7A 3RC9A 1CIVA 2O3QA 1O0SA 1W73A 3SBOA 7ADHA 2YDYA 3VAZA 5ICSA 3WXBA 2Y66A 1OOEA 5KNLA 3OIGA 2QYSA 4FS3A 3C1AA 3NDRA 1BG6A 1DIHA 2X1HA 2AQKA 5CFZA 4PLPA 2NU8A 2WYUA 1WDLA 5AXAA 3HE3A 1A7AA 3FD8A 4IDFA 2VOEA 2Y1CA 2O3UA 2EV9A 5KJ6A 1R4NB 4OXNA 1PJ4A 1X15A 3ZDFA 3D1LA 1GCUA 2I66A 2VZ9A 4E2ZA 2X23A 4R1TA 4K6FA 3ICCA 4R68A 2PKQP 4LSWA 3TJRA 1IZ9A 3MJVA 2Q1SA 1ONNA 4I08A 2HJSA 1H9AA 5F1KA 3C1OA 4J0FA 1EVJA 3DBVO 3W4KA 4GX1A 1XDWA 1DIGA 2BGMA 3AUUA 4J4BA 1JTVA 1Z45A 3QHAA 4EITA 4QUKA 4XYLA 1IL0A 4WNIA 1JN0A 5DF1A 3V1UA 4RDIA 4J3FA 4JN6B 4NDNE 2ZB4A 4EJ0A 2J3JA 3ZU3A 4HY3A 3R3SA 4CMIB 5KJ1A 3GUCA 4CM1A 1ISIA 5IG2A 4X54A 4JIGA 1NHGA 4BNUA 4TZKA 2NTVA 5JO0A 1A71A 3G49A 2C29D 3AFNA 4L4SA 4NJMA 4D0SA 1PJ2A 4LMPA 1NBOA 2DM6A 4IGFA 4XEHA 4RCVA 3WMWA 4KMSA 5G4LA 5COAA 3TRIA 3DZJA 4YYZA 1C0LA 2EJVA 2PTGA 3S2EA 1B8UA 5TJHA 3H5RA 3AU9A 1LUAA 4GX5A 1PJ3A 2X8LA 4TRJA 1A9YA 4FPXA 4DIOA 1W0CA 4WNCA 4CQMB 1EBUA 3CMMA 4M1QA 3PI7A 1M67A 4CPDA 3H5NA 3VKVA 3AOGA 2YHIA 4IY1A 2C5AA 3ZW8A 5JW6A 4YA6A 5KKAA 2GN6A 4HFRA 3RD5A 4YXFA 4IINA 4NG5A 1QV7A 3PZBA 1IULA 5IZCC 4D3DA 2E37A 3JQCA 2J5RA 4M8SA 1MV8A 2VUUA 3L6OO 4L8VA 4BKOA 1UDBA 1DC5A 3L9WA 2ZTVA 1SEPA 4E4YA 2P2SA 1HDCA 3FPLA 3OH8A 2DPGA 3ZCXA 1F12A 3VHRA 3V8BA 1HDGO 3ZHXA 1IZ0A 4OKIA 3FR8A 1YJQA 4BV9A 1FMCA 1NPDA 3HSKA 4ZQGA 4WCDA 3WSVA 3G3EA 3IUSA 4BO0A 1LDYA 1EFLA 4WCFB 3DMTA 2B4TO 3FCOA 3ZV5A 4DIFA 4DTIA 1J6UA 4BO4A 4HFJA 1GV1A 1PJQA 3D3EA 2AXQA 3WWYA 3GT0A 3IKTA 2ET6A 5BSEA 4J2OA 4XYBA 3VPFA 1R66A 4HWKA 1OBFO 2OORA 2WM3A 4MVJD 2DBVO 3C3XA 4D44A 1T2EA 2V6FA 4HNHA 3E03A 3PLRA 4JQCA 2OXIA 3W6ZA 8ADHA 5F5NA 1TT5B 3WWZA 4FGSA 3IJPA 2ZYGA 1U28A 5B1YA 1B26A 3AY7A 3JQ8A 3QVTA 2C5EA 3QRWA 4WOKA 1LNQA 2VWHA 3CZMA 3ZHBA 2X5OA 4AJEA 1CYDA 1QG6A 3PEFA 4HBGA 4Q9NA 4YAEA 3D0OA 3BIOA 5G4KB 1PS9A 4Z0PA 3H9QA 3JQGA 4MVJM 3VH2A 1V9LA 4P4NA 4WOJA 1EBFA 1IB6A 4CLOA 1PJSA 3Q0EA 4GMFA 5DULA 3NT2A 4C7JA 1FDSA 4CR8A 2IEDA 3ADOA 4JJGA 4B4OA 4CUZA 2C2YA 3B6ZA 5A3VA 1PZGA 4ZRMA 4U6QA 5IN4A 1DRVA 1GFSA 4IDAA 1Y8QA 2UDPA 2ZKLA 2I67A 1ISJA 1DPGA 2X86A 4KOAA 2IEBA 4Y9DA 4H7PA 1NAIA 3JQEA 4W6ZA 1NFRA 4Z3KA 2R00A 5KCZA 1SMKA 1YONA 2PNFA 4PCVA 3ZWMA 1U3TA 1MXHA 1HZJA 3GOHA 4AJIA 4YJHA 1YKFA 2DLDA 1A7KA 4BNTA 4A2CA 4JJIA 1LLDA 2O48X 2D1YA 5A05A 1F14A 4C4OA 2PGDA 3ONDA 1E92A 3PPIA 1P74A 2VZ0A 3JQ7A 2JAPA 4J1NA 1Q7CA 1RM0A 4LW8A 3NKLA 3RFTA 2QG4A 4IJWA 3AY6A 5H83A 3LZ6A 1O8CA 3AK4A 4PG4A 4ZQHA 4J4TA 5KJCA 2YZ7A 2EEZA 3T4EA 1CRWG 5TT1A 4ND1A 4J91A 3GFGA 2CVOA 4BNJA 4LRSB 5I7VA 1ZKMA 4CLDA 4O63O 4PVDA 2NLOA 1ZSVA 4J1TA 4CM4B 4UULA 3VTZA 5F1PA 3KM0A 4W7HA 8LDHA 5IN5A 1BSVA 1E1KA 1X1TA 1C0KA 3ASUA 1I0ZA 5BNFA 3TZ6A 4BNKA 2I6TA 3GG2A 3WX0A 1KOLA 2PKQO 2EKLA 1OMOA 1R15A 2VHWA 2WTBA 3ZNQA 1YL7A 1GYQA 1I2CA 2B5WA 3DBLA 4ONEA 4Q3AA 4CR6A 3AU8A 3QSGA 1HSOA 2Y1GA 3TFQA 1CEQA 3JQAA 4RLSA 1Y8RA 3DZIA 1YQGA 3KSUA 4JCOA 2F1KA 3VTFA 1ZK3A 1IUKA 3AM3A 3ULKA 3AJRA 2BFPA 3ONEA 1H93A 1NM5A 3T4XA 2Q4EA 1LSJA 1YH3A 3I9NA 3KBOA 2DQ4A 5HTOA 3VOSA 1HYEA 3JD3A 1R4MA 2DFDA 4BO6A 2EJWA 3RVDA 1LC3A 4RVUA 1HDZA 1TB4A 5TQVA 3ADPA 3A4VA 1H6AA 3GDFA 3HG7A 5IDXA 3VZRA 1ZEJA 3RU9A 4DPMA 1M66A 3A1NA 1HYGA 5G2OA 3OEYA 3W8EA 4J16A 2I76A 1B14A 4WKGA 2VWQA 5C37A 2X0JA 1UH5A 3GA0A 1S7CA 4BNNA 4RL6A 1PEDA 4ALNA 5G0UA 1U2GA 4WLEA 4YRDA 3UCEA 1L7EA 1E5QA 5CG1A 2CFCA 4B4WA 2W4QA 3PWSA 1R16A 3JYLA 3UKOA 5JY1A 2QQ5A 3DZGA 2E82A 3DZBA 1R0SA 2WEKA 3C7CB 3GH3A 4CLRA 2NQ8A 1YBAA 2EERA 3GNTA 2JFHA 4CM8B 4ZHSA 3U3XA 3TF5A 1J5PA 1CERA 2BFAA 1R0LA 1E1NA 1R12A 1LRJA 4WLVA 2HAEA 4FQ8A 3HUDA 1E7WA 4G2NA 4J9VA 4RV9A 3HB4X 5TJ9A 4FJ2A 1ENYA 2YDXA 3PJDA 3U5TA 1YO6A 1ZIDA 3KSZO 4CMJA 4PLYA 1NX6A 1XQ6A 2JD1A 2B4RO 4ZU3A 4BO8A 4DL9A 4EEZA 4YPOA 1OZAA 2QRKA 3BTUA 3MTGA 1H5QA 2PGJA 1JWBB 1EUCA 3TZQA 2BFMA 3CMCO 1MP0A 3FNEA 4XYEA 3GK3A 2WE7A 3WGGA 1PGNA 1TLTA 1DAPA 1FF9A 4J1QA 2Y1EA 1YL5A 2Y93A 3DZKA 1TT7A 4J7UA 4PG7A 4QECA 3UHAA 1J0XO 2E4AA 4W4TA 3LT4A 4IXTA 4NFSA 4NZ9A 2O3SA 4RORA 4JLWA 1YBVA 4YT4A 3BMNB 3K8ZA 4L4XA 4DMLA 5L45A 3HN7A 4TSKA 1X14A 4AJ4A 1MG5A 1YDEA 1Y6JA 4J90A 1N92A 2W2LA 3DMTC 5JMPA 1MUUA 2CF6A 3JYPA 2A92A 5L7TA 4ZICA 3GZNA 2E48A 5JAZA 1C1DA 1SZJG 2AEJA 3CE6A 2BI7A 1NR7A 4GKBA 4E5KA 4PG6A 3UCXA 4YRAA 4NFHA 2JCYA 4E0BA 3WGOA 4LCJA 2X22A 2V6MA 1YVEI 4E5PA 3INGA 2QW8A 2AQ8A 4HADA 3ZU2A 3PIIA 4ND5A 2BHLA 3ZWNA 1ZK1A 3JD1A 4Z0HO 1GY8A 5IXSA 3QW2A 4CM3A 4NBVA 2LDBA 4BIIA 2Q2WA 1Q7GA 2A94A 3DTTA 5AOVA 3RUCA 3ZGYA 2UUOA 1R37A 1FDTA 1ZBQA 4R3NA 1EQ2A 2WD8A 3KYBA 1M6WA 1MC5A 3ICPA 1VI2A 2WD7B 1U4OA 3G79A 4KWHA 3GVXA 4RGBA 4JROA 2GNAA 3BHIA 5C7IO 5IXYA 4WGGA 1JKFA 1V3VA 1WPQA 3VVBA 1NXQA 2W2KA 4E5YA 4MVJG 3OMLA 1AHHA 5CHEA 3WGQA 4E6PA 1GQ2A 2RHRA 1UXHA 1JLLA 2DPHA 5AYVA 4I1IA 3FHLA 3ROMA 3NYWA 4MJLA 4RZIA 2WJPA 1IYZA 5DOZA 1GL3A 1HDXA 1SCUA 4YDRA 3BTSA 3GN1A 2CY0A 2PY6A 2WWRA 3GLQA 2HDHA 3PYMA 2AG5A 1VL0A 3PQDA 2GGSA 1SC6A 5BR7A 3ZU4A 2G1UA 2JCVA 1G0OA 4Q39A 3S1LA 3DHYA 1CQJA 4GX2A 5K0ZA 5ER6A 3RFVA 3BTOA 3GZ4A 4D3FA 5HBRA 3D5TA 3K2BA 1PR9A 6ADHA 1LA2A 2VWGA 2ZYAA 1RM5A 3Q2IA 1HEUA 1N5DA 2GN9A 3FWZA 3NTQA 1VJTA 2NWQA 4Z6KA 1BXZA 1Y1PA 4UAGA 2C59A 4B4UA 3GMDA 4UEKA 1DAOA 3H9JA 2HK7A 2WDZA 4XIJA 3QQPA 1P1KA 2Y68A 3L77A 1N8KA 1I32A 1T1RA 2JHFA 5CDUA 5A04A 1I36A 5JCXA 3GFBA 2PK3A 4NBUA 3JCZA 4IXWA 4MP6A 1Z7EA 2BGLA 1BXGB 4WEQA 1CJCA 1X13A 1HTBA 2EKPA 3E6AA 5T64A 1J49A 3KXDA 3OA0A 4FOSA 4UVGA 3VZPA 4LRTB 3VH1A 4PZCA 4YT5A 4NK5A 1DJQA 4UVIA 2GZ1A 1YS4A 4WASA 2RHCA 4PLCA 1Z74A 3H2SA 2X0NA 2C7VA 3PHLA 2FHSA 3HHPA 1ULUA 2EXXA 2NACA 4CMCA 1DBVO 4WJZA 3BMCB 3LVFO 4J0EA 1LTHR 3ITKA 3TSCA 4KZPA 1U2DA 4GVXA 1JW9B 1LLUA 3C1TA 4OSPA 4JBHA 5JCJD 3KLPX 2OUIA 2FSSA 1VL6A 3VH3A 4ALJA 1NQ5A 5L53A 3I9OA 1U3WA 1N9GA 3OQ6A 5B4UA 2FPIA 4YAIA 4QO8A 4N18A 3MEQA 3GVCA 3DFZA 3TQHA 2O4CA 1ML3A 2NTJA 2OMEA 3D4NA 4XGKA 3VPGA 1ISFA 2EW8A 2AW5A 4II3A 3WGHA 4BGIA 3C24A 3W6UA 1ENPA 3ONFA 4JBGA 4A73A 1KETA 3I9MA 3NV9A 4B3HA 1JKIA 1LQTA 3PFFA 1NHWA 4LVUA 2NVBA 2V65A 1ISMA 1F17A 4IZIA 1IOLA 1AE1A 4RF2A 3RKUA 3WYEA 1NQTA 3VPXA 4ALMA 1U7TA 4NJOA 1E3EA 2RCYA 1DIAA 1LJ8A 1NFQA 1O95A 1SEVA 3GEMA 3GN2A 3PXXA 3RROA 3U49A 5TSDA 2PA3A 3UFXA 4DBVO 2CMDA 3ZNOA 3M2PA 3EMKA 3MJTA 4E12A 3WSWA 1PL6A 4KTVE 2HRZA 3EZLA 4PFJA 1V6AA 2WYWA 2P4QA 1MFPA 2IRWA 3LC2O 3RAJA 3LF2A 5KOIA 1DIRA 1DC4A 1AUPA 5FEUA 3H9UA 2OFPA 3C7DB 2HK9A 4L9RA 4PLWA 1IE3A 1YOVB 1GZ4A 3ZI0A 2XXJA 3EYWA 3RWBA 2FPGA 3H2ZA 4AJ2A 1C0IA 3E48A 3UAGA 3L6DA 3U4CA 4YJGA 4CMBA 1NQOA 3HDYA 4LSMA 5KVCA 2GSDA 4BMSA 3V1YA 1AN9A 4TZTA 3OQ1A 4E21A 4A0SA 3K2EA 3GHYA 1GZ3A 1GTMA 4J7XA 2NUAA 4IQGA 3OECA 4K28A 1DXYA 3WLFA 3N7UA 1ZO8A 3KYDA 5LC1A 4AG3A 3P7MA 1UZNA 3PWZA 3S55A 1M6HA 1QSGA 1O5IA 2VHXA 5K9ZA 1H94A 1X7HA 3D3WA 5DBGA 3L4SO 2B35A 4M49A 2NVWA 5COBA 4BO5A 5HWSA 3WOHA 4R01A 1R0KA 1E7QA 5F3RA 1ZFNA 5IZ4A 3K31A 4FB5A 3LC7O 3GVIA 1VJ1A 2X5KO 1QYDA 1Z6ZA 4AJKA 3RBVA 5IDYA 1I01A 4L74A 4BO1A 3WFJA 3HADA 5L4NA 2G82A 2HSDA 5BT9A 3LT0A 1GU7A 1OFGA 5CEFA 3OF2A 1QORA 3GNQA 1UXGA 3IKVA 1I3MA 1ZJZA 3DOCA 2X9VA 4XA8A 2I5PO 4IMRA 3QWAA 4GI2A 4FGWA 3T7CA 1RJWA 1CWUA 4MVJI 5A06A 3BXXA 3N74A 1BW9A 3L07A 1UZMA 3WBBA 2VHYA 3U9LA 1XKQA 2PKRA 4U8GA 4J9UE 4BNZA 5TC4A 2AE2A 2I9PA 4NJMB 2EP5A 5T8KA 1ADBA 4BGUA 1ZEMA 3I9LA 4OYRA 4BKPA 5CDYA 1T4BA 4IGEA 2P91A 3NTRA 3KOUA 2X5JO 4DREA 5F1OA 5AXBA 1R4NA 1HSZA 3M6IA 3ZV6A 2NVUA 4RJTA 2BFOA 2A4KA 4CV1A 3G0OA 2D5AA 4U6SA 2GN8A 4FC6A 4FCCA 3WJAA 4AICA 3E9MA 4E2XA 1Q0QA 3X2FA 2GZ3A 3B1FA 3DONA 3PJEA 2P9CA 1E3JA 2YQ5A 2O7QA 4R41A 3PK0A 3F47A 3RUHA 3Q11A 3DQPA 1X0XA 2BI8A 1VLLA 1MG0A 3LC1O 1Y81A 2P5YA 2Q3EA 1H2BA 4MVJH 4CMKA 3SXPA 3PHIA 3MTJA 2AQIA 1QXSA 1HL3A 4WEOA 4UUNA 4RQUA 4QFCA 2PD4A 2HLPA 5BSHA 1H6DA 4UVEA 3ZZNA 4CMIA 4GL4A 4I8XA 2DT5A 2Y1OA 4NBTA 4W99A 2NSDA 3UXYA 3IC5A 5ITWA 4K26A 3FTPA 1PTJA 3EDMA 1W8DA 4EGFA 3BMOB 5ENDA 1RYEA 4MVJP 1GEEA 1U8XX 4BO9A 1EDZA 3WQRA 4DWVA 4EI2A 1P44A 1RKXA 2ZQZA 3EVNA 1MXFA 1ADGA 1EFKA 4E31A 2A9FA 1H2HA 5MGBA 3QIVA 3JQ6A 5L51A 3C85A 3R1IA 3DBRB 1JAYA 4BO2A 2NM0A 4NHEA 2NU7A 4YB8A 1PS8A 5L40A 1P0FA 4CM6A 4RZHA 3PDUA 3WLEA 3EK2A 3I9KA 1WLYA 1M76A 3JQGB 5CP8A 4PIVA 5GZ1A 4AJHA 1I3LA 1KVSA 3QWIA 4DYVA 2GZ2A 4J1SA 4IDBA 1BDMA 2IYPA 3I6IA 3E1KA 4Z9FA 4CLOB 5DT9A 4EBFA 4KQXA 3HDQA 4O6VA 5FI5A 2DTXA 1P1IA 1E7SA 4CV0A 1HKUA 4BB5A 5JE8A 2D0IA 1C0PA 3DTYA 1XLTA 5THQA 4OKNA 4XQGA 1Y8QB 3CSDA 3QVSA 2BGKA 5DNAA 5T6BA 1LX6A 2FOIA 4KP7A 1T1SA 4E2WA 2DVMA 3I6QA 1K89A 4RO0A 4FBGA 3FNHA 4D43A 1VM6A 4EYEA 3GR6A 3LT2A 2P9GA 5EL0A 2Y05A 3JTMA 4LN1A 4YJHB 3VVCA 4HX5A 3RUAA 5ADHA 1LLQA 1PJBA 1IPFA 1DRUA 2B69A 5TRTA 4CV3A 3MWEB 4Y8VA 1F8GA 4FFOA 1Z82A 1ONOA 4L76A 3M1LA 1CDOA 1M75A 1K0UA 4R16A 3WGZA 4BNMA 4N54A 4ZVVA 2HUNA 1NYTA 1C1XA 2OGUA 5FI3A 4C7KA 1LSSA 1O9BA 2PV7A 4XCVA 3E9NA 4EW6A 4TQGA 1KC3A 2FZWA 2ZTLA 3Q9UA 5T5QA 3TL2A 2CDAA 4IBOA 1NFFA 3GUYA 4E13A 3AUSA 5I9NA 3ZWVA 5I9LA 4OGWA 3TN7A 5AVOA 1DFHA 1W6UA 4CV2A 4CUJA 5G0WA 3OIDA 2GASA 1Y9AA 3W1VA 1ID1A 3ROQA 3E82A 4JK3A 4JX8A 5FFFA 2DKNA 2GCGA 4P22A 1PJLA 5F21A 2ZCVA 2CDBA 3DWFA 4URFA 4KUGA 3VC7A 3S2FA 3DBLB 3KB6A 5IDWA 2BRUA 4DVJA 4XQCA 3JQAB 2PH5A 1Y8RB 1B3BA 4FIZA 3WGIA 2P4HX 3JD0A 3MOIA 4TMFA 1YXMA 5FYDA 3ITDA 2UAGA 1GQQA 5JDCA 3Q3CA 4RPHA 1YDWA 1ZCJA 4PRLA 3WR5A 1HXHA 5COQA 2VT2A 2O3RA 2C07A 3IS3A 2ZB3A 4Q3BA 3SEFA 1UXJA 1JDJA 3L9XA 5EN4A 3S8MA 5I8WA 1I3NA 3NEPX 4ALKA 1ZMOA 3TPCA 3RJ9A 3DZHA 3K30A 3PIDA 1SOWA 2IXAA 2X0RA 5HRUA 1U4SA 2Z1NA 3QWFA 5BNIA 3H8VA 5MDHA 3FN4A 5CPFA 4KUHA 1XYGA 1KBZA 4DBZA 4B7XA 2HRBA 3GQVA 3V2HA 3QWBA 4QFDA 3AI3A 4FFLA 5EJ2A 3O9ZA 3FPCA 2OZPA 4D7AA 3O26A 3CIFA 1L1FA 1PZHA 1LQUA 3K73O 3EHEA 4MPDA 3CPSA 4J2HA 4YJFB 1EDOA 3ZH2A 3BMQB 1EQUA 4CM4A 3JD2A 4KQWA 3CH6A 4ITUA 3BZUA 4YBZA 3EC7A 3WYBA 3GEGA 3K9QO 1GCOA 1HDYA 1HZZA 4YR9A 3PVZA 1EK6A 2D8AA 3I5MA 1E77A 4L73A 3SLGA 4CLRB 2X9NA 1JU9A 4FJ1A 4BOYA 1D1TA 3WBFA 2GYYA 1TVEA 1ZK2A 3AOEA 1PZFA 5T8KC 4RPJA 2HK8A 3WFIA 3IJRA 3P19A 2GDZA 4CUKA 4A7PA 4UUMA 5JY6A 1ENOA 4DLAA 1DHRA 3U62A 1A9ZA 4E5NA 1LDEA 2IDZA 2WSBA 3JQDA 2VQ3A 2Z5LA 5KJEA 3TZKA 4MIOA 3UF0A 2PGLA 4RVFA 3WNQA 4IIUA 9LDBA 4IJUA 2OO5A 1PJTA 3NRCA 3SVTA 2QX7A 5BQFA 4NK4A 4CLHA 1EUDA 2IXBA 2NNLD 5LDGA 1NPYA 4UVHA 2B36A 4EJ6A 4NH4A 3F4BA 1XU7A 1RPNA 4J4HA 4PZEA 1NNUA 2JAHA 4RQTA 4RDHA 3V2GA 3COSA 1EUZA 2H6EA 1N2SA 2CVZA 4OXKA 4BQRA 1A72A 4BMNA 4ZA2A 2FR0A 2G5CA 4CM9D 5CPBA 1NWHA 1GYRA 3ZHYA 3WIDA 3CZRA 3GPIA 3QE3A 3WMXA 1GZ6A 3MJ4A 1KVQA 3PRJA 1ISGA 1YBMA 3O8QA 4XKJA 5DBFA 4KDFA 4R54A 4PLGA 4DGSA 1EEHA 3WDSA 3ZV3A 3ZWPA 2RBEA 4H3VA 3I9JA 4RF4A 5TNXA 2AMFA 4FR5A 3SX2A 5DP2A 2O2YA 4YVFA 1I33A 2Z1MA 1CETA 1Y5RA 4MP3A 4FSHA 5BSGA 2J3IA 5JAMA 5DP1A 4GLLA 5H81A 4GMGA 5LCXA 4UVDA 1U1IA 3SJ7A 3ABIA 1PU2A 5JAQA 1LDGA 3D64A 5U9CA 2P5UA 4UUOA 1T2AA 2O3TA 1UAYA 3R3JA 5DBIA 4E32A 3ROPA 4MINA 1HDRA 1E7RA 1U9JA 4U7WA 4MO2A 1BTOA 4N5MA 3RSHA 2J3HA 4L75A 3WQQA 3LYLA 5CAEA 3OICA 3WS7A 2PZKA 1JWAB 4WE3A 3LLVA 1W4ZA 1TI7A 5AXCA 1E6WA 1Q2XA 1SOVA 1XQ1A 3LDHA 3QVXA 4GH5A 4MVJA 2HJRA 4NBRA 4S3MA 5KIAA 3U09A 4HP8A 4N7RA 2DC1A 4FN4A 4D41A 1QYCA 5JMWA 3EW7A 3P2OA 5ILOA 3L6EA 4EUFA 2YW9A 4MIEA 5JO9A 3RUEA 3GVPA 3BMNA 4MVJF 4RVSA 1QRRA 2LDXA 2NQTA 5CG2A 1B15A 4H15A 1PWZA 4B7UA 4ZGWA 3UN1A 3KRTA 3EUWA 1FDWA 2VUTA 4OOFA 3ZN2A 5A03A 1F06A 1QV6A 3CKYA 3W8DA 3U4HA 3KYCA 1SO8A 2HQ1A 3H7AA 4BMVA 4E2YA 5B12A 2EWMA 4I9NA 2JFFA 2EG9A 1NQAO 1WMAA 1QYWA 2X4GA 4PLTA 4XDYA 2X7HA 1VKNA 3HZZA 3ZWCA 3I4CA 4RVGA 3D7LA 3PGJA 2HMSA 2V6GA 4NR0A 4XJSA 5ILGA 2E6UX 1Y9EA 1B8VA 4NU5A 4AJLA 4BHTA 1P1RA 5C5IA 1PIWA 1VRWA 4RVDA 5TX7A 2GO1A 4D0RA 4OQZA 2QYTA 2R00C 1G1AA 3A14A 1E1LA 5F5LA 3GY0A 4DQVA 4UEJA 3HNPA 3C8MA 5A1TA 3GHHA 4WLUA 3EVTA 3F1KA 5I9MA 3VKUA 4R1NA 2DFVA 1FJHA 2A35A 3PYXA 1NVMB 4FFNA 4BB6A 1MX3A 2YHUA 3AM4A 5EIOA 2BLLA 3ZWAA 4Y6RA 4A5OA 1GV0A 3HDHA 2Y1DA 5IAAA 1QKIA 4EUHA 5DCYA 2Y1FA 2Y0EA 4ZRNA 5JAIA 5KWEA 4XZ3A 1D7OA 3JYOA 5GMOA 1C3VA 4GLOA
chains in the Genus database with same CATH superfamily
1NZDA 2JK0A 2QR2A 1SM4A 1FNMA 3G1WA 3N2EA 3BWVA 1GYPA 4KMRA 4P3PA 4C89A 4DLLA 1VQ1A 4UU8A 3ZNPA 3GUZA 3RU2A 2B9VA 2P4EA 3GG9A 3GLGB 3EPPA 4S1NA 3EEYA 2BRUC 1GXSB 2UZIR 3U9TA 5FBVB 1ZMTA 1WMBA 2VT6A 4QYTA 1GCGA 1CNMA 1ZVQA 4EY6A 1E0DA 4PC6A 2E5LB 1F5SA 2PA0A 1FFXA 5AOAA 3F7MA 3VR3A 4JI4B 1KI7A 2EIXA 3WTBA 1YULA 3VDQA 1YZLA 4FN5A 4FI3C 4YXWA 4TZ0A 1L7QA 5LP6A 3TBKA 1ZM3A 3QX8A 1FYFA 3E18A 4NPHA 5IFLA 1M5UA 2FV8A 2G1JA 3JQFA 3HJTA 3WKEA 4BXOB 1KY4A 4ZTBA 1U7DA 4CQLB 4HFMA 5EQFA 4ARBA 3WYNA 2Y77A 4RVOA 1ZLYA 2QUBA 5D5QA 5JROA 3ICQB 1SCIA 6GPBA 2B1JA 2QRLA 1D1SA 3L0OA 1B1CA 3TOVA 2P7IA 1LDBA 3CZAA 1U1FA 1JGTA 1LW6E 4KGXA 4OH7A 3UJ7A 4EG5A 1HOTA 4DN6A 2WM2A 2E0IA 4DG5A 2JFPA 4LF6B 2O05A 5FOTA 4A36A 1WQ3A 4G9GA 4CRWB 3DWIA 1YR7A 2IX3A 3IHWA 3IR7A 4QFBA 4MKRA 4GWGA 3SD7A 4MW2A 3EAQA 2Q5OA 4ZXFA 1Q1QA 3AGQA 3QPCA 3CZ5A 621PA 3OTIA 3CW8X 3T0IA 5FUQA 3ABRB 2AKEA 1E0AA 2QG9A 1KMCA 2XPCA 3U4IA 5SZKB 1BXGA 3UOGA 3RFXA 1CJSA 1Y80A 3A4MA 3BM5A 1GQRA 5G0VA 4G4IA 1ZI6A 3IUJA 5H7XA 4YRGA 2P41A 4ZCSA 1H2ZA 2E89A 1QIEA 3H05A 2G71A 1KO5A 1PT5A 4IM7A 4WN9B 3EZYA 1HZZC 4XM1A 3OLZA 4ZDIA 5I7UA 2RGDA 1DOHA 3SHQA 5FLXA 1QP8A 2ENUA 1FJ2A 2I3ZA 2O7SA 5CYFA 4RM3A 2AOXA 4B3CA 2C2GA 2O2HA 1DBQA 2Q7XA 5JFGA 5DFAA 5KPDA 5FWNA 4BFTA 1IY1A 3L02A 1LI4A 3HACA 1BH2A 5HKBA 1IY8A 5A5FA 5KDOA 1JU4A 4C0SA 1RXYA 1A5ZA 3R4CA 2Z2ZA 4C87A 4G5YA 4KR7A 2Y1XA 1RT9A 5A7FA 4I55F 1HQCA 1EX9A 1CZOA 1P45A 1QUEA 2V98A 3LC0A 4IV0A 4L4ZA 5M34A 1NJSA 3AI2A 4HYYA 4JOCA 4F4DA 5CFNA 3MFYA 1OIWA 2CUNA 3CLRD 5AHKA 3V1KA 4DNQA 3F78A 4O4IF 1KL7A 1TXGA 3TOXA 1U94A 2UUPA 3MQ2A 4IF6A 4ZVPA 1WMSA 1XLWA 1ZQ1A 4KQ2A 5EMHA 1TYCA 4GE0A 4ILKA 2BKEA 3MIZA 4YK7A 2FPGB 4IJMA 2ZSAA 3V1TC 1EA7A 3F2IA 4EY7A 3KPJA 2HMVA 1U7XA 1E9SA 4G0PA 3WDLA 1DZ3A 4WUVA 3A28A 4K8RB 4O4LF 3OF3A 4CMEA 1PHPA 1E1CA 1HBJA 3G0IA 2RIRA 1XCOA 2WHQA 4DZTA 1VOTA 4D9CA 1T8RA 1UZUA 1KHTA 2OHJA 1X0VA 3TLAA 1B0PA 1A9SA 4R31A 2HHJA 5CM8B 2I6FA 3PEVA 2CVFA 4FU0A 1YQDA 1D0SA 4O3MA 2ZVPX 4GMXA 1P4HA 1WPRA 3GF4A 5CCDA 2WJVA 3GAZA 3OLYA 4DUPA 1X8KA 2JIQA 3HCAA 4GAEA 5AVQA 5JPDA 4E14A 4B3JA 2OESA 3SSMA 1PL7A 1T4MA 1Z2OX 2R8PA 3QXSA 3CT6A 3D3WB 4GOJA 4IIBA 3S2SA 1VC2A 5AW5A 4WXHA 2FTKE 5ALSA 4NDAA 3DTNA 4QOJA 2UVQA 3IE2A 3L7OA 4FCTA 4F8YA 1HLGA 2QV0A 3KDSE 3TXXA 4CM5A 4BKQA 3OQBA 2YJTD 2GAAA 3AY3A 4QQRA 1S3SA 1HG0A 2VDJA 3CFYA 4JJ8A 2PX8A 4X8HA 4QA9A 1JS1X 2W6CX 3JALB 3KTAA 4BBZA 3ROGA 5I4KA 3UPDA 3SS9X 1PGJA 2NU8B 2PPVA 2ZAGA 2O2EA 3WDKA 3OETA 3LUKA 3G8YA 2YASA 2B0JA 2JJYA 5TS3A 1PUXA 2Z4TA 3D6VA 4BUCA 3O8OA 2PFSA 5EQDA 5KVSA 1RI5A 2J6CA 2NADA 1QK5A 5LQJA 5F52A 5E6UA 1XPOA 2HO5A 1MC8A 1KS9A 2ZSFA 4W5OA 1E3IA 1LB1B 1I7NA 1M74A 2MSKA 2PLFA 1EWRA 1UEJA 3BD9A 3ECAA 2JCXA 4P32A 5TQ0A 3IDSA 1Y34E 4NESA 5A1JA 2CMHA 3T15A 5JVDA 2ODBA 3C3DA 4RHCA 5EESA 3W8NA 2YZKA 1T5LA 3F5QA 3K0HA 3QP9A 3S2IA 3WLRA 2IITA 1FTQA 2C4HA 5BNWA 4R2IA 1FFHA 4HDKB 1GHTA 4MWOA 3PJFA 5JTUA 2W8ZA 4NMXB 4CKBA 3JQAD 2W90A 5DYIA 2O14A 3S1AB 2DFKB 2JDID 4DSAA 1V16A 3R5JA 4RE5A 5DIFA 4XUEA 3I1YA 2OYCA 2XDYA 3NDPA 4Y6SA 2BCEA 1JR3A 1GDDA 3NFRA 3DBHA 4F45A 4MSUA 2YXPX 3DEHA 3TXAA 1MC4A 1MQ9A 3V1LA 2P90A 2PZ8A 3L0CA 2GAIA 5LLDA 1HT1E 4Z99A 4YN3A 1Y6RA 3ZS9A 3UH0A 3A6GA 2D1RA 5AKJA 2C2WA 2NVUB 2GDJA 4PYJA 2CFTA 3H83A 1DTWA 3B6EA 1YS7A 2G6BA 3B1XA 4PICA 3GLKA 3H6KA 2RH8A 1JT9A 2FW6A 4PC2A 1IZ8A 1ESNA 2YCBA 1E1MA 1Q16A 1X74A 1IY9A 2ZYUX 2O5RA 4LZJA 5EPOA 3PX7A 4PM4A 4OIMA 4UBLA 3EBLA 3BKWA 2EZ4A 3LCMA 4RD6A 5AHRA 2FPMA 1F6WA 4MOWA 3PP8A 1CZLA 5TVGA 3ZHUA 2R6R1 3WVNA 1VGVA 2XUIA 1YT5A 3IP9A 4M1ZA 3CTPA 5CDFA 3STXA 1V8PA 5JD3A 3NLLA 3C6YA 4FLEA 5SY6A 2ZIAA 2H57A 4DLKA 2OGWA 2ZVDA 4JC8A 3X2SA 1OKKA 2G9RA 1JEYB 2O3JA 5AOCA 4I5GA 4KJZA 2YJ6A 2IYFA 2H7VA 2A0WA 4QAQA 2R7NA 1LBIA 2AMJA 2YHIB 4IMPA 2I1WA 3RHZA 3F3YA 4EG8A 3VU3A 2BKAA 1SCKA 3IYLW 4OFZA 1JMKC 1LPPA 4GO1A 4QTUB 1GWNA 3GJ3A 4M46A 1QRAA 4LJ9A 2FJ0A 2EGGA 2R8BA 1LV7A 1WCYA 1P4AA 5HMMA 4PSAA 2GEDA 3ZR4B 5CXQA 3QYPA 5B55A 2ZBRA 1GR0A 4C20A 5K0TA 1I10A 4R83A 4UE2A 1TLFA 2CL0X 3N2LA 4YQYA 3V1NA 3ZPXA 3W0LB 3C7TA 3R5KA 2F67A 3VOBA 3ZU5A 1KYYA 2XLBA 1E3SA 2J07A 3ILXA 2H1CA 3NO4A 1UKYA 3K0CA 2VPTA 1H8HA 2AJTA 4X3OA 3ESXA 3AJ9A 3VDRA 3WRXC 1ZH8A 4I2NA 3DFIA 4KI0A 3FMOB 4EPWA 2M6LA 4OGFA 3HDJA 1SVUA 4FYYA 4PS0A 3RRNA 4M0DA 4X66B 4PPGA 1QTQA 2AN1A 4A03A 2AFIA 4HSEA 5E6SB 2VTBB 3CRNA 4Y1GA 3IBCA 3NNNA 3OFJA 1SR8A 2C9MA 2PGXA 5JHGB 1QH9A 4D2IA 2QNRA 2X8AA 3JQ8B 3E9YA 2RI1A 1UBGA 1W49A 2GA9A 3OQPA 4O2AF 2ZSUA 4GPEA 4B35A 2BDTA 2DTEA 4JU8A 1AKQA 3SYKA 2A78A 4E7PA 3HKDB 3P5SA 3VR5H 1GNPA 3UHJA 3AO0B 4U5XA 1XMOB 4AFNA 3FWNA 1J2YA 3BWBA 5U1PA 5CB4F 2YUIA 5FJJA 1Z34A 4S12A 3ETEA 5B5SA 1RI2A 4KXVA 2W42A 4X3PA 4JQYA 3PGLA 2X0IA 1SUEA 1PO7A 4BX2A 2HOQA 1NTRA 2HJHA 4I1OA 2FE4A 3PKZA 1CQPA 3D5EA 2R25B 4B76A 3CX7A 1X7YA 1S01A 4RENA 4E22A 1G8YA 5LPNA 3MBOA 3TQOA 2JFGA 2CZCA 5JCJA 4NYJQ 3I0NA 4MARA 2GBPA 1LRLA 1TM5E 1ZINA 2FWRA 4JGBA 4KFRA 3KEOA 1ZIOA 1QIMA 5D85A 3ZHOA 4DLPA 4JI0B 1IMOA 2WWTA 4KXMA 5GONB 4H4CA 3W6OA 3MWJA 2IEAA 2ZI5A 3OT1A 2D59A 5IVIA 3TB4A 2XUHA 3E9EA 1E64A 1XEWY 2CNDA 2M1XA 5IM4F 3IAM6 2V6IA 4OF4A 3Q1KA 1QHHA 3R6DA 1I5OA 4ID3A 1PEYA 2G7MC 3PENA 4FD3A 4HEA6 4ABYA 3ADBA 3PHJA 3TLGA 1X39A 2ISCA 3O2JA 5IAGA 4B47A 1A0OA 2ZSKA 3ZVMA 5TGDA 1W5FA 2AN4A 4WZ6A 1F8UA 1Z18A 3GOQA 1XMIA 2CK3D 1JEDA 1PR2A 2PJZA 2YBDA 3M3PA 3NHZA 4CMAA 1P4SA 5P8WA 1XPRA 1CRPA 4AKSA 2XUOA 3FG9A 2ZUBA 3IQXA 1ISHA 1E3LA 1TPYA 3K16A 3UJ6A 1TVMA 1F2UA 1H0KA 3EGIA 4QXMA 3ISVA 3JQ7B 1OLOA 1M2OB 1BVRA 1P1FA 4FZVA 4IYJA 4XSHA 4BB0A 2Q3BA 1JVNA 1Z15A 1Z39A 2A1UB 3BZWA 4BNFA 3ZDCA 2WIGA 2IF2A 2FPPA 4BC0A 1MO6A 4R2MA 1OF1A 1Q0HA 1X70A 1TFRA 2QGNA 4DMHA 1U81A 2GPNA 5JNVA 1UK8A 3JRNA 1WV0A 4FEAA 4K03A 5A9TA 3ERCA 4G8DA 4XD2A 3AKDA 4Y2SA 1PT6A 2XZPA 1ZCZA 1W93A 4MDHA 3LKZA 4PO3X 5G4KA 5DCWA 2ECOA 3TDNA 5A4IS 4MV8A 5DTMA 1U5BA 1HFJA 1YB1A 2WMYA 3A2LA 1W46A 3LQFA 2ZI6A 4D3ZA 4BNLA 4R1UA 1TRHA 4WLNA 2EIHA 1Q2UA 2IQ5A 3SEZA 3UUWA 2VYQA 3FCYA 5BURA 4WK6A 5KNDH 4TVOA 1X8XA 1ONPA 3QTBA 2PAAA 2X0EA 5B7QA 4EHDA 2YVQA 4OHXA 2ZRPA 3BE4A 2BFWA 3FCCA 2BGGA 3DKPA 1EIWA 4WOPA 3HNOA 1SUIA 1M1NB 1QQ5A 1J99A 3RAFC 3VR1A 1EGVB 5JHHB 1ZD1A 4WK0B 3X2EA 1R7RA 1VTKA 2UZ1A 2FWBA 3AFMA 4WGFA 4OHWA 1WDKA 4TSFD 4ND4A 4NX2A 1C9JA 1BH6A 1FQOA 1LK0A 2VOJA 3AV3A 4UREA 4YROA 1JEOA 1UXKA 3B85A 3WLAA 5CIYA 3FOZA 2CNBA 3W8FA 1Z4QA 3OUZA 4E30A 2IZ6A 4M0CA 1W19A 1WWKA 2A5DA 1JDUA 3OEHD 3IBGA 3WRYC 1KA9H 1GG2A 2JF0A 3A70A 3G5MA 1A5AB 3O3OB 1SCAA 2F59A 4U6NA 1N5RA 5CVDA 3WICA 4HQLA 2HHHB 3BGDA 3WHPA 5AVSA 2IYUA 3GQBB 2I4TA 3ONNA 3W77A 1MVNA 2XMBA 4BFXA 4CODB 2AVNA 3Q87B 2DXIA 3SF8A 3WLIA 4BIMA 5DM0A 1NJFA 1RAGA 3T7SA 5BPHA 1K6IA 3BIXA 4XR9A 1G5RA 3QWHA 3CRVA 5C3UA 1UDAA 1RFGE 3BA1A 2OWEA 2ZS7A 3CINA 2VDUE 4NNJA 2C0CA 2VRCD 1CY7A 2OT3B 2PXAA 1RKBA 1Y9ZA 2UVDA 1N2CB 2Q27A 3DOOA 4OAPA 3ER9A 1GPDG 3SDZA 1C9YA 1OAAA 3KL2A 3DHNA 1J90A 2BISA 2WABA 3AEQB 1FOEB 1U7UA 3EDCA 5DV9A 3SR3A 3CCCA 5C80A 3F73A 1YTLA 2QM0A 2J32A 4NCJA 4WK2B 4YCDA 3COYA 4FIDA 2D5CA 1QRDA 2BMAA 2G06A 4EATA 3HVUA 4D42A 2H51A 1ABEA 2AC4A 4QNNA 1YU6A 4NV0A 2GBFA 1UP6A 4BNIA 1FUIA 4XB2A 2CD9A 1DHTA 4ENPA 3QUBA 2JDIA 1R64A 4QODA 3VPHA 1WCXA 3MJCA 4CEJA 5B58T 3M81A 5T57A 1ZR2A 1ZOIA 2J7PD 2OQRA 4MV7A 5D1NA 3WG9A 5CNMA 1TEHA 1Z22A 4ENRA 1ZZEA 4PG8A 1EZ4A 2YN2A 5J1SB 1BVUA 2XAAA 4YS6A 5TE9A 4ERXA 3HVRA 2Z95A 2W6QA 3KTFA 2IUYA 3MJEA 4F06A 4PRKA 4PFSA 3Q6IA 4NE9A 5DDIP 5IC6A 2QN8A 3ENVA 3T9FA 4DARA 4MVWA 4LF5B 2CKDA 2CE2X 2CB9A 4OL9A 5KDDA 3H65A 4YQFA 5LR6A 2IZ1A 5KVQA 3VC2A 1QP7A 2W7TA 4KWTA 2HJWA 4ZARA 4B3TB 3BJMA 1PG2A 3AR5A 1J2UA 1A5TA 2JRLA 3WNVA 1CV2A 3KXPA 1SIOA 2DE0X 3Q2OA 4Q48A 3WO1A 3AF0A 2OXCA 4HYEA 4N8DA 3OCWA 1HLDA 4TM7A 4D46A 2SKEA 5A3JA 4NRDA 1TPZA 3KJGA 2CVQA 4OB7A 3NX4A 3KBBA 1UP4A 2W98A 4CL8A 4URYR 5DIZA 2YXNA 2H5LA 2F00A 5HSGA 1ZHHA 3G9XA 4Q37A 2RJNA 3FSJX 2PUEA 2YFHA 4GFDA 4ZOLB 1Z7BA 4XRRA 3O8QB 4YRTA 1N77A 2Q7DA 3PHCA 5ELMA 1BEUB 2JHAA 4NWIA 1PR6A 4RKQA 4TTQA 1JVSA 3I2JA 3OZCA 4YJ3B 1PJAA 3MYRA 3LXRA 3ENNA 4LYAA 3W6NA 1FDUA 4MMZB 5K3AA 2VP0A 2IYAA 2Z8YM 3CB4A 4OMDA 3UHFA 4BNWA 1T10A 4UTVA 2H29A 4N76A 2IS4A 3U1BA 2EX4A 3SSNA 1XZDA 2CVHA 3EFBA 3R7FA 1RZVA 4RY2A 3JRXA 2GVNA 3HNRA 3ZVLA 3U16A 2W2QA 3DMYA 4NKRA 3EG5A 3ZVRA 5CEEA 3CLHA 1K7YA 3AVXA 1JHPA 4P54A 2DFTA 2F3UA 3AI1A 3L8EA 3EIEA 4O59O 4I14A 5LA6F 3U3RA 5FQOA 1JIQA 4LHWA 5EIXA 3GPDG 4RFLA 3G89A 5AICA 2P3LA 5F4ZA 1VL1A 4HKTA 1KQ3A 2J9XB 2YYYA 2IHVA 4IMJB 4CXMA 4AJJA 5CAEB 3FJ1A 4GSLA 5KREA 1GTVA 1UQUA 4CMHA 2ODAA 2FAXA 3DOFA 4IJVA 4M8NE 2IDJA 3ZX5A 1QGAA 1N2OA 3OMWA 1WNFA 4CL2A 2IGBA 3KVOA 4KXQA 3UB4A 3CEHA 4QXRA 5HS4A 4ZYVA 3ABSB 1O54A 4B3XA 5HUQA 1JHRA 2ZR0A 1YK0A 4YX9A 4IUBS 3AVWA 3R5FA 3ROKA 3FPJA 2OL4A 3LE8A 4XYGA 5E8RA 4KXLA 4L51A 3I32A 2Q0HA 5CH8A 5DLQC 4AT1A 2GZAA 1UJ6A 1YA8A 2QUZA 4KBYA 2HKIA 3U0BA 4D96A 2X3UA 3KT3A 3EEIA 5EERA 3FDZB 4QOEA 5FI1B 2CXTA 2RONA 1SB9A 2HPZA 1JJIA 1LU9A 3RASA 4QQ8A 4I5FA 1PVDA 1ZCAA 2DUWA 5ICFA 1O8BA 3E81A 2B5OA 2GCOA 2R6CA 3FNFA 3H1BA 5JCOA 2D5BA 3GVHA 4DAOA 4W5HA 4Z9XA 2SKCA 3QPVA 3MJSA 3VH4A 3ZHQA 2Q4DA 2EU8A 4IIVA 2QZPA 3DHEA 1QIHA 3KYCB 4OMFG 3D2CA 2ILTA 1PSWA 4O4HA 4RH0A 4BZQA 4KDEA 5KYWB 2JJ2A 3BH0A 5EZQA 3QKRB 4MP8A 1SBTA 3EVBA 1B6RA 1YR3A 4F6LA 4CKWA 5LKAA 3QYFA 1SIUA 4UE3S 1L8AA 1AV7A 3M9WA 4YRIA 1Z0JA 4ALIA 4AMUA 2Q4BA 2DBQA 4REQA 1SCUB 2CE7A 2IF0A 2RG7A 5HM8A 1XIVA 4KQHA 4Q3DA 4INOA 2I3GA 1GZ7A 1MT0A 1SCJA 1IXRC 4OQFA 1RM4A 2BTEA 1ZGCA 3OJEA 3RE1A 2IKQA 3U80A 4ZHQB 2YWJA 5CVEA 5EMLA 5CGQB 3MGCA 1RW4A 1SAYA 5EUCA 1B8OA 3UIEA 4HS9A 3D6HA 1DT3A 1ECPA 1NJ2A 2R44A 3P27A 3NV7A 4RELA 1P2VA 3ANNA 3SBDA 3TSZA 2SCUA 3MVEA 2M98A 4M1KA 4PVCA 3TQRA 4D3SA 5UKDA 1ZNYA 2C5FA 2CK3A 3EH2A 3IKLA 2X14A 3TB6A 1IFXA 4Z3DA 4DPKA 1ID8A 1V35A 5K3CA 3MPUA 3ZI4A 1JA9A 1RWBA 1YRLA 3L7YA 3H4TA 2Z3ZA 5H68A 3W4IA 1RKVA 4TYMA 3D6AA 4JA0A 1X7GA 4KIWA 1FY2A 4BMOB 1N3IA 1UJ4A 4RSRA 1V7CA 2FVYA 2Q6LA 3B89A 4M9SA 4YRBA 3S8EA 1NP6A 4LOJA 2QTRA 1E62A 3ESAA 1E3DA 2Q9CA 5CA1F 1M5RA 1ZD9A 5A3RA 4TLLB 2Q4OA 2B2NA 1II9A 4L4RA 2FEWB 3W2IA 4C4YA 2F62A 3W05A 4DMMA 3VTAA 2A4MA 4LV8B 3TKAA 4R4JA 1EVZA 3FOAA 1QONA 1I6KA 1UK7A 3ORYA 3ZHZA 4YFYA 3LXMA 1L7AA 4IDDA 5LUBA 2V4MA 4C14A 5BPFA 3MTIA 2DEUA 3HQ4O 3JR3A 4BO3A 2RSLA 2ZJ4A 1NYRA 3CB2A 5A9SB 2D3WA 3OY2A 3RC7A 4LF9B 1A9QA 4FFMA 1B16A 3EGXA 1XWIA 4FGZA 3NORA 3URMA 3VDNB 3MCZA 1NU6A 3IP1A 4WLOA 1ISRA 2FWJA 4BMDA 4NP6A 2PG3A 2NXCA 2R7AA 4G0OA 1SVNA 4BAGA 1OC2A 2BF4A 4R9VA 5CXXA 5EZSA 5EMJA 2YBEA 2EG5A 2IYLD 4TTIA 1I3OA 3NC1C 1Z25A 2H16A 3GCDA 4XWWA 4MV1A 1ECCA 3QVOA 3KC2A 3L82B 2Z83A 4XQEA 4BQFA 4TSFA 4WKPA 1EP1B 3IDFA 5CTAA 3AF5A 5KKCA 1XX6A 2OQIA 5DMHA 4IXDA 4NPCA 1HT0A 2P68A 4R2HA 2GBIA 4RCYA 5ED4A 4OBXA 2R8XA 3KOYA 5JXWA 4XRGA 4YMGA 1ZK4A 5E3JA 2YJZA 4WFIA 1KP2A 1U9IC 3OEHA 1QVAA 2G4LA 4L5IA 4YCAA 4ZQFA 6LDHA 4EI7A 1UBLS 4PX2A 2C2XA 4O2RA 5J2TA 1U1CA 1QGOA 3A9VA 3BTVA 5LP6F 1WMDA 3OJLA 4LK3A 2IPMA 1ND6A 1QB8A 1YMQA 3H5VA 4N3NA 4N3BA 4DLBA 2AEFA 4AS1A 1DXQA 4M4SA 3W5AA 1RC1A 4B1FA 4E5MA 3K0AA 1N36B 2NXEA 4AX8A 1JEQA 1XHLA 3A26A 3R8CA 1AHIA 1R4AA 4YT8A 4ZODA 2QT9A 3WADA 1D1QA 3HUFA 1V1JA 2CLKB 3D2LA 2G9VA 1KJIA 4OUDB 2RHGB 2VRCA 3QMWA 4TRRA 5KNDA 2XKKA 4OHOA 2Q50A 2R1TB 3GLGA 2I2BA 3O95A 1GXSA 4IS3A 1AURA 2PFGA 4PYRA 4QJBA 4TRNA 5DNWA 1O6ZA 4YQEA 1BAPA 5DLPA 4V1CI 5HZHA 1FW8A 1QO7A 3ANYB 3HFSA 3EPKA 1UDWA 4ARSA 3UJHA 1PK9A 3D7RA 3NJ8A 5CMLA 4A4DA 1C8LA 3SSOA 1RQPA 3L49A 3DAFA 1NVGA 1ZNWA 4CQLA 4Z4EA 3KSDO 3FOCA 5D6OA 2ADMA 3FLMA 1JTEA 1HNNA 1PGPA 2P6MA 2OYSA 2ZJAA 4MMYB 3GRKA 1R5NA 4X90A 4B3RB 1LFDB 2PRZA 4OQXA 3DC2A 3OQIA 3R9WA 3I23A 2GF2A 3RG8A 3IVXA 4FFPA 1O03A 1SZDA 5K2MA 4NE7A 3ND9A 1VYVA 4DYDA 5ES4B 4YRSA 5KOJB 2HNBA 4TMKA 2B7BA 2J6BA 2QQ0A 3L0SA 1ODFA 9MHTA 3E3AA 1FCJA 2ODNA 1IHXA 1MTZA 3GRZA 1T8UA 1I8TA 2V7PA 4MGIR 3H6GA 4OA5A 4P34A 5J5CA 4H2DA 1ZR4A 2G0TA 3AIOA 3CSSA 2VJCA 2JKVA 2PJUA 2WFMA 3JVVA 1MU0A 1AXRA 3L3BA 3LX5A 3G68A 4OO3A 1IN5A 4PPYA 3NOOA 3T7KA 3SN6A 1OFVA 1M34B 4TOIA 4WN9A 2XCSB 1LPOA 1HFEL 3CF0A 4M9XA 2V45A 3FYSA 4A8HA 4B0PA 1ZC3A 3RUFA 3DLBA 3KKLA 3SF0A 4YAUA 1RYDA 2I6UA 3UM9A 2FEKA 1D4ZA 1BJKA 3NT4A 821PA 4OQLA 3VVLA 2H63A 1JWLA 1N9KA 1H6CA 1KAOA 3B1JA 1H4QA 3R8FA 2AMLA 1Y7TA 2FRDC 3Q2KA 5JC1A 4HJXA 3WB0A 1XAIA 4Y2QA 2Q0QA 3OMXA 3DWGA 5I7HA 4OHCA 3AUAA 5KYVA 2R2GA 2ODQA 3KHSA 1LD3A 3KKMA 1MRSA 3OAAA 2FR1A 5ICGA 1SBCA 1BNCA 3PS9A 3C0KA 3S2UA 4CCAA 1GGKA 2ZAYA 4WSOA 4A23A 1WXIA 2B20A 4J43A 1ILWA 4FFWA 5EEHA 1V5EA 2ISSD 3ONWA 1HO3A 4L8YA 1SH7A 4Q4JB 2B30A 3TTSA 5G40A 1PS0A 4PXYA 2RGGA 1M0WA 5AI0A 1VE9A 3OLWA 5DMXA 4DCGA 3FOEC 2I65A 3FYTA 2JD2A 1EHYA 1YOVA 3NUGA 4JT4A 1BYIA 1Q7BA 2NTYC 2W6PA 3EXHB 4JP8A 4OJTA 5IBQA 1UMCB 1O89A 2WUGA 3DL2A 3RIHA 5I5EA 2I29A 4OMCA 4Z8YA 5JSQA 1B4DA 2O6HA 4ZVVA 1H66A 4HYTA 2C9ZA 4R3WA 3RARA 3UCFA 4EK9A 4HPJB 1TQHA 2ZTMA 1UKZA 3OJFA 5HQJA 2VCEA 3E9QA 2WB2A 2XVAA 3WJ7A 1VPVA 1EK2A 4BYGA 3NATA 3DZCA 3HL0A 3Q7TA 2Y6VA 4KQ1A 3HYNA 3NIGB 2Z43A 4QX6A 1CF9A 3BILA 3SK0A 2FPXA 5AJHA 4A8JA 5CDTA 1JA0A 1VHTA 1RWQA 4U9IS 3SBOA 4F9TA 5BYAA 2YDYA 5ICSA 4ZCPA 1WDWB 1U8UA 5JVDF 4MPPA 3RRYA 1XZCA 1CS4C 3C1AA 5K3BA 2FMHA 4MI1A 1KU6A 1QOPB 1BG6A 3IV7A 3B36A 3JWHA 2AQKA 1MDBA 1QWOA 2NU8A 3IDOA 4C0BA 3VBEA 4Y9TA 2VI5A 3MT9A 2QR3A 3FD8A 4WINA 4D9IA 5T7BA 1CUJA 3LFTA 5CLGA 2O3UA 4F38A 3OIWA 4JODA 1KFKB 4PZ9A 1XZBA 3NHKA 1PJ4A 4H4DA 3E61A 3ROFA 1GCUA 4LKOA 1VJGA 3IKMB 1GOTA 3WLLA 3BWCA 2AR7A 2E87A 1IMJA 2ROQA 3N28A 3S68A 3T0GA 5BO5A 4K6FA 2ZZNA 1I1HA 3WKBA 3K32A 1Y63A 4FE7A 3HA2A 3TJRA 4GWLA 5SV2A 3MJVA 2Q1SA 1NW4A 2UYOA 4JC4A 1JHDA 3D8TA 5H02A 1H65A 2XKAA 3DBVO 4DIEA 4JBXA 3VU9B 2H5JA 1IWBB 2IHJA 3KXIA 2H65A 4GX1A 3PFBA 3QUSA 1DIGA 2C31A 3VV2A 2NT3A 4YUXA 1JTVA 1KJNA 3KWFA 1IL0A 1WEKA 1IZZA 2B4AA 4WNIA 5DF1A 3ESBA 3V1UA 2CHEA 2OFWA 4G8BA 2II6A 2AJDA 4ZI7B 4JI6B 1P7YA 5K6RA 1RBQA 3N5CA 2RHTA 3R6WA 1SCBA 2QN9A 2J3JA 4NDNE 4RZSA 2AXNA 4RGYA 1AUVA 2FW0A 4TL7A 3TPZA 3EXAA 4WVFA 1BKSB 2AXEA 5KJ1A 4JENA 3GUCA 1ECBA 3A37A 4MYSA 4R8RA 1ISIA 5CUQA 5IG2A 1WHSA 1CY8A 1YF3A 4BJ6A 4RSHA 3FBWA 4BNUA 3Q8XB 2NP7A 3C1UA 4JY7A 2V03A 4L4SA 2QN7A 3B2NA 2FR8C 4MX8A 3SQWA 1OREA 1EGHA 5TMEA 3FTDA 4IGFA 2WNSA 2O8CB 2PLRA 3JRWA 3RYFA 2I34A 1QQTA 4KMSA 5G4LA 2PE5A 2POCA 4QUIA 1C0LA 2PTGA 5CK4A 4TXNA 3S2EA 4US1R 3AU9A 4LSZA 1UDXA 4LZAA 2X8LA 1ADJA 2R65A 4AN1A 1Z4OA 2JFXA 1S2GA 3I2FA 3K4PA 4WNCA 2OTCA 4HDRB 4CIXA 4CQMB 4UXJA 1CUHA 4D8YA 2C7OA 1JEYA 3I39X 2B2CA 3N8IA 4CPDA 1OAKA 2DWPA 2H48A 4JXJA 1FNDA 4TV8B 3AOGA 3VKVA 2YHIA 2B7LA 2JLSA 5E38A 5JW6A 1ESZA 4HK4A 4FMDB 8ATCA 4YXFA 4IINA 3NALA 3L7MA 1XBTA 3KVRA 3QMMA 2ZI4A 4I4TB 4KAXA 4A0QA 2GYWA 3HXTA 1V26A 5CYGA 3ADKA 4HMOA 2J5RA 1YAHA 1NY5A 1MV8A 3RAPR 4F6RA 4BKOA 5IT0A 1NF8A 4FYIA 2ZTVA 4W8GA 4F9GA 1SEPA 3ISJA 4LX8A 3R7BA 2ONZA 3QKUA 4E4YA 1BU8A 1F12A 4O02B 3ENQA 3EUAA 5EJEA 2H00A 2FUG1 4XSVA 3UFBA 1NPDA 4RAOA 1RWXA 2OR3A 4BV9A 4BY9E 3F98A 4WCDA 1DZIA 2CFIA 3G3EA 3IUSA 5EXXA 4BO0A 2OD7A 2H9AA 1QJ4A 1NMQA 3ZV5A 4YV2A 2NUPA 4DIFA 4RVCA 5BN4A 3K94A 1YK1A 2IU3A 2ET6A 2LUOA 1PZMA 1O77A 2H0QA 4HGOA 5CD9A 3VPFA 1R66A 1O0CA 1GKIA 4BFCA 3OU7A 2DBVO 2WKSA 2VJMB 4N7JA 4OHFA 4JQCA 1U8YA 2OXIA 2MSDB 2CFOA 1TT5B 3AJ8A 3DOUA 4YH1A 4FGSA 3IJPA 1N2BA 1EB9A 3JQ8A 3QKSA 1KDVA 3U44B 1XDSA 3T5GA 1LNQA 1YZ3A 3FPEA 4FHEA 3K05A 2VYFA 5B7PA 3HKDA 1C3LA 1W4CA 4AJEA 1CYDA 2RD2A 1A82A 2QX6A 2ZDQA 3EFEA 3L43A 3LPAA 4IIDA 1ZAKA 4UDOA 3H5OA 5CBPB 1NIPA 2ZULA 3GEEA 3L8DA 1T1GA 3KR9A 5DBHX 2ZT6A 3O31A 4JKYA 1PS9A 1UQTA 1MAHA 2JGEA 4YNBA 3ZCUA 4CFZA 5BV0A 1P3JA 2AFIE 4MVJM 1W9MA 3RS3A 4PX3A 4ZI3A 1Z5UA 2OCXA 4K9LA 1NXTA 2C92A 4IHJF 4GOKA 4WOJA 2R1UA 3VO2A 5DX8A 3VC1A 4AMBA 4CGYA 1PJSA 4D6PA 4LQLA 1U2RA 3MHPA 1FRNA 2VXBA 3HPRA 3T4UA 2VBIA 3AJDA 4CWAA 1DINA 2VPYA 2PU7A 3GJQA 4B3DA 1W76A 2HUPA 4K6KA 2OHFA 4CUZA 2HPAA 3B6ZA 5GONA 5A3VA 3DDSA 4I1YA 1I7PA 3DW1X 4MAMA 2I67A 1DPGA 1BN6A 1C7ZA 1NW8A 1P29A 2NV0A 3OTGA 4JVLA 4KOAA 4OFXA 4XTCS 5BV8A 3DVAB 4EKGA 4K6HA 5HDQA 1VDZA 2LW7A 2PQ2A 4HWOA 4DCMA 1WSBA 4RA9B 2R00A 4LVOA 2JAQA 1SMKA 4LZWA 3TXYA 3VISA 1L7MA 2B99A 2UUBB 4D57A 4Q16A 4YREA 4KNWA 3TRHA 4F04A 3FH0A 2BMWA 2BEUB 3M6WA 2HC9A 3NBXX 1LLDA 5D3QA 4XWAA 2Q28A 1N9ZA 5A05A 3DMGA 4H08A 1GFWA 3C3PA 3H11B 3ONDA 1G3IA 1OLXB 3KFVA 3PPIA 4DV0B 1P74A 2NZXA 3SVZA 1RWVA 2VZ0A 3JQ7A 1GQSA 3B6JA 3TS1A 4XDHA 2PNJA 4N3AA 1RM0A 4OJKA 2VDNB 5FH9A 4C78A 5ALZA 3PWTA 4LTDA 1R6UA 1U0FA 3D59A 1Q17A 4G0VA 3AK4A 3TSWA 2XY4A 3D8NA 3DZ8A 5ALMA 3HI4A 5CW2A 3RO7A 3EGDB 1FSGA 2P62A 2AD5A 3LPCA 1Y7PA 1RQXA 1V6SA 3LY5A 5EE5B 3BPSA 2DCUA 4YCNA 4J91A 3GFGA 4OU5A 5DNYB 3ORQA 3HO1A 2CLDX 3OWOA 4FNOA 4QAJA 2XXAB 1GZ5A 2NLOA 1ZSVA 2JH3A 1I4TD 1VLJA 3VTZA 2FUKA 2J0VA 5EWLB 1DKLA 2XR1A 4W7HA 3H1PA 3STTA 3T9CA 3ZBQA 2YWBA 2C1XA 5IN5A 1GG9A 3ASUA 3NR2A 3LV8A 2AK2A 3TZ6A 3WX0A 1XPJA 1UM9A 2PKQO 1CZKA 3AR3A 3RTDA 4U2CA 1R15A 2WAMA 4ONEA 1I2CA 1Q3KA 2P4SA 4JVMA 4LTNA 2WWVD 1NJ6A 1CEQA 3TM4A 4RLSA 1Y8RA 2G70A 3DZIA 4MWSA 5SZHB 1YQGA 3KSUA 3ND8A 3ED5A 1J1ZA 1TKCA 3LXXA 1ZK3A 4PZPA 4UKDA 4MCJA 1X7XA 2KB0A 3AM3A 3ULKA 4AUMA 1DBIA 1EINA 2HADA 2QU7A 4CL0A 1Q22A 1QK4A 1SBQA 3ONEA 5IU6A 1EFTA 1ZH0A 1LI7A 5BR4A 1W36D 1LSJA 1NBMD 2W2MA 2DQ4A 1TM7E 3QVGB 5LZ2A 3GQBA 4FDTA 1JNYA 4FR0A 1ZN9A 1HYEA 2QTHA 4KBFA 4OV6B 2CW5A 4B48A 4JA2A 3TQSA 1VFNA 3H6HA 1AKEA 3QLUC 2IOFA 3OCXA 1TB4A 1V5WA 3ADPA 3GDFA 3HG7A 5D8DA 3I09A 2KBEA 4DPMA 4LWQA 4M8LA 3A1NA 2Q8PA 3WO0A 2X41A 3SY8A 1IQRA 5G2OA 2GBGA 3LUDA 4K7JA 4LZZA 1DELA 3LUHA 2I76A 4OU4A 1PFUA 3E70C 1M54A 1F0NA 3ACDA 3IODA 4WKGA 2VDWA 3NHFA 3W3AD 3BD6A 4ENWA 5ISMA 1N1DA 5GWXA 2PGIA 1FMLA 1RACA 3IV6A 1S7CA 4L5AA 2WF9A 1XO1A 4FE3A 3ZDBA 1W4RA 2LV8A 3SAJA 3D43A 1U2GA 1YIAA 2X1VA 2OQVA 1L7EA 2GEKA 2EJBA 3B7PA 3H1GA 1AKYA 3LPDA 4Y2JA 1PWYE 3GL9A 1YCFA 5ALJA 5ESDA 2AFHB 1X1AA 2R3SA 3M5CA 2E4UA 3PWSA 3SSAA 3WK6A 4NYJR 1QFSA 3KOOA 1TVKB 4G5OA 5KYGA 4CM8B 3FKQA 2QK4A 3U3XA 5LYJB 1CERA 1R0LA 1R12A 2CHVA 3BULA 5B2ZA 2O1WA 3L7AA 3P2KA 3HUDA 1AQIA 2Z6VA 3T3DA 1BDHA 1E7WA 1FVFA 4TTRA 2NO7A 1MVOA 3PNMA 3TD2A 5K99A 3WDMA 3UWSA 4NG4A 2NXNA 3ZCPA 3PJDA 3U5TA 2OM6A 3OM1A 4BMXA 2WIKA 3U7RA 4MZDA 5CW1A 4DV4B 1U1GA 2D2FA 2OCDA 1ZD3A 3UNXA 4E5DA 4KXWA 2OKGA 2QRKA 3NC0C 2OD9A 1NMXA 1UFRA 5IKXA 2ZJYA 1UK6A 3V97A 4K6MA 4RMNA 4BV3A 1SUWA 2JVKA 2XX3A 4ZYUA 2UU9B 4U63A 2CL5A 3KT6A 1JWBB 1U02A 2D0PB 3DPSA 5I4BA 2BFMA 4WADA 3JTEA 2ZIWB 3NBZC 1W7AA 3QX7A 5IX8A 3GJYA 1JNXX 5E7IA 3V7NA 1DAPA 4DV7B 5F7ZA 3RC3A 1YCHA 4BP8A 3DZKA 3NIFB 3D8BA 3CX6A 1Y5IA 3OD5A 2Y1WA 2EZUA 2GB4A 3IKJA 4YJ3A 1J0XO 4X3CA 3W2FA 4G0YA 1IONA 1OXMA 3ELDA 2C58A 4WTOA 4NFSA 3UENA 4HNUA 4HEJA 1C9KA 4MAFA 4OHBA 5AM0A 1YBVA 3JWIA 5GP1A 4CDRA 1C0EA 2GRJA 2ORVA 3K8ZA 1KKUA 3HN7A 4TSKA 1ESEA 1Y5LA 1ODIA 5EKTA 1DRJA 4DCCA 5HFJA 3WZ2A 4XB6B 3WISA 4J90A 1N92A 2W2LA 4HPXB 2G77B 5FTWA 5L6LB 1FP2A 1OX5A 4O2BB 3JYPA 3CZPA 3F7OA 3KFLA 4HLCA 1RLMA 5L7TA 1WSAA 1OH6A 3D3KA 1Y6ZA 3H4MA 2VKTA 4FHZA 4V2UA 2QORA 4A15A 2AZDA 5DHTA 5JAZA 1ZQ9A 3EEOA 2BI7A 2QMOA 4GKBA 3HO8A 1CUUA 1K88A 1LFAA 4MI6A 1Z17A 1ZMBA 5D86A 1P5HA 2CLLB 1SVIA 3UWKA 4K6GA 3REQA 3FTEA 1G9SA 4E5PA 1N5MA 4N48A 3CHYA 4O4HF 1QDEA 4AYWA 5BY2A 5HOEA 3D4IA 3FFXA 3JD1A 3BQMB 3UKDA