4YPOA

Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
325
structure length
325
Chain Sequence
MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Ketol-acid reductoisomerase
total genus 129
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.86: Ketol-acid reductoisomerase (NADP(+)).
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4ypoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ypoA01
1O5IA 5JBIA 3VAZA 1AHHA 2HMTA 4J2HA 4BO7A 2ZJ0A 1LRJA 1BRMA 4A27A 3OJEA 4NR0A 3Q11A 1HXHA 3LDHA 1LC0A 3C1OA 5JAMA 1DLJA 4B4WA 1UDCA 2FR8A 5JDIA 3I1JA 2O3QA 4F3YA 1Z7BA 3RBZA 1VJ1A 1NQ5A 1JQBA 3PJDA 2PNFA 2VYND 3RROA 2Y1EA 2G82A 4XQGA 3DFUA 5G2OA 3JQGB 1SPXA 1V3UA 1XYGA 3LC1O 1HKUA 1DIGA 3DQPA 4GQAA 1EVYA 2BFAA 3QWBA 4MVJM 5J23A 4Q3AA 2Q1SA 4PZEA 4GX1A 5G4KA 4UVIA 5CPBA 3TJRA 3HB4X 3U62A 2W90A 3DL2A 2OHXA 3KVOA 4Q3NA 3WS7A 4ZD6A 3HQ4O 2ZIZA 4U0KA 3KSUA 2AMFA 4R5MA 3TZ6A 2NM0A 2X5JO 1HRDA 4AJ4A 2BFPA 4CQLA 3RASA 5EESA 4RQTA 1Y5RA 2PKRA 2RAFA 1JDJA 1C14A 4LSMA 3QWAA 1FF9A 2J3IA 3OSUA 4L8VA 4X54A 1MGOA 4OIMA 3VZQA 1Y8RA 1DRWA 4J3FA 3SLGA 5DCWA 1XA0A 5IAAA 4D45A 2Y1CA 1T1SA 1KVUA 1NR1A 2VUTA 1FDSA 4DYVA 5TX7A 2PZMA 2X58A 2BGKA 3K73O 4YT5A 3RC9A 4AVYA 4CLRB 4EJMA 2QG4A 2QX7A 4AJ2A 2RIRA 1UXGA 1L1FA 1PS8A 5GMOA 1HSOA 1JVSA 3KEOA 4LCEA 3ASVA 4AG3A 1U28A 1WDKA 5DZSA 4JBIA 5L95A 5G0VA 3H4VA 3KXDA 1R0KA 4U7WA 1DC6A 3SJUA 4YACA 3PJEA 1C3VA 3IJPA 1NHGA 3I9MA 4IDFA 4J7UA 2C2XA 3LLVA 1ZSVA 1B3BA 4EGFA 2D0IA 4LW8A 4UUOA 3ZN2A 4CMEC 4EI2A 3VTZA 2EKPA 5I9LA 3C1TA 2NUAA 4C4OA 2BD0A 1WXDA 3PIDA 2EERA 4IM7A 3UFXA 3K6JA 4O59O 4D0SA 2VWQA 3OF2A 4O5OA 3H5NA 1IE3A 3NT5A 2C7VA 3PK0A 5HS4A 1ZVMA 4YBZA 1AGNA 4WLFA 3OA0A 4CQMA 3ST7A 4Z9XA 5A5EA 1DIAA 1YO6A 3WIEA 2YUTA 3I9KA 3LQFA 4AJIA 1EDOA 1WAMA 2OP0A 4J9UE 4XA8A 2CY0A 4PLGA 5KJEA 1V35A 2IEBA 4G81A 1B8VA 2I6TA 3GZ4A 1TI7A 1H6BA 1MX3A 2NTNA 1H5QA 2JKVA 2FHSA 3NEPX 3BAZA 4MVJH 1OFGA 2NU6A 3FWNA 1EUDA 4XR9A 2NVUB 2Q2VA 4CM9D 4YJDA 4ZVVA 3ZDFA 2X9GA 5C7LO 5CG2A 3WIDA 1DRVA 1GZ4A 3MWDB 2PGJA 4TWRA 5IXSA 3ROQA 5JS6A 4KQXA 4XB1A 5AXCA 4E5YA 2DUUA 4IJWA 1XHLA 2XAAA 3GMSA 3JQFC 3ANLA 5HM8A 2B0JA 3QHAA 3GNTA 1H6AA 5BNFA 4ZQFA 3JQ7B 1KEWA 5ILGA 4RPLA 5KKCA 2IXBA 1GCUA 3ORFA 3H65A 1XSEA 2JD1A 1U1IA 3R3SA 3QP9A 5FWNA 6ADHA 3S2FA 5A02A 4IQGA 3D5QA 3PEFA 1IULA 1NASA 4DVJA 4CMHA 3AM5A 2Q99A 3IP1A 1I24A 5BSFA 1TT5B 2HMSA 1WZEA 4PLPA 5COAA 1QXSA 3E8XA 1PJCA 3RVDA 3B70A 2GPTA 3OIDA 3G1UA 4H7PA 4IJKA 4J2OA 5A9RA 3PFFA 5L53A 2J5QA 3JV7A 4R1TA 1GAEO 2WYWA 1N9GA 1BXZA 1EZ4A 3BXXA 3HDYA 4E0BA 3I4FA 1PL6A 1I3MA 3ZI0A 4BNHA 4CMIA 3U09A 2X0RA 2OGUA 2HLPA 3DC2A 1D8AA 1DHRA 2PD6A 2DT5A 4HFNA 3U9LA 2Q46A 5K9ZA 2IZZA 1UP7A 4UUPA 1JKJA 3TPCA 4GX2A 4QO7A 4XYBA 1NQAO 1I2CA 4YB8A 3C7DB 1I32A 4KUEA 1ADGA 2OL4A 3GVPA 2TMGA 1MC5A 2P5YA 3TSCA 1GQYA 3UF0A 4MPDA 4LGVA 4YAGA 2BI7A 4NK5A 1IY8A 5JE8A 2DBRA 1EK5A 2D3TA 3OQ6A 1R4MA 3FBTA 3PDUA 4IDEA 3V2GA 3TZCA 5A05A 1GYQA 5C37A 2P4QA 3EZLA 3OBBA 4WNIA 1PR3A 2ZCUA 4A26A 2QRKA 1KEVA 4Z6KA 2O3JA 1VL0A 5G0WA 1RYDA 1ISFA 4R3WA 3MEQA 4CODB 3ZNPA 1YKFA 3B1JA 3GA0A 3TWOA 3WOHA 1EFLA 3DR3A 4CMJA 1PGQA 1SZJG 3NTQA 3VTFA 1HZJA 5FF9A 4M54A 1ZK2A 4RPGA 1DC3A 1Y8QB 4MKRA 2DKNA 2WE8A 1BWSA 4NBVA 1O95A 4UVHA 3WQQA 1VL8A 4CV2A 1E1KA 4YT8A 3I9LA 2GLXA 3MJ4A 2HO5A 3PPIA 1B0AA 4JP2A 2DM6A 3HFSA 3NTOA 4IS3A 4Z3KA 4YTEA 4BO8A 2YHIA 2C5AA 2IXAA 1EVIA 2XXBA 3FRJA 4WCFC 4FFLA 3D64A 3AFNA 3GFGA 1BXKA 4DLLA 4M89A 4CM6A 2GUGA 5BSGA 3IC5A 3WGQA 1HDYA 4O1MA 5BT9A 3W6ZA 1B2LA 5KVVA 1F8FA 2BKAA 3IQDB 1OMOA 2AQIA 4TMFA 3JQCA 1K2WA 2JJYA 3RAJA 5A03A 3PTZA 4JQCA 1NXQA 3KB6A 1ONOA 3V8BA 3QW2A 2C0CA 2O3SA 1J49A 3K9QO 4CLDA 4CM8B 1GPDG 3P2YA 1P1KA 1Z82A 1LEHA 2YDXA 1D3AA 3FF4A 4IBOA 4KDFA 4BB5A 1PGJA 4U0JA 4A2CA 1LDGA 1F8GA 1YQDA 3GVCA 1MG5A 1X15A 3O26A 1YDEA 4M1QA 3KM0A 2QYSA 2VT2A 4WUVA 1CDOA 3FHLA 3JYOA 3H5RA 3HHPA 3GK3A 1KVQA 5I7VA 1ZBQA 4B4OA 4L0QA 2QZ9A 1PSDA 3CSDA 3DZGA 2ZYDA 3CE6A 4R41A 1NPYA 4BIIA 1E1MA 1M6WA 3M1AA 1B8PA 3JQ8A 4UAGA 4OXYA 2GR9A 3F1KA 4IGEA 3TZKA 4LRTB 3WGOA 5JC1A 1NQTA 4MVJF 1Y5MA 3VHRA 1HDZA 3NUGA 3GZNA 1E3WB 3GRPA 2GN8A 3UCFA 1HDXA 4BNFA 1YJQA 3U4HA 3ZNNA 4K26A 5DBFA 4XYMA 4BB6A 3WMWA 3F6YA 3FN4A 4CM5A 2C7GA 2CD9A 5CEEA 4YT2A 3LT4A 4HX5A 1I0ZA 3NJ4A 4BGEA 1N2SA 4Y98A 5A1TA 3UOGA 3HJAA 1UDAA 4UVGA 1QSGA 5CG1A 4TZKA 3N74A 3FNGA 1KERA 1F14A 4UEKA 3GZNB 4YQZA 2Q49A 2WSBA 4WOKA 1E3SA 4DLBA 2Y68A 3G3EA 4LK3A 4FFPA 2JHFA 2P9EA 4P22A 4DUPA 3Q9NA 3HFGA 1N7HA 4EJ0A 1E7YA 1RM3A 1EEHA 2DBZA 4OSPA 5KJCA 4P4NA 1GYRA 2HMVA 4ZQBA 4AJEA 1EK6A 4XDZA 3LC7O 1NPTO 5ER9A 5BNIA 2H6EA 2PLAA 4CQMB 4URFA 1T2EA 2O7QA 3VZPA 3GDFA 2ZATA 3DZHA 1CQJA 1K6JA 3BTSA 3QIVA 3EAGA 1LJ8A 1YB1A 3INTA 2NU8A 3W8FA 1MXHA 4RVDA 5KNLA 1E92A 3AU9A 3O9ZA 4BV8A 1DB3A 1T4BA 5EMHA 4YWJA 3K2BA 3WYEA 3ZGYA 1YGYA 4OKNA 1ADCA 3K92A 4LSWA 3KLMX 3GDGA 2G76A 2ZB4A 3HDJA 1E6WA 2BMAA 1CIVA 4BNTA 4XYLA 1A4UA 4Q3EA 2HAEA 1NP3A 3BMCB 4FFMA 4NBTA 4CMGA 3O03A 1WNTA 1PGOA 4NBUA 2AG8A 1CQIA 1GPJA 3GC6A 3Q9UA 3WYBA 1CERA 4FB5A 1E3EA 4FW8A 3WG9A 4PLCA 5EQFA 4L4SA 2W2LA 4OQZA 1MV8A 5A9TA 3L6EA 5IN4A 5LC1A 3LLSA 3U3XA 4B3IA 3DBRB 1U5CA 1HL3A 4ZICA 1D7OA 1JW9B 5ICMA 1ZXBA 1JWBB 5TIIA 1C1XA 1TEHA 3WJ7A 4CMKA 2YZ7A 3EVNA 2BF7A 4I9HA 5B1YA 1KVTA 1YB4A 3Q1LA 1A9YA 5FI3A 3S55A 2AQHA 5AXDA 2R6JA 1O9BA 2OP1A 3GAFA 4KTVE 4RF5A 2B35A 1TLTA 3C3XA 4GKVA 2EP5A 3RJ5A 3OP4A 4P4GA 4XGNA 3GLQA 3H3FA 5KCZA 5IG2A 3QE3A 3JQEA 1P1FA 4Q3DA 4IDGA 1ENYA 3S2GA 4PG6A 5CDSA 3WWYA 3G17A 4HNHA 2I5PO 4WLEA 1P1RA 4J1TA 1ZK0A 3R3JA 1VRWA 3F5SA 1IHXA 4GVLA 1JU9A 4FJ1A 3JQ7A 5ER6A 2NNLD 2E37A 3F1LA 5L4NA 1F06A 2GN4A 4I8XA 1VE9A 1PWZA 1B26A 2E4AA 4HWKA 3DDNA 4CLOB 4XD2A 1T26A 2X6TA 2HKIA 5IFLA 4N5MA 5JO9A 1F12A 2HMWA 2FP4A 2D1YA 1YOVA 2B5VA 1YWGO 1BG6A 2JAHA 1MB4A 4ZQHA 1JAXA 3VPSA 2EG9A 5JMPA 4OYRA 3PP8A 1UAGA 4U6QA 2RHCA 4DMMA 1GADO 3HG7A 3KYDB 3JCZA 2CUKA 4UULA 2FPPA 4Z9YA 4MIYA 3T4EA 4B7XA 4RDIA 4NH4A 1C0PA 3DOJA 1ADFA 4DC0A 1ZUD1 4OGWA 2IRWA 4L73A 3PYLA 4DYDA 4A5OA 2Y67A 3CH6A 3BMQA 2DTEA 2JL1A 1Z7EA 1JKIA 3PHGA 1LQTA 2NADA 1CWUA 2CFCA 3WICA 4BNVA 3TNLA 1YVEI 2W2KA 4YPOA 3HN2A 2PH5A 5U1PA 3GDOA 1R15A 3K2EA 3FD8A 3KO8A 4NFHA 4QFCA 1NM5A 1LX6A 1I01A 1MXFA 4HFRA 5G0TA 1QYVA 3FR8A 3A4VA 1KVRA 1A27A 2POQX 4WECA 3HDQA 3JD3A 3SC6A 3ICCA 3NTRA 3JQBC 4D3SA 2QYTA 3IIEA 3EDMA 4YJFB 3RBVA 2VZ9A 1X0VA 4E2YA 4CL8A 2XPCA 4XZ3A 5KOIA 1R6DA 1LTHR 1ZSYA 3WB9A 1UDBA 3ZWOA 5EIOA 1FMCA 1U8XX 4MVJP 1IUKA 1KEUA 2FPIA 5DULA 2V65A 4PN3A 3RC7A 3HNPA 3E9NA 4OXKA 3DMYA 2CF5A 4L76A 3ZWCA 3ITDA 1ULUA 3W4KA 4XJTA 4XQCA 5L4SA 4YRBA 1ZXLA 3TL2A 1LBEA 5TRTA 4XIJA 3ZWAA 2D8AA 5DBIA 1I2ZA 2WE7A 1PZFA 3N7UA 4GSLA 4FJ0A 2EGHA 3D3WA 1N7GA 1RPNA 3BMNB 4L4XA 4BKRA 4XKJA 1SB9A 1ORRA 3PQFA 2X9NA 3GHHA 2QQ5A 3COSA 2O3UA 1KS9A 5GZ6A 3ZWXA 3TDKA 3KOUA 3KYCA 2A35A 4BNZA 2Z1MA 3QWFA 4R1NA 4L9RA 1U2DA 3E6AA 1ZIDA 1SEPA 4CUJA 5TT0A 3BTUA 3PRJA 2O23A 3BHJA 4E2XA 5F1KA 9LDTA 2Q45A 4Q3CA 4BNLA 2DPGA 3RCBA 1ENOA 2X8LA 3D3WB 1YJ8A 3BMNA 4NFSA 2JFFA 5GY7A 1DC4A 5CFZA 1VSVA 4TKLA 5B4VA 4ZJUA 4Q39A 2FOIA 3GQVA 5ENDA 4ALLA 3EC7A 1RM0A 4YRAA 5CDGA 1I2BA 2DTXA 5JO0A 3OJFA 3E48A 1EUCA 5AVOA 2J8ZA 1LSUA 3RIHA 2AQKA 3RUIA 5JCXA 3PQEA 1VC2A 3LT0A 1GEEA 2O2SA 2XXJA 3L07A 3UAGA 1KOLA 1I8TA 3PZRA 2Z95A 5FI5A 1D1SA 4FBGA 3ICPA 3WGZA 2ZQYA 4NQZA 3JD0A 1VM6A 4XYEA 4YAJA 3PWSA 1K5HA 1ZW1A 2CMDA 3C7AA 3GG9A 3ZWBA 4QECA 3DXFA 3OQBA 5ITVA 1ENPA 1JWAB 4N54A 3JQ9A 2AA3A 3HADA 1UH5A 1M67A 2HU2A 1CYDA 1YDWA 3JQ8B 4CJXA 4BO2A 2W98A 4YDRA 3KLPX 3QSGA 3RC1A 4YT4A 3JD1A 1E1NA 3NKLA 4J9VA 1M75A 3JYQA 3PJFA 3E18A 4AJHA 4YJGA 4LMPA 4WCFA 2NV6A 4CLXA 3VPHA 4M87A 3GH3A 2GZ2A 3AWDA 3H9QA 3BYZA 1BW9A 5DN9A 1ZEMA 3F46A 1F17A 4UVDA 3QV1A 4JCOA 3L4BC 3G0OA 3AM3A 4DWVA 3ENNA 4OOFA 4QO8A 1WZIA 3MJCA 2ZTVA 2YHUA 3RUCA 3JQAD 1PQPA 4CLHA 3ZWWA 3PIIA 4RPJA 4TRRA 3FI9A 4K9DA 4Y6SA 5TT1A 3STHA 1DIRA 3WQSB 2FZEA 1QYXA 3MOIA 4GX5A 4EEXA 1ULSA 3JTMA 4J90A 1RJWA 4NDNE 4RF2A 3TF5A 1U3TA 4PLTA 3RUEA 1ZCJA 1TB4A 4DPLA 1J4AA 4ITUA 1O8CA 4RVGA 1NVMB 3S8MA 2EW8A 2ZK7A 4D42A 4KUGA 2OUIA 2VWGA 5IDYA 2JFHA 2G5CA 4PG4A 5T8KC 1PZEA 1ZK3A 3ZWMA 1TT7A 4NJMB 3PI7A 2X0NA 5KKAA 1ZMTA 2DU8A 1DXYA 4R51A 1PGNA 3G1TA 2PV7A 3VDQA 4RGBA 1H94A 2PGDA 2AE1A 1BXGB 3JQFA 1HT0A 1NFQA 4TZTA 4IZIA 2VHXA 4HBGA 4D3DA 1QYWA 1W6UA 2X4GA 2Y66A 5EN4A 3VOSA 1LNQA 1UXIA 3NV9A 2Y99A 4RVHA 4TQGA 4Z0TA 3ETEA 5JAIA 4I1IA 3AK4A 2QRJA 1AUPA 4WK6A 4CQLB 2GN9A 2VZ0A 5JFOA 2C2YA 4AL4A 4KTTE 1LSOA 4W7IA 1HTBA 3DZFA 8LDHA 4PVCA 2P91A 1BTOA 4P4LA 2GGSA 1JAYA 2GD1O 1SO8A 1KC1A 2VYVD 3M2PA 1A72A 1KY5A 1PJSA 4ALIA 2GCGA 3H2ZA 1LSSA 2XOXA 4PLVA 2X0JA 2B4QA 2GF2A 4ZN6A 1NTOA 3ZHXA 3RFVA 1HE4A 1MA0A 1K3TA 3RWBA 1TVEA 1QP8A 1E3LA 2VTEA 3QVOA 3ONDA 1QRRA 1DIHA 5COQA 4P38A 2G1UA 4O63O 1FJHA 3K5PA 2NACA 1HE3A 1RM4A 4WCFB 4BO6A 1MC4A 3GF4A 2Q1TA 2YDYA 2EHDA 1HDCA 1ZEJA 2VUUA 2WDZA 3LK7A 4NG5A 1BW9B 4PRLA 3RU7A 5L51A 3WGHA 4FOOA 3VH3A 4KQWA 4WEQA 2RH8A 3KYDA 3R6DA 2Q2QA 1AE1A 1QV6A 1IPFA 4I08A 1IPEA 1VKNA 1SC6A 5IF3A 3KSDO 3GHYA 3TOXA 1YONA 4WGGA 2DLDA 1T2CA 3W8EA 4JJGA 2DC1A 2BLLA 2IYPA 3A1NA 3GFBA 5JAQA 1UUFA 4WLOA 1PJ3A 2ZYGA 1YH3A 4PIVA 1SBYA 5CPFA 4RZIA 1AHIA 1E3JA 3E5RA 5MGBA 4IDDA 4YVFA 1FDTA 1KYQA 3FNEA 1A7AA 4CM4A 3RU9A 2D2IA 2V6FA 2DBVO 2HMUA 4ID9A 4QTZA 3D1LA 5EPOA 4FQ8A 2FR1A 1H2HA 4QX6A 4A73A 1J5PA 2EXXA 1NBOA 4HUJA 1DIBA 3QWHA 2FN7A 1DDOA 5IZ4A 5C7IO 3ZV6A 1HF3A 3W1VA 4EDFA 4ND2A 1A9ZA 5GZ3A 4F46A 3RJ9A 2I3GA 2PKQO 1D4FA 5A3VA 4Y6RA 4E5MA 1Y9AA 3SVTA 3TOZA 2X0IA 1S7CA 2R2GA 2JCXA 5EJ2A 1YBMA 3OIFA 1Z6ZA 2FR0A 1HDGO 3SXPA 1CJCA 2PH3A 2B69A 5HA5A 3MTGA 4GKBA 2CSUA 4B7UA 4MDHA 3GVIA 4HFJA 1BSVA 2HCTA 1E7RA 4WKGA 3TZHA 1QORA 3AUUA 3RUAA 4RVFA 3UW3A 3KEQA 3F47A 7MDHA 3JQ9C 3SEFA 2J3JA 5JC8A 4YAIA 5DP2A 1A71A 5TLSA 1O89A 1V0JA 4CV1A 3WYCA 2FPGA 1J0XO 3C85A 3Q3CA 1ENZA 4Z0HO 2OO5A 3MWEB 3I52A 2IZ1A 1PWXA 4LVUA 3JQAA 1DSSG 3WXBA 4CM1A 1QG6A 3PQDA 1ZH8A 4UUNA 4WJZA 4BO5A 4YXFA 1TT5A 4XDYA 4ZQGA 4II3A 4DPKA 4EBFA 3KRTA 1U3VA 4NIMA 2JAPA 2B5WA 5FEUA 2WTBA 1GUZA 4ZGWA 4EUHA 2RH4A 4XX0A 1WDLA 1SOVA 2NU9A 2EJVA 2CF6A 5DDIP 2IYOA 4ALMA 5KIAA 3WGIA 4J7XA 3CINA 3H5AA 4BKPA 3ETGA 1VJ0A 3DEYX 5U4QA 4FCCA 2UV8A 4D7AA 2AXQA 2C20A 3RSHA 2GERA 1Q7BA 2NWQA 2VRCA 4P8RA 4BNYA 2D4AA 4W82A 4J0EA 1E7WA 4PG8A 3CUKA 4DGSA 3IKVA 2Q4EA 1P9LA 1C1DA 1GZ3A 1NAHA 5IZCC 1ONPA 2B83A 3I6QA 1JLLA 1ZK1A 5DCUA 3ZWYA 3OQ1A 4RPKA 3PGXA 2WJPA 2OMEA 3GEMA 1K6IA 2JCYA 1YBAA 3C7CB 1QYDA 3OETA 1GD1O 1E5QA 1K89A 5F3RA 4WLVA 1PTJA 4DIBA 4JX8A 1U8FO 3R1IA 2BELA 4NHEA 3NDIA 1EQUA 4QXMA 4MIEA 3M1LA 5U9CA 2W4QA 1ZK4A 3WX0A 3C1AA 4CR6A 3M6IA 3SLKA 4PLZA 3R0IA 2VHWA 3ZHZA 4AJLA 1Q0QA 2FRDA 3DHYA 3DZIA 3HZZA 4FFRA 1Q0HA 2V6MA 2BGLA 2BFMA 3NGLA 1OZAA 4FSHA 3NDRA 2C07A 4GH5A 4Z0PA 1HLPA 5G0SA 1ISGA 1H6DA 3RD5A 3UCEA 2UYYA 2O4UX 1V6AA 4J0FA 3RKUA 4FC7A 3G49A 4HV4A 2QRLA 4A0SA 3W4IA 2E48A 2VHZA 3K96A 1M2WA 4D43A 3PDJA 5IDXA 2OBYA 3ONFA 4W9NA 4E2ZA 1GQ2A 2ZB3A 4CL3A 2HUNA 2WMDA 4WNCA 3K31A 4GSKA 1UP6A 5HWSA 3INRA 3EZYA 5DNAA 4EITA 3GGGA 3ZWVA 1W73A 4RORA 3CZRA 4MVJE 2PGLA 5BR7A 1NR7A 1U5AA 2GRAA 2I65A 3E1KA 4R9RA 5DBGA 1P0FA 1DOHA 3LT2A 2O3TA 3UH1A 1DRUA 1EVZA 4J49A 3GUYA 1QKIA 2H63A 5T64A 5TS3A 1NHWA 4XCVA 5A06A 2VYNA 3F9IA 3ZU3A 1R37A 4E5PA 2C59A 2PR2A 5IN5A 1I30A 1PQUA 1DHTA 2EF1A 3VH2A 4ALJA 2O48X 3A14A 3S2EA 1XG5A 4RJTA 2Q4BA 1HYGA 1P1IA 2R00A 2X1HA 5JY1A 5G0UA 3RC2A 3E82A 4IMRA 2NQ8A 1E0DA 4BNGA 2D59A 3SJ7A 3X2EA 2HK8A 2NTJA 2QZZA 3ZU4A 2VHVA 2HQ1A 3WTCA 1CETA 4IXTA 4I5GA 3DBVO 4HP8A 4KOAA 4TVBA 3WGYA 3RKRA 1GL3A 5LDGA 2YFQA 3BHIA 5F5NA 1CF2O 3W8DA 1ID1A 1IB6A 1EVJA 2DUWA 4OH1A 3OA2A 1WPQA 1R12A 2ZB7A 2D5AA 3ETDA 4NJOA 3GPDG 2P9CA 1WWKA 1D1TA 3FTNA 1W0CA 3O38A 4Y9DA 4A7PA 1P0CA 1DLIA 4ILKA 3NRCA 5H81A 3L9XA 3ASUA 4Z3DA 5C3MA 4Q3BA 3GMDA 2Q1UA 3JYLA 4D3FA 4PLFA 4NI5A 4MVJA 1IHYA 1GZ6A 2NLOA 2EJWA 2BGMA 2FY8A 4RZHA 2VN8A 2O4CA 5L9AA 1N1GA 3I9OA 1BVRA 2P5UA 1UXHA 3HWRA 4JXKA 3IJRA 4B3JA 3WJAA 1SNYA 1MFZA 4R9SA 3VVCA 4FJ2A 4BL5A 4E4YA 2A9FA 4DQXA 4F6CA 3K8ZA 2Y05A 4WASA 3A28A 4JP3A 3D0OA 5I7SA 4OO3A 1EQ2A 1PS9A 3ZHYA 3IUPA 3ZW9A 4HKTA 4QSMA 4DQUA 5L40A 3OJ0A 4D79A 3QVTA 4RF3A 2H1SA 3JQDA 4BNNA 1DAPA 4B4UA 2V7PA 4BNKA 1BDBA 4KMSA 1ZMOA 4K6FA 1C0KA 4DA9A 4NMHA 2X5KO 1EBUA 1GR0A 5JMWA 3D7LA 2BFOA 5JW6A 2JD2A 4O6VA 3P7MA 4OXNA 5K6AC 4WE3A 1YQXA 4J4TA 1P77A 4YAEA 5ILOA 4E13A 2FWMX 3UXYA 1ISJA 4MVJD 1LRLA 1O94A 2J3HA 4RLSA 3NT2A 4MOWA 1PZHA 2F00A 2OFPA 1U3UA 4TRJA 4Y6PA 1LDYA 3D4NA 1YOVB 1LLUA 2FMUA 3HDHA 1IZ9A 3QY9A 5JSFA 5JDCA 4E30A 4LVCA 5KVCA 4IQ0A 1VLLA 4I9NA 4GGOA 3VPGA 4OM8A 3BTOA 4IGFA 4YA6A 5DOVA 1WMBA 2CDAA 4YCAA 3IOYA 2IE0A 4Q9NA 4B3HA 4TSKA 1XU7A 2VTDA 2Y93A 1LI4A 4BQPA 3VPXA 4JN6B 3O4RA 1XELA 4OOEA 5JXWA 3VPFA 2I99A 3OFSA 1ZKMA 1UJMA 1LSJA 4H3VA 1HE2A 1ONNA 4TRMA 1Q0LA 1QLJA 2WD7A 1KVSA 3AW9A 3BMQB 3AI3A 1LA2A 4D44A 2BH9A 2YQ4A 1JN0A 1XEAA 1OC4A 3W4JA 4DREA 3T4XA 2W2KB 3OH8A 2P68A 3AOEC 4BGIA 2ZTUA 4NNJA 2QW8A 1O6ZA 1S6YA 4HFMA 4CM7A 3GNSA 3BIOA 1WVGA 2PTGA 4TROA 4DRYA 3FPLA 4JBGA 4XB2A 5ES3A 4E33A 3KV3O 1XQ1A 4TVOA 1VPDA 4YJHB 4N7RA 4MP6A 4PZCA 3Q2IA 2DTDA 2PZKA 3U4DA 3TZQA 3AI1A 5AOVA 4HNGA 1LU9A 3UN1A 3DTTA 2VWPA 5H82A 4AICA 3ITKA 3ONEA 4ESOA 2DFVA 5DP1A 3WWZA 3WDSA 3WNVA 2NVWA 4CUZA 1KY4A 1NFRA 4XEHA 4CLOA 3DBHB 4UUMA 4M8SA 4Y67A 4BNUA 3VKUA 3E03A 3IS3A 4FFOA 3DOCA 3CXRA 1A4IA 1OOEA 1IZ0A 3F4LA 1Q7GA 1NPDA 4KUHA 4ONEA 5KVQA 4YJHA 4JBHA 4R4JA 3NDJA 1P3DA 3E9MA 5L7TA 5KJFA 3WGTA 3JSAA 1R0SA 1DC5A 3AOGA 1T25A 2C54A 4D41A 1AXGA 4RV9A 1QR6A 4U6SA 1XU9A 1ARZA 2WYUA 4W4TA 1ZJZA 2HDHA 4IJVA 1Y1PA 3OMLA 3H9UA 3DMTA 1MFPA 8ADHA 1N8KA 3FWZA 4LMRA 5ENVA 2VCYA 1P31A 1GEGA 1U9JA 4N5LA 2R00C 3WQRA 2RCYA 1X14A 1YL5A 2PFGA 1NVGA 4GMFA 4CM3A 2GDZA 1T2DA 1LLDA 4IUYA 5I8WA 3OHSX 3KTDA 3GN2A 3GUCA 4XRRA 3I23A 3DAGA 5EINA 1I3LA 3MCVA 5JYDA 4AJJA 1ZSNA 3ENKA 4QT0A 5A5FA 2Y1GA 4CMCA 2Q50A 2JFGA 4RL6A 4OSOA 5L7YA 1T2FA 2VQ3A 3BA1A 1WLYA 3JYNA 1H9AA 3A06A 3H8VA 5TJHA 5A9SA 4GWGA 3DOOA 4BKUA 1GV0A 3ADOA 4EYEA 1XDWA 1PGPA 1TXGA 4BKOA 2GN6A 2IEDA 3OJLA 1N92A 2F1KA 1CEQA 3S2IA 1JTVA 3GVHA 2O7SA 4E5KA 3ROPA 4IS2A 4A03A 5F1PA 1YB5A 2E49A 1VL6A 4J4HA 4IDCA 4BO0A 1P1JA 4FR5A 4FOSA 1Y8QA 3JD2A 4EW6A 3OJOA 4ND3A 3LSYA 3H9EO 4MJLA 3ZV5A 1P74A 5AXAA 1MG0A 4PGFA 2GYYA 4BO3A 4FD3A 5T8KA 3UGKA 2GNAA 2I66A 3GGOA 5TSDA 3ROKA 2VUSA 5GZ1A 5FYDA 4ZA2A 1H2BA 5G4LA 1Q2XA 2GO1A 3GAZA 1FDUA 1H93A 2VT3A 3PHHA 1GQQA 1YL6A 4QUKA 3H9JA 3KUXA 4JJFA 4CMAA 1RWBA 5IZCA 2YV1A 4CM9A 2ZTMA 2HK7A 3LF1A 1EUZA 2C82A 2GZ3A 5TQVA 4ZRNA 4NBWA 4GLOA 3PYXA 1PQWA 5TNXA 1DEHA 3Q2KA 4GL4A 3ZNQA 2A4KA 3WTBA 3RUDA 5JLAA 3ZU2A 3ZWPA 3HE3A 4QFDA 4XGIA 4GX0A 3PYMA 3QVSA 3Q6IA 4MKZA 4B8ZA 4BNXA 3IP3A 1B7GO 4QEDA 4EZBA 3BMCA 1V8BA 1B8UA 2X23A 5CDYA 2Z5LA 1GU7A 5B37A 2OOSA 3PHJA 3AUAA 2E6UX 1U7HA 2Z1NA 3OM9A 4IINA 5KJ1A 5HBRA 4OAQA 5CDTA 5CAEA 4OKIA 1TA4A 3F5QA 5IJZA 5CP8A 3GVXA 1I3KA 1R16A 1PS0A 2DPHA 1EBFA 5TC4A 4NZ9A 5BSHA 3EMKA 1SAYA 4AFNA 4BO4A 1A5ZA 1OBFO 1MLDA 1X1EA 1X0XA 2UUPA 1MUUA 4HXYA 4RVSA 4IIUA 1U7TA 1V9LA 5IXYA 4Y8VA 3ANMA 1ML3A 3V1UA 4YRDA 3A9WA 4E12A 3QA9A 1ZJYA 1I36A 4R69A 3AU8A 3RI3A 2AEFA 4II2A 4R68A 4K28A 5T67A 4XGKA 2VYVA 3AOEA 4BMSA 3DZBA 4BO9A 2NQTA 1KETA 1Y9EA 4BUCA 2EKQA 4PRKA 1CRWG 3DBHA 4MINA 1J6UA 3GOHA 3ULKA 3FNHA 1LQUA 1KIFA 1HYEA 3E9QA 4IQ8A 4B7CA 2P9GA 4M55A 1ZO8A 4DQVA 1P1HA 2EWMA 4GAEA 2Q1WA 2P2SA 3FBGA 1VKOA 3KBOA 2C29D 3RQSA 5AYVA 4JROA 4ROSA 3DFZA 3TRIA 3AJRA 5HTOA 2PKQP 2CVOA 1BVUA 3GR6A 3S1LA 4OJNA 3E5MA 3TFQA 4KWIA 2PA3A 2Q2WA 3D3EA 4BGVA 5BQFA 2P4HX 1VJTA 1HDRA 5KTKA 3RUHA 3RBXA 3MJVA 3DB2A 4FC6A 5THKA 5IDQA 4MP8A 5B12A 1BXGA 4LN1A 1DO8A 4DL9A 4R54A 3LZ6A 4EJ6A 3AY6A 3RFXA 2EEZA 2PY6A 3MZ0A 2CNBA 4RPHA 2IODA 3I6IA 2YJZA 1IL0A 4H15A 2DFDA 3L4BA 2EV9A 4R1SA 1PIWA 3WNQA 2ZB8A 4ZHSA 1C1XB 1PEDA 4F6LA 2VZ8A 4OMUA 1O0SA 5FFFA 3JQAB 4JNKA 3JYPA 5A9SB 1GCOA 5TGDA 3WBBA 3AUSA 4L74A 2VRBA 3FTPA 3O8QA 1PJLA 4U5QA 1DPGA 1E77A 4ZU3A 4XIYA 4BHTA 1OAAA 3PWKA 3PWZA 4FPXA 2I3AA 5JPIA 1E7SA 3CKYA 1SMKA 4NU6A 4INAA 2VNAA 1NWHA 3NJ8A 4YEDA 4BS9A 4YR9A 3U5TA 5K0ZA 1I10A 2VRCD 3CTMA 4FGWA 4IY1A 2O3RA 3KYCB 4BNWA 3H9GA 4PG5A 4GGPA 2CZCA 3Q0EA 3QLJA 1N1EA 2Y1DA 4NK4A 4AJ1A 1NNUA 2Y1OA 2D5CA 3PXXA 3BZUA 3HUDA 2OZPA 1JKFA 4FN4A 1XLTA 2GZ1A 5KVSA 1H9BA 3DHEA 4GMGA 3EW7A 3WBFA 5F21A 2IDZA 2ILTA 4D0RA 2HK9A 4GPD1 5L7WA 4IZHA 5T5QA 5B4TA 4IPTA 3H2SA 4MP3A 3C24A 1WP4A 2DQ4A 4KZPA 4UEOA 1T1RA 1X1TA 3OECA 3EHEA 5JYEA 4IJUA 3PJGA 4A10A 3KZVA 4B4VA 4E5NA 2NTVA 2B36A 1T4DA 5DF1A 4NJMA 2X86A 1Q1NA 3P19A 4BNIA 4C7KA 5AQ1A 5I9NA 4I5FA 4BQRA 2G0TA 1E3WA 3PHLA 1EE2A 1H0KA 2WD7B 4I5DA 1QLHA 2AG5A 3FNFA 1HLDA 4RDHA 4CV0A 3I83A 4F45A 3W6UA 4CR8A 3L6OO 1X7HA 1PL7A 2EIHA 4MIOA 4OHUA 3WSWA 1DFGA 3RFTA 4J6FA 4HY3A 3DAPA 1GYPA 3L9WA 1LDNA 4C7JA 3DZJA 2PK3A 2VHYA 3IL2A 2ET6A 4NU5A 1P33A 5F1OA 5JDCC 1R4NA 1ISHA 1SB8A 3IAHA 3MJSA 4G65A 1YE3A 1GUFA 2W2LD 3ON5A 3KHUA 2NSDA 1E5LA 4YJGB 3WSVA 4BKQA 1LRKA 4E3ZA 1M76A 2RBEA 2X22A 2PZJA 4DBVO 2UAGA 4XQEA 2WYVA 3L4SO 3UCXA 5T57A 3GEDA 3B1FA 1R0LA 2UUOA 5JDIC 1Z45A 2EW2A 2Y0CA 2J5KA 2CDBA 3LF2A 3ZHBA 3H7AA 2WD8A 1PX0A 1XKQA 3JQGA 5F5LA 4PG7A 4MKXA 1PR9A 4LISA 3AFMA 2HRZA 1G1AA 4R5HA 4CV3A 4E32A 4EUEA 9LDBA 3UICA 2DAPA 2AEJA 4K1LA 4GI2A 2FSVA 3L6DA 1HSZA 2YYYA 4UEJA 1B16A 1GTMA 1UXKA 2WEKA 3DWFA 2UDPA 4E31A 2I9PA 3GRKA 3BMOA 4BO1A 1WMAA 2YHIB 1K0UA 5ADHA 4CQMD 3C8MA 3AUTA 4H16A 2LDBA 2JD0A 1UR5A 4HADA 4M49A 3VH4A 1OI7A 1KEPA 4J1NA 3KSZO 4PCVA 4WEOA 4YQYA 2FSSA 2CDCA 1UXJA 4L75A 1PJQA 1EMDA 3FR7A 4UVEA 1LLQA 3QQPA 1QYCA 3AY7A 3I9JA 5CHEA 1JA9A 3DONA 3LU1A 3QRWA 1BDMA 3OEWA 3IKTA 3CIFA 3GGPA 3TL3A 3PFWO 3WMXA 2FZWA 2AHRA 4JIGA 3ZH2A 2HJSA 1G0OA 3CZMA 4ND5A 5TF4A 2QIOA 3MOGA 4OL9A 3EUWA 5LCXA 3NGXA 1L7DA 4PVDA 2EP7A 4J1SA 1V3VA 4MVJI 3KYBA 1F0YA 1Y7TA 3DMTC 3V5NA 4YYZA 2B4RO 1FK8A 1X7DA 2GASA 4KWHA 4O0LA 4ZRMA 1EDZA 4IIVA 3B6ZA 3UUWA 3MTJA 1B14A 1VI2A 3V2HA 3EGOA 2EKLA 4U8GA 1YL7A 3BTVA 4DIOA 4BGUA 2OORA 1QV7A 5IDWA 3VVBA 2B4TO 1LLCA 3X2FA 1X7GA 4YJFA 4XQ9A 3VC7A 1M6HA 1P45A 2EGGA 4BNJA 5A04A 1I5RA 3CPSA 2H9IA 1NWCA 2ZYAA 4CMEA 4W7HA 1BMDA 4CR7A 1KBZA 5JCJD 1H6CA 3ZNOA 3SBOA 3FPCA 1Z75A 1RM5A 4CLEA 3H3JA 5I7EA 4Z9FA 3UHAA 3D5TA 4R3NA 3PLRA 1NX6A 4RCVA 4RLHA 2J6IA 1Y6JA 3F3SA 4PLHA 2JHGA 2Y0EA 5A4DA 4PFJA 2WM3A 1LUAA 2NVBA 1FXSA 1E6UA 5C7OO 2B37A 1Z74A 4LCJA 5LDHA 1XGKA 1NQOA 3PZBA 1C0IA 3GN1A 4PLYA 4KDEA 1Y8RB 4EEZA 2O2YA 1YS4A 3G79A 2A92A 5CDUA 1DJQA 2TMDA 3PGJA 4I5EA 3B20A 3T7EA 1LDBA 4ALKA 1DBVO 4RVUA 3LVFO 2NU7A 3U0BA 2Y1FA 5C5IA 2GSDA 2VWHA 3HN7A 1Y81A 1ZFNA 1PJ4A 2HRBA 3SC4A 4AJKA 2W8ZA 4GVXA 5K6AA 3VZRA 6LDHA 2BHLA 3WLEA 1DFHA 4W99A 3GNQA 3DAFA 4XYGA 3FSRA 1ZZEA 4YAKA 4GWKA 2YV3A 3VDRA 4XR4A 3NYWA 3CEAA 3TN7A 3KETA 3WLFA 4MVJG 4DBZA 2YY7A 3QJ5A 1NYTA 7ADHA 1XIVA 4GLLA 2XF8A 5AXBA 3RUFA 1I3NA 2DBQA 1HYHA 4CMBA 2X7HA 3EY4A 4J16A 3U4CA 4R1UA 4B8WA 3HB5X 1RKXA 4IXWA 4DIFA 5JY6A 2YV2A 4R01A 1DAOA 3NAQA 3I3OA 2BRUA 1GV1A 1JVBA 3L0DA 3OEYA 4M86A 5I8ZA 4E2WA 5BSEA 1BHSA 1KC3A 3GEGA 1HEUA 1R66A 4W6ZA 4W9NC 4ND1A 3DBRA 5T6BA 1UAYA 1UZMA 2OXIA 1HDOA 1PJBA 4DLAA 1FDVA 4FFNA 2C5EA 3JQBA 4RF4A 4N18A 1GFSA 1W4ZA 3I4CA 4CMIB 4L4RA 5L3ZA 4FDAA 1E6EA 4JK3A 3IUSA 3EVTA 2BI8A 1K6XA 1A7KA 4NFYA 3WR5A 3MJTA 4JJIA 1HE5A 2AE2A 5BNTA 3HSKA 1SEVA 4J91A 1B15A 2H5LA 1U4SA 1YQGA 4ZQEA 1PJ2A 2SCUA 1NAIA 1XR3A 3BMOB 2DVMA 3UKOA 3LYLA 3VKVA 4WCDA 3OIGA 3IDSA 1W8DA 4CM4B 1VSUA 4WPGA 5ITWA 2JCVA 4D46A 3VZSA 3P2OA 5KWEA 1XQ6A 1ISMA 4PZDA 3ABIA 4JLWA 2J3KA 2UVDA 4DC1A 3AM4A 1PU2A 2O50A 5DT9A 1AXEA 3V1YA 3H6KA 4I9UA 1GUYA 5CEJA 5I9MA 2A94A 1YXMA 2ZKLA 3I9NA 3IMFA 3NT4A 1PZGA 4CUKA 4QQRA 4EUFA 4J4BA 2YFHA 4WLUA 4NPCA 3ZZNA 1LDMA 1U2GA 4BOYA 3ADPA 4XJSA 3ZCXA 2ZJ1A 2AW5A 5ICSA 4E6PA 4RQUA 2Q3EA 4GBJA 4G2NA 4KP7A 1AN9A 3QVXA 1Z73A 2OBNA 4ND4A 1T24A 3O8QB 1C0LA 1FDWA 1B3RA 1MP0A 2CVZA 4TKMA 4BNMA 1YBVA 2AEMA 1X13A 1HWYA 3GY0A 4XRGA 1HETA 3TQHA 1T2AA 4DMLA 5A3JA 2IZ0A 4J43A 4AJOA 2I76A 3VH1A 5DOZA 3WFIA 1NVTA 4FS3A 4B79A 1G0NA 2VNSA 2HSDA 4S1VA 5JAZA 4JGBA 5JCJA 3QVWA 5KJ6A 3JQ6A 1GDHA 1XWFA 4AJNA 3U4IA 3U49A 3CMMA 1EE9A 1SCUA 4BMVA 2J5RA 1DFIA 1QMGA 3F4BA 2ZTLA 2E82A 3ANNA 1EFKA 3DTYA 1DJNA 2QHXA 4IDAA 5DCYA 1N5DA 4BMNA 1ISIA 4R16A 2PD3A 1G6KA 4DPMA 1HZZA 3NX4A 1E1LA 3PLNA 4J1QA 1M66A 3N58A 3ZV3A 5B4UA 3WGGA 3GG2A 3FCOA 4RO0A 1WDMA 1IOLA 3TFOA 3PHIA 3UVEA 2AQ8A 5L4LA 2G17A 1R4MB 2LDXA 3GPIA 3DZKA 3M2TA 5EERA 1BGVA 1E7QA 4NBRA 3AY3A 1PL8A 3GT0A 5EL0A 1OC2A 4WOJA 1LDEA 2RHRA 3T7CA 5HRUA 2ZQZA 3EK2A 3OICA 5G4KB 2V6BA 4K6CA 1U3WA 3B1KA 4N5NA 1ZNQO 3K30A 1LC3A 3D4PA 4FGSA 4WLNA 4OQYA 4CPDA 4TRNA 1RYEA 1XCBA 3WFJA 1N9GB 3SX2A 2I67A 5EQDA 1WW8A 3BHMA 3LT1A 2PD4A 1NFFA 1YRLA 3CMCO 1R4NB 3D4OA 4J7CA 2HJRA 3DHNA 4ALNA 4BVAA 4DTIA 1E7MA 3P5SA 2CVQA 2PZLA 4MO2A 3JD4A 2NVUA 1SOWA 4IDBA 4G5HA 3ROMA 3LC2O 5COBA 5MDHA 1V3TA 3DBLB 2VOJA 1ADBA 1I33A 1UZNA 3ZV4A 4AJPA 2V6GA 2YQ5A 4XWYA 2VOEA 4CLRA 5H83A 2WWRA 3PVZA 5I7FA 4S3MA 1GY8A 1IYZA 5L45A 3DO5A 3MJEA 3I5MA 5TJ9A 3V2UA 4LRSB 3ZW8A 3L77A 3EYWA 1UZLA 2PWZA 3INGA 3QWIA 3V1TC 1PJTA 4E21A 1UP4A 4BV9A 4UREA 5HS6A 3ZU5A 4DXHA 1C1DB 1L7EA 3ZWNA 1U4OA 2YW9A 4CM8A 1LXCA 3AI2A 2X9VA 3DBLA 4FIZA 4PLWA 5JNLA 1E3IA 1P44A 5THQA 1Q7CA 4IMPA 2Y0DA 2ZCVA 5CEFA 2X5OA
chains in the Genus database with same CATH superfamily
2AB0A 1VHWA 1O5IA 5JBIA 4KN8A 1NLUA 3R20A 1N33B 1GPWB 1GNLA 1BX1A 4I50B 3ROXA 1J2RA 3HKBA 4BO7A 3KKPA 1UCFA 1WHSB 2Z30A 4F4DA 3Q11A 3P2EA 3LDHA 2Z43A 3C1OA 4P3PA 3H4MA 4YHBA 5JAMA 3K0AB 3K15A 4U3JA 1O9GA 2FR8A 1B2RA 2GNOA 1BU5A 4PO3X 1NNSA 2FPIB 2LCFA 5FO1A 1EHCA 1NQ5A 4MMXB 2XYVA 1GNPA 1MX9A 7ABPA 2EFYA 4K46A 5HILA 4G1FA 3PNLA 3RROA 2Z6VA 1V37A 4XQGA 4K8RB 3U37A 2FFHA 2RHGB 1J22A 4IMIB 2XE7A 4X3PA 5DT2A 4OAPA 2Y8EA 2XMDA 4GM0A 1W7AA 3CF6R 5FT9A 1YBFA 1P0IA 3ZTTA 1DIGA 1XPUA 3DQPA 3OY7A 4GQAA 5KU7A 1IN7A 2BFAA 2VDRB 4X1YA 5J23A 1SG0A 2K2WA 4GX1A 1J0DA 1CR4A 1JIXA 1Z7YA 2FE4A 2XUHA 4FYVA 1CUVA 2X2FA 4KQIA 5CPBA 3H6GA 4HYEA 5FHQA 3TJRA 4BJ5A 3DL2A 2SKCA 1N2BA 1XZHA 1ZNYA 3CH7A 4DDWA 5DLDA 4BQEA 3D3NA 3BWYA 3VYWA 2B6HA 4W1RA 1RQNA 4JUIA 1LNZA 1S4MA 2WKQA 1DX9A 1FUIA 2NPOA 4ZOBA 1OW3B 2EARA 1HRDA 2HJGA 2BFPA 2XYPA 3C3KA 2ZS9A 3LRPA 1Y5RA 1U0NA 3C14C 2PKRA 3AIIA 2RAFA 4PZYA 1FF9A 3A3PA 1Z2OX 3Q7PA 4P31A 5HVNA 4X7RA 1E9VA 3JVDA 3EEBA 5BWCA 2XNDA 2F7SA 1DT5A 1Y8RA 2BDTA 4J3FA 2W6JD 3I9V6 1G16A 5ALOA 3BGIA 3AEXA 1FTGA 2GBCA 5CK4A 1ZCBA 5IAAA 2Y1CA 4L5IA 4REQA 4HDNA 2XUIA 5EKSA 5HF5A 4DYVA 1G8MA 3S1SA 3LH5A 2BGKA 3GJTA 3OPMA 4WXMA 1V1RA 5F1YA 4CLRB 5FPTA 3E9DA 3PQ8A 3MIIA 4OYHA 3T7IA 5GP1A 2JFXA 1AOXA 2ACKA 3SIXA 5GMOA 1ML4A 3KEOA 3NG1A 1Z08A 3H11A 1WDKA 4PPGA 4DDUA 4JLUA 2QVZX 4N7MA 5HSGA 1TCUA 4DANA 1Q7RA 2QLJA 3PUZA 4EGQA 2A5FA 4C0WA 2X4LA 1JIVA 2WWWA 3ZK8A 4BPRA 1EWTA 2B8WA 4IDFA 4IVRA 1DL5A 4J7UA 4AF8A 3CQ9A 2C2XA 1WQ1R 1XI2A 4CVNA 5IAOA 3SS9X 2CBZA 1NOKA 2R2AA 1TM4E 3ILHA 4UUOA 3G59A 3ZN2A 5EJIA 5BVHA 2PUFA 2NPFA 1BE0A 3CSSA 4C4OA 2MINA 1WXDA 1GGEA 3UFXA 1MDFA 2A57A 5DEIA 3KQQA 4O59O 3VDNB 4W5JA 3DVAA 1Q95A 1WY7A 3FY4A 4O5OA 1T3GA 2QN9A 3GJ6A 3L43A 3PC2A 5FLEX 1MAVA 3WLKX 4EGFA 2OCXA 4EARA 2FMTA 3CUYA 1Q17A 1W19A 2XUFA 3EFBA 1ZVMA 2WILA 1AGNA 4BMDA 1HL7A 3L7IA 4WLFA 1OLSA 1HE1C 3G0BA 3UWMA 4BVLA 5FIUA 3FVQA 3WIEA 3ZVLA 4M1OA 1YQQA 1EDOA 1WAMA 3GFVA 5DHPA 2OP0A 5LXTB 5BVHB 3RVLA 3IEVA 2IZOA 3X1ZA 2CY0A 4KV7A 2IEBA 3AP1A 4JLNA 1B8VA 2I6TA 2DFTA 3GP3A 4ZVSA 1W0JD 1TI7A 1H6BA 1KBQA 3IHKA 4GNRA 4ESHA 1RPZA 4C7OB 3DQZA 2H1CA 3WL4A 1OFGA 2C2BA 2NU6A 4OQMA 2Q7DA 1LGYA 1L4EA 5FUQA 4B76A 1EUDA 2NVUB 1XTJA 4OREX 2ECQA 3A3OA 4Q03A 3VU0A 3ZE9A 2HNKA 3N2KA 4LZPA 1TEXA 3AFOA 3L6BA 1VHTA 4KPYA 4HMPA 4NZPA 5JS6A 4J3NA 5TARA 4DRXA 4QASA 2PA0A 4PYQA 3LYAA 5DV9A 1E9DA 1G2QA 2REQB 3RODA 3V4SA 1ABEA 4JUCA 1SA0A 1UINA 3LDUA 3KS9A 2XAAA 4MKHA 4LSGA 4LDZA 1P80A 2JLXA 1NF9A 1E5XA 3QHAA 3GNTA 1EP3B 3M9WA 1K08A 4IVNA 4MRRA 4GE3A 1PFQA 3ZGOA 1Q1QA 3GLFA 1J5EB 4QGHA 5AH0A 2H65A 3GJ4A 2O05A 5IC6A 3T7RA 2R7MA 5KKCA 1GCUA 3ORFA 4ZHQF 1TIKA 2JD1A 3H65A 4E09A 4YDSA 3QP9A 2Z2YA 5EXDA 2WTEA 3CZ5A 1U0TA 3F3YA 3ISVA 4EOGA 5A02A 5FD8A 2XA2A 2MT9A 3LD9A 3QFSA 4GQIA 1MO6A 3MRXA 3N5KA 3VR4H 2PRSA 4URZR 5BSFA 1JG2A 1QKKA 1TT5B 1UBCA 3UK2A 2JAUA 4UBNA 3RAEC 4PLPA 2ODEA 4RETA 1QXSA 3E8XA 5E8RA 3S6JA 4EGSA 1ZD5A 5JMOA 1IWPB 5ES4B 1EA7A 1FFAA 3OIDA 1SK8A 1NQUA 1T0IA 2W2OA 4IIJB 2UKDA 1R6BX 4EB3A 2ZJZA 4JP8A 5DHRA 1LVGA 3JV7A 5P21A 3CBGA 5JEDA 1XNQB 1MO5A 3IUJA 5M7EA 1BXZA 1U1FA 3HDYA 2J3QA 3BRQA 2BKLA 1F2UA 3ND7A 2X0RA 4JOSA 4FEEA 3T7TA 1F48A 2HLPA 4EA7A 1M8KA 2QP4A 2LBPA 4WQMA 2A3RA 4I81A 1P4AA 2Q46A 2IZZA 4XX1A 3RIEA 3EVBA 3UOAB 3VUEA 3PNYA 1W4CA 3AHIA 3RF6A 2E4UA 3UJBA 1FNSA 4QO7A 4XGQA 2IIVA 1AM4D 3R7SA 1NUAA 2PRZA 4R1PA 4NJEB 2XGMA 2OL4A 2AX3A 2XB9A 3I0MA 6CHYA 2P5YA 3FFAA 1C3LA 3C8ZA 4LGCA 3UF0A 2I0FA 1G60A 1VSTA 3ENQA 4L51A 4D3ZA 4Y2YA 1IBCA 3KVRA 1ZGBA 2D3TA 1QRTA 3ABQB 4EGJA 2BTQB 4F1WA 2DY0A 2PWBA 1UK8A 1W4LA 4HOYA 2HA0A 1P7ZA 3OBBA 3JPYA 4KDCA 4WNIA 1R1DA 2ZCUA 2ZGVA 3LPCA 4L8GA 5HK9A 2QD3A 3T9BA 4HEJA 5DYYA 4Z6KA 1YJBA 4D9CA 5CDFA 2J9ZB 5EP2A 4B83A 2C3UA 5DHTA 4GC5A 4QT4A 1YKSA 2CHFA 4CMJA 1P7WA 3DR3A 3W9SA 5CB4B 4QRHA 5LBUA 3IAM1 4IYJA 2M32A 1R00A 1CY6A 1DC3A 2JVJA 2PANA 3WQQA 2GAAA 2AFIB 2DR3A 1RLMA 4UNPA 3OOYA 1UC8A 4HWPA 1Q1ZA 4FW9A 4J1TC 5FLYA 3WKEA 1JAHA 2XB6A 2BEVA 4OKSA 1ZRSA 4JP2A 4DM7A 4XLZA 4FI3F 1RSZA 2VDMB 3NTOA 4Z3KA 2HHAA 3G85A 2BMJA 2FPMA 2YVLA 2IPOA 2G4LA 2H11A 2IXAA 2J7KA 2ZI5A 3CGGA 4HZUA 3VGPA 4CF7A 2ID9A 3EGXB 3UMMA 2ONCA 5FNVA 3AP3A 3GFGA 1XEXA 2G1JA 4NNOA 1JX6A 1NOJA 3FLAA 4PWZA 5BSGA 4FGJA 1NV8A 2FZKA 3O9VA 1HDYA 1YKGA 2WF5A 2D2VA 3EXIA 3QEMB 3W6ZA 2PZEA 1W25A 1B2LA 1M0WA 3EQZA 3ROZA 1OXVA 4M9CA 2XGOA 1J97A 1RYNA 1H5NA 3H1GA 3M6VA 1SRRA 1W76A 4TS3A 5IP5A 1C7FA 1ZJ6A 3FPAA 3RAJA 3WXMA 5A03A 3I5YA 3EIOA 3THSA 1S2MA 1YIAA 1Y5LA 2OD2A 3V8BA 3QW2A 4FEAA 2C04A 1J49A 2QMQA 3WHPA 3AESA 3WRVA 1QV9A 1F0PA 4HDCA 1SVWA 3P2YA 1Z6QA 1LEHA 2YDXA 2C31A 4K9RA 4KDFA 1GKUB 1XEXB 3SQDA 1JEYB 3AKCA 3IR6A 4JQYA 4DARA 3G88A 2ZB2A 3AGPA 4RCZA 2IXEA 5J58A 3GVCA 1YVPA 3ONWA 4R2XA 4DF3A 4IOJA 1CS4C 1E1QD 4LDJA 4CGZA 3QE0A 5FTLA 1Q16A 4COKA 4WUVA 4C0QC 2ZYIA 3C3YA 1BE8A 3QBDA 4URUR 1QC5A 3EWNA 2C7RA 2G36A 2FQWA 1F60A 4L2IA 4EG7A 5CA0F 3NBUA 1KAQA 1PSDA 2QZ9A 4L0QA 3DZGA 1CJMA 3ICOA 4L3WA 4R41A 1PR0A 1NPYA 1AA6A 4Z51A 2CVHA 1KYXA 1S9DA 1U2RA 3HYSA 3R9KA 3SF0A 2PSJA 1VHLA 4AXXA 4IGEA 4DAEA 1YASA 4ESEA 5JC1A 1Z8FA 3TR6A 2C58A 3VHRA 1HDZA 3NUGA 4DSNA 2AW3A 5C46F 3HWX1 2EYQA 4DCPA 1HG0A 4I19A 5HTKA 4QREA 1AMUA 1YJQA 3NEAA 4X44A 1VJRA 3BXHA 3EQ8A 1RLIA 4BB6A 1VLZA 4D9IA 4UTXA 3F6YA 4GOKA 4XTRA 3EXAA 3X2SA 3THYB 3LT4A 4QXRA 2DBYA 5ERYA 4LF8B 3ZD8A 3ZE2B 2OWEA 5C35A 1AT1A 2LKCA 3BULA 3UOGA 1GWNA 1JWLA 1M8GA 3RVBA 1UDAA 1OYOA 1D2CA 1YRQA 1LWOA 1YB6A 4FMPA 1N6OA 1EBBA 4TZKA 1KERA 1NTRA 3U9SA 2FJ0A 5CYOA 1F14A 3R7WB 3QXSA 3F2IA 3GZNB 4YQZA 2WSBA 5JXJA 1K1EA 4B7ZA 2VSQA 3KR2A 1YZGA 4C89A 4FFPA 4BYMA 2BTOA 3OE7D 3ER8A 2XVAA 4OUDA 3KOXA 1Y5IA 5TV2A 5T7BA 2J3EA 2FSVC 1W5BA 4MV0A 1E7YA 5BWBA 3H8WA 2DBZA 1GNTA 1NVXQ 4OSPA 4YLYA 3PDWA 3VR1A 5J1SB 4AJEA 3U7HB 1Z18A 1YGPA 3MAJA 2P90A 3LKDA 4Q19A 4MR7B 4BZWA 5ER9A 1N6KA 5ALQA 1G5IA 3RTCA 1GILA 1E6KA 5BNIA 4CQMB 4EW2A 1OX4A 4HRXA 1MAUA 3D4BA 3OWOA 1E9AA 4ZAFA 3GDFA 3TLXA 1BS9A 2O2IA 3DZHA 1CQJA 3BTSA 3E1SA 3QIVA 2PX4A 3V4ZA 1YB1A 4EF5A 4ZYWA 5JROA 4FEGA 4Z49A 3DUWA 1MXHA 1O0CA 3PUWA 2XOKA 1KQOA 4LTMA 2SKEA 5AM0A 2BN4A 5ABPA 5MN4A 3BL6A 2Z6QA 5HOQA 2Q3CA 1G291 3CVJA 3K2BA 3WYEA 3O3OB 3R6GA 3K92A 1L9XA 1RACA 1NSYA 3MYRA 1NNEA 5IVKA 5E9WA 2G76A 2BMAA 1PZNA 3AV0B 4WBNA 3RW9A 3GLIB 4R0VA 4Q3EA 2HAEA 2MDTA 3BMCB 1JVNA 3N8IA 1U9YA 2BR3A 1PGOA 2KWIA 3FYUC 4NBUA 1Z8NA 1CQIA 1W2GA 1YRYE 4HH3C 4J0DA 5C4MA 1RKUA 5CYPA 4FB5A 3ECSA 2FG5A 3WYBA 3F6RA 4RTPA 3LPNA 5J40A 5EQFA 1S2GA 2A6PA 1R8JA 3OPNA 1IZZA 3OPYI 4L4SA 4OQZA 3RWMB 4AO6A 3L6EA 5IN4A 5LC1A 1Y48E 3IULA 3C3EA 4K1XA 1XQ9A 5FADA 3Q72A 3RH0A 5JARA 3OPXA 2FGKA 3M0EA 4DT1B 1MABB 1JW9B 3CM0A 1JLMA 5BRAA 2WJAA 4BQFA 3UJ9A 4PAWA 3BZWA 5TIIA 4IIGA 3D7SA 1TEHA 3URMA 3BRWA 1XLUA 4Y6QA 5FJIA 1U3CA 5B3JC 3EVNA 2BF7A 4Z4CA 1U1GA 3GV0A 3LNCA 5CM8B 1CRZA 4UASA 4GPZA 1F4VA 4UJ3A 4NYMR 3ZE8A 7MHTA 1YI1A 3N75A 4IVPA 4F8YA 5KX5F 1UOOA 1EJ6A 3EIWA 4GMKA 4Q47A 3GLSA 5FWXB 3HXOA 2J31A 4C29A 1VDZA 1JIQA 3FDIA 1M83A 5ICGA 3ANXA 3KXPA 5F7ZA 4H7KA 5IG2A 3QVGA 3CUTA 1T0HB 3FRHA 3M3PA 2P4UA 2RHLA 4HTFA 3V7NA 1U9CA 4IDOA 4B47A 1XCJA 3G17A 2PGIA 2XYRA 2I3ZA 2H2GA 3ES9A 2XYGA 2ZRCA 1UC9A 1XD8A 2Q27A 4H3SA 3IXQA 4QOGA 5B58C 1GPAA 1AQIA 4J1TA 4EENA 2G5PA 4HWRA 1IHXA 5KYXB 1WVIA 2VSXA 3JQ7A 1KJZA 3PTLA 2DE0X 1L0BA 2VSOA 1XCPA 2QTFA 4D8VA 2WJWA 3TG8A 3CEHA 3G7NA 3TIFA 3ZI7A 5K5EA 3W5VA 1I7LA 3R6LA 3TR5A 5A6VA 2UUBB 2UZAA 3F0TA 2FNAA 2X6TA 1XDBA 3MSCA 3E0XA 4NH0A 3KP1A 2ZRJA 2H4HA 5IT5A 4QYIB 2COUA 3HJGA 5LOVA 4EYOA 4Q1DA 2V1XA 4HJRA 1TM1E 3I05A 5HF9A 2WABA 3RDPA 2IXGA 4FKZA 2J6HA 2JAHA 1UPUA 4R84A 3WBKA 2WAAA 4AZ3B 4B85A 2WG2A 4WZBB 3COJA 3TTWA 4K05A 1ISSA 4ILEA 3THXA 4QZVA 1MKYA 2F4VB 4HQRA 3OUTA 1QM5A 1UAGA 2AZDA 5B53A 2ZUEA 2O8BB 3RIMA 1KJWA 3FUVA 3DBIA 1JDSA 1T4CA 4MAFA 4UULA 4AUEA 4JEIA 2PLFA 4NNPA 5BV0A 4C30A 3S3TA 4RDIA 1B00A 3NYIA 5H68A 1KJ8A 3G9XA 5JSZA 1UK9A 3DVRX 1E0AA 1PR6A 4YONB 4XD7A 4DYDA 4UZEA 2V0CA 1ACLA 2RHBA 3CH6A 5DB4A 5DTEA 5TQJA 4XUCA 1H05A 2JL1A 4U7JA 4F2HA 2I2XB 2O8DB 4J0QA 3T5MA 4YUWA 4RZ2A 5GM1A 2VDNB 3TNLA 1YVEI 3CLRC 4HH1A 2PH5A 3IP5A 3IAM6 1CUSA 5EZYB 3GDOA 4MYDA 3SZUA 4WUTA 3TLAA 3VHXA 1D5WA 2VHCA 3FD8A 3MWDA 4MW9A 4A0HA 4EO4A 3O8RA 1NM5A 1LX6A 2I78A 1MH9A 3DS8A 2C2KA 4WN9A 2XECA 3K4PA 3ESBA 1K3FA 3I6BA 3PFNA 1KVRA 1A27A 2POQX 3IR5A 3JPWA 2ZBQA 3ICCA 3L0SA 1DKMA 1FYDA 3ER6A 1N6NA 1ODTC 3A7EA 3EDMA 3RBVA 1JSLA 2VZ9A 3MYYA 4CCYB 4MH0R 1JNYA 2BHRA 4CL8A 5K05A 2V7UA 4GBMA 4K6OA 3KQHA 1R6DA 3TTXA 1SHTX 2Z2KA 4JR2A 1RAEA 1UDBA 4MQEA 2O8DA 2XCSB 3OLYA 5EIOA 2IUUA 3ZVNA 2VJNA 1UFVA 1VG8A 4MVJP 4KGXA 5JTUA 1KEUA 3RHTA 1UXOA 1A9XB 4MLZA 5I9BA 3UJCA 3M83A 1CVRA 2O20A 2JLSA 5CVTA 3BX1A 3NBXX 4OGKA 4OXKA 1U1EA 3W4KA 1ULUA 5FXMA 4XJTA 5IBRA 2WPDA 1C9KA 4PIMA 1WS6A 3K0CC 3A6FA 2ZANA 3ZD7A 2OBMA 2ZR0A 1B73A 2A0XA 2D8AA 3ZWAA 1YUMA 4DN6A 4FLMA 4OBWA 2WE7A 4Y1RA 1G5TA 1GPH1 3A9RA 3R4CA 3RNLA 1I2MA 3ANSA 4P84A 3KQKA 3P0IA 3FVWA 4KBYA 4BKRA 2JANA 5CT4A 1OZ0A 3ND8A 4IIYA 4XKJA 3H84A 1TU0A 5CFLA 3I1YA 3PQFA 5DASA 4BV2A 3DCYA 2COEA 2G4VA 4OQEA 3R0XA 4LQLA 3RIGA 2O3UA 4Q6WA 1KS9A 3FOEC 5KO2A 4MO9A 4GYKA 1XZLA 4NDAA 4ZC8A 3ZWXA 3KOUA 3KYCA 3LM8A 3LQ2A 4MYCA 4L08A 4L9RA 4R1NA 3E6AA 1PEKE 1ZIDA 2P4EA 3PXCX 4AXBA 2CW5A 5HE9A 3UM9A 4PNPA 3UJNA 1QIEA 2O23A 2MMCA 4X9XA 4CTOA 2AMYA 3F2VA 4E2XA 3AVTA 3NO4A 4G09A 1VBMA 4QICA 2DPGA 1UWCA 1WJGA 3AT1A 2XLBA 4QATA 5CFZA 1KJQA 1X1RA 3F71A 3OZEA 3CFYA 4TKLA 1YJXA 2FOIA 1QGAA 1RM0A 3BA6A 3HCDA 2HCFA 4AKSA 4M1YA 2NV2B 4YRAA 2C9MA 2DTXA 3BE8A 3OZGA 5AVOA 1OB5A 3RADC 1LSUA 4R8MA 3AVUA 3DOFA 2AQKA 3OCUA 4RFSA 5L3QA 3RUIA 4IHQA 1PYOA 1JFFA 1GAQA 4OA8A 3OE7A 4A0RA 4DNQA 2QD4A 3SBXA 2OCAA 1V1JA 2G63A 3AHEA 4GECA 1KOLA 9ATCA 4JOBA 3PZRA 2G1KA 1VB3A 3Q8KA 2WVGA 5JHGB 4GFDA 3TBKA 4NQZA 3JD0A 3GJ0A 1CF4A 3CEPB 1SC1A 2EWVA 3QE4A 2PYZA 4YAJA 4KPFC 3IEXA 4G85A 3DXFA 4KPUB 1ISRA 3BRSA 4GR4A 1PT5A 5AVTA 1KZ7B 2P2ZA 3C6XA 2FAXA 1TAUA 3H5WA 2G77B 4YMWA 3WLSA 3F9RA 3B2EA 1QX3A 4OHKA 2OB1A 4NZZA 2GB4A 5DISB 1E3DA 4J9VA 5BN5B 1E2LA 3FLBA 5BV7A 3E18A 3L49A 5JADA 1ZX1A 1RZUA 1SIOA 1T5OA 2Z8YM 3LK6A 1RAFA 1RAAA 2PMDA 4WCFA 4EFKA 1EZ1A 1L5YA 4W1PA 3AEZA 1RQPA 2VUIB 3OLCX 2X0FA 3TTTA 1ZR4A 1C9NA 3BYZA 5GJWC 1FVHA 2FCRA 5DN9A 1ZEMA 2ZUFA 4CU2A 4JCOA 2JLZA 1KA9H 1LK0A 1VA4A 1YR6A 1ZU4A 2ZE5A 3AM3A 3FHCB 3MERA 4OOFA 4OU4A 4QO8A 4CR7A 4JKOA 4BRSA 1EG7A 4KVAA 5EHXA 4Y30A 2PCJA 1G7CA 1PQPA 3HV0A 2D06A 2J9FB 4EECA 3K1AB 3DV2A 3Q8WA 3KK0A 4K9DA 4WFJA 1QLWA 2VYCA 1R2QA 1EG2A 3MCAA 4B6GA 2RK3A 3C98A 2EBWA 2FZEA 2G09A 3SF8A 4GX5A 4XGRA 1ZYUA 2FZGA 3FTDA 2NYVA 3OCWA 1V8ZA 2V8OA 3MM4A 4HDNB 4OJQA 2C2HA 2CK3D 2VPYA 4FZVA 2GCOA 4MPJA 4QVKA 1GGHA 1TB4A 3RUEA 3TRDA 2W6QA 1IUOA 4EG8A 2PPLA 3T3IA 4QNMA 1KO4A 5IVHA 5ESXA 3OT1A 2WNHA 4KUGA 4YP0A 5E7MA 2XWSA 2VWGA 4KIGA 2JFHA 4IV5A 5IDYA 3EBPA 4KQHA 3SQMA 1B76A 5NLLA 2C98A 2QDKA 3DLIA 3E84A 2NXCA 4NJMB 3EPRA 5FQNA 3ZU6A 4YRLA 3LKVA 4Q4AB 3T35A 2VSYA 4CCSA 3G1TA 2Q5LA 4RKEA 1BFKA 1XZDA 2CNNA 2WBLC 3DZCA 3JSXA 2C83A 5AVJA 4EYSA 5K4AA 1BXGB 4N8DA 3EZGA 3JQFA 1NFQA 3TNJA 3S81A 1OLUA 2H4ZA 4GOJA 5JAZA 2ONYA 2Y66A 4OK3A 1GM5A 1LNQA 4URYR 3NV9A 2Y99A 4RVHA 1POXA 4Z0TA 1P75A 3U3RA 4BFSA 4I8DA 2QRJA 1AUPA 1F1JA 5EZ6B 1RZ3A 5L6MB 5FOXA 1E69A 1FVXA 1HTBA 8LDHA 3IQFA 1N7IA 4FHFA 2BYTA 1SO8A 4GICA 2CFSA 3LBIA 1A72A 4FDUA 1PJSA 3T3EA 4B71A 2JI9A 5IRCD 3ADKA 5EE5B 4YGYA 4ER6A 4TV9A 5H9WA 2E2WA 3FUCA 3Q2OA 2GF2A 2RONA 3F8SA 3NBKA 1ZJWA 3VI3B 1MA0A 2OCPA 2ZJAA 3KPUA 4RJ2A 2PFKA 4MHOA 1M6NA 3ONDA 2OAQ1 4FFSA 4FDMA 4GI3A 3TQFA 4TUYB 1U80A 1LI7A 4QBHA 5COQA 4P38A 3LC0A 5HQTA 1JMYA 1FJHA 3K5PA 1QAQA 3TQIA 3WO0A 1N2CB 3CR3C 4KOEC 4ZI3A 3B1WA 4BO6A 3W6OA 3GF4A 4F8JA 4Q9AA 2Q1TA 2YDYA 4DQKA 1HDCA 3QY0A 1TFUA 1BW9B 3EA5A 3VH3A 4KQWA 4WEQA 1ECPA 3UK6A 2QPLA 4EG6A 4EJSA 4C4PA 4E1VA 3PSAA 1G4HA 1RMQA 3K6RA 1QV6A 2RD2A 4MRMB 4KYTA 1IONA 3OOJA 1N2GA 3ADDA 2OZLB 1TJ5A 5DU2A 1E1RD 3GLKA 4PYLA 4LDQA 2XR1A 3PX7A 2NUAB 2PSEA 3S28A 1YCFA 3FDFA 3KSDO 4C03A 3TOXA 3BGVA 4LYGA 1JQ5A 1Z83A 5AW1A 5GVSA 2DC1A 3GFBA 4C20A 4DLPA 3GIWA 1UUFA 2HW8A 3K1YA 3NBMA 2ZYGA 2Z4SA 4PIVA 3OLVA 4WLOA 3HVKA 5BQ5A 1G6HA 5CPFA 4LFCB 4RDXA 4RJKA 3DEKA 4HAZA 4MS4A 4YVFA 1P7VA 3N6XA 1W88A 1VI6A 1A7AA 1FOEB 1XCGB 2VYFA 2D2IA 1XC7A 3C4VA 2XJ9A 3RU9A 3ZVRA 3OQJA 2QU7A 1HY3A 1XDGA 1CY1A 2A1UB 4A2WA 4TWIA 3KWMA 3MWEA 2ZJOA 5DHAA 1LS1A 2ERCA 1JECA 4DSTA 1P19A 4ECAA 4A73A 1MB9A 4XIIA 2QTWB 4IIDA 1PR2A 3L84A 5CGQB 2PDAA 3E8MA 3QX9A 5IZ4A 3NM6B 4YRPA 1DKUA 2XNDD 3AERA 4KQ2A 4I1OA 2WU0A 1LB1B 3ZBQA 5KYKA 2FF7A 1AD2A 2V7XA 4Y6RA 1YAHA 3ZOKA 1BNCA 1O3YA 3OKFA 1JR2A 3TOZA 4LJLA 2PGNA 2D2FA 1YBMA 4TVKA 1C7JA 1CE8B 2VHEA 4AMUA 5JH7B 1U94A 2II6A 3ELWA 4DLSA 1I1HA 1TK2A 1CJCA 3QLTA 4FHGA 2JLVA 1JR4A 4C0BA 1EDEA 1I14A 1YVRA 1Y4SA 2BFFB 2QNBA 3L0IB 3MTGA 4GKBA 4YC7A 3GEIA 4BTLA 1R5OA 2NPIA 3GVIA 2JHCA 4RXTA 3GUZA 1E7RA 3ZXYA 1QORA 4ZT7A 1QE0A 2G7ZA 3B9QA 5FRDA 1R6TA 2JGFA 2IWRA 2O8BA 2ADMA 4QTUB 2J3JA 3MTAA 5K8TA 4DLXA 1E9EA 1FMTA 3DVQX 1B93A 1X7ZA 3GRVA 4LPSA 5K6RA 1E9RA 4JXJA 8OHMA 5DX8A 3WYCA 4CKXA 2C7BA 1SUSA 2C4VA 1J0XO 1O7JA 5ICEA 1U0BB 4IJQA 4Z0HO 1VYUA 4BWFB 1JSRA 4GMHA 1QCCA 1CQZA 1DWUA 2IZ1A 1PWXA 2QPOA 1M5TA 3I52A 1E96A 3A4IA 4G5XA 2JGIA 4IKOA 4UJ5A 1KI3A 1WV0A 4JI0B 2YXDA 3P9CA 1TT5A 4M0MA 2FQYA 2RGCA 1WF6A 3V9AA 1RDFA 1XRSB 2EU8A 3DH0A 1U3VA 4HZIA 3EH1A 1C8KA 4FMDB 1O57A 1D4OA 2B5WA 4MRNA 1WY5A 2IS2A 1SOVA 2NU9A 2EJVA 3E5NA 4MGIR 5DDIP 3BEOA 1OILA 2DFNA 4FHZA 3AIOA 4E46A 3WGIA 2QLFA 3CINA 3IESA 4INJA 3ETGA 3GLHA 4BEVA 2BAGA 3O93A 5A4FS 5C0OE 5HE8A 2H3EA 4NHOA 4FCCA 1QRSA 4RX1A 3T4PA 1HTTA 3NM4A 4B1FA 2C20A 4D7AA 3NWEA 4R8LA 1KP3A 4IQ4A 4JI3B 3RSHA 1Q7BA 4P8RA 3SHWA 5AJZA 3G7UA 3LLCA 2EZ4A 1E7WA 4PG8A 4PFQA 1XHFA 3I8SA 4LZJA 1P9LA 4WZAB 1GZ3A 5HKKA 4GPTA 4MQBA 5B1SA 2UXBB 2B83A 1J2EA 1XZNA 2VJKA 3I6QA 3OCVA 4JR1A 1THGA 1JLLA 4O2AF 4TXHA 2MCFA 5FOWA 4F72A 3CONA 4F4FA 4RPKA 3JASA 1NVKA 5JD6A 1FDOA 1HLGA 2WJPA 2JCYA 3FZGA 3GEMA 4YS6A 5E6UB 3VBCA 1KO5A 3IKJA 1E5QA 4ZDWA 2HNAA 5HZHA 2Q8NA 4DIBA 1NT4A 4WXRA 3ELYA 3R1IA 1OBVA 3QYJA 4NHEA 5IWAB 3ZJYA 1V3QE 4NFLA 3KU4A 3EQ6A 2OFFA 4MIEA 1MB2A 4ZOLB 3TW0A 3F6CA 3ZWDA 3LWNA 2OPBA 3C1AA 3WX0A 5JYCA 2E87A 2CUTA 4Q7KA 4C76A 2ZG6A 3BXOA 3R0IA 1DBIA 1MMFB 4YCMA 2P6PA 2HO4A 2YJ3A 5A6SB 3D6AA 2FRDA 3DZIA 3URKA 1N3IA 4FFRA 1VXOA 1BYUA 3HCRA 4XAQA 1JEAA 4ICIA 3NATA 1C3JA 3GLGE 5FUMA 4RIIA 4RLQA 4XDHA 1HLPA 4BDSA 1QG4A 4BAUA 1XCLA 2C95A 3IPAA 4PHFA 4X7PA 4MVXA 5GJVC 2EKBA 3RD5A 4F12A 5FCDA 5TXGA 1KDVA 2Z8YA 3M9XA 2O4UX 4ZVPA 1PNQA 4YLEA 3HEAA 2ZETA 2R1VA 4DILA 3HCFA 3D6MA 5JJBA 3HP4A 5UKDA 1M2WA 3QG5A 3NHFA 4D43A 1F1BA 1QRAA 1ZJJA 5IDXA 3IV9A 5LLSA 2X5NA 4AYXA 3IOEA 1I7DA 1K0FA 2XNSA 6YASA 1XJQA 1XO1A 2HUNA 3GFFA 4ZI7A 1DEAA 4WNCA 4KN6A 1QFYA 1W96A 3K31A 3E23A 2C4HA 5DNAA 1UBNA 1DKNA 3V7YA 4D6YA 2ORIA 1EWKA 3MELA 2AN9A 5HKLA 4PQEA 1DQRA 4BAGA 4D9MA 2FPKA 4MVJE 4RIHA 1NR7A 1CPYA 2I65A 2YYSA 4R9RA 4WH0A 2SHKA 3HB0A 4TS9A 4O4IB 1DOHA 1W9MA 3LT2A 2O3TA 4O2BF 3LLMA 1EVZA 4J49A 1QKIA 2H63A 2UYOA 1NHWA 2O14A 2C03A 5DM0A 4ZWNA 3WWEA 1QGYA 3SNHA 1UM8A 3C45A 3F9IA 1OLOA 5H80A 2WIBA 2PMCA 1K7XB 2FLWA 1U2QA 4E5PA 2HLHA 2Q5FA 1MAWA 3K7EA 5IN5A 3KR9A 1I30A 3I8XA 4G9BA 4Q18A 1OZGA 2EF1A 3VH2A 4OG2A 4ALJA 3A4YA 3UAYA 3L7YA 5AK4A 1RVV1 2VP4A 1XG5A 3D8NA 4D74A 4C3OB 2M2IA 3RTAA 1ZH6A 4C6TB 4DTCA 4C01A 1PR4A 2JCSA 3AXSA 3HA3A 3E82A 4IMRA 3RC2A 1WSWA 2NQ8A 3DEFA 1E0DA 3QHPA 4BNGA 1K66A 1OF1A 2JS7A 2P4SA 3X2EA 1ZGAA 4O1IA 1A9PA 2P27A 1NU6A 2QXYA 3QMMA 4IXTA 4I5GA 4I3HA 1K6EA 2I3BA 2G8LA 2Z83A 4IH4A 5JATA 2PGOA 2QN7A 5ECYA 5LDGA 5JECA 5F5NA 1BJKA 4L5JA 2XH8A 3RF7A 3W8DA 4A6EA 3OOHA 1JV2B 3IO5A 4RA9B 2ZUSA 4GOMD 1CQJB 1EVJA 5C1PA 5JR3A 3CT4A 4LE1A 3ND6A 3OA2A 4QTXA 5IK2D 1YHZA 5CB6A 4EW3A 3M49A 4KO2S 1SKUA 1W0CA 1FZQA 5LYJF 3AWIA 3G0GA 4Y9DA 4A7PA 3IMGA 4M1WA 4UM5A 2VPXA 2NXWA 1UJCA 2P2LA 4QUAA 3PFCA 4LVOA 2XOKD 2XHZA 5K3AA 2PFSA 4Y2JA 1RZRD 3IAFA 4IUBS 1QTRA 3ZIDA 4JBYA 1A9TA 4PZZA 5K45A 3CX7A 2IYSA 2PH7A 5DGIA 5IVPA 1ZCAA 1MGPA 1FFCA 2B20A 4MVJA 4PWYA 4RAOA 1IHYA 1J8FA 5EJAA 1UEIA 1OWPA 1ZM7A 2FY8A 1SZPA 2RSLA 2QUAA 4P5PA 3R7WA 3T5BA 1D09A 1N1GA 4KSYA 1BVRA 4ZARA 4TL8A 3A6DA 4Z54A 1M6YA 4JL8A 3SCZA 3RTEA 2Q4TA 1MFZA 4R9SA 1C7IA 3VVCA 2R6FA 2K2QB 4CDMA 4E4YA 5KOHA 2DX7A 4DQXA 3HXQA 2RI6A 4MB0A 2D0DA 4P3OA 1ADYA 1OJ7A 3BC1A 4WASA 1ZVQA 5I4CA 4JP3A 2XEXA 4B75A 1MA3A 1NZDA 5C1IA 2OYRA 1V8FA 3A3YA 1J42A 1P2TA 3BH6A 3K72B 3ZY6A 3NDBB 3S44A 4QSMA 3FYSA 3SPXA 4MW1A 1TQHA 3PXUA 5H0IA 5L40A 4D79A 1TUIA 3DLBA 2J07A 1P3JA 4IYRA 2IY7A 1NI4B 4ZQIA 3JQDA 5MF6A 3PBKA 3JZIA 5KYGA 1ITZA 3FPEA 3QU4A 3KQOA 4RHEA 2P6NA 5DSZA 2QTZA 3EULA 4BVFA 1ZMOA 4OCZA 3LCCA 4DA9A 1MX1A 2X5KO 5DKFA 2XVZA 1EBUA 1GR0A 2OGWA 2WIGA 3W79A 1GARA 3D7LA 1NRIA 3JQRA 4QUIA 3GRYA 5DCLA 5ALSA 1MCZA 4ER0A 1KAMA 4OXNA 1L4BA 3AR5A 4PSCA 1TEVA 4LC1A 2JARA 3R3YA 3R4VA 5CT6A 2A1TR 4GKJB 5AKXA 1E2IA 3UXYA 4KXMA 4QGFA 3W6PA 4EZEA 4C2TA 2J3HA 2JCGA 4RLSA 1ODLA 1CZLA 2W43A 5FTMA 2FFAA 1USVA 1GPYA 2V7WA 5DM1A 2RBKA 2ZRBA 1HNNA 2PZ8A 1U3UA 3II6X 5IW8A 5E3IA 5MHTA 5DTRA 1ZIYA 1Q5PA 4R2IA 5DTQA 2HN9A 4DDKA 3BGOS 4QOHA 4K88A 1AX9A 5KHLB 2NUPB 1U8ZA 3LIIA 3HDHA 3LPDA 4I5IA 1IZ9A 4KIJA 4MUAA 3QY9A 2XQVA 2GYUA 3P2JA 3THOA 3ZJ5A 4IG9A 3NWBA 3TVTA 2C2MA 4Q4JA 4E30A 4BWYA 5GGYA 1AMOA 4NAUA 3UO8B 4MQFB 4YRCA 2AKEA 1YMVA 4IGFA 4XB6B 1Z28A 4N39A 4W9MC 1YVUA 1WMBA 2CDAA 3INNA 5DBEX 2IE0A 4B3HA 2IYFA 2VTDA 2PJZA 3DVSX 1IH8A 5TMPA 3IDAA 1ZJ5A 4AI6A 1TM5E 1K27A 2OC4A 3ZCRA 1S02A 5JXWA 3IQGX 4OI1A 1R3UA 4BCCA 2I99A 3OFSA 4KB5A 5A5GA 2XXAA 1L7OA 4GPIB 3LBFA 2WD7A 3AW9A 3BMQB 4I4NA 4UEWA 4D3XA 3WA6A 3NYRA 3CVVA 3KX2A 2ZROA 3W4JA 2HF7A 2IF2A 3AF1A 3KPYA 1RPAA 4RY0A 1XCMA 2W2KB 2Q3DA 3HJNA 4J0HA 3QBTA 2ZTUA 4BC1A 4YIHA 3MJRA 3AF3A 1C4KA 1NF8A 3KL4A 4HFMA 3KOOA 5BUCA 4G2TA 4PPFA 3L4EA 2AZ4A 4QDOA 2PSFA 4IGIA 4E33A 1DQZA 1KZ1A 4HQFA 4TVOA 4YJHB 3RT9A 2XWJI 2V45A 4MP6A 4N7RA 1OVMA 1T5HX 1EIWA 3UN1A 1CUEA 1RIFA 5ADVA 2P2DA 2FK7A 1RJFA 1H0HA 3MG9A 1CXZA 1WXIA 2CMFA 1X94A 2K5UA 3ONEA 4LJ6A 4DCTA 5DLEA 3OQIA 3WWZA 4ESOA 3WQHA 4YRMA 1NLMA 2NVWA 3N28A 3O1IC 3QXHA 5IU6A 4CUZA 5DI3B 1TO1E 4CLOA 4M8SA 3TLMA 5B3LA 4Z1MD 2JPDA 1ZI6A 1QVAA 2GILA 4FFOA 4W6QA 4JZKA 1SXJB 3U7FB 2PV0A 1IZ0A 3EASA 4LJ5A 4KUHA 2VBCA 2NO5A 2H1HA 2VH1A 4R4JA 3OD5A 3GX1A 1V39A 5KJFA 5L7TA 6PFKA 4NBSA 1DX6A 1T3HA 1R0SA 3V3TA 3GU3A 4OLAA 2VT7A 3OZAA 4KVGA 5AK0A 4TS1A 5FOQA 1C81A 2VK8A 5BR8B 2HDHA 5AKGA 3E5HA 4IJVA 4TV8B 4AZVA 4MWZA 1NLFA 4HUQB 4LHYA 1Q1BA 2VP5A 3H9UA 3TPFA 4EX7A 2CT8A 2W2TA 3DMTA 3LBYA 1MFPA 3AIKA 3E1GA 2VCYA 5LQSA 5CK5A 4GLJA 1AC5A 2EZ8A 2QBYA 5ALPA 4MAAA 3DTNA 2H59A 2Q8QA 4CM3A 2GDZA 1LLDA 2FG6C 5I8WA 2C57A 2X2EA 3L4JA 2OORC 1OU0A 1D2GA 3GUCA 4J29A 2GFQA 4RZ3A 4YPFA 3DAGA 3MCVA 3EUAA 3P1JA 1ZSNA 1SKBA 4QHSA 3ZDQA 5A5FA 1R0YA 1MOQA 1MR3F 1QF7A 2TSYB 4NATA 3GP5A 1TGYA 4P53A 1GP2A 2QX9A 4MKFA 4OSOA 4RPCA 1GGVA 1M1YE 1YCHA 2H5IA 3C15C 1TA0A 2Q3JA 4ECEA 4AO7A 1ZM2A 2GTIA 1QDEA 1G8YA 1TL7C 3FA2A 5H02A 1DAMA 2KYRA 2R7AA 3A06A 3E7FA 1HYBA 1UBMS 2KS6A 5CM9C 4BN4A 5A9SA 4E5UA 3BJRA 5KSYA 3DOOA 4BKUA 1D0SA 3OAAD 1P7CA 3ROEA 1E32A 1TXGA 3OF5A 4H1UA 5J4KA 4M1SA 4NSNA 1X1CA