4YPOA

Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
325
structure length
325
Chain Sequence
MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ketol-acid reductoisomerase
publication title Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 129
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.86: Ketol-acid reductoisomerase (NADP(+)).
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4ypoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ypoA01
5TC4A 3X2FA 5CG2A 1HYGA 3DOOA 1SB9A 4CMCA 4Q9NA 3AWDA 4CMEA 3TF5A 3GZNA 1KEPA 4Q3AA 1XQ6A 4CM6A 4R01A 2R00A 3LLSA 3HG7A 4FOSA 2VN8A 1KEUA 2OMEA 1C1DB 1V0JA 3IP3A 2G5CA 4A27A 1YBMA 4FD3A 4L4XA 4WCDA 2VRCA 4WLOA 3ZW9A 5K0ZA 1LSUA 4YEDA 5CDYA 3ON5A 1G6KA 1OOEA 4Y98A 4EYEA 3OICA 5IXYA 3W6UA 1N1GA 3K96A 2D8AA 4MP8A 2TMGA 3BTSA 2PNFA 4CLRB 1GQ2A 4QTZA 3EVNA 2P4HX 4OH1A 1YDWA 2AMFA 1I3MA 3U4HA 4ZQHA 4TZKA 2HLPA 3IJPA 4GSKA 3TN7A 2HAEA 3WICA 3PFFA 4BKQA 2Y67A 4EUFA 3ZNPA 2X58A 7ADHA 1XDWA 4DL9A 3FPCA 3ITDA 4OIMA 4P4GA 1Z82A 2YY7A 1FDUA 1HWYA 1C1XB 4HFMA 4RVUA 2ZYAA 5DCYA 1NFQA 3KB6A 2DUWA 3OF2A 1Y7TA 4CV1A 1NM5A 1ZSYA 5T8KC 4D7AA 4F6CA 3QVOA 4O1MA 1ZNQO 2E4AA 4E30A 4F3YA 5I7SA 4RLSA 2Y1CA 1GQQA 5EQFA 2ZYDA 3OJFA 4XGIA 4MKXA 3WTCA 5FI5A 2ZKLA 4CUJA 4ZQEA 3AI2A 2PD4A 3H2ZA 3JQAD 4MP3A 3RBZA 1LSSA 4YJFA 4D79A 1CQJA 4DQXA 4NNJA 4M8SA 1LTHR 1XSEA 3WFIA 1V8BA 1R4NB 2X1HA 3WNQA 3ZNQA 3TWOA 3M1LA 4U6SA 4JP2A 4XRGA 3PWZA 2X86A 5ENVA 4L0QA 1K6IA 5G2OA 2FY8A 5KVSA 3DONA 4AJIA 3LT1A 3CMMA 1GUYA 4NFYA 4EI2A 4RCVA 5ICSA 3HUDA 1BXGA 3D3WB 1Y8QB 5JC8A 1KVTA 1P9LA 3BXXA 2VHXA 4A73A 4R68A 2D5AA 2I66A 3D3EA 1ZJZA 4L73A 1H2BA 3ST7A 3HDJA 2AE2A 1N5DA 4Q3CA 3I83A 4RVGA 4Y8VA 2Q99A 4DPLA 1HDOA 1VC2A 2GASA 4CQMD 4WCFC 3CMCO 5EINA 2E82A 1V35A 5FF9A 4KQXA 4KUEA 1UUFA 4RPJA 3INTA 4CL8A 3TDKA 3OQBA 4R3WA 1E7QA 2G17A 3JQBC 3WXBA 2O23A 4IDEA 3QHAA 3UF0A 3GVHA 1N7GA 2UAGA 1ZK3A 3IS3A 1H0KA 3RQSA 1IOLA 2NU7A 3UN1A 3UFXA 4KMSA 5BSFA 4JXKA 2PZKA 4TROA 5I8ZA 3ADOA 1GYPA 4BV8A 2AQKA 3GRKA 5TSDA 5A06A 3OA2A 4ZRMA 5JFOA 1AN9A 3ROMA 1QG6A 2BH9A 3AUTA 3DBHB 4J1TA 1A4IA 4XEHA 5CEFA 5TIIA 4O0LA 4R5HA 3ENNA 1K2WA 4ALNA 4PG5A 4BQPA 4BNZA 3Q0EA 3EMKA 3RKRA 1CWUA 4BNTA 2I67A 3IC5A 3RIHA 3RROA 2VZ9A 3WGHA 3KSZO 4PLZA 4D42A 1N9GA 1QV7A 1QSGA 2Q3EA 4XQEA 2YQ5A 5I7VA 1JKIA 2WD8A 4WEQA 4UEOA 1PQPA 3G49A 2Q1SA 4EEZA 2Z1MA 1VRWA 1H6DA 4GSLA 1BG6A 1BHSA 3FD8A 2D0IA 2EXXA 4PLWA 1YB4A 3PIIA 1IB6A 3PHJA 4LRSB 3TL3A 3RFVA 3ORFA 4ND4A 2BGMA 3WR5A 1Z6ZA 3VH1A 4NIMA 2HMWA 3BMOA 4J6FA 1UAGA 1EK6A 1JWBB 3N74A 3WIEA 3M1AA 3P2OA 1E7YA 4B7CA 5IZCC 2A9FA 3CIFA 3FPLA 3CSDA 5DDIP 5IN5A 1XU9A 3PLNA 5L7WA 2VUTA 3SX2A 4ZHSA 4ZN6A 4R1TA 4R51A 5KJCA 1YXMA 1JAXA 2JD1A 3RC7A 4CQMA 1H2HA 1C14A 1A9YA 2DAPA 1W6UA 4DC1A 1T1SA 4TZTA 1LDBA 2NNLD 1LC0A 3BMQA 1P1RA 5TT0A 2QQ5A 1XU7A 1ULSA 1SBYA 1G1AA 3DTYA 2LDXA 1UZNA 1U8FO 4NJMA 3NTOA 4FQ8A 2V6BA 2OZPA 1EVYA 1ZEMA 4DC0A 4RVDA 1R0LA 4BMVA 2XXJA 1Q0LA 1TVEA 2EWMA 5HS4A 3ADPA 2ZTVA 4S3MA 3BTUA 2Q2QA 4C7JA 3KYDA 2VZ8A 5G4KB 1RM5A 1YS4A 4LVUA 4BGVA 2WTBA 1NXQA 2PD3A 3FSRA 4DRYA 2I9PA 3WB9A 3GFBA 1YB5A 2FPIA 3JYQA 3X2EA 5C37A 3ABIA 2V6GA 2HU2A 1EVJA 2R2GA 3QLJA 4GL4A 3STHA 2DT5A 3ZWOA 3RU7A 3IP1A 3LZ6A 3FTNA 4IJUA 3LC2O 1YDEA 3COSA 2FMUA 3C8MA 5KKAA 2HDHA 4E5MA 5TRTA 5ER9A 5CAEA 1ZXLA 2ZJ0A 3L9WA 2QRLA 4OKIA 3ZNNA 4YYZA 2J3KA 1CYDA 3NDJA 3RUIA 3HDQA 4DLBA 1D1SA 4NR0A 4B4OA 4NMHA 4XD2A 4LISA 1FDSA 3E1KA 1B0AA 1DFHA 4IXWA 1CJCA 3L07A 3CTMA 4IDFA 1E3IA 2XF8A 1T4DA 3F4BA 4CMGA 2VUUA 1DC3A 1ZSNA 4ZU3A 3OH8A 3PYXA 3ZWPA 1X14A 1XQ1A 3JQFA 1QRRA 4EUHA 3WSWA 5CFZA 1V9LA 4CM3A 1DB3A 1NFFA 1ENOA 1D4FA 2EP7A 4E2XA 3HN2A 3JQGB 2E48A 4QO8A 2J5QA 3QE3A 4E12A 4D3DA 4PIVA 5JAZA 1QKIA 1I2ZA 2YDXA 4XZ3A 4CM8B 1I3KA 2HCTA 3NDRA 4J0EA 1WXDA 1T2FA 4QFDA 3GT0A 5HA5A 4ROSA 3TNLA 4JX8A 3PHHA 3KEQA 1HSZA 2DC1A 3BYZA 4BNYA 2J8ZA 3F6YA 3WLEA 3NT5A 1NVMB 4Z0TA 3I3OA 2RHRA 3E8XA 4UEKA 4YJGA 1VL6A 1H9AA 4K9DA 2QYSA 5JNLA 2GSDA 3CINA 3AY7A 5L9AA 2VHVA 2NADA 1DC6A 2D59A 4CR8A 4EGFA 5K6AC 4OM8A 1U3VA 3ASUA 4R3NA 4FN4A 4O5OA 4ZQGA 4ZA2A 4LMRA 4Q3BA 3H5NA 1SMKA 1WVGA 4U7WA 2P4QA 3GY0A 1QP8A 4J7CA 3E82A 1ZJYA 2B4QA 1WMAA 3CE6A 1IYZA 4O63O 5JYEA 2G82A 1R0KA 1Y5MA 5BQFA 2NUAA 3ZH2A 3AJRA 4R1UA 5A4DA 4H7PA 4RZHA 3IAHA 3NT2A 5KVQA 2GZ1A 4QO7A 1P1HA 4F6LA 1EE9A 1MX3A 4WE3A 4A26A 5AXDA 4A5OA 4JNKA 3NX4A 1UXIA 2V6MA 1Y6JA 4QT0A 2NLOA 1HE2A 3GVCA 2DVMA 1BXKA 1XCBA 1IPFA 4WCFB 4EJ0A 3LT4A 4BO9A 3GN1A 4CMKA 4GLLA 1O95A 3W8DA 1T24A 4GMGA 4RVFA 1GDHA 4FC6A 4F46A 3FNEA 3QV1A 4UULA 3WGTA 5DNAA 4CLOB 1U7HA 2IXAA 2VWQA 4XYLA 4ZGWA 1ZVMA 2J3HA 4FOOA 2NU8A 3ZHXA 5H83A 1NVTA 3E9QA 1UH5A 1NQ5A 3MJEA 5THQA 2YFQA 4HFNA 4AJOA 1HETA 3ITKA 1JLLA 1R4MA 2B37A 4XGKA 1CEQA 2Y1EA 3NGLA 3DB2A 4CUZA 3DMTA 3FN4A 3IJRA 2I6TA 3K73O 4IPTA 2YHUA 3BHIA 4IDGA 4OMUA 1PR3A 3PEFA 4QFCA 1I3NA 1A7KA 3GPIA 2PH5A 4WGGA 2O3TA 2AA3A 3QWFA 4BNKA 4F45A 3KYBA 3LT2A 4CJXA 1C1DA 3NKLA 2ZTMA 1TT7A 3GGGA 2Y66A 3B6ZA 2JHFA 5ICMA 4WLEA 3KYCB 3H4VA 1PGQA 1QORA 3AFMA 1ZK0A 1C3VA 5T6BA 5KWEA 4NBVA 4ESOA 1SB8A 4OSOA 4BNWA 4OJNA 4XYBA 3MJTA 3G79A 3H6KA 4W4TA 4BIIA 2GO1A 4NU6A 2P68A 3GFGA 4BVAA 2WM3A 1LLUA 4KUHA 3MOIA 1WDLA 2OP1A 4ZRNA 4BGUA 4E33A 2CDCA 4UUPA 3GC6A 5BNTA 4J49A 3JCZA 1LU9A 3LQFA 2QG4A 3ZHZA 2O4UX 1UJMA 2OFPA 2GZ3A 1QYCA 3JQEA 3DOCA 1FXSA 4J1QA 1CQIA 4DMMA 3VH2A 4J1NA 4Q3NA 4QECA 4UUMA 1WZEA 3OIGA 2IODA 1RWBA 3WSVA 4DYVA 2VCYA 4EDFA 2FSVA 4FFPA 2GUGA 2Y0EA 1W0CA 2RHCA 4TKLA 3ZWNA 4BKOA 1C1XA 1PJ4A 2Q4EA 3K30A 1EZ4A 3VOSA 4H16A 2YV1A 4GMFA 3GVPA 5JYDA 5JDCC 3E48A 4E4YA 3GAZA 1P33A 3OEWA 4N18A 1IPEA 1D8AA 3WX0A 3PWKA 2IEDA 2AEFA 2Y99A 4BKRA 2WE7A 4JBGA 4B7XA 1BDBA 5I9NA 3ZV6A 4R16A 4DQVA 2RAFA 3VH4A 3ZU5A 1PQWA 1KY5A 2DBZA 3ANMA 1QMGA 2IDZA 4IMRA 3TRIA 3ONEA 1NQAO 3GZ4A 3D4NA 2FZEA 3RC9A 4RGBA 3QSGA 1DRVA 2RH4A 3I9OA 1E92A 4P8RA 4YAKA 4CMIB 1DPGA 1NPYA 3ZN2A 5JDIC 3HB5X 1LX6A 3ULKA 3MJSA 3WOHA 1Y8QA 1OZAA 4RPGA 4DUPA 5A5FA 2GYYA 4Z6KA 5L95A 4YT2A 2PD6A 4J4HA 5BSHA 3DZGA 2ZK7A 3UAGA 2YFHA 3DDNA 2QZ9A 3I52A 3PQFA 1UDAA 3WGOA 3WMWA 1LI4A 4DREA 2G1UA 4I9HA 1ZK2A 1CDOA 4AJ4A 5GZ1A 4HUJA 1GD1O 4G2NA 4NQZA 3IKVA 4M54A 2B83A 4KP7A 2ZATA 4W9NA 1GV0A 1A9ZA 4U0KA 1VJTA 4L74A 1AXEA 1PSDA 1O9BA 3KEOA 2CZCA 2FRDA 3U4IA 1KC3A 1XKQA 3ETEA 3UCXA 4HV4A 4E5PA 2ZB7A 2JJYA 1DRUA 1NWCA 4FW8A 2NVUB 5CDGA 3CPSA 1SZJG 3H9EO 5GY7A 2OHXA 1Q1NA 3BZUA 3TL2A 5JAIA 2DFDA 2NU6A 3DAFA 3Q2IA 5A03A 3PGJA 4GVXA 2VUSA 3EAGA 4J16A 4E32A 4ILKA 4W6ZA 3TFQA 2C54A 2NU9A 1XG5A 3MTGA 3VZSA 1ML3A 2X4GA 4RVSA 5EESA 4YPOA 1MC4A 1JA9A 2JCYA 4UVGA 3K92A 1VPDA 2B36A 3JYLA 4WASA 4BO7A 2PKRA 1E3LA 1HTBA 2C20A 3GF4A 4GX2A 1ISFA 3QWBA 4IDDA 3S2GA 1ULUA 2OP0A 4UEJA 1RKXA 4II3A 1BRMA 4MKZA 3LT0A 4BNFA 1E7WA 3LF2A 1LC3A 2C07A 1PZEA 3DO5A 2YYYA 1I10A 1PJSA 3GMDA 2HUNA 1EUDA 1XIVA 2PV7A 2EKLA 3K6JA 5G4LA 1H6CA 3WLFA 4CLXA 1HF3A 3O03A 1HZJA 2AHRA 3H3FA 2I3AA 4FJ0A 4G81A 1IHXA 1H93A 3BHMA 2X5JO 1HKUA 3P2YA 1SCUA 2A4KA 5G0UA 3U4CA 2CVQA 4YRBA 3KETA 1L7EA 1ZEJA 3AOEC 3ASVA 1X15A 3PHGA 2X0RA 3BMNA 5TJ9A 2GZ2A 3UVEA 4NH4A 4J43A 1G0OA 4FC7A 1NR7A 4KDEA 3PI7A 2EF1A 2WD7B 4BMSA 3SC4A 1JQBA 2X22A 2YDYA 1VSVA 4OQZA 3U5TA 3WGYA 2FP4A 1K89A 1YL5A 1A72A 4LSWA 4WUVA 2C2XA 1DC4A 5TS3A 3NJ4A 3LYLA 4U0JA 1SPXA 3W4JA 4ALIA 2C5EA 2UYYA 1F8GA 4JIGA 3EYWA 1T25A 4K6CA 1PL8A 2Y1OA 4IJKA 1PWZA 1YE3A 2VHWA 4L75A 4IIVA 3T7EA 1T2EA 4QSMA 4TVOA 3S8MA 3L6DA 3K5PA 5ITVA 5KJ6A 2E6UX 5JSFA 1HYEA 1I30A 5A1TA 5T64A 1EQUA 2IZ1A 2WYVA 1X1EA 4WNIA 1HXHA 2FR8A 4J3FA 2C5AA 3L77A 4IM7A 1MFPA 2X0JA 1WDMA 4JCOA 1PWXA 2JFFA 1U5CA 3DZJA 1PJBA 2Q49A 4NK5A 1EUZA 1YOVB 1TXGA 1NHGA 4CM9A 3RKUA 4XDZA 2HRBA 3T4EA 4L9RA 4WECA 2GNAA 5KCZA 1ZIDA 2AEMA 3Q3CA 2D5CA 4J7XA 3GLQA 4AJJA 1PIWA 4K28A 1PR9A 1KVUA 4PG8A 2W4QA 2JAHA 2D3TA 3K31A 1LLQA 3PJEA 4BNJA 1XLTA 5I8WA 4BO3A 4AJ2A 4B79A 4BHTA 2VWHA 4B7UA 2FN7A 4GWKA 3GDFA 2Q4BA 3H9JA 3TZQA 3C24A 5G0WA 1YL7A 3F9IA 1M66A 1NFRA 2EW2A 4NZ9A 4RO0A 4BO5A 3I6QA 3WGIA 1F14A 3RJ9A 3L0DA 1PZFA 3QWAA 4OSPA 4GVLA 1I2BA 4CQLB 4GKBA 4J9UE 1C0LA 5DZSA 5JAMA 5IDQA 5KJ1A 4YQZA 1ISGA 2X0NA 2Y0DA 1X13A 1XHLA 1B2LA 4E6PA 4DBVO 5FI3A 1XA0A 1DFGA 1GQYA 1NASA 3OSUA 3JD2A 5BT9A 4MJLA 1LLDA 3KO8A 4AJKA 5EJ2A 2AE1A 4ND2A 3ROPA 3LVFO 3VPSA 1N92A 3PZRA 3U62A 2EV9A 3MTJA 1NX6A 3JQGA 2C7VA 5TX7A 1EVIA 4D41A 3LK7A 1Y8RB 3NV9A 1P1IA 1GCUA 2YQ4A 3EHEA 4R1SA 4CM8A 4DMLA 2GN8A 4UVEA 4DXHA 4IQ8A 1YL6A 4FFNA 3RC2A 4WEOA 3BHJA 4MIEA 2F00A 3TOZA 4QEDA 1E5QA 2BGLA 4J7UA 3VPFA 4AICA 4HKTA 1EDZA 2H1SA 5GZ3A 4YJHB 4XYGA 5GZ6A 4YAGA 1VLLA 3JSAA 3C7CB 2AQHA 4E5NA 2JKVA 1GCOA 2UUOA 5B37A 5KJFA 1WZIA 4WK6A 2P5UA 1T4BA 5A5EA 4OXNA 1P0CA 3L6EA 2HO5A 2BLLA 4E2WA 3C3XA 5G0TA 1IZ9A 3ZV4A 4BUCA 5ES3A 2NWQA 3OIFA 2EIHA 5IN4A 5DBIA 1PJTA 1DO8A 5IF3A 4N7RA 4TQGA 3QVWA 1YBVA 2DBVO 3PGXA 4R9SA 1HLPA 3IMFA 4YAEA 1ZO8A 2VTEA 2JD0A 4MVJP 1RYDA 2GDZA 4UREA 1DEHA 4TMFA 4BGIA 3UH1A 1UDBA 4EEXA 2Q50A 5I7EA 3OFSA 1XYGA 4XIYA 2BHLA 3NGXA 5DF1A 4NBTA 1K6XA 1R66A 1TA4A 3JQBA 3VZPA 1PU2A 3DHNA 3ENKA 1Z7BA 5JPIA 4CLOA 2DLDA 2W2LD 3HDYA 3KLPX 3WQRA 5JCJA 2HMSA 1EBFA 4DPMA 5J23A 2HK9A 1Y81A 1OMOA 5KVCA 1ZZEA 3HZZA 2BELA 3ZWWA 1GU7A 2P9CA 3FTPA 2HRZA 4RF3A 1ZK4A 1WPQA 3IKTA 4RV9A 2YZ7A 2BI7A 2NACA 3NEPX 1YB1A 2IYOA 1E6UA 1F06A 2W2KB 3NYWA 1YO6A 4QXMA 1ZSVA 2I5PO 5COQA 1KERA 3PLRA 4JGBA 4CV3A 2DUUA 2OL4A 1AUPA 1E7SA 2XAAA 3U0BA 8LDHA 1DJNA 4IINA 3GDGA 4ND3A 4GWGA 3UXYA 3QRWA 4R69A 5U9CA 4AL4A 1P3DA 1CETA 4MOWA 1EDOA 4UUNA 3GEDA 1U3UA 1B8UA 3GEMA 2JFHA 4Z9FA 4BGEA 2W98A 5F1OA 1U3WA 1JN0A 4JQCA 3JQ7B 3VPXA 3QJ5A 2JAPA 2BFOA 1KYQA 1K5HA 1N7HA 3KYCA 4I5GA 1YONA 4MVJD 1SC6A 3ZV5A 4BB5A 5CP8A 3JYPA 1X7GA 3IOYA 3M6IA 3MJVA 4M89A 4AVYA 2PZMA 1P45A 2A92A 1YH3A 3ZCXA 1ADCA 4D0RA 1NNUA 3DL2A 3KSDO 3W6ZA 1DOHA 3ZHBA 3H3JA 4IGFA 3OIDA 4IUYA 4XR4A 2EW8A 1ONOA 1MXHA 2G76A 1HDYA 1EBUA 4ZQBA 5AYVA 3EGOA 1DAOA 3D5QA 4EJ6A 1OFGA 4HBGA 4OOEA 1Z45A 4YT8A 5KVVA 4II2A 1ENYA 4J1SA 2PTGA 1ZMOA 4ID9A 3C7DB 4IBOA 4D46A 5CDSA 5ER6A 4I5EA 4YRDA 1E1NA 4PLTA 3V8BA 4HXYA 3ZDFA 3UKOA 2GPTA 4BNLA 3ZWYA 4XCVA 3VPGA 3GVXA 4UVDA 3U9LA 3JTMA 3ZU2A 4E3ZA 3VDQA 4GKVA 2QX7A 3R3SA 2W2LA 1RM3A 5CDUA 2EG9A 1SAYA 2X9VA 1T2CA 2DQ4A 4MP6A 4O6VA 4YTEA 3AW9A 3K2EA 4CM4B 3AU8A 3LU1A 2Q46A 4QUKA 1NAIA 2CF5A 3O26A 1HDCA 1CF2O 4LSMA 4N5NA 1SEPA 2GD1O 3C85A 4MVJH 1HZZA 4WLNA 3VDRA 9LDBA 1U9JA 1ENPA 4RF4A 2X8LA 4RLHA 1E3EA 5B4VA 4PG6A 3TFOA 5AQ1A 2PR2A 1UXKA 4L8VA 3VVCA 4DLAA 5JXWA 4PG7A 1ZUD1 3NUGA 3ZI0A 1LDMA 2VHYA 1PZHA 3EY4A 1ZFNA 2ZQZA 4GX5A 1OC2A 2NVWA 4CLDA 3E9NA 3ZU4A 4CMIA 3CH6A 2VHZA 3V2GA 4CR7A 1D7OA 2YJZA 4PLYA 2GN4A 3GNSA 3JQ8B 2DBRA 4NPCA 2O3JA 3DZHA 5L51A 1MGOA 2C82A 1PS0A 4MVJA 3WDSA 1WNTA 1E3WB 2QYTA 1ID1A 4I5DA 2P91A 4CR6A 4FJ2A 5C7LO 1KS9A 2IEBA 5L7YA 4M86A 3TZCA 1BXGB 3GNQA 4KOAA 3S2EA 3VTFA 1I8TA 5EMHA 5B12A 4B3JA 3D7LA 3EZYA 5I7FA 3JV7A 3B1FA 4D3FA 1FMCA 3OJLA 4XQCA 1PS8A 3RWBA 1SOWA 3VVBA 1E7MA 4PCVA 2ZB4A 4YDRA 1TB4A 3JQDA 2W8ZA 4IGEA 2VOEA 3FBGA 1GPDG 4M1QA 1B8PA 4RVHA 5I9MA 3W4KA 1E3SA 3WTBA 1DXYA 2NVUA 4BKUA 4DYDA 2HKIA 1ARZA 2NM0A 2HQ1A 1E77A 1NVGA 3ROKA 3GOHA 2IYPA 1J4AA 3PRJA 4CMBA 4J4BA 5ILGA 3DBLA 4CM1A 2G0TA 4UVHA 1E6WA 1IE3A 1IL0A 1YVEI 3GQVA 4DBZA 1HDXA 3FWNA 3VTZA 4BQRA 4KUGA 5JW6A 2VQ3A 3PVZA 1QLJA 5ILOA 1X7HA 3EVTA 5A3JA 1LA2A 4OXYA 5DOZA 4FFOA 4BNIA 3RUEA 3AOGA 4EUEA 3O38A 2DTXA 4BL5A 3DMTC 4DLLA 3E9MA 4L76A 5L3ZA 1JAYA 4IZHA 2HK7A 5IDXA 3H5RA 4YAJA 4MVJG 1Z73A 5DBFA 3GN2A 3ZWAA 4PFJA 4UVIA 2HMVA 1GV1A 3L4BC 1AGNA 1VSUA 4JJIA 2GGSA 3PYLA 3UCFA 3TQHA 3OJ0A 1JW9B 3JQAB 4XRRA 5G0VA 4ALJA 1KEVA 4MVJE 5F3RA 3FWZA 1I2CA 1Y9AA 2ET6A 3W8EA 5CEJA 1ZW1A 2O7SA 4RJTA 2JHGA 5EN4A 4A7PA 4CV0A 3V2HA 3AI1A 1MG5A 1S7CA 2X6TA 1U8XX 4AJPA 3F47A 1JWAB 2J3JA 4IJVA 4NI5A 3Q6IA 4DVJA 3VKVA 3DAGA 3PQDA 1E1LA 3Q9UA 4TRJA 1CIVA 3HDHA 4BNVA 4BB6A 2WD7A 1PL6A 1VKOA 1WMBA 4E13A 5BSGA 2P5YA 4OL9A 1GEGA 2BFMA 2H63A 2NTVA 1R6DA 4R5MA 3GUCA 3IIEA 3JQCA 3ZZNA 1K3TA 2CUKA 2DTDA 4NFSA 2ZTLA 1B26A 1UP7A 1ZMTA 2ZCVA 4YQYA 1LUAA 4BKPA 5B4UA 4GX1A 5GMOA 4O59O 1MUUA 4WLUA 4CLRA 3RJ5A 1EEHA 4BNHA 4CQMB 1E1KA 1LQUA 4JBHA 2DU8A 3RBVA 3S2IA 1O89A 1P1KA 4MKRA 3TZKA 2DBQA 2WWRA 1GAEO 2DKNA 4N5MA 5KKCA 5AXCA 3PJGA 4RZIA 3E03A 1B7GO 1DJQA 1YOVA 4DTIA 4YR9A 3LF1A 4Z9XA 2PK3A 3G1UA 3CZMA 4RDIA 3CEAA 1HE4A 5LC1A 3OQ6A 1E5LA 3PXXA 4TRRA 1QV6A 3DR3A 1BTOA 1TLTA 1LEHA 3GR6A 1GZ6A 5AXBA 4D3SA 3WYEA 3EK2A 3GHHA 3PDJA 1HYHA 3CKYA 3LC7O 1GTMA 1GFSA 4IXTA 5A9SB 2GERA 1VL0A 3PJDA 1ZK1A 1HT0A 3OEYA 4I5FA 1Y1PA 4W99A 2X0IA 2IZZA 3B1KA 1DIAA 2F1KA 3BTOA 3OM9A 3WGQA 1JKJA 5CPFA 1VKNA 3TJRA 2X9NA 4KWIA 3AK4A 5AVOA 5IFLA 1YBAA 4IDBA 1HSOA 2UVDA 2BRUA 4CODB 2NQTA 1S6YA 1DLJA 2HK8A 2DPGA 4NJOA 1C0KA 1VJ0A 3QW2A 3VKUA 1K6JA 3I4CA 4MVJF 2P9EA 1IZ0A 1T2DA 2AQIA 4BO2A 3DMYA 4KQWA 3VZRA 4YRAA 5BR7A 4CQLA 2GN9A 8ADHA 2NV6A 1Q0QA 1R4NA 4GPD1 1ISIA 5IXSA 3BMCB 2Y0CA 5MGBA 2IRWA 4GH5A 1FDWA 3DTTA 3TOXA 2FWMX 2B35A 2FZWA 1R12A 4CLEA 3VH3A 2JFGA 1NP3A 3PHIA 3A14A 3OP4A 1OI7A 2DFVA 4RPLA 4QQRA 3WMXA 1PGOA 4BO1A 4D43A 3D3WA 1RPNA 2O2YA 3IUSA 3GAFA 1Y8RA 4EZBA 5IJZA 4BNXA 1XGKA 3L6OO 2OO5A 1P74A 1Q0HA 2ZCUA 3FR8A 4DWVA 2OORA 3M2TA 4I8XA 1UXGA 3F1LA 1X0VA 3GEGA 3IUPA 4IDCA 4URFA 2QHXA 2E37A 2VWGA 4YJHA 3WG9A 3ZHYA 1JTVA 1LQTA 3LC1O 1UP4A 3NJ8A 3KM0A 1NPDA 3KUXA 3GA0A 4OAQA 3KOUA 4RQTA 5L4SA 1V3UA 5JLAA 3GPDG 1ONPA 1AHIA 5HTOA 1P1JA 3JQ7A 1J49A 2X7HA 1U28A 1NAHA 2CD9A 2NSDA 5L4NA 2O3SA 2VYNA 1DIBA 5JDIA 1C0IA 3QWHA 4TRMA 2YHIB 3A1NA 3I9JA 3Q9NA 4FJ1A 3D5TA 3JYNA 5BSEA 1KY4A 3MJ4A 4BNMA 1EQ2A 4I08A 3L9XA 4MDHA 3OHSX 1E6EA 4AG3A 3DBHA 4CM9D 9LDTA 4GGOA 5TLSA 1M2WA 4E0BA 4YBZA 2QZZA 3AUUA 3RSHA 3SEFA 3LDHA 2UDPA 4Z0PA 4M55A 5JY1A 1GZ3A 1HE3A 4CMHA 3DWFA 2ZIZA 3R0IA 2Z1NA 3A9WA 1R37A 3R6DA 4OQYA 3RCBA 2FR0A 4N54A 2NTNA 2ILTA 1HDGO 1WWKA 2PZJA 1PX0A 3JQ9C 3DZIA 1XELA 4M49A 2Q45A 4YVFA 3JD4A 4MIYA 4P4NA 3A4VA 3S1LA 3P5SA 3Q11A 1UZMA 4WJZA 4K6FA 1RM4A 4Z9YA 3HJAA 4CMEC 4OXKA 5IAAA 3KSUA 3GGOA 4Q3EA 2R00C 3GDOA 1X1TA 2J3IA 4CPDA 5CHEA 3TZHA 4LN1A 1KIFA 4JK3A 5LDGA 4BNGA 5IG2A 2W2KA 2OOSA 4I1IA 4NBUA 1SNYA 4PRKA 3OBBA 1KBZA 2B69A 2VT2A 5CG1A 2WEKA 2XOXA 4WOKA 1VJ1A 2WJPA 1W8DA 2I3GA 2W90A 3DAPA 4S1VA 3DOJA 3DZBA 2RH8A 4Q3DA 4IZIA 2ZTUA 1ZBQA 3FI9A 2BD0A 3QVXA 1HE5A 5L45A 5KIAA 2CF6A 2O48X 3VC7A 3V2UA 4R4JA 3F46A 3HQ4O 3WJ7A 1AXGA 1QLHA 4Y6SA 3AY6A 3IL2A 3U09A 2Q2WA 3O9ZA 2OGUA 4I9NA 3AM5A 2CDAA 4CMJA 5JO0A 1GY8A 1WW8A 3QY9A 3MJCA 3CUKA 4IQGA 5AOVA 1GL3A 4ZVVA 5IDWA 3QQPA 5HS6A 1W4ZA 2BMAA 3G3EA 3O4RA 2OXIA 1MXFA 4OOFA 5IZ4A 3AOEA 2VRBA 2OBYA 4HNGA 1VL8A 2B4TO 2QIOA 5FYDA 1O94A 3WQQA 4W82A 5COBA 5G4KA 4GAEA 5A9TA 2FHSA 6LDHA 5A3VA 5CPBA 3IQDB 1ZH8A 4W7IA 2EJVA 4GI2A 2XXBA 3P7MA 1OBFO 4PLFA 1FDTA 4KTTE 4FDAA 3WWYA 4L4SA 1I36A 1LSOA 3B20A 4E5KA 5L7TA 1PZGA 4N5LA 4B8ZA 2XPCA 4PZCA 4XB1A 4XDYA 1KVRA 3TSCA 3NTRA 4CV2A 3F1KA 4KZPA 2ZYGA 2BKAA 3D4OA 2AW5A 3ZWBA 6ADHA 2OBNA 1F17A 1ISHA 4CM4A 1LDEA 1B3BA 1PJCA 2I99A 1BXZA 1SOVA 3WJAA 3LLVA 3WBBA 1ENZA 1AE1A 4DIOA 2PKQP 1R16A 4LGVA 3C1TA 4B4UA 1FF9A 3PPIA 4R1NA 1MC5A 2O7QA 3JD3A 4JJGA 4PLCA 1H9BA 3U4DA 4BO8A 1JVBA 3DBRB 2CVZA 1D3AA 5JCJD 2NTJA 2NVBA 2VWPA 1N2SA 4R9RA 4HY3A 2X5KO 3KLMX 1UR5A 3GVIA 5KJEA 4CMAA 3DFZA 2Y68A 3UCEA 4XIJA 1TT5B 1EUCA 3SJ7A 4GX0A 4LK3A 5T8KA 4IMPA 3G1TA 3JQ8A 3PK0A 2O4CA 1BMDA 2AXQA 5IDYA 5JCXA 2CDBA 4INAA 4TKMA 3I9MA 1Z75A 1P31A 1DIGA 1XEAA 4YB8A 5DP1A 1A7AA 1ADBA 1H5QA 4OO3A 1E3WA 1GEEA 1LXCA 3RUCA 3JYOA 1WP4A 1HDZA 3O8QB 1PJ2A 2CMDA 3EC7A 3I1JA 3AM3A 1CERA 3M2PA 2O3RA 2RIRA 1MA0A 2GF2A 4TWRA 2WYUA 3E6AA 4PLHA 4CM7A 1O5IA 4WPGA 1LLCA 4RL6A 1IY8A 1PEDA 1UP6A 3OECA 4XYEA 4BS9A 3PDUA 1PJ3A 1HL3A 2J5KA 1PS9A 3RUAA 5HWSA 4IS3A 3AU9A 1H6BA 3N58A 2VYVD 4FBGA 4CM5A 4B8WA 3UOGA 4ZQFA 2IE0A 4ZJUA 1BW9B 3GGPA 2Y1FA 1PQUA 4GBJA 1JU9A 4Y6RA 2H9IA 2BGKA 5A02A 1J6UA 3I9KA 1NQOA 2CVOA 4FFLA 3RD5A 4IDAA 3GUYA 3Q2KA 1GYQA 2LDBA 3CXRA 1I3LA 1QYWA 1P77A 3KHUA 1I0ZA 4JJFA 1V3TA 4P38A 5H82A 4G5HA 2Y05A 3JD0A 4WOJA 3ICPA 3I9LA 1A27A 4FGWA 1CRWG 3S55A 2AQ8A 4FFMA 4WCFA 4U6QA 4ALMA 1YWGO 1Y9EA 3GG2A 3OQ1A 4HP8A 2EEZA 2AG5A 3OA0A 3R1IA 3P19A 3GK3A 4J2OA 1BGVA 2HMTA 5KNLA 3KTDA 3MEQA 1NQTA 1PTJA 2I65A 3ANLA 1GZ4A 4B4WA 2ZB8A 2PH3A 2QRJA 1LJ8A 3FF4A 3NAQA 3BIOA 4EITA 4AJ1A 1FJHA 1KOLA 4E31A 3DHYA 2PFGA 3H2SA 3JQAA 1SEVA 3C1OA 2C59A 2PGDA 1ADFA 5JMWA 3MWEB 4YT4A 1YQXA 4FR5A 2A94A 2UUPA 3DZFA 4AJHA 3B1JA 4JN6B 2B5VA 4XJTA 2YV2A 3SLKA 4P4LA 1ONNA 1I5RA 5HRUA 4KDFA 4D0SA 1IULA 1UDCA 3KZVA 3OJEA 3PTZA 4AJEA 4RPKA 3V5NA 4TSKA 3RI3A 5U1PA 4YAIA 3I6IA 1R15A 5A9RA 5AXAA 4C7KA 5T67A 3ICCA 2X23A 1XR3A 2PGJA 3A06A 5JMPA 1DIHA 4YWJA 3ZWMA 2HSDA 4BNUA 4XYMA 3ZWCA 4NU5A 1KEWA 3DZKA 1YKFA 5C3MA 4A10A 3BMNB 5ENDA 5DCWA 3GZNB 4KWHA 3DBVO 1EK5A 4MINA 3KVOA 3WGZA 4HWKA 4XQ9A 1M75A 3MWDB 3RUHA 2VYVA 1Z7EA 4YJDA 2C2YA 3UICA 4X54A 3EW7A 4AFNA 2Q1TA 4IJWA 3H5AA 3AUSA 3L4SO 3PIDA 1MG0A 1Q7GA 3A28A 1YJQA 3GMSA 3RASA 2D4AA 3PQEA 4GLOA 4B4VA 3QP9A 5IZCA 2B0JA 2JD2A 4ZD6A 1KC1A 4LW8A 3R3JA 1F8FA 3H7AA 3D4PA 4HNHA 1XWFA 3NDIA 1ISMA 4IS2A 4OHUA 1LRKA 3ANNA 3WYCA 1Q7BA 5F1KA 1V6AA 4XB2A 3I4FA 3WQSB 1T26A 2Z95A 5A9SA 1EVZA 2VNAA 5H81A 2H5LA 4NK4A 3QIVA 3GRPA 3VAZA 3GG9A 3ZW8A 1I01A 1DSSG 3G17A 2PA3A 3D1LA 4GQAA 1IHYA 1JVSA 2FPGA 3JD1A 4NG5A 2PY6A 3JQFC 2DPHA 1Q2XA 4D45A 3BAZA 1NTOA 3HE3A 4DPKA 5CDTA 3DFUA 1HLDA 5TJHA 3RAJA 4B3IA 1DDOA 4PG4A 1LRJA 1PGPA 5A04A 3I23A 1M67A 4ALKA 1PGJA 3BMCA 2HJRA 4DIFA 4J0FA 5DULA 3VPHA 2O2SA 4FIZA 1DAPA 3W8FA 2BF7A 4PLGA 1DHTA 5L4LA 2IXBA 1B8VA 4MPDA 1I32A 2CY0A 3G0OA 2QRKA 2H6EA 4YJFB 2IZ0A 1ZXBA 4XWYA 4AJLA 4NFHA 2EHDA 5JE8A 3PHLA 4XQGA 3SJUA 3V1YA 3WYBA 4Y6PA 1J0XO 3WFJA 2I76A 1MV8A 3HB4X 1U5AA 3FRJA 2DTEA 4YT5A 1YRLA 2FSSA 3WBFA 2PZLA 4LRTB 5JS6A 3OMLA 4BOYA 3ONDA 4R54A 3I9NA 1TEHA 1LDNA 1DIRA 5LCXA 1B16A 1VM6A 4MIOA 3S2FA 2ZQYA 2C7GA 1B3RA 5FWNA 4PLVA 3ZWVA 4PVDA 2FR1A 2CNBA 3H9QA 3GHYA 2AG8A 2D1YA 3RBXA 5C5IA 3I5MA 4YCAA 1E7RA 3HHPA 1YQGA 1EE2A 1KETA 1YJ8A 4ND5A 5EERA 2YW9A 3UW3A 2FOIA 1T2AA 5TF4A 4BNNA 3U3XA 3W4IA 3N7UA 1WLYA 4NBRA 1AHHA 3WS7A 1MLDA 3NT4A 1X0XA 3PYMA 4FFRA 1GR0A 4FS3A 3GH3A 3SVTA 4XJSA 1A71A 4E21A 2YHIA 5CEEA 3AFNA 4J91A 1DFIA 4J9VA 3SXPA 5ADHA 4A0SA 3K2BA 3PZBA 3KV3O 1HEUA 1N8KA 1C0PA 4PRLA 4FB5A 3FNHA 2Q1WA 5T5QA 1PJQA 2EP5A 4ITUA 4AJNA 3HADA 2EJWA 2HMUA 2FPPA 1ZKMA 4WLVA 4PVCA 4CL3A 1BVRA 2GLXA 2PWZA 5EPOA 3FNGA 1B14A 2DM6A 1Q7CA 4J90A 5JY6A 3SLGA 4OKNA 1U2GA 2GN6A 4XA8A 5DN9A 2Q1UA 3V1UA 5K6AA 1UAYA 4XR9A 2O50A 4BMNA 2A35A 3FR7A 3ONFA 1OC4A 3FBTA 5U4QA 1P1FA 1QXSA 1PL7A 1DRWA 4HX5A 3WGGA 4JBIA 3ZNOA 1I33A 1O6ZA 1J5PA 4W7HA 1O0SA 3H8VA 5HBRA 1BDMA 1LDGA 2EKQA 2OUIA 1N9GB 1ORRA 1QYVA 5DCUA 4DA9A 2EGGA 2YV3A 2Z5LA 4R41A 5I9LA 4FGSA 3DXFA 1QR6A 4D44A 2WE8A 3HSKA 4IQ0A 2R6JA 5COAA 3OETA 1DLIA 1U1IA 3MZ0A 5F5NA 3RUFA 4XGNA 4LVCA 2O3UA 2VTDA 4LCEA 3KBOA 4TRNA 2AEJA 1G0NA 2GCGA 1W73A 3DQPA 1SO8A 1B15A 3JQ6A 3PFWO 3LSYA 2X5OA 2GRAA 2EKPA 2WMDA 1QYXA 3C7AA 5F5LA 5L53A 3AUAA 2O3QA 1QYDA 1VI2A 3BMOB 4PN3A 1MB4A 4QX6A 4MO2A 4BV9A 3AI3A 4RQUA 2VOJA 4JLWA 2UV8A 4ZICA 3L4BA 4RORA 2PGLA 4RPHA 3BTVA 1F0YA 3NTQA 4M87A 5TT1A 4E2YA 1IUKA 3AY3A 3F4LA 4CLHA 3FNFA 5TQVA 3EUWA 1WDKA 2ZJ1A 3KXDA 5KTKA 5DBGA 3RFXA 4Z0HO 4BO0A 3K8ZA 2Y1GA 3Q1LA 3RC1A 4PZEA 1BWSA 2HJSA 4G65A 3BMQB 4H15A 5K9ZA 3F3SA 3OJOA 3DHEA 3B70A 3PWSA 5TNXA 4NJMB 1D1TA 5G0SA 3W1VA 3WWZA 1R0SA 2VYND 1V3VA 2VT3A 4PZDA 3ZU3A 3RFTA 3QVTA 3PJFA 1GUZA 4GGPA 4A03A 4I9UA 2Y1DA 1F12A 3DC2A 3SC6A 5C7IO 4MVJM 1MFZA 2BI8A 3H65A 4WLFA 3C1AA 1EFKA 3KYDB 1P0FA 3ZV3A 4RF5A 5JAQA 2RCYA 1NBOA 4OGWA 3UHAA 5EQDA 5LDHA 4C4OA 3IDSA 2PKQO 3VHRA 3INRA 1DBVO 5MDHA 1Y5RA 3BA1A 1A4UA 1T1RA 2WDZA 1DC5A 4ND1A 2J6IA 2WSBA 2NQ8A 1N1EA 1A5ZA 5TGDA 3DEYX 5F21A 1U7TA 1JKFA 5B1YA 3DBRA 4HFRA 3E5MA 1YQDA 4NDNE 4Y9DA 1M76A 5L40A 3QA9A 5DT9A 1PGNA 1GPJA 1P44A 3MOGA 4FSHA 4E5YA 1LDYA 4B3HA 3ETGA 4RF2A 3KRTA 1KVQA 4IY1A 1FDVA 1H94A 2JL1A 1TT5A 4HADA 4ONEA 5JDCA 3RU9A 5BNIA 4W9NC 1L7DA 1U2DA 2BFPA 1NYTA 2EGHA 2P2SA 1RYEA 1UXJA 1NHWA 4WNCA 1LRLA 4MVJI 1NWHA 5BNFA 2TMDA 5FEUA 3D0OA 3O8QA 3F5SA 1RJWA 4LMPA 3RVDA 2E49A 2D2IA 3MCVA 3PP8A 5ITWA 4NBWA 5HM8A 1YGYA 3HFGA 1WAMA 1LSJA 1E0DA 3V1TC 5EL0A 3NRCA 1NR1A 5DOVA 3TZ6A 4BO6A 2J5RA 4YA6A 4Y67A 2RBEA 3INGA 2WYWA 4FCCA 5A05A 1E1MA 3AM4A 4Q39A 2POQX 4EJMA 1LBEA 2GR9A 2CFCA 2X9GA 4YJGB 4L4RA 1UZLA 1NPTO 2B4RO 1U4SA 4P22A 2C29D 1UXHA 4ALLA 4JP3A 4IIUA 5T57A 3HNPA 3T4XA 3UGKA 1BW9A 3H9UA 2EERA 3FCOA 4DIBA 4DQUA 4U8GA 2VRCD 5FFFA 1TI7A 2VZ0A 3E18A 1E3JA 1MP0A 5EIOA 3WNVA 4PGFA 3ZWXA 4BO4A 3CZRA 3E5RA 3FHLA 4TVBA 3U49A 3D64A 1L1FA 4JROA 3F5QA 4K1LA 3WIDA 3ROQA 5B4TA 4FPXA 3VZQA 4CUKA 1U3TA 4XX0A 4DGSA 1DHRA 3ETDA 1Z74A 1LNQA 3H9GA 5F1PA 4J4TA 1I24A 1RM0A 2P9GA 4YACA 1X7DA 4PLPA 1GYRA 7MDHA 3HFSA 1ZCJA 1U4OA 2JCXA 1VE9A 1KVSA 4K26A 5KOIA 3QWIA 3TPCA 1H6AA 3DBLB 1GUFA 3HWRA 4U5QA 4E2ZA 3K9QO 1BVUA 1HDRA 4LCJA 2V7PA 3HN7A 3QVSA 5JO9A 1EFLA 1EMDA 4OYRA 5DP2A 4YXFA 5C7OO 5THKA 3ZGYA 2PLAA 3EDMA 3EZLA 2JCVA 2Y93A 2B5WA 3UUWA 4RDHA 2YUTA 2BFAA 2C0CA 1ADGA 1OAAA 4KTVE 5JC1A 1PJLA 2ZB3A 4H3VA 1O8CA 3GNTA 3SBOA 4J2HA 4NHEA 2SCUA 2CSUA 4A2CA 4WKGA 1K0UA 2VNSA 3RUDA 1R4MB 4HFJA 4UAGA 4EW6A 4UUOA 2V65A 1M6WA 2V6FA 4XKJA 4Z3KA 1JDJA 1HRDA 3JQ9A 4EBFA 3T7CA 1M6HA 4Z3DA 1ISJA 2Q2VA 5JBIA 1BSVA 2QW8A 1FK8A 1GADO
chains in the Genus database with same CATH superfamily
3QM1A 4KYVA 1KH1A 4J8PA 3ZVLA 2LR0A 3VNUA 4MWSA 2RI1A 4HK4A 4HWGA 4CMCA 1ESMA 4OYYA 4CMEA 3D4LA 3DC7A 4Q3AA 4TV9A 3T1TA 1SHJA 2XLCA 4UAJA 4PAMA 4TTSA 3DZCA 4FOSA 2VN8A 1KEUA 4DDHA 1A50B 1JLHA 4I2VA 1AK9A 1RTTA 5KNBA 5GV7A 1D6SA 3OG9A 5DRTA 3F90A 3BCHA 4S24A 4A27A 2EZUA 3BCSA 1YBMA 3LRPA 3NVMB 3TSZA 3WWPA 3GLFB 4F2HA 3HNOA 3ON5A 5JSKA 2C2WA 5LJLA 1OOEA 2I9KA 7AT1A 5D6OA 3OICA 1CS0A 4TS9A 1PFKA 2JFUA 4OQLA 1QIGA 1Z5ZA 2D8AA 3RVMA 1OJLA 5JSZB 2WIAA 1GRRA 3PKJA 2OZEA 1GQ2A 3I2HA 5IBPA 4DZZA 1YAJA 1Z7GA 4N3GA 3RSQA 1H8ED 5KNDH 5K5EA 1SC9A 3KQUA 1E20A 4WACA 1E9SA 1UMCA 3EXG2 4ZQHA 1X6VA 1ZCBA 4GOOD 4URUR 2IYTA 3IJPA 1BXRB 4S1PA 2XKAA 5TMEA 4DCTA 4F0JA 4R2KA 4EG8A 1J99A 3EA0A 1TTQB 3CVXA 4I19A 3ZIAD 4ETNA 4A4DA 1T6BY 5LZ8A 4TWIA 4L16A 4AWBA 2O8EA 4OAPA 1PNVA 1P39A 4ZCPA 4ML3A 3WZ2A 4AMBA 4BP3A 2HBYA 5K8VA 1ZUNB 1QAMA 2XNDD 2AS0A 2EDAA 1N5RA 3KJGA 4UD2A 4UMVA 5ECWA 4HFMA 1O7JA 1CZKA 2OGSA 2R25B 5CMLA 2QD3A 5HQJA 3SEQA 4RH1A 5EUQB 4G63A 1HQCA 1T8UA 3ICQB 3OEED 3OF2A 1ZGJA 2ZE7A 2VKTA 3K9GA 1FUEA 3N8HA 4JVOA 13PKA 1QQ6A 3HCRA 1ZGHA 2E4AA 4UTXA 4E30A 2O1SA 5I7SA 2PJRA 1TMGE 4ZJZA 3G2JA 4QQNA 1ZD8A 2RI0A 2H1CA 1H4SA 3VNAA 4XGIA 2A1UA 5AW1A 4DJAA 4P0QB 1HT1E 1FTQA 3RDPA 2ZUEA 3QKRB 3HUUA 3ILHA 3MCWA 4JH0A 3MWYW 1INLA 2ZAYA 3GFOA 5E0OA 1G18A 3TIVA 1WXWA 4D79A 4NOLA 3ABQB 1XSEA 1U0FA 4UE6A 4GPZA 1V8BA 5LQCA 3RJZA 1S3FA 2HZ7A 3GQBB 4HLQB 4F06A 2A33A 4H1UA 4JP2A 4P80A 4RDXA 3CLTC 3BC1A 1A96A 1GP2A 1FFDA 4YK7A 2FY8A 3WL5A 2WLSA 3ENWA 1S2NA 3TQIA 2QD4A 3IPYA 4FNGA 4M53A 3KG2A 5KVSA 2HFKA 4JJ6A 1ZICA 5DYWA 1UJ2A 1E69A 5JQGB 1M7HA 2R1VB 3TTVA 4EI2A 5ICSA 1BXGA 2PL9A 1ZM7A 4P6VF 4YY3B 1U0TA 4ODIA 4MW5A 3MCUA 3FYCA 2D5AA 4WZAA 2I66A 4DCSA 5C52B 3L4EA 3CZCA 1NW7A 4YI5A 1E1DA 1KIMA 3H2HA 1H3EA 3U3ZA 2I2AA 3IR6A 3CU5A 3O95A 2OYCA 4TZ0A 1T8WA 2YICA 1ZVQA 2LP4Y 4DMFA 5ALFA 5I9TA 4KR9A 1P3JA 4QYWA 1K7YA 4ZOLF 3FSGA 3VU8A 4QVIA 1VC2A 3T7AA 3TXAA 3FHTA 3SS8A 4YXWA 4B80A 1A04A 1BS9A 4D4GA 5EINA 2JAQA 1M72A 5FF9A 4NP6A 4YMVA 4B5KA 2NSLA 3SFVA 2HV8A 3OQBA 2KLBA 5K3EA 1OVGA 3A4YA 3L0PA 4CKCB 4DABA 3WXBA 3QUTA 3K0EA 3UF0A 1Q17A 5B3AA 1YZNA 1ZK3A 1ETHA 1H0KA 2CZQA 2IF0A 5DHAA 2IS6A 3UFXA 1A9RA 3GRAA 4CF6A 1PTJC 2PZKA 3NBYC 1YRAA 1KY3A 1LK5A 2FPWA 2QJRA 4GR5A 4BV8A 3AEYA 1L4HA 2XKKA 5TSDA 1J1UA 4WWHA 5AM2A 1T3TA 1MVOA 4Z4CA 1U7PA 4JXZA 4ND8B 5JFOA 4EG7A 2Q0SA 2UYGA 4F8EA 3ZGZA 1QG6A 4US1R 1A4IA 1Q1ZA 4O0LA 4R5HA 1D2GA 1MRSA 3QBEA 1E2MA 5DLDA 4MA4A 2MU1A 3C4JA 4JP1A 1J8YF 5ALUA 4BQPA 1TCAA 4BNZA 2Y9MB 4CT0A 3IDFA 3NIDB 4PWZA 5K3OA 2ZSUA 3K7EA 1SGWA 2NT4A 3GIDA 2W2QA 3G9ZA 2ECOA 1A3CA 1UEJA 4YJ3A 4BVLA 3RKRA 8GPBA 3D6UA 4QE3A 4Y2HA 2I67A 3IC5A 3O4VA 5IBRA 3RIHA 3RROA 3KSZO 3GX1A 2GPBA 2QE6A 3BF7A 3O4HA 4GOLD 2W93A 1QV7A 3ZD8A 1QSGA 4TV9F 2PGIA 3BWYA 3FDFA 4I4TB 4WEQA 1GPWB 4HEQA 2CE2X 1PQPA 1XN1A 4WUTA 5AM5A 3G2PA 2Q1SA 2QZJA 3BK1A 1FQKA 1XEWY 2PT7A 4EEZA 2HEIA 3KU4A 5BWCA 2HI0A 3U3DA 2Q07A 3C5HA 1AS3A 2Q8PA 1QE0A 3FD8A 3HB0A 4HQNA 5AKZA 5B2FA 2ATIA 4DSNA 2AN3A 4PCLA 2EEPA 1Z6GA 2EXXA 3R2JA 1G5HA 1YB4A 2ODEA 3IPCA 3PHJA 3TL3A 1YQQA 1QC5A 2ZRHA 3IVRA 2VBGA 4NZMA 1Q92A 3EVCA 3VH1A 4GYJA 4NIMA 1XZMA 2HMWA 3CW9A 3BMOA 4MRAA 3OPXA 4DZRA 1UAGA 4ECEA 3N74A 1UWKA 5EZSA 3TMYA 1DXQA 5A2GA 5IZCC 4BATA 2PUGA 3T3EA 3CSDA 1ZM2A 1XU9A 2VUTA 2WT8A 3SX2A 2CNLA 5CA1B 4P92A 4YMUA 4ZN6A 4R1TA 1HH4A 1YXMA 1WM1A 1R6AA 2EATA 3COZA 3KALA 4UBNA 3F6PA 1C14A 1PJAA 3M6UA 1YUNA 5BN4A 4DC1A 5F9HA 1T1SA 1TGVA 4EVSA 1BCSA 5L6LB 4NFLA 4WBSA 1G38A 5HP4A 1CR4A 4Q1AA 5F7XA 3GL9A 3BMQA 2X7XA 4NPAA 3RC3A 2J4CA 1XF1A 3D7NA 3E70C 4OFZA 1SBYA 1MBZA 4P5EA 1RKQA 2WVHA 3IQEA 4DLSA 1V16A 4EGSA 1U8FO 4NJMA 2UXCB 2IYLD 4MXDA 3JVEA 3EQ7A 1U9CA 1ULAA 4OGGA 1G63A 2W71A 3DP7A 3OU6A 1LBQA 4RL4A 4RNDB 1JU3A 2V7XA 3V1NA 3A04A 3CX6A 1HZZC 2ZGVA 2LGJA 3ECAA 4BMVA 5BMVA 2CJWA 4L7VA 1Q0LA 1P3Y1 5H70A 1TVEA 1CXZA 2EWMA 1FFAA 2GCOA 2CBGA 3HJUA 2IF2A 2RG7A 4UHJA 1PNTA 2Q2QA 5BV2P 1J5EB 4C7JA 1GR1A 5G4KB 3E22B 1ZQ1A 2XNSA 4LVUA 3W2FA 4E94A 4QXRA 2WTBA 1ZCZA 4UBKA 1NXQA 2PD3A 4DRYA 5JISA 2I9PA 3E7WA 3NBMA 1JJBA 3QVMA 4HDNB 4WY2A 2C7RA 1NLYA 3QHPA 3G2KA 5CB6A 1CEXA 4LXGA 1H1TA 5F2OA 3JU3A 3GP5A 5DX0A 3HVUA 2HU2A 4AT1A 3LTEA 4C76A 4GL4A 5DYNA 3O2NA 2BKUA 3KK0A 1PW7A 3HVIA 1YDEA 3UJCA 3C8MA 4RE5A 3T5AA 3RFCA 1YU6A 4HXEB 5ER9A 1MTZA 2AX3A 1XZLA 4OKIA 1R0XA 2OBMA 2J3KA 1C3LA 1UCFA 3RUIA 2FN3A 4D4JA 3OLVA 4E5VA 4GL2A 3TQTA 1I4WA 2LW7A 4PO3X 3UJNA 3WLOA 2O2ZA 4S1OA 1J56A 3CLUD 1Q6ZA 3PB3A 2IYUA 3AONB 4LISA 1Z39A 5FA5A 4ZHQA 2ZYVX 1CJCA 3CNHA 3CTMA 4HZGA 4DUZB 3OTQA 5LQRA 4DLVA 1CRPA 1Z2DA 2EQAA 2VJYA 3OH8A 4P4SA 5EJ5A 4D8YA 3KXIA 4P5PA 1RQGA 5BUCA 4FDUA 4NENB 4U7DA 4KAJA 1QRRA 4D80A 4EUHA 5CFZA 3EDOA 1V9LA 1USKA 3TVDA 4CM3A 2QBYA 3UWDA 3UOAB 3K6KA 3GFSA 2NYRA 3HN2A 5AKIA 5C31A 4TYPA 2H7CA 2J5QA 4P3OA 4WFKA 5SZHB 4E12A 1MOZA 4KR0A 5CXSA 1N7JA 3BEOA 4MGZR 2EJCA 1RQLA 1XZDA 2AK2A 2IYFA 2JH3A 4CM8B 4GLBA 2OMKA 2XUOA 1T2FA 1IBSA 4QVGA 2ZJ2A 3TNLA 1SD1A 3EBPA 4JX8A 1SXPA 1SBHA 3PHHA 2YJ3A 2C8LA 4M7RA 3KEQA 3T95A 2BJHA 4PC3A 3OQMA 2UYCA 2C58A 1XD2A 4OFBA 3CISA 3QXGA 2GWRA 3KKPA 4TMXA 3UJ8A 2X9LA 2BTEA 2LTAA 3PNBA 5AW0A 4UEKA 2QL6A 4BY9E 4J0IA 5FBZA 3CW2A 5HSGA 1QYRA 5A7FA 5JNLA 1OB5A 5L9AA 4U5XA 3EZ9A 1WUHS 4CR8A 4QUBA 3WYDA 1II0A 1RE0A 3HABA 4YJ3F 1U3VA 4R3NA 3EF1A 5EE1A 3PPVA 2XTJA 4Q3BA 3WHKA 4C4XA 3U5ZB 4OGFA 3GY0A 1QP8A 4LX0A 3PFHA 1GKLA 1TJNA 1D4ZA 1ZJYA 4C0XA 1DKNA 4YUZA 4V0RA 1L5QA 5CNKA 4Q01A 3BXFA 2OC9A 4OP1A 5A7HA 5JUWA 2BFDA 1WZUA 3FZYA 3KSAC 3ID6C 2Q9CA 5CLIA 3B38A 1DEAA 4LCBA 2IV3A 4MS3A 2EF0A 4WH0A 5BQFA 2P65A 2J87A 2WTMA 4ESVA 3TLCA 1J97A 1QOZA 4H7PA 4ZU1X 4CTOA 4QO7A 1P1HA 3OUZA 5B2EA 3GUUA 1CKEA 1V3QE 1L4MA 3DW1X 4NYJR 3T8YA 1GQFA 4A26A 4RFLA 1FMTA 4JWTA 2QLMA 2EU8A 2P0YA 4EG0A 2YMLA 2D5BA 3FFAA 3LV8A 4P4TA 4DM4A 3QOWA 5BUZA 5LQNA 2INGX 1FUKA 1M0SA 1S02A 3VSEA 1O57A 2O54A 1DAGA 4R2HA 4EJ0A 4LTDA 3LT4A 5CT4A 1L5MA 1F2DA 2JLCA 5EP3A 4BO9A 5KTNA 1O95A 4H2DA 1DARA 5DWVA 3JXEA 4GMGA 3NAMA 2HCRA 4JB8A 1GDHA 4OI1A 3FNEA 3QV1A 1SU4A 1CR6A 1PG2A 3IKJA 1P4HA 3ZCQA 3M6WA 3IULA 3PUHA 4GI3A 2VWQA 1GPYA 3U81A 1CDEA 2J3HA 2N9UA 2NU8A 4UTNA 2CSXA 1AA9A 3LHIA 3GB9A 1NQ5A 2B1IA 3MJEA 4R9NA 5THQA 5IJXA 1C0EA 1HORA 1KJ9A 3C3CA 3KHKA 5BPFA 3ITKA 4IUCS 3IMKA 4JYCA 5HHTA 1CU1A 3PPYA 2V1XA 2GA8A 4RY0A 1CUDA 1FX1A 5HOQA 1DAMA 1IAQA 3DMTA 4MJ3A 3B9PA 3IJRA 2VK2A 3CEJA 2NV0A 3ONWA 4W1SA 3ZY3A 5TGTA 1S3SA 1YUBA 3BHIA 4W9RA 1PEAA 4B31A 2VJLA 4OMUA 5D5PA 3OZTA 3PEFA 1I3NA 1A7KA 2OZLB 1KL7A 5BMVF 1Y7HA 2PH5A 4I99A 4KXWA 4WGGA 3QWFA 2XCUA 3R5KA 4HH3C 4BNKA 4DLYA 3B85A 1SXJE 1ZX1A 3V1LA 5LOVB 3FZGA 3H1AA 1BDHA 2XMRA 1T13A 2C5BA 3O90A 1BX0A 1C1DA 1QTIA 3GD7A 1OZHA 5JZSA 4G0YA 4RGYA 2WAAA 3GGGA 1CUGA 3HB7A 4PX9A 4C4YA 1PSZA 3RADC 4ARZA 3ZR4B 5TMBA 4EFLA 2OA0A 3B36A 3H4VA 2AR7A 1J8QA 5F12A 1B0UA 3SFZA 5B2ZA 4MHTA 1XMSA 3OZSA 1GTVA 1ZK0A 5T6BA 1II8B 4OSOA 3ZQ6A 2ADFA 4JLJA 4OJNA 4G41A 2XCLA 3HTXA 2BSQA 1QBGA 1VHJA 5J4LA 1T6NA 1W5TA 3BBPA 3ND9A 4YP7A 3TRKA 4UU0A 4C3UA 4CKBA 1N3LA 2X8JB 1XTZA 3X1JA 3X1DA 2WM3A 3ADKA 1HDEA 1P4GA 1LLUA 2B30A 3G02A 4PRZA 5LL6P 4ARCA 3G0GA 1WDLA 4E33A 2CDCA 7GPBA 1YUMA 4J49A 5TE9A 1I1NA 4WBNB 1JZQA 4ITRC 2OHIA 2RGEA 3GLGB 3JQEA 4J1QA 1CQIA 2Q5IA 4I6EA 4QUIA 4J1NA 4Q3NA 4ZHQF 1WY7A 3P2MA 1IUNA 1JZTA 1WZEA 2IODA 1RWBA 3WSVA 2J6BA 3ETHA 1Z5UA 4EDFA 1EK0A 2A9VA 2FSVA 1SVKA 1W0CA 2RHCA 3E9RA 4M8KA 3RREA 1XXHB 3ZWNA 4EPWA 1PJ4A 4NMXB 2IX9A 4M0LA 2K7FA 3KPVA 1FQOA 4HAOA 4NBLA 4BEVA 2GFHA 3KKQA 4JL5A 4E4YA 4KO2S 3RH0A 4LE2A 1IPEA 1T91A 2Q6KA 2R84A 2ZI7A 5FV7A 2Z3ZA 2Y99A 2XQVA 4G4SP 4BKRA 1AQJA 4B7XA 4HMPA 4NJEB 4JHLA 3OJWA 2A9OA 1I0IA 1FNSA 3NVAA 2BF4A 3VH4A 3ZU5A 1J39A 4Q37A 1KY5A 2DBZA 3LWZA 4IV8A 1T9ZA 3ANMA 3UJ7A 3LCCA 1JLKA 1G64A 4GS5A 4Q3KA 5K7SA 2MYUA 1NQAO 2FZVA 3D4NA 4UTOA 2FZEA 1L0BA 4F5YA 1EYZA 1PR2A 3EEIA 2ZU6A 5E3HA 2EKBA 3QU7A 4ZIRB 5JSHA 3NP9A 1CD5A 3K0AB 3IJ5A 2V7GA 4QXOA 2ZSKA 2H4HA 4RGBA 5CB4B 1WXIA 1WB5A 3LPCA 4HAVA 3C6BA 2ZIUB 1CUVA 3D8HA 3OSZA 3A0RB 4FQ5A 4MMXB 4A8TA 2GD0A 3CVUA 1T9GS 3QUQA 4ZYYA 3PRYA 3MJSA 1SXIA 3AGPA 4DUPA 5A5FA 3R7AA 1EGVB 2GAOA 4WZBB 2E85A 4ZVLA 4JUBA 1NMZA 1Y7LA 4YT2A 1OYWA 2GJ4A 4LQLA 1JEOA 3EXFB 3DWIA 1ORWA 2YFHA 3PQFA 2A5GA 3EMBA 2C94A 1QS0A 4JT9A 5BSUA 4AK9A 4Q4AA 2ECFA 2YL2A 2G1UA 3L18A 4NV0A 4CNQA 2X5NA 5BYBA 1RRPA 4E51A 4I2NA 1CDOA 4JBWA 5C34B 4G2NA 5MN4A 2ANCA 4NQZA 5HVNA 4AKEA 1G55A 2I22A 5LMUB 3U4QB 4LHYA 1RC8A 4LV5B 5HKBA 4OIFA 1A9ZA 2F1OA 2OXCA 1TUGA 3NOXA 1G2PA 2DSNA 3TR5A 3FXAA 2HK6A 3IX7A 3ZZUA 1N8NA 1AXEA 2P2NA 3MBIA 2BFEB 1QQBA 3NGMA 2QVBA 2GX6A 4UDNA 1E6LA 4HV4A 2MYNA 3OESA 1HEYA 3CN9A 1WCYA 2C3UA 1DRUA 5FA6A 1JR4A 4B84A 3CRQA 1T15A 5GOTA 1SBZA 1K8XB 4PXSA 4MB2A 3EZGA 3CPSA 2NVUB 3WLKX 3T3PB 3KXPA 1SXGA 5JCOA 1K97A 3IAUA 2NU6A 1F60A 2D8MA 3EAGA 1M9NA 5H3HA 1DUVG 1JDBC 2IW1A 1F38A 2VNIA 5IYZB 2EC5A 4O2LA 4HQ0A 1XG5A 4MAMA 1SRRA 3VZSA 1ML3A 3F67A 3PRHA 4N3CA 1C7RA 2X4GA 1KMHB 3GAAA 3PXAA 4YPOA 2ZI5A 4JLPA 4TTAA 4WK4B 5E9QA 5EESA 2JCYA 1W93A 5C1IA 4UQPA 3QXJA 1E3QA 4Y2PA 4GX2A 4Q6BA 2F3RA 1IHPA 2R6ZA 3IP5A 4IDDA 4KMOA 3S2GA 3WA7A 3DLCA 1GPMA 4NV1A 3T9EA 3H1FA 1U1DA 4PPYA 3WDKA 3VU3A 4EG4A 1MHTA 4CW7A 3TSYA 1E7WA 2BH2A 4IJ6A 2RHBA 1J0EA 1G8SA 1ATIA 2C2HA 2HUNA 2RHLA 4RZUA 1EUDA 2R8BA 3QU5A 3RFUA 2PV7A 3U3MA 2EKLA 1WCWA 1SH7A 4ZI2A 1H6CA 3BJZA 1L5FA 1QFYA 3LUHA 3O03A 5KC8A 2I3AA 2AI1A 2V58A 2OZVA 1J42A 3EAQA 5JI2E 2X5JO 2WHPA 1HKUA 3NAZA 2B2CA 2C4VA 3OM8A 4J0JA 4H7JA 3EIQA 4W8HA 3TJMA 2F43B 2GI4A 3Q5DA 3KETA 5CVUA 3KT8A 1TE2A 4MRPA 4WXYB 3KJEA 1G5QA 3GI1A 5TVKA 2G04A 3BMNA 1E1YA 1UKEA 3TTTA 5DM0A 3KCNA 4J43A 1YU9A 3G0BA 4B73A 1AQUA 4W5TA 1NR7A 1Z0FA 4KDEA 2ATVA 2ZR0A 1SCBA 2GPNA 1XZBA 2WD7B 3KHSA 4NV3A 1SCQA 2Q6IA 4ID3A 3JX9A 1OREA 4KW7A 4F4CA 1DEXA 2YDYA 2Z08A 4OQZA 4JI3B 3V9PA 4RIGA 1GNLA 5K0SA 1YL5A 1A72A 4LSWA 3L7BA 3CBGA 1TCVA 1VKHA 3UAOA 5B7GA 1DC4A 1SHZA 1WB9A 3NJ4A 4I14A 2RGWA 2UYYA 3W9SA 1T6XA 1F8GA 2RKOA 3R4CA 1H4VB 3FTEA 4ZCIA 5AW8A 4RACA 4QODA 4N39A 1Y5IA 1YE3A 3IVGA 5LUAA 3MVEA 2HU7A 1T2EA 4FMPA 2FGJA 1FPMA 2X2FA 4TVOA 1EESA 4CDRA 2XT0A 3NC0C 4ISBA 3L8DA 1X1EA 4UCFA 2QT9A 3MGAA 2FR8A 5JI3E 4WGFA 4OB6A 2HDOA 1WDMA 1NBWB 2JGRA 1PWXA 1YBHA 3ETLA 4XGQA 1Y3BE 2Q49A 3A2MA 2NYVA 1W2HA 1EI9A 4LJRA 2CLIB 4D4LA 5ECGC 2Q28A 4IRXA 1R18A 4WECA 2EG5A 4J7XA 2ZYSA 2NUTB 2G8NA 3GLQA 4UBIA 1Q0SA 1SVWA 2WZBA 1PR9A 1KVUA 1G2QA 2NG1A 3ZDDA 1V95A 1T1GA 1T35A 2LKCA 4ER0A 4L57A 4K9RA 4XGRA 4KPFC 1C7QA 3CZ5A 1KSFX 4KQFA 1SXHA 1WOYA 4U9IS 4NRDA 2RSLA 2WPNA 5E7JA 3RRBA 3UGTA 2AN1A 3N3BC 3E8SA 3KELA 4B7UA 5FTKA 4QG3A 3QLEA 4D4IA 4LIPD 3RT7A 3M6LA 3T41A 2AHOA 3HYSA 2BM1A 3K1JA 4BO5A 1Z6YA 5TDHA 4OHKA 2HC9A 3EIFA 1WCV1 2PU5A 3RJ9A 1NBAA 3TW8A 3SOPA 1X7YA 2E5FA 1UBGA 3PTAA 1IJFA 4KO8A 3IIKA 2QM3A 5DZSA 1T2NA 3MWFA 5HF9A 3N2YA 4L28A 2X0NA 5KSOA 4S04A 1X13A 4MO9A 5H68A 3IVCA 1N6IA 4E6PA 5FI3A 3H11A 1GQYA 1TQ8A 2VF2A 3AB3A 3OSUA 3PUJA 5ALIA 5BT9A 4RCYA 4CCWA 2IUFA 5CA0F 3KO8A 1YAHA 1DTWB 4JJ4A 4ND2A 4BQOA 1VG8A 2RGBA 4K46A 2XWQA 3VPSA 1N92A 1KAOA 3HA3A 4KXUA 3U62A 1BQ3A 3R74A 1KXZA 3JQGA 2BGRA 5BSMA 2OO7A 4DSZA 1XMIA 5TX7A 2MSKA 5KHLB 3LK7A 4HJRA 1Q3HA 2WFLA 1IU9A 2YQ4A 3EHEA 3D2BA 4RY8A 4MWDA 3BSFA 2J6CA 4HJXA 1F5SA 5BN3A 1YL6A 1OX6A 2SKEA 3NXKA 2IOQA 4WOCA 4LJYA 4C2AA 3OZGA 3VYTB 1TU4A 1GZSA 4LFBB 2WV7A 4QEDA 1Q0PA 1B8OA 1VMKA 2PSDA 1S96A 2MYPA 1NXOA 2FUG1 3GT7A 4HKTA 3UMRA 4AICA 1P9WA 2AWOA 2VFAA 4YJHB 4TLCA 5JZMA 1CNEA 3HCNA 3JSAA 3N2IA 3KQWA 3HUFA 3ZLUA 3ZTWA 2OY0A 2GXQA 1CUBA 2C2GA 2Y8EA 2UUOA 5A6VA 3UJ9A 3ZWQA 5KJFA 1WZIA 1IN6A 1UIRA 2K7ZA 4HHEA 4WK6A 1NXWA 4WJKB 2BCJQ 2P5UA 2IYNA 1V37A 5CCXA 3HLYA 4FFVA 3L6EA 1ICIA 2FW6A 2HUPA 3CF6R 5L3RA 1V2HE 1W5SA 4O08A 4YP0A 1TZBA 1E4EB 1ECLA 3ZV4A 4BE4A 3Q4GA 2WUFA 2VQDA 3TBKA 3DKPA 3ZJVA 1EGQA 3UJ3X 5B6JA 1NUQA 5IF3A 4N7RA 1QLWA 1GXSB 1TEVA 2H51A 3QVWA 1UPFA 4YV1A 1X38A 3CYFA 3PGXA 1XAGA 4G85A 2CE7A 2R4QA 4FFSA 4BYGA 2VH2A 2VJNA 3H2YA 3OFJA 3COWA 1ZO8A 5DM70 2UZ4A 3MXOA 4MVJP 2GDZA 3A3YA 4MWOA 3D2CA 3EXEB 2HXGA 1UDBA 4QUHA 1IXSB 2J9YB 3OQHA 2I4IA 4FQ7A 3QIAA 4HX2A 4X44A 1RLOA 5CT8A 1FMFA 1IQ0A 3MM4A 3BRCA 5AP9A 3UB3A 1XYGA 5DTQA 2FJUA 3DH0A 5JRZA 4DA4A 2A2ZA 5A0VA 4F92B 3YASA 4ZI5A 4E70A 2YVQA 4QEZA 4Q4CA 1OIVA 1CIJA 4JVNA 1R66A 4H7HA 3VZPA 2REXB 1K86A 4ZOLB 4CLOA 2VQEB 2W2LD 3ESBA 3HDYA 4MQ6A 4OK5A 2IHBA 1JQKA 4EYGA 4L27A 4LJLA 1CUWA 2WKRA 1UOOA 2PZBA 4HRXA 2I2WA 3LD9A 3IA7A 4DLPA 1RS0A 3HZZA 1WXHA 1Q0ZA 4CKYA 1KJYA 2HF2A 2XMGA 1KEKA 1Y48E 4MJ7A 3FTPA 4Q34A 1YZYA 2WKQA 4Q1VA 2QN7A 2DWUA 1Y37A 1PR1A 1RJFA 1W59A 4RV9A 1WHTB 3MWJA 4G0UA 4LYGA 1JDBB 3C5CA 5BQOA 1EG7A 2OR3A 1FIUA 2W2KB 4KX3A 3PD0A 4H4DA 4HGYA 2WJJA 1TO6A 2I5PO 4KBGA 2QE7A 1WF6A 3IQWA 4Y1EA 3U0BA 1QK3A 3E4DA 3HP4A 5C7YA 5IMSA 5BWNA 1ZM9A 3QRWA 5U9CA 1NKVA 3AHJA 3FCXA 3FLMA 3MT9A 4UUNA 2QTNA 4TMKA 3QVKA 1D1QA 1L7OA 4UXHA 4ZT2A 3BUSA 2P1RA 1LK7A 2FN4A 4Z86A 2YIJA 5F1OA 1RQ7A 4DOMA 1F9EA 4EGQA 1JN0A 5E9JA 3JQ7B 4L8YA 3EEFA 1CF9A 1CRQA 1N7HA 1P5HA 4W6QA 1I5EA 1W5AA 2C96A 3KYCA 3MQFA 4QHYA 2QI9F 4D9BA 1PT9A 1SC6A 5E4YA 1PG5A 2VP9A 1XLVA 5HK9A 5IM4A 2V59A 4YUWA 2E5LB 5CP8A 4M89A 1X7GA 3WBKA 1NTRA 4AVYA 5HX7A 3GRFA 1VL5A 1ZNYA 2A92A 1YH3A 3ZDAA 1ADCA 1EK2A 1RLJA 4D0RA 4OREX 4DV3B 2XHZA 2D74A 1GRNA 1NNUA 4HNVA 1ESCA 1DOHA 3ZHBA 1KARA 2R8OA 3H3JA 2R7LA 3ISVA 4IGFA 4PQFA 4EBBA 5KQRA 2OB1A 4B6FA 3UPTA 3OPYI 3U61B 2IDKA 4KG7A 4ZQBA 1SXJD 1CFZA 1SKBA 3EGOA 2B3DA 2L69A 1R5NA 1UADA 1H3FA 3PUZA 4IJ5A 4AG6A 4BC1A 1OFGA 4HBGA 1YHZA 1C1YA 1YJXA 3I64A 4YT8A 2A67A 5KTOA 1KOJA 2Q5EA 2B4KA 2PTGA 1ZMOA 1UKCA 1T4GA 2WAYA 3LKVA 4O4IA 1P91A 4MW7A 3O3MB 1RAGA 1QHSA 4HXYA 3F74A 4DLWA 4BNLA 3ZWYA 3PUIA 2CXSA 1NQXA 721PA 3ZU2A 1UEXC 4E3ZA 3JTMA 2Q0HA 1RSZA 2UKDA 1HEIA 1MPTA 1A1VA 5HPYB 1L5RA 3CT6A 5BVGB 1EFVB 1RM3A 2IGTA 3OCXA 3RYTC 5KSZA 3RYCA 2EG9A 4FFWA 1VE6A 5T3YA 2ENUA 4CM4B 5AW7A 1ZD3A 3L7OA 2O8EB 3B6IA 2E4XA 2Q46A 3LZDA 2V4UA 2CF5A 1JSRA 1B8NA 2G67A 3O26A 4N3NA 4ZZIA 4X5OA 4ZYVA 2BV3A 1F2UB 1SEPA 2GD1O 1KI7A 4AZ0B 2SNIE 3WIOA 1S7GA 2CHGA 2W6CX 1JEEA 1Q11A 2D1FA 5LU9A 1ENPA 1Y1RA 3KTFA 1EAMA 5DXFA 1E3EA 5I9IA 2AOXA 2NO1A 4FFDA 4RGVA 4O2AA 3TFOA 3MTQA 3QXCA 2PR2A 1OH8A 3O1IC 4XD7A 4EI7A 3GD5A 3FNRA 2IH4A 3OD1A 2G80A 4FE7A 2VHYA 2ZEJA 4Q15A 3TI9A 3X2SA 1FJXA 1T0HB 5AJYA 5BOSB 3O8LA 3EY4A 4HEA6 3UK6A 1V7CA 3WWOA 3ZU4A 1JR3E 5LQMA 4FOPA 1JHXA 3AJEA 3MHTA 4CWAA 1E0SA 3V2GA 2PS0A 1WXGA 2YJZA 1Z7YA 3EEQA 1ZGAA 1Z4LA 1R0RE 2DZDA 2GZRA 5HEKA 4UPEA 2WILA 3DZHA 3O2SB 5L51A 1MGOA 3BGWA 5TR9A 1PS0A 2AUMA 3OT1A 4EGJA 3WDSA 4R8RA 1ID8A 4Z49A 1LGYA 1XWIA 2I6UA 2XJ4A 4CR6A 1W96A 4FJ2A 4AU1A 1OLXB 3NHMA 4M86A 2C8JA 3T7SA 3TZCA 1BXGB 3VTKA 4AS1A 3GNQA 3S2EA 2X4DA 3LUGA 3GDWA 1HE1C 3BQNB 4RPCA 3EZYA 4MROA 3L0BA 2C4HA 3O1JC 5TQ2A 5A4IS 2QIPA 3AR6A 3HO8A 3SSOA 3NEJA 4UNPA 3R7FA 1PS8A 3A27A 1SOWA 1VOTA 3D8TA 1QH0A 2ZB4A 4M37A 4P58A 5AKYA 3D2AA 1TB4A 4QUGA 5DSTA 2C84A 1LPMA 4PW0A 1G7SA 4K9QA 4F91B 4BLVA 4M1QA 2B5OA 1W9HA 5LN1A 4WD3A 3M81A 4D5GA 1LS1A 1QFMA 1V6SA 3DG9A 4V0OA 3NBUA 1ARZA 2JVJA 3FB4A 4L4YA 1KDZA 4LDPA 3V4RA 1H42A 1NVGA 1F3OA 4UE2A 4JDUA 2CNOA 2IY9A 4H7EA 3PRJA 5AVVA 1TUIA 1NW5A 3LDGA 1E0AA 1JECA 1Q84A 2EJTA 4J4BA 4QHTA 3I32A 4TXLA 4UVHA 5ENZA 4KYIB 3N0VA 3W2EA 3A26A 2XYHA 3FVRA 4X24A 6GPBA 4ZI7A 4UCQA 4BQRA 1SUEA 3IBFA 3TW4A 3OIUA 2QZ4A 1X74A 1YCHA 1KQOA 1Z0JA 3O73A 1K7XB 4FFBB 1EB9A 3EVTA 2V97A 1DOZA 3CWZA 2IUYA 4OXYA 4BNIA 3RUEA 2ZRIA 1N8TA 1XZGA 3A6JA 3OX4A 4I0WB 4BL5A 3C4QA 3DMTC 1UBNA 5FNVB 1XNRB 2CKMA 5BQ5A 3UQZA 2HK7A 5LUBA 4AULA 1JLMA 1PZNA 1M2EA 3QV2A 4ZAXA 4DANA 1ZRSA 1BEUB 4QGFA 5F9MA 1VCOA 3CH7A 3GN2A 3OEHA 3R7WA 3L4BC 3DFIA 1QX3A 3PYLA 4YJ3B 1UM9A 4DQ0A 2Q8QA 5DNVA 4MKIA 4EYSA 1F1JA 1GA1A 4D6XA 2BCEA 5G0VA 3E2IA 1HT3A 4HVCA 4EJSA 1GG2A 5F3RA 3VR2D 2PRJA 1JMVA 4MQEB 1Y9AA 2LWIA 3S7ZA 5CEJA 3TZEA 5L3SB 4A6EA 3ISJA 1U5BA 1ZW1A 4RJTA 3C5WP 5EN4A 1FS6A 1LCIA 1IHUA 1R88A 4PSCA 4X61A 3TG2A 2DULA 3N86A 3ND8A 4HEA1 5F64A 1H2XA 2XMPA 1JFFB 3E3AA 1DV1A 1ZGZA 5BY2A 1DRKA 2WJ6A 1EZZA 3DVAA 2EX0A 4FXOA 1JWAB 5LDDC 1SULA 1GRVA 4NI5A 3ER8A 5KTSA 5KX5A 1WUJS 3UZUA 1B76A 3Q9UA 1EFRA 2D7DA 4XI9A 4ADSG 3H6GA 1JB1A 3IV9A 4BB6A 2QNRA 1QC5B 3URKA 2V3CC 4GICA 4IH9A 4UMFA 4F3KA 2IUEA 2ZG6A 1GEGA 4TM7A 4C0HA 1NA5A 5BN1A 2H63A 1PR4A 4JVMA 1R6DA 4R5MA 1SFRA 3RHZA 1Z4MA 3EZ2A 4O4IF 4QL3A 3V7FA 3TUZC 3RAEC 4DT1B 1E9VA 4TN1A 5ED4A 5AJWA 1B26A 4FYHA 4TMVA 4N7BA 2H1OA 2H57A 2O5VA 3T1QA 4WZZA 4BKPA 3O74A 1NY5A 3EASA 1FSFA 3PUXA 1A2QA 4FKBA 4XVHA 4N8SA 3N07A 3DJFA 2GB4A 3LX8A 3T0FA 4DQLA 1U0EA 1C7IA 3DA8A 4DR6B 3F7MA 4IXMA 2BJVA 1E1KA 1LQUA 4BNHA 1YVUA 3RBVA 2FSVC 3VUEA 4B9EA 1J22A 2HQSA 4HZIA 1U0NA 3V4FA 1BCSB 2ARKA 2WWRA 4L85A 4N5MA 1JHMA 4RA6B 5AXCA 3MF4A 1EX7A 1JJAA 1B7GO 2DUJA 3C8DA 3LQ4A 4CCSA 5A4JA 1I3OA 2W2PA 5FFNA 3DKRA 1MB2A 2H5EA 1P75A 4O2AF 3WGUA 2XZDA 5AKJA 1P4SA 1TLTA 1ZBDA 2YIMA 4M9UA 1FYDA 2JLQA 1ABEA 2PPVA 1LEHA 1QZ3A 4QTXA 5HF6A 4E15A 5I6DA 4D3SA 2X41A 1YFZA 3OZDA 5LWHA 2YJGA 2RHOA 2IH2A 1W9MA 3LC7O 4JSYA 3CVWA 4M2LA 2CJWB 3RU3A 1GVNB 4MYHA 4EF5A 2P75A 2LVBA 4IXTA 3AF2A 5A9SB 5BRAA 1TYBE 1ZK1A 1HT0A 1XLUA 2R8EA 1BJTA 2GDJA 2W6QA 2X0IA 3A32A 2F1KA 3P9QA 3BTOA 4P5DA 5E6RB 5IH3A 4ZDIA 3I6BA 3ZKAA 3M9WA 2V3VA 1VKNA 1KHHA 5TF0A 1KMMA 1KGDA 3DEKA 1YBAA 4K9PA 1HSOA 4AW9A 2C5SA 2ZBPA 4DMGA 1DELA 2B1QA 3OCJA 2Z4TA 1P17A 3H2IA 1N3IA 2GNOA 2H4WA 3IODA 2AW3A 3N6RA 3PNSA 1CNMA 2NX2A 3SJAA 2JH9A 3L1VA 3NM6B 3QW2A 4X9XA 4XUCA 2P9EA 5HRCA 2IZ6A 2AQIA 4IXNA 4JEMA 5EKUA 1F2TA 2AMJA 4M36A 4UOZA 5JNTA 2DKFA 2CB9A 2QUJA 3E0QA 2XD9A 2RARA 4JDPA 4L7QA 5HDBB 2EWWA 1FX0A 4CQLA 3IE1A 4HH1A 3HJNA 5TEWA 1AKVA 2GBLA 3LWBA 1YI0A 3BMCB 5LWQA 2IJGX 3AEKB 3AEZA 1J0AA 1KA9H 2QXUA 2FWMX 4RA9A 1L5NA 4B6RA 3AJDA 2Q6VA 1M5RA 3OIVA 3STTA 3HUTA 2KMLA 1NP3A 2F1IA 3I5AA 4C4PA 4BX9A 2G1KA 1S8OA 4DN6A 1BOOA 4RPLA 2PYDA 4UNRA 4IHQA 1L5YA 3IOEA 3T99A 1A5AB 4ENSA 4ZT4A 1KO1A 1T36B 1JEQA 1CUZA 1XDSA 1FUIA 2R5FA 4EZBA 3ENZA 4EKEA 3B1WA 3T54A 4GMXA 4JS0A 4B6EA 1EM8B 1GRCA 1GSOA 1ITZA 4TL6A 2GTIA 2RB4A 5DW0A 1GGVA 2WM8A 2ZCUA 4RD2A 3P0JA 1EP3B 4FX5A 4F5WA 4YUYA 2OORA 3E0XA 4LKOA 4D57A 2QBYB 4MR7B 3M2TA 2ODQA 5BRJA 1C4OA 1VG9B 3F1LA 3S70A 1V25A 2X5XA 1PK9A 3L7CA 4URFA 1NN5A 4Q5IA 2VWGA 1L8AA 3F6SA 3P52A 3ZHYA 3AF0A 1LQTA 2XKBA 1CY6A 2AN9A 4ZI7F 5KHAA 4PZ9A 2CXUA 5FPSA 2FMTA 1A0OA 1UODA 3GPDG 5LQSA 3ECCA 5JCOC 1QG0A 3I5UA 5HUQA 4ROTA 3OQNA 4FYVA 1JVNA 4RLFA 5E6SA 5K3FA 5LIPA 2FSHA 3S8YA 5HTOA 1HYQA 2CFIA 2WMNB 2WZDA 1TVKB 2UZ0A 1BU5A 1U28A 2GESA 1NAHA 2CD9A 3DBIA 4G0ZA 3AUKA 1VLJA 3NZEA 5JZ9A 2VDMB 2POCA 1NVDA 5JDIA 1DIBA 2FPRA 3ANSA 3BE4A 3EWAA 4BECA 4CL2A 2O2IA 1SURA 3I9JA 1QHXA 3Q9NA 1BWRA 2FX3A 2ZVJA 3ICWA 2LXNA 4KE6A 3MELA 1M34A 2Z2YA 2ZVDA 3MJ4A 4I08A 5BQPA 4BNMA 5CB4A 1X9GA 4CVNA 2HA7A 3OHSX 4AG3A 1VDMA 3A7EA 9LDTA 3JARA 3DOFA 5FQOA 5JYCA 3SEFA 4TX1A 1NBME 3KXLA 2N47A 5IS2A 2JA1A 1MW8X 2E87A 1HE3A 1BS1A 3DXYA 1TM2A 2OFFA 5LD2C 2ZIZA 3R8CA 1OH6A 4AMVA 3C3AA 2Z1NA 5G1OA 1YKGA 3RCBA 4OQYA 2V5UA 4N54A 2HZBA 5CLJA 5DX8A 4BUZA 2ZE6A 1NVAA 1WWKA 4AIIA 1PX0A 5KX5F 2PX4A 1D1PA 5FBKA 1JAZA 2R8XA 1W0KA 1E3DA 3ORYA 4EPVA 4EA6A 3AUFA 1TKAA 3P5SA 3Q11A 4ZZ1A 4WJZA 1WUKS 1YDGA 3H7IA 2QN6A 3PX2A