2P4SA

Structure of purine nucleoside phosphorylase from anopheles gambiae in complex with dadme-immh
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
YTYDTLQEIATYLLERTELRPKVGIICGSGLGTLAEQLTDVDSFDYETIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHINLMGFAGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGIENELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEEEEHCHDSIVGVGKNREKTLGEFVSRIVKHIHYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Anopheles gambiae purine nucleoside phosphorylase: catalysis, structure, and inhibition.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p4sA00
1JP7A 4QFBA 1LX7A 4TS3A 2OC9A 1ECPA 3FB1A 3NM4A 4NY1A 4EARA 3UAWA 1V2HE 3PHCA 4WKOA 4PR3A 1Y6RA 3KVYA 1TCUA 1A9PA 1Z37A 4OJTA 1SJ9A 3QPBA 4MCIA 4X24A 4DA8A 4R2WA 4WKPA 3KHSA 5B7QA 2P4SA 1PK9A 2RJ3A 3IOMA 4D8VA 5IFKA 1U1DA 1YBFA 4H1TA 1PF7E 4MCHA 4BMXA 3LBAA 3TL6A 1C3XA 3E0QA 4OEHA 1YQUA 4R31A 2I4TA 1PR6A 2ON6A 1RR6A 3DP9A 1A9OA 1T8YA 1V45E 5B7NA 3O4VA 5DK6A 5B7PA 1RXYA 4PNPA 5F78A 2I8AA 4F2PA 4BMYA 2A8YA 1JDUA 5CCDA 3DPSA 4FFSA 1B8NA 5CYGA 4TXMA 1OTYA 5CYFA 3UAXA 3PHBE 4YO8A 4LNHA 4DARA 4G8JA 2PGAA 1Z35A 4OF4A 4M3NA 1V41E 4L6IA 3LGSA 1XE3A 1RXSA 3ENZA 4P54A 2A0WA 3K8OE 1PR0A 5C80A 4K6OA 5EPUA 1ODJA 4I2VA 4YNBA 1RXCA 4F3KA 5I3CA 5EUBA 1A9RA 4QEZA 4F3CA 5FAKA 1PK7A 1U1EA 1Y1RA 2AI1A 1JYSA 5ETJA 1YR3A 3DF9A 1RFGE 1V3QE 4GMHA 5F76A 4WKNA 3EUEA 4G89A 4WKCA 3ODGA 1JDSA 5CXQA 4ECEA 4MARA 3GGSA 1K3FA 2ISCA 4WKBA 4DABA 1Y1QA 1Y6QA 2QTGA 1B8OA 3UAZA 1PBNA 4TXLA 4RJ2A 2HSWA 1ZOSA 3T94A 4TS9A 1OTXA 4BN0A 4DAEA 3OZEA 3EEIA 4JP5A 3FNQA 1RT9A 2Q7OE 5IU6A 1QE5A 1WTAA 3E9RA 3OZCA 3BL6A 2AI2A 1A9TA 1NW4A 1CG6A 4JWTA 4QATA 3PNSA 2QPLA 4OGKA 1Z5NA 1A9SA 2OECA 1PR4A 3F8WA 1PR5A 3LA8A 4LZWA 1SD2A 3BJEA 1NC1A 3DJFA 1Z34A 2HWUA 2A0YA 3BGSA 1ULAA 1RCTE 3INYA 1LVUA 1V48A 1VHWA 1PWYE 1RYZA 1OUMA 1U1FA 1JDTA 1T8WA 2AI3A 1TCVA 1YRYE 2AC7A 4D8YA 3KVVA 4LNAA 3UT6A 1K9SA 1LV8A 4OGLA 4LDNA 4GLFA 1A69A 1N3IA 1Y1TA 5F7JA 1TD1A 5JPCA 3NM5A 4L5AA 4YJKA 1VHJA 4DA6A 2OXFA 3MMSA 4L0MA 4F1WA 5F77A 4U2KA 4DA0A 3OOHA 2H8GA 1OU4A 3FAZA 2HRDA 3SCZA 1V4NA 3GB9A 1RXUA 1U1CA 4NSNA 3UAVA 4R2XA 1Q1GA 1G2OA 3NM6B 3E9ZA 5F73A 1OV6A 3U40A 4D9HA 3K8QA 3OZDA 3IEXA 1Z38A 4LKRA 1JDVA 1ODIA 4TXJA 3KU4A 1JDZA 1VFNA 3OZBA 2IQ5A 4OY3A 2QSUA 1Z5OA 5CXSA 2BSXA 1NC3A 5F7OA 2QDKA 1RSZA 5CCEA 3OCCA 4M7WA 4L5CA 4DA7A 4EB8A 1FXUA 4TYMA 1TGYA 4D8XA 3BSFA 1ZL2A 3P0EA 1U1GA 1JPVA 1K27A 1Z5PA 3KVRA 4E1VA 1PR1A 4TTJA 2QTTA 3EUFA 1T8RA 5KB3A 1PW7A 5K1ZA 3FUCA 1Z33A 3FWPA 3DDOA 4JOSA 4D98A 4TXHA 1ULBA 5F7XA 1PR2A 4M1EA 4GLJA 4TXNA 4DANA 3O6VA 4QAQA 5B7GA 1JE1A 1JE0A 4IP0A 1T8SA 3EMVA 3NBQA 4BMZA 4YMLA 4G41A 2A0XA 3ONVA 1ODLA 4UC0A 2HN9A 1CB0A 1T0UA 3C74A 1OVGA 1YQQA 2B94A 1A9QA 1TGVA 5EFOA 1SD1A 1PKEA 4F2WA 4KN5A 4QARA 1Y1SA 4DAOA 4GKAA 3OF3A 4TTAA 2XRFA 1ODKA 1M73E 3KUKA 4TTIA 3D1VA 3FOWA 4NS1A 1I80A 4QASA 1VMKA 3UAYA 3P0FA 1Z39A 3OPVA 2OC4A 3PNPA 3OOEA 3MB8A 2GUWA 1SQ6A 1Z36A 5F7ZA 4L5YA
chains in the Genus database with same CATH superfamily
1U5CA 3K0AA 1ES9A 3K8YA 5T8KC 5BV7A 1E1LA 2VVTA 4X45A 4LN1A 3LT2A 5IAAA 1K7EB 5AHOA 2O3JA 5IDQA 3WK7A 4NY1A 2IHJA 4J3NA 2P2DA 2O2XA 4RTPA 3GEIA 3MCZA 4IOKA 5L3RA 1UWVA 2V7TA 3LDAA 1ISPA 1G8HA 5EN4A 5TS3A 3UAWA 1VSQA 4Q1DA 1XD9A 3PYMA 4MQFB 4MO2A 2J31A 1CJCA 1RI1A 1RJWA 3V33A 2WU1A 4DC1A 1YR9A 5JS1A 3NASA 3RTDA 3K70C 3AVXA 4LOLA 4D8UA 1BA2A 2JBAA 2XJ4A 3N7TA 2FN4A 2QU7A 5DTJA 2F00A 3OFSA 5D5HA 4BQNA 2V5AA 3NV9A 4OK5A 3RKUA 3BZWA 3EC2A 3TI7A 1W2GA 3V9PA 3WKAA 4QUIA 4MKFA 2ID9A 1M1ZA 1QZTA 5JQGA 1U0BB 1C1HA 1ORRA 4JASB 1UDBA 3PA8A 4DA8A 3TRIA 1BDIA 3KHSA 4H77A 1YCFA 3CUSA 3IC5A 3UANA 1W0KA 2F1RA 1JGTA 3WK6A 5LOVA 2RJ3A 4W8OA 1PJSA 2IOYA 2K4MA 1OROA 1DEKA 4HX5A 4EEZA 5LOVF 1UBHS 3BC1A 3RG2A 3K5IA 3BD8A 3BTSA 2O7NA 3AI3A 2X86A 3HE3A 4AD8A 1JEQB 2OZVA 2VPPA 3HZHA 1RJ9A 1QVRA 3EARA 3NC1C 4I3GA 3TM5A 1Z4OA 1Z08A 4EA6A 2FR1A 3K0SA 4JROA 2XKKA 2QIPA 3G7UA 1PJ4A 5KAMA 2QL5A 4C88A 3A1WA 1V9LA 4ALLA 1MG5A 1PWZA 3OIFA 3U3MA 4RGYA 1SXJA 4C05A 1AKNA 1QQ6A 1R5JA 2GLUA 3M6XA 2J6CA 2YJ5A 1T3HA 2I9KA 5C8XA 3QVWA 3TOXA 1M34A 4M1OA 2A84A 3ZHYA 4FDLA 2PGIA 2PGDA 1COWA 1PZXA 1QHFA 1XVVA 3WHPA 5EJFA 3DO6A 3V00A 3WXBA 2OZLB 3CF4A 4QGFA 1BRTA 5F1OA 1RQPA 3ROFA 3SZOA 1RMYA 2QUHA 1KERA 1CQIB 1TF7A 2NPFA 4MUAA 5DLYA 2B30A 3KAQA 3W7BA 4C4TA 2CXUA 2QTZA 3DWFA 5E1BA 4CI9A 1XZ8A 3L41A 4L6CA 3DFKA 2X4DA 3FPGA 3RC2A 4D6PA 5IKXA 3N8IA 3EGXA 2K87A 3FMVA 4S1VA 1CQJB 1B8VA 3U44A 5ICSA 4AY5A 4ZCQA 1EWTA 3UMSA 1NBAA 1I3CA 1WY7A 3WYDA 4J0GA 4KIUA 2M6SA 4GRAA 2PSEA 1XQWA 3LXXA 1VJCA 3QSGA 2RK3A 3FZGA 3UGTA 4BJHB 1HOXA 5I4BA 3AJDA 2Q9BA 1JDUA 2YC4C 3MJ4A 1ZA1A 3KAKA 4Q3CA 3JWJA 5GADl 3HBLA 5FUXA 3F7OA 2WINI 2V74B 5D6NA 1KZ6A 1N8NA 3WAKA 1OH6A 2GBLC 4HTFB 3VKFA 4MW1A 4AG5A 2ZJ0A 3PHBE 2YS6A 4XIFA 3P9XA 3L6RA 2CBGA 2Y1CA 4GT1A 2AVNA 5I51A 4BU1A 4A0FA 3PUWA 3WL4A 1AK9A 4MYDA 3ZWPA 4NU0A 3O82A 1WZNA 4TWAA 4E31A 5FBVB 3GVXA 3HG7A 3JQAD 1BS9A 3AX6A 3CLUC 5FNVA 5K8IA 4L0QA 4J4TA 1CQWA 1MAWA 1PVDA 2ETXA 3JQ9A 4I6JA 5HFJA 2M6RA 1ZOIA 5DO9A 4ER6A 1QRSA 3VISA 4EQ6B 1XZHA 1ZPDA 1KH2A 2HKIA 4F8YA 3PQEA 2XCRB 3BCUA 2NP7A 2ZCVA 1Y8QB 4H7EA 5CB4B 3EGVA 1Z4LA 1UMKA 1DSSG 1KZ4A 2OGUA 4GOJA 4WOPA 3ZWQA 5BR7A 2E21A 1DEHA 5K9ZA 1EK1A 2I4IA 3VBEA 3I83A 3VXKA 1Q50A 2HT6A 1GSIA 1RQ2A 2OBFA 2IH5A 3TGPA 5BPHA 3THRA 3N8KA 1DAKA 4WLEA 2CCGA 2OO3A 3R8CA 5CA1A 1UPAA 4I2VA 5HFAA 1HNWB 1FMTA 5CA1F 3MGGA 5EJGA 1M2OA 1SCQA 2JIZA 3IBSA 4PX9A 4F5WA 1FYDA 2PE5A 1ECJA 4RJKA 2BFDB 1AHPA 1KP9A 1XTVA 3OX1A 5DRYA 5SY4A 3KZXA 1HE3A 5FAKA 2CV0A 2NSJA 4L78A 3SYKA 2QWXA 3UWPA 3MIZA 3OZWA 3E48A 1I2CA 1B3BA 4PLZA 4S1WA 1R0BA 3DTTA 1TVKB 1LFDB 2V7XA 4AICA 4DLPA 5KSPA 1D2AA 1DWUA 5JZSA 3S68A 1P77A 1W0JA 1G66A 2DKOA 4OQZA 3RAJA 2FEPA 2AMLA 1VA4A 3REQA 2KX7A 3LDGA 3O4GA 5CVCA 2C2YA 1FFXB 1RBQA 4LGYA 4BFVA 4D74A 2LIPA 1A97A 1IL0A 4OLFA 3OEHA 5AI4A 3U7HB 2R44A 1MX5A 4INOA 2OXTA 1ZK2A 1EJ6A 2VJQA 4F5DA 3AKYA 2FW9A 2YY5A 3Q1LA 1CV2A 4RGBA 2V6GA 1MHPA 3G2PA 1SCIA 1AKTA 3OF2A 2CDNA 4JIMA 5EKTA 1O2DA 3ZGXA 5JAPA 3TQHA 5LXTA 3HVHA 4BQRA 4EFKA 2A4MA 3PEWA 4J6FA 3F49S 1VB3A 1XTBA 3CEHA 3DE7X 2X19A 3P0IA 4MV5A 3B3GA 5LXTF 4QJ3A 1P0PA 1E61A 1LQ2A 4HPXB 2C42A 5L4LA 1I1QB 5H4HA 2Y1KA 1UQUA 2WHEA 4NULA 3PVSA 2NUPA 4RTKA 4C2BA 1TUEA 2Q6OA 1IBKB 2FPMA 1LU9A 2A1TS 5DMHA 3FNQA 3D8TA 4P8RA 2BKAA 5DM4A 5TIIA 2PGNA 3E9RA 4MB2A 2CFRA 3AWDA 4XAQA 3IJRA 1NUHA 1HTTA 2JFPA 5JH7A 1L4EA 2HHLA 3B1KA 1L1QA 4YJ3F 3UMVA 4DVGA 4BO6A 2PNFA 4BNVA 5JH7F 3G3EA 4QATA 2G9ZA 2Q62A 5FBLB 2W6NA 5H16A 3VUFA 2WR8A 4CODB 1A5AB 1KORA 4N7BA 3FYSA 2HWWA 3DE6X 4UEOA 3ZHCA 5KQMA 4MEAA 1GARA 2ICAA 3DZBA 3WS7A 1R6UA 1HT3A 2O8EB 1KDRA 1SKQA 1ZHHA 4DZZA 1H4VB 4TT8A 5AYVA 3TG8A 1MDFA 1G5QA 2DPYA 3RAGA 3AESB 3RUAA 2O7SA 1Z34A 3CUKA 2DPXA 3G02A 4LMPA 4PGGA 3U39A 2NN3C 2GA9A 4CWAA 3B78A 4F5ZA 16PKA 1CZRA 4DYVA 1VKJA 1HTBA 1J0EA 2ATIA 5A5GA 1M5RA 5KNDD 3T5CA 4E12A 2YHSA 1VG9B 2DBVO 2IGTA 2WG2A 4CNBA 2D7DA 1ZK4A 1ZR4A 3GCGA 4X93A 3HA3A 2C61A 3RV3A 3ZBPA 3PWTA 1E2BA 3MWKA 3BG5A 1KZ9A 4GNKA 4URUR 2Q21A 5A5VA 3THWB 1LDBA 1Z0FA 2Q9AA 5J59A 3B7WA 1BS1A 2O6LA 4P83A 3DG9A 1LZKA 4LJ5A 5FPTA 2P1RA 2P65A 4N65A 4YRPA 3RSOA 4JFRA 1XZFA 3DMTC 3G85A 3QM1A 3AUFA 5G4KA 3A11A 1YFKA 3F8SA 1Q16A 2I33A 5CMLA 5E6SB 2OHFA 4Y2TA 5FL7D 2YS7A 5EHQA 4CG2A 4ZV9A 2OFWA 1CETA 3FYHA 2OHXA 4WXMA 4IIBA 2W70A 4MRVA 5EIFA 4BNGA 3OT1B 6AT1A 2YW9A 3EOBI 2GCOB 2M2IA 3GGDA 5K3FB 1G16A 4MTLA 1AK1A 4EYSA 1RHKA 2AHOA 1TX4B 4L5AA 1NE2A 5EE3A 3TLAA 3TUIC 3BMOB 4B47A 3AR9A 3WJ2A 2HO4A 3WO1A 4DLSA 2Q9CA 3RYFA 3QEBZ 1LDNA 1HYGA 2FMKA 2SHKA 1J2YA 1NIPA 3EZXA 4FSDA 1MQAA 4KK4A 5EXPA 3DR3A 4Y6SA 4N03A 2D2FA 1GFZA 4GBMA 4BNNA 4RF2A 3U3ZA 2H1VA 3QFHA 3WKEA 3KHTA 4ZV4A 1YXMA 2OHHA 1DMSA 1QE3A 2XOKA 1JHVA 1NW6A 3Q9NA 2WJ4A 1V16A 5JATA 1XVIA 3SCZA 5ARDA 2D1QA 4B31A 1F2TA 4IIEA 1ECCA 3CIOA 3UWMA 5DZSA 4ESEA 1AMOA 4E5KA 1FDTA 2GDZA 4E7PA 2ZE7A 3BMNB 1X15A 3LGAA 5J40A 2IU4A 1OU0A 1RAAA 1HK7A 5U1PA 3QEKA 1VIDA 3MRVA 4KXXA 5AHXA 2VA8A 3B1FA 1YGYA 5SY6A 1HURA 4OH1A 4LKRA 3DAPA 3V4PB 4CF4A 4QPNA 5U9CA 1YJBA 1VHQA 2XHZA 1ZS9A 2Z83A 3RUPA 3M6LA 4OXRA 4ARUA 4YCLA 1L3IA 3GZTB 2TECE 3QTTA 4HDRA 4G0ZA 2VH5R 4FN5A 4XFJA 3H1TA 1R8YA 5K8JB 1OXTA 4PGMA 5TS2A 5GZ3A 4K86A 4OY3A 3KWMA 4DIUA 5CFNA 1Z4QA 3QA9A 3ANSA 3OECA 1CUYA 3E8MA 3OT4A 5EHGA 1PAUA 2G71A 2O2IA 4N5HX 1R8JA 5DB4A 2Z6UA 4ZI2A 2YDXA 4LGCA 3GLGE 2VNKA 1Q6YA 2XB6A 5I8WA 5GGXA 1GUZA 1SMKA 1R8QA 3IRUA 4PLGA 1CKEA 3WGZA 4MYTA 1KEWA 3AGQA 3D31A 4J94A 1ZO8A 2BBOA 3U49A 5BRNA 5ICCA 4RSGA 4YYEA 3A2KA 3HSKA 1KFBB 4N3AA 2WJWA 4BLQA 4TRRA 4YJ2B 4BX8A 3LUJA 2DR3A 3B1YA 3KNZA 1DC6A 4RFLA 1KI3A 1DT5A 1ESZA 3LZ6A 5CAEA 5I7FA 1XCGB 1YZVA 2AX4A 3IP8A 3L8CA 5C37A 4NDAA 4AULA 4JYCA 5D01A 4XFDA 4WA8A 4ETMA 1ZUIA 1FLDA 4WCFC 3M1IA 1CEQA 3E3OA 5CR9A 3G68A 3INGA 4Z3OA 1P2FA 5BN5B 3FWPA 3B9RA 2AEFA 4COOA 1B1AA 1NBIA 3DDOA 1BGXT 2W5UA 3NKVA 4URHA 2WT9A 5ARBA 1N9KA 3IS3A 3UXHA 3ZDAA 5BQ5A 4KR6A 2H29A 2IYRA 1YB5A 1YS7A 2GNOA 2BGNA 2R79A 3D8NA 4MPDA 4C0QC 3I5AA 4ZTZB 1ZL0A 3KL4A 1Q57A 4WESB 4MUMA 4ZI7F 2GK7A 1TA9A 4P0PB 4UAGA 4NE9A 5T5QA 1TT5A 1V7CA 3B2QA 4NMMA 3VVMA 3FKJA 2FSSA 4AJKA 4M1EA 3ASZA 1A98A 2DHEA 2H3HA 4F4HA 3RWBA 4CV1A 2AOTB 3FYUB 1HT2E 5IK2A 5FBWB 4Z54A 2FPUA 4CEJA 1K3UB 1TIPA 2CDAA 4MV6A 4EY6A 3RTGA 4Q66C 2G80A 1PGPA 3QU4A 2XGJA 1GYRA 1RM4A 4E6EA 2XXAB 5IJ9B 5BXYA 2HF9A 2PY6A 5LSAA 3P9IA 1LSUA 4TTSA 1G3IA 1PHRA 1QVWA 3R3JA 4IM7A 2ZTMA 3C1AA 4Q3KA 3DSRA 3TSAA 1N2CE 3MT0A 5KAPA 2NVUB 4JOBA 3MJFA 4WN3A 3SYNA 2BBWA 3Q3EA 1WKBA 3A05A 5AIAA 2G1AA 1RNLA 3GRUA 4XX1A 1XRRA 4MVJI 1GNPA 4V0RA 2DX7A 3BTVA 3C16C 4FEYA 4IXNA 2YOGA 5E2BA 4GU5A 5ESRA 4B85A 4DV6B 2GF0A 4TX1A 2ZSJA 2C57A 4RPLA 4H15A 3FSGD 4FGLA 1Q20A 4ENWA 3HI4A 1XWIA 3G7SA 1VE6A 2XZTA 4JQCA 4RV9A 3AJAA 5J2TB 3Q87B 4FZ5A 1Z6QA 3BQ9A 4DQLA 2SKEA 9ATCA 1U04A 1EM8B 3QE2A 1QF7A 3KKQA 4QBTA 1P5RA 5G0WA 3ICPA 1GZ5A 4KXVA 2OXRA 4D9NA 3IQGX 4AUKA 1KJZA 1D4AA 1NVUQ 6GPBA 2OAQ1 3DP7A 2I8LA 3SOZA 4PQRA 4PPNA 2IS1A 1P6QA 1KGSA 2CGEA 1TPYA 3Q5GA 3DHYA 1R6XA 2BGJA 4LY0A 1QR6A 2J45A 1DAHA 3LQ1A 1PVOA 2X6RA 4B75A 5GZ1A 2HHAA 2J67A 3E82A 3E84A 4UZEA 4ECAA 4ND6A 4CIWA 3B1JA 3I30X 4KNWA 3WTCA 3AEZA 3PI7A 4P7GA 2H5IA 2MSKA 4HNAA 5ALKA 4BVEA 3JZFA 4Z2AA 1RQLA 1UWCA 5EXXA 5LBUA 4KPFC 4YQFA 3ECCA 1RKBA 4BMNA 1U3TA 4XFKA 3OESA 5ELXA 3RV4A 1PX2A 4ND3A 1H3FA 2JAUA 3GO4A 1MB0A 4US1R 2WUDA 1SVSA 3MYRA 4L76A 4CLRA 5HYVA 3B3FA 5TT1A 1FSSA 4RD4A 3C85A 2AW3A 4UE6A 2A1UB 4W7SA 1DUVG 4DMCA 2WQZA 2X7JA 1YNSA 2DMRA 3IAS6 4NBWA 4WCFA 2PAAA 4JJEA 2IEGA 1J7JA 1WQ4A 3AEYA 5AKXA 4J1NA 2F9MA 4G2NA 4JLDA 1E79A 2WOOA 3NYQA 4HKTA 2UZ4A 2IUFA 4DR5B 1KDTA 1SO8A 2IDZA 1ZQ9A 2WJYA 3H2JA 4Q7EA 2E5LB 2NPOA 1RE1A 4I08A 4R41A 2IXDA 1QRUA 1Y82A 1B8UA 1EUDB 1NXTA 1MOPA 4Y6OA 5AK6A 3VRHA 2B21A 4BNFA 1V2HE 3DKPA 3QUQA 3KQQA 4QYMA 3TDMA 2MSNA 2H4FA 2ZBPA 3PUHA 2WOJA 2ZREA 3QPVA 2EW1A 2PL5A 5DEOA 5DKFA 1FJHA 3ABZA 4YRBA 5HRAA 3CWCA 1LW6E 1SZPA 2UUAB 2V7QD 4LOAA 2VQ3A 4ZT4A 1WTCA 2GF9A 1KL7A 4JNCA 3B20A 2D62A 4M86A 2CJWA 2PUVA 3IEVA 2ORED 4OA5A 4EBFA 2EP5A 2ZYAA 3O2JA 3SR3A 1KKUA 2LV8A 1RAEA 4IWNA 2ZT6A 4GP7A 3UKOA 1WMEA 4PC3A 2WIJA 3CZRA 4HRVA 1CUSA 1JAXA 3I9V1 4ZDWA 3SJAA 1T4DA 1KYIA 2WPDA 1OAKA 2Y71A 2DWQA 3RIGA 4ZHSA 4MGEA 5KTTA 2PS9A 3IL2A 3H8SA 3QQ5A 4IUBS 1JDNA 2ZPUA 4IDHA 3L7KA 3LUAA 5J1SB 1VMEA 4WEQA 5JNLA 1SKAA 3E15A 4QPCA 2LXNA 3DGEC 4L4SA 4UE2A 4COKA 3RFFA 4FDMA 5H1YA 5IJ0A 1QH1A 4KAFA 2RHJA 1ZP6A 3LXUX 1UEJA 4QLAA 4O4JA 4KO1S 1ODCA 4TVKA 4KWIA 2AKYA 1D3AA 3GZNB 5SZIA 3STTA 3J7AC 4H31A 1R0LA 4O4JF 4A6PA 1GZ4A 3UEOA 4F1JA 4I1YA 3URKA 3A7EA 3PX7A 1XU9A 1GA1A 1Z8DA 5C7YA 8ADHA 5LZ7A 4BQOA 2FPRA 1C1DB 5FNZA 4P4LA 1HRKA 2XMGA 3COSA 2DH6A 2J33A 2YMQA 4XVHA 2ST1A 4OP1A 3KQPA 3DP9A 4PRYA 4A6DA 3G9QA 3HCEA 4C03A 1N25A 2GEDA 4HGYA 2ZDQA 3UJHA 1V45E 4II7A 5A2QA 4UNSA 4AKTA 2AMVA 2R751 3TW8A 1C7IA 2VHUA 1AGYA 2CF5A 4HN4B 2IQIA 1H2BA 4BMPB 3OI7A 3MA0A 5EZYB 2FB9A 1TPZA 4JGBA 3T5MA 5DCYA 3ODPA 3HDTA 4IIFA 3A1SA 4OHXA 1P2UA 2I87A 1SM4A 4QU9A 5AK5A 5M5BA 1Z6AA 2OSBA 3FCCA 1TYZA 4U6SA 5DSZA 5HE9A 3V6MA 5KNBH 5HDBB 3LP6A 3MOGA 4Q3AA 4KYTA 5D1NA 5HF5A 4QYXA 2Q2QA 4KH0A 1J2RA 3C8UA 2NXCA 2FHPA 1QX3A 1XGKA 2XWBF 3HKCB 2ETVA 4MWSA 1F60A 4KTVE 4G0YA 4RMJA 3DCYA 4UEKA 4DSOA 2DWOA 1XAGA 2C7OA 3TAUA 5JI3E 3G0GA 3GP8A 2QM7A 1G2IA 3ZJ5A 5KYYA 3GCXA 4G0MA 1CUGA 2ZJ5A 2XRYA 1KVQA 4TKLA 4AJOA 4D0NA 1FVXA 1L6IA 4ES6A 4G97A 2MMGA 4Q4JB 2VHTA 1K1EA 2ZI4A 1U90A 3BORA 4B84A 5EYPA 4RA9B 5K0NA 4BNDB 4ZOBA 4LHWA 5DHAA 3T3PB 4CVNA 3LP8A 2WB2A 4DLKA 4WAUA 3ESXA 5CFZA 2FQXA 4DRZA 3PU6A 4IUYA 4D3YA 3A3KA 4CKYA 4ZVVA 2IKQA 2WT4A 3HJRA 5CM9C 2QVGA 4FYJA 1H3NA 5FA5A 3P2KA 2P5UA 3NT5A 2A0WA 1KZYC 2J3LA 4G1FA 1PYGA 3ZU6A 1PR0A 4FMBB 5C80A 9GPBA 4DLXA 4BGUA 4N18A 4OFBA 5CDFE 4NOMA 2N1MA 2XVXA 5GM2A 3A04A 4MV1A 2OFOA 4G5YA 4OHOA 4WLOA 3USCS 3DNPA 4UNNA 4GWGA 4CMIB 1DQSA 4WWHA 5C53B 2YXEA 3KVNA 1EX6A 2HLDA 1IHOA 3DCIA 4QQRA 1E0AA 1E2NA 1W4RA 4W1RA 2WJIA 3RTCA 2PQ0A 4ASUA 4DE5A 1JXQA 4IDBA 3IESA 4KE6A 3K20A 3W2IA 2ZLBA 2BFFA 4M7RA 5AVWA 2AZ4A 5C4GB 1QHEA 2QX8A 3G5UA 5CX1A 1MAAA 1RFGE 3T95A 3EFOB 3FPAA 1M54A 2CJFA 4C06A 3R77A 2NXEA 5I9MA 4CT0A 3F5FA 2FP4B 4DJ5X 4LF8B 4RD1A 1DFHA 1ZHFA 3DTVA 4E03A 5K51A 2DUUA 2WIDA 3CPSA 2HQOA 1ORIA 1SVWA 3VR4H 1GCIA 3OOSA 1Y5IA 1U6JA 1WRBA 4IR7A 4P84A 3UV6A 2PT7A 2ISSD 2IY9A 1QE0A 2XTMA 3CLRD 4MARA 4NJMA 4OO3A 5AO9A 4BP3A 2WZCA 1NNI1 3JWEA 3F6EX 1OBOA 3KYCB 1SXIA 1BXKA 2OP1A 2PT6A 2W0MA 3L3BA 1P7CA 3P0HA 2UZIR 5IAJA 3WMWA 1KYXA 1OXKB 1RP1A 2JFHA 3IUEA 3P45A 3T0IA 4I1PA 1KE2A 1DAPA 3FVVA 5DN6D 1IB0A 3WIOA 2L0XA 2Y1OA 4IHJB 5CFPA 1HQKA 4I8DA 2Q8PA 2HSWA 3L7YA 2H7YA 4RV5A 4J16C 2GM4A 5CM2Z 1XEXB 1Y37A 1OT3A 2HMTA 3V1YA 3UJ3X 4EF6A 5JDIC 1KBZA 1ZZEA 2ZP1A 4KRYA 1OA0A 1SHTX 1VPVA 3VPBA 7ADHA 2CV2A 1XZCA 1Z6TA 1VYTA 3OZEA 5FUMA 1F2UA 3TQIA 4CR8A 1IOZA 3THXA 4HN9A 1SUDA 4WXEA 3R0ZA 5AP9A 3D5EA 4TRNA 3DPUA 3GEBA 3WNVA 4D0SA 1K7FB 2O2CA 1RRPA 1T43A 1TJYA 1L4NA 2OV2A 4OFZA 4XA8A 2DJ5A 5EWMA 5TVKA 1EI9A 3ESAA 2PX8A 3UUWA 1CRPA 1Q0SA 4GZ6A 3U5TA 1UT5A 2I65A 3EK2A 2AWNA 2JH3A 3BF7A 1UZMA 2FPSA 1U11A 4FUTA 4D3DA 4C7OB 1GRRA 1A9SA 2ZYIA 3IEIA 5IXYA 1T3LA 2E4UA 1OPRA 5DX0A 3LA8A 2AHRA 3VR3D 1WMSA 1M0TA 5GVRA 4D41A 2Z5LA 3AR2A 5FWYA 2PVCA 3ORFA 2P0YA 1QJ4A 2OV6A 1Q1ZA 3FCUB 1F0KA 2FE1A 3M6VA 2NU8A 4N47A 1CRZA 1EA7A 4W5NA 5CT4A 1AO0A 2UV8A 2DWUA 4O2AF 4YGYA 3ROEA 3GLGA 4F4DA 3FYTA 3H84A 2F2TA 3H4TA 1ULAA 4WFJA 4C7KA 1QIIA 2YJGA 2PYIA 2D06A 3N58A 3F67A 3NFYA 4NJOA 5KREA 1YZQA 2IHBA 1DIHA 2HEGA 3P32A 2EFDB 2Y1WA 3QHAA 5D3QA 4A4DA 4FOOA 1BMQA 4YGXB 1P8AA 2G7ZA 5JISA 1E1DA 5AKZA 1UL1X 4H6PA 4IOLA 4JA0A 4HUTA 1WUIS 2EFGA 1MRSA 4EG4A 4ZOQI 3EIEA 1YCHA 1FP4B 1H2FA 4LV8B 2IP4A 4IIXA 5I7AA 4EFNA 1YS4A 1DAIA 1ZD2P 2VDWA 1VRCA 3A10A 4EUSA 3MFYA 5AVXA 3LVQE 1UZUA 1P5ZB 4GXNA 4YRSA 4F7WA 5ANRB 5LKAA 1YOVB 3PL1A 2RBGA 3SE7A 1EFPB 4BEBA 2GT1A 4MUXA 3JRWA 1W87A 2VI5A 3IO5A 3PQ6A 5FFFA 3H1PA 4MQLA 1DLJA 2WD9A 2O3QA 4U8HA 5ALTA 5H70A 1GU0A 2I80A 4JJKA 3G1TA 4L4UA 4CLOB 1Z0JA 3C14C 1NBME 2ECQA 4G3XA 1S9HA 4J0DA 3HPRA 4KQXA 2CC2A 3FLAA 1GOTA 4E21A 4F11A 1SWWA 2P11A 3IR5A 4HBGA 1G7TA 5CJ2A 4YN3A 4DR7B 4U2KA 4UHCA 2JHGA 5EXEA 1GHTA 3DVLA 2CDBA 1PNRA 1OMOA 3B5EA 2H65A 4H6XA 1Z4JA 3CN7A 3KS9A 1P81A 3GAAA 1K92A 3CPEA 4C3ZA 4RXMA 4GHWA 3L79A 4UVHA 3MG9A 1OWNA 2C84A 4B6PA 1L6RA 1ZM2A 5A0VA 5AFSA 2ZCUA 3UMBA 4WRRA 1GADO 5J5CA 1L5FA 3FROA 4ZCRA 1HA3A 2A7XA 3GB9A 4NF2A 1X14A 3U17A 1RABA 3UV3A 4FZRA 4RTQA 2IHUA 4L8GA 1L5QA 1N2CA 3WIVA 4ZHQA 2CVHA 3DAGA 4OFWA 1G2OA 3CH7A 3D1LA 1MTZA 2WIFA 3FDJA 1DINA 4FYWA 4ZHQF 4KQ9A 5DH9A 1FUKA 1UMDA 2VT2A 2AJBA 2CN1A 1C4KA 4RIEA 1LSSA 4WNAA 2GM5A 3QPDA 1N2GA 2I3DA 3LX4A 4ENVA 2HFJA 4RY2A 5FHRA 3BEDA 3IBFA 1EDDA 2HCJB 2J5QA 2QRJA 1RACA 4ZAWA 3CMMA 4DF3A 2JGNA 4EG0A 2WYIA 5L3QA 1ZD1A 3VDQA 1ZUNB 4D99A 3GJXC 4JELA 4WXPA 5ALZA 4NMXB 3WL7A 1E3SA 3T7DA 5THXA 5B53A 3V5NA 5JV5A 2GZHA 1PNOA 3PVCA 1NC3A 4V03A 2JHPA 1OCEA 1VGRA 2H0AA 3QEJA 4MDYA 1VGQA 3OCCA 3A14A 5DXFA 2K2QB 5K0EA 1DKMA 4PNHA 4QBGB 1XZNA 1YVUA 1FCJA 2G5GX 1Z5ZA 1F7UA 2YVKA 3HXKA 4Z4EA 3WYCA 4Q03A 3ANXA 1ZJ6A 3SJBA 4LJ4A 1A72A 3LL4A 5CLLA 5AVKA 3PXUA 3WP1B 1G8MA 2C3MA 5CH8A 1K7CA 3L46A 4AS2A 2ZAIA 1SAYA 3V4VB 2QQGA 3C1OA 4HB4A 1Y4ZA 3LDHA 1Y7LA 5EEHA 1I2BA 3GVPA 3TD6A 1B2LA 4KR2A 3A31A 4EG8A 3GIDA 3NALA 4CKCA 3RRMA 1JAZA 3U26A 1ZN8A 1YB2A 5HUJA 2W2LD 4QYIB 3RHFA 1B74A 2H2FA 3TW6A 3LRTA 5CCXA 5BWMA 1LVHA 3L8GA 2VUHB 4JOSA 3IEUA 4WY8A 4FFRA 1OH8A 2LE0A 2H1LA 4J1SA 5DHQA 3H0KA 3OZFA 1D2RA 1Q3HA 3EOZA 3IT2A 3RSCA 3CM0A 2FFJA 2HJVA 3T35A 2J9ZB 4LAFA 3VVBA 4BUCA 1PFVA 3GCWA 3GRKA 3X2EA 3MGAA 1E64A 2RAFA 4G1CA 3W77A 4LK3A 1ZH2A 2VAPA 4R5HA 5BOSA 4AMBA 3KQLA 2X5OA 3KQTA 3EWSA 4CV0A 4B7XA 3NWOA 2RSLA 5FUWA 4MH0R 4S04A 3Q3GE 2LCQA 3U4QB 1KSFX 2HQSA 4G65A 4TXNA 4FLEA 4DANA 5ICMA 2R96A 2GO1A 5DYGA 3MTGA 4QAQA 4R83A 1ISJA 4RELA 1G0OA 4BNMA 4YMHA 3DQPA 4CFZA 1O9HA 4XIIA 2OBYA 2EX4A 2RIPA 4HB3A 2XCIA 1RI2A 4CTJA 5HTOA 1H5QA 1TYEB 2HXYA 3AGPA 3WGLA 3R7DA 4TTQA 4UU0A 2NU7A 4XB6B 5A6VA 4UUAA 2CFIA 1PL0A 2DPMA 5AT1A 1HV8A 2RGWA 4B6GA 4QOGA 2ACKA 3NKLA 3W8NA 5JR3A 1ZAYA 4OQLA 2ERCA 2FRDC 3PQ3A 3PGKA 4X6LA 3ICOA 1F6DA 2VP0A 4Z86A 3TD2A 1OVGA 4NQZA 3SS7X 2HK6A 1H4TA 5K2MA 2WSIA 5BMVB 5I7RA 1Z6GA 2CVQA 3F9CA 4QBHA 4R7GA 2DC1A 5LUBA 5BVHB 2QF7A 3PC8A 4RX1A 4D3SA 4E51A 1NMYA 4PFQA 4JB2A 3NHZA 1VPLA 2F1JA 3HJBA 4POAA 5A62A 4U7FA 1HE5A 3H04A 4FFBB 4CM4A 4GI5A 3DHWC 3MLEA 3AM3A 4IBOA 5KYUB 3C6YA 2VF5X 4IIJA 3V8MA 3EWIA 3OWXA 4L15A 3ZU3A 2IXFA 2NT4A 4I5DA 4IIJF 5EHNA 5LMNB 4KNYA 4D6YA 3SK0A 2PX2A 3HCRA 3PNKA 1V47A 2D0PB 5FDFA 3HKDA 1QOZA 1KK3A 3OO0A 5CDYA 1H6CA 2X6QA 1CD5A 3UT5B 1M73E 1PEAA 1U7XA 4CV3A 4NZPA 1ZUWA 3OQIA 3DAHA 3EA4A 4MA5A 1YBVA 2I6QA 2KWIA 3V1NA 2QTLA 3ZXUB 4B6JA 4BNHA 5FWXB 1RWXA 1I80A 1BVHA 4LXIA 4I50B 4PSVA 5KSOA 4OV6B 4C01A 4TLBA 3GLIA 4AIIA 3K9NA 4KX3A 3C97A 4CBVA 3IEMA 3CVUA 1W1UA 1Y4UA 5AJYA 3BGWA 4QO7A 5JWHA 1A9XA 2D1RA 3PNPA 1N4DA 1UPTA 1J5EB 3QF4B 4M0UA 4Q00A 1P1KA 4ZAGA 4YWHA 2LZ0A 1H05A 3GJSA 3IAM1 3KU1A 1PCXA 4DLLA 4RVSA 1MEEA 4C0JA 3T99A 1NJ8A 1IWBB 3ZH9B 3LD9A 4FFOA 3U09A 3GAMA 4D79A 4RPIA 4U2BA 4LYYA 4W9MC 3ROQA 3DYBA 3VR5D 2LNDA 1AOXA 1H6AA 1W8DA 1Y4AE 2ZE5A 3VJKA 3CWZA 5CFQA 5ITZA 3OPNA 3I39X 4JLMA 4P32A 1LSJA 4JJIA 2K2WA 1MR3F 3QEOA 3A4IA 1LWNA 2QTRA 4K6HA 4MR8B 4DPKA 4R8KA 1ATIA 1MA3A 3A1DA 3OHPA 4U7JA 3VAAA 4LMAA 3PHCA 4D81A 4ZICA 3U5ZB 3I2JA 3AZQA 4Y30A 2VP3A 5IJXA 2DSNA 1A9PA 5T6MA 4DV2B 3VDNB 3KXLA 5JS2A 2VJAA 2W8ZA 3IAFA 4XTCS 3TIIA 3ZQUA 5LZ9A 1N5IA 2AG8A 4OXKA 1BQ4A 4PLYA 2GPJA 1IYZA 1UWKA 3ZVMA 3KJIA 1GITA 1NLFA 2R4UA 4MRAA 4BS9A 2CDCA 2R1VA 3PCTA 3PGXA 1R6AA 4R2WA 3C45A 2EG5A 3I4FA 5AJVB 3VH4A 2F1KA 5B6IA 5AW6A 2MINB 2QRUA 3DWIA 2GD6A 2H2WA 3HFJA 4CMCA 1S2IA 2GEUA 2PMWB 5CDFA 1THMA 2AZDA 1A4IA 1NVVR 1XO1A 3P9PA 4FCCA 4RFSA 5BSGA 3G79A 4JSRA 1NHGA 1MB9A 3NNNA 3T1TA 5FWAA 5IFKA 3VZPA 3ZY5A 4RW0A 4B3BA 2MR5A 3MMNA 4FCWA 2Y27A 1U5BA 4AF7A 5L51A 2AG0A 4HJXA 5ECGC 4UCWA 2GS9A 1KZ1A 1N0HA 3R9WA 1G5PA 2NQ2C 2BGUA 1S4MA 4LE2A 4OLHA 3E2PA 9ABPA 3EXFA 1M3SA 3BXOA 1GKLA 2A0FA 2O5VA 3L8DA 1I1OA 3I2GA 5AM1A 5JCXA 1KWGA 2P9TA 3ECSA 2WTBA 4MVCA 5KTPA 3T41A 3UK1A 3NYWA 3AR8A 4KJXA 1KEVA 1Q1QA 1RR6A 2A2ZA 1PVVA 1U3GA 2NVWA 3QMWA 4JKOA 3RT1A 2BHRA 3ZGNA 4EFDA 3NVAA 5ECDA 1U0FA 3GUCA 2GCNA 1GV1A 4WI1A 1D4FA 4XYMA 3L82B 5FFNA 2EJTA 5A2GA 4DYDA 3W8EA 1ZLYA 2XE7A 3ZY3A 1I3KA 5THKA 4POOA 4FHEA 1COZA 2JLSA 2HU2A 1PIWA 2H6EA 3GHHA 5C18A 3FCOA 2FMUA 4TVBA 1TAHA 4LNUB 1KARA 2ZRNA 2DPLA 1BKYA 4P58A 1QH8B 4Y2GA 4EI8A 1BH6A 3D5TA 3RYHB 1Q91A 1N2XA 3Q8XB 1B23P 3CLTC 8AT1A 1GKYA 3AHJA 1WDKA 2BFOA 4URFA 1J7KA 1Z0AA 3C7AA 3HC7A 1A96A 4DG9A 4ROTA 1TMOA 4NYIQ 3T1OA 2DQYA 1TMKA 3BK1A 3D2AA 3OWHA 4FFMA 1Z7BA 5FOSA 2W22A 1AQ6A 1ECFA 3A0UA 3IR6A 4AK9A 4A2PA 5HUQA 1C30A 4FT2A 1S89A 3NTQA 4WXHA 2X9QA 3WWYA 2MSCB 1EA5A 4J49A 3KJNA 1LRLA 3NXSA 4H1VA 2D5CA 2BI7A 2JAOA 2VDQB 2ADMA 1ZD4A 4MW2A 4Z7JA 1ND5A 4QTUB 1WPRA 1XD8A 3E0XA 3V7NA 4E08A 1HR0B 1J2EA 5EMHA 2KS6A 3VH2A 1EGQA 3K09C 4PO9A 3I9OA 2VTBB 3CBQA 3R6LA 2VSQA 3BQNB 3W04A 3DTYA 4ZMBA 4EO4A 2OCGA 2WILA 1A3CA 1NJ2A 1NT2A 1J9ZA 4FHZA 1KVTA 1OZ0A 4Z8XA 3T7EA 1CUVA 4YJHB 1NMEA 4YNBA 4YPVA 2A9QA 5AHWA 4YRQA 3HVKA 1OIWA 4CU2A 4EAQA 4F3KA 2O59A 4JJ4A 1RTKA 3EVDA 1H1LA 4V2UA 2O0MA 5EUMA 2IHVA 1X8JA 2A30A 3TLZA 3GVIA 4UJ3A 3ZTYA 2ODAA 4CNQA 4GE3A 1PK8A 2QSJA 4IVRA 4MRSA 3DEKA 3C7TA 4LXYA 1TJNA 5GZ6A 3ZCQA 1H93A 1GEEA 4LI0A 1V3TA 2OD2A 1M8GA 3GN2A 1MIOA 1NXVA 1RHRA 1HXHA 3ZQKA 4YRKA 2FJPA 4QPJC 4AN4A 4DLAA 4CE6A 2WYHA 2ZWPA 1J1ZA 1FSGA 1R6BX 1YC5A 2AN9A 3SS9X 1E3IA 3PNYA 3PHJA 1RADA 1F6BA 2B0JA 4RPHA 5FPHA 1JA1A 4G5FA 1YHZA 4ZCLA 4I4NA 1Z07A 2K5UA 5LL6P 1OLSA 5AVOA 4CR7A 5SZKB 2X23A 1G3RA 2CXTA 4E88A 4B3SB 1KK0A 2HIHA 1JMYA 3LUCA 1R6VA 4JYPA 4BAZA 1E89A 4BNTA 1G7RA 1HE8B 3LUFA 5IDVA 2O19A 1AD2A 4A2CA 2WWIA 1QANA 2XBMA 3OMXA 4KV7A 1NASA 3OPYI 5DV9A 4Z9AA 2D0OB 2UVDA 4M87A 4QHYA 4HP8A 3QFFA 1E2QA 1XZDA 2QRMA 3GMDA 821PA 3R0VA 2CVZA 4LGVA 4DV3B 1W94A 1VJ0A 1H2ZA 3N7AA 4YFVA 3PA6A 4D9JA 1WHTB 4PTLA 4L8LA 5KS2A 1OBCA 1Y3DE 3QV1A 3ZWMA 4KAJA 1E3JA 1VCMA 1GPMA 1YMVA 4MQFA 4JYBA 2OB2A 2FE4A 1JKJA 3KFXA 4F4IA 4OOFA 5H3LA 5LLTA 3U81A 3HL0A 4RULA 3H3XA 4JP5A 3UHOA 2IOHA 4JX9A 2DLCX 4V38A 4BJ1A 5FLKA 1QE5A 1TT7A 2ZVDA 3BPSA 4R1PA 1IEXA 1MJGM 4FKZA 1N7HA 1OD6A 3FNRA 1XMXA 1PDWA 3Q12A 5CVVA 3U62A 3UMRA 1FYXA 1JSCA 3L93A 1FOEB 4LRSB 4ACAA 2V0GA 3IE0A 1ZI6A 1HFJA 1SGWA 1Y81A 4JWTA 4J3JA 4ARCA 4G0NA 1RLIA 2I03A 4JDUA 4WVFA 4C3VA 3NDPA 4NESA 2F64A 2QT0A 1X1CA 1FP6A 1FSFA 1BW9B 3IURA 1PR4A 4Y1FA 1I1HA 1U0EA 1YCGA 2G9VA 1OLUB 1XD2A 1DKNA 3KP1A 2FTKE 4M22A 3RLIA 1QQAA 5J5AA 2H52A 3F6PA 4UUPA 3UOWA 4A0RA 3QPAA 4WOBA 3OQ1A 4B74A 1JTEA 4AQ7A 1AV6A 3V7YA 1XU7A 4ROSA 5ECYA 2KMLA 3L7CA 1JEQA 2IV3A 4RSHA 1EESA 3MUEA 4ZVQA 4F21A 1OFUX 3JWPA 2QPTA 2QVBA 3SG0A 2AD1A 5IBCA 3G89A 5AR1A 2VHZA 1CUJA 1P19A 3CINA 3AINA 4KHPB 3S44A 1SVMA 1T9AA 3PUZA 1P0IA 3AM1A 2P2CA 3S7ZA 3A6PC 2GPNA 2O2YA 2QEQA 3H8VA 4F60A 4FWIB 4KQGA 3RC8A 1RYZA 5I8PA 4QUAA 3RROA 3M4ZA 2W6ID 2W11A 1Y8CA 4PZUA 3LY7A 1ZMOA 4FFDA 2AYXA 4WSOA 2Z2YA 1FUUA 1JAIA 1VYVA 4HQKA 2OBNA 1MBZA 4RD2A 1DBVO 1CUZA 1PFKA 3ONDA 4LNAA 1IE3A 4KNVA 4L5BA 3UAGA 1ADJA 2OKCA 3WYFA 3OLXA 4D3FA 4P08A 3KR9A 1MPTA 5AQEA 1NV9A 4OUKX 1NF2A 4F6CA 3U4MA 4N1AA 3P94A 1WS6A 4Y6QA 1CQJA 1ETUA 1RTTA 3NWBA 5EG5A 3QLTA 1XRMA 1CC1S 2ZITA 3COPA 3O8OB 5EA2A 2N3ZA 4K81B 3ETCA 3KT0A 2BZGA 4R8MA 4YJKA 1QUFA 3LCRA 4G4IA 2BGTA 1ZMXA 4TKUB 5DTEA 4EKYA 3L1VA 3SYLA 4FCTA 1R4NA 1RWBA 4HAUA 3T4UA 1QRRA 1VOTA 2PAFA 2V5UA 4Q9DA 2FCAA 2GGSA 2PT9A 2R8XA 3MMSA 3FF4A 1EK2A 4HTFA 3KPVA 2XTJA 4U7DA 2HWKA 2J46A 3TG2A 5CNMA 1E7SA 2P3OA 3HNRA 4UXHA 3H8JA 4WFQA 4K26A 3WQBA 5IYZB 5JXHA 4ZVMA 1OB2A 1CB7A 2X8AA 4JAVC 3EE6A 3ZHXA 2AS0A 5L8VA 2MYUA 2W2KB 4TKZA 1W36D 1J97A 4C0AC 5FD8A 1QV9A 1X13A 3EEQA 4FBGA 1II9A 3NR2A 4EQ6A 1RXUA 3E22B 4G2TA 4R7TA 3P7MA 3ZZ0A 1SUIA 2IT1A 4PPQA 1N57A 3O31A 1B42A 4WMLA 3RFTA 1SKMA 4BAGA 1Y8QA 5CB4A 3DLPX 4KQFA 1PZFA 3FSEA 1CF4A 1JHPA 5CB4F 1GG5A 2BMFA 1Q0UA 1K4KA 3OC6A 3IEXA 3WNQA 3NDBB 2I6XA 4UHEA 3K6SB 5A05A 1NWCA 4YB8A 4ESOA 2ZBEA 4GYJA 3ZNPA 1Z2OX 4M98A 1Z9BA 4ZP1A 4PYOA 5CITA 3TTVA 3ILYA 5C1IA 2H2GA 4DMRA 3TNFA 1JH8A 2B25A 2GJAA 4CU5A 4LQDA 4R2MA 4XVUA 1ILWA 4FE7A 1K8XB 3CZ5A 4ZT7A 4TV8B 2BFDA 3UC5A 5DIZA 5GGYA 3WTBA 3AL0C 2GXSA 2IZ7A 4BP9A 3F96A 3MWDB 1WP9A 4FCVA 2F3QA 3C15C 3CKLA 3B3QA 1RSZA 1DOZA 2IYOA 4DSNA 2X0KA 1SEPA 4HFRA 2WHYA 1SB9A 1U2ZA 3QKIA 3WAGA 2CXRA 4NYMQ 4PX5A 1TVKA 3R7FA 4D3XA 2TMDA 1I32A 4D4GA 5GAJA 1QOPB 3GQVA 3OAAA 4MS3A 3I1YA 4QPZA 3O9MA 1QLJA 2PYZA 3BCSA 4OHVA 1CLUA 1BRMA 1JA9A 5DP2A 4Z4QA 2HRRA 2YYAA 5J1TB 2JJ2A 1CTQA 4MR9B 2DE0X 1FFXA 3B9PA 3EXIB 2G9RA 2CHUA 4XVCA 2BDUA 3WICA 1WLSA 2QD1A 3K72B 1Y6GA 3AR4A 3QNMA 3BM5A 4GOOD 4NAUA 1B93A 3R0QA 4OMCA 4R6WA 1EAMA 1P3Y1 5MF6A 2KPOA 2ID7A 1U2PA 2PKYX 3BK7A 1X3LA 3OBBA 4ER5A 4RS4A 3DZJA 4PC1A 2QQ5A 3HWX1 4EELA 3EX7C 1VXOA 4UBLA 5PGMA 2G4VA 4KQJA 3RABA 4IH4A 5F12A 1OC2A 3IB6A 3GRPA 3C5WP 1FLAA 1V5IA 2IIVA 5KOIA 3H2SA 3VJRA 4JI5B 4ME6A 3KSAC 4G0WA 4YDQA 3MAAC 1RRKA 2WFMA 1N4AA 5BOVA 1T3GA 4BVHA 1W5TA 1L4FA 1HH4A 3NBUA 4G5QA 1CU1A 1Z73A 2CL5A 3K1ZA 1OI4A 5KVQA 3H6KA 3ZGYA 1ZNQO 1P6UA 2V9CA 4G67A 3SFTA 2AQHA 3ROZA 2ZJYA 5K99A 1WLYA 1OLOA 4KRFA 2YXBA 4B0OA 2YNMA 3OIGA 4UDOA 2V3CC 4I1RA 5K3CA 1CZUA 3CIFA 5IJWA 3OA0A 2ERYA 2F1HA 4DBLE 3M81A 4IMJB 4MUGA 1GL6A 3MWYW 4U7PB 4DRXB 3GEPA 1HE1C 1XTQA 4P4TA 1X42A 1EVIA 4P3KA 4HRXA 4YP6A 3S1AB 3LQKA 4FFPA 4PWYA 4WACA 1SIWA 1GUBA 2N46A 4RVGA 3AESA 3AM4A 3DFIA 3GAZA 1T0UA 3TLBA 3FTNA 3Q0EA 5IAOA 4IH1A 3EQ2A 1SR8A 1NVGA 3EA0A 2EL7A 2V7WA 1WEKA 3PUXA 4G86A 4YT2A 5JMOA 4N8EA 3UUFA 3FPJA 3A9VA 5D3ZA 1CHNA 1IHXA 3L04A 3NTOA 2O1EA 4NNOA 1ZGHA 4AJNA 5ALPA 4QYTA 1ZKDA 2MSDB 3PRYA 4EHBA 3VI4B 1FK8A 3CCCA 3T3MB 1D7AA 1J39A 1QGOA 1TVEA 2DBZA 3NCHA 4YH1A 1ZJZA 5E9QA 3HO1A 1XAIA 4IDFA 4QBKA 4XCQA 4GYYA 3N2IA 5M2QA 3THWA 4OXQA 3PDIB 4YJDA 4MW5A 2FZEA 2OCAA 3N59A 2PUAA 3FHTA 1UBSB 2GB4A 3A4MA 4LBZA 1I9GA 1LPOA 1Q0RA 1ZC4A 2WTAA 3ZXIA 5J4HA 2C1XA 3COZA 2J48A 1U6IA 1FUYB 4M21A 4Q93A 4WZAA 1WDLA 2BKLA 2A33A 2ZM6B 1AZSC 1KU6A 1WA5A 1ITZA 4G5RA 1DTWB 1XL0A 1ZNZA 4XXHA 3RVNA 5AKJA 4TLDA 2X7XA 4MVJG 4DEXA 1TM3E 4OHMA 1E3LA 5I5GA 4TL7A 4LF7B 3OT1A 4JYAB 3D1VA 4KVFA 2HMUA 5K3FA 5JZOA 3IQZA 4O1MA 5FTMA 3S1SA 1EVQA 3C3XA 2QB5A 2QLMA 4GG1A 4DC0A 1JR3E 4AKIA 4D4HA 3B82A 1U7UA 4PZAA 5BQXA 1OB5A 1QRDA 3WB9A 2XYRA 2J3HA 2AXQA 4DQ0A 3KEGA 2EYQA 2DF8A 2ORIA 5DHUA 3FYUC 2XWSA 2B4YA 4TS1A 1YAHA 5DHTA 1R7RA 5DW0A 1LTHR 1APBA 1AXRA 1MZVA 3FWHA 5A06A 4B7CA 3LL7A 3ZBQA 2GF2A 4Z1OA 3TB6A 3OE4A 1CJUC 1NMQA 2XT0A 3JX9A 5BSTA 2CFCA 5BYJA 4A0HA 3QHQA 2FU5C 3EZNA 1JKMA 2R00C 4B4VA 1YQTA 1MO2A 3MAJA 2C5SA 4E5MA 5J3JA 4P4UA 2WQ7A 3EJWA 2W6MA 1P2SA 3UG7A 5K0LA 1AQYA 2Z2ZA 5JDCC 2FSGA 3FZYA 3NHBA 4KWHA 5CVEA 3SR4A 3HJAA 3ROXA 3BMNA 1UKBA 4OI2A 4WKOA 1HMYA 3CRZA 2C83A 2G1PA 4X1KA 2JGDB 1NV8A 1OIXA 2FQQA 1TCUA 5CDGA 3JQ6A 3VHXB 1TOAA 1SJ9A 1HFEL 3IPYA 3RC3A 1YQ9A 3OFVA 1N6HA 5A7HA 1ACJA 3UZUA 2J4DA 1BA3A 1A5TA 3IJ5A 1UAAA 1W2HA 5IZ4A 2H00A 2XNSA 4QPPA 2GFQA 3MHPA 4X24A 4H16A 4FQ8A 4YALA 5JAZA 4AI6A 4L7VA 5FYQA 1EAYA 1C8VB 1ULHA 2Z95A 1A5ZA 4IFIA 3WXMA 3NBFA 1K6JA 3C41J 5JIBA 1DQZA 2ZZKA 3AK4A 4RESA 1IBSA 2VZ8A 5FBHA 1PK9A 3TF5A 4RC9A 1Q7TA 2X14A 3H11A 2D5BA 2GKOA 4AP9A 2B82A 2AXNA 3FNIA 2XUZA 1M6YA 3JAWB 2XYQA 4P33A 1G8JA 5E7JA 4QA9A 5HCUA 5DNCA 1RWQA 5B1IA 2WU3A 2C82A 2E4WA 4OVKA 1GXSB 1O97D 2YH2A 2BRUA 3O2NA 1RP7A 3U3RA 4YJ2A 2HPZA 2O2JA 3SP1A 4TGLA 1WW8A 4RDCA 2CLHB 1ZBQA 2QRHA 2UYGA 3DBIA 1RQNA 3ITKA 3JSXA 1EUCB 3N76A 3QMMA 4KW7A 5EKDA 4ZCSA 1N1EA 1S2OA 4E5PA 5KTRA 4FZ3A 2AE2A 1FRVA 2QM0A 2EZUA 4JP1A 4N6GA 3UO8B 4MVJM 4EITA 3O8CA 2AVDA 1NTRA 1ULZA 3VNAA 4GL4A 1INLA 2IXEA 2B4QA 3DMYA 3ANMA 2ZTVA 1KJIA 3PJEA 3V9AA 3WRWA 2IF2A 4EOGA 3GFQA 1M33A 5BN5A 1EFCA 1S2GA 1VHDA 2QLTA 1E2FA 4HGQA 3HDJA 5E9AA 4M0LA 3ZIDA 1JU4A 3DBVO 3WLFA 5IM5A 4FUQA 3TLJA 5HF9A 4DGQA 2BEVB 1QYRA 1MJ5A 3L77A 3T5AA 4JITA 4Z7NB 1KFJB 1RXYA 2E9SA 3KLPX 4M9CA 3RD5A 3WJAA 4DMHA 3T1NA 4REMA 1MAVA 2DOKA 3HRHA 4L4ZA 2X9VA 1UKZA 4MJXA 4PZZA 4PPGA 4Z9BA 3SAJA 1NQVA 4YT4A 5JMTA 1XNRB 3JYQA 4EZBA 4D9GA 2RKWA 1LDEA 1XQXA 3DT8A 3IKVA 2J9XB 4KPUB 1M2JA 4TOIA 3KKEA 3G6WA 1PFYA 1M0WA 2R25B 4UNPA 3HK2A 2AOTA 3FYUA 5IG2A 3RDPA 1EWRA 2JVKA 5IC5A 5C8ZA 2F9LA 4CYMA 1WY5A 1T9ZA 3L6CA 4XQEA 3E3NA 4TROA 2XXAA 4NI5A 4KX5A 5IJ9A 1QGUA 4WASA 3FPSA 3R7WB 4EJ0A 5BY2A 2ZUUA 4ADSG 1JIKA 1R0KA 2R00A 1GA4A 4BGEA 1QP4A 4KLCA 3KQYA 2GARA 4QVGA 1LTKA 2NVUA 1NX6A 4MQ5A 3RU7A 4NCAA 2GEVA 4UTOA 4QDOA 2W8BB 2WY2D 1IFXA 1G5HA 4QDXA 6PFKA 4RUKA 4QX6A 1M2EA 2BKXA 4UFNA 3JYOA 1H8HD 1QU3A 3F97A 3D3QA 5IKMA 2UXCB 4Q16A 5JD4A 2GRJA 2VOEA 3GFGA 4IRMA 2AK3A 4C2TA 3TN7A 1T13A 2ZJ8A 1OXUA 1XLTC 5DK4A 2VTDA 4K0RA 5J2TA 2WU8A 2OA0A 3LF2A 4AWAA 5K6AC 1EVLA 5HFNA 3LT0A 4DIKA 2H9AA 3HCNA 5J2TF 1H6BA 2RKBA 1EM8A 2GYWA 2VRCA 3G0OA 1Q19A 2XSZA 3LDFA 3RQIA 5LZ8A 3SSMA 1KVUA 2CMFA 3CB4A 3QVLA 4XKJA 2DT5A 5JZMA 1CUCA 3K0CC 5ESXA 3U61B 4DADA 4ZPXA 4ZAVA 1X6VA 3PXAA 4Q37A 1AS0A 4BV9A 3GLKA 4C0SA 5I3CA 2I6FA 2XBUA 2VCEA 2HFKA 3U4IA 1IQ0A 5HZHA 2GNPA 1NNLA 1ZM7A 3O26A 4V02A 4HBZA 4KQCA 4V0QA 5DDIP 4PRZA 3RHTA 4CQNA 5CJJA 4K5QA 2BGRA 3FJYA 3HYNA 3H7IA 4MUKA 3WI7A 4BO1A 1QC5B 1Y9DA 5T57A 3TLMA 4U2FA 1SBIA 1E1YA 2NZ8A 2XMRA 2XB2A 2P6NA 2P6MA 4BU0A 1URPA 4NCBA 4B33A 3H1FA 1NFFA 3EDQA 4G1UC 2CVFA 2QXYA 4WDRA 2BCJQ 3W5UA 1AK2A 4AURA 1KE1A 1YC2A 2G0AA 3ADDA 1FA9A 3OPYB 4BYMA 4CXMA 3GX1A 4M49A 1T4MA 2PZGA 1JLMA 3H87A 4YAOA 5H5JA 3O38A 3SBOA 4MCAA 3LLUA 4M1MA 5CXQA 1PQWA 1JQKA 2QZPA 4HDCA 4GZLA 4L8VA 3JQGB 2QVCA 2IPAB 3ULKA 2JKVA 5IXJA 2BI4A 4XDYA 2MYTA 4CKZA 1EFTA 4BVBA 1V8BA 1W6RA 3NTXA 3FTCA 2QTGA 4OMFG 4IRXA 2CB9A 3CW2A 3DVSX 5IKEA 2WSSA 3CVOA 3RVLA 4LXHA 1XU4A 3TPCA 3ZCPA 3KUUA 4DBLC 4YI5A 4A3SA 2CZGA 4QOSA 1EUDA 4ZGBA 1D0SA 1JJFA 3KTFA 3QXJA 3TGWA 5A4IS 1ZGJA 3ACDA 2G6BA 3OKCA 4S24A 3G9ZA 3H0EA 3T94A 4LJYA 1Z2AA 3T4EA 5FLXA 2CCJA 2IW1A 5CDTA 5JU6A 3M6MD 1S1MA 2Q3HA 1E1NA 4DXHA 1X7WB 3PQDA 4MVJE 1RLMA 5TEVA 5IU6A 3DR5A 1V35A 2GZ2A 2UXBB 1IQUA 1WTAA 2XQGA 2IYZA 2YHIA 1HBJA 3BYZA 1NQAO 3HADA 3AFIA 1YB7A 1PDOA 3ETNA 1A9TA 1OGYA 4ZVRA 3ZX5A 1VMIA 5KCMA 3THOA 3W4JA 4PYMA 2YUIA 2VBIA 3S6JA 1E5TA 5J9FA 1CEYA 3PNSA 5DCLA 1GSHA 4IFBA 1T9GR 1FE8A 2AYYA 3CF2A 1EFAA 3KBBA 3D64A 1FSPA 3MWLA 4HLCA 2VAXA 5CJPA 1O97C 1YCDA 3R9XB 3NHJA 3BJEA 1NC1A 1SOVA 1GQSA 3T7RA 4H4EA 4RWZA 3ZNOA 1NOKA 1NLMA 4RTLA 4EF5A 3CNEA 1K66A 1E2LA 4Q4AB 5AJHA 5GQSA 4TYNA 1XIVA 2J5BA 6LDHA 4ZIRA 1JS1X 4IJVA 1XLTA 1XMPA 1CERA 4DSZA 1IHDA 1L4UA 5BT9A 3NIDB 2Q1TA 3D3JA 3ME5A 1RCTE 3LJKA 3RE1A 3D6HA 1WXXA 3GZNA 4RKRA 5BSMA 2JC3A 4PXAA 4B6SA 4BX9A 3RNOA 1P1RA 1V2GA 3RUFA 2Y0BA 4PBSA 4EYGA 1MJGA 1L7AA 1GRCA 4RZIA 3WBJA 2OHJA 3K0CA 4PZCA 1IXSB 1XRQA 1J0BA 1DT3A 4U4AA 1T8WA 3ZHQA 1V4BA 1C1DA 3LBNA 1YRYE 1Q22A 2ENUA 3HKBA 5KEIA 2OQ2A 4TMYA 3S55A 1WJGA 3KVVA 4BB5A 4DY6A 4FWTA 4PEVA 4TLAA 2O23A 4U2DA 1CULC 1RQXA 4EJ6A 1Z8FA 1YIOA 5ERXA 2IYWA 4XWTA 1C3OA 4LZPA 1QBKC 2IYAA 1QONA 2RK4A 4OM7A 2Q3LA 3CCBA 3D4NA 5CBPB 4Q1BA 5E8JA 1SCBA 1JU9A 2WM2A 3L6UA 1RYBA 1U9IC 5EZYA 1Z6ZA 3UGQA 2ZZNA 4DC9A 1NRJB 3NM5A 5EZYF 4CCSA 2YQ5A 1BROA 3WMRA 5HIKA 1V1JA 2DUJA 2IYUA 3HUFA 4PWZA 2O8FB 5JPDA 3ZCSA 4OX9Y 4U7WA 4F1WA 3K9LA 3FNGA 3QU5A 4FOPA 2YMPA 3HKCA 1IULA 3OUTA 1OE0A 3GPCA 1IHPA 3DPIA 1KI2A 1UEXC 1YDFA 2CJYA 1QH0A 3FAZA 4TV9B 1CY4A 1HT0A 2RGNA 2ZJBA 1FQOA 5KVCA 4EMTA 6YASA 1C50A 1GRQA 1JR6A 4B6EA 5ES4B 2H7CA 1T0JB 1GL3A 1OZFA 3PL5A 4CQMB 3TJRA 4E0BA 1XG5A 1T5BA 2XA2A 3PFFA 4HAIA 1I6MA 5TMBA 1VSTA 3DB2A 2XD4A 4Q4JA 2HA2A 1P5HA 4K9DA 1JVSA 1Z0KA 4RA9A 4EGSA 1XEFA 6REQB 1Y3FE 1P2TA 4YBZA 4ZCTA 2G09A 2VF7A 2UUBB 4NK5A 1PL8A 5LQRA 3LCJA 4F04A 2ZI7A 4WD3A 5E8RA 3VX4A 3LE8A 5CDSA 4DM3A 1ZVJA 1JZQA 3IP1A 2X0RA 3OC0A 3OZDA 1SXPA 2Q4TA 1ECLA 4C89A 4ZKDA 3G8CA 1SC3A 2QUIA 3FOCA 4QD3A 1TB4A 3FNHA 3O93A 4FYXA 3GLHE 2BV3A 1CCWA 2BMAA 5CEJA 4UVDA 3TQTA 4HCJA 1U3VA 1VFNA 1A5SB 3DAYA 4Q05A 3WQHA 3OZBA 4LSZA 2CXNA 1Q1EA 1E9FA 2EGUA 2XUIA 1CJKC 2WIKA 1E1QA 1CUDA 3UXEA 3ZWKA 4B09A 4C4OA 3D0OA 3VV2A 4EM6A 1GUFA 4PM4A 4QQKA 5BN1A 2E4ZA 1IJFA 1JXOA 4RD3A 1B41A 5JJBA 1N2EA 1RMTA 4M7WA 3KM0A 2B0CA 3KT8A 3N7UA 3BL5A 1ZJYA 3DFZA 4Q5IA 7ABPA 1MX1A 3QJYA 4KQHA 1ZYUA 1JHMA 3AIMA 2E1RA 4JYMA 2UZ1A 3HN2A 4DA7A 3ORHA 1EM6A 1GP2A 5ENDA 5EKSA 4HNUA 3D6MA 5B2FA 3NTVA 3EFOA 3TTWA 2Q0XA 2PKEA 2P6UA 2WMYA 2J9FA 2Z5FA 3O92A 1DRWA 5KNDA 1T2VA 2FP4A 5JPCA 1U8CB 4ZDIA 3A1TA 2ISQA 3FN4A 3L7IA 3OKPA 5CU7A 2FWAA 2UZ3A 3B13B 1JR3A 4QAJA 2PUJA 2HNKA 3UICA 1FLVA 1NN5A 3EMBA 4FI3C 2AT1A 4U9UA 4LJRA 4FOSA 3C43A 4MI3A 3VSBA 4CKWB 3KYCA 3UPTA 3ACCA 1JIIA 4GSLA 4O5OA 4X90A 1W9MA 2O7QA 5JNTA 1YFJA 2D0IA 3L7LA 4YUXA 3S2EA 5FB3A 5B58C 1NQUA 1UEIA 4M9QA 4D98A 1H4SA 5GJBA 3DHNA 3EGIA 1N2HA 3LV8A 4BIIA 4IHJA 3BB1A 4KH1A 4R9UC 3VO8A 4BNZA 3TWOA 1UT6A 3VC7A 3HA2A 5JPIA 3W78A 3JQEA 4OQFA 1TF2A 4IHJF 1U9IA 2PDAA 1WE2A 5JLAA 2ZRJA 2YZ2A 1T2CA 4FKMA 4GXRA 4ABTA 1KU0A 2H1OA 3NT2A 4LVCA 3FUUA 3Q40A 1Z29A 1UKAA 2BM1A 4MQMA 5GONB 4HQRA 2C2WA 4D96A 1ZI9A 1MA0A 2FR8A 4RK7A 4H35A 4LWZA 1NQOA 3SKXA 2KM1A 4UDNA 5ADVA 2GTHA 1GG2A 3EQZA 4R71A 1LPSA 4MP8A 5EQFA 3VU9B 2X76A 1BDBA 4F4UA 3IRVA 3QLUA 3R76A 4C7OA 2RHHA 2VJMB 3D3EA 3JYHA 1LNQA 4BZWA 5BN4B 3MOSA 4PC2A 3PF9A 1AGXA 1Z82A 4YK7A 4KBYA 3UJDA 2OGSA 4RKWA 2ZRQA 1L5GB 1F0YA 4AF6A 3MQFA 4Z51A 4JBIA 4ZVOA 1Z5GA 2G5PA 4BO2A 4PANA 4PYJA 1CJMA 2ZJ3A 2EC5A 2RHWA 2FSFA 2VL7A 3O3NB 4GFDA 1DFIA 2IP2A 1CR6A 2PGJA 2YBDA 3HU1A 5A0TA 1EHYA 3GUZA 2JEZA 3OTOB 7REQB 2VBGA 4GZMA 4IQGA 1SUCA 3ZDYB 5EZ5A 3EMDA 3CUWA 3OA2A 4ALNA 4FS8A 3GEDA 3BA6A 3K9CA 4ZVTA 5IC4A 2XUGA 1FP4A 5G53C 1RKXA 5JSHA 4WN9B 2ZSBA 5LFAA 2JLAA 1ODKA 3X44A 1FU8A 2IIQA 3WG9A 1JXAA 2WMNB 3G7NA 3QXXA 3ZDEA 3DKVA 1XA3A 1YOVA 4I9GA 4MIKA 4ZGWA 3H13A 4Y2QA 5L4NA 1D8TA 4TTIA 3C5CA 2PMEA 1EFPA 1K97A 2E5WA 3RK1A 1P7PA 2QZ4A 4KQMA 3BA1A 2PJRA 1MKYA 3VKHA 4AMUA 5CLQA 2UYHA 3OT5A 1C5KA 1JB9A 1PQYA 4AZSA 1DRKA 2V7UA 2B20A 1CZNA 1PT7A 1CXZA 3HYCA 2VTVA 4UD6A 4V0LA 4EZIA 4CLOA 4FWBA 2RCYA 2GYUA 3L1KA 3Q6NA 3ZE9A 2OM6A 4BAUA 3EPKA 1YS9A 1K68A 4XGKA 2CLMB 2HDHA 3ZR4B 3RR2A 4ZEMA 2W83A 2BTOA 3EYWA 3B8HA 3QNUA 5JAIA 1C14A 4XSVA 3OOJA 5DNDA 2WF6A 1LI4A 3NHRA 3I8XA 4XEUA 3D7KA 2EF0A 2PBRA 2ZE8A 3PR2B 4REOA 2HMVA 4LYFA 4W4TA 5DGCA 3QOFA 3HJGA 4FNGA 4MVXA 1BCRB 3FGPA 4PO1A 3VO1A 3QJ5A 1I10A 5JC1A 3RH0A 1WDWB 1AHHA 5I4KA 3LKZA 3IXMA 3CW9A 1P1CA 3IUNA 4N5MA 1Z0DA 2CK3A 2UUOA 5BWNA 4NATA 5FKJA 4EARA 4YP0A 3RYTC 3AI2A 3QGMA 5I9SA 5KMGB 4L9RA 3I6MA 1RVV1 4OKNA 2PMFA 3IVCA 2XCQA 1Z37A 4W5QA 1B00A 3ERCA 3HACA 1Y3IA 5ITSA 4DDWA 4GX0A 2PSJA 3WHKA 3GFSA 1XDBA 2QV7A 2QMHA 5C32A 3O5AA 2H06A 4JI1B 2ATEA 4BV8A 1ESDA 2BM8A 4V0MA 3GJYA 3Q3CA 1RCFA 5EPOA 2ACVA 1RE0A 4MW0A 4G07A 1X3SA 1ZUNA 1C9MA 1SUSA 1BFDA 1RJFA 3HFSA 3J81k 1PQ4A 2R7LA 2ZDGA 2P40A 3D4OA 4RHTA 3QVVA 2ACWA 2HL6A 5D51S 1N34B 3T9DA 1DI0A 1XT6A 2X9GA 3GFFA 4RKQA 4EYQA 1E3EA 2IYQA 4XYLA 2ZANA 4WW0A 4TMWA 3DDCA 3B85A 5EJMA 3V8VA 1W35A 1G5IA 1DXHA 4DQVA 2IUEA 2IHTA 3BZBA 3I2HA 3TR6A 2EARA 1NHWA 2F1IA 5KJ6A 4LJ8A 5ABPA 1JQDA 1KKLA 1YQUA 3AR6A 3D3WA 1GR0A 4Y7CA 5IT5A 4RF3A 1JU3A 2I4TA 3O84A 4OIMA 5G0UA 4LYGA 2Q5FA 3AI7A 1C3EA 2ON6A 4IPTA 3ZZNA 3PJDA 1PFGA 3AF2A 3JRNA 3RJ5A 2FMXA 3WZLA 2ZIFA 4QYIA 5T64A 2QN1A 4D26A 1RI5A 3F3MA 2FG7C 3BFVA 3ZWWA 4XDZA 1P1BA 3I8OA 2KBEA 5I01A 3K31A 2HAEA 2CF6A 4X91A 2QN8A 1NXQA 1TKAA 1UH5A 3R1IA 1VSUA 4OBXA 3TOZA 1BAPA 2VSOA 3LUBA 4NRDA 5IS2A 2X3FA 2ZSIA 3ICVA 5TRTA 4NCHA 1FUIA 2CFSA 2I7VA 1E1CB 4R8LA 3VAYA 4LMRA 4DQXA 2DUNA 3TPZA 1T3TA 3OQBA 4DZTA 5FOUA 3QKUA 5KHOC 2PX6A 1ISMA 1CS0B 2FN9A 2RGAA 4P80A 3RB8A 4MV3A 3D8UA 1W1WA 4IQ0A 3U4QA 3BICA 3LCUA 1S8OA 2WZQA 2A86A 3CUTA 8LDHA 5JT1A 3N86A 4FFSA 2DAPA 4MQ4A 1U28C 5U4XA 4E5DA 1QIEA 2VG8A 5B3JC 3U6BA 1X94A 4NBSA 4WGGA 4KXMA 4MVJA 3TRJA 3QFRA 2IL1A 3E2IA 3VGJA 1OZGA 3M4NA 1IY2A 2FSHA 3OOWA 4MVJF 3NWJA 3T6KA 2CE7A 2EWVA 4MWGA 3K9QO 1TYBE 3AOEA 3C7KA 4MIYA 4EEXA 4X44A 3EPLA 4TRJA 1J00A 2AB0A 3JWIA 2X9LA 3FKQA 4WCVA 1XTZA 2AUMA 5I7EA 4X66B 5KOHB 5JMPA 5DT9A 3TD9A 4O2BF 1THGA 2FW0A 2PX0A 2WWGA 5BMVA 1V41E 1BXGB 4Y0NA 2EWWA 2LVBA 3ZE2B 5BMVF 1W59A 2CB0A 2PXAA 1R0CA 5FO1A 1VBNA 3PF8A 3V42A 4K2AA 2V7QA 1DBQA 1T8PA 4P54A 1EQ2A 1VL5A 4EHKA 3OJCA 2WQ6A 1U3UA 4G63A 3K8OE 3ETLA 5DXAA 2RH4A 4KL8S 1KY5A 4FFBA 3AFHA 3VPSA 1PJ8A 3QVOA 3I9V6 2EDAA 4NCIA 2XDQA 4P7KA 5KYUA 1T0IA 1CHDA 2G88A 3GYGA 4BV3A 1PZNA 3R5FA 4MWBA 4B3JA 2QKYA 4Z4GA 1TM4E 3VX3A 4DHWA 3HEAA 4LIPD 3MTEA 3G8DA 4QEZA 1FVFA 2QL7A 4CLEA 2YZ7A 3V8RA 1CY2A 4NIMA 1Q0HA 1DKQA 3I9JA 3WFIA 4EP1A 2F4NA 1FMCA 1ST2A 3DEJA 3E2MA 3DMGA 3EZYA 3GRCA 5FTKA 3UT5A 5JZ9A 1WKVA 2XQKA 3GIWA 1V3UA 1JYSA 3DW3X 4I5GA 2HCTA 4LJ6A 1GTSA 5JYCA 5FWXA 1NWHA 4PZ9A 3ZW8A 2VDVE 3MQ2A 1ZJWA 1M2GA 4I50A 3T9EA 4BO7A 1JHUA 2IH2A 1U65A 4X6YA 1H2XA 3FHOA 4I50F 4P5PA 4B3MB 4L9SA 2LRHA 1L9XA 2PX3A 1DPGA 3BK2A 4PPYA 3DLIA 3ODGA 1MG0A 5E7IA 1N36B 5B3AA 4KLRA 4XI9A 5JQGB 3UKJA 1QSGA 3QF4A 3KSDO 2A9JA 4M0DA 1I36A 2BF7A 2R6FA 4EKEA 1EUQA 1RVDA 2WA1A 5A9TA 3MGCA 2EGHA 3PFBA 2WNSA 4ITRC 4L27A 2EKPA 4WKBA 5E6UB 2Q41A 4DABA 3PXCX 1A95A 3RHSA 3PC3A 2ECFA 5CA0A 3ZWOA 1DC4A 4XWGA 1QV7A 3C3DA 1B8OA 4EJ2A 1ZK0A 5EZQA 3E5MA 3ITNA 1WBJB 3UMFA 1YBMA 4MR8A 1RJ9B 4NEGA 1K5PA 3QKWA 4N3CA 4BL5A 4K05A 1G41A 1BZYA 1V95A 4UQPA 3RVMA 3QBEA 4LFBB 3KQVA 3QA3E 4HI0E 5EZ6B 1AB6A 4XOIA 5BMOA 1L8OA 2E48A 1QLHA 3O3CA 4B6FA 1Z0ZA 2P0EA 1PT5A 4RCZA 3DF7A 4R68A 1ZVMA 1UM9A 3VSCA 5JS7A 3B9BA 2R8OA 2E7ZA 1TMYA 4PHCA 4GPD1 1YE3A 3K96A 1E9EA 1H2WA 1QG0A 4YTEA 5DM2A 5B3JA 2IEIA 3QLVC 3T1YB 2NU6B 1Y3AA 4I9FA 3CTMA 3M49A 4IF6A 2MINA 4IX9A 4O25A 2E49A 2GFIA 2YFKA 1BE0A 1W48A 2IZOA 1B4DA 2HRCA 2W0SA 1GZSA 3BGDA 4NOLA 3IMEA 3PLAE 1FNCA 3DJFA 3EGXB 1JDBB 4JR1A 5K0SA 1HLPA 2FVYA 4NG4A 3MRTA 4AFNA 4QT4A 3LLMA 1A7KA 4YRTA 4ZJYA 4JI8B 4PYIA 1XDGA 3F1LA 5FOQA 1TA4A 1U4SA 4B5LA 3K5HA 1D8AA 4A10A 1KYTA 3LT4A 3F3SA 1JQ3A 1R50A 2JGLA 1Z4KA 5HWSA 2HF7A 2JI4A 1R1DA 2BEJA 3AHEA 1A0OA 4OI4A 3RTBA 5CFMA 1V48A 3KQSA 3P9SA 3RAPR 4N4AA 3VNRA 4I5FA 4N8DA 1HUQA 1LDYA 2W2OA 1MPXA 5FI5A 3UBTA 1YTLA 3IXQA 1IXKA 3FLEA 4CCYB 2RHRA 3N05A 4EAAA 2NYRA 4U5XA 1PI3A 4R4JA 1U0LA 1E2MA 4AJ2A 2P9BA 5FNVB 2XYGA 3KXKA 1GPKA 5JRJA 1LV8A 2GERA 4G8DA 1NPTO 3CVWA 1M2HA 4K9SA 2NO1A 2Y1GA 3MF4A 2IUUA 1P3JA 4JS0A 4B4KA 3V32A 1JKXA 3DL7A 2PZFA 1FW6A 1I7QB 3TVTA 2GEKA 2DVMA 4FC6A 3VGPA 1I9CA 1M7GA 1N2BA 1QH8A 2Q3DA 5ED4A 4B3XA 3QWFA 5I7UA 1X8XA 2FEOA 2R86A 1FY2A 5EZSA 3BWXA 4ZT2A 4HXFB 4ARIA 1E32A 3BSYA 5KYVA 1JQJC 1IQPA 1FTWA 1IG0A 2F9FA 3OX3A 4K9PA 4KXWA 4QTTB 4HNQA 1TQHA 3VHLB 2XAUA 1XTJA 1NXPA 3SHWA 3HWRA 2H3EA 1JIJA 4KXYA 1XVUA 4H3SA 4J2TA 2E0IA 3N39C 3D7RA 4JMLA 1US8A 1WL8A 4DS3A 4LOKA 4H4CA 2PGXA 2IU3A 4ISBA 3SWWA 2BBTA 2NUTA 5LDDC 3R3UA 3P2JA 4G9BA 1R4MA 4OJYA 3QI7A 3SSAA 3U60B 1JWLA 3OE7D 5BV8A 4RVFA 3D5QA 4BKMA 1GQQA 5JO0A 3MBIA 1AV7A 1Y4SA 4PLVA 4XD7A 5FTLA 2IUYA 1FP1D 1PJQA 4X54A 1E7RA 4AY6A 3IPAA 3D59A 1DPFA 1CY8A 1ZJ4A 2XWJI 3I53A 2GHIA 3UGKA 3V4ZA 1E1KA 2HLHA 2I34A 1H2RS 5FPQA 5IUNC 5LP6A 3MAGA 2C8KA 1FNMA 2VTBA 4R51A 2G4CA 3BREA 2V1UA 3V2UA 4NABA 4C6SA 4BB0A 3LLVA 1GAQA 1TCBA 2OFPA 2DWCA 3VR5H 1E4VA 3V2GA 1TIBA 2OD9A 1UR5A 1MEOA 2JIMA 2MYPA 2JCSA 1X9GA 3EVCA 4HWGA 4TSFD 4TXJA 5B58T 3V6LA 3Q3HA 3KOZA 4LRQA 4YJHA 5F1KA 3QLVA 4C22A 2WHQA 1HM5A 3O83A 4GYWA 3C7CB 1E58A 3PGVA 1PS8A 2A59A 3EULA 3OP4A 4MDHA 1OGJA 1YZKA 1FXWA 3M6FA 3ZDXB 4ETNA 3I28A 5EQTA 1KEKA 1WETA 2F8TA 1M75A 4BBJA 3ZLUA 2G1KA 1VG0B 1FXWF 4M53A 2BSXA 3VR3A 1ADGA 3RS4A 3GQBB 3R3HA 3UV7A 3I0MA 4NHOA 3FJ1A 2A57A 4BE7B 4X65B 3O1HB 1A27A 4IZIA 3RRZA 4DM7A 4OOEA 2YXDA 2C4WA 2QAIA 1WZEA 4JHLA 2Y66A 4X71A 4BVFA 3O1LA 3K0FA 3ZVLA 3FPFA 3GJTA 1FFHA 5KJFA 3AF5A 3P0EA 1TZJA 4H7FA 4YAFA 5F2EA 5BWCA 2AOXA 2CXHA 1Q84A 5JCJD 3NHLA 1E0SA 4M1YA 4ZEWA 1QVAA 3USZA 3NANA 2HB6A 1DIRA 1NTOA 1ZW6A 1HZJA 2PVSA 5FX2A 2PUWA 5KINB 2XXBA 3U48A 4GR5A 3EXG2 4LYAA 4DIBA 3NKFA 4E2XA 1OX6A 3PPVA 1L5HB 1YIDA 3G9UA 3L7MA 3DLCA 2QAGB 2I2CA 1P2BA 2G4LA 1ZDMA 2W6JA 1YSCA 5HM6A 2KI5A 1QO0A 3LC2O 1MUUA 4AMGA 5I7SA 1YI0A 2EFYA 2LIVA 1TO6A 2DULA 4HK4A 2X2OA 4RXUA 5FOXA 3BWBA 1DC8A 3FVTA 5HILA 2DR0A 3IAEA 4O02B 4LKOA 4R2JA 5FUQA 3PKIA 2O4UX 4YCMA 2NV0A 2QUAA 3OD5A 4BOYA 1WCYA 2XITA 1TUIA 1KYZA 1GQYA 4KR0A 1GZ3A 2WPNA 2ZRKA 1XFDA 1L4GA 2CNKA 4R9SA 1WZ2A 1WHSB 3NCTA 1A82A 3COWA 3NWPA 1EFRD 3HJUA 2PQ6A 1WXFA 1PW5A 2WJJA 1M0EA 4JHXA 1UJNA 5IMSA 2Z3WA 3TLGB 4BE4A 1J8DA 2J3QA 2Y1FA 3GOQA 3IILA 4WADA 5TXGA 4A5SA 3KXIA 2DTDA 3EWAA 5FFMA 3MVEA 5DISB 4I46A 3GJ0A 1CDEA 1BW9A 3E53A 3ZU2A 1YT5A 1T6YA 3EMVA 1EFLA 1OLUA 3FZNA 4TPKA 2VHWA 2E18A 3L4KA 4KLZA 1ZK1A 3ZC3A 5AICA 721PA 4LWQA 1MOZA 1YL6A 4UFPA 1CF9A 1EVZA 1TEVA 4O29A 4QHSA 4EGQA 3NTLA 3FOBA 3BH7A 4FLMA 1CDZA 4CMEC 4HFMA 3SQWA 3RVOA 2PUGA 5EXTA 3RYFB 4YPFA 2YJZA 4BPRA 5F2KA 3I2KA 3UWDA 4C20A 5FBZA 4GL2A 1ESEA 2B1GA 4XLTA 2OPHA 4MAFA 4G5HA 4O33A 5TPZA 4X61A 4YLEA 3WQSB 2PEYA 1SKBA 2WM9B 3UATA 4D57A 3OE5A 3ZHBA 3KTOA 2VNAA 3H17A 3LXRA 2NSDA 4HDQB 5EJ9A 1ENZA 1L4MA 3D8RA 2BWJA 3ZUGA 3H75A 4LVOA 3ND9A 2BJVA 5JYDA 1K8YB 2P9YA 3ETEA 2JFXA 4NU8X 1QTRA 5BV0A 2XNDD 3EODA 3LX6A 4U7TB 4WBNB 3AUUA 3KUKA 1NOIA 3QG1A 3TB4A 4JR2A 1ZU5A 4U0KA 4OX9B 1XUOA 2W2TA 4Q6WA 3IHLA 2HLPA 1KR5A 3DDUA 3PNMA 1JJVA 1FLNA 1E2PA 2ZIXA 1U7PA 4QASA 5D6OA 5DI3B 1VDMA 4U2CA 4L1KA 1QYWA 1C0PA 2MOKA 2QORA 3TM4A 4BKOA 1ZCFA 2D5AA 4LMBA 4TKUA 1JBEA 1YV9A 2AK2A 4FTWA 1JI0A 1RZRA 2I2XB 2PH7A 4B4OA 4ZI5A 2GRAA 1BVYF 1BN6A 1R0RE 1SC9A 4HDRB 5IHPA 2CNBA 5F9HA 3AY0A 4EYEA 2GUWA 4J6EA 3OZIA 5IYZA 2WAOA 3Q1KA 5F7ZA 2W2LA 5EMNA 3UQYS 4L5YA 5EIOA 3W1EA