2P4SA

Structure of purine nucleoside phosphorylase from anopheles gambiae in complex with dadme-immh
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
YTYDTLQEIATYLLERTELRPKVGIICGSGLGTLAEQLTDVDSFDYETIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHINLMGFAGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGIENELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEEEEHCHDSIVGVGKNREKTLGEFVSRIVKHIHYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Anopheles gambiae purine nucleoside phosphorylase: catalysis, structure, and inhibition.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transferase
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2p4sA00
1RCTE 1U1FA 3O4VA 1VFNA 3UAXA 1V3QE 4NS1A 4G89A 4OJTA 4GLFA 3E9ZA 1SD2A 1A9TA 1C3XA 1V41E 3QPBA 1JE1A 1U1CA 4D9HA 1RXUA 4F1WA 3OCCA 4TTAA 5F77A 4WKBA 5C80A 1Z5NA 2IQ5A 3UAYA 1Z5PA 4QATA 1T0UA 4R2WA 3KVVA 4QAQA 4BMXA 1JP7A 5KB3A 4D98A 1Y1QA 4L0MA 3P0FA 3EMVA 5F7OA 3OOEA 5CYFA 1ODLA 3FAZA 4OGKA 4WKOA 4TTJA 1QE5A 2BSXA 3KUKA 4R31A 1PWYE 3INYA 4E1VA 3NM6B 2P4SA 1ODKA 1ZL2A 1RT9A 1Z36A 4OF4A 4DA8A 3GGSA 1RSZA 2PGAA 1V2HE 5F76A 4QEZA 2QTGA 4DA7A 1A69A 4R2XA 3IEXA 3UAZA 1VHWA 4WKNA 1Z35A 3KVYA 2AI3A 1PR1A 1RYZA 4F2PA 3F8WA 1A9SA 4BMYA 3OZEA 1FXUA 3D1VA 5CCEA 4PR3A 4QARA 4DANA 1YR3A 1WTAA 1PR5A 1VHJA 1OU4A 5IFKA 1RXCA 3K8QA 5JPCA 4U2KA 5IU6A 1RR6A 4JWTA 1JPVA 1ODIA 1TCUA 1B8OA 4JOSA 4TS9A 1A9OA 3K8OE 3BSFA 1OVGA 3ENZA 3U40A 2QPLA 4QFBA 4TXNA 3ODGA 2Q7OE 3DJFA 4RJ2A 1PR2A 4OY3A 4M3NA 2I4TA 1Z38A 1ODJA 5K1ZA 4TXLA 4DAOA 2GUWA 4UC0A 1PR4A 3GB9A 3OZCA 3BL6A 1ZOSA 2OECA 1CG6A 4P54A 4MARA 1PKEA 5CXSA 1OV6A 4KN5A 3SCZA 5F7XA 4L6IA 1JDUA 5EFOA 5F7ZA 4ECEA 4YJKA 1Q1GA 1PK7A 4YO8A 3BGSA 5F73A 5EUBA 1TGVA 1T8RA 2ISCA 1PF7E 1Z33A 2A8YA 1JYSA 3DP9A 3EEIA 1B8NA 4LNHA 1T8SA 1SJ9A 4QASA 3FNQA 1PR0A 4NSNA 4TXMA 4FFSA 2A0WA 4TXJA 4G8JA 3NM5A 2OC9A 1JDZA 4L5YA 4YNBA 1SD1A 1ULAA 1LVUA 1M73E 1A9PA 1I80A 4LDNA 3UAVA 3TL6A 1Z5OA 3IOMA 3PHCA 1CB0A 3FUCA 3T94A 3DPSA 4GMHA 4OEHA 1XE3A 2B94A 5B7QA 3ONVA 4D8VA 1PK9A 1RXSA 3FOWA 1LV8A 4LKRA 3OF3A 2H8GA 5DK6A 1Z39A 2XRFA 3PHBE 2HWUA 1YQQA 4MCIA 3EUFA 1OTXA 2A0XA 3E9RA 4G41A 1Y1RA 5B7GA 2RJ3A 1OTYA 3BJEA 4F3KA 4LZWA 1T8YA 1U1GA 4TYMA 4EB8A 1U1EA 1JDTA 4D8XA 3NM4A 4GLJA 4DAEA 2OC4A 4BMZA 4OGLA 1YQUA 5CXQA 1TGYA 4X24A 1Y6QA 1JDSA 3KU4A 4D8YA 4L5CA 4L5AA 1NC3A 5B7NA 1ULBA 3NBQA 3OPVA 1NC1A 3MB8A 1OUMA 4TXHA 1N3IA 3LGSA 4TS3A 3PNSA 1V4NA 1NW4A 1Y1SA 4IP0A 3KHSA 4WKPA 4LNAA 1U1DA 4M7WA 3E0QA 4GKAA 2A0YA 4NY1A 1LX7A 4BN0A 4DA6A 1PR6A 1K27A 1Z34A 1G2OA 1TD1A 3OZDA 4F3CA 3C74A 4DABA 1T8WA 4JP5A 1Y1TA 2AI2A 1Y6RA 3LA8A 5ETJA 1V48A 2HSWA 1Z37A 1SQ6A 4WKCA 3P0EA 5F7JA 4YMLA 1VMKA 3FB1A 1YRYE 5CCDA 4DA0A 1A9QA 4PNPA 3FWPA 3PNPA 1RFGE 3DF9A 2ON6A 4H1TA 2OXFA 3UAWA 1JDVA 4K6OA 1TCVA 1V45E 4TTIA 4EARA 1JE0A 2HRDA 3EUEA 3DDOA 1K3FA 3O6VA 4M1EA 5EPUA 1YBFA 3MMSA 3UT6A 1ECPA 2HN9A 1RXYA 5FAKA 3OOHA 4DARA 3LBAA 2QSUA 1K9SA 5I3CA 2AC7A 1PW7A 3OZBA 5CYGA 3KVRA 2QDKA 2I8AA 2QTTA 1PBNA 4MCHA 1A9RA 4I2VA 5B7PA 5F78A 2AI1A 4F2WA
chains in the Genus database with same CATH superfamily
3BX1A 5I8ZA 3G85A 1CIPA 1HTBA 2HA0A 3QE0A 1L9KA 1XCBA 4NG5A 4YBZA 1U81A 2AKEA 1J23A 1EZ4A 1ZUHA 2CE7A 2NXWA 1D3AA 1CIVA 1JJBA 2XQJA 3HY3A 4OJTA 1F3LA 3EGEA 3DWIA 4M1KA 2E5LB 4MJ7A 5JJKA 2O54A 2P1ZA 4HMOA 4ZJYA 2WU8A 3HZRA 2ETXA 2RGEA 2RI0A 5CAEB 4BIMA 5FNVA 1YI1A 1XZDA 1JIQA 1O4VA 1W49A 1C0KA 3D3KA 4PZDA 2BEKA 3PFNA 3TH5A 4M22A 3SMQA 2C88A 4H77A 4L9AA 4P83A 1PEDA 4QUJA 2Q4BA 5FWAA 3C41J 1LBQA 2I87A 2IQ5A 5DOVA 3BKXA 3WZLA 5BOSA 1LDMA 3P4YA 2XCRB 2BJHA 3FKSA 2VAVA 3O5AA 5JJIA 2XTZA 3EH2A 3NTLA 4MAAA 3T41A 3DMFA 3I9V6 2OO7A 16PKA 1YASA 4DR1B 1OHHA 2IPMA 4KGDA 3PTAA 4QAQA 3PXDA 4E5VA 3IOYA 4JEIA 4JLBA 1JBEA 3K4QA 2IP4A 2QI9C 4OXKA 3DDNA 5JQGB 1RIIA 2EWVA 2ZPTX 2C95A 5C7OO 3INRA 4P4UA 4ROSA 2NADA 5C18A 2G25A 3H2ZA 1UPCA 3ZLVA 2H4HA 3ESYA 3N2IA 4LJSA 2QVZX 4LYGA 4NU6A 2VDOB 4KH0A 5C1DA 1R6VA 1XZLA 4NMWA 1R16A 4O5OA 1IY1A 4GL4A 4TWBA 4E3WA 1N6RA 3MOSA 4ALLA 5JNSA 3G02A 2IYSA 1IB0A 3BTVA 4U6NA 2ZRBA 3IBSA 4C29A 1K3UB 4CKEB 1WMDA 3USES 2F3SA 1QIEA 3AUTA 4PE5B 1ORIA 3HVRA 4M54A 1UXIA 3G3EA 4QPDA 4R3NA 1OX4B 4RVSA 2LDXA 2YDXA 2R1VA 1W2GA 1Y6JA 4R9NA 3ZWXA 2J5BA 8ADHA 1I0ZA 2GBPA 1DARA 1SIBE 3I04A 3MCAA 1PG5A 3ONDA 3QFCA 2F4NA 4PGGA 3UT5B 1Q16A 2X9LA 2ZTLA 3HZOA 4MQ6A 3TSOA 1XT6A 4Z3OA 2GYVA 4ND6A 3TRDA 2IV3A 1AJEA 2R6DA 4D9MA 1Z18A 1TVKB 3FJ1A 2OQ2A 3CF2A 3MJFA 4AZSA 4JN6B 1R0BA 5C1IA 2KYRA 4JLUA 1P44A 3KR0A 3EZYA 3Q7SA 2HT6A 4R40A 5AWFC 3UWKA 1OAOA 4ENQA 3H9CA 2QRHA 1A4IA 4DA7A 5IDWA 1AKYA 2H2HA 1X2BA 2QNIA 3B3FA 4R2XA 4YXWD 3RYCB 3NHZA 4QXQA 4WGFA 2XMCA 4GYWA 3NHPA 4IIHA 1U2GC 4H4DA 3ANXA 4BQEA 1S2GA 1WW2A 2WHQA 2XYPA 1YDGA 3GLQA 5JLJA 1ONOA 4JBXA 1PR1A 1XZAA 3BFPA 4R9VA 1VE3A 3HYCA 2VTDA 3FHOA 5CVDA 1PLJA 2Z2KA 3KQWA 2FWMX 3OD5A 1XJ0A 2HUPA 2A9PA 1E6LA 3EIUA 3EEQA 4MS1A 4ZHQB 2C4MA 4R7GA 4PN7A 3MJHA 4HX9A 5CFOA 5CCEA 3DB1A 3RUPA 2A0KA 1JHZA 2ZAYA 4FHGA 1F0NA 3INTA 4W99A 4JLAA 5D85A 3ZDXB 1BEZA 4TYWA 4BVHA 1MH1A 4NZMA 2QRQA 1L8OA 3FMPB 3RODA 4KQ2A 4EVSA 1ZA1A 4X95A 4FDMA 3TZLA 1M6NA 1OX6A 3EPJA 3RQSA 3COPA 4ARBA 1T9DA 3KQVA 4MQFA 4KU4A 4PLYA 3N2GB 2P78A 1MIOB 2D3TA 3NH6A 1E3LA 2HA4A 2V5AA 4B4DA 3QE2A 2C3MA 4HAOA 3FPBA 1MAAA 1T3HA 1Q50A 4X85A 4DCSA 1YVPA 2QR5A 4CMEC 1ZD8A 1SBIA 1ZN7A 1C8VB 4OXQA 1SKBA 1OLXB 1VHLA 3SSMA 1YULA 4A36A 1TUBB 1OVGA 3FNFA 2CD9A 1PTKA 5H9WA 2EEPA 4Q9NA 2W8BA 1L1QA 3PNMA 4RV5A 2X1LA 4MMXB 4F6RA 1G20B 2NQ8A 2Q7OE 2YIVX 4M0CA 5AW6A 3F6EX 2ZZNA 4M7PA 5FFNA 2VAMA 3H83A 2ERCA 2YMPA 3KYIB 4H7KA 3KCQA 2II6A 3B70A 2FX2A 1A98A 3KXKA 5EP1A 2QX4A 2WIBA 4N9WA 1GL7A 1MPXA 4R1OA 3K32A 3OC6A 3JQ7A 3GJRA 3HDTA 5LA6B 1J5XA 2NP7A 3DKPA 4ILEA 3AYZB 2HCBA 5G4LA 2ZUEA 4XRGA 4V1CA 2Z83A 1HZJA 2VF7A 1Z06A 5G0TA 2Y68A 4ZD6A 5IEBA 4AJJA 4NV3A 4LMRA 3RUEA 2AZXA 1GZ7A 3CW8X 2FR1A 1UJ4A 2J9GA 3R09A 3KJIA 2VDWA 4IZIA 5JSZB 5KYUB 1AF4A 4YPFA 1CZHA 4WZAE 4FM9A 3DUWA 4HPWA 1G4AE 2H1CA 3R2JA 4RW0A 4FN5A 1QP7A 1CYEA 1T3TA 1ZOSA 2EC5A 2LXNA 4HGQA 3T7CA 4P54A 4UCFA 1Q12A 1F51E 4O25A 4OM8A 1Y7PA 4RL4A 1A8IA 3G9ZA 5KI6A 4ERXA 1U9IC 4MEBA 4HYQA 1BDMA 3ENVA 4FIZA 1JUDA 2IUEA 5EKDA 1R5BA 5D51S 2XOXA 4OQEA 4RESA 4UM7A 1TC1A 1R0KA 2E1PA 1M2HA 4HR7A 4RFSA 5CX1B 5KHOC 3ZTTA 2KM1A 4ZO4A 4DDTA 1RKXA 3L06A 1L4FA 1KJ9A 3D9QX 2HWKA 4TN1A 4MGHA 5BYBA 4HZGA 1JFFB 2ZCUA 4XOIA 2R5WA 3HCAA 5EUBA 4BB0A 4RF3A 3RIGA 2GCNA 3DLHA 1VZ2A 4HNVA 2R6GA 1C50A 2RFLA 4BFLA 4ARCA 2I99A 2ZXEA 4CIAA 2FEWB 3F6BX 1IM2A 3GLGB 2HBYA 3S1AB 1Z7YA 3DHNA 4PZ9A 2LE0A 2WMOB 3PICA 4GR5A 1I5EA 3COSA 3WNQA 1WBDA 5EE0A 2C8LA 4C7BA 1T8SA 2WKPA 5C9ZA 4KH1A 5F5XA 2ATVA 1IWPB 3ETDA 2Y27A 5EG5A 2O2JA 2XNJA 3JQ8B 3SC6A 4JQSA 3FUXA 2WAMA 1FSFA 4QUAA 1DG9A 1JTVA 1OSNA 5D8DA 1DUVG 3QPCA 2PJZA 2B35A 4H1UA 5EI5A 4EB6B 5K3OA 2XZPA 1M2EA 3GMIA 4GICA 2RHMA 1FDVA 3BIXA 4IEEA 2QL9A 3FVRA 3IAS1 4NOLA 5DU2A 4G8JA 1W4LA 3LUDA 1DEKA 3NM5A 2C92A 1JW9B 3N0XA 1WHSA 3OIDA 2Q0QA 4BO0A 1BDIA 1IM5A 2H65A 2X6RA 3AEKA 1ULAA 2V6JA 1NJ6A 2ZYSA 4PCAA 4YNBA 1M7BA 4AN4A 3FCCA 4NXNB 3TOXA 5KJEA 4ZYUA 2A35A 2YS7A 4JC5A 4AJ4A 2I5PO 4HDOB 1I80A 3DC7A 4OHPA 5CNMA 5TARA 3UOAB 3ZHYA 1JDPA 4ITRC 4Y2HA 5GONF 1QPGA 3D7KA 4I9NA 5HIIA 1A50B 4HFNA 3KT0A 1GUFA 5BSUA 3THWB 2Q3EA 1DKRA 3MCTA 5LQSA 3VFDA 3MW8A 2I4OA 3LMKA 3M4JA 4RC9A 2QTVB 2UXBB 2XYHA 2CXUA 1FSGA 1ZM7A 3DOEA 4HQ0A 4IFBA 3PKZA 3QZUA 5FWNA 4RD6A 2WR8A 3M49A 5KNCD 2Z9BA 2BOVA 4ZYVA 3DKIA 2GJ8A 5SY9A 3RYHB 5IS2A 3KYBA 3UWOA 2AG5A 3GJZA 1QU2A 3ZJUA 2JIQA 3G0BA 2ZB8A 4ZVUA 3L1UA 4OXIA 3OIWA 2XA2A 2RGDA 2OZEA 1D2MA 3VHXB 1K3TA 1AKEA 2YZMA 3KPVA 4JDUA 5I7WA 3R5XA 4FFWA 1JDBB 4O0LA 3W6UA 4A6XA 5I7AA 4JASB 4BMCA 3KEGA 1IEVA 1I4EB 4UPEA 4HB0A 2X9VA 3SXUA 1E66A 1HF3A 1UBEA 1IUNA 3C5VA 5BNWA 3DMHA 4I14A 4I55B 3TEFA 3LY5A 5DM0A 2QJWA 3WLEA 2HX1A 1M0SA 2I67A 4A5SA 3HEAA 2IU4A 4I1RA 4B76A 4YCLA 3ZGZA 3BFXA 3FMFA 3IR5A 1T4CA 2Z6AA 1HSOA 4IM7A 3R9XB 1YK1A 3G8YA 3KYCA 4B47A 4BO4A 1L0BA 2NTYC 2ZE7A 2EP5A 3R3HA 4YAGA 1B6SA 1JA1A 3R3ZA 3BJEA 3E7WA 1IN6A 3L3BA 4I5FA 4WBXC 4ZQBA 2POCA 3ZOKA 5GADl 1TI7A 1L8AA 4KIUA 1KY3A 3BT7A 3KCNA 3QBDA 1I7PA 3RC9A 3EHEA 2RIRA 1P7CA 3WSVA 4J3FA 5FBQB 3X43A 3WFZA 1F14A 4MUNA 5CG2A 1KXJA 3W5BA 2ZWAA 2JCXA 4RAOA 4LJLA 4IEFB 3P9XA 1Z62A 2AYXA 3UM9A 1OIVA 2WU4A 3FI9A 1L7OA 1GSOA 3H6HA 1KEKA 1N25A 1UKZA 2VNIA 4ZAWA 2PV0A 4HMPA 1UMDA 3PQDA 3KJHA 5ABPA 4AJ2A 3HP1A 3UGJA 1QHEA 3O1HB 1AO3A 1Z2EA 1FJ2A 5FWYB 4DT1A 3OZFA 4GX0A 4IMRA 4YBRA 3OY7A 2P30A 5AVTA 3UXEA 3HXOA 2PWAA 4L5CA 1J90A 4NU8X 1T6YA 4G4GA 2PKCA 3P2MA 4KQFA 1L4LA 3PDCA 3KTFA 2FSVC 4TT3D 4WLEA 4MPDA 4Z9AA 1OFHA 3PQ8A 5HRCA 1SIUA 2Q4RA 2UYHA 4N41A 5ALHA 4IDOA 5EIBD 2IEGA 4X41A 4EOGA 1UJMA 1VBMA 4QQRA 4NZ9A 3ZNNA 4BO1A 3DOOA 3A9SA 1NFFA 3Q1KA 3TLBA 2VBCA 2C9DA 1KOGA 4HQRA 5FOVA 2QAJA 3TQCA 1TT5B 4C87A 4QTZA 3BXZA 4JLPA 4KAXA 2NU7A 1M8GA 2VJDA 2G04A 4D4JA 2R1TA 4R1SA 4V0SA 3COJA 3NUGA 3CISA 3HRKA 1AXGA 3BXXA 3RVLA 3VNRA 4K9SA 1T9BA 4GPD1 4M0DA 2VF8A 4ND3A 5G4KB 3RSQA 3OESA 3V8BA 4WJLA 1XQ9A 1PJZA 1QVWA 3DZCA 3AI2A 4LNAA 4W8HA 1I2ZA 2ZRNA 4PAQA 5JD5A 2Y1WA 1EUCB 1G9TA 1NVAA 3E0QA 3IV7A 4RYDA 1O95C 3O92A 5JSKA 2RGNC 3H75A 4X92A 5J1SB 5ES3A 1FS5A 3NVDA 1SVOA 3KHUA 4MR9B 1AMUA 1H3FA 1O94A 1T2FA 2VIIA 2X6TA 4RDIA 4TSFA 5LBTA 3PPYA 1KJJA 1E6WA 2QB5A 1ZH2A 1ONPA 5GZ3A 2VPWA 1WKBA 1QHYA 2VJMA 3N5KA 1NVXQ 2HHCA 5FUMA 4X9XA 1NMYA 1SUFA 3HFGA 3EDYA 4OHBA 2CVOA 1H4VB 2Z2IA 1W9HA 2FUNB 1IRIA 1GUZA 3ANNA 3BCHA 5COBA 2HQRA 5JXJA 2HNKA 1GCOA 1L4MA 2WOOA 3MINB 3N2KB 4RY9A 4QVKA 3S2UA 1MABB 2ORED 2NVUB 5DGIA 3BYZA 3FDZA 1Z26A 4JB0A 5HM6A 3LTEA 3PC4A 1OXTA 2XOEA 3T9BA 3EG9A 1QCYA 2G40A 3HCDA 3REGA 1EFVA 2I6XA 1UBRS 2Q3MA 4YV1A 2ZYGA 3G2HA 3HNPA 1MB9A 3DF9A 1JFVA 1C3JA 1IHDA 2PKQO 1UL1X 1ZXLA 4CDMA 3TBKA 2WYUA 3GEDA 1WXIA 1DHRA 3AFOA 4GZ3A 1KTVA 3UAWA 4ZK6A 2QE6A 5FYQA 1JVSA 3KB1A 3ASUA 3SICE 4HBZA 2XMDA 1E5DA 4MPRA 2BEUA 1GLGA 1CUDA 2AJBA 4N5MA 1P7PA 4H6VA 4E1AA 3TG8A 2O2DA 1UXKA 4WNCA 3AFGA 1QCZA 3GARA 1Y8RB 5KOHA 1ZXXA 2G08A 1YDWA 1N2JA 1E3DA 4ITUA 2VPXA 4LOJA 4M1OA 5AXCA 2VPQA 3R5FA 4TMZA 5DOZA 3ZWMA 3HLYA 2BI4A 1HOXA 1I1QB 3DZFA 3KOMA 2QTCA 1J1IA 2VRCA 3TNDA 1TM5E 3VR5A 2BFPA 5HZHA 4X0EA 1M74A 4J9VA 5T57A 1RMTA 3IP9A 2D0OB 4KXMA 2E1RA 2A5JA 4XUCA 5GONA 1Z8DA 1RZRA 3EAGA 1BH2A 3R5KA 1YJAA 1F20A 3TGPA 4LJAA 5DM60 1EH5A 3ZWOA 1QE3A 1QFMA 3L40A 2GFHA 3M33A 5FTJA 2DVMA 2Q1YA 3RTCA 3CXUA 1K98A 4Z4GA 2QQFA 1SVNA 3AETA 1UPXA 4UM9D 2I80A 2GEVA 1CDDA 3S4YA 4JY7A 4YHBA 1JAHA 1E3JA 3GJ0A 3U4CA 1ZLXA 4PG4A 2IPLA 3GLUA 3KXLA 2IVZA 5AM3A 3NOXA 3M6VA 4Z7NB 5T8KC 3OM9A 1KP2A 4O6VA 3FVVA 3IQWA 1P81A 2AKYA 3ET5A 2R6CA 4XZ3A 5CFZA 4I2VA 5B6PA 3E9EA 5M7EA 1Z5ZA 4US0R 5AVZA 2O5EA 5GPBA 4FNMA 4MMYB 3D81A 3VU3A 3ABSB 4RKFA 5LB4A 3I3SR 1XMPA 1CJMA 2M6RA 3L0PA 2ATCA 3MWJA 2F59A 1YRLA 2JFGA 2R7MA 1AX9A 2GLUA 1M0TA 5CIYA 4MW7A 4OUDA 3OZSA 1K92A 2GZAA 5AM4A 4ALIA 1K4YA 4MKRA 3BZUA 1A9TA 2QT0A 3CPEA 3QFTA 2GK6A 2H00A 4NF2A 4PIPA 2HLPA 2PCJA 2QRKA 4W6ZA 1FRVA 1Y4ZA 5DLEA 2ZBVA 1Z7WA 4YB8A 3RVNA 3SM9A 3WA7A 1XELA 1SR8A 2B9EA 2CNDA 3KLBA 4NCHA 5HRUA 2FAXA 3L2OB 3TOSA 3AP2A 3FJOA 3BBLA 4CUKA 1AD2A 4NQRA 2CLLB 4ZO6A 2R11A 2X5NA 3WAGA 4RAQA 4BV8A 2Q62A 2YBEA 1A2QA 1JS1X 1SUAA 1H6DA 1MEEA 2VDRB 1GFIA 3IA2A 4AK9A 3KQTA 3OCZA 4QWWA 1JR3D 4F8JA 1M6HA 3KWLA 4FDAA 1J8DA 4U7PB 1LNSA 4UOZA 1YFKA 4RTKA 1PZXA 2VT6A 1ISSA 3WRVA 3CKMA 4NC9A 5KVQA 2LCIA 2JLZA 4F4HA 1B74A 1XTKA 1VYTA 5LIRA 1VM6A 2DZDA 3B1WA 3T7SA 4KZKA 4N5DA 2P9JA 2VZEA 3CO5A 5C3MA 5K2OA 3WGUA 3K92A 3BMOA 1Q3TA 2BM0A 3TNLA 3EMVA 3BE5A 4DKXA 4WN3A 1XZBA 5DKFA 1O5TA 3ZW7A 2ZE5A 5M3BA 3EEYA 4LPKA 4J0GA 4NFLA 3SIRA 2EKLA 2IDMA 2IL1A 3D4NA 4TQ9A 1QHGA 1C2YA 2Q5HA 3NHMA 3NKLA 2QRPA 2J5XA 2IYUA 3RAFC 1FCJA 2VWQA 4Q7KA 1U3GA 4IIJF 2XTMA 3SI7A 3QXHA 3RRYA 4MUAA 3UW1A 5BXQC 1XU4A 2BZ1A 4FNOA 4NECA 4Q5IA 4TLEA 4E09A 4R31A 5JASA 2JD2A 3E84A 3HDGA 1XBTA 4RJIA 5J4LA 3EXEB 2KBFA 1DDOA 4UBIA 3ZEAA 3TECE 2IVFA 1JEQA 4H1VA 1UMCA 3P9KA 3NO4A 4NBTA 2DQZA 2R8EA 3C24A 4HNHA 5CCXA 3L43A 3LO8A 5I48A 2GI4A 4M8KA 2DTDA 1Q3HA 1OA1A 3CNQS 3W78A 1S3FA 3ICVA 3PIDA 3AL3A 2VJLA 3RG8A 2DLDA 2FVXA 4OGWA 2HF9A 4DDKA 1W85B 2D54A 3JWGA 2CBXA 4FFNA 4A73A 1NXPA 4PCLA 3Q8MA 3P9ZA 1PX2A 1VHWA 2BEWB 3QVSA 4RADA 1TK2A 3TIVA 2JAQA 1GN8A 5JZ9A 3SOZA 2ZWOA 4TL6A 3UTCA 2Z2JA 3O8OB 1W1UA 2A0UA 3HPQA 4PNZA 2M1XA 3K1YA 3W5UA 5KNLA 2I54A 3PCTA 5KTYA 5KNDD 2J09A 3KX2A 2QVCA 2YIMA 3ZHXA 4CCYA 1IVSA 1IUKA 1DAPA 3PUIA 2WU0A 1A7UA 1P7WA 3V9AA 1MTZA 4DWWA 3A7EA 2DQKA 3QPAA 4DANA 5SZJA 2E82A 2OM6A 1N8SA 3P5BA 1U5BA 1KFCB 3KLMX 1RYYA 2NYAA 4WACA 5EA2A 4QOIA 1WG8A 4LXIA 4KACA 4R3UC 1KDPA 4YFYA 3QITA 3SM3A 1QHXA 3FWKA 1UM9B 4POAA 1K8XB 5CK4A 1BS9A 1Z63A 1KQOA 1MDFA 1YVUA 2F3QA 4C2TA 5GQSA 2J1LA 5EIWA 3SU8A 4DDMA 4MYUA 3DE0X 4MSUA 3SFTA 1U6IA 3NPMA 4XRRA 5JFOA 1M2GA 1JI3A 3SF0A 1STOA 2ZZKA 4Y1EA 1UT5A 4BAZA 4EKIA 3ME5A 4EJFA 4PONA 4WLOA 2VXBA 1RHMA 1I94B 4ES6A 2C9OA 4L4XA 2D2EA 3A14A 3IAS6 3ZV3A 3E4CA 1GNRA 4FE4A 2Z08A 3L7AA 1RJ9B 4G5FA 2OAEA 3I61A 2I3AA 2FK7A 1CUGA 2CE2X 5LQAA 3PUHA 2VNSA 4RZXA 1MC4A 1G20E 1NX6A 4UW9A 5T4FA 1UWCA 1QE0A 2QV7A 4GPTA 4H3VA 3PT5A 1RAGA 3LCCA 2AG6A 3FSJX 4LDJA 1MOQA 1BD4A 1IPHA 2QHXA 3FA2A 4MDFA 3WK5A 2FPIB 2WSBA 4KI0A 2XMQA 4C4YA 1XWWA 3IP6A 1M83A 3ED5A 1QMGA 4JP2A 1XGKA 1U04A 4X1IA 1WIWA 1P8JA 2QORA 3H9UA 4ER3A 4RF4A 4RUKA 4RVOA 4XX0B 3Q0EA 4DR6B 1X9IA 3TFOA 4MKIA 3I1FA 3DZHA 2WDZA 1ARZA 3LHDA 4RGBA 4HLUC 3JZMA 1NWCA 3FTQA 3IVGA 2AUNA 1I14A 2UZ0A 3AF5A 4WV3A 3ZI7A 1I6WA 2Y05A 4IGFA 4L9WA 4RY2A 1TO1E 5TGDA 3ZYZA 2CGEA 2C5BA 5CDHA 3DHEA 3K8YA 1X3SA 2QUBA 3CKLA 1KI6B 3OZCA 4RCYA 5L3SA 1TKBA 2BTEA 3MTAA 5J4YA 3QBTA 4N7MA 2XW6A 1MJ5A 5E7QA 5A7FA 2J85A 3T7TA 2JGLA 2OXCA 3EULA 4M1WA 5EWMB 1FP1D 3OU7A 1W36B 4H7FA 3V1TC 5IG2A 4DR4B 4F2HA 2EF1A 2V8OA 4I0WB 1L7XA 4LIPD 5D5QA 5F4ZA 3F7NA 4ZVRA 5CDTA 1E4VA 4M87A 2NM0A 4DMMA 1P73A 4PSKA 3I9JA 2ZIZA 3KL2A 1PK7A 4WK0B 4HO1X 3V8PA 1FYDA 1KERA 3QKSA 1C30B 4GSLA 5DULA 5J63A 4WBNF 2XEXA 2WT8A 1YUMA 1X1RA 1C0LA 3IUSA 3UG6A 2I3ZA 4JL5A 1TF2A 4W4TA 4ZOCA 3BQ9A 4F8YA 3OO1A 3DCJA 4ZMSA 1K7XB 4FWIB 4L8LA 2JC3A 2PSSA 3PE6A 3SR4A 4BGDA 3SKVA 3F4BA 5K05A 4P3KA 5JQWA 1FYEA 4JYCA 3WSTA 1PYOA 2NZWA 5TPZD 3M2PA 3GLGE 1NQOA 5HKBA 4LNHA 4LF5B 4BEJA 3S2EA 3A3NA 4JUFA 3T38A 4RMGA 2DBRA 4QDKA 3TUJC 3ZV5A 2B92A 1O0SA 4YRJA 2RGGA 1ZK3A 3M82A 5L7WA 1GZDA 3Q10A 1EFRA 4HNGA 2OCLA 2F43A 2FPGB 4WOCA 3RS9A 2I91A 1KPHA 3IVXA 5AVXA 1YA8A 3NORA 4YXFA 2JK1A 1KAEA 1XVLA 3O4FA 1QAOA 1TM7E 3T5MA 4LGYA 3TK1A 4RIFA 1R74A 1CUAA 2IZ1A 2QQ0A 4QBKA 1JA0A 5C35A 1JF8A 3CR3C 4MWDA 4IJMA 2XBUA 3SD7A 5K3AA 2CL6X 2JIZD 4A0QA 3H1EA 1MW8X 3WLIA 2JFNA 1XEXA 1N0VC 2XUOA 5CVEA 4DPLA 3EVNA 1M7HA 2K2QB 2REOA 1YDEA 3JYLA 3V9PA 4BVAA 8MHTA 1DZ3A 5LKRA 1XZIA 2V6BA 2WTNA 4PV7A 2ZRHA 4IIJA 3QUAA 2WWGA 2V4ZA 4QLOA 2Z1NA 4ZXPA 2XZLA 5AVVA 1BDHA 1T1JA 3MWLA 4AO7A 2BEVB 5IXYA 4G5HA 1OPRA 2MU1A 3B85A 3P1JA 2NV6A 1KAGA 4LYHA 4S0ZA 1AZTA 2AGVA 4TS1A 5ADUS 3H8SA 1H85A 3SYLA 2JK0A 2ZIWB 1NZDA 2PT7A 2Q0HA 2QMQA 3B7GA 4MWOA 4O4JB 3JAKB 4F92B 1OAKA 1RJGA 2P9EA 3GVHA 5DHTA 4CEIA 3WQQA 3CRRA 4BNIA 4DC1A 2QVLA 2AE2A 5DK6A 3PLRA 4J4BA 2QK4A 2V7PA 2XRFA 3SQXA 1Q0SA 2BHSA 2X6QA 2JAWA 4HRAA 5ESWA 5C0OE 1B0ZA 4F93B 4JBWA 1WBBA 4PPFA 3LPDA 1JZQA 4YRCA 1XRPA 1KFBB 1GPMA 4FD3A 4LCBA 2HA5A 2NO5A 2PZGA 2E18A 2XUHA 2D4HA 1JR3E 3C4JA 3O1IC 3QLUC 4E5UA 4OB6A 2OFFA 1CEXA 1XAHA 1ZJYA 2OBNA 2WUVA 4JKYA 2J3HA 3LUCA 1VIMA 4UULA 4UUMA 3CBGA 3E9NA 1Z0UA 5IUKC 2RJ3A 2OORA 5J4KA 1FJXA 2EBWA 2ODNA 1Q14A 3TZKA 1PGQA 2EKBA 3II6X 4ZDJA 1TM2A 2P5UA 4KAAA 4X7PA 4FGUA 1TCBA 5HIJA 2EL7A 4ZQCB 3URMA 1GL3A 1QOPB 4REQA 2OAGA 1M72A 3D3WB 3SJAA 2WFLA 3D7SA 3RH0A 4BUJA 1KL7A 1DHTA 2NQ2C 2XV1A 3KFVA 2KB0A 2ZYDA 3DBOB 2CMDA 1U1EA 3K2BA 2AEJA 3P20A 4LOKA 2WD9A 4PU0A 4K6MA 4EHBA 3AQ4A 1RXVA 3TQHA 4RH0A 2WQZA 2FFRA 3WKAA 2IDJA 4GI5A 4QLAA 4MV7A 3LNTA 3TINA 4LCEA 2OEPA 3WGZA 3UMGA 3PEWA 3IB6A 3CB2A 3V1MA 5TVKA 5CXQA 1X1EA 5HYVA 3H1AA 3ITEA 3GLIE 3TCKA 1WO8A 3AMVA 3FLAA 4O4HF 4ZGWA 3S29A 2CMKA 3FVQA 4R6WA 5D1NA 2V1UA 4FYJA 5IJ0A 3CF6R 1ZP6A 1ULBA 1SVKA 2PMCA 2PWPA 2PL9A 2Y1LA 3C7CB 4PYNA 2GA8A 3JVIA 3BTSA 1W36C 1DC3A 4X61A 1DTSA 1QAMA 2QTNA 1AGYA 4IXMA 5ALUA 2XXAB 2YOFA 4TXHA 3HV2A 4AJNA 1B8VA 4O4LB 4CUZA 1EHIA 1U0OC 1YVEI 2GX6A 5FPTA 3NBAA 3H5RA 1LXCA 3R20A 3AUXA 4OOFA 4PHFA 1WEHA 5EHGA 1LBTA 2JDID 2HK9A 3GEEA 4M9XA 1GGMA 1Y1SA 4NIMA 3F98A 5IVIA 1VHQA 3UJ8A 3G79A 4DN6A 4YDQA 3ZGNA 5L4LA 2OSVA 4ABTA 5KTTA 2FEOA 1SG9A 2HHHB 2Y77A 4A23A 1X7ZB 1L4NA 2ES4A 2GZRA 2QJTA 2WB4A 1NG1A 4RZIA 5CYOA 2QS9A 5AMXA 3ZNPA 2CLEB 1EA5A 3BB3A 2NXJA 4LRXA 2BD0A 2EL9A 2VUHB 3I05A 4WKPA 4YRFA 5IUNC 4HN2A 4D9IA 3FYUB 2CCJA 4HQOA 4E4YA 3IMGA 2P4EA 1V8BA 1J7KA 1W52X 3ESAA 5DN6A 4Q02A 3ZKWA 2X0IA 1FEZA 1A77A 4IJ5A 2HCRA 4EMSA 4XOUA 3AF4A 5LQNA 2EFGA 4K05A 4ZJZA 5EQFA 3W1VA 2WY2D 3LBFA 4MUYA 4L16A 5IKEA 2ZUDA 4Q3LA 3A6GA 1P62B 4ZEWA 4HYYA 4P7FA 2PT9A 1P17A 3IRVA 1P2FA 1P80A 4QSHA 1F0KA 3WYAA 5BORA 5AW4A 3PSHA 2VNJA 4YCJA 4WBNA 2YXEA 4Z1MA 1H9AA 4Z7QB 4UUQA 3SPXA 5D87A 3ZLBA 2VR1A 1NI4A 2POQX 4RJLA 4I5EA 3PRHA 4CYMA 2RE8A 1KMHB 2HPHA 3AB7A 3DZDA 5F98A 4GQBA 4C21A 3TW6A 1GUBA 1GR1A 3KB2A 4KYIB 4ND7A 3W77A 5F9HA 4H1TA 4B3FX 3K5HA 5ES4B 1H1LB 2PIDA 1IUPA 1FVHA 1QFZA 5AM5A 2UU9B 3RJ5A 4I3GA 1R0CA 4WA7A 2WWTA 4AAYA 4DILA 3A6FA 4GM4A 3LXUX 3H5LA 4RTLA 4XLTA 2CZGA 3EUEA 1EVQA 2MYNA 3KELA 5CNJA 3W1WA 2WKQA 1UJ5A 2BMVA 1ILEA 1YOVB 3QH4A 1CY6A 3DG9A 4TKVA 2RK3A 5LD2C 2NVOA 1VGQA 5B3AA 3MHTA 5JVDB 2G6TA 2QXYA 1Y5MA 3SEZA 2R65A 4KLAA 4Z5XA 1QHIA 2G9VA 4RACA 2YWEA 3MMNA 2WUFA 5JYBA 2NUTB 5DXAA 1P91A 3RT9A 4XJSA 3ANTA 4FILA 4L73A 4TOIA 2CJWB 2HU7A 5CB4B 3I9NA 3ZE8A 2O2ZA 4OYLA 3GLFB 3LRTA 3AUJB 3MXOA 4O2AB 4HGRA 1PT6A 4KRFA 1HTWA 4RJKA 1OLUA 1X87A 3LBAA 3TLGB 2EQBA 2GEBA 1D0IA 3SSNA 1FFCA 4ESEA 4MHTA 1S89A 2P5SA 3TXYA 4QOGA 4RGYA 5IKXA 1XZ8A 2IOQA 3OM0A 1GV1A 1QMPA 1PW7A 2V74B 5FL7D 3ZWYA 3C97A 3H2JA 3KOOA 4EPRA 4YAFA 2Z6QA 3QEKA 4N8SA 5NLLA 1P5RA 3IERA 5IKMA 6ABPA 1CLEA 3ZDQA 2XMGA 4EG4A 4V0NA 3TGLA 1A9RA 2PRSA 3TLJA 5BW4A 4D3DA 4I5GA 4BS9A 5B7PA 5KTOA 1R37A 2JBWA 4IUDS 4IZ6A 5KEIA 4TVOA 4HEHA 3IPLA 4FDTA 5H16A 4KXNA 4MYCA 2B83A 3BXOA 4YACA 4AG5A 3LU1A 4KK3A 1G1AA 2I34A 4G89A 3SEQA 4KFUA 5KVVA 4N0PA 5J2UF 3K9HA 2ZUBA 3NUZA 2Y1CA 4BVKA 4RNDB 4H7HA 3MTIA 4PFKA 5U1PA 1G98A 3OHSX 4BGIA 4CLEA 2H5IA 3THXA 1BS2A 3L0YA 1H1DA 3PUWA 5IBQA 4TTAA 5JEEA 1BDBA 1T2EA 1TF7A 1WZIA 3GDOA 4X97A 3FNRA 3HUFA 5AM0A 3V7UA 2WTUA 4G0WA 2BAGA 1QIKA 4WX2B 3UH1A 1EAYA 2MSKA 3L77A 2EWMA 2JVIA 2JJ1A 3D8BA 3ITKA 1ADCA 4H17A 4I1OA 4M7RA 3VC1A 3SWWA 3Q98A 1CRPA 4OBXA 3TO5A 2WZBA 3GBVA 5H59A 5T67A 4R54A 3ZGXA 3IO3A 1ECJA 3HEBA 4IWXA 1NTRA 3VU9A 1LPMA 1I01A 1HURA 4Y2VA 2A57A 3ELUA 2JIPA 3QEJA 1C3OA 1FRZA 4ZAYA 5D7NA 3HBAA 2EQ5A 2AOWA 3UUFA 3FOZA 1WB5A 5TEVA 5FNVB 4OHZA 2CLFB 4L2IA 2A6PA 1BCRB 3WSWA 3F1LA 3WWZA 1DJMA 4YUZA 4XGNA 3GUYA 4JK3A 1EE9A 4EG8A 3WYBA 1R00A 1CQIA 1YS2X 2NO9A 2O3UA 2ZYWX 4CQMA 3FYUC 1CUYA 3QX9A 3T1NA 4D97A 2QE7D 4DXHA 5BOSB 4O4HA 5JC1A 5JT1A 1ADJA 1AHNA 1V5GA 4FCWA 2IP1A 2V4UA 3LUGA 4GI1A 4B3GA 4AQ7A 3K16A 3PQ4A 1UKAA 3DL2A 4D4LA 5LJLA 3F73A 2WAOA 4DV4B 1UKYA 4B6OA 1IY2A 1ZZGA 3D64A 1WCYA 4DRYA 1EGMB 3ACDA 4IYRA 4QKQA 1XNHA 3LDFA 5A4FS 1TNDA 4HTFA 3VH4A 1A8UA 1ZKDA 2NX2A 5GM1A 1PWYE 4FBGA 2HIAA 2H92A 1FDOA 2R86A 3K73O 2WHXA 1CVRA 2FR8A 1E2QA 3AUKA 2C54A 4ZAVA 5B2ZA 3TD2A 4BFVA 3OZTA 3INYA 1WXFA 3NAGA 4GAEA 3BDAA 2GK4A 3WBKA 1TQ2A 3V7NA 5DYNA 2XMPA 5JBIA 1C9YA 2BCEA 3H2BA 4N49A 4D2IA 2CD7A 2PQ6A 4CV1A 4RPKA 4C4RA 2CNBA 2YY5A 4NAUA 2R1VB 4LV6A 5F9MA 3VR5H 3KKOA 3ZU4A 5LSAA 1M2WA 2GD0A 3K70B 1VXRA 4QICA 1FU7A 1GDTA 1EDOA 4YDHB 3IJ5A 4AU1A 3U4QA 5I8PA 1J1UA 3G88A 1KI9A 2ZBGA 1LBEA 1CY0A 3VJKA 5LZ4A 1AKWA 2WG1A 2BV3A 3GEIA 1IQRA 4HGYA 1YFJA 4MW2A 5I5GA 4JELA 1SCUA 3IT3A 1FMJA 3EMBA 2QG4A 3JSAA 4H9GA 5AIBA 1P2GA 4ZZ3A 3OWHA 3CA8A 2XUDA 4RY0A 3NJ8A 4CR6A 3SLRA 2A59A 3QE3A 3OEED 3EBPA 4U2CA 4LF4B 1BJTA 3MMXA 3QXXA 3R7NA 4UHJA 4ZYLA 1Z83A 1N9GA 5SZHB 3JD4A 1SKMA 4LE1A 1NU6A 4L85A 2I33A 1Q44A 3EWIA 3IP1A 2CDRA 2P75A 3JQRA 2Q8PA 2GMWA 4NAVA 3OUTA 3SVLA 4RX1A 2W42A 3KUUA 5LQRA 1SFRA 3C3PA 4RDHA 3WL4A 3T5GA 2TYSB 2XITA 5DK4A 3W2EA 4XIFA 3U7QA 4CQNA 4E4TA 4LHXA 1CK4A 1Q7BA 4GW3A 1ZWKA 5CX4A 4TVSA 1EYZA 4MS1B 1LF0A 3CQ9A 5F3WB 2BMWA 4BGUA 1HE1C 3E9QA 2W2VA 2FSPA 4E5YA 3U7GA 4JL6A 3QKRB 4UFOA 1A9OA 3QF7A 2AYZA 4GOLD 4PO1A 2J6IA 4UHBA 3ENZA 3X1JA 1T1EA 3FF1A 2D6FA 1W2HA 4QQ8A 5B3JC 2PR2A 4MQFB 5I5EA 5LQUA 4EUSA 1FX0A 4N0DA 4C6SA 4HRVA 3UHPA 2G80A 2VYVD 1JKIA 1XZHA 1Z38A 1JEAA 1FNMA 2VDUE 2ZULA 4LSWA 2XUZA 1SZJG 1FTNA 4TMKA 5A4KA 5HJ2A 4PN3A 1ZRSA 1AK2A 2VJKA 4XQ0A 2BFMA 5EXEA 4RK7A 3DBRA 1PSZA 3R40A 4MW9A 4ZCPA 4KFTA 1JKJA 1B14A 2W8BB 4GSYA 3C8UA 3THSA 5AJUA 4F6RB 4DAOA 3MG9A 1Z2DA 1T8TA 3OE7D 1H0RA 2FQQA 4YPOA 5LYJF 3OLXA 5K6RA 1TJYA 3EQ8A 3PQ3A 1QGYA 1Z22A 1ZSYA 4DREA 2OV6A 3IHKA 3AZOA 3D0RA 1L4HA 3JQ7B 2GM5A 2IEZA 1I3OA 4Y2YA 3KKQA 2I6QA 4FYWA 2XDAA 2FGKA 2R6HA 4EO9A 4V1CB 3KTAB 5DP2A 4AECA 1T6ZA 2YZ7A 3D8SA 3I23A 4LQLA 2A0FA 3R5HA 3WG9A 3GH1A 5BV1A 5BQPA 2G5PA 2JRLA 2QQ5A 3PSAA 2VDWB 3ANYB 5EVCA 4C0KA 4MS3A 5IAKA 5I9BA 4RLFA 4ECEA 5TQ0A 1XQ6A 5J2UA 1RS0A 2C29D 1OYWA 3H3JA 4RKQA 1I3NA 4W1QA 2QRMA 4FZ5A 4P93A 4X5OA 1SBZA 3UOWA 2ZYAA 3A10A 4A2PA 1QTRA 4F11A 1GGVA 1TW2A 2I6UA 4BGVA 5HK8A 1TGVA 2CWDA 2WUGA 5C4MA 2QTMA 1E2KA 4EKGA 1YZKA 1PF7E 2Y1KA 2R4TA 3WAKA 1XK7A 4DIKA 4PG7A 2QZPA 1MG0A 3PQ6A 3P26A 4XWYA 4DQLA 3EEIA 3F2IA 1OASA 4RFSB 5EXTA 5CH8A 2AG0A 3R5SA 1PGJA 4IS3A 3N07A 4CMGA 4B2IA 2IHJA 2ZPAA 4P31A 3N0TA 4GNRA 1FNSA 2WHPA 4CFYA 5EMMA 1J07A 4D81A 2BTOA 3U37A 1N3LA 3AL2A 4HNRA 5JY6A 3CX7A 2DSTA 4E0BA 3SSOA 1JYFA 1JG1A 3FYTA 2WJIA 3I6ZA 3JVUA 5CFNA 4TXMA 1W34A 2QLNA 4HXFB 4AZTA 1EIZA 2CLCX 4R2KA 1BWRA 1XSEA 3AIOA 4FHCA 1L8LA 5H82A 4DPKA 3FYCA 4TTTS 4DKJA 3RVBA 1EU1A 4CLRA 3O84A 2TS1A 2XUFA 3BSYA 4L74A 5HJEA 4HZIA 1OGJA 3G2LA 5EESA 2I6TA 1JG3A 2VXOA 2HK7A 3OIVA 4JX8A 4JWKA 4PAGA 3K70C 4GI3A 3F6RA 4CCWA 3OICA 4D4GA 2BE7A 1SQGA 3I1YA 1QIGA 1QQAA 3GX1A 1CWUA 4G5OA 4JROA 2NPOA 3TGWA 3MQ4A 1RI4A 3KDAA 4JQYA 1EX7A 3TS1A 1GUDA 2VQ3A 1R15A 3UBTA 5IVPA 3HA7A 1F48A 4XPZA 1RQGA 4PRZA 1MXHA 1T2NA 3JRXA 3SJ7A 1OAOC 1WHSB 4M9SA 4ODIA 4Q03A 2R0QC 1OFUX 3ONVA 1Z6TA 3AEKB 3ZTYA 2QL5A 4ENUA 4CODB 3ZCSA 1WXQA 1YS9A 4DG8A 4CIBA 2OLKA 4XTCS 1NQWA 3C16C 4J7UA 2XBMA 1NUUA 2ZREA 4KK4A 3GMSA 4N65A 3COVA 2WD8A 4MAMA 4UDOA 2C07A 1Z8NA 1Z39A 2QD1A 2HT1A 5JADA 5AVYA 4RHEA 3SQNA 2VPYA 3T1OA 1BMTA 3DE6X 2GN2A 4XTRA 1XPJA 5IJXA 3ONEA 3EZ2A 2AZ4A 2MINA 1PX0A 3H5TA 3M5DA 5ALDA 3IESA 1ML3A 2NAPA 3B38A 4RCZA 1GZUA 1GPKA 2GEFA 3O1JC 4NCXA 4TWRA 1PZGA 1VKRA 1KI4A 5FUXA 2YRFA 1JQDA 1LDNA 2PU7A 4NPAA 4Q18A 5EJAA 4ABYA 4B6RA 3E8SA 1OH6A 1EWTA 4RMNA 2V7XA 3G82C 4WOBA 1NF9A 4JB2A 2B25A 3F9CA 4CL0A 3VR4A 4K6FA 3RFXA 2FB9A 4CBVA 4DNQA 4GFDA 4F38A 4X84A 5F23A 4RM2A 4C4XA 1TO2E 5KPJA 1YJCA 3MYYA 3DCYA 3ZWBA 3BE6A 1VRWA 4M0LA 1UPTA 1XVTA 1SAYA 2DQYA 2Z57A 5DM70 3RRMA 2PD3A 3E1GA 4TLBA 4KNYA 2N46A 2JJ8A 3EWNA 3ND6A 4JOCA 5FJJA 1YXMA 4H7PA 3PF8A 2G83A 1L4KA 2QLFA 2IXTA 2X76A 3EAFA 2OXRA 1CNFA 1P3DA 3O73A 1QU3A 2QN6A 1T4CB 2HHJA 2R97A 4E2WA 1CUVA 3VU0A 1AF7A 3KYCB 3QOYA 3F96A 3JQAD 1GITA 4ZDIA 7AT1A 1QPZA 3ULKA 5LLTA 1EJ6A 1EINA 3HADA 2COEA 5GJVC 1EVZA 3K94A 2WILA 1K6IA 3L7BA 4ANFA 4ROTA 3MJCA 3BWDD 3IVCA 2OCBA 2XVZA 4OFBA 4XQEA 1E1QA 2HV9A 4HV4A 4PY2A 3ZHUA 1GL6A 1OE0A 2LGJA 4B2PA 3QKUA 2LIVA 3ZNOA 3VA7A 4IQ8A 3L7IA 1S2LA 2GZDA 2AOTA 1IN7A 4EB0A 4EHIA 1QORA 1GXSB 4UNQA 1GRCA 2FW9A 1C4XA 3P2KA 5E7JA 3R7WA 3VV3A 2ZB4A 1VPEA 1UMDB 3A58B 2JJMA 2XZTA 3GLSA 4J1TA 3T15A 4KITB 5JJBA 1CP2A 5L3QA 4DBLC 5JD4A 5JNRA 3GPLA 3GZNA 4KQKA 5BW5A 1H3NA 4WPGA 3RGWS 5L4NA 4BAGA 3CKYA 3EDRA 1LPSA 1U9CA 2PS3A 1ZRNA 3DOCA 3SKYA 1N6OA 2E21A 2YWCA 3IR6A 5KC8A 4FLFA 1SO8A 2QRJA 4B87A 3EGIA 1GAXA 4EY3A 3FZQA 4NONA 4XB6B 2GTIA 1LRKA 4ZU1X 4PXSA 5CD9A 5LYJA 2VWGA 3FI0A 3LPCA 1NJ8A 2NPFA 4IFIA 1NVEA 3F7TA 1BS1A 2OO3A 2IUFA 3EPPA 2P77A 1H2YA 3JD0A 2NU7B 2Y1EA 4G8CA 1QYCA 1NM5A 4JGGA 3ABOB 4RMIA 2R1TB 5HFJA 4ARAA 4HWTA 5JECA 5B7NA 1CCWA 4B9AA 1TM3E 2XAAA 4FFDA 1V95A 1T9AA 2WP0A 3H97A 3SYMA 3S2YA 3ZXUB 4WHMA 2BHTA 2A4KA 4HEA1 4E32A 1IBSA 2H4JA 1XR3A 4GP6A 4R6XA 3GW8A 4MLDA 3AR9A 5DSZA 1NZJA 1WDLA 5E7MA 1B16A 2K4MA 1IMOA 1VJ5A 1AU9A 1U2ZA 1CSEE 4M9ZA 1GA4A 2PPVA 3LZDA 2QW0X 3E8MA 2WABA 3A4LA 4F3NA 5G3ZA 4AZ3B 3S1SA 1IJBA 3CVXA 2VJMB 1ZJWA 1LK0A 1UJ2A 3DC2A 3W04A 3AHGA 1CQPA 2YL2A 4L02A 5DNCA 2XCLA 4HFMA 1NKSA 5FR2A 4QAJA 1T6NA 2ZYUX 1NR1A 1N1EA 2P4UA 2Y0BA 4XFJA 3RVKA 3ZZNA 2I0FA 4N12A 4UFNA 2P3OA 3TXXA 3OBIA 1HDOA 1KK2A 2ZAIA 4IKPA 3FDZB 1CRZA 3HI4A 3LPNA 2QM0A 3BVPA 1JLKA 1X13A 3KPJA 1H5NA 1AKUA 1DU4A 4EHNA 5H0IA 4UD6A 2COUA 5CM2Z 4Q3OA 2WNSA 2NZ2A 2PT5A 1YZTA 3NJ4A 4G37A 4KQIA 3SOPA 1D4OA 3ILVA 1RXEA 1O2DA 1IBMB 1KFJB 3ZIAA 4RTRA 2V7VA 2IV2X 3RVPA 2VOJA 1DFHA 4HH0A 5M34A 3TRIA 3QV1A 4KAJA 2C61A 4E15A 3V1YA 1T4BA 4UHEA 2KW5A 3TXAA 1MX9A 1OFUA 2CHQA 3AR6A 4LS3A 5ALEA 2EJBA 3W2GA 4EY8A 1VDMA 1NBMA 1C5KA 3UTDA 1Q6ZA 5DEIA 5KOHB 1RHUA 1ADYA 1ZGGA 4ND2A 1V11A 2EG5A 4A8JB 1ATZA 5CHYA 1FMTA 2FPLA 2OG1A 3OECA 4IQGA 4LHSA 3HVUA 2QSUA 4C5CA 4M0FA 4CM9D 5KNBA 2PSEA 4AKHA 3T7IA 3V97A 5T3UA 1CUUA 3GLHE 4RIIA 3WDMA 4A0GA 3UK0A 3QX3A 1TJNA 4IOLA 4GIBA 4DVJA 1JQ5A 1US8A 5DHSA 3TDMA 2R87A 3G5MA 4RQAA 3S0JA 1WAMA 5GONB 3W8NA 1V9LA 3JQDA 3G9UA 2QX8A 1N34B 1UAGA 4F2WA 3LRPA 4R8RA 4ZCSA 1B1AA 1IDN1 4CG2A 4IEIA 4C5AA 2BGUA 4UREA 1S01A 2EZUA 1ZGBA 4QEKA 2ZKLA 4BVFA 2EFEB 1FFWA 3AETB 1ZI9A 1A5ZA 1DJLA 4RTPA 4A0SA 4YAKA 3X1MA 4OI2A 2BKVA 2GYWA 1YE5A 1W4AA 5EOVA 1JU3A 4H2DA 2R2GA 5J2TF 3HSKA 3G9QA 4K9KA 1JE1A 2CL0X 1R8SA 5IT9A 1JX6A 2QDXA 3UCFA 1R12A 4RIGA 1E3QA 5KOIA 3CLTC 1TTPB 1N75A 4U0JA 4UVIA 4L8FA 1SXQA 2MSCB 3DB2A 3RADC 2OQVA 3NYWA 5LMZA 2EV9A 4DDHA 4OUDB 4BAUA 2XIQA 1ENZA 3QELA 2O19A 5AKXA 4MYDA 4F46A 3BORA 4LOLA 4M21A 4IXDA 4PHHA 2WTEA 5C4GB 4LXUA 3KVVA 2CZQA 3CS3A 3CWQA 3X44A 1TECE 3U60B 1WOYA 3BCUA 3OCXA 4YN3A 2J7PD 3FMIA 2GM9A 2K6GA 4LNUA 4A0HA 2F8MA 2WG0A 2H4XA 1LDEA 4D98A 2HJSA 1YACA 4JQZA 1TFRA 2CXRA 2H2AA 3UMVA 1JHOA 3PPIA 1NYLA 2FFAA 1QUFA 3D7RA 3L8EA 1A27A 1JHRA 2D0PB 1M8KA 1PO7A 4QDXA 1LJLA 4CU2A 4EO4A 2CDNA 4JT9A 4CMBA 2OD7A 3ZQKA 4FS8A 3KQKA 1UF9A 3FAZA 1R0XA 4WLUA 1KQNA 1PD1A 5DTJA 3E5NA 3C6XA 3EZ6A 3GRUA 2MR6A 5I47A 2CJFA 5DCWA 4EF5A 2O3TA 1UFKA 2XWPA 5IXJA 4L3WA 2BM1A 3RNOA 2A1IA 2ZRGA 3BMOB 3A9WA 3NNDA 5TVGA 5C81A 2GO1A 3WIVA 2QGZA 4IJWA 4E14A 4JJEA 5LLDA 4EKNB 4X8OA 3OBBA 1T24A 2PRZA 1Y6FA 3O2SB 1ZN9A 1O94C 4GKKB 1UBHS 3A28A 4OHMA 3LKDA 3IV6A 3TNJA 1R4NA 3ETLA 1IQ0A 2WMNB 3T5TA 3Q7EA 4OF4A 3U4AA 4RH1A 2YWRA 4QTXA 2JI6A 3ORRA 4KQ1A 4FOLA 4U7JA 3WIUA 1UOEA 2G9RA 4WNIA 2Z3WA 3UK7A 1OLOA 3OCWA 4A91A 2M32A 3AKEA 3QNUA 5EY5B 3RSFA 1G63A 3TZHA 2PMBA 3L6CA 1NP7A 1JEQB 5AJZA 1ZIOA 1JEJA 3EDCA 1UMCB 2LR0A 5DGCA 3W8DA 5E3IA 3VJLA 4L4RA 3ZV7A 1XLWA 4QUKA 1GPUA 2DPHA 3VVMA 2ZI9A 3GPBA 4MV8A 1QGUA 4FR0A 3BFKA 3ZWVA 3VJMA 4CKBA 1I7DA 4M88A 2GNOA 5K8CA 3U7IA 3L6UA 4DY4A 1FQJA 1U2EA 3C1UA 1EWYA 3DBIA 2JD1A 2OVBA 1FXUA 2ROQA 3ZWPA 1MH9A 2CYCA 3LGAA 3SP1A 5MFZA 1VIVA 3DBHA 2QW8A 3DAHA 1NJFA 1Y5IA 4ZA2A 2GTPA 1UOQA 1QK4A 2MIIA 1H22A 3G8BA 1EJBA 1DJQA 3GHYA 2OVFA 1RPNA 1U11A 1YIOA 1MTOA 2IYEA 4BNZA 5KTMA 2ZVQX 4BY9E 3AKDA 3K53A 3HZZA 1RLUA 3MRXA 3OHPA 1P2DA 2IYTA 1NZFA 2EJCA 4WOPA 3ESDA 2I1WA 5BYKA 2YINC 2XR1A 1O57A 5KVCA 1T5LA 2RK6A 1KA9H 3CUEF 4A8JC 4CCYB 3RSHA 2HA6A 4C7KA 1XQYA 3UJPA 4EHKA 1ODCA 5JC8A 4R83A 2C4WA 5L53A 4DV6B 4NZNA 2ZXFA 2DQSA 5A62A 1CJBA 2B8JA 1IHOA 3KZVA 5HZGA 2P27A 3DHWC 3DZKA 3R9KA 1T5SA 3J7AC 4UKDA 3L79A 1AQIA 3TPZA 1NQUA 3JWIA 3X1XA 4IZHA 3JTEA 2YDYA 4PPQA 3ZS8A 1JWLA 5JFGA 4QPJC 4DDWA 4QUEA 1DXYA 2Y76A 2B61A 4JLKA 5JSQA 3O8QA 2DBZA 5LC1A 3OQMA 4JJAA 2HWYA 3ORHA 3DUFA 1PR2A 1Y7HA 1XDSA 1Z4PX 2CHFA 2E4WA 3CZAA 4K6GA 4KX3A 2HV8A 5A7HA 1FP7A 3H1GA 1MBZA 1KY5A 2XGSA 1JHXA 2C9YA 4MCAA 4R2HA 3ZVKA 2GHTA 4BNYA 4BOYA 1RHJA 4K3UA 1P18A 1S4QA 1QZ3A 1ZL0A 2C77A 2GCGA 3MZ0A 3AC0A 4N01A 1NTOA 2VK4A 2VYQA 2X8AA 4QBFA 4NJOA 2FR0A 2Q6KA 2OXIA 2P2GA 3ZWDA 5K0BA 1G9XA 1ZC3A 2JI7A 4R84A 621PA 4LRYA 5MF6A 3GUUA 4RKYA 3MS4A 1SQ5A 1VI2A 3GK3A 4Y2QA 3HE3A 1H0KA 3AY0A 5HKOA 3AR4A 3W5AA 3WGNA 1E9RA 2CVFA 2YNMD 2C7BA 3LO5A 1LTKA 1TXGA 1WDMA 2BM9A 3CTPA 4BNLA 4WWHA 4P3NA 3SJZA 4X1IB 1U2SA 1MUUA 1QC5A 2XRZA 4PLGA 3G17A 2IDKA 1BYIA 5DX1A 2UAGA 1FE8A 3RVJA 3FAKA 1U98A 1VRVA 1ZX1A 5A03A 2BELA 2EP7A 2VHJA 5DCUA 2G1AA 2ILVA 2ZS8A 2ZR8A 3U3MA 3RV4A 1UBFA 2IELA 1I1HA 1CTQA 4JSYA 1MQ8B 4L75A 1NF8A 1Z0KA 1MOSA 2FPWA 1OAAA 1WY7A 2VUIB 2ONKA 2AQ8A 4M0MA 1WMBA 2QN7A 2Y6UA 3LHIA 3KSRA 4M38A 5B53A 1UQRA 2FOIA 1Y3CE 3ZWQA 4E30A 3ZJ4A 3N3BC 5HX7A 2E4XA 1NURA 3FE2A 3S70A 3L5KA 3ESCA 3SBEA 5AKKA 3SQMA 3UN1A 4KN8A 2CFIA 3HNRA 3JQPA 4ENPA 1Z56C 2PGLA 3OLQA 4B3XA 1MGPA 4E21A 1YI0A 4YQEA 1TYAE 2JCGA 4QX6A 4RIEA 5DBOA 3QKSB 4OJYA 4C2BA 3S2FA 5BO5A 3ZV4A 1GKUB 3R8CA 4Q1CA 4RPLA 1Z4JA 2P9HA 4I6JA 4TLCA 2FHSA 4IH9A 5K0NA 2X5XA 4I08A 1UZUA 1H6BA 2FDXA 2LPMA 3ZG6A 4CEJA 4IR7A 3HG7A 3CG4A 2VI5A 1P0PA 3EWSA 1Q0LA 1EESA 4PAOA 3AF2A 2QP9X 1RKQA 3BXGA 1EDBA 3MUOA 4H16A 3KAQA 3KR9A 2GSWA 2EHDA 3GUZA 3EDMA 4HJRA 4E94A 2F3UA 5TSDA 3JXEA 2I9KA 1A5TA 2VBFA 3NQ41 2XJ9A 4G2NA 1BXRA 2XHZA 2YFYA 3HGMA 3I8OA 1X8XA 1LVUA 2JLBA 3H2IA 4ND4A 3WK7A 3GA5A 4C03A 1RE1A 4ZIRA 2F43B 4JENA 3OZRA 4JVSB 5AW5A 4DDVA 3NC4A 5ALPA 1V7PC 1J25A 2EGHA 4QPPA 1U2PA 3GELA 1EG2A 4E4RA 1AS3A 3IAM1 5JSFA 3QXGA 3PXAA 4Q9DA 5EP2A 1SVMA 2QG6A 4PGHA 2Q4OA 3G59A 4BASA 1PS8A 1F8YA 2B5VA 1G3QA 4HGPA 4QYIA 2FPPA 4ND8A 4Y3UA 3V4LA 3UENA 1EVIA 3CNNA 2Y1XA 3UFBA 1XEXB 4L7VA 1L7RA 2QZ9A 3D4BA 2V7UA 3SF8A 4LOAA 4R1QA 4R81A 4NDAA 2HUNA 1UH5A 1GRVA 3FPHA 3BJRA 4NCJA 2QENA 4R0MA 3SYTA 3H05A 3FM9A 1UZMA 4EW6A 3EISA 5IT4A 3LDAA 3ADDA 4IIJB 3RTDA 1DFGA 5BWBA 4ZKEA 5IWCA 2N9UA 4KXLA 2AFHA 2WF6A 4RSGA 3V4PB 1ZM2A 1RC1A 3CCBA 4KPFC 4IW3B 2LZ0A 1MNQA 1Z0JA 4RPCA 1MHTA 2ACWA 4MV4A 1XMQB 4TL8A 4CF6A 1I3CA 4PM4A 1GAEO 3CUVA 3G2NA 3IYLW 1Q6YA 1QFXA 4GP7A 4RJJA 4CIVA 5ICCA 5FI1B 2IHZA 4ZVMA 3VYVA 1SC9A 3EA0A 1UK8A 2ATXA 4CEIB 1A9YA 2DHRA 2NO6A 4YAJA 3SYNA 4HEA6 2RC6A 4EW2A 3SZ3A 3M2TA 2NV0A 3E7XA 5CT9A 3K0FB 5B4VA 5NULA 4OMCA 2FQWA 2AN9A 2QTLA 3O3NB 4BIIA 4EBFA 5L7TA 4MPJA 3T5AA 1SG0A 1ACMA 4DIUA 2AWOA 1T0BA 2NU6A 2ZPUA 3T9EA 1EFAA 5JD6A 3AJRA 4F97A 3QUTA 4CKCA 3E22B 4XVUA 1EB8A 1PR9A 1D03A 1M54A 1TMYA 3DO8A 8GPBA 3U09A 4O5AA 3T0GA 2PUEA 1KY4A 1VGRA 1L2TA 4YJGA 5TQ2A 3I5AA 5A2QA 1GEGA 3BSWA 3SX2A 2G9NA 5BV2P 1K75A 2C9BA 2G1KA 4KXXA 4M0PA 1ZVVA 1HPLA 3K2EA 3O95A 2RHWA 1L5HA 1OBVA 3S68A 1ZOIA 3EMDA 1TKCA 1ZCBA 2ZR7A 3VPBA 1U7DA 3G5TA 1MOZA 5HOQA 2P40A 3OQ1A 1N6NA 3WVNA 4F5EA 2V0NA 1R6XA 2Q5LA 3HB0A 4QELA 1MB3A 4H59A 3PD7A 4REQB 4F2DA 4QHYA 1YBVA 3PYLA 1TGYA 3EZNA 3KOUA 4BC0A 4D8WA 5CVUA 1YTUA 1TQ6A 4RA6A 2YYSA 4JQOA 1JDSA 5K7SA 1E3WA 1N92A 3MTDA 1XL0A 3VYUB 2FDRA 1Z4OA 1E2HA 2R9VA 2WSIA 1XJ5A 3RIMA 3M6LA 2C5GA 4B3SB 3GEHA 4G63A 3OIUA 1FFYA 4P92A 3STTA 1DAOA 1NVVR 1MC5A 4XWTA 3HMQA 2G5TA 2QGNA 3MB8A 2OCDA 3MRTA 2C2XA 1N2XA 2QTRA 2GPTA 2OB1A 4B33A 4D6XA 3MAGA 3UT0A 4E2YA 3LK6A 3ZVNA 1E3TA 1V4NA 1L6IA 3KHKA 5ALFA 4C0SA 4BQSA 3CNOA 4G0NA 5FEMA 4M6WA 5F9FA 3RJMA 1P3JA 1QYWA 5IJ0B 2JHGA 1DBWA 1T4DA 5AW3A 4I46A 5L6LB 4MVJM 2Q46A 4UBLA 2JLVA 2J5QA 1NXXA 2HKIA 4S2EA 4MYTA 3N74A 2FP4A 1V39A 2JHPA 2ZVDA 5EJ6A 5AJHA 3TI7A 3TTWA 3L0CA 1XXHB 1C80A 1FLDA 1U6JA 2C5LA 3FFTA 1U2QA 3IQXA 4E03A 4XCQA 2P6NA 4MRMA 4DA6A 1Z34A 3OZDA 1VZ3A 3PYMA 3CTMA 3QPVA 4DW8A 2NW6A 4IRXA 3UPTA 3ADPA 4UTRA 4IGAA 1LZLA 4WN9A 1NLMA 1DC5A 3U48A 2NMVA 5D3KA 1QM5A 3U3XA 2FEPA 3ZBPA 1PGPA 4OBBA 1KWGA 1E3SA 2O5VA 3IMFA 1IYZA 2VPTA 1RRGA 3GT0A 4TWIA 3BB1A 4N7BA 1UFQA 1VL2A 4QJIA 5PGMA 1MGOA 4PS0A 4BQNA 4CGZA 2B8EA 3ZKWB 4BN4A 2Q1UA 1QP8A 1W0KA 3WMEA 1NW8A 2BW0A 3BIWA 2JLAA 1QCDA 2RHRA 3BGOS 2ZETA 1I4OA 2CVZA 4FCCA 2WKSA 1B0AA 3GR6A 5AP9A 2E7ZA 2ZQYA 4UOQA 4YHHB 2OB2A 1BJRE 1SK8A 4BLWA 1C8LA 4DBZA 5EJ8A 1BWSA 1JDJA 4IO0A 1J00A 1KMCA 1A3CA 4FYHA 5KTNA 3IMKA 4BO6A 2RHJA 3AVWA 3UJ3X 4G0QA 3P4UA 3PRKE 3QFSA 1VBNA 5REQA 1HE3A 3OTHA 4JOQA 4Q00A 3L4JA 4M9CA 3KXIA 3TF5A 1T10A 1V45E 4FJ2A 4YQYA 4D5EA 3D1JA 2R8BA 2PL1A 4EA9A 1KHHA 1NI4B 1ABEA 1IOZA 3QTBA 5IJZA 3EODA 2NZYA 2XKKA 1Y42X 1A71A 1CT9A 1LU9A 2FCRA 2V55B 2VNKA 1L3IA 2FLVA 1CY7A 5L3ZA 2P35A 1EVYA 4W9NA 3FBTA 4RELA 4K6CA 4B0OA 3AKCA 1GSIA 1BAPA 4ZU6X 2EWWA 2MWMA 4HQ6A 5FPQA 1WSWA 3PTLA 3UT6A 4R3WA 1QH1B 3T9FA 4YYZA 2CFOA 1FDTA 4YAIA 3FJYA 3W5JA 5BT8A 2C98A 1NVFA 4DMFA 2XGOA 1RKUA 5F3RA 1PIWA 3OLYA 4NJEA 1CHNA 4Y6QA 1ZW1A 1WCIA 3PHLA 3AHEA 3NDRA 5DYTA 2ZYRA 1GWNA 4XYMA 5JSHA 4QM7A 1DRWA 2Y0CA 3WE7A 4EYSA 2IYVA 4TKVB 5HFAA 4KEAA 4LY3A 3NHRA 3ZGYA 2QMHA 4FVTA 4RWEA 4N8EA 3FYHA 3GQBA 4HF7A 3A2MA 2UYOA 1J2EA 1RYEA 4UVEA 4Z4CA 5CRIA 4CDRA 3KOYA 4EY4A 3L7MA 4C5BA 2WIKA 3IJPA 1H0HA 4FKMA 3O8RA 3KJNA 1JBKA 3HJUA 3ON5A 6PFKA 2V7QD 1EGAA 1UXHA 2VZ9A 1GFWA 4FI3C 4HN4B 1O6FA 2J6BA 4YJ3F 2AI1A 1VPTA 5CB4F 1OLUB 1CFZA 4ZOQI 1HEUA 1NOKA 2OORC 2WAAA 1F8UA 1FZQA 3D8TA 4KIGA 1Z5WA 2C8KA 2WSSA 4A8HA 4K46A 5LBUA 5JARA 4JVOA 3RFUA 4WZAA 2XZDA 3WLRA 3ZW9A 4ZZIA 1KIMA 2QX6A 3PIIA 2C8JA 4FGWA 2JASA 4V0ME 8LDHA 1J2TA 4JJ6A 3CMCO 3EVCA 1UKBA 2NT3A 4BO2A 2BFOA 1X8JA 4RD3A 3GPIA 1RXUA 3NXKA 4EHDA 4J2OA 3QXSA 5EP3A 1DQNA 2O8CA 1ZW6A 2EIHA 4K8RB 3I39X 4EZIA 3KZNA 4KPEC 3NV7A 3N05A 4KE9A 5AO9A 3OFND 3W1EA 4EKEA 4L6CA 3VPDA 3QX7A 1JNXX 1K6JA 1KYTA 1ZXBA 2YXNA 3NHLA 2P2ZA 4EB8A 1UODA 1E9VA 1VG0B 1WUHS 3A3OA 2QP3A 4YRIA 1GOTA 1RACA 4MW4A 4QBIA 3RSGA 1NMZA 4NHEA 3T7AA 2FWNA 5KYXA 2HADA 3M6IA 5ELLA 4BKRA 3THXB 2KLHA 4EGQA 4RDXA 2OWDA 2XB4A 2M6KA 5MGNA 1JP7A 1N0WA 2HRZA 4RKRA 4WVFA 4PEVA 3RLFA 3TFQA 1HH4A 1WPGA 3WYCA 1GAJA 3L1IA 1PWHA 3HYRA 1XWIA 2HQSA 3CBQA 4K88A 3M9XA 2OPBA 4CHTA 3P0RA 5B30A 3NTVA 3VU9B 4IDHA 1DIOB 2DUUA 4D0NA 1BSVA 2VPIA 1FFEA 2O0HA 2IEBA 4BB5A 2OYRA 2YZ2A 2D5BA 2M6LA 1C3OB 3N8KA 1CUCA 4OMFG 4F1KA 2YS6A 3OC0A 4BKQA 4FEEA 3HO6A 4BYMA 4AULA 1LSSA 1W93A 3WHIA 2QLLA 1VMAA 1N0UA 3AGPA 3IFSA 5DN9A 4Z7JA 2QZ4A 2XUQA 2YJ4A 1LK7A 2PLWA 3AI3A 4WKOA 2AYYA 1R66A 2UUBB 1QE5A 2PKRA 1DC8A 1CQIB 1LLUA 3JWEA 5EHNA 1HKHA 2UXDB 2D4AA 3GOQA 4KGXA 1XAJA 3TTTA 2MMGA 3A6DA 4O4HB 4RTSA 4MI6A 3K1TA 1DE0A 4P32A 2ORWA 4UHFA 4RTJA 4QNMA 1G5HA 2X2FA 3MD9A 1Z73A 5TV2A 4CTJA 1AUPA 4J4HA 4JJKA 4BP3A 2YVAA 2DR2A 3G2KA 1FS4A 3O0DA 4H6PA 1TZJA 1ULTA 2QIOA 3BA6A 2W2LD 4YGYA 1NMEA 3U17A 2XQFA 5KC9A 4GZLA 1M5RA 7MHTA 4L8YA 1CR6A 2WE8A 5FOWA 5KDLA 2R25B 1VPWA 2PXHA 4HTFB 1JWAB 1THZA 4Q9AA 1V25A 4HGOA 2QTGA 3EIEA 3MSCA 1SCIA 3PEUA 3ROKA 3LT2A 1W4CA 4XM1A 3D6MA 3DEAA 3UYLA 1GO2A 3UMSA 5JV5A 1XLTA 3RRBA 2F8TA 1DAHA 1DEOA 1JH9A 3KVYA 4W7HA 1MP0A 3DWEX 3I53A 3OFSA 4FCTA 2ZSIA 2HMSA 4MR7A 3Q40A 4BQOA 1H05A 3DDZX 3ENNA 3FTPA 1ONNA 4LMBA 3DT9A 1VLVA 1MFZA 3ZDFA 5KNBH 2OZLA 3R75A 4G1CA 4N3AA 4XYLA 3NKFA 2E5FA 4EFNA 2IXBA 3DYVA 4Z4FA 1D2GA 4GOMD 3NHWA 3U9LA 2UVPA 1W76A 3IB3A 1EUYA 3AWIA 2JCSA 3ZCPA 1UUFA 4ZAFA 2W00A 1NXVA 3FBWA 5JWRA 3G49A 2CL7X 1G41A 3MERA 1WLYA 3KQYA 1TIPA 3D2CA 4LA4A 1EAMA 1EEHA 1KQPA 3JZAA 4ALKA 4GKJB 1U7TA 4D9JA 5IFKA 2ZWIA 4DZZA 3K8QA 3V1NA 1L5YA 5JDCC 1E4EA 2RH9B 5DRTA 5JYEA 1SCUB 1UBMS 2QEQA 3WHPA 5CT5A 4Q3CA 3WNCA 1IHXA 1SHKA 3CZMA 4JWTA 4U2FA 4YP1A 4K0RA 5T4HA 4DBVO 1J1ZA 1JGTA 1Q92A 1VL5A 5AESA 1CP3A 1SUIA 3ENWA 4GU5A 4UDYX 2ZFUA 4Z8XA 4BRUA 1N9GB 3N7AA 4AMYA 4LRUA 1C7RA 1UPUA 1Q91A 4GMXA 3OPXA 3SR3A 2ZSBA 4O63O 2JLYA 1D6SA 1GCGA 2ECPA 1ULHA 4GOKA 1SUCA 3NBKA 4S24A 3VDQA 3LKVA 4MWEA 3CPSA 3L7YA 5F51A 3ZI0A 2Q4DA 3U7QB 4Z9BA 3DVAA 4EW3A 4M8SA 5TMEA 4W82A 1B4DA 1PCXA 2PKEA 2VSNA 3W79A 1L6RA 1IJFA 2I29A 5HVNA 4Q3BA 2PMEA 3WXBA 3AZPA 5F1OA 3VO2A 3CO0S 2HJRA 2MDTA 4OY3A 1C7ZA 4O4IF 4TTVA 1XN1A 3PE4A 2FWPA 1RBMA 3HUEA 4XDZA 4MUBA 4BLOA 4QUBA 4Z1MD 1E7YA 2DHQA 5I9NA 2WQ7A 3LC1O 4FB5A 3JQFA 1VG9B 3CLVA 3RRZA 1OWPA 2BFFB 2ZRFA 1CZLA 3MRSA 4H3SA 5BSWA 5AOVA 1NJ1A 3PCXA 4QU8A 3U49A 1C1HA 1FX0B 1MVOA 3SX0A 1DTEA 4BKPA 2HMWA 2EJUA 1YDFA 2KBEA 3R6TA 1J9GA 4YXWA 1ZQ9A 3GB9A 3ROPA 5E38A 2GYYA 3WBJA 2ZZMA 1QO9A 2QJOA 2H85A 1RWWA 3ESQA 4IL5A 1NPDA 4QQNA 5KIAA 3WB9A 1QP0A 1DNPA 3M6FA 1P6QA 4YJ3A 1UBUS 3UMJA 5E6SA 4D3YA 3OTIA 1BOOA 1U3TA 3DBRB 5FTNA 4PYRA 5CB4A 1PT5A 2CT8A 1JKJB 1LW6E 2C42A 3PL1A 1IZ0A 5HP4A 2OM2A 2YBDA 1XDZA 2BVNA 2W4QA 3FROA 3NYQA 4KDFA 4L4YA 4X8MA 4YLEA 3QY9A 2IUUA 4FW8A 5F7XA 4CM3A 2LBPA 3QVWA 4IAOA 3EUWA 4NOJA 4H15A 4LE2A 2EFYA 5H1YA 1YZQA 2YCBA 5FOSA 5TPWA 4KVGA 2G9QA 3ICPA 3HSSA 4M1TA 3MS7A 1U8UA 2XLBA 2EZTA 2X7XA 2ZIUB 2H1LA 1PJ2A 3FFBA 4B9EA 4RBNA 4IICA 1K7EB 2FCAA 3QU4A 1DIRA 5A6SA 1OB2A 4FCVA 5JLAA 3T3PB 5EE1A 1GPH1 3P19A 4MS3B 1DBSA 3D4PA 1U4NA 4K87A 5J2UB 1T34A 2B5WA 2DH5A 5TQ0B 5ECWA 4AUKA 3ANMA 4II2A 2KLBA 3B2NA 3HQ4O 3ZBUA 4ETMA 5JCXA 2W9XA 1W75A 1IMJA 2LNDA 3OA2A 5DWQA 1C0EA 3IDZA 5CDFA 3GZJA 4NL4H 4HFRA 2ZIGA 3RS7A 121PA 3C39A 4QASA 3WNZA 3AF3A 4ZVNA 3T3IA 2OILA 5HG0A 3TCNA 3ZGOA 3GGOA 3LXMA 3OU6A 5K3BA 3ZK8A 4AYXA 4JYAB 5KYNA 1LKZA 2FMXA 2GBFA 2MSWA 2QAGA 3O90A 3OF5A 1YGPA 2HMVA 3H1TA 2OESA 4QEDA 1N4AA 1M8FA 1WKCA 5IDYA 2BGRA 1QRAA 4Y1RA 1GRQA 3VZQA 1NY5A 1OA0A 2C83A 2DFTA 3LDGA 1OF1A 3L0ZA 5CEEA 2WHPB 1YQTA 2OE2A 4G5XA 4AUEA 4MV3A 3VNQA 1UPFA 5C5CA 1BVHA 2R84A 3SKXA 3KPYA 3VNBA 2X2OA 2FR8C 4EGAA 2VCEA 2VTEA 4TMWA 3DGEC 3S7TA 3LIIA 3CURA 1XCJA 5KTKA 5MN6A 2J8ZA 5IT0A 1S2DA 5FB3A 3OG9A 3UW3A 2GRUA 4J0CA 4YLGA 2UYYA 1RZVA 2N0SA 2ZIEA 2GEKA 3LY9A 3GROA 4NDZA 1BXGA 1J49A 5BNTA 4K26A 2HJVA 5J43A 2JJ1D 3TQFA 5L9AA 4CLRB 1JQAA 5GV7A 4R9SA 4E33A 2YFKA 2A5GA 2FA9A 2PZBA 2ENWA 1U8AA 1S3GA 3LX5A 5AXDA 4Z86A 3ER6A 3T61A 3HACA 4IDNA 1D2EA 3EIWA 4AY4A 2HNAA 1GD1O 1F7VA 3FCXA 1IQUA 2JI8A 1SKUA 4IPTA 4P0TA 4D26A 2VFAA 1VL1A 5KYYA 4EABA 4QOEA 4LW8A 4R8MA 4QRHA 2FWRA 4M9RA 4LJ9A 2QA5A 1PJTA 2GLTA 3DGFC 4NOKA 4PRYA 4PSUA 4MUXA 5BR4A 3B8EA 2H5LA 3F74A 3OE4A 4CQMD 4RK5A 3THYA 4WKGA 3EGOA 2P90A 2OBLA 1I2CA 3G8DA 3IUPA 2XQVA 3LHSA 1J9ZA 1G3IA 1U0NA 2OGUA 3D8UA 3KJGA 4IHAA 1E9DA 4IV0A 4X3PA 1XDUA 2V3CC 2P2LA 4DYHA 2WUWE 5FUYA 3IAEA 4OXNA 1CERA 4B4WA 5CLHA 5EIEA 1M6WA 5HSGA 3EFHA 3C5HA 1OC4A 2JBAA 2DFPA 4M8LA 4JI7B 3GRVA 3TKYA 1T0HB 1MRZA 1QB8A 1XD8A 2CXNA 3LP8A 3CRZA 3P9YA 1T8YA 1GLNA 4B3IA 1RI5A 1GGFA 2BLLA 2ZIVB 1E5TA 3B12A 4QFCA 5CHEA 2JEOA 4H08A 4LWOA 2DFLA 4YALA 4MGIR 2E9SA 3PR2B 4LVUA 1ZVJA 2I1VB 1D9XA 2H51A 3WRYA 2O06A 3H4IA 5AI5A 3DCIA 4CLOA 1O58A 1D8AA 1CVLA 2PIAA 3CLUC 1UINA 3CYFA 4KWTA 3FPLA 3QEMB 3UHOA 1WXWA 5DTQA 1U8YA 4DCJA 5JOQA 3L7LA 1R0LA 4R0VA 1NT2A 3B5JA 3C3AA 4Q7LA 5IULC 2PX6A 3ML1A 4HK4A 3AK4A 1R8QA 5GY7A 2Q41A 4DRZA 1AOXA 1SXJD 4F5ZA 2QY6A 3ORSA 1XWFA 4MJLA 3BK7A 1X7WA 4CV0A 3AUUA 3S2GA 3SZOA 2GS9A 4BFZA 5JROA 5HCNA 1Z2OX 4BNWA 3B6EA 2V59A 1AUOA 5IVKA 1HEIA 4IXNA 4ZI5A 3B6ZA 2YVLA 1U28A 1V1JA 1AN9A 3BXEA 3WOHA 3IS3A 1WP9A 3NDPA 1RI3A 4CEHA 1ZJ5A 2BTQB 4M89A 5GGXA 1IJEA 4JVNA 5BN1A 3WGIA 3ZVRA 3RC1A 3VISA 1IU9A 3DAGA 2V0CA 3LQ1A 4RGVA 2LDBA 2HEGA 2WU1A 2ADFA 4O4IA 4WEQA 5KNCA 1XF1A 1TYEB 5ESRA 3AHDA 5TT0A 2XKJE 3ZR4B 4M1SA 4F5DA 5TMBA 5KOYA 2OZVA 1WQ3A 5K6AC 1KI7A 4ACBA 3G6WA 1ATIA 1OYOA 4KQMA 5CPBA 4BO9A 1KJZA 2AOTB 3B1JA 1CBUA 3ZXXA 4MQMA 3E48A 3JWPA 3OJLA 4PC3A 2UZ1A 3R7WB 4N6GA 1GKLA 4KBGA 1DEHA 1EG7A 2ZSDA 3MQFA 3WQHA 3DV2A 3AOEA 5L3QB 3IVMA 2JEZA 5DNYB 2OFOA 2RCYA 2IFTA 3GZNB 4PLCA 2Q50A 4UEOA 2FRDA 1U63A 1U5AA 4DLLA 1G3MA 1LRLA 3HWX1 4M0EA 4OA8A 2VHTA 3S40A 1CDZA 1Q20A 1Q95A 2YV4A 3PEEA 4F8EA 2DU8A 2PUBA 1OB5A 4DABA 3GBPA 2OY0A 1RAIA 4HEQA 3ZQUA 4Z4HA 5HF5A 4RZQA 3HBJA 1EM8A 3RF6A 3TRKA 5D00A 5LYJB 3CC8A 1WZ2A 4ZPJA 4DQKA 3E53A 3QX8A 4NAHA 5B1SA 2C9ZA 3ILHA 1GPYA 1Z37A 1SQ6A 3E7DA 3AM4A 3EG5A 4JT2A 4OHWA 3RS0A 4N3BA 1V7CA 2PBLA 2QU7A 2UDPA 4MV5A 3RWOA 5EJ4A 1BEUB 3DA8A 4HQKA 4R71A 2FPOA 2PSFA 3QVKA 5KHAA 1VE9A 1WXGA 4WCFA 2QSYA 3IUJA 2PNJA 2ISSD 4PNPA 3F5MA 2X3FA 2HHLA 1DWUA 2QJFA 1N2CE 1UC8A 3Q41A 4R98A 1D7AA 1GQQA 1V5WA 1FDWA 3NC1C 4J76A 1C0PA 4RABA 3H18A 4Z0TA 5CB0A 2Z2YA 2C7QA 1PD0A 2OENG 4MP8A 1RLTA 1ZIDA 3GV0A 1Z0DA 1Y3DE 3TE6A 1JDVA 1ZRMA 1FYWA 1TCVA 1EP1B 2PSDA 3F97A 4Q3NA 3R3SA 1VKHA 1F2DA 2VT2A 4RF5A 3SHTA 3AHJA 4TT3A 3FSGD 3UQYS 4HB3A 3VZSA 4EMBA 2BFDA 1G291 4NH0A 2RI6A 3EZGA 2DP4E 3V4SA 4BMOB 4CRWB 1ZVQA 2PUJA 3I6YA 1ZAYA 3LE8A 4GE3A 2C59A 1H2HA 2A3NA 4LSZA 4Y6RA 3WB0A 1JEYA 1SHZA 4M1EA 2ENUA 4JSRA 5EPUA 1ZJ6A 1Z4KA 2AXNA 1J2UA 2IU3A 3NBYC 4FMPA 4JP8A 5DGHA 3MLEA 3MJVA 1TIKA 3HYTA 6AT1A 5AOCA 3ECCA 4KB5A 3AT1A 4DLRA 2W58A 5ADWA 2OGSA 5IC4A 1C8KA 4XD2A 4HGZA 1VJTA 3MAJA 1GA1A 3ROZA 1RHQA 3HN7A 1KOLA 4F0JA 2VJYA 1D04A 3N0RA 3BH0A 1TRKA 4KNWA 1YQWA 2VOEA 1WVGA 2YV5A 1MAUA 4P4LA 5TS2A 2DSNA 3BJIC 3N75A 1XMJA 5EJGA 4KCGA 1QGDA 2G28A 2PZMA 5EE9A 4HUTA 2CLHB 2ACEA 1UAYA 2F1HA 3DEJA 1SEVA 1DUSA 1D4AA 4J0HA 4G2TA 3X1WA 1IN5A 4TZ0A 5K0FA 1HX7A 2VTBA 2J9RA 1E1YA 2V7W