4RK7A

Crystal structure of laci family transcriptional regulator ccpa from weissella paramesenteroides, target efi-512926, with bound sucrose
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
270
Chain Sequence
RVVGVVVPLIHTNFADEIIKGLYETTISSGYELLITYLDEDEDHQYQVFQTLLSRQVGAVFMLSLDIPSWMIDKLLEEQISVISLTALLSEQISAVTSNEFEMMNSIVDYLIDMGHKNIALVGDTKLTTNISSTRRTNFIKSMTDHNLAYENIFLYGNDHSYETGYTSVTTGYDINQLPFTAAIATADMVGQGLINAMSDHGKTVPEDLSIVTIDGLQQTEIARPKLTTVKQDFPEIGRIAMQLFLDSDEPQIIYIPTELIQRDSVLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Glucose-resistance amylase regulator
publication title Crystal structure of transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926
rcsb
source organism Weissella paramesenteroides atcc 33313
total genus 80
structure length 270
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A01
4Y9TA 4HYEA 3JVIA 5FBKA 1JX6A 4LZLA 3KJXA 4ETIA 1PEAA 3BBLA 1USGA 1QP7A 3HDGA 3G1WA 5JNWA 2N9UA 3LUGA 3TO5A 2GWRA 2DRIA 2MYNA 4ZYLA 3RH0A 5JNSA 3QX9A 2QU7A 1C0EA 1OXBB 3O75A 4MR7B 5B3JC 4KNYA 4MR9B 1FFSA 4G0QA 5HM6A 3FGZA 1RZRD 1KMIY 2FEPA 4KK4A 2WWVD 1WETA 2VUIB 1DG9A 2CWDA 4YV7A 5BRAA 2PUFA 1JBEA 1U8TA 1VLZA 2LPMA 4MS1B 5IBQA 5FWYB 4G0PA 2PUEA 2FEWB 3IP9A 5JS2A 4S04A 3P9YA 3DGEC 2FQYA 5DCLA 1J56A 2VYCA 3Q7SA 4N0PA 3SNKA 2M98A 2PKXA 5CNKA 1XWWA 4IRXA 5KI6A 4OG2A 4KRFA 2ZWMA 3SAJA 1BA2A 3QELB 4YP9A 4WT7A 3T8YA 3LUKA 1LJUA 5EWMA 2NT3A 1TMYA 5FBHA 2I6FA 3RVMA 1DCFA 3ILYA 4RKQA 4RWEA 4E7OA 4W5OA 2W42A 2IYNA 4YO7A 3MYYA 3H5OA 2FMFA 4RK0A 3RVJA 1DRKA 3GV0A 1GCGA 4H3HB 4LRQA 4N03A 2IPAB 4Q6WA 1W25A 1YS7A 4F8JA 2A9PA 3EDCA 5ED4A 1GUBA 3H1FA 2MSKA 3CTPA 3KLNA 3LUFA 1JWLA 3QLTA 2QSJA 2ID9A 1D2AA 4RSMA 2FQWA 5TPZD 3IP6A 4RK7A 5BRJA 3GBVA 1JL3A 1YK0A 3H5IA 3L6UA 1E6MA 2GKGA 1TLFA 1XHFA 4YLEA 1A04A 4EYKA 2PUBA 1ABFA 3CRNA 5DKFA 4HNRA 5BR1A 2M1ZA 4RKRA 3CG4A 5EWLA 4TN5A 1M5UA 1NXTA 3NBMA 1Z12A 1MVOA 5ABPA 3HSYA 3H5VA 1YK1A 2CHFA 3FFXA 1C4WA 2X7XA 5KC8A 3C97A 4PYRA 4MS4A 1FQWA 1A0OA 4PICA 3W9SA 4NCAA 1QQBA 2KYRA 3CG0A 3I45A 5EWMB 4DQDA 4E7PA 6CHYA 4D74A 3TD9A 4Z99A 3OLWA 4JB2A 1DBPA 4JAVC 4W5QA 4IF4A 2JVJA 4RS3A 2YHBA 3KTOA 3GRCA 4KPYA 3N53A 4W5NA 5TQJA 1QQAA 1KRWA 2A9OA 1TM2A 5CHYA 4EUKA 4KREA 4O1HA 3OQMA 3CNBA 4MR7A 5C5EA 3O1IC 4RXUA 5IEBA 1EFAA 1YMUA 4MR9A 2A9RA 4NV3A 1F4VA 3D8UA 4XAQA 1EWVA 2B1JA 2NZVG 5KQLA 3HJFA 3CKMA 4ETNA 5DLEA 3VNAA 3BREA 4OBBA 1U0SY 4H60A 5FWYA 2PUDA 4G0XA 2L2QA 3URMA 3BILA 2QVCA 1P2FA 4M88A 2RJNA 1MB3A 2ID7A 1R8JA 3H6GA 3ROTA 1JFSA 2F8SA 3OM0A 4IILA 4Z4EA 5JNRA 1QO0D 4G97A 3F7NA 3Q15C 5CNJA 2PLNA 3H75A 3NNNA 5HKOA 3M6MD 2AYZA 2P4UA 3EQZA 2WJAA 2HPHA 4B09A 4Z4HA 2MYTA 3C6QA 4QYWA 3L49A 4Z4GA 1Y1LA 3EODA 2FMKA 4DADA 1P6UA 4WWHA 1RZRA 3JTEA 3OQOA 3O1HB 4P1ZA 2FMIA 2MYUA 2MYPA 3KCNA 3EQ2A 2QW1A 4RDCA 5IC5A 2MSWA 3CHYA 1JFTA 3CZCA 2AYXA 3GWGA 1K66A 4FB4A 1YMVA 4TMYA 3HZHA 1BDJA 1PHRA 4RK6A 5FWXA 3FMVA 3GT7A 4YRZA 3M9WA 2E4VA 3MF4A 4JP1A 1YTUA 2NT4A 3E3MA 1VRVA 3A3KA 2IPLA 5DGCA 3HUTA 1AB5A 3LTEA 3N0XA 2JVKA 3F73A 5JNTA 1JH9A 2WB4A 4N0QA 1QKKA 2CHEA 2FMHA 2RGYA 2E4YA 3LOPA 1M2FA 3MM4A 4KMRA 3DLHA 3LUHA 2JB9A 4O5AA 1LBIA 4Z4FA 4G0ZA 3KKEA 2PUGA 3JY6A 4S05A 3C3MA 3LUCA 5KC9A 5TPZA 1QP0A 1URPA 1APBA 1VPWA 3SQNA 2L17A 1E2BA 4MAAA 3FFTA 5JS1A 1LK0A 1NATA 4L85A 3UUGA 8ABPA 3Q7RA 1UDRA 4Z4CA 6ABPA 2FN9A 5JNUA 3SM9A 1GCAA 4WUTA 1USIA 3R0JA 3OMWA 4FE7A 3EGCA 4N76A 3C3WA 1NXWA 4KV7A 4UHKA 2HQOA 3OO1A 4Z0NA 1S8NA 4RK1A 3DGFC 2PAFA 2FSPA 1ZVVA 1EWKA 1PEYA 3JPYA 3QEKA 2NZUG 3K9CA 4YS6A 3T95A 5IUKC 3LUDA 5D2CA 3NNSA 5FWXB 1DC8A 5I4CA 3I42A 4RXMA 3OLVA 4Q7EA 5KQMA 2HQRA 1A2OA 2V0NA 3OQNA 1RNLA 4RK4A 3F6CA 1DP4A 1DJMA 1SD5A 1W9HA 4L4UA 1JF8A 4TLLB 2FN8A 3HCWA 3UK0A 1DC7A 4RY0A 3CS3A 3NHZA 4H3KB 4IMJB 4MQEB 3O1JC 1KGSA 4EY3A 2FTKE 2QR3A 4EYQA 3GBPA 3TX6A 1XHEA 3BRQA 1USKA 3MA0A 2B4AA 4GPAA 4XFKA 3T38A 4KQ9A 5HQJA 3OO0A 3D02A 1JYFA 1ABEA 4FE4A 3BRSA 3RVLA 2IOYA 3LUJA 2PMCA 3FDFA 2FKAA 1SXIA 3I09A 2R25B 3NNDA 4EVSA 4MLCA 4EYGA 3OMXA 1MAVA 1QO0A 3A10A 4KZKA 5E3JA 2QV0A 4OLAA 1NXXA 4WXMA 4ZJPA 3M9XA 4QICA 2NUBA 2PUAA 1NXOA 3H5TA 2R4QA 3H6HA 5IUJC 3CLKA 2MSLA 5GOTA 5HSGA 1NXVA 4RU1A 4ZMSA 2L18A 2OENG 2PL9A 4EVRA 4RY8A 4RXTA 3H5LA 5TPWA 5T7BA 4CBVA 1BDIA 1CHNA 4QYMA 4N41A 4RV5A 1E6KA 3RVOA 1VKRA 2JCGA 5BQ3A 3DBIA 4XARA 3KLOA 2OQRA 3IP5A 1TVMA 3KG2A 1SXHA 5JNVA 1D1PA 5TQ2A 4ZPJA 4OLBA 1CEYA 5PNTA 3E61A 2XDYA 3B2NA 4W5RA 1EHCA 3MIZA 3RVRA 1EWTA 2GI4A 1DRJA 1ZDMA 2H3HA 3ILHA 1JHZA 1MB0A 1RPJA 3EULA 4JA2A 5TQ0B 1D4ZA 3F6PA 3S99A 2JRLA 1Z2EA 4IGAA 4MS3A 4D6XA 1EAYA 1GUDA 4PE5B 4JOQA 2E4XA 3QX8A 9ABPA 4NCBA 3QEMA 4RZSA 3RVKA 2E4UA 2JVIA 2LP4Y 5C5CA 2FEKA 1RXEA 4JASB 4MYRA 2HJ9A 4G86A 5CNIA 1TJYA 1DZ3A 2LUOA 4IMIB 5KWSA 3HXMA 3O2QB 1ISRA 1ZH2A 4QPJC 3RQIA 3Q7TA 4ML3A 5IUNC 4EVQA 5F64A 4KFCA 2IPNA 2WJWA 4G0MA 4YGXB 3RVSA 1DCMA 3NHMA 4Z9AA 3O74A 4F12A 1T34A 1YVUA 4MPTA 4UHJA 4EYOA 4XLTA 2JBAA 3HS3A 3LKVA 5TPWB 1BVHA 3GL9A 4OTZA 1H9CA 4MQEA 1FFWA 3ROFA 3G85A 1NXSA 1SRRA 2QXYA 3QLVA 3IP7A 1OXKB 4KQCA 1QPZA 2BGGA 3RVPA 5T3YA 2IPMA 4NICA 3DLBA 3MMNA 4OATA 3JPWA 3C3KA 5KQGA 5TQ2B 4O1IA 1ZHHA 4MR8A 4MRMA 4LDZA 1AB6A 2RDMA 4EGSA 4Z4IA 2VUHB 1CYEA 1ZITA 2L19A 4MGEA 2PUCA 2FLKA 3H5WA 4YR7A 1QMPA 1DBQA 2GX6A 3KYIB 3UKJA 2YHAA 2LBPA 2Q5CA 2ZAYA 4G0OA 4MS3B 4RK5A 3CZ5A 4LX8A 1JDNA 1JFVA 1E6LA 3QEMB 1P6QA 1U2QA 3N0WA 3QLVC 1KRXA 2R47A 1Z16A 5EWJA 4MQFA 1JDPA 4TLMB 3N8IA 4W5TA 5IULC 4P98A 4GNRA 5DTEA 2RJOA 4D6YA 4KK3A 1GLGA 3FFWA 2P9HA 5IX8A 1YS6A 1ZAYA 1B00A 4HNQA 3N0RA 2H0AA 4XASA 5TE9A 3SY8A 2TMYA 2F8TA 2HSGA 3IDOA 4KVFA 3JVDA 3Q41A 2A9QA 1ZGZA 3JS5A 3LFTA 5GQSA 5KQPA 1U2PA 3T6KA 2R48A 1FFGA 1RXIA 1FSPA 2E4ZA 3H1GA 3HDVA 5CNMA 1QP4A 3CU5A 2JBAB 2JK1A 2WY2D 2WMYA 2PE5A 4LE2A 1HEYA 1K68A 3A0UA 1NTRA 1Z17A 3HUUA 3O2SB 3TB6A 3N6VA 1D5WA 2QVGA 1JLKA 4MLDA 4PEVA 3VNBA 3EJWA 3O21A 1NXPA 1ZH4A 2QZJA 1D1QA 3GA5A 3GYBA 1DCKA 1SXGA 3KYJB 1QNLA 5TQ0A 2VK2A 1U04A 2PL1A 1I3CA 4MR8B 4MRMB 4YCSA 3HM9A 3N75A 1ZN2A 2WRZA 3LUAA 1Z18A 3H1EA 4ETMA 3IPCA 2FW0A 4JB0A 1ZY2A 2IKSA 1Z25A 3RVNA 3HK2A 3IPAA 1LBHA 2IDMA 3OLXA 5IEJA 2FLWA 4LDAA 4Z9BA 3I5AA 3LMKA 1Z15A 4MQFB 1M5TA 5EWJB 2FQXA 4LE1A 2PJUA 3RVQA 4WXEA 3O2JA 3TMYA 1Z13A 2J48A 3Q9SA 1NY5A 3QLUA 1PUXA 4WZZA 2GBPA 3OLYA 4NQRA 2FVYA 1LJLA 1L5YA 3OM1A 3KS9A 4MS1A 1YIOA 2HQBA 3CFYA 3EAFA 4N47A 4F3TA 7ABPA 1P8AA 4XXHA 3KSMA 2FXIA 1F51E 3HV2A 4PZ0A 1MIHA 1BDHA 3HVRA 1ISSA 4Q6BA 1Z26A 3HEBA 3DZDA 3KHTA 3SG0A 5EWLB 1Z2DA 3QK7A 2O20A 1BAPA 3A0RB 1DBWA 4YWHA 1ZESA 3QELA 1IIBA 3K4HA 4DN6A 4LE0A 3LKBA 2CD7A 1M2EA 5B3JA 1ZGGA 4G0YA 4F11A 4F06A 3HO1A 4HNSA 1JYEA 2LIVA 2E4WA 3OLZA 1PNRA 4MS4B 1L5ZA 3QLUC 4ZMRA 4RY9A 1PNTA 3MQ4A
chains in the Genus database with same CATH superfamily
2X9GA 3M3PA 4MVJE 4IDAA 2YN2A 5DBHX 1XQVA 4LSZA 1WTAA 3QJYA 5K99A 3C6ZA 3RJZA 3KJXA 3KU4A 2I8LA 3MBKA 1OWNA 2BUCA 3OM8A 3ZHBA 2V6FA 2OBLA 1C9YA 2EQBA 4KR6A 3NCTA 1KZGB 1O94C 2CYBA 3ZXSA 2AW5A 4KBGA 5CITA 4DA4A 4B7XA 5IXYA 4OIMA 5MF6A 2P3LA 4Y6RA 3HCEA 2C7PA 3KDSE 2AOTB 1M1XB 4DA6A 3QE4A 4KNYA 4IR7A 4ZKEA 4MPJA 4BRWA 5DN6D 1SIUA 5HM6A 1N77A 2QN9A 4YV1A 2C94A 2FEPA 3HKEA 2WWVD 1A72A 1E5DA 3P2YA 3F90A 1I5RA 2F2TA 1YFLA 1U8TA 3W2GA 2J9XB 4YGYA 1CZRA 1PQPA 5SY4A 3KJNA 1HT1E 2IU6A 1YJXA 1CRLA 4S04A 4XE5A 1LTKA 5C8YF 4TKZA 3Q7SA 3NTOA 3LQRA 4WY8A 3TFWA 4Z5XA 1AS3A 1QIGA 2PD4A 2VHWA 3RYCB 5JARA 3ETDA 1H4TA 4C87A 1XJCA 4KL8S 5KIAA 3CWZA 3JWHA 3DCNA 3F7MA 2IY9A 3MT8A 2YUTA 3REOA 2QTHA 1XVVA 4JKIA 1U1CA 3R9XB 1GP2A 3N0VA 4NBNA 4CKCA 3BWVA 2WYWA 3KK0A 5LLDA 5KNBA 1L5GB 2ZRKA 3O8QA 3CRVA 2WOJA 4HWGA 2VIIA 4LC1A 5HDBB 1MJGA 2ZUEA 1PW7A 2ZRNA 4F8JA 3LWNA 3OSZA 1TI7A 2G25A 4IHKA 4DBVO 2CSUA 3IBSA 1PNVA 3HVUA 2NZJA 2VYNA 3FTCA 4OQ4A 5EMNA 5LBIA 3FBWA 3DEHA 1XRNA 3FUWA 3MWDA 5GJWC 5J2TA 1GTSA 4CCYA 1E9DA 1ISIA 3QU7A 4MKZA 1Y0BA 4DV3B 5JO0A 1V8BA 5F2EA 4M0DA 1HE8B 4P31A 4Y6PA 4BPRA 3GUUA 1NE2A 2QLTA 5KTRA 2FHPA 3PX7A 1GYRA 3CIOA 3EIUA 2P7HA 3HKEB 3N2KA 1RBQA 1O8CA 4QXPA 4RF2A 5B1DA 1XA3A 5BR1A 5AW0A 5JASA 2HX1A 3CG4A 4Q15A 3BGSA 1NPDA 3I6ZA 2AG0A 4FBMA 4UBMA 3HU3A 4DMHA 1SGWA 2VA9A 3PEVA 2CHFA 4GP9A 5B37A 4DQLA 1XDGA 3EFOA 3NP9A 4MGZR 1BOFA 2C9CA 4FGKA 1YR3A 5DX8A 4YRKA 2C88A 1LNSA 4ALMA 3WZLA 3WGUA 4DA0A 2C58A 1J00A 1NVVR 1R9JA 3NOOA 4M9SA 1JA9A 4Q9HA 3K0SA 1CB7A 4L7QA 1KOFA 1TKCA 2PX5A 3B6IA 1GOTA 1LF5A 3NJ4A 4C0LA 2RI0A 5H3LA 1LK5A 4IM7A 4O4LA 1J23A 3E23A 3BWEA 2VG8A 4NZPA 4OB7A 5HGJA 3VSEA 4MZDA 4AJ4A 2GERA 4MEJA 5KO2A 4I50A 3PBKA 1Y3AA 2YXNA 1HY3A 4DJJA 4E2FA 5H4GA 3ZHZA 2ACEA 4YACA 1YVDA 2VP2A 1E1LA 2AC2A 2UYOA 2X6TA 4L0QA 5JC8A 4KREA 4OQDA 2W37A 4WZ6A 4FKZA 1JMVA 1U3GA 1VHDA 3CH6A 3CSDA 4PFJA 3ZE8A 3MWDB 3CF6R 3U26A 2GRAA 1SK9A 2B1JA 2NZVG 1LRKA 3BFPA 1P17A 3N8GA 4CCYB 3PL1A 1BHSA 4FFBB 4FJ0A 2X4IA 3DG9A 3QLEA 2JAXA 4YAKA 1NRJB 1UPTA 1CNMA 1YBMA 2ERXA 3GGPA 4IV5A 4U2GA 3O8NA 1W0JA 1YOBA 3R8CA 3N2KB 1COWD 4CLDA 4HNVA 2V6IA 2AVNA 4QNMA 4Y2JA 5IXSA 1JQBA 3H7AA 3P32A 3VPCA 5A5EA 1PK7A 3EMVA 3AUTA 1J70A 1AV7A 1OYYA 5COBA 1D0SA 3UB3A 4CRWB 2IT1A 4PZCA 3RC7A 2BH9A 3CRW1 2WTUA 4Q4JA 3F7NA 1VE6A 4MP8A 3U4AA 1AKUA 3QRWA 2RC6A 4YAGA 3A14A 2JGIA 1MC5A 2PGDA 1FFAA 1R9NA 2PYIA 3E9MA 3HADA 3NNNA 3T5AA 2EDAA 4V24A 1G4UR 1TPYA 1M6NA 2A14A 1ZA2A 2R8EA 4BRSA 1RADA 4DBZA 5A0FA 5FPTA 2J46A 3MFYA 3QE2A 3T52A 4Z4HA 5B2FA 4O4LB 4AU1A 5DYIA 3WY9A 1B6TA 3PE4A 4FHFA 3W79A 1Y9DA 5DVZA 5T4EA 4ZTBA 1QHFA 2H7CA 4I50B 4ILEA 4EL0A 2EGGA 2DH6A 3ZH2A 2FN3A 3CRQA 4DG8A 2MYPA 2YVAA 1L1RA 5IF3A 5HEKA 4DJFC 2QP4A 1NXQA 4H1WA 1VHWA 3GNSA 2MSWA 2X9VA 3SHTA 4JC8A 2X41A 4JDPA 1RJWA 1I0LA 1BJKA 2XHEA 2IW3A 3K96A 4FFMA 2QAJA 4G07A 4O0LA 4OI4A 2R60A 4P35A 5H3CA 5JTUA 3PPWA 1XYGA 1Y81A 4FYYA 2GEFA 5IJAA 4B3SB 4WI1A 2FX3A 1BDJA 4RK6A 3BGDA 4ZEWA 3ED1A 2DUWA 3QWAA 1L5LA 1HE5A 2WMOB 1Z0KA 3SJAA 2NVUA 5F1OA 3VR4A 4WW0A 3RFXA 1GYQA 1X15A 1RI2A 2XDWA 4JP1A 4M8SA 5EINA 3S1LA 4DOMA 5IXJA 3EWIA 3VKWA 2F3RA 2F90A 1WDLA 2P9QA 1YFZA 4MVYA 1XF9A 2OTCA 1E66A 3BUSA 5JJLA 4WKNA 1P1RA 2Q5IA 3E5HA 1OFVA 4N01A 2FMHA 4DYDA 5EE9A 2RD2A 1HMYA 2ZWIA 1L4BA 4Q4JB 1I36A 1L5HB 5ULLA 5GIPE 4KMRA 3KD2A 2O5EA 2JS7A 3G2IA 4M0KA 3QU5A 4JS0A 4JT2A 3ER6A 5EZYF 3QBTA 2R5NA 4MHTA 3KJIA 1IEXA 2PUJA 4LF7B 5KNCA 3N7UA 4CKYA 1G21A 1J21A 1VE5A 1O58A 2XCIA 4GXTA 2A4MA 3JQAA 3UXMA 1LK0A 3JVUA 5E8JA 5C53B 2Z2XA 3N8NA 3C41J 2FN9A 2J0VA 4JNKA 1V43A 1PYOA 2QVLA 5K0ZA 3KOXA 5I7FA 1BYIA 2PUWA 1L3BA 5CMLA 2CHQA 2P91A 2AZXA 2Q2QA 5J40A 1OA0A 4B3BA 4MVJG 4D98A 1O6ZA 1W49A 2IU3A 2W2TA 4YS6A 4RVHA 4XJTA 4BLUA 4HAYA 5D2CA 3K9QO 2JZCA 5KX5B 1V96A 3HZRA 4RXMA 1K6EA 1NR1A 4C05A 4C3OB 2R79A 2WU4A 3URKA 3LIPA 2JIRA 3DA8A 2GN9A 2VL7A 1RKBA 4G41A 1V95A 5ICEA 2BJHA 5FT9A 3OQNA 1SBNE 2DY1A 2GBLA 4OCZA 1WE2A 1V5GA 4E2WA 3SIXA 1C3XA 2B98A 3PQCA 3V42A 4PXYA 3EOBI 2YHIA 1XFDA 4I1YA 2WHPA 5CB0A 2GM4A 2EP7A 2HAEA 1G2QA 2H2AA 4EUFA 3KKQA 4B3TB 4X64B 4FI3C 1GJRA 1XELA 2F4NA 4NCNA 5F2KA 4DILA 5JZOA 3OEED 1ANKA 4KODA 2HY7A 3C5VA 4S1OA 1DWOA 3BK2A 2GA9A 4K3UA 4RLSA 4OAQA 1VE3A 2ZETA 2CVQA 3WGHA 1G21B 2VJMA 1PFGA 5DLDA 4Q3DA 1E1QA 3IOYA 4JLPA 1QQ7A 2Y9PB 3BGWA 2NW6A 3FRHA 5ALQA 1WUHS 4UU7A 2XWPA 5JZVA 1V41E 4LC0A 5HKLA 4W4TA 1HEIA 2LNDA 1TLLA 1JKMA 3NPAA 3P7MA 2BD0A 1GTRA 4K1LA 4WBXC 4EZBA 3GOHA 2OB1A 2IYTA 2Q4BA 4YT8A 3NNDA 1N1DA 4KZPA 3L0ZA 4MIEA 5TDHA 1THTA 3EAGA 2LE0A 2J5RA 4W1QA 3A10A 3V1MA 4F3KA 1TAHA 4XSGA 5G3ZA 3ES9A 1QTIA 3DQPA 1RVDA 1PZEA 221PA 4HNTA 2VP9A 1XVLA 1VBKA 2R4QA 1BVYF 4TYYA 2DAPA 3E82A 1NXVA 2HBZA 4TTVA 4NEHB 2JFZA 3ENVA 4FCWA 3VOAA 3RO7A 1E7YA 3FI0A 3UPDA 2JHPA 2CV0A 1RWVA 2N0SA 3F2IA 5E8RA 3NHJA 4BO5A 5IS2A 4RV5A 4C7KA 2PU7A 2XTNA 5F7ZA 1QKIA 1WS6A 2QD4A 1FJ2A 3LQQA 4CFSA 3JZDA 1W75A 1WVIA 4A8JC 1Z6PA 5BQ3A 4D0NA 5IANA 1NBOA 1U6IA 1UZUA 5HE8A 5GGXA 3SWWA 4YUXA 3AY3A 4FDTA 1JLRA 2LTAA 3HBJA 4UBNA 2DX7A 2G5PA 1ZJ6A 5C1IA 1CEYA 1JHQA 2CUKA 1P2DA 4RFVA 1EHCA 1Q50A 4PSDA 1VA4A 4W5JA 1ZYUA 3QENA 1RPAA 1XA4A 4NFYA 4ZEXA 4AK9A 1W36D 1OAAA 1QGOA 4MV1A 1RPJA 4NYMR 4PZDA 3CJRA 1OF1A 4FNGA 2I03A 1LV8A 3AERA 2OM6A 4IJ5A 1XB2A 4JOQA 3GUVA 1DJOA 3MBIA 2GBGA 3CW9A 3I37X 3OT1B 3H97A 1SHJA 4LJ8A 521PA 4ZRDA 3SC2A 5ISMA 3LHDA 1A3CA 4IMIB 3PUXA 5KWSA 5K09A 2I99A 1ISRA 3KUCA 3ZCSA 2YRXA 2W00A 1NRWA 1VG1A 2C77A 1MX1A 3UV3A 2XMGA 4C20A 1B93A 4CL8A 4EVQA 5IUNC 4FDAA 1AKMA 1VYTA 2IDKA 3IALA 3IR5A 4B40A 3WTCA 3AK4A 4RTPA 1F6DA 1V6AA 2ONKA 3V3TA 4OYRA 2D1QA 1BG6A 1KK3A 1YNOA 3JD3A 3KP1A 3NC1C 4AMUA 1KQGA 3S8YA 2GB4A 1EUQA 4YJHA 4BB6A 4RNDB 8LDHA 1B43A 1T4DA 1W44A 1UK9A 3GVCA 3HS3A 1FJGB 5K3SA 2XMQA 1RCFA 2O5CA 4JC0A 1VXOA 4R0NA 4JI4B 1FW6A 4A8PA 2AG8A 3BTVA 1KU6A 4J0HA 3V55A 1KK0A 1L7VC 4Q9LA 3RVPA 4HGOA 3AF5A 3CEJA 1GQYA 1QG2A 2NO0A 2WHRA 5KVCA 4YJFB 1A9ZA 4F85A 1DCTA 1RI3A 1MV5A 2FHSA 2IUYA 3KEOA 2UYGA 3QLJA 4JCOA 5JJIA 3AJ9A 1E2KA 1J97A 5BPFA 3L7JA 2C3OA 3ANTA 4PLHA 2CXUA 4L5AA 4EFLA 1UM8A 2HWKA 1RWOA 4P82A 4IJKA 3CWQA 4QEKA 2LBPA 1B76A 3PSHA 4P7KA 1DQSA 2ZI3A 4TGLA 3RUHA 4BATA 4CCSA 3AERB 3IQGX 1Y4SA 2QI9F 3LX4A 2E55A 2PNJA 3WLLA 3X1JA 4RDXA 4ZI7F 1R4AA 2D5CA 3W9YA 1Y1PA 2XCLA 4G5RA 4MQFA 3SC2B 1AZWA 4PZYA 2ANCA 2ZEJA 2UUBB 3IE2A 4X20A 2CHGA 3PA6A 1U2SA 4M0MA 5AKEA 3IIIA 3VX3A 4MGHA 5THXA 1PR2A 2PJZA 4JYPA 2W58A 3FKSA 1H0RA 3WKBA 4PGGA 4C4RA 1TQ6A 1YQXA 1J4AA 4RE5A 2H48A 3E2IA 3JS5A 3PRKE 4ARZA 1ZONA 5LZ8A 3UJ8A 2R48A 3CLTD 3JD1A 4K9NA 3GLGA 3PI7A 3EF1A 1KP9A 4YJHB 3TLEA 4BQFA 4A4DA 3LWDA 3USZA 1VCMA 1Q0QA 1RLTA 1UJNA 2BCGY 2PN1A 1S5PA 3F6BX 4RSRA 4TV9A 4UUQA 2N1BA 4ZTZB 2Q6LA 2BMDA 4RPJA 1L5RA 5BO5A 1HL3A 5JQGB 5G41A 4EHHA 2OECA 3SDSA 4NK5A 4EK9A 1GAJA 2RCYA 4GI3A 1J24A 1AGYA 1HNXB 4IDGA 4LA4A 4ITRC 2IUEA 4ZRNA 4P83A 3N74A 3MNFA 4BO3A 2F3TA 4PG8A 3LDUA 4R1UA 3IQFA 5A4AA 2Y66A 5KYWA 1NUSA 3OZCA 1NU8A 3HXOA 3JQPA 3H1EA 3H65A 5FUQA 4XYEA 3U3DA 4OUDA 3VVBA 2FA9A 4J16C 4ACBA 4YJDA 1AOXA 4R2KA 1Q77A 3H84A 4LF5B 5JATA 3OLXA 4PC7A 4GRIA 1E98A 1EA7A 1X8JA 4F8EA 4LDAA 5IEJA 4HH4A 4INOA 3LPCA 1S7CA 4UCQA 1DX9A 5FHQA 4AF8A 5F1PA 1FTNA 2DMRA 2PBLA 4MQFB 2FE4A 2PMDA 1E2LA 2HJRA 3GFFA 3KJEA 3E3AA 1HQCA 2ZTLA 1RP7A 4X20B 5ECGC 4BJ5A 4BEBA 1ATZA 2WIBA 4MQ4A 4EPTA 5K05A 2WAXA 1DG1G 1ML3A 5KJFA 2B94A 2QB5A 3AO0B 4WACA 5A0VA 4DRZA 2GZ1A 5AVKA 5HFAA 1CJBA 2UKDA 5EP2A 1U0NA 2P5UA 2X8WA 3OM1A 1HQDA 5ECYA 4RGBA 4OKIA 3TIFA 4ARZB 4I4TA 1XLUA 2NTYC 5AI9A 4WNYA 3GLGB 1CPYA 2ODPA 2QROA 4AXBA 3AVQA 1TKBA 3O91A 3Q9LA 4TV9B 1K27A 5LYJF 4R1MA 3TNYA 2J41A 1DC6A 4UTPA 2PDAA 4QG3A 2ONCA 4R81A 2I91A 3RFCA 4K88A 4HXEB 3WLRA 1NFFA 1JQEA 2C0PA 2DBRA 4G0YA 3ESAA 3Q3EA 1JTEA 3DWIA 2GF2A 2BZGA 4QASA 2HK9A 3ASUA 5KYWB 1G66A 4X1IA 2EP8A 1N34B 3QWHA 1F17A 1MOZA 1ZS9A 1T25A 1VGVA 1GG9A 4YO8A 3G8CA 4DLLA 4XPIA 4YAWA 3GELA 1ECGA 1NW8A 2BLNA 1TVCA 1W87A 2IEGA 3PD1A 1GDDA 4KWCA 4PGMA 4LV8B 2WB2A 5A02A 4I81A 1J49A 5JJ5A 1A5ZA 4A36A 2WP8J 5HF5A 1XT6A 2VO1A 2IXBA 3HJHA 4FYIA 3WFJA 2CXRA 5F9HA 4IDDA 4J7UA 2RGXA 4LV6A 4B44A 4E4YA 2BFFA 4R31A 1ZD5A 2Q2WA 1UPFA 4CKXA 1U99A 3D4LA 2AXPA 2GAFA 4M8LA 1QCDA 5FV7A 5I5GA 2PVPA 1DG9A 4M54A 3MOSA 3NKVA 5KDLA 3V2UA 4IIYA 3ZTYA 4R9VA 3F0TA 5KQRA 2X1MA 2GD6A 3II6X 1S2DA 1SVIA 3CWCA 4GXNA 3DV2A 4KQEA 4L76A 4E3ZA 1OVGA 4RHFA 2A1TS 2VVTA 5JR3A 3AOEC 5FTMA 1FUEA 1KH2A 2WICA 1U9CA 5T4FA 1RWNA 4IRXA 4OG2A 1BZYA 4FMDB 1E5VA 4IG4A 1BA2A 1ODFA 3ZWNA 2Z09A 1UPBA 1UXGA 3GEPA 3T8YA 2I1VB 2Y05A 2C9BA 1W9MA 5TT1A 3RS9A 2YZ7A 4YJGA 1N36B 4RJIA 4O02B 2ZRPA 4I08A 3AB8A 4HADA 5LUBA 3I32A 3IQXA 4HRXA 4LECA 4WLOA 4FCTA 2W42A 1SBHA 4X1IB 1TDJA 3WXBA 4RK0A 1GUYA 2A1UA 3RVJA 3ZVRA 3DB2A 2EKPA 3SIWA 4C29A 4Q9IA 3ZXIA 3RNLA 4XPIB 2HIAA 1EZ4A 3UJ6A 3OUZA 1Z6GA 2B0JA 3MCUA 2VLIA 3L0OA 2FLVA 1FP2A 1ZGHA 2B7LA 2EZ9A 1D6SA 4D46A 5ALEA 3EPLA 1BMFD 3SVZA 1WB5A 2FQWA 3VVLA 1CR4A 3X1XA 3KXLA 5FI0B 1XTKA 1JTVA 1Z7WA 2IXTA 3O4VA 4WERA 3HEAA 5EVCA 3R74A 1IUKA 2ZJ1A 2BFFB 2WM8A 4L8LA 3PIIA 2C5EA 3K3PA 3TZQA 3HMQA 5IYZB 2C42A 1TUGA 1ZJJA 4KV9A 3SMVA 3UAOA 1QS0A 4F60A 4Q16A 1Y7HA 1RJDA 1Q21A 4L8YA 1WXWA 5EP3A 5B7GA 5L45A 4RULA 3N2YA 4KRGA 5LKRA 2WJGA 5JZ9A 2E82A 3CUVA 1VMKA 4ZDJA 5M29A 2CUNA 4BX2A 4MP3A 5L4NA 4HDCA 5KWIA 4RFLA 4WAUA 4U7FA 3AEZA 1SVMA 1U7UA 2AEFA 1ADBA 3O4IA 4Y0VA 5IM4A 3DKKA 1A9SA 3ZKAA 4AP5A 4L3VA 2MINA 1V3QE 4OEHA 2VTEA 1JEOA 3W9SA 5CLFA 3HB0A 4NCAA 1WMSA 3GUZA 1R6BX 2KYRA 1EVLA 3JQ6A 4DIMA 1AA6A 4YJGB 3ZE1B 3WHKA 2H51A 1HBJA 2EBUA 1JRLA 1JXOA 3QPWA 1B26A 2O0LA 5G0UA 2WJZB 3B70A 1CT9A 3EWNA 4IIGA 4PHFA 2W9XA 5K3EA 5DLYA 2PSEA 2A1UB 2B4QA 1SXJA 1E7RA 1YCFA 4FR2A 4JT9A 4YN3A 3WYAA 1KI6A 2HOQA 4HHEA 4CTMA 5A6SA 2BHLA 3C7KA 2JRCA 5I8PA 4JXXA 3QVTA 4ETWA 1NAIA 1Q3HA 1YB2A 4ZU1X 2VEDA 4Q3NA 3NIDB 1FPQA 1Y7IA 4MR7A 2QVBA 4EI8A 2N47A 5EJ4A 3L0DA 3QFTA 4FNAA 1E9VA 3ECCA 2PWYA 4PO9A 4ZT5A 4L51A 3KYCA 5L3QA 4C5AA 1G98A 1GFIA 4AO6A 5GM1A 4OK3A 2XRZA 3Q0TA 2W4MA 4IFIA 3NV9A 1UJMA 4OHOA 3H42B 3RIGA 3T34A 1PZHA 1QS0B 3G2JA 1QIFA 2O4UX 3LAWA 2BJWA 1W2HA 3O3MB 1Y80A 4A0GA 1FZTA 4Y18A 3ROTA 5FNVF 4AL4A 1EUZA 1X38A 4LXTA 2DGDA 1NI4A 1P18A 4MPPA 3MFQA 4QOGA 4X60A 5HKKA 4XFDA 1DTWA 4XYBA 5HNKA 2I22A 4OP2A 3VKVA 3ZK7A 2C5HA 1MB4A 3L4EA 4W7SA 2MINB 4QUHA 3T1QA 2OCBA 2ZTMA 2KW5A 4JBYA 1KZ1A 3HYTA 2QL9A 2HPHA 4BO9A 3V1LA 1NBIA 2Q5OA 3FPCA 3PX3A 1L7OA 4Y2YA 1H3FA 3K0AA 3R7NA 3DZJA 2MTBA 3KJGA 2YV4A 4WWHA 4CT5A 2ORWA 2Y71A 3QEOA 4NF2A 4GI1A 4IOMA 4NPAA 4LOIA 1WF3A 2VHJA 5AHKA 1O4VA 3P26A 1KI6B 3H7IA 4F4JA 2FMIA 4AG6A 1WPRA 1Y1SA 4EQ6A 1XJ5A 2V9PA 4OHWA 1XOIA 3LT2A 4W1SA 4JLMA 1HX7A 3QVUA 3I2IA 3LLUA 1VLVA 2DKNA 4G81A 1L4LA 3K1TA 3Q6NA 5NULA 4FT2A 2IEDA 4FNOA 3KYCB 2PRSA 4TSFD 1F14A 1Q0ZA 2PJDA 1G2OA 3GCDA 2MR5A 3VPBA 4YRZA 4L0DA 1KRHA 2O3UA 3NAGA 4P4UA 1YTUA 2OV8A 5K3OA 4ZCIA 1PS0A 1Z4NA 1CUHA 1R0WA 2B5VA 3DKRA 1NT2A 4PPNA 3H1TA 3HFSA 3NAQA 4LJKA 3G8BA 1UXJA 1G8PA 4CTNA 1Y6GA 1KFKB 4DARA 3RIMA 1FYEA 4JOBA 4G23A 1NI4B 2JFXA 2YICA 1KI4A 1HG1A 3OE7A 3TQTA 2IZ6A 1DTWB 2OHGA 2QJTA 4AF7A 5BW4A 2R2GA 2O8BB 1MG5A 4V2IA 4JI5B 3TOCA 1U0HC 2V6BA 3ID6C 1OT3A 4TKUA 3CKYA 3FSEA 1ZOSA 1G0NA 5CBPA 3JQBA 3A1NA 3LHIA 1X1DA 3FCXA 2BPOA 3UYLA 4CTKA 3K0AB 4WCFB 1VRCA 4LN1A 4MAAA 4LY9A 1C1XB 1ADJA 3ASYA 3Q2KA 1I14A 2IDJA 5GJVC 3Q7RA 3NHSA 4BVBA 5BY2A 4E6PA 1Q1AA 3EYWA 1KAOA 1RU3A 3RAGA 1C9DB 3EZFA 5G1NA 4EQ6B 4MQBA 4PLCA 1E7QA 3C3WA 3OPMA 2NXNA 2HQOA 4NZZA 4EJSC 4LYAA 3VOTA 4RK1A 3ZXUB 4EW2A 4OREX 1RHRA 1LXCA 3DAHA 3RHZA 2P78A 5IUKC 4D4KA 3AMVA 4JB8A 1SCBA 3O4GA 2NNWB 5CAEA 5TMEA 1MJ5A 4DCTA 4KE8A 3LTNC 4LPKA 2CHUA 4V0OA 3EH2A 1GFSA 3DVQX 3U3OA 5CFRA 1U2ZA 4K9QA 3IULA 4A0HA 4DT1A 5G4KA 5LQNA 3KTDA 2PKWA 4MUJA 4UE2A 5JCJA 2WF8A 3KOWA 3V48A 2FGKA 4JBIA 2JI7A 4MEAA 5LJLA 5EN4A 2PZFA 2PBZA 2O0MA 4U6QA 3RC8A 1A4RA 4MUYA 4MSUA 4BQRA 4YXFA 4D25A 3PZBA 1IMJA 1M2WA 1B42A 1JV2B 4B0PA 3C16C 3CPJB 1SG9A 2LCQA 1SOVA 3Q2OA 4QBIA 3TLKA 4CV0A 1FFXA 4O0MA 3RSHA 1STOA 1U7DA 2DVMA 3C3AA 3KZOA 2JLRA 4FYJA 5DHTA 3TJMA 3G1TA 1CLUA 1XQXA 1FXWF 1WMAA 2Q8PA 2WEKA 3EC2A 3OZBA 2CHVA 2IHJA 4GPTA 1E60A 1ETUA 4QUBA 4MH0R 3ESRA 4AX4A 4QRHA 4IICA 5C7IO 2PMEA 1C3VA 3UK2A 3V4SA 3IE1A 2CLEB 2XSZD 2QG4A 1DX4A 3UC5A 1W52X 3DNMA 1KYXA 2VH5R 3I5MA 1R0LA 1FVOA 4D9EA 2B8JA 4BIIA 1ISFA 1NW5A 3JXEA 3CF4G 3CSUA 3VGPA 4D6PA 3D6UA 5JSUA 1XD8A 1V2GA 1YQQA 2YYYA 2PUAA 4ZJPA 2V6JA 5CAEB 5I7UA 1SOUA 3PDHA 4AJHA 4DBLC 1YZHA 3RV3A 3OZEA 3AVPA 1MH1A 3CLKA 1TU3A 3H1BA 2IQ5A 1Y9EA 2VSOA 4CI9A 3C0KA 4E33A 3STYA 1F2UA 1J2JA 4DIFA 4JI3B 1LCIA 4DT1B 5G4KB 2L18A 3TFQA 1D6NA 5LZ7A 2XYHA 2VPPA 3H5LA 4B6FA 4EHKA 3GROA 1NQOA 1Z4IA 1KTIA 4X97A 3CH5A 3NEPX 2C9OA 2CNWD 2AE2A 1KR5A 4UE6A 2YMQA 5JCOC 4TL6A 2Y8EA 5FTJA 5NLLA 3WICA 1TCBA 2AOXA 1KI2A 2XGSA 1ZOLA 3O38A 4FDVA 4IUCS 5T4BA 4RX1A 4HPWA 4DANA 4HBZA 4DWWA 3A4VA 4ZYZA 4OM8A 4PSKA 5BR7A 5CLQA 2XVMA 5CJJA 4C0QC 3MG9A 1EX9A 4CQMD 2PKEA 4XQ0A 1TQ8A 5EJFA 3S2YA 3UJAA 2B1RA 1Z74A 3HMKA 3T4PA 3I23A 5KYXB 3IMGA 3HCOA 3NWEA 2A0YA 1H2FA 1RXEA 4R84A 3I5UA 1DZ3A 3ZYCA 1FJXA 2QSZA 4AZWA 2IL1A 2H7YA 2Q3MA 4PIMA 3JQ9A 3OECA 4K9KA 1XZJA 1VZ2A 1E9CA 4JUDX 4G9EA 1F38A 3KHUA 4RJKA 2BGMA 4R8VA 4C0AC 2EKLA 3O74A 1F2UB 3DOEA 3MCWA 4JVNA 2RH9B 2HO4A 5DISB 5JD6A 2P2CA 4HOYA 2Q99A 4LHWA 4PPYA 4MHSA 4G6ZA 1E18A 2D8AA 3ZGNA 3MGGA 1KO8A 4MQEA 4MPRA 2BEUA 1SKBA 2OCKA 4HL6A 3QMMA 3TTSA 4LDNA 2X4LA 1GIAA 4Q1EA 1F1JA 2IGBA 1ZISA 4LXQA 3LIIA 3G82C 2V6MA 1UBFA 3S29A 4D3DA 1IK6A 5DNCA 2Y1WA 1PK8A 1DMSA 4AMGA 2HWYA 3CR3C 4A6EA 1BU8A 3L4BA 4L1KA 4YMHA 4WZAE 4EGSA 2DECA 3BXHA 3I73A 5FOVA 4GR4A 4RETA 1ZITA 2KMLA 2H0QA 3FOBA 4N8DA 4QULA 1E8NA 2E6KA 4MGEA 4QGHA 1W47A 2SHKA 5EP1A 2C95A 3RGWS 1Z7BA 1XMSA 3VZDA 1LU9A 4S0ZA 3AJAA 3WDKA 2HIHA 3OTGA 3HB4X 3LT0A 4RK5A 4UVIA 3THSA 1JHAA 4BWFB 3GPCA 3WBBA 4D02A 5DIFA 3JR7A 4PAWA 4M87A 1LX6A 3N0WA 2I8CA 2R47A 1Z7YA 5ELLA 1GKUB 3ZNOA 3OJOA 1C3JA 4PG5A 3Q7EA 4QELA 1XU9A 1HTTA 4M9UA 1N78A 3LFHA 1E4YA 4S1TA 4ZU6X 4HN2A 3FPBA 4R0MA 2B25A 5K9ZA 4PF1A 1SH7A 3Q41A 3ER9A 1KFEB 3H9GA 3LFTA 1F3LA 4MRNA 3AZOA 4IIVA 1RXIA 3M3HA 3F97A 2Z6VA 1J0XO 3HM2A 1I6KA 5BYBA 5SY9A 3E5NA 3NW9A 1PJ4A 4GL4A 4M60A 3ZE0B 4CQLA 3SK0A 2A86A 2FPRA 3MTAA 3Q87B 3QITA 4R40A 5KJEA 2DFVA 4BNJA 3F8TA 5B1EA 2IHKA 3NP7A 2UVQA 4NDZA 1WP9A 1K7CA 1N4DA 2WM3A 3HNRA 4XB6B 1W6UA 2CBGA 4MKFA 4GR9A 1E4VA 1VGQA 2POCA 4A1OA 2AX4A 1P74A 3WBKA 4CLRA 3VNSA 3PHLA 4GPZA 3HM9A 2JK0A 3DDSA 3H2GA 2ZATA 1OIWA 4FXPA 1YU9A 4EA6A 1L3CA 3P97A 4QPZA 4HJRA 1XLVA 4G24A 1UCFA 3C6MA 3KQWA 1ONNA 4BO4A 2TYSB 1VHJA 1Z4QA 4LVUA 5DH9A 2X2OA 1KY3A 4D8TA 4MAMA 5FPPA 4URFA 1AD2A 2OM2A 2V4MA 4OL9A 1RDFA 2O3QA 4JSTA 1EJ6A 4EB0A 4HH1A 1M10A 1T9KA 2XEDA 3VH4A 2BF4A 2O14A 3O1LA 1RCUA 4NBKA 4OI1A 3U7HB 5C8YA 4DKJA 3A11A 1N6OA 2R85A 2RGAA 1JR6A 5C8ZA 3QUCA 1PUXA 4F0JA 1E61A 3U1BA 1LJLA 3M1LA 4H7FA 3T7AA 3WYFA 4E88A 3SXUA 1YI1A 3TDMA 3Q5GA 1N6HA 4JI7B 4N7MA 3O03A 2OFWA 5AJXA 1WQ3A 3VBEA 4PTLA 3AYZB 3BXZA 5EKUA 4J0FA 2X9NA 3BJEA 4OHBA 821PA 4AKIA 1Z26A 2GILA 3DZDA 1A9XA 1OI3A 5BQOA 2ATCA 1YUMA 5KPJA 1JIJA 2O20A 5BMVB 4WJZA 2C84A 4RV9A 4M9ZA 1GILA 3A1SA 2J31A 3DAYA 5BSRA 2CD7A 2AC4A 4OK5A 1IXYA 2Z56A 3AYXB 4HNSA 3L40A 5EKXA 2A6PA 3ZWPA 2PX2A 3P2MA 4IQ4A 3RPEA 1K5GA 5THKA 5BPHA 2X42A 4HLQB 2H5LA 4WX2B 2A5GA 3KQSA 4XIGS 3WAGA 1HC7A 3KWLA 4LSGA 3GD7A 2CK3D 2GARA 2PKYX 3DL2A 1C1DA 1H93A 1QE5A 4O4HF 1TEZA 2X3UA 1TM7E 1H2YA 5A0TA 3G3EA 3OTHA 4NK4A 4R8KA 2B20A 3R5FA 2GFQA 2Q7OE 3EAQA 3SVLA 3RH0A 1A9TA 2XMDA 4FM9A 3OCJA 1FFSA 4MWBA 3T5BA 2XXAA 2Q3CA 3ZNQA 4EHNA 9ATCA 5K8IA 3MWYW 1Z39A 2I3ZA 4G5XA 1E2NA 1PDVA 2PUEA 4TMWA 1TCVA 2I4MA 3Q8KA 3AIIA 1NI5A 2EIHA 3IP9A 4N6GA 4RLHA 2CXQA 2GM9A 3ZJUA 2ZRAA 2OR3A 2ESRA 3IOCA 4D99A 3O82A 2QD1A 1VL0A 4M9XA 1F0NA 2Z5GA 2PXHA 3MJVA 5DYTA 2GYYA 3HPQA 4LJ9A 4EA9A 2WD9A 1PVOA 4EHLA 1QPGA 1E79D 3NV7A 3ESXA 4D4HA 1OH6A 2F64A 2EG5A 3HGMA 5CB4F 1OXXK 1PNQA 3BL6A 1QHSA 2H7XA 1V4NA 1N8TA 4XCXA 5FOSA 3O26A 4IO1A 3ROQA 4C4SA 2W7TA 4OQQA 2HBRA 1Q15A 2B6HA 4BUJA 3TRIA 3QW4B 3FPAA 2E37A 4KR3A 4FXOA 3NBZC 5DBGA 2H5IA 1GKLA 3R7DA 1P9NA 2EJTA 1C1DB 4TS3A 3UJ7A 5EJMA 5JWOA 3K9NA 5JFOA 2Q9UA 5DX0A 4DM3A 3ZVMA 3D8NA 3UOAB 3L18A 3AP3A 3D1VA 3SYLA 3JYQA 2XZOA 4HDQB 3QE0A 4EY5A 2ZFUA 4OJMX 1Z6TA 1OXMA 4MW2A 3U3KA 1TZKA 3ZV7A 4BUCA 5A62A 1YK0A 3KXPA 4YECA 2CVFA 1TT7A 2OBXA 3K2QA 5BQFA 1D1SA 3PE6A 2XXAB 1SC4A 1G5FA 1O54A 4LK3A 3CRNA 1FYVA 3WJ7A 5LYYA 4CLOA 3V5NA 2V5VA 4QG7A 2EEPA 3A6PC 5KYUA 4EPWA 3HCDA 1DC3A 2XE8A 3FH0A 1P7WA 3FMOB 3OZAA 3VU9A 2C59A 4X5OA 1UODA 2C2WA 5AK5A 4CQNA 2ALJA 4F6LA 4QD3A 1WXGA 5TB5A 1E6EA 2YC4C 2O3SA 3LCJA 2X7XA 5F2OA 5KC8A 2HMUA 2RH4A 5EE5B 1GCIA 4RJJA 2WHEA 5DSTA 1BFKA 1A0OA 4HAUA 1E2EA 4MUXA 5DMHA 4LXUA 4EO9A 3BGOS 1QQBA 2QTVA 1F7VA 4IEFB 2RHGB 4UVDA 6CHYA 2YIJA 4LWOA 4A2WA 4BVKA 3FZQA 3MUEA 4HTAA 1QYRA 4Z99A 5DV9A 1UK8A 2ZYTX 3P71T 1SVLA 3U4DA 1HDZA 2H9AA 1N2GA 1VECA 5K1ZA 4C06A 3B78A 4P54A 4D4MA 5HJ7A 4X9XA 1AQLA 3EK2A 3GGOA 2NO5A 5AKHA 1CS0A 1XAIA 2GJKA 3CNBA 1G5QA 3DR3A 4GM4A 3SEFA 4PC6A 4YT5A 1XEWY 3E6AA 5I8WA 3SE0A 1NOJA 1SUDA 4H16A 3FCUB 4FCVA 3FB1A 3NHFA 4WLEA 4NBUA 5FPQA 1MIOA 2G3YA 2I76A 1CF2O 3OF2A 1W8IA 4MRPA 2W22A 5CJ2A 2JIQA 1CW2B 3BXEA 2XUGA 3VC7A 3R0IA 5BUQA 2LCIA 4CLOB 2L2QA 1FU4A 3E4CA 1E8DA 1FU7A 5EZYA 1XBTA 3GEEA 1PX2A 1FUKA 1GRQA 1DTSA 2WUDA 4YRBA 1YH3A 3SHWA 3LDAA 4QDOA 4WXHA 5IDXA 4IILA 1O95A 3UAXA 3ZCPA 3VO2A 1YI8A 1QO0D 3L84A 4OU4A 5L3RA 5JNRA 3FD8A 1JMYA 3OQMA 4MUBA 1A7KA 1PFUA 1UP7A 3C6XA 2WJYA 3KVRA 4EJMA 5A9SA 4V1CA 5HKOA 4JVLA 4EY8A 4B8YA 5J43A 2QTVB 4X90A 1K7YA 3BCHA 4I8XA 4OGKA 5FI1B 1RFLA 1XZCA 5LD2B 3L7AA 2X8AA 3H0CA 1NW6A 1RE0A 4S1VA 3ZTWA 4ZYVA 2G4VA 5L3VA 1QHGA 1ZU5A 3TEJA 4QNNA 4JNCA 1WEHA 5DO9A 5FJJA 4H27A 1ZMOA 1V0JA 2VAVA 4EFNA 3OQOA 3UV7A 1NZDA 3ZY4A 1H94A 2QQ5A 5DNWA 2QW1A 2VUTA 3IEIA 1R0ZA 1CS0B 4QVGA 1Z37A 3SZLA 1ECLA 2J6CA 1J2YA 1QOPB 2M2IA 2X1LA 4RHTA 1VJ5A 3QVJA 4QUIA 3DXFA 4I55F 4HT3B 2PJRA 5JS7A 2Q5FA 3PG5A 2JH3A 4FB4A 4Y6GB 4AZ3A 1SVUA 1YMVA 1KO7A 2GZRA 2VTKA 3FLEA 1MIOB 4FYMA 4MUNA 3FMVA 3ZNPA 3UO8B 5AQ1A 3QZUA 3OZSA 5LVAA 1VRVA 1SVSA 5DGCA 4GOND 4XWKA 2C4VA 4LZNA 1B1AA 1SC1A 3ORFA 1P0FA 4BVHA 1G18A 1A1VA 2FG7C 3N6XA 1KYWA 4TRMA 3RD5A 3FR8A 5LOVF 3QKRA 1U1DA 3UUWA 4EAQA 1QKKA 2BONA 4KGDA 4MA4A 1GPH1 4TS1A 5DMXA 3F6RA 3KQVA 3U1VA 1TC1A 2X0KA 4UZFA 3CIFA 4RTLA 1O4WA 4O5AA 2H9IA 2VZ8A 5A9SB 5DT9A 4S35A 2E9SA 5KSOA 2O1SA 1XZHA 3ADPA 3O8LA 3B13B 1FQOA 2F17A 2CXOA 1RWWA 4H2DA 2D54A 1PJAA 1N6PA 1YIDA 3ET4A 3E7XA 4HLNA 1DO8A 5FEMA 4C0SA 1XMIA 5BSVA 1HRKA 1I3KA 4CN9A 4X66B 3I62A 3AG5A 1RJGA 1U0LA 2AMJA 1POXA 1P9LA 2OG2A 3E58A 5K3CA 3ED5A 1NLFA 2QRMA 4Q66C 2Z2ZA 3CLSC 5CA0F 1RKUA 5E1MA 1GPUA 2CXTA 3EDQA 3SZGA 4B31A 1EWKA 2HRCA 3JPYA 1EM6A 3AB3A 4R2LA 4R1PA 4AZ3B 3GHYA 1UUFA 4I4IA 2R7NA 4XYGA 4X3OA 2H2IA 5BYJA 4X8MA 3Q6IA 1RE1A 2C57A 5L3ZA 1HDIA 2C4NA 3UUEA 4F2PA 1G3MA 2H9YA 2I71A 4HPXB 4NCJA 4IIHA 4Z2YA 1L5KA 5JXJA 1VJ1A 3RDPA 2BGTA 2OBFA 3GJTA 3AF4A 4MQMA 5EY5B 3WWDA 4CKWB 4RK4A 1XDSA 3CJQA 3F6CA 3EE6A 3QKRB 4Q9KA 1YZKA 3B1ZA 2ORIA 2PBFA 2CN1A 1XDWA 1IXKA 5A5DA 4TLLB 2J5QA 2R5WA 2QRJA 2I2CA 1EVZA 2EZUA 3EWSA 2XB6A 4B6PA 1VE9A 2DTXA 2FQQA 2WWWA 4BGUA 4I9NA 3SKVA 4D8UA 3ONVA 2CMGA 1QYWA 1R50A 1VSVA 1R4ZA 2YJZA 3E35A 4DB4A 2WIFA 3UUFA 4RVDA 4NBRA 3ZE9A 1PZMA 1EFUA 5JUWA 1MZPA 1NUAA 1YKGA 3O5AA 4B4UA 2AV6A 2PMCA 4L78A 4EATA 5AFSA 1AV6A 1U8CB 3I09A 1OYOA 4JYBA 1EFPA 3IX7A 3EN0A 1ECCA 1CX9B 3EEQA 4JGBA 1NNLA 3AVOA 3INNA 2G76A 2ZRCA 1WD7A 2YFQA 4BBAA 4OLAA 4FU0A 1QO9A 1Z4PX 2CJYA 4LNUA 3JQRA 3HDJA 5F51A 3T15A 3TDNA 4V3BA 2GK6A 3MILA 1B2RA 3H5TA 4F2WA 3VNQA 1N5DA 1GL6A 3V8NA 2BMEA 1T1EA 2IIQA 4E12A 5AJHA 4JJ4A 5F4ZA 5I4IA 1EHYA 3O94A 3H9UA 3PSAA 4NAUA 1KFJB 3EQ9A 5KTSA 3L8YA 3TRDA 3FAKA 2E3JA 2QMZA 1NVAA 3DTVB 4NZMA 3SZ3A 1KVSA 1O7JA 4KXQA 4Z0PA 3RBXA 1ZX1A 2YVKA 5KU7A 5AM5A 1EHIA 1CETA 3LLMA 3MD9A 4Y98A 3W1WA 3QJGA 1KYVA 4X24A 2EFJA 2Q6KA 3B48A 4XARA 3WC4A 5JS6A 2NP7A 2DQYA 2VPZA 5SYMA 3ZWCA 5CCXA 4KQ2A 4ZI7A 3VR6H 3B1YA 4OLBA 1NWHA 5AT1A 2V3WA 1ZWKA 5PNTA 2C5LA 4DJ5X 3D0QA 3B6KA 4LV5B 2IVZA 2PA0A 4LVCA 3CGGA 4P3OA 2JHFA 3NASA 4QPPA 2LVBA 3EULA 4HDMA 4JQCA 2GHTA 5HK9A 5I9LA 4BB5A 4JVOA 1JH8A 2AR7A 2LRHA 2YXBA 1T5IA 3HBNA 1GKIA 3QX8A 1H2BA 1NONA 1LPMA 2AS0A 1TD9A 3BL5A 1CDEA 1PW5A 4WH0A 5HIIA 5T41A 2Z5LA 1Q1EA 1JNYA 4YI5A 2R8OA 3SFTA 3LD9A 4JU8A 4A2QA 1JHYA 2AT1A 2QVXX 3L6BA 4LNUB 4B4WA 4K03A 3S68A 4KMMA 2HSDA 4NCKA 2ZBVA 2B1QA 5CVTA 4P7BA 1C7FA 3MINA 1AF7A 3WLAA 2WHYA 3UT0A 3GQVA 4ND7A 1GN8A 5AKIA 4BWVA 1YVUA 1I4OA 1Y48E 3H3JA 4REMA 3NLLA 1YAHA 3CEAA 4MLPA 2Y27A 3P5BA 3ROFA 5GPBA 4KQCA 2P2DA 4P84A 1O87A 3TBKA 1QPZA 1WULS 3UKDA 3ZBTA 4AYWA 1J5EB 5T3YA 1K8ZB 4M6WA 5AM0A 3P94A 4EBBA 2Q4EA 3GP5A 1X14A 1CY0A 1C14A 3SQDA 3DKIA 3TXYA 1T2AA 4ZI7B 2WAMA 4YY3B 5HF9A 1CYEA 3EEYA 1HDCA 4YLGA 2IHUA 3K5PA 2QNIA 1WDMA 2PUCA 1IM5A 2O7SA 2BZ1A 2Q62A 3I8OA 2NUTA 2J5XA 1AKYA 3UKJA 2CNNA 4JJEA 1CUDA 1FP7A 3CZ5A 1I3MA 1E3WB 3A4TA 1I30A 3I12A 1GGMA 1QHXA 1FS4A 1ONSA 1P6QA 1U2QA 3Q5DA 3QTTA 1DPGA 2KS6A 2AKAB 1KPGA 2BT4A 2QZSA 3L5KA 1N0WA 3QIAA 4M0CA 1GLGA 1SAYA 3LH5A 4JMLA 4IJ6A 4J29A 2DBYA 5LYJA 3T12A 2J87A 5DWQA 3CCBA 3IVAA 1VL2A 1CDZA 1JLLB 1SIWA 1R0BA 1OC2A 4FFOA 1LVUA 2E18A 3WWEA 2O2JA 1PG2A 1YT5A 4TTPA 4MXDA 2XCQA 4LGYA 1QQ5A 3CVYA 2PE5A 1HEYA 2QE7A 2P6PA 3FKSD 3K6KA 5LLSA 1DJQA 1J99A 1XAHA 2QQ0A 3GCXA 3M6FA 5E0KB 1RHKA 1W88A 2G67A 4RHUA 5CPFA 3WGQA 3RTGA 3KZKA 1E89A 1WCV1 2QN7A 3OHSX 4M6WB 4M53A 3RFTA 1L7AA 1SPBS 2HRRA 2Y1EA 3LT4A 2I33A 1D1QA 3KKPA 5KYGA 3Q2IA 4UD6A 4D9FA 1PG5A 1XXHA 3IJEB 5H9WA 2EW8A 1OSNA 2DFNA 2PD6A 1RRCA 1SB8A 2NUTB 2WD8A 2X0RA 4JB0A 3S4YA 2FF5A 4AF6A 4OHRA 4NFLA 1Y3DE 1ODSA 1GPWB 4GPEA 1I4EB 3IPAA 1GPMA 1XMVA 3NHWA 1YIAA 4KQWA 3G1UA 3LWBA 2DG2A 2YZKA 2FLWA 3CNQS 3I1JA 3FTPA 3L41A 4OSEA 2HHLA 2IXDA 2NPIA 2FN7A 1KU0A 3F71A 1C3OA 3LMKA 2Z6UA 4MI3A 4EY7A 1I4LD 4URVR 3A58B 1F2TA 1PTKA 3W2TA 1P5FA 1XVIA 3DXYA 3I64A 2H2WA 3LDGA 3RTBA 3NANA 4JITA 4JBGA 1HH4A 1DRVA 2J48A 1G41A 1R74A 2J5KA 2WNHA 3CUSA 4HDAA 4TTQA 1ZM4A 4ARVA 3JD0A 2B8TA 1NPTO 2P4HX 5K8TA 1ESZA 4OB6A 1U3DA 5EZ5A 3B1FA 1J8DA 1V8ZA 5HVNA 1T91A 4OHVA 1LKZA 1IBSA 4L16A 2J7PA 1PK9A 3N9IA 1E59A 1HYHA 1KXJA 2CMKA 2HK7A 3HV2A 3UPUA 2BR3A 4HGPA 3DWFA 4KQIA 1RAGA 5EWLB 2PCJA 4A73A 1W88B 4XDYA 4XEUA 3VPAA 3EVDA 3QELA 3VR0A 3C4VA 5D6NA 3DFFA 1FSGA 2A0KA 1H4VB 1RM0A 1MP0A 2KQUA 4MKXA 2HCJB 4WY5A 3IKTA 2FV8A 2RMKA 2QMUA 4LDRA 7ADHA 3IXLA 4KPGA 3MSCA 4YQEA 5AW2A 1XXHB 4KE6A 4RY9A 4UBOA 2PQ0A 1UWCA 1NVWQ 2DJ5A 4BB0A 2F8LA 3KWFA 5KKNB 2M6RA 5KJ6A 1NASA 3WK6A 3EG9A 1VQ1A 2JCBA 4TV8F 4NPCA 3BJMA 4PRYA 1CEQA 4IF6A 4ETIA 5G0WA 2YIVX 1T13A 4LQCA 4GEKA 5BW6B 3OZFA 4ZZ3A 3DXXA 3FOCA 2RGCA 3NJ8A 1N2IA 2N9UA 4N5HX 4RKFA 1LTHR 2D5AA 3PNYA 3PE3A 4GM0A 2WILA 4NPHA 1CKEA 1C3OB 4IXNA 3PHIA 4HMPA 2PM8A 1N25A 2IA5A 5DYNA 1MUUA 5LBTA 3T7JA 1F2TB 1K6XA 1R18A 5AUOB 1RBZA 1TYAE 3I01A 5J47A 1G8JA 1N0UA 2H06A 2ZBGA 3IR7A 3JQ8A 2A5FA 5KYVA 1XN1A 2JFHA 3IAS1 1OIVA 3R8FA 1FCJA 4H1UA 4YXWA 4GUDA 2RG7A 1RQPA 4J6FA 2W6OA 3K8OE 4ZHSA 3Q3IA 4IP0A 5EGSA 1J5PA 3WTBA 1TM4E 2OV3A 2FEWB 3FCCA 1R0KA 1GG2A 2DY0A 3D5QA 4JEMA 4TQ9A 1P77A 1DJNA 2WAYA 3MRVA 3IODA 3PGLA 4ZCQA 4J6EA 2QUIA 3F6YA 2CJFA 4X1OA 1WNTA 2IRWA 2ACKA 2HXGA 3N2ZB 3GPBA 3QELB 4ZALA 3ZV3A 3OZXA 1QZZA 2WT4A 3ZI4A 2G4CA 2Y76A 3C7CB 5JH7B 5KTYA 3S55A 3F3YA 2H65A 5DX1A 3NFYA 2W6IA 4RWEA 3IDAA 3ONNA 5BWCA 4R9SA 2QEQA 1J39A 3PQ4A 1B3RA 3TZCA 3J81k 3GMIA 1MQSA 4EG7A 4DB2A 1N9ZA 3EG9B 1E2MA 4Q6WA 2IPAB 3OQIA 1W25A 2PSFA 2CMDA 3CNEA 4V0LA 4UATA 3ZZNA 5ED4A 1U3VA 3KLNA 3LUFA 4MAFA 1OKKA 4OLJA 4X7BA 3T7SA 1IY2A 3G8AA 3DF7A 5LZ4A 5T64A 1XNQB 4II2A 1C7JA 1CUBA 3BRWA 1PZNA 4IIUA 3WMGA 3R5KA 4ZYYA 4QOHA 3REQA 2A0UA 4MW9A 4DVJA 1N3BA 1EIWA 2ORYA 1IRIA 3CT6A 3H2IA 1ENPA 4IJMA 4EY6A 2VSNA 3UOWA 4Z86A 4C7XA 4GP7A 3T7EA 3PV0A 4YALA 2E5WA 1JWBB 5A71A 1G21E 3D4PA 4EX7A 2BFNA 2C98A 2V7TA 3GPIA 4AUNA 4TYMA 4V0SA 1DAMA 3DUWA 1Q1NA 4KWIA 3LPMA 5ABPA 2GO7A 3H5VA 2G7ZA 4HWKA 4P2GA 3BWCA 1YTLA 1U4SA 4R1NA 1QONA 4A2PA 1JA0A 4CT0A 3FX2A 1KPIA 4OSOA 4GRAA 4L9SA 4ASUD 3F5SA 1Q0UA 4BJ6A 1M7GA 2ZE8A 4KU4A 5GMOA 3R7FA 3RF6A 4ECAA 4IIFA 5JALA 1J2EA 1D2GA 2Z4RA 3EXG2 2W6JA 3FNRA 3OPNA 1N33B 3ZGOA 1DUVG 1YQTA 3KSZO 1P1IA 1IK4A 1SVOA 3ME5A 1HK7A 1MU0A 3WAJA 4IF4A 2O6HA 1DAEA 4RVNA 3EQ8A 3OESA 4YROA 3D64A 1XZGA 2C4WA 3D6AA 3OQIB 3WKEA 3HDQA 4H0FA 2DWOA 4JXJA 2BM0A 2VF5X 4HGNA 1J6UA 1YASA 3FNBA 3GGJA 4QU0A 1B4DA 1SKAA 3DZFA 4JUBA 3WG9A 2ZSIA 5ITZA 1EFAA 1SK8A 4MR9A 4L9RA 2GBLC 3AFHA 3UW3A 4E1BA 2XYPA 1NJ6A 4PIPA 4DCOA 1LZKA 2SECE 4M9CA 3U16A 4BQPA 5C2JB 4F7WA 4KKXB 4QXRA 3JQ7A 4AWXA 2CMFA 1VFNA 1LH0A 2IYXA 2BMAA 1TU0A 2XOKA 1EDEA 2Y1DA 2HV8A 1P2FA 4M88A 3K5WA 3RUEA 2Z4TA 3P9CA 1Q14A 5U4QA 5FX2A 1C9JA 5DB4A 5FORA 3DDCA 3RYIB 3ETCA 1SQ0A 3KLBA 2F8SA 1XZ8A 3WIDA 4FT4A 5D5QA 3D5EA 3A26A 3IVCA 1GQ2A 4HSEA 1Z0JA 4IQFA 4EEZA 2GNAA 2PBRA 4ZAXA 1BVRA 1DOHA 3GLVA 2Q2OA 3RWOA 4Z1MD 4AY2A 5HUQA 4BVLA 1M3SA 1I2BA 3GEDA 3H75A 4R2IA 1P4GA 3NAZA 3NAMA 3V1UA 3ZOKA 3AESA 1CZOA 3HG7A 1FTQA 2WJAA 1YZLA 3U62A 1A8UA 5AW7A 2GRUA 2DR3A 2V7PA 1YDFA 3VHXA 2F1HA 3PDIA 4D3ZA 3L93A 2WIAA 5LJIA 2D2IA 5ALFA 2J07A 1TPZA 5DNAA 4RVUA 2ATEA 2C78A 2BRUA 2VWPA 2Y0EA 3RYIA 4C6RA 5MN6A 1UK6A 3QVKA 3CBGA 3PGJA 5FL7A 3TKYA 2J6IA 2VHQA 3LCVB 4LRSB 3IOMA 5IM5A 4Q03A 3VNRA 3GJSA 4X6LA 1V9SA 1FBNA 5IDQA 4MMZB 1ID1A 3C14C 5BRNA 4Y67A 2J30A 4ZYTA 1O57A 2ZQ5A 5CJPA 5ITZB 3JWPA 5LB4A 3FDIA 1ADGA 4RLFA 4DNOA 4QDKA 3GWGA 5I3ZA 1XUOA 4TMZA 3DMRA 3TM4A 4MYUA 5GZ6A 4DCUA 4UUMA 3RSOA 2VAMA 3EW7A 3AM1A 2XGJA 1J9EA 1HLFA 1W73A 3AFMA 3DL7A 3TLAA 4F1JA 3GJXC 1TYEB 3GRYA 4I1OA 3JQ7B 4KYTA 1XNGA 2MCFA 4J07A 4W9MC 3COZA 2AN3A 2G9NA 5B4TA 2IHTA 5LWQA 3PS9A 2F43A 1UR5A 2G70A 1PE0A 3OX2A 2BI7A 2F59A 4L8WB 1KE1A 1LLQA 1WXFA 2CJWB 1ZXLA 1ZSVA 1W5BA 2JAWA 2OGWA 3A3YA 3UV6A 3I92A 2O0HA 5C80A 1SHZA 1UKEA 2GUWA 3TLMA 2EFYA 4FEYA 4X54A 2A7QA 1FXWA 5IAEA 3S40A 1MHPA 5SZKB 1J9GA 1WLYA 4KAAA 5AI0A 1NIJA 1TMGE 3F3MA 2Z9BA 3JY6A 4BJHB 2VSFA 4RPHA 5FLKA 3R3YA 4E5NA 1HSZA 3JYNA 5AESA 3WA6A 2DWUA 1VPWA 2VP4A 3D7KA 1EK1A 2R84A 1RRPA 3PDIB 2EDCA 3IB3A 4XZ3A 4HB3A 1IZ7A 1MGPA 1PWZA 3PQ8A 2ADOA 2LR0A 8ABPA 2JAUA 2ZBFA 5JNUA 1F4PA 4HUJA 1PZFA 4G56A 4N3BA 5I9BA 4FS3A 3E70C 3R0JA 1Z07A 1DIGA 1XHLA 1YHZA 2QMYA 2GD1O 3AUXA 3RBZA 4JK3A 1I3LA 1G291 2FSPA 3UA4A 4EB3A 3O8DA 3PFWO 5MGNA 1MN6A 2QRKA 2RBEA 2AOUA 3E84A 1KEZA 3M6LA 3MS7A 2QYTA 5TY0A 5L95A 4Y8VA 1PV4A 4QXMA 1D7OA 1L8XA 1DUSA 2Y0BA 2UUCB 3NM4A 4I5DA 1Z4OA 5JI3E 3G13A 2AX3A 1KP3A 2F43B 4LQDA 1OLXA 3UMBA 1MOQA 2FFAA 2HQRA 1BKYA 1RNLA 1ZW1A 3K05A 5KWVA 4QO8A 4P0QB 2SKCA 4G8BA 2P35A 5EC8A 4IQ0A 4J8PA 5AK3A 421PA 1JUDA 4U63A 3E81A 4CM1A 1NW3A 2I29A 2ZAGA 3NDPA 3EISA 3ZJ5A 3STVA 4ZRMA 3A3PA 2A3RA 2XGGA 1XD9A 1UJ2A 2QTGA 1XRLA 3DL0A 5DW3A 2Q0XA 4EYQA 3OZ7A 4YJ2F 2YJ5A 3V2HA 5CYGA 3NTLA 1VHLA 2QT9A 2V55B 5CCEA 5BN3A 5B6JA 3MA0A 4E70A 2AD5A 1MQ9A 4ZAWA 2FJPA 5EUBA 5CUQA 1L5NA 1JYFA 3GCZA 4JY7A 4B35A 2Q6OA 1PEDA 3N07A 1G64A 1H66A 3HN6A 3L7NA 4MVCA 4H35A 5IKMA 1BCRA 3HB1A 4RHEA 2XTJA 4CYMA 4QDTA 4B2PA 3GLGE 1PQWA 4NH4A 3IT1A 3DS8A 4XX1A 1OZFA 3RSFA 5IFLA 4HXFB 3LCRA 4J1QA 4RJ2A 1FP4A 4J1TA 2XKAA 5AICA 3KKNA 3OLCX 5J1SB 1RMQA 2AOUB 3LC0A 4UVEA 4Q48A 1K7EB 2FP4B 3OOWA 2MHCA 3ZDFA 3NBKA 3ND7A 3VR6D 2NPFA 1NMSA 1DXYA 3L7OA 3U7IA 4G36A 1W5SA 2XODA 3TTYA 1ZIYA 3K70B 5CH3A 1OLXB 3IP1A 3HXKA 4F4UA 2QG9A 2FPWA 2VDRB 2Y1GA 2G88A 5P21A 3U3RA 2ZITA 3UIEA 4H7PA 2CVHA 4RCVA 1A5TA 1Z0AA 4V3CA 4NECA 4KPFC 4WTOA 4FGUA 3AUYA 3F8SA 4HAZA 2Q8QA 1LLFA 2QN8A 1I7SB 1DAPA 2YHSA 4FPXA 1DU4A 3RTCA 1NRIA 4DUPA 1H69A 3RHSA 1FUIA 4BMCA 3HN7A 1WSDA 4XM1A 2MMGA 5M5BA 3ESYA 4EG4A 5CDYA 4JUCA 5BN3B 1CY1A 1RD4A 4IYRA 1F9AA 1Q16A 3LXRA 2GI4A 1RRMA 2ZUCA 4A6XA 3K4PA 4AKSA 1GV0A 4EF4A 5HILA 1IFXA 2P3QA 3KVNA 3EVNA 3WL6A 2WT9A 3F6PA 5DNUA 4YDQA 4G8DA 1QYVA 1Y7TA 4MS3A 1BCRB 3IQIX 3KQQA 2XWSA 3TW0A 5K2OA 3QFFA 5CU7A 3U6BA 3MC1A 3NIWA 1KBOA 4M0FA 1WV0A 3QVXA 4MTCA 5GJBA 4BPBA 4M7WA 1FP4B 1W0CA 3B9PA 4PZAA 1S2IA 1UKZA 3T1HB 1RW4A 3KD3A 3MYRA 4ZV4A 1JQDA 1NM5A 1VCIA 3L1KA 1R4NA 3LVRE 2B4RO 4KFCA 4MUEA 2QYOA 3IAAA 3L8MA 4FQ5A 4YUVA 1OLOA 3H1PA 4EKNB 1RTTA 3P52A 4GZ3A 4M1SA 1DCMA 4D4GA 1L8LA 4JZKA 4BOYA 2HLHA 4UVHA 1VYVA 5KWJA 2WKRA 4PYOA 3UFBA 3TVTA 3HVHA 2FJ0A 1Y5RA 2ZWOA 2B2NA 4PLTA 1U28A 2QLLA 1U11A 2WJJA 1V3UA 2Y67A 3QLVA 5DM1A 4C6HA 3L4SO 1KY4A 2HJSA 3UWDA 3H5RA 3HLYA 2DFDA 1XNJA 4OGWA 1VMDA 5AUPB 3LVFO 2Y6UA 1RI5A 4W82A 3ORSA 4OATA 2NPOA 2IS6A 1C8LA 3WIOA 3G0CA 1J25A 2D2EA 2PQ6A 1NMYA 3G5MA 4U9IS 3C3PA 3I04A 3LOQA 4HG2A 3WSVA 1QCYA 2RDMA 1ZR2A 2FFJA 4W7IA 2HFKA 3T7DA 4EF5A 3DEZA 3EZXA 2GF9A 3LG2A 2BTOA 4HAVA 1EWQA 4RF3A 4WESB 2HXSA 4I36A 4AM8A 3GRAA 1JW9B 1NJSA 4NHOA 3FOFC 5FO0A 1K3FA 2QL5A 2QRQA 2AJBA 2WDZA 4MS3B 3U09A 1PL0A 1PR5A 4D3FA 3IPYA 4KWEA 3RSZA 4I1SA 3VMMA 3QXHA 3DBRA 3ZWQA 4PCLA 1KRXA 4TKLA 4AECA 3TRHA 1T6XA 1WPGA 3EZGA 1VKJA 2X1HA 3U4GA 5IULC 5KTNA 2X3FA 3I2HA 2OOSA 4M1QA 4YRTA 1R4NB 1B00A 4YAUA 4JXZA 1DWQA 4OOFA 3TAUA 4F97A 1G60A 2ZUVA 3K30A 2G17A 1MRNA 3SY8A 3WNQA 3LNCA 1H65A 5JS8A 3G02A 2LXNA 3A6EA 3OOSA 4OJKA 3LQ1A 2RAFA 1K63A 3HDVA 5CNMA 4WSOA 5JT1A 5G1OA 4R3NA 3FYUA 4Y30A 3DONA 2I9KA 3MJ4A 1NN1A 1QK3A 5AVRA 1ORTA 2ZDGA 2GTPA 3V97A 2OQIA 3BAZA 3HJGA 5EIBC 3VNBA 4A26A 4AO8A 4F92B 1EE9A 3R5XA 4U8GA 4CEIA 4O4HA 1NFQA 2N75A 1HOXA 3D6TB 3WLNA 4FZJA 5IAOA 4CXMA 3KELA 4ZVPA 4FJ1A 4RPLA 3TGWA 4TQAA 4E14A 3ABSB 3MMZA 1PSDA 2XUFA 4ETMA 4QC2A 2AFHB 3NIBA 1VLQA 4L3WA 4WOBA 2C2MA 5LDHA 3L0CA 3IVXA 5GTDA 1CZNA 4NWIA 3MZ0A 3FTQA 3DBRB 1VSTA 2NN3C 3BIWA 1D3AA 4DRXA 3F3SA 1G6Q1 4X65B 2PANA 1R0RE 4RIHA 4WVLA 3QQPA 4P3KA 4TLEA 4TWBA 1UC9A 4R7TA 3EBOA 1KI8A 2EL9A 4F2DA 1Z13A 4Q18A 4IHQA 1P4RA 3AV0B 4O25A 4JOSA 2OWDA 2EAUA 1QBKC 3VBCA 1L5YA 2VNJA 3B6ZA 4MS1A 3IBYA 5I47A 4CQJA 1YIOA 4UMEA 1TO2E 3WGLA 5DCYA 1QRTA 5DGDA 2ZYVX 3JWGA 3PJDA 4GDFA 4J3FA 5CB4A 4US0R 3FYUB 3INYA 1BKSB 2QUHA 1UBCA 3I39X 3QUAA 3CV3A 1SXJC 1O94A 1PD1A 3EZYA 4IKOA 4KR7A 3QKTA 3K0FA 3LKBA 5B4VA 3T54A 1UMKA 1MNQA 3FDXA 3NCHA 1F20A 1ZI8A 2EOAA 3PFFA 2WTXA 4CEIB 4N0MA 1LSOA 4ZAZA 1U1IA 4P08A 5JSFA 3SDZA 1ZD2P 2J3IA 3I9OA 3VDNB 1DMRA 5AVQA 1KI1A 4TOIA 2X6RA 5CFNA 1MA3A 2I3GA 4LY3A 2D7JA 3T1YB 1XPRA 3KPUA 4G0WA 2R6HA 3UM9A 1GGJA 1DFIA 1GR0A 1ZN8A 2QLNA 3BGVA 1XALA 1S2NA 4LYDA 3LK7A 4L6IA 4NNPA 5FAXA 5IT4A 4C0KA 2IXEA 4N5LA 1QP7A 4EJ2A 3G1WA 1A96A 2OESA 4XB1A 3OCWA 1TJ5A 1BXKA 3EMBA 4GLBA 4NZYA 4PRLA 1WZNA 2POQX 4Q02A 5AP9A 2QM8A 2Z9CA 2IU4A 4G5HA 4LGMA 5EL0A 2C61A 2PRJA 4YYZA 1JA1A 2R6AA 2J1LA 4NNJA 3QX9A 2BM1A 2ZS8A 4I99A 4ZARA 1Y6QA 4I4LA 3CLUD 1RZRD 4ZQHA 2JJ2D 2XIQA 1Z22A 5BRAA 4CMIA 3THOA 3G9XA 4MS1B 3SJUA 2QLMA 1DBSA 4EKEA 4LOKA 5K0SA 1J2RA 1U5CA 5KNDH 3AI2A 3PNPA 2WWXA 1G8KA 1JSZA 1KY5A 5CB4B 4IVRA 5KWEA 1UXKA 4IQ8A 1YU6A 4DL9A 1Z63A 3QYPA 4EG3A 2YKGA 2ZW9A 2PU5A 1XWWA 3UFXA 1CUGA 3EXAA 1UC8A 3OCXA 2CB9A 4UTVA 1P2SA 2HBQA 4NOJA 7MDHA 1XJ0A 2J33A 4FBLA 2Z04A 3AXSA 2ZAOA 5D01A 1O0SA 2ZZNA 1FNMA 1ZOOA 4LHXA 3RVMA 3ILYA 2GAJA 4RKQA 3RFVA 4B71A 1A2BA 2YBEA 3Q8LA 1XPUA 3LW7A 2YY7A 4H3HB 2IYLD 1QG6A 1OBVA 3GLSA 4IQGA 2JIPA 3ZWMA 4KP7A 4DEYA 4F72A 2R65A 3ADKA 4Y2HA 3QLTA 3VH2A 3BM5A 4Q7JB 5TLSA 1C1YA 2QSJA 1CZLA 1YHYA 2C0QA 4ZMBA 5IVPA 5JXIA 1Y7PA 2PWAA 1DDGA 2I1WA 1JU9A 1QB8A 3E4DA 3AF3A 1BSVA 3O84A 3Q85A 4L8VA 5F9FA 5GONA 3IIKA 1Z5ZA 4MDYA 3PCXA 3T4UA 3U39A 1DBIA 5A1JA 2JFWA 3CNHA 3AINA 1GY8A 2ZT6A 5ICSA 1PLJA 1U81A 2R6GA 1H85A 2QN1A 5C5DA 1RAFA 3C87A 3C5WP 3JQBC 5EXSA 3Q0IA 1N5LA 1XZPA 1DFHA 3T5MA 1NXTA 4LMAA 4CUKA 1IZYA 1G3RA 3HR7A 4WNAB 3PFKA 1UEJA 3BCSA 3AKDA 3CLTC 3PNKA 5F1KA 4DDWA 2NIPA 4WV3A 2D62A 1IY9A 2GKSA 3EIHA 4MS4A 5B1HA 3U3XA 5H1YA 4A10A 2X8LA 5EJEA 1LNQA 2AWNA 2FEOA 4R2JA 4C1BA 1CUZA 1G5HA 1KYQA 3CG0A 3OKAA 4LZOA 1T24A 3SX4A 3PCTA 4DQDA 2A59A 4MDHA 1EEHA 2IIVA 2PT9A 2XVXA 3FDZB 3AY6A 4I55A 3WVNA 1KZ6A 4JLUA 4L6AA 1GSHA 4P4SB 1USWA 2NM0A 3TPFA 2WDPA 3C5CA 2BMJA 4URYR 2R1TA 2OZKA 2WU8A 1FTSA 3M4YA 4NFHA 3V8VA 2HR1A 3N53A 4LCJA 4YHHB 1AGNA 3A70A 1TM2A 4AIIA 1DTEA 2P9GA 3BWYA 4E22A 4TTSA 3WS7A 1JT2A 5C5EA 4RXUA 5L4LA 3E8MA 4O3MA 4QOJA 5C81A 2A9RA 1DC4A 6YASA 2QMHA 4GECA 4PLPA 4CIWA 3V3KA 5DGXA 2XB2A 2P68A 1V47A 3C15C 4HD8A 1E1RA 3VDXA 3ZVNA 5FWYA 2O3TA 1KKLA 4AS3A 5C3MA 3OOHA 4UW9A 4TRJA 1DQYA 2R4TA 2BUAA 2ZXEA 2FGJA 1KZYC 4NE2A 3ZKWA 1T5TA 4DV7B 4MWTA 1KDTA 2G71A 1M6HA 3PD0A 5CT8A 5EE1A 3W06A 2I1QA 4PY2A 2P3SA 2LDBA 3DMGA 2FK8A 3HACA 4KQKA 1I80A 5I7VA 1R6VA 5F52A 2RG1A 4G4SO 3FRIA 2QORA 1RHQA 3KB8A 3U4HA 3Q15C 3BERA 2ZJ2A 3L07A 4NTZA 3RAPR 1GNPA 1Q5PA 5EJ2A 3TN7A 4UCXA 1QUEA 2F9MA 2XUPA 3USCS 4Q4AA 3WLQA 1J0EA 2CDRA 2AUMA 3NIFB 4MOWA 3C1TA 4JJFA 1GGVA 3O47A 3ZDXB 4GYYA 4B09A 4G5OA 5BN1A 1ZL2A 2CWWA 5I6DA 1XEAA 4XR4A 4EWLA 5FUYA 5JPDA 5CA0A 1K92A 1Y6ZA 4I55B 1RYYA 5HDQA 4EEKA 3RG8A 4REQA 2FMKA 2NGRA 1KHTA 4J91A 1W59A 1BN7A 2BDUA 3RYFB 1UIRA 2R1TB 3P2OA 5FYQA 2BM9A 2LGJA 3QUBA 3TMAA 4P1ZA 1QRSA 2RGDA 1SU4A 1VG0B 4Y2VA 3T3HA 5JAMA 1NQUA 1IN8A 2PWBA 4GWLA 5CXSA 4PZ9A 3K16A 5DI3B 2QP9X 5IC5A 3L0SA 3TG2A 5A03A 1HE2A 1LSSA 1P72A 1PRYA 3OZWA 2AYXA 1JG7A 1UBKS 2HV9A 5DK6A 5H4HA 2R8YA 4R98A 3TCNA 5FADA 4BNHA 4OU5A 3KVYA 2I2XB 3ZGVA 4EJFA 3DZIA 4UTXA 4YWJA 3MF4A 4A27A 4FSHA 1YDEA 2OK8A 1JSLA 4CNBA 3G0HA 3LC2O 4LRXA 1D6JA 2C7BA 3B53X 3BQ9A 3N0XA 4PCUA 4UDOA 3TZ6A 2BR5A 1US8A 3UANA 3ZKWB 4POAA 3I76A 5JC1A 5BUCA 5JSZA 3ESZA 3IRVA 1E5LA 2IOFA 3UHPA 4C7BA 3VC2A 4KJXA 1N6RA 1C7IA 1FVFA 1NBMA 1MT3A 2ZYRA 2WYIA 2VHXA 3EXEA 1G2PA 1OXVA 1YCHA 4J9UE 1Q2XA 5GOZA 3MM4A 3LUHA 2ZB2A 2ZYIA 3SR3A 1LBIA 4II7A 4S24A 1P0MA 4Q4AB 4C43A 5C31A 1AIPA 5HJEA 2GM3A 3FRJA 4TTJA 3HJUA 3K9LA 2XUAA 3U0VA 2RGUA 3OJFA 3TLCA 1F0YA 1TUEA 4J0IA 5ESWA 5CA0B 3TSWA 3COVA 4REQB 1AKWA 1YS4A 1TEXA 3D2LA 1QZ3A 3KBBA 4D4IA 1AJEA 3N2LA 3ZCRA 2F1RA 2JLQA 3JW8A 3EASA 3DT6A 2C2BA 3DDHA 2RHOA 5DTJA 3S8MA 1NBEA 1C9KA 3A6GA 1AXGA 1RYBA 1YR1A 2QW0X 3KR2A 4FP9A 1SD2A 3W05A 5FFFA 3DM9B 3WB9A 1VJTA 1EM8A 4FYXA 3V33A 3ZGXA 1ZVVA 4ENVA 1RKXA 1QCZA 2WW8A 2X19A 2FDCA 2JGJA 4RZQA 3PVSA 4IVPA 3SEQA 5J5VA 3C8ZA 5AR1A 2LWIA 1E3EA 1G55A 3ZWDA 5FEUA 1YA4A 2IY7A 2O6LA 2XMRA 3K9BA 3RHTA 5FTLA 4IJVA 2QP3A 4PLZA 3W90A 1ZH0A 3P1JA 4X44A 1US8B 3VO1A 3L4BC 5JSZB 1DP4A 1FMTA 1NN5A 2XCRB