4RK7A

Crystal structure of laci family transcriptional regulator ccpa from weissella paramesenteroides, target efi-512926, with bound sucrose
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
270
Chain Sequence
RVVGVVVPLIHTNFADEIIKGLYETTISSGYELLITYLDEDEDHQYQVFQTLLSRQVGAVFMLSLDIPSWMIDKLLEEQISVISLTALLSEQISAVTSNEFEMMNSIVDYLIDMGHKNIALVGDTKLTTNISSTRRTNFIKSMTDHNLAYENIFLYGNDHSYETGYTSVTTGYDINQLPFTAAIATADMVGQGLINAMSDHGKTVPEDLSIVTIDGLQQTEIARPKLTTVKQDFPEIGRIAMQLFLDSDEPQIIYIPTELIQRDSVLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926
rcsb
source organism Weissella paramesenteroides atcc 33313
molecule tags Transcription regulator
molecule keywords Glucose-resistance amylase regulator
total genus 80
structure length 270
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A01
3LUCA 4MPTA 2ID9A 5FBKA 1ZH2A 4LE0A 4F06A 3EJWA 2HJ9A 3I45A 2WMYA 3HM9A 4KPYA 4RK7A 4EVRA 5B3JC 5BR1A 4ETMA 4OLAA 3GYBA 3A0UA 3BRSA 4H3HB 2I6FA 4RDCA 3RVLA 4N0QA 2FQWA 1H9CA 4JASB 4MS4B 3TB6A 2R47A 4KREA 1RPJA 4XFKA 1CYEA 2HQRA 2JCGA 2JRLA 3E3MA 3KCNA 3M6MD 3NHMA 3O1HB 4MR9B 3EQZA 6ABPA 4KQCA 1C0EA 4Z4EA 1M5TA 3QX8A 2L2QA 6CHYA 3MMNA 2M98A 3QEMA 2NT3A 3O2SB 5KWSA 4ZJPA 4G0OA 5TE9A 5DGCA 4G97A 1NXXA 2HQBA 2PUGA 4ZPJA 1D2AA 4FE7A 1JX6A 3FFXA 5FWYA 3TO5A 1QO0D 1FFSA 3A3KA 3P9YA 4KZKA 1NXTA 1FFWA 4Z0NA 4RXUA 3B2NA 2QVCA 3TMYA 4YWHA 5JS2A 2FMFA 3K4HA 1JDPA 1EHCA 4F3TA 5I4CA 3HO1A 4P1ZA 3JY6A 3HXMA 3T38A 1YVUA 4MLDA 3EGCA 2JBAA 3LUDA 3Q41A 3DBIA 5IUJC 1ISSA 4OG2A 3LUKA 1GLGA 3SQNA 1DP4A 3C3MA 4KK4A 1L5ZA 4ETNA 3O74A 1TVMA 1JFSA 2P4UA 1ZHHA 4ZYLA 3IPAA 2A9RA 2N9UA 4N47A 1JH9A 4NICA 1Z12A 4RS3A 4UHKA 4D6YA 4HNQA 5JNRA 4MS3A 3QEKA 3CG4A 3W9SA 1W25A 2B1JA 2IPLA 2PUFA 3DLHA 1JDNA 2OENG 3GV0A 5TQJA 3ROFA 4RSMA 2PMCA 4MS4A 1W9HA 5HSGA 4KMRA 4S04A 4ML3A 4MR9A 3A0RB 5KC8A 1DG9A 3IP7A 5IUKC 5T3YA 3H5WA 3T8YA 2PKXA 4KVFA 2P9HA 1JWLA 2R4QA 2HSGA 1L5YA 1USKA 5C5EA 2QR3A 1SRRA 3C6QA 2IKSA 4D74A 1Z25A 1DCFA 4MS3B 3JS5A 3HJFA 3OMWA 1VPWA 2PUEA 4YS6A 2FSPA 3OLXA 3CHYA 5FWYB 5IUNC 3JVIA 3MM4A 2CWDA 2VK2A 1BDHA 2RJOA 1RXIA 3KTOA 4PICA 2AYZA 1YMUA 7ABPA 1M2FA 3OQNA 2IPNA 3KSMA 3Q7SA 4YRZA 1WETA 4L85A 1NXSA 3SAJA 2CHFA 2L17A 1IIBA 4EYGA 1Z26A 4OTZA 4DADA 1KRXA 2MSWA 1ZESA 2HQOA 2NZVG 2ZAYA 3HUTA 5TPZD 4B09A 4JAVC 1ABEA 2A9OA 2QZJA 4LX8A 2JBAB 4ZMRA 3CU5A 2OQRA 3QLTA 3LUHA 5E3JA 4S05A 3OLVA 3N0XA 3F7NA 4O5AA 4TLLB 2H3HA 2MSLA 4EGSA 5BRAA 2PAFA 4IRXA 3H5VA 2FMHA 2MYNA 1OXBB 3FFWA 3R0JA 2GWRA 3URMA 1LJUA 3OM0A 3T95A 3I42A 3S99A 5TPZA 3OQMA 3IP6A 4TMYA 1DCMA 3CZ5A 3KKEA 3LUFA 3C3KA 3NBMA 3T6KA 4ETIA 4WZZA 5IEBA 1PNRA 3DGEC 2FXIA 4RK6A 1D4ZA 1JL3A 4W5TA 3IP9A 3TD9A 2QW1A 1M5UA 1JLKA 4OATA 5KI6A 4IGAA 1LBHA 2F8TA 4YLEA 1VLZA 2RJNA 4HNSA 4XLTA 1U8TA 1URPA 3CNBA 1QQBA 4GPAA 2FTKE 3HV2A 3KYIB 1KRWA 1OXKB 1JBEA 3LTEA 5EWLA 2JVKA 3I5AA 4RY8A 4YP9A 1KGSA 2WRZA 1EWTA 2XDYA 4F12A 1ZN2A 3KYJB 5CNJA 3NNSA 1D1PA 1XHEA 3EAFA 3OLYA 2PJUA 3H5IA 1U2QA 1SXHA 4IILA 4N0PA 3EDCA 1K66A 4KFCA 2FEKA 2PE5A 1EWVA 4MR7B 1Y1LA 2WJWA 3F6PA 3O2JA 2L18A 3BBLA 5EWLB 1NTRA 4JB0A 1HEYA 1XHFA 1DZ3A 2HPHA 2NT4A 2H0AA 3M9WA 3KS9A 5IX8A 3EQ2A 3L49A 3RVRA 3N75A 3OO0A 4D6XA 3G1WA 1DJMA 3RQIA 3N6VA 3LMKA 3RVPA 1P2FA 3LUAA 1SXIA 3H5LA 3H1EA 2MSKA 4KRFA 1KMIY 1AB5A 1BDJA 3BRQA 3IP5A 2IDMA 2FQXA 3NNNA 1NY5A 1Z2EA 3JVDA 3SG0A 3HUUA 2E4ZA 5CNIA 3OM1A 3TX6A 4Q6BA 3KJXA 3RVOA 5KQGA 1EAYA 5C5CA 2PUBA 4PYRA 4RXMA 4XASA 2TMYA 4W5QA 2FKAA 3C97A 3OO1A 4LE1A 1RZRD 1JFTA 4QPJC 1PEAA 2LPMA 5KQLA 5JNVA 4DN6A 3GT7A 1NXWA 4Z9BA 1DBWA 3MQ4A 2FMIA 3KLNA 4WUTA 3RVKA 4IF4A 4PEVA 3HDGA 1JYEA 1A04A 3VNAA 1FSPA 3QK7A 1DRKA 4RV5A 3FGZA 4XARA 1YTUA 1Z16A 1YK1A 5EWMA 3MF4A 3LOPA 4N03A 5HQJA 1VKRA 4QYWA 2FW0A 1P8AA 2DRIA 2O20A 4F11A 1LK0A 1DBPA 2GKGA 1LBIA 4Z4GA 5TPWA 1NXPA 5TQ2A 3RVSA 2ZWMA 4MR7A 4MS1A 4WXMA 5FBHA 2MYPA 1A2OA 2B4AA 5DTEA 4EY3A 1Z13A 3RVNA 1NXVA 3ILYA 4NCAA 1R8JA 1D5WA 2NZUG 4TN5A 1QKKA 1TM2A 1T34A 4MQFB 2YHAA 3UUGA 1SD5A 1J56A 4G0MA 5TQ2B 4LZLA 5TPWB 4MS1B 1TJYA 2FMKA 2QU7A 3IDOA 1S8NA 3H5OA 3FDFA 3VNBA 1F4VA 2FQYA 3G85A 1DRJA 2R25B 3OQOA 4MLCA 1EFAA 2LUOA 5KQPA 2NUBA 1JF8A 3MIZA 4O1IA 3Q7TA 3EODA 3EULA 4MYRA 3LFTA 4RU1A 3F73A 1USIA 1BVHA 4MRMA 2VUIB 4JP1A 3SM9A 1U04A 3O75A 4LRQA 3ILHA 5EWJA 3GL9A 3H1GA 1DBQA 3HSYA 5JNTA 1K68A 2V0NA 1ZY2A 4DQDA 5HKOA 4Q6WA 1PNTA 1MVOA 5PNTA 3MA0A 1E2BA 4G86A 4FB4A 5DLEA 4NCBA 3L6UA 1QNLA 3JPWA 4G0XA 4LDAA 2BGGA 1GUBA 3KG2A 4MQEA 1MAVA 1ABFA 4JA2A 3RH0A 4WWHA 1ZVVA 3JPYA 4W5NA 1QP4A 4E7PA 2QV0A 3F6CA 5KQMA 1D1QA 4MR8A 1RZRA 4N76A 3H75A 4H3KB 3FFTA 1AB6A 3ROTA 5KC9A 4LDZA 3MYYA 3QELB 5CHYA 1B00A 1MIHA 3M9XA 1JYFA 4Q7EA 4P98A 1USGA 4Z4CA 1ZAYA 3D8UA 4FE4A 1F51E 1I3CA 3CKMA 2ID7A 3I09A 4NV3A 4MQEB 4G0YA 5IBQA 3E61A 5CNKA 4YV7A 3DLBA 2FLKA 3Q7RA 3QLVA 1Z15A 1QP0A 4G0ZA 1CEYA 1CHNA 1DC7A 2R48A 4MQFA 4KK3A 4LE2A 3GBVA 2RDMA 2PLNA 2F8SA 1DC8A 1ZGGA 3LUGA 1TLFA 3BILA 3QLVC 5T7BA 3LKBA 2PUDA 4NQRA 4RWEA 3Q9SA 2PUCA 4YCSA 4W5OA 4H60A 4Z9AA 3N8IA 3GWGA 2W42A 1JHZA 2CD7A 5CNMA 5IEJA 1GCAA 1ZH4A 2JK1A 3CFYA 3O2QB 4MRMB 2E4XA 2WWVD 8ABPA 5EWJB 3FMVA 3HS3A 3UK0A 4Z99A 3CS3A 1APBA 5JS1A 4O1HA 5FWXA 4JOQA 2KYRA 1QPZA 3O1IC 3OLZA 1ZGZA 2A9QA 2IOYA 3NHZA 2L19A 2PUAA 3H6HA 1NXOA 5TQ0A 1MB0A 5ED4A 3N53A 3Q15C 4E7OA 4RY0A 4PZ0A 1YS6A 1E6LA 1M2EA 1QP7A 2GBPA 3LUJA 4EUKA 4Z4IA 4MR8B 2LIVA 2CHEA 3KHTA 4XXHA 3A10A 2JVIA 1BA2A 1JFVA 2MYTA 1ZDMA 2WB4A 3OMXA 1VRVA 3QELA 4RKRA 2QXYA 2PL9A 3QLUA 3K9CA 4OLBA 2WJAA 1P6UA 2WY2D 5HM6A 3HVRA 4MAAA 5ABPA 2A9PA 2YHBA 2FN9A 1GCGA 1ISRA 1UDRA 2GX6A 3GRCA 2LP4Y 3DZDA 4RK1A 3CLKA 3HEBA 4RK0A 4G0QA 4ZMSA 4Z4FA 1E6KA 3KLOA 3IPCA 3NNDA 4QICA 1TMYA 2LBPA 4YGXB 5D2CA 1ZITA 3QLUC 4EVQA 4WT7A 4IMJB 2GI4A 3SY8A 1Z2DA 5F64A 2IPAB 4OBBA 1QMPA 1C4WA 3C3WA 3CTPA 4IMIB 1DCKA 1BAPA 1LJLA 1PUXA 3N0RA 2PL1A 2QSJA 2M1ZA 2MYUA 4PE5B 1YMVA 4RKQA 4M88A 2Q5CA 3JTEA 4XAQA 1Z17A 1BDIA 3UKJA 1E6MA 4RXTA 3CRNA 2JVJA 4L4UA 4EYKA 1P6QA 1U2PA 5DCLA 4W5RA 3CG0A 3H1FA 2JB9A 2FN8A 4Z4HA 1A0OA 2E4YA 3RVMA 1YK0A 9ABPA 3D02A 5B3JA 1QO0A 5GQSA 4G0PA 1RXEA 1NATA 3CZCA 5FWXB 1FFGA 4WXEA 1EWKA 3H5TA 1FQWA 2AYXA 3HK2A 5TQ0B 3H6GA 2X7XA 4YO7A 5IC5A 4F8JA 3OLWA 5GOTA 1QQAA 2FEWB 3DGFC 1U0SY 1SXGA 3SNKA 1YS7A 5BQ3A 3BREA 4RZSA 3QEMB 4RK5A 1YIOA 4CBVA 3LKVA 3GA5A 3O21A 4RY9A 2VYCA 4EYQA 4HNRA 1PEYA 1Z18A 2FEPA 5IULC 2IPMA 4N41A 1RNLA 3QX9A 4Y9TA 4UHJA 2QVGA 4KV7A 3HDVA 1MB3A 2E4WA 4JB2A 2FVYA 4QYMA 2RGYA 3GBPA 4KQ9A 2J48A 4RK4A 4EYOA 4YR7A 3HCWA 5JNSA 4EVSA 4GNRA 3RVQA 2E4VA 2FLWA 5DKFA 3RVJA 3HZHA 4HYEA 1XWWA 1PHRA 2E4UA 4TLMB 4KNYA 2VUHB 5EWMB 3N0WA 4MGEA 5JNWA 5JNUA 1GUDA 3O1JC 5BRJA 2IYNA
chains in the Genus database with same CATH superfamily
4PV7A 2CXRA 2GPSA 2HK8A 4M46A 4TZKA 5DMHA 5FTMA 3A11A 2VA9A 4J94A 2I3AA 4MJLA 3X2EA 4RTMA 1MH1A 1I1HA 3WLQA 5IYZB 2BMVA 3FTNA 3VTKA 3NT5A 2QUIA 3FCXA 5TIIA 5ELXA 1RM0A 2FPKA 2B92A 3KTAB 3Q7PA 4TXMA 3WGUA 4BXOA 1IOZA 2PGJA 3FTDA 1YJCA 4GZMA 4DLNA 5AM2A 4KAJA 5HUHA 3ADOA 3LL7A 1QZUA 3NHLA 3T3GA 3ES9A 2JRLA 3FWNA 1AKEA 1XJ0A 3NHMA 4J7XA 4U7JA 5C1BA 2AXQA 3U3ZA 4BLPA 5FX2A 4CG1A 4NEQA 5EXTA 1G8HA 4IUYA 4UJ5A 1NUHA 4PIMA 3EB9A 1G8MA 2VWPA 1WDKA 3IALA 3L2OB 3AGPA 5AKIA 2VPQA 3NAMA 3V8MA 2Z9DA 2Q2QA 5KNBH 4D3FA 2I6TA 3ZHOA 1J09A 1EI9A 3WLNA 3FFXA 2VT2A 4HWRA 1GPBA 1TC1A 1LI7A 4LDPA 3RM3A 4NCKA 3DOOA 3TO5A 3ZWBA 3CZ9A 4EB8A 1IB0A 1YIAA 1C1DA 4DJDC 2C57A 2B8EA 2D1SA 5FUQA 1VLLA 3K0AA 1IQUA 2IY7A 2W6JA 3FROA 3FUTA 3K6KA 4UZFA 3UQYS 1H2ZA 3MERA 4IJ6A 2ZYUX 3K0HA 3QHPA 3EDMA 5F3DA 4OI1A 5DGDA 3F47A 2O2HA 3ESAA 5DVZA 2EZTA 5E95A 3WHKA 5EQTA 3PE6A 4CJXA 3D59A 4CW7A 3PPWA 1X42A 4MPDA 4AAYA 3U4QB 2ZRGA 2QTNA 3DBIA 1FMTA 7MHTA 2FWNA 4YRRA 2JFFA 3FPAA 2FFQA 5J9FA 4E21A 5CDHA 3TLGB 2BJVA 1LKZA 2PBFA 3UAXA 1WBBA 2OORA 4OFBA 4M36A 1QYDA 1RFLA 1ULBA 3FI9A 4NFSA 3T0IA 5KHLB 1EB9A 1KVRA 4MV3A 4Y2UA 1HTTA 1H4VB 2OCKA 3U39A 2Q2NA 2DWQA 1LDNA 1F9EA 1OAKA 4QOHA 1NW9B 3UPDA 2A86A 3C1UA 5IASA 1XNRB 1GILA 2XQVA 4NICA 4J6FA 4Y2VA 3AETA 3PCXA 1JZTA 5BR8B 2AEFA 4IIJF 1JIVA 1RE0A 4UMEA 2AR9A 4EHDA 1SCDA 1SCUA 3ZLBA 3CVXA 2IL1A 2BMDA 4BUJA 1E69A 1JPNA 4EJFA 1WBDA 2PUFA 3CF6R 3RIMA 3W7AA 3K9FC 4OXRA 4LBYA 4UHEA 4EPRA 2A6PA 1HZZC 3A0RB 3KL4A 1DG9A 1TRKA 2GPAA 4DEVA 3ZNOA 3GUCA 5SY4A 4QPZA 1T4CB 3FLMA 1A8SA 2B98A 2G07A 2VJPA 1L5YA 1XJCA 1USKA 2UZ1A 2QR3A 1NUQA 2F1IA 1QE5A 1VIVA 1YRQA 1U3UA 4YAGA 5BV2P 1GXSA 1J2TA 1VLQA 4GGMX 4IQ4A 4RHXA 1DDIA 2ZM5A 1FNBA 1K8RA 2ZUFA 5ELLA 5AYVA 3TK1A 5J2UF 4GI3A 1COWD 3U3JA 5H16A 5LZ7A 1B76A 5EHIA 4GL4A 5IAAA 1HR0B 5JS8A 2XZLA 4TMFA 3EYAA 2DJIA 4QA9A 2C7OA 1QANA 2W2OA 4KYUA 3IOMA 2CHFA 1VRCA 3FYHA 4RD2A 4X97A 1QHIA 5LLDA 1JG6A 1Z26A 2PGAA 4HEA6 4N40A 3TR5A 5AESA 1ZESA 1DJQA 2O8NA 1XDDA 3GLQA 4DA0A 3SYMA 3RHZA 3ZS9A 1JA0A 5E1OA 4B7XA 1CV2A 3K5HA 1IBMB 5AXBA 4HUQA 4KE8A 4PFQA 2VI5A 4B4UA 2WD7A 2FZ4A 1Q0HA 2ODQA 3NEAA 2WHPB 1B3RA 3GJ0A 2HA0A 3NG1A 2YWFA 4K40A 2O3RA 4LJSA 4TX1A 3LT5A 1OWPA 5LKAA 1Q50A 3R0JA 3SZ3A 1PZHA 3L43A 4BO6A 5LJLA 1UWVA 2TMGA 3PDWA 4I50B 5TPZA 1U7TA 1WXGA 2I7CA 4HAZA 3CPSA 4OSEA 2CC2A 4RMNA 4RVSA 1RPTA 4DUZB 3C3KA 1OX6A 1MIOA 3KYCB 4IH9A 3DGEC 2GEDA 2WZCA 4N3NA 3IEMA 3F7MA 4FS8A 5IJ9B 3RFTA 2HFJA 1DAOA 1X92A 2OP1A 2XXBA 5FF9A 1QG0A 1PLKA 1EDOA 3BH0A 4MVJF 4CUKA 1ZM9A 1HE3A 3IAUA 2C5AA 1XMXA 4DQ0A 3DLPX 3GT3A 1SBYA 2IFTA 3JQRA 3KR2A 1SKYB 3O92A 2Z3ZA 5IJ0A 5LNK6 1ODSA 1PGNA 4RTQA 1T8YA 4MCAA 5C53B 5ICFA 2APJA 1R9GA 3HGTA 2HB6A 2YJZA 3I5UA 3TZQA 2VYNA 4DZTA 1LNSA 3F4BA 3C45A 1N4DA 4N6OA 1T6ZA 3DTVA 1L4HA 1RYMA 4MI6A 1EWTA 1RW4A 1RLMA 3KYJB 2ZRIA 4KXXA 4P86A 1W5SA 4LRYA 5JYEA 4I50F 1U2QA 1MQAA 3I83A 5D3ZA 2ZT6A 3K6SA 1I51A 3ON5A 4AZWA 4QUHA 1DOHA 1AKYA 4GP7A 4JR0A 3W5HA 1XKTA 1EWVA 3JD3A 4WZAA 4Y9SA 2OYCA 5BNTA 1JEOA 2EWMA 4U2EA 5DGHA 1XTIA 1DOAA 2UYHA 1EWRA 1Q44A 2YN2A 3M82A 3OOJA 2O2YA 4LTDA 3SX4A 3WDSA 2XUPA 1BQ4A 1LU9A 1S3IA 4KRGA 3UATA 4EEZA 4UULA 3SC2B 3BGSA 5IX8A 1TAGA 3BHNA 5D87A 2AOUB 3P2JA 2GJSA 4HEQA 1SCJA 2YWJA 4DJTA 2FJ0A 2QVBA 4OHWA 1C8BA 3F3KA 1O89A 1U7XA 1KL7A 3TM5A 3NOVA 2FMTA 3FRIA 4RM3A 3CH7A 4LRTB 4QOIA 1WHTB 4QGSA 3EOBI 3WNBA 1Q0PA 2ONZA 1JAZA 1M2HA 1NOIA 4RNDB 3HJBA 3W8NA 1XMJA 1VCNA 4HPJB 3DQQA 1D2GA 1JFLA 3AOEC 4FFDA 1IN8A 1DAFA 3GPLA 2W6ID 3OIDA 3L1IA 5AVOA 1SWWA 1ESMA 3GLHA 1Q7BA 5JCOC 2FKAA 3C97A 3OOEA 4OCZA 4Z53A 4UHBA 3M1LA 4BX0A 1WW8A 4FLFA 4P9NA 1JHPA 1KHTA 1L5FA 1MFPA 1NXWA 3R5TA 4JENA 4NBRA 4BVEA 3X1XA 2Q3JA 2HTEA 2VLBA 2XYHA 3DL4A 1NVTA 3SGLA 3D3EA 1KSFX 2FVXA 2D13A 3B82A 3QE0A 3VNAA 1ZD3A 4GQAA 3AKZA 1TYCA 1U28C 2W4IA 1DL5A 3JRWA 3MILA 4CTNA 3FLAA 1NQTA 3LOPA 3MF4A 4BGUA 3L8GA 2A9JA 3AEUB 3CSDA 1ZYUA 3H3FA 3P5BA 4GYYA 4EQ6A 3WMRA 4D98A 1VHLA 2IOFK 4HFNA 1KH3A 1XVTA 4YYEA 2MMCA 2Z6AA 3NONA 4RFSA 3W2GA 1T6BY 3DLIA 3RVSA 2QAGC 4ZVVA 5CYFA 2YUIA 1A2OA 4QODA 3L46A 3V80A 4KO2S 4BFVA 2BFOA 3UMCA 2RCNA 1KZ4A 2ET6A 1XAIA 4FYVA 1QC5B 2BFAA 3EZFA 4BFTA 3RI3A 3QVXA 1O7JA 4OHUA 4DSTA 5T3UA 3BIOA 2IHKA 4LVNA 1N36B 2EARA 3U7JA 1T34A 1IXRC 3HE3A 1L4YA 2F1OA 4Z9XA 4OQQA 3T12A 3UUGA 2RGAA 1C9KA 1U65A 4M0PA 3B2QA 1UPXA 1H66A 1PS8A 2P6MA 3EBLA 5JVDB 4NOLA 4ZDJA 2GHQA 1UOEA 2QLFA 4AF6A 1XTSA 3ROZA 4FTWA 2Z8YM 1Y6FA 3FDFA 2IX9A 4XD7D 3SE7A 3IDFA 1D0VA 3KR9A 2OZEA 4QAQA 1HNWB 4TQ9A 1MLDA 5CG1A 4Y8VA 4Z3OA 1DQPA 1QZZA 2PZAA 3QF7A 3ZYZA 4CMKA 5JH7B 1K08A 5JCPA 3REQA 2XQIA 3VMFA 4QBKA 5HTKA 2GYYA 2PY6A 3D8TA 2WF7A 3QTTA 3GFVA 1JZQA 4RPJA 1ZSYA 1ZY2A 1X2BA 1WF3A 2CUKA 2UAGA 4BO4A 4DBZA 2ZJBA 3DKKA 2YS6A 4PZYA 5DP1A 5DHFA 1PR2A 4OHYA 1RRVA 2X2PA 4BDSA 1AKMA 4G0XA 1M7BA 1I7NA 4YT8A 2O8VA 2XDAA 4WY5A 3OKAA 3DE3X 4CNBA 4LSGA 2ZJOA 1TT7A 3LCCA 3V1UA 3W2TA 4W5NA 4WZBA 4ENRA 2VSXA 5LMNB 3E7WA 3HGQA 1GY8A 1VPDA 2NV0A 3FMFA 1KMHA 1JXOA 5GJBA 2P30A 4X3OA 5ITZA 1DCTA 1MIHA 3BQMB 4J16C 4KSBA 1LPOA 3FSEA 4GR9A 2OCDA 2CYCA 4FE4A 5F7XA 2IJGX 5EZYA 1ZU5A 3A6GA 2C31A 1KJQA 1GZ7A 3DDSA 3KAJA 1JA1A 3DZFA 3G49A 4G0YA 5DI3B 1YS4A 4C7VA 3ACCA 4NFHA 4W8HA 4EGQA 3H4VA 1Q2UA 2PSDA 4WBNB 1N6KA 4EECA 5C7LO 5IFKA 2BUAA 3I76A 2Q5JA 1LNZA 3R6LA 5ECWA 1G55A 3K9HA 1ZK3A 4PAGA 5F1YA 4HH4A 4Y9UA 3TVDA 3QVLA 1V3VA 3M6FA 1UBLS 4MITA 4C14A 5EHNA 5KNBD 1N0UA 3T5BA 4KLNA 4QT0A 1HLDA 3ZD6A 3RTDA 1MENA 3LKBA 3VSBA 1XEWY 2I6UA 4MH0R 2C4TA 4WH0A 3RFVA 3H99A 1PLJA 3SF8A 3NFRA 2DFVA 3BTUA 4XR4A 4ZHSA 3HN6A 4NDAA 1N5KA 4KXVA 2GETA 3VI4B 2GF2A 3SEFA 2QTWB 2ZIVB 2CL0X 3AHGA 2IXDA 5EWJB 1T4GA 2O7VA 2P9CA 2Y99A 2HPZA 4FFPA 1L5KA 2BPOA 4HK4A 1G4AE 4IH4A 4RJIA 3SP1A 5LL6P 4ZU6X 4DWWA 5H70A 1QX3A 4PZAA 4Z0TA 5FWXA 5K45A 5DYTA 3KQVA 1IWBB 4ZVPA 4I8IA 1FP2A 4UHFA 4BJHB 2N0SA 3AEKA 3LHFA 4U7TB 4CN9A 3AHCA 1T8TA 2FPPB 3GEMA 1J0EA 1E2IA 3NWPA 4PZ0A 4AYXA 1M2EA 4PX9A 1ACJA 4O2RA 4BIIA 5BV1A 1E9VA 3WO1A 1TUIA 5FEUA 3KIPA 4Y9RA 1NYQA 3ADBA 2XUQA 4DRXB 1QQTA 4YEDA 2B37A 4LGYA 1F2TA 2W37A 4G9EA 1P81A 1SUDA 1ZMRA 2XH8A 4EGCB 3NR2A 4EUSA 1FEZA 3ADDA 4P4SA 4TSKA 1BJTA 4OJMX 1R0RE 3G2JA 2W2VA 3U5ZB 5KYYA 5ES3A 1CFJA 4JKIA 1K4YA 3AV0B 4ALIA 1H69A 2F43A 4JP8A 5H8WA 3EMVA 5DSXA 5KQSA 3I2FA 3WR5A 2AE2A 3W5BA 5KZMB 1DCKA 1NASA 5A4DA 4J0KA 2M1ZA 3UEOA 4M88A 2WG2A 3EVAA 2DFKB 2QEQA 2QV7A 1P1RA 4J0GA 3DYBA 2P4HX 4WKNA 1ETHA 1IZ8A 1P4SA 2EP8A 2VDJA 1P2GA 2PUWA 2ZI3A 3FCEA 3H84A 3OU7A 4ZD6A 1I2ZA 3W3ZB 4RH0A 5E4JA 2J9XB 1R9NA 5JJ5A 2GXQA 2QAGB 1W29A 3N07A 1YK0A 3C8HA 3WYBA 2WNSA 3CPEA 2O8BB 3JD1A 1R4NB 3M4ZA 4LOAA 3CLSC 4FFBA 1EWKA 3B20A 2XKAA 5GGYA 3IV6A 3R9IA 1CJTC 1S01A 3W6PA 5HFAA 3RTGA 2ZCUA 3FDIA 3KKQA 3ZWCA 5IFLA 1D2CA 3FZNA 5JYBA 3I1FA 4MVWA 4U7HA 5LZ2A 4YO7A 3INRA 2BEVA 5GOTA 1C3XA 2G6BA 2VHEA 2XTJA 1WP4A 1ZONA 2WAAA 3DWGA 2PN1A 4JEUA 3H3JA 4LZPA 3PCRB 4HWPA 4QEKA 1MPTA 4U2CA 4DABA 1J49A 2E4AA 2KM1A 3ZCUA 4XPIB 5LLTA 1VGVA 3HXKA 3O21A 3A9UA 4M9QA 2EHDA 1EP1B 1KYIA 1P0MA 3C5EA 2H4YA 4FHCA 4X62B 2W2QA 3A6DA 2WM8A 5BO5A 1DINA 2FEPA 1XI2A 1YDEA 2VP0A 2VPPA 1RJ9B 3O8DA 3SS8A 4ATNA 4F4UA 4PQRA 2B9VA 2QRPA 3W3AA 5IMSA 4OLJA 4KV7A 2NQTA 2FR0A 4MKFA 1XL1A 3ZPXA 3WYFA 1X1BA 4JSYA 3WI7A 4HX5A 1E1QA 2HU7A 5DZSA 2ZVJA 2P91A 4DLPA 5EXDA 3F67A 2GPJA 2P2GA 2E4VA 4Q47A 3G0OA 5EL0A 4LYYA 3WJ1A 1QCCA 3NKFA 2O2JA 4JOSA 1E1RA 1G6KA 2FSSA 2IUSA 4EX6A 5BN3B 1XPUA 4H1HA 3UG6A 4NBVA 4TT8A 5IDVA 2ID9A 4EJMA 5FBKA 4ANFA 1CJVC 1J99A 1VSUA 1YB6A 2W4MA 1T36A 2WWYA 5EOVA 5ICGA 1NGSA 3ADKA 3QVGA 5TNXA 1PG2A 1BKYA 3BHJA 5LR6A 5KYWB 3QOFA 1LTQA 2XTNA 5EQJB 1D5CA 1NLZA 2ATIA 2WJ3A 3LYUA 1C3EA 5BP7A 2W7TA 5LIRA 3PVCA 3MINB 4JHXA 1PL7A 1ZOOA 3KCNA 2FPLA 2PWYA 2D59A 3M6MD 4R7GA 5JNLA 4NYMQ 3K0AB 2NXWA 4G2TA 3VC3A 2AF4C 5CB4B 3IT0A 3WQHA 3FPLA 5JFGA 1SKUA 3RR2A 4FD2A 3J81k 1UT8A 2PEYA 4G25A 4P54A 3P94A 1VE5A 4O1MA 4UTZA 2QT9A 4CL8A 5C4IA 4KE7A 4RD3A 1EFVA 2C42A 4B0PA 1PLLA 1JX6A 3MWDB 1L5MA 3OC6A 1XZFA 4M2LA 1Y3FE 2BKAA 1C4KA 3M1AA 1NQVA 5IAOA 2YWDA 5BUCA 3R24A 5JADA 2WWGA 3PXDA 1U5BB 4LFAB 4KJZA 1VXOA 1BE6A 2X1VA 4URHA 4CTKA 3B2NA 2ZWAA 1IC6A 1QVAA 3PEEA 4NULA 5DDIP 4CEJA 3GCWA 1W0CA 5EPUA 5FBLB 3L4BC 3D1JA 1D4FA 3RJ5A 2JIZA 3BGIA 2QRJA 3UT0A 1FYWA 3Q41A 4BMZA 2Y1GA 4X20A 1YBMA 3DMYA 3EZNA 1VI6A 3D2CA 4MVJP 1K75A 4MEAA 5TXGA 5JC8A 4IDHA 1NRXA 5EJ7A 2W6JD 4GOXA 121PA 5TGDA 3QVWA 1QFJA 3FJYA 3KSZO 3S2YA 3RS5A 2AFRA 2MTBA 4HDSB 4ARAA 3AEXA 4EEXA 4E1VA 4E31A 3KM0A 4KQMA 1U0FA 3BICA 3ZEAA 1YE8A 3COZA 4MTCA 3DXYA 1G8AA 5EC8A 1XCBA 3GV0A 2JFPA 5I5EA 3JRNA 2EFJA 1M5RA 1R5JA 2DVMA 4ADSG 1AH2A 2BFBB 1UJ4A 1WUIS 2ZDGA 1P17A 4E1BA 5F5XA 1PQPA 5BUSA 2GR9A 4CZ2A 4GAEA 1UDCA 2CJPA 3OBIA 5DXAA 2IX3A 4KVFA 1GTSA 2P9HA 5F9HA 2HSGA 1A82A 4MWCA 3F4LA 2Z04A 5E3IA 1LNQA 3S8MA 4ZYUA 5AKJA 4F1WA 2FY8A 1DCFA 1V4VA 4UHCA 4DFDA 1CUXA 3IUBA 3SQXA 3PNKA 1KARA 1QFMA 3K2BA 3B9PA 1WPQA 2AOWA 3CHYA 1LRLA 1RZVA 5EXPA 1V8DA 3MM4A 1GZ6A 3FBGA 4C29A 3LTNC 1BDHA 4PICA 1RWKA 1OH5A 2HXGA 5DWQA 3INYA 3JWJA 3PK0A 2VHJA 3ZDQA 1N25A 2WUGA 3QV1A 5IH3A 1Y9EA 2CVPA 2JAHA 4AKIA 1T35A 1JBQA 2QGNA 4CFSA 1F6BA 2P6PA 4FZVA 3ZHYA 3GJ3A 2ZAYA 3QRWA 1MIOB 4V3BA 1C9JA 1DBSA 1VKJA 4CV2A 1TPZA 1THZA 1KYTA 1KIFA 5IJ9A 2IT1A 3RYIA 1W0JD 2O7SA 2Y3IA 2H1RA 1M75A 2XVAA 3PD7A 4WXRA 3RGGA 5JZVA 1MEJA 2FUNB 5IARA 4DBLC 3P4YA 1EUDB 1QGYA 3F5SA 4EGSA 2BRUC 3CX4A 1YOBA 3TJZA 9ATCA 2G83A 4XDHA 2J87A 1Z47A 4N9WA 3P0HA 3VFDA 4F9TA 2PX8A 3P4XA 3IEKA 3TTVA 4X1YA 2CNOA 5AMXA 4FOPA 4UDYX 4EY4A 4WZZA 2I80A 1W0KD 2R65A 3OBBA 3DBHB 4EO4A 3QKWA 2BN4A 1X8LA 2YIJA 1Z83A 2ZJ3A 3RS7A 1AU9A 4CV1A 4CDNA 1Q12A 4OATA 2NAFA 3HFGA 2J0VA 1JEQA 5D7BA 4WLEA 5F9FA 3QI7A 5DNEA 2R60A 4JYAB 4YQEA 2I7DA 1X9HA 3K2IA 4OH7A 1H4SA 2GA9A 3ZGOA 2AXNA 3RIHA 1SU4A 2QDXA 4P35A 4OV6B 2BKVA 2B4KA 3HABA 4TTIA 3V8RA 3VOTA 2WE8A 3W6NA 2A8YA 1BS1A 1CF9A 4K9OA 1UQUA 2IUYA 5J40A 4DIDA 2DH5A 2W2TA 2A0XA 1SKAA 2WM2A 2XDYA 3ESRA 1XHEA 1E1LA 1OIWA 3H5IA 1NKVA 1SXHA 1HT0A 3IAFA 1Y81A 1BRMA 2QI9C 5A4JA 3DBOB 2BM0A 1XB2A 1TZKA 4QKQA 4ZHQF 1I36A 1YACA 2FF5A 1G1AA 1G8SA 1WB4A 3N2LA 4MR7B 4QUIA 3ZY6A 4MV7A 3WLIA 4EUEA 1SM4A 2CHGA 4A9AA 1C14A 4GRAA 4JBNA 4R9SA 5KIAA 2FRDA 3PGVA 4MVJA 5EJAA 3L0CA 1JIJA 3D0QA 4RLHA 1V8PA 3E1KA 4CLOB 4JR2A 1H2HA 1U8CB 2G5TA 4FDTA 4C3UA 1RKUA 4WEQA 3N6VA 2WHRA 3P9QA 4QBGB 4UUOA 1Y3HA 1T5BA 1UFVA 3NHYA 5MHTA 1MJ5A 1TYBE 1KTVA 2K2QB 3GFRA 3R6GA 4IX9A 1ZUIA 4IGKA 3UTCA 4B3IA 4YY3B 1H6DA 2W2LA 4TKUB 1FRVA 5L3SB 3P45A 4ILKA 1E3EA 5SY6A 2NN3C 4ZQGA 4R2JA 3KEMA 3L6DA 4E2ZA 4BB9A 5EHQA 4IHQA 3EWAA 3OWXA 5I9BA 2VXBA 3WIDA 3H7AA 4KQWA 1JJVA 3UB3A 3IAS6 1GLVA 4QOGA 3OO1A 4BVBA 5TMEA 5KVVA 3E9EA 1MD9A 3N2GA 1JFTA 3OUUA 4D57A 4MP3A 3ZVRA 4KFTA 3FMOB 4REMA 1B74A 4KO4S 4FYKA 5DV9A 2FW8A 5KJ6A 1DDGA 4BN5A 1VZ3A 3ET4A 1XU7A 2PX3A 5TMDA 4HH1A 2DPGA 4UEKA 3RT7A 3TQIA 4QDOA 2D06A 1A4RA 2ZPUA 3M4JA 4KQIA 1N1GA 5JJKA 3CVWA 2J5QA 2FHSA 2JFBA 3CBGA 1GKUB 2O6LA 3M1YA 4EYSA 2FW0A 5CT6A 4UNPA 1GGFA 1UBTS 1EKXA 3HJCA 4UM8B 3OTIA 2VP4A 4NFLA 3T7KA 1MORA 3VV2A 4E2FA 1BDMA 1YRHA 1H94A 2NACA 2RI1A 2IPXA 1SMKA 4KWEA 5K3FA 2HWKA 1T26A 1FF9A 1JR2A 1YL5A 5DHQA 5FHRA 1G9SA 1C30B 3NM6B 2ASEA 3QLJA 3U56A 2J5RA 3CGWA 2BFDA 2AMYA 2QZZA 4DMMA 3V9PA 1XZAA 5CLLA 1K7EB 2I55A 3T5GA 3HSSA 3TXXA 3RAEC 4P0QB 1P44A 1EP3B 5CH5A 2GZHA 3M5CA 5FAXA 2GXUA 2XQFA 4HDNB 3AHHA 1LPBB 1M2WA 2A4KA 2CXUA 3IDZA 4BTLA 4C6TA 3S5JA 5ECYA 1G5RA 1SKBA 2BC9A 1TJYA 1VKZA 1RJFA 2J31A 4NESA 1L7EA 1QCZA 4I8DA 3TE7A 1KFCB 2HY7A 3E22A 1A5BB 1BC5A 2EDCA 4NARA 4XLZA 1UJ2A 2Q3BA 1UFRA 3KD3A 4WNAB 4XWYA 3W9YA 2NO6A 4BQEA 4EY5A 3ZV5A 5KWEA 5I7VA 3PDUA 4LBZA 2WA1A 3VZDA 1VYHA 1U04A 3CUUA 4TWIA 4BBPA 3BB3A 4ERNA 1BWQA 2JZNA 2ONKA 2V0NA 3O4FA 3LFHA 2QTCA 5LYJF 3AONB 4Y6OA 2WU0A 3G5AA 2GFIA 4KQ6A 1FMLA 1KMMA 1N0HA 1YJXA 4OJKA 4Q7KA 3ROKA 7YASA 1TCCA 4X91A 3JPWA 5KNLA 1DT3A 1XL0A 3SDSA 3ZGLA 1X7HA 3U31A 1AT1A 1JLSA 1J97A 1NWHA 4ZV9A 4AURA 3SXUA 4UUNA 2OM2A 2HH9A 3O2NA 4JA0A 2H31A 5E1DA 2B7CA 1KEKA 1DTSA 1JJIA 2WTBA 2JK0A 3MK31 5ANRB 4B4VA 1ZK2A 1DARA 1HTWA 3AU9A 3E8SA 4EKIA 5I9SA 2ZOSA 5BVGB 4E08A 1CQPA 1QQ5A 2WWIA 4IMPA 4QTUB 1FBNA 1AF7A 1R4AA 5FPSA 1IEXA 2CK3D 2Q5QA 4RZQA 2H2AA 1RYDA 4F60A 1R6BX 1WNFA 4AMGA 3I4FA 4RHYA 2XBMA 1XK6A 4BQPA 5EIHA 4B80A 1M0SA 1V39A 5L4LA 5AI8A 5CA0F 3THWA 3HFRA 4PCVA 1PO7A 2XZDA 1MC1A 1KJZA 5ECDA 4IJMA 2IXTA 3WE7A 1CEYA 1YCGA 4HR7A 2KX7A 2OO3A 2PWZA 3QU9A 4TWBA 3VPCA 1CY4A 1M1YB 1OKKD 2PV0A 1ES9A 2WTXA 4HLDA 4ZOEA 1ARZA 5DBHX 5A3JA 4QXPA 1AUOA 3GT0A 3SJZA 1B73A 1ZGGA 1BU5A 1E4OA 3LUGA 3QKSA 4FCVA 4OJYA 2DQSA 4M1KA 3UKDA 1WAMA 3WLPA 1BOFA 1LJ8A 3B60A 1V41E 3A9RA 4HPWA 1EVIA 3A4MA 4LMAA 2O2XA 1B14A 3PR3A 4MQUA 3GWGA 4O33A 4OUKX 4RDHA 3REOA 4DPKA 2H8GA 3UWOA 3AR3A 4G1CA 2VCYA 1Y4SA 4JMPA 1MJGM 2XGOA 4XCVA 8ADHA 1S8OA 1CX9B 3MJEA 8ABPA 4EO7A 4QOFA 3W78A 2WIAA 3FMVA 2IITA 4GKAA 4N4AA 3C7TA 4RPLA 5CVDA 3FFBA 3EHEA 3DMTA 3DMGA 2BW0A 3BF7A 3CN9A 3PVSA 3SX0A 3ZHBA 4YMTA 4FILA 2RG7A 3O1IC 3WLKX 3UB4A 4R81A 2A9QA 1T6YA 1UUFA 2L19A 3DTVD 1PUIA 2FF7A 3V2IA 3QQPA 4CUZA 1GM5A 2ID8A 4BFLA 3RYHB 4AJEA 2EZ4A 5JPCA 5KYYB 1VE1A 1O0SA 4BE4A 1DNPA 2A5FA 1FTGA 3GLKA 4ZC8A 2YNMC 3QKIA 2XE7A 3A3OA 3D3JA 4I4NA 4EFLA 5LP6F 2VT7A 1LPPA 2ISCA 2PA0A 3GLSA 2F43B 2RAUA 1XVLA 3RNOA 1A8QA 2AW3A 4Y2JA 4CMCA 1T2VA 3NETA 1NVUQ 1J2YA 1W1IA 3H0KA 3MCZA 4LEIA 2WJAA 2OOSA 3UC9A 5KS2A 2R6AA 3E5NA 1BGVA 2J3DA 3WK4A 2GX6A 4FNAA 5GJWC 3H2HA 1NC1A 1NBMD 5ALYA 2YV5A 2W4QA 4DSAA 4RTNA 1X1QA 2F8MA 1EVYA 2ZBUA 3GG9A 2BMEA 1GD1O 1L1EA 2ON6A 1XNJA 4MCIA 4CIAA 4OH1A 4AKGA 1PEDA 4IWYA 4CT5A 2WQZA 4KW7A 3F3YA 1JEDA 1MNQA 1U8EA 3GFBA 2QNIA 3CF2A 4PZZA 4ENQA 3KZVA 4LSMA 4OBBA 1Q92A 2VEDA 3OIFA 4YRDA 3UUWA 3VPAA 1QIGA 3TW4A 1V3QE 1XLTC 2L82A 3AR2A 3HKEA 4KH0A 4QASA 2CGEA 4LCJA 4QQFA 5LZ8A 2D00A 5LQMA 3MMZA 1Z4QA 2OXTA 2WJ4A 4LMBA 3UKJA 4AU1A 2O5EA 1SK8A 1SURA 2CLCX 4EYKA 2I1QA 1P6QA 2VT3A 4BGVA 3O8CA 1U2PA 4ED9A 5BV8A 3CG0A 4BNKA 4X94A 5H02A 3AKEA 4NMXB 3LFUA 4CLRB 1ZIXA 3O6VA 2C2ZA 5IKMA 1MJHA 2I29A 3TGWA 4UATA 4OUDB 5GP1A 3CR3C 4O08A 1QRUA 1XJ5A 2VZ8A 2JCYA 1QYXA 3ZGXA 3ABQB 2NU9B 2MR6A 4U7DA 1V5EA 2BY4A 1ISPA 4G5HA 4I81A 2O8FA 1QQAA 4WZ6A 4YB8A 1S96A 5ARDA 4AIIA 2H5LA 5BQ3A 4M0FA 4RZSA 3I73A 2H29A 4WNIA 4X7BA 1N2JA 5CX1B 1XWFA 3NANA 3T7SA 1Y89A 1U0HC 2FR8C 3MRSA 3ZV3A 3ZZ1A 1RQLA 1HNXB 2ZWPA 2JS7A 2VXCA 1UC9A 1GU7A 3CEHA 5JHHB 4F2DA 3P2EA 3R5JA 3WOVA 4E5VA 3L79A 3A3PA 4V0QA 4XVCA 1A9OA 1RNLA 1J0XO 4Y9TA 2QVGA 3OJEA 4JLMA 1GOTA 4XB2A 3MTDA 3PDIA 4DR6B 1T36B 3CUEF 4XVUA 4DDMA 4URXR 3GBPA 1MMFB 4RK4A 3EVBA 3OFVA 4KV9A 3ZW9A 1A9XA 1TQ4A 4DWOA 2JH8A 1YJ8A 2GO1A 2CBZA 4GNRA 1Z6TA 2WKPA 1BGXT 1QCDA 3G82C 3GLRA 5JXWA 1FU7A 4RE6A 3WDMA 3V4VB 2C7PA 3E23A 3C5HA 3FXAA 5TF4A 2QQGA 2CCJA 3KDSE 1RCUA 2B0JA 2YZNA 3LLSA 1P0PA 3O1JC 4UCWA 1IWPB 1HYQA 4QQNA 1IBSA 1W9MA 1FU4A 2WYWA 2H11A 3DCIA 1YULA 3OQPA 4LY0A 3NFYA 1HL7A 2GCOB 3TPFA 1JDBC 3WRVA 4BB0A 4BLOA 4ZI3A 1PR1A 1XVVA 3AP3A 2CJWA 4K2HA 4Q7JB 4GL2A 3TDMA 3DT9A 3ZNPA 4EW1A 1PGQA 1P9LA 3INTA 3EZ9A 3GYBA 5JXHA 2Z1NA 3MWDA 1CUBA 3NLLA 3FLEA 2XITA 3ZLTA 4N7MA 4EF6A 1UADA 1SKQA 1Z7BA 2IIVA 5G0TA 1U2GA 1F12A 3CR8A 3EQZA 3K1TA 4YJFB 5BSRA 4LCBA 3SZLA 5DYGA 3CEMA 3E8XA 3QX8A 4PNZA 5IKOA 2X9GA 3UK2A 4C04A 4U9IS 2JI9A 2X4DA 3CLSD 4ZZ0A 2Q7XA 4JWKA 1P4JA 3VR4D 3GHYA 2C1XA 3TQFA 4CR6A 3RBVA 4NH4A 3MBOA 1UZMA 4BNXA 4ZCMA 1GAXA 1NXXA 2CV1A 2C0CA 4BCBA 4Z1MA 4CQJA 1YS9A 3KSRA 7AT1A 4P81A 2EX4A 1NBMA 2O2CA 1VPLA 5I8WA 2V6FA 3B51X 1KAQA 1ISHA 1ID1A 1C9DB 1KY5A 3QP9A 3WSVA 4BL5A 5HX7A 4FMDB 2F17A 2JD2A 4G5XA 5IT9A 4I9HA 4AJ9A 8ATCA 1USVA 5H83A 1VSTA 4MB0A 2DY0A 5FLXA 1EVEA 2WR8A 1RRGA 4LDJA 3I0MA 2HWYA 1P9RA 4Y1FA 3F9RA 2DFPA 1XFAA 2HA6A 3X1WA 4V2UA 4YUAA 5KU1A 5AWFC 4M55A 1XDUA 5F21A 3C3MA 3B5JA 1L5ZA 4JQYA 1N2CB 2VHYA 4IDCA 3RROA 1PV4A 4LV6A 1A7KA 3GF4A 2P4UA 3LHDA 2O14A 5BUZA 5H5JA 4KWHA 1Z12A 3FUWA 4TKZA 3VR0A 4UHKA 5AW8A 3L8HA 4K86A 1YS2X 1RQGA 1SZDA 1YT5A 4HTFA 1PK9A 3CG4A 3KAPA 5AXDA 4BQRA 4EBFA 5LD2B 2V6GA 1VKNA 4AJLA 1RCFA 1H1DA 4RSMA 2EU8A 3AUTA 2C4VA 2QWXA 3LPDA 1Y5RA 4HVAA 5K7SA 3I23A 2DKFA 4MPPA 3ABOB 4QREA 4S12A 4F3NA 3CPHA 3LY5A 5AW7A 4F4DA 5E6SA 221PA 4LNAA 4Q3OA 3L7KA 3MS2A 4J03A 4OYLA 3O4RA 4TVKA 5LU8A 5LOVA 3NC0C 1D2HA 1EQUA 3C4QA 5KTYA 3OMWA 1D4OA 1FFXB 2OHHA 2QRVB 4HLCA 4BMPB 3FZGA 5BSVA 5CCBA 1Z36A 3Q8MA 4OB6A 1JQ3A 1ZIOA 1RXIA 3ZXYA 1KYYA 1Z63A 3LX8A 4WESA 3PE4A 5AR1A 1YMUA 1XUOA 4JZKA 1E0JA 5FO0A 2VUSA 3TZEA 2R44A 4ZOAA 1J1UA 1Z6ZA 3Q85A 1M6YA 3KPVA 1WETA 2EKLA 2IEGA 4XIFA 5DBIA 3RU9A 1L8XA 1GGHA 1K89A 2V4ZA 1BVYF 2P9YA 3PQ8A 2YJ3A 4R8RA 4ZAVA 4UASA 2DUJA 1M6EX 4QOJA 2H18A 2Q3EA 5EHZA 5J1TB 5K2MA 1R4MA 4IZ6A 2WIFA 3R3WA 2IZZA 2WAXA 4DBVO 2NQ2C 1V4BA 1Y8QB 1ABEA 2OHGA 3QOXA 1ZJ5A 3NT2A 2HBRA 3EX7C 1PGOA 1DAHA 2XUFA 3C4VA 5DM0A 3WIUA 3B5IA 5KTRA 3NATA 4M9UA 1ZSNA 3F7NA 1SD2A 3O31A 3WGZA 2PSSA 1JEQB 2RGNA 1EJ2A 1MB4A 2ZGVA 3PUIA 1NL3A 4FBLA 4FGKA 4XDGA 3IEUA 1KVUA 3U1VA 5J4HA 1AHPA 2RGRA 1Z8DA 3ICOA 3PWTA 5AKXA 1B15A 3KP1A 5F7ZA 4QDKA 4EKGA 4LFBB 3KJFA 1ODLA 1EINA 2GTIA 1RM3A 4JLOA 2IYRA 3AWDA 3QYJA 1XZIA 2W6PA 2ZYSA 5DNDA 2M2IA 1IBRA 3ILVA 4CQLA 3HB9A 1R12A 4RZXA 5IS2A 1D4ZA 1DQSA 4WN9A 1TJPB 3V4SA 1LRKA 4DM3A 5HOEA 5ALWA 3SBDA 1QH8B 1ZOPA 3L4EA 2DM6A 3C7DB 1YZGA 2VF4X 1TQ6A 1TM7E 3I8SA 1RKBA 3U4IA 5DX0A 3VUFA 2N3ZA 3GQBA 4V0RA 1JHRA 1XNHA 2IPOA 1U8TA 4P2GA 4BEBA 3PXXA 3EUEA 2G7ZA 4YJHB 5IAGA 2WSMA 2NPFA 3UXHA 5JRZA 3PC2A 2D0IA 3MHTA 2FAXA 3FGOA 1EEXB 2WF5A 2OFFA 5EWLA 1Q0LA 1CUHA 3CPJB 2XD9A 3DWFA 3U48A 2PANA 1NYTA 3BFKA 5F51A 3NDJA 3PA6A 1LI5A 4R2HA 3GR6A 1N78A 2D0PB 2XTZA 1L5OA 1P80A 1EE1A 4F0JA 5LMUB 2GF0A 1G5PA 4IXDA 3H0CA 1DJOA 1J4AA 2V7WA 2PYIA 5LDDC 4KFCA 2OSBA 4Y2QA 3VU3A 1ZIYA 3F3MA 3FOEC 1TUBB 4OX9B 1PN3A 1VE7A 5L3SA 2Z95A 3W34A 3R44A 3BBLA 4GSLA 1TIPA 2MT9A 2X13A 4BVGA 2DZDA 3VDRA 2VDLB 1DKLA 3CXRA 3NP7A 4L0MA 2DKOA 2C9BA 2WW8A 3ITKA 1SQSA 5G4KB 3DHYA 521PA 3I0ZA 5IM5A 3ME5A 3SZOA 4UPEA 5B12A 5LWQA 4IGFA 5EIXA 1X86B 4KPUB 1CS0B 3RQIA 3THSA 4AMUA 4ZCRA 2CXQA 2VZ0A 2WAYA 3B9BA 3GFFA 3H04A 1OZ0A 4HV4A 4KO3S 2HQSA 5CLQA 3NGMA 5ILOA 2VF8A 3UH1A 2IDMA 3HCEA 3R40A 4L50A 4Q48A 2D5IA 2JJQA 2IGBA 2O57A 1KNQA 1ZA1A 2OLKA 2MU1A 3C24A 3D1LA 3L3BA 2HU5A 1LLFA 3OE4A 4BU1A 4GH5A 2Z2ZA 3NTRA 2PPLA 2I62A 4I1SA 4J8PA 4MQ6A 4HH3C 3KJXA 5KQGA 2I66A 2FFRA 5TS3A 2XA2A 1SCQA 4Y3UA 3I3SR 1IUOA 1Y0BA 3FKSD 2EJCA 3BE5A 2VHQA 2VSFA 3PX2A 1TI7A 1ZP6A 3C3EA 3CRQA 3JQ8B 3ZDFA 4JI2B 2QA5A 3L4JA 3RWMB 1CERA 2FLVA 2VJQA 3AUSA 1SGWA 4MMZB 5ELMA 3TH5A 4Q4HA 4AF8A 3E4CA 3V4FA 4IL5A 4BKOA 1ADYA 3PNSA 2EQBA 1BNCA 1WNTA 4L2IB 3JQAA 3JU3A 5CGZA 3FGZA 1K2WA 5ALIA 4XARA 4XQ0A 3TDKA 3VJLA 1WQ3A 2XQJA 4JYBA 2ODBA 4L9SA 4Z8XA 4CLHA 3IMCA 1GG8A 4EW6A 1TA9A 3ZU4A 1P8AA 3IMEA 2ZYIA 1E89A 1W5FA 1ECPA 2HUNA 1G38A 4I3FA 4M8SA 1E63A 4I9NA 3LD9A 2P27A 2ZWMA 4QYXA 1QX4A 2DPHA 1WXIA 3DEKA 2MYPA 3QMVA 4WXMA 3E22B 3LJKA 3MCAA 2YYYA 4N5DA 4ZVUA 4Z7NB 3DOJA 1EUCB 4ISCA 2XECA 1DAIA 2BFMA 3DFUA 4QGAA 5H9WA 3KR0A 5ESDA 4X7PA 5LLSA 4HC4A 5A03A 2HFKA 2NZUG 2YHAA 4JGGA 1SD5A 3U40A 4NTZA 2FPGA 5B2FA 1UZAA 2EZUA 4RF5A 5EIEA 3DR5A 5C34B 4X66B 4MS1B 3BMQB 4HO1X 1R27A 2KBEA 4Y0NA 4G8JA 1CUWA 1BYUA 1KO1A 3GPDG 3KQPA 5HFJA 2C3OA 4MUBA 3DOIA 4D92A 5AVVA 5KHOC 1XRPA 2JLVA 2A1UA 2WF6A 1E9BA 2C4NA 3HCAA 4M1OA 2GA8A 2NUBA 3Q5GA 4YLGA 1YZYA 2QZ4A 4EGJA 1FS4A 3LFTA 5TGTA 2IYUA 1KJNA 1YRYE 5PGMA 3T7EA 4YPFA 3T1NA 4FB5A 1G42A 5JARA 3O75A 3HYNA 4I36A 5DRYA 3TTUA 2PRJA 2ATEA 3MJCA 4NE7A 2SKCA 2X8BA 5TVKA 5A6VA 9MHTA 4I3GA 3W5AA 3LIPA 3MMSA 2Q3DA 3QUSA 4H7DA 1E61A 2OQ2A 2WSSA 3JQ7A 4OAPA 5COQA 4CMIA 3UAGA 4IIFA 3P96A 1B41A 4FB4A 2B1GA 4NYIQ 5ED0A 2QT0A 2FDCA 4Y2SA 1A5AB 4URWR 4WN3A 4G65A 1E6UA 2GNAA 4YPVA 1Y3DE 2KMLA 1PW5A 3Q7QA 3UOGA 3UFXB 5GM2A 4JBIA 2BKUA 5JHGB 2PX4A 3AY3A 4JL8A 5JI2E 3BAZA 2OHJA 1I0IA 3EVFA 2R1TA 2E85A 3SJUA 1CUFA 3EIHA 3TNDA 3C8DA 4PNEA 4F8YA 4XFJA 5IVIA 4ZRMA 2H0QA 3TBHA 4AKTA 5GV7A 3QFHA 2O2EA 4AUKA 1GZDA 3LBIA 3CKYA 4E33A 4Z4CA 3IUJA 1EJ6A 2VDPB 4FCTA 4H18A 4ZOLA 2PKEA 5C8DA 3QLEA 1I3CA 1TKCA 4AS3A 3VNUA 5JVDF 2WJ6A 4KO8A 4LV8B 4O2AF 5BWBA 5LSAA 1YWGO 5IBQA 1HE8B 4EW3A 3AKYA 4YV7A 5EXSA 1HSOA 1SBNE 3K9BA 4B84A 1UXGA 3FYTA 3I92A 1E6WA 2IYSA 1DC7A 2Q5EA 3N2YA 1SVIA 2CLFB 3R9XB 4R40A 3IIIA 3H1AA 4D4HA 1ZMOA 4J0EA 1Z56C 2PLNA 2R00A 2PZMA 3V3KA 4CIVA 1SU6A 2AOXA 3ECCA 4N39A 1NR1A 3WNQA 3THXB 2FFHA 4WDQA 1Y3IA 2HPVA 3KJIA 1EE2A 3IR6A 3RYHA 2AFHB 5EGNA 1ADCA 3IPYA 1XU4A 1TXGA 3DTTA 1U5AA 2JK1A 4HAWA 4ROSA 5GTDA 1LBTA 1J39A 4B8YA 4BQSA 3K1AB 3MT0A 3P27A 3QWFA 3WIVA 1Q7GA 1KJJA 4ENUA 5KNCH 4I4TF 4CG3A 1FXWF 2RJ3A 2W6QA 3Q12A 4KFUA 3MGGA 3ZD9A 3EGXA 5BSKA 3RK1A 1CXZA 4RZUA 4IEFB 3V5NA 1QPGA 4BX3A 1KPIA 1YGPA 3NHZA 3STXA 4LQLA 2FWAA 5I8ZA 3SJBA 5CIWA 1MJNA 4CM4A 3H9UA 1KI4A 2RHWA 3TWOA 4NV1A 1JJ7A 3KVNA 1OWMA 2OPBA 3OP4A 4AY6A 4NWIA 2OCYC 4XVHA 2XI4A 3OZXA 1CNMA 2C03A 3BGWA 1KSGA 2HYIC 4FYMA 3KZCA 4EUKA 2QIPA 2CHEA 1M1YE 4Q03A 3ZWMA 2GCPA 1ZDMA 4D9BA 5KJ1A 1IHXA 1BO6A 2Q29A 4M9SA 5EMHA 5JAQA 2QE7A 3VR6A 2V1UA 4P0PB 1XAGA 3X1KA 5C1OA 4JD5A 2RHDA 3I3OA 2QPTA 3HVRA 2XCIA 2VK1A 4EITA 5ABPA 4QJBA 1RC0A 1LDGA 1L6RA 4HP8A 2LP4Y 3JALB 1K27A 4H7IA 2CXNA 4D9FA 5I48A 3RGWS 3JWPA 5KNDD 4DNXA 1K4MA 5KYUA 3M3PA 1GZHB 3WGHA 3VNVA 2Y0CA 1EAMA 4CLRA 2YZ2A 1P2SA 2LBPA 1YCDA 4AJJA 1EK2A 1K6EA 1TD1A 3ENQA 4F2GA 1Z0IA 4OUDA 1UXJA 3CTPA 2I3DA 2GEBA 1Y9JA 1GAJA 1DO8A 1YMVA 1ZW6A 4KAAA 1OFIA 2YXEA 3AY6A 4LWQA 3BVPA 3IILA 5AQEA 1AS3A 1D3AA 4KUHA 5KX5A 4RXTA 3OEED 2DBVO 4JHLA 3M3HA 2VIIA 3PWKA 2Q0QA 4W5RA 4GUDA 3JARA 4KIJA 3PWSA 1KYQA 1WXXA 3WQRA 1PYDA 2YFYA 2E4YA 3K15A 4RMJA 3GI1A 2UYCA 2XVXA 1GTL1 5C8ZA 2Q6TA 2C8LA 3C5VA 3H1PA 2ZSFA 3IT2A 1VG9B 3V8BA 2YNMA 3JQQA 4OQXA 2I6QA 1RR6A 1J6UA 2EKQA 4D45A 5CCXA 4KMMA 1RRMA 2EP7A 4ZQHA 3H2YA 3L92A 1XZCA 1HE4A 2AUTA 3CIOA 1V7ZA 1G5QA 3TRDA 1TFUA 4QL3A 4GLLA 3A26A 1SUBA 3DDOA 3GA5A 1X13A 4XYEA 5KSWB 1VA5A 4HNRA 2OV1A 1L8LA 3QENA 2QTHA 3BUSA 1G6HA 1GCIA 1GGJA 1ODFA 3AXTA 2UV8A 2RIRA 4Z86A 5I7UA 4LHSA 2O50A 1DRUA 2CFOA 2NG1A 1OOEA 1PR6A 2XEXA 2ZULA 3CLUD 2IIQA 3KEGA 3QX9A 4X9XA 1O9HA 3GGPA 3AM4A 1DQYA 2GN8A 5H7XA 5IJXA 1Y1QA 4RY2A 4R0NA 1U80A 2HLHA 5GZ3A 5EQDA 1U11A 1Q74A 3NBUA 3ADCA 3ZQ4A 1SVWA 5DM4A 2FK7A 2W6OA 1CF4A 1G7SA 4DIOA 4E03A 5AIAA 1IJKA 2RIPA 1H4QA 2ECOA 3PSAA 3X1MA 4C7BA 1P7PA 2JFZA 2H0RA 2C8VA 3MLBA 3WYDA 4RTPA 3LA6A 2B8JA 1IHDA 3HBAA 4Q93A 1A5TA 3KKMA 2PLWA 2Z08A 3ZKAA 2YXPX 3EJWA 4IHJB 4TVBA 3IB6A 2ONCA 2HF2A 4IUDS 5CT4A 2RHHA 3C3JA 4KPYA 3BMNA 4HUJA 1IVYA 1KBZA 1Z0UA 2DULA 5SZJA 1YOVB 2AT1A 2WICA 1CJCA 2CF6A 2XJ9A 4JC5A 4H3HB 1TDJA 2J41A 5BQ5A 5DNWA 2MSEB 2OAP1 2Q8NA 5ALXA 2B8TA 3BMCB 3UMJA 4DNPA 1GAWA 5L40A 4RHFA 2Q46A 1WKCA 3P2YA 3P9PA 1QK3A 1X9GA 3OSUA 2YVAA 1XRNA 3I8OA 2XMGA 5JASA 1WXQA 4A2WA 1H9BA 3I28A 3ZD7A 1C0EA 4URVR 1GNRA 1CSEE 3AERA 1W36C 3OJWA 5ILQA 4CV0A 3SYRA 1K7XB 4BQOA 1JIXA 3EIUA 4C0SA 1UBUS 2VQ6A 2Z5LA 1C7RA 1WZCA 1F8YA 2Q6VA 2R87A 4P92A 3VPBA 3ZVLA 4FE7A 1DUVG 1ENYA 1K8YB 3FOBA 4Z7OB 3O0TA 2PBRA 3S3TA 1OB5A 2BFPA 1AQJA 4L8GA 3W8RA 3L05A 1IUNA 3NJRA 3R41A 4LKRA 4MWZA 1VE3A 2GSDA 3N39C 5CLHA 1YQDA 1C0PA 1GCUA 1XDWA 4I5DA 3OCWA 2O7RA 3PZRA 4NG5A 2G9NA 2ZDHA 3MJRA 1Z9BA 2DTDA 3PD0A 4PONA 1E64A 3W8DA 1S1CA 1XZNA 3SC4A 4MVJE 4FLMA 1FYFA 2PJZA 4OGLA 4MV5A 2J9FA 1YRAA 1C41A 5CX4A 4YGYA 5FRDA 3TB4A 1ZGBA 2FRXA 3VVLA 1Q19A 2E18A 2HDWA 5IUJC 3I4CA 3SR0A 1GNLA 1DHTA 1ZVQA 3TGLA 3NI2A 4MVJG 4ZT7A 2O9JA 1ZN9A 1JKFA 4OQFA 5EPEA 2ZJZA 1TVMA 4IJWA 4YMHA 5CVJA 3TFOA 2AJDA 4EHAA 1B3BA 1WUKS 2XB6A 3BTOA 4ZARA 2N9UA 1NJ5A 5E6SB 4X8LA 5CCEA 1NRJB 2FPSA 3CRVA 4I5EA 2HPAA 2I6GA 2IIBA 3LO8A 2FFJA 4MS3A 3UV3A 2OQIA 1W4CA 2QRVA 2X3UA 3ZY3A 3OE7A 1PKXA 1PNOA 2PLFA 2BBTA 3IUSA 4DR2B 3VZCA 1JDNA 1DWPA 3ABZA 3GJRA 3ROFA 4DQKA 2CYAA 1A88A 4MS4A 4WESB 5EE3A 2FOLA 1JSRA 4M1MA 5DK4A 3BIJA 1XRRA 1T0HB 1B7GO 1X8KA 3I1JA 1H23A 1QGZA 4M54A 3IP7A 3ZXXA 5TS2A 4OFWA 3E5RA 5DLQC 3TIIA 2QTBA 5ICCA 1LBQA 1JHDA 1Z34A 4EZIA 4G1UC 1SRRA 2IKSA 1V1MA 4BVLA 4C4YA 5HVNA 3S1AB 2HA4A 3IH5A 2OHIA 2HDNB 1BU8A 2JFXA 4A10A 3DF7A 3K96A 5FOTA 1E9CA 2HW8A 4FWBA 4B87A 1S4MA 3BQNB 3OPNA 2F48A 2AYZA 2GN4A 2INGX 2I7XA 2J32A 2QB5A 3AK4A 4GR5A 1D8TA 4GZ5A 4M22A 4NK5A 4Z9FA 3W2FA 1ZD8A 8LDHA 5AVQA 5E7QA 3N5KA 2D8MA 3O9ZA 1NJ1A 4IHJF 4KQXA 4FU0A 3MGAA 1EIWA 5FR2A 5EGSA 5CU7A 3VR6H 4YRMA 4L4YA 1XXLA 2OMEA 3UPUA 4K87A 4G1VA 4WN9B 1JWAB 2JBAB 4C3OB 2H1OA 4ZAFA 3QLTA 3R7WB 4WDRA 2YXLA 3ENZA 4FP9A 4JUCA 3TLAA 3WC4A 4DLVA 2COEA 2OZKA 2VTKA 2Y71A 2EF1A 1KI7A 3TPCA 4Z3KA 1PFVA 4FDAA 4F9EA 1IAVA 1RXVA 1MC4A 4INPA 1JPVA 2Q8QA 2ZBDA 3IP6A 4NC9A 4LHVA 1HO3A 4ZYZA 2HK7A 4UXIA 3IUMA 1KO5A 1PJRA 5E9WA 3SSOA 2F3PA 1HF3A 4QPPA 1VXRA 3GA0A 4MLPA 2P3LA 1VI5A 3KR1A 3CQ9A 5DIFA 4J0QA 1L7MA 1OW3B 1QIMA 2B1RA 2PK3A 3L9WA 5CD1A 4ND5A 1DO0A 3W5JA 1JU3A 1NZFA 1B43A 3D5QA 3ZX4A 2R11A 1DEXA 4R31A 5E7IA 3G9UA 3LY7A 1JS1X 3IOYA 5EP1A 4XJXA 1IEVA 2Y1WA 4PSDA 4GBGA 4TV8F 2CKDA 2XYVA 4UEQA 1Y98A 4YMVA 3CA8A 1Y9DA 1QF9A 3PPXA 1RJWA 1WP9A 1AQ6A 1RVDA 1W93A 10MHA 4IQFA 3FWYA 3TRJA 2WYIA 2ZS7A 5CJJA 5E0KB 2DSTA 4NNJA 4BFZA 5KSZA 5L7WA 5COBA 5AJZA 4TYMA 2IW1A 4XYBA 3VSEA 2VDQB 2PX0A 4HZUB 4I1YA 4EL5A 2JI7A 5I7WA 3C7KA 1T91A 3IP3A 4FYIA 1F48A 1B8UA 1ZPDA 4W5JA 1SQ5A 5TVGA 3UK1A 1TX4B 5BN5A 3Q4GA 2YIVX 2TSYB 4XX0A 2CE2X 3DZCA 3L5OA 4DOMA 1LW7A 1KBQA 2JAUA 4M0MA 4QOSA 4DLRA 3ER8A 4TYPA 1FP4A 3GLUA 1EM8B 5CFRA 4L8VA 1OCEA 3FYUB 2ST1A 4Y30A 2Q4BA 4PZPA 2C88A 4TRJA 1YDFA 2GRJA 3CNNA 3MS7A 4A2PA 1W2HA 2GD6A 2HCJB 2VJCA 4MCHA 1FSGA 2G28A 1IZZA 2JD0A 3H9GA 4MYDA 5EUBA 1CR4A 4YJ2F 4AJOA 3O8QA 4Z9YA 1LBSA 2IYLD 2VZLA 3IXMA 1GPAA 4M49A 2J5KA 1TEHA 2P40A 3I12A 3IIMA 3OPYI 4F6RB 4FYYA 1PJTA 1KYZA 1S9DA 2VDMB 1GRNA 3D5TA 5ICMA 2XRYA 2WU4A 1UPCA 2CBGA 4RTKA 5HDQA 4MV0A 1NY5A 3HWRA 3INGA 3JVDA 1UBCA 3BTVA 1VMDA 1E3SA 4TLDA 3VHQA 3SVZA 3DCNA 1EZ4A 2PKCA 1L8AA 5E7MA 4OXXA 2YY7A 4EKYA 4HRXA 1OU0A 1G4UR 1JSZA 2MJLA 3UJ9A 5L7TA 3UN1A 2FX2A 4H1VA 4CF7A 1TQDA 5EUCA 5CDYA 4Z9BA 3QW2A 2RGXA 4WY8A 3RSFA 1GPYA 2IZOA 2ZBRA 5AJYA 2ID4A 3FY4A 4YQZA 1JYEA 4HL6A 4WKCA 1SWVA 1QYIA 1YUNA 3NAQA 1KEEA 3MJVA 1GDHA 1NR5A 5DMXA 4X95A 4PCUA 3O93A 2IYWA 4L16A 3HVKA 4QU8A 3RKRA 3BXGA 4QYWA 1E9AA 2A1IA 3EXFA 1OFUX 1P1IA 1U8ZA 3D6NB 5KDOA 5LQNA 4ZK6A 2PRYA 4RHUA 3PNPA 4MS1A 5FBHA 1Q20A 1PZFA 4UD6A 2H4XA 3EF1A 1K8XB 1IEQA 3EGDB 4O2BA 2I87A 1NMYA 4BWYA 4CM1A 3I9OA 4DPLA 5BSMA 1DBIA 2H9YA 3ENVA 4BFSA 2WJPA 1ILEA 1N0VC 3L6CA 2B4TO 2VH1A 3L0BA 4LYFA 1XRJA 2DGDA 3IQIX 1D5WA 2V5UA 4CM8A 4B7ZA 3LPMA 1EWQA 4XWKA 3OX2A 1IHYA 3D54D 3R09A 5JRJA 5EMJA 2PEZA 3ZIDA 1ATZA 2WILA 5HS6A 5JEEA 3CW2A 3TTTA 4O2AB 2FMKA 2QU7A 1S8NA 1KA9H 4IR7A 4JLJA 2ZAIA 2D1YA 3KYDB 1UBNA 3QU5A 1DRJA 1ISIA 1PR0A 4AF7A 1D7OA 2EBWA 4PXSA 4AJ1A 4OJTA 4EGAA 3GLTA 3LHSA 3WL4A 2QNBA 3GD7A 1HL3A 2Q5OA 3LPCA 4LRQA 1LVGA 4HGNA 3GL9A 1YA8A 1VRWA 2QUKA 2R7LA 3U6KA 5EHGA 5GPBA 2I33A 2W6ZA 4Q6WA 3NHAA 2XQGA 4F72A 1VDMA 4NBSA 5JD5A 3ZCXA 2VK8A 3IMFA 3NWEA 5FD8A 3THYB 3JRXA 3P0IA 4E5MA 2BGGA 1KEWA 3JZAA 3I2GA 4O4IB 4RSRA 3V7FA 1F8UA 1N5MA 3KK0A 4NZNA 5KKAA 1CT9A 1ABFA 1K5HA 3BH6A 3PDHA 4H6XA 4QWWA 1XD8A 2I4OA 4R7TA 3NKVA 1RD4A 1SH7A 4FX2A 2Z56A 2YDYA 2CW5A 1UEIA 4MR8A 4Q1VA 5LA6F 2IDJA 3H75A 1RC8A 4AKHA 3FFTA 2WWWA 3HZRA 1AB6A 2DWOA 3OZFA 2V7BA 3AY0A 2XMBA 2EATA 2OESA 1B8VA 5CDTA 4HMOA 4K9RA 3G9ZA 5DX1A 4XYGA 3RANA 2Q1YA 1Z2AA 3CEJA 4FMDF 5CMLA 1DWUA 2VJLA 1J70A 1OREA 4AG5A 1QS0B 3OU2A 5BVHA 2HK6A 1O95D 1CRPA 2ZYGA 1KDVA 3GVCA 1SUPA 3RKSA 2IHYA 3MJHA 2FI1A 2HIMA 4WFKA 4CG2A 1VSBA 4FKBA 2VYVA 1PSDA 3DAYA 1KEVA 4CCYA 4DSNA 3MTEA 5BQFA 4G4GA 2AJTA 4ENPA 1VIAA 2WDPA 1J20A 1V2GA 3ANNA 4MPJA 4BNLA 3LQKA 1CDZA 3K1YA 3PHCA 4IGEA 2VDWB 4DYVA 4EB6B 4YXFA 5LQRA 1FXWA 4OLFA 3Q9SA 3RG8A 4Y2PA 2TECE 3EXHA 3O26A 4H60A 2VP5A 5FOQA 1SU8A 2GPNA 4WK2B 2ZIEA 4RCZA 1DLIA 5AW5A 2G4VA 2P9GA 2ZRBA 4BQIA 1T25A 2E4XA 2XEDA 4LYDA 3WWDA 1SB9A 5AVJA 2OT3B 5NLLA 4FZJA 4B4KA 3UK0A 3KPYA 4MZDA 1C1XB 1E66A 1N8KA 2O1WA 3DBLB 2FGKA 3BM5A 3OECA 3QUAA 3ZZNA 2BVNA 2DHDA 4EMTA 2HGSA 1ST2A 5CYGA 1GN8A 1SXQA 3QPCA 5K01A 4BGIA 4CM3A 3WV5A 4RVNA 3VKVA 5ADUS 3LK6A 3SYLA 1AOXA 4O4HA 1XRLA 2UXBB 5IPFA 1L7AA 2HEGA 4HQRA 4PBRA 3VPSA 2BONA 4X41A 4E7OA 2ECPA 2B83A 3AEYA 3EIEA 4ETWA 5AHKA 4H0CA 3RC2A 1A71A 2R68A 3LT0A 3W5DA 4LZJA 5DEOA 3KXLA 3SXJA 2PCLA 1RAFA 3A10A 5LXTF 5LYJA 4CDRA 2QGFA 3A9SA 3STVA 2Y0DA 2WSYB 2CNNA 5IZ4A 1TT5A 4RD6A 4EOGA 1PX2A 2QUZA 2YBEA 4BFYA 2QM0A 5HJ2A 5G2OA 2IEAA 5T8KA 2A9PA 3TS1A 2W11A 3TNJA 3OKCA 3IT1A 3K0FA 3ERCA 1J7JA 1N6OA 4RIEA 2D5BA 3RRNA 3Q8LA 4P58A 1GPUA 1TYDE 3OKFA 4PGGA 1AM4D 2FFBA 1W73A 3CO5A 3OJFA 1POXA 2WVJA 4MO9A 1VL2A 1Q0SA 3A1WA 4NDNE 2VKTA 4FOLA 3OPQA 1XTKA 1J7KA 2G3YA 1WDMA 1VKOA 1KJYA 2EEPA 1P3DA 1ECLA 1X15A 3I2JA 5L3ZA 1SIUA 1G19A 1LFDB 5DIZA 3KBBA 4IWXA 3R0XA 3P52A 2Q5CA 4G1MB 4PLTA 3VZBA 3DEZA 2AJBA 4TYQA 4ZGBA 2VXYA 1QV6A 1RWMA 3AWIA 3AZOA 2DWPA 1EH5A 1L0BA 1R88A 1W85A 4GUAA 3TLEA 3FVRA 1OAAA 4REOA 5HBGA 1A98A 2RHRA 4LFCB 3FCOA 4L78A 5ALSA 4X3PA 2FHPA 1A5SB 1VCMA 1C7IA 3ACDA 3D81A 4QDTA 2OY0A 1DSSG 3ZH9B 1R6XA 4RX1A 3IAM6 1E3TA 4RF3A 5SYAA 4YONB 1JQDA 2Q6OA 2VZEA 4FK8A 4WXEA 5SY9A 1EFRD 4W6ZA 4MAFA 1MRZA 3U3MA 1G5FA 2NVUA 2QR2A 5BN4A 1BE8A 1EFHA 2PZ8A 3DUFA 3G1TA 5CR9A 4QT4A 1U0SY 3PD1A 4E14A 3TOCA 5AW6A 5HK8A 5F4ZA 1ZKDA 4Q1FA 4RK5A 4IEEA 1M33A 2F2TA 3EVDA 1BW9B 1PTJC 1KFBB 1YIOA 1Z82A 2AOTA 2BGIA 3ISJA 3BIWA 1Y6JA 2WUVA 4ABYA 4CIDA 2JPDA 4RY9A 5EPOA 3UENA 2FSFA 3Q3JB 5F23A 1RHUA 1GPNA 1PW7A 2IYPA 4YMLA 2PH7A 1AMUA 4NMMA 2DR3A 4MKZA 1F0NA 3CVVA 5G0SA 2AG6A 4FEEA 4Q4AB 4PC6A 3MT9A 3ZWXA 3WFJA 3W4JA 1IM5A 3DVAA 4WK4B 4PRZA 5L7YA 4BV8A 4DXHA 1RWVA 2DHRA 3AG6A 4X6YA 4C0BA 4TM8A 3CKLA 1GKKA 4HKTA 3S2ZA 4PBTA 2OZLB 4PVCA 3RARA 2XT6A 2EJUA 3CISA 5DN6A 4MV1A 4NBTA 1OGYA 3BL5A 4DT1A 1JKXA 4RGQA 2JGMA 2B61A 4GW3A 1T9KA 2QQFA 2QX9A 1PJZA 4TLMB 3ZTYA 5BQXA 3NW9A 1DV2A 4WOBA 1H3EA 1GUDA 3SX2A 2OC9A 4EG0A 3TSOA 1NJSA 2PBZA 1E2BA 1H65A 1JQKA 3PL5A 4KHZA 3KQQA 4LNUA 4YUXA 1K92A 4DCTA 1JJAA 5DO9A 3X2FA 4HD8A 3I45A 1BZYA 2C92A 4IAOA 4QUDA 4E3ZA 5FBQB 1TTHA 3EMDA 3YASA 3H7IA 3GJQA 3I1YA 1VA4A 1QHHB 1K8QA 3KZOA 2HO5A 3PNVA 3VR1A 3A0UA 4EPTA 3K71B 3ZVNA 4R54A 3HVHA 3HN2A 3KVYA 2J59A 3PQ6A 1JHAA 3EFHA 3FSGA 3MPUA 5EKTA 5A05A 4ARZB 2FJUA 6REQB 2JCGA 4MR9B 1VMKA 4RMIA 1U98A 3R5FA 4QVGA 2Y0BA 4WEOA 1XXHB 5AP9A 4ZKDA 1PJSA 2C3PA 1AY0A 1XZEA 4YAIA 3LX6A 2FP4B 4D97A 1W4BA 4ZQIA 1MC5A 3JQ9A 2JI8A 4JGBA 4A3SA 4DDTA 4G4SP 1HFWA 4IVNA 1I5OA 3HMQA 4UUPA 2W2MA 1IFXA 5DPMA 3UB2A 4D82A 5JZMA 3SQMA 1TAUA 2OAGA 2XDQB 2DUWA 2E87A 3IKJA 1BOOA 1BJKA 4AZTA 1W4ZA 2QU8A 3N76A 4KZKA 1F3LA 1FFWA 2F3SA 2R7MA 2SICE 4U2GA 2P2YA 4EBBA 1SUSA 1TIKA 4UNNA 4M89A 1CR2A 1P8JA 2R3SA 4JJIA 4C0AC 2BAGA 3W1EA 2YYZA 2ZT8A 3B1VA 4RNCA 3AETB 3UGKA 4P1ZA 2P9JA 1XP8A 4R9NA 3L1VA 4DV0B 4D3DA 1EGMB 1EK6A 1OX4A 3KFLA 5GGXA 3ETEA 1DJLA 1T2CA 3DO6A 4PXAA 5AJWA 5FP0A 3FF1A 2A9KA 1HFEL 1G17A 3PXEA 5AW2A 2R6GA 1JU4A 2GJ4A 4I46A 3G0IA 1L3IA 4YA6A 4R8MA 1ZHHA 2YJ5A 1CZOA 3RSZA 6Q21A 3LQFA 5JWHA 4RS3A 3ZK7A 1MZPA 1R0SA 2XA9A 5DCUA 3VGPA 2RI6A 3I05A 3QEKA 3HFJA 4LJ5A 1S2IA 4OJQA 1W25A 4EAAA 4KCGA 4Y2GA 3PC8A 4Z2AA 1HG0A 2OENG 2V9PA 1QTQA 3IVCA 1A76A 4HB4A 4HTAA 4WFQA 4OXNA 4AP5A 3KDAA 2CDCA 4UHDA 2NO4A 4P3KA 2UVQA 1XZBA 2OO7A 3OJLA 2PKXA 1YFKA 3GYGA 3O4JA 1ISJA 1GYQA 3CN7A 4FWIB 3V6MA 4TMTA 4UQOA 1R1DA 5JSQA 5K3CA 3RF7A 2P6RA 1F0KA 1ZZEA 1C3JA 3LK7A 1LQ2A 3GJTA 4N1AA 2PUEA 4NEHB 4D25A 1PQUA 1P73A 3I9V6 2HA5A 1C9YA 2WD7B 3DTNA 3IJRA 4KYTA 4S1WA 3QTBA 4WTOA 3T41A 8AT1A 3MVEA 1M6VA 5AVXA 1GUAA 2IZ1A 1Z4MA 5JQWA 1CYDA 3HKDB 2GGSA 1WVMA 1JEAA 1IG3A 2DP4E 3PUYA 4UNQA 3EVCA 3DL2A 3QXGA 2EKPA 3SHWA 4KE9A 4V02A 2ODAA 4XJTA 3KB8A 4BNTA 1RKQA 4A03A 3GN2A 4W4TA 1JSLA 1QR6A 2B20A 1XZGA 4A2CA 2B36A 3JZMA 3G0DA 1D1SA 5HG0A 5SICE 4B09A 5J2TA 3FPEA 3L06A 1PV1A 2YJNA 3Q3GE 1CJBA 2B5VA 2OGTA 2ENWA 3PUJA 2QLJA 2BGNA 1R0YA 3DEAA 3LSYA 4OEHA 5D1HA 2HJWA 2GM3A 1DQNA 2MSLA 1N3YA 1TM1E 2QQ0A 3H2BA 4IRXA 3REGA 3UIEA 3WHIA 5HQ3A 4MB6A 3H5VA 4CKXA 4MEJA 2GSWA 2UZ0A 1S3FA 2AMLA 3E5HA 1DC4A 4IF6A 5G1NA 2ORED 4C0WA 1DCMA 2HCTA 4D9NA 5J47A 1GZ4A 5EJIA 3T6KA 1NNUA 1X6VA 1ZKMA 3CLRD 3DW3X 1V3UA 3L6EA 1U94A 4RVHA 3T5CA 4JC8A 2JBWA 2R6R1 4RK6A 2IYFA 5M3BA 3CLHA 3X43A 3CUVA 1LA2A 2F3UA 3QPDA 4RENA 4NJMB 5J5VA 3UJ8A 1S7CA 5IJZA 5I9MA 3EPPA 3FHTA 4HDMA 2C77A 5AI6A 3DLAA 4P36A 1AUXA 4Q39A 3ODGA 1EIZA 2ZBGA 4HNSA 4AWAA 4WVLA 5BN5B 1FUKA 3N86A 4B7AA 3W5IA 3MFYA 4WZAB 3TGPA 2WM9B 1GUFA 2OBXA 3ITNA 2X0IA 4G37A 4M8NE 3JXEA 1SU7A 3KJZA 1KRWA 5H3HA 3NS7A 1EM8A 1PJCA 1ZQ1A 2D7DA 1SCNE 1ECGA 3CF4G 1OIXA 1V3TA 2X9LA 1VB5A 2RAFA 4P5DA 4YCJA 5F5NA 3RFCA 1XELA 2VA8A 3T1QA 3ONNA 4FEGA 2GNPA 2IUTA 3GEEA 1AIPA 1P3JA 1OLSB 3CNLA 3I72A 2O1SA 4HQLA 3C98A 2I54A 2Z2IA 1SIWA 2YUTA 2Z30A 4IXNA 4TTTS 2QUBA 2IHJA 1A8PA 4XSVA 5GVRA 4B2LA 3MN1A 4B9AA 4D9KA 2BMJA 4DMGA 1DKQA 1PWXA 2E7ZA 2AZMA 3VC7A 3CLTC 1R6VA 2WJWA 1LFAA 2X0DA 2ZT7A 3VH1A 4HWKA 3LZCA 2VQFB 3LLMA 4ITUA 1E3DA 5E3HA 1XEFA 1HEYA 2X41A 4N6NA 2O8CA 4DJAA 4DILA 1OLUA 3M9WA 4D0SA 3SEAA 5T8KC 4BBJA 1Y48E 4BQNA 4IVQA 4D6XA 1ZJYA 3P2OA 1GGMA 3G8AA 3RRFA 1K0FA 2HUPA 3FPSA 4RYDA 3LUAA 3I6MA 2ZUCA 4OL0A 2MSKA 1HDEA 1HT1E 5EEHA 2FR8A 1CJSA 3BJIC 3IP5A 2RAPA 3CBQA 3AM3A 2YQ5A 2YJGA 1EEHA 2I4MA 1GV0A 4ECAA 2XGSA 1XPOA 2PJRA 5DN9A 1PKEA 3BB4A 1T15A 2XKJE 3X1ZA 2A30A 2ZXUA 3TX6A 2VQSA 1GTG1 5THKA 4JSTA 4B46A 1R9MA 3IQFA 4I2VA 3KSDO 3MGKA 2VAWA 3WYAA 1W36B 2DSNA 3AEUA 5GONB 2K7FA 1JBKA 1MX9A 3P7MA 3RHTA 4OM8A 3THOA 3WXMA 3NUZA 1RLJA 3CW9A 3GCZA 5I9NA 4QPJC 3UY4A 1L5HA 4DG8A 1VJ0A 1YHZA 1Z62A 2QQ5A 4FHEA 5FI1B 1XC7A 3RVBA 1IU9A 5KQLA 2O5VA 3DQPA 3NPAA 1XROA 2W6CX 2WTNA 2Q5LA 1J5XA 3S2GA 2RHBA 2BUBA 1UBHS 5FWAA 3HDGA 1Y1KE 1A04A 4FKZA 3L7NA 2DOKA 1J0BA 2LCIA 3ZD8A 2O3TA 1G63A 1PT8A 1HLFA 2EX1A 4PS0A 4C2UA 1ZEMA 3EH2A 2QW0X 1DWQA 3ZHZA 4HXFB 4J49A 2PD3A 4LQDA 2NPOA 2XCLA 2I7TA 4FMCF 3ZI7A 3PEWA 3OJOA 1P1FA 2DRIA 5DBFA 4DCPA 4Q66C 1I6MA 1NE7A 2JJ1D 4NECA 2GZAA 3T34A 1QAQA 2HGZA 2HF9A 3ZWPA 2RC5A 5BWOA 1GL3A 2EOAA 2RC6A 3B12A 3WGQA 4ZO9A 2REQB 4ZT3A 5EE0A 5ALUA 3VHRA 2XOKA 4E4TA 4S1PA 1CUDA 1PNQA 1ZM3A 1E3WA 3AC0A 1NXVA 3P0RA 4J6EA 3GXBA 3T5MA 4KR6A 1GQOA 1KMQA 4ILEA 1V8BA 1VP3A 3FZEA 3I01M 3REQB 5EP4A 4UUQA 4JJGA 2VNSA 1EP9A 2Q3LA 5K0ZA 4OBXA