4RK7A

Crystal structure of laci family transcriptional regulator ccpa from weissella paramesenteroides, target efi-512926, with bound sucrose
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
270
Chain Sequence
b'RVVGVVVPLIHTNFADEIIKGLYETTISSGYELLITYLDEDEDHQYQVFQTLLSRQVGAVFMLSLDIPSWMIDKLLEEQISVISLTALLSEQISAVTSNEFEMMNSIVDYLIDMGHKNIALVGDTKLTTNISSTRRTNFIKSMTDHNLAYENIFLYGNDHSYETGYTSVTTGYDINQLPFTAAIATADMVGQGLINAMSDHGKTVPEDLSIVTIDGLQQTEIARPKLTTVKQDFPEIGRIAMQLFLDSDEPQIIYIPTELIQRDSVLNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Crystal structure of transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926
rcsb
source organism Weissella paramesenteroides atcc 33313
molecule tags Transcription regulator
total genus 80
structure length 270
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A01
1SXIA 3CZ5A 1YS6A 4HNRA 2JVKA 3SAJA 3O2QB 1JYEA 3H1FA 1JHZA 4N47A 2NT3A 1XWWA 4JB2A 4RKQA 3RVOA 2FN8A 1JFTA 2R48A 2AYZA 1YK1A 3G1WA 4KFCA 3RVRA 5FBHA 1ZHHA 4Z0NA 1QPZA 3MM4A 1VLZA 4XARA 3N0WA 3LOPA 3QLUC 3MQ4A 3CRNA 4RY8A 3A10A 1QP4A 4FE7A 2L19A 2QR3A 2CHEA 2P9HA 5JNRA 4Z4CA 2GX6A 4Y9TA 3H1EA 2JBAA 3FMVA 2MYTA 4MR8A 2NZUG 1DCKA 3DBIA 1L5ZA 1ABFA 4PYRA 2FQYA 1BDJA 2XDYA 3ILYA 4H3HB 3JVDA 3NNNA 3ROFA 3ROTA 4RXTA 1TVMA 3EQZA 4MQEB 4NCAA 5B3JA 1Z15A 3OO0A 3GRCA 1LJUA 2GI4A 1PUXA 2LP4Y 4TMYA 2HSGA 3C3KA 8ABPA 3HXMA 2PUFA 4MS4A 4OBBA 1NXOA 6ABPA 4UHKA 3HO1A 1JBEA 3A0RB 2QVGA 4JAVC 4O1HA 4MQFA 2H3HA 2A9PA 3SG0A 3H75A 5CNIA 2R4QA 4EUKA 4W5QA 3CU5A 2M98A 3LUJA 3GBVA 4MAAA 4Z9AA 2E4WA 4XAQA 3C6QA 1NXTA 4TLMB 4L85A 1CEYA 4MLDA 5JNVA 4LZLA 1DBQA 4KZKA 2LBPA 4QYMA 1NXPA 1BA2A 5C5EA 3BILA 4EVSA 2PE5A 3E61A 2LIVA 1C4WA 5JNUA 5TQ2A 1RZRD 3IP9A 1FFGA 1Z16A 4RXMA 4N76A 2FMHA 5TPZA 3QEMB 4ML3A 4LX8A 3HS3A 1JLKA 2GKGA 1Z26A 3CHYA 4RY0A 3JPYA 1DRKA 1DG9A 2QVCA 3TD9A 4RKRA 3F6CA 4O1IA 1DJMA 3KS9A 5EWMB 5CHYA 4JP1A 4Q6WA 5TQ0A 3SQNA 4PICA 5T3YA 2FMKA 2FSPA 4P1ZA 1ZH2A 4MYRA 3MA0A 1Z2DA 2HPHA 2FEWB 3MMNA 1FSPA 1ISRA 1USGA 3EAFA 1D1PA 1ZH4A 1PEAA 2PUAA 3LKBA 1T34A 3JY6A 3KCNA 5IEJA 2PJUA 1YMUA 1EWVA 4OTZA 1PEYA 1DBPA 2WB4A 4W5TA 4KREA 1YK0A 4RK6A 3QLUA 1GUDA 1IIBA 4EVQA 4EYOA 2L17A 5JNWA 3TO5A 4MRMB 1NXXA 4RK0A 4G0OA 1FFWA 5IX8A 3HV2A 1BDIA 1USIA 2ID9A 5FWYA 3Q7RA 4RS3A 1AB5A 4YV7A 1NATA 4IF4A 3UUGA 2FN9A 1ZGZA 1D4ZA 2PL1A 3C3WA 1QP7A 3OMWA 4YR7A 1Z18A 4IMIB 2IOYA 3BREA 2GBPA 4ETMA 3CNBA 5IUNC 1NXSA 2GWRA 2IPAB 3D02A 3E3MA 3RH0A 3JVIA 3NHZA 1LBIA 1XHFA 2MYNA 3CS3A 3RVNA 1E2BA 4YLEA 3UKJA 3H6GA 3RVSA 5IUJC 3OLXA 4DN6A 2J48A 2KYRA 3LUAA 1ZESA 3RVMA 1ZAYA 7ABPA 2VUHB 1YS7A 1Z12A 3KYJB 2FXIA 2JBAB 3N0XA 4MR8B 4RXUA 3N6VA 5CNJA 4HYEA 4YCSA 3H5VA 1B00A 1GUBA 1QNLA 2JVJA 1DP4A 4NICA 2E4UA 3H5WA 4W5NA 2HQRA 1RNLA 1JFVA 1W25A 3GBPA 2QXYA 2O20A 2RGYA 3BBLA 3A3KA 3F6PA 4MR7A 4MS4B 2OENG 4F06A 4E7PA 3I5AA 1MIHA 5E3JA 5IC5A 1S8NA 3H5OA 1L5YA 2MSWA 3RVLA 4NV3A 2QSJA 2AYXA 1E6KA 4OLBA 1BVHA 1RXEA 3I42A 1EHCA 4MQFB 3F7NA 2B1JA 1DCFA 3KLNA 3HDVA 1YIOA 4YWHA 4WXEA 2JB9A 2RJNA 1SXHA 3LUFA 1JL3A 3RVKA 5BR1A 4IGAA 4B09A 5D2CA 3QEKA 4WZZA 2HQOA 1YMVA 4Z4FA 3GT7A 3OO1A 3I09A 3LUCA 4RK4A 3KLOA 2FMIA 5TQ2B 4ZMSA 5TQJA 4Z4IA 1EFAA 3KKEA 3K9CA 3MYYA 1Z25A 3HSYA 4MLCA 3LKVA 1BAPA 3NBMA 3OQNA 3F73A 1Y1LA 1E6MA 4IRXA 1JFSA 1KRXA 6CHYA 1APBA 2PMCA 3GL9A 3RVQA 3OM0A 4ETIA 4G0MA 1A2OA 4G86A 4RK5A 3FFWA 3JTEA 3H1GA 5IULC 1DC7A 1ZGGA 3G85A 5EWJA 1NXWA 4Z9BA 3HEBA 3K4HA 4LDZA 1YVUA 4KQCA 4Q6BA 3IDOA 1Z13A 9ABPA 2IKSA 1M2FA 1NY5A 1MB3A 4N0QA 2FVYA 1E6LA 4WXMA 1DBWA 5FWXA 3O74A 1U2PA 4RSMA 2NT4A 3NNDA 1D2AA 4CBVA 2L18A 4F12A 1YTUA 1KRWA 3Q9SA 4MQEA 2RDMA 4KNYA 3Q41A 2QZJA 4GPAA 1EAYA 3L6UA 2PAFA 4KMRA 2PUEA 4F3TA 4ETNA 3I45A 1U8TA 5FWYB 4DADA 4QICA 1USKA 1JDNA 2FKAA 4IILA 5DLEA 2E4VA 3IP5A 3IPAA 2MSLA 4MPTA 1BDHA 4RU1A 3BRQA 2PUDA 4MS3A 1MB0A 3GYBA 5EWLA 1QQBA 1TMYA 4JOQA 2F8TA 3URMA 4RK1A 2PUGA 5T7BA 1H9CA 4ZYLA 3KTOA 2MYPA 3O1HB 2LPMA 2PL9A 3QELA 5KI6A 3UK0A 2JVIA 3B2NA 3D8UA 5KQPA 1SD5A 3LTEA 5GQSA 4Z4GA 3LUDA 4Z99A 1CYEA 3R0JA 3OLZA 4O5AA 2FEPA 4HNSA 4YRZA 5KQLA 1M5TA 3O21A 4OLAA 4E7OA 1U2QA 1AB6A 2YHBA 2CHFA 1DZ3A 1A04A 1VKRA 5TPWA 3CG4A 3FFXA 5DTEA 1D1QA 1P6QA 2WY2D 1U04A 2HQBA 1URPA 3QX9A 4PZ0A 3N53A 3RVPA 4FB4A 2JK1A 3H5IA 1PNRA 1FFSA 2NUBA 3N75A 4YP9A 2FEKA 5IBQA 3T38A 1QP0A 3RVJA 1KMIY 4MS1A 1Z2EA 3EGCA 4DQDA 3C97A 3OLVA 5BRAA 3S99A 2QW1A 3W9SA 2MYUA 3KHTA 3CG0A 5IEBA 4N0PA 5TE9A 1U0SY 2YHAA 3OLYA 4TN5A 4EGSA 1RXIA 2ID7A 5BQ3A 3QK7A 5I4CA 3M9WA 5TPZD 3OMXA 2F8SA 3EULA 5HQJA 2L2QA 5C5CA 2E4XA 3O1JC 4JASB 1JYFA 3NHMA 4EVRA 5JNSA 1LK0A 3C3MA 2NZVG 3H5TA 1I3CA 2IPLA 3O75A 1RZRA 1F4VA 3P9YA 5DCLA 1ZVVA 3OQMA 3CLKA 2P4UA 4FE4A 1TJYA 4PEVA 3A0UA 4EYKA 1QKKA 3T6KA 5KC8A 2I6FA 5JS1A 3LMKA 4N41A 5ED4A 1ZY2A 2B4AA 4G0XA 3EJWA 4GNRA 4RY9A 4RZSA 2A9QA 3N0RA 3OLWA 1MAVA 4G0QA 2PUCA 3Q7SA 3QLVC 3DLBA 3TMYA 4ZJPA 4G0YA 1EWTA 4N03A 1KGSA 4MR9A 5FBKA 1GCAA 1NTRA 3DZDA 2FTKE 2WJAA 3O1IC 4Q7EA 4EY3A 4F11A 4F8JA 2WJWA 1QO0D 2WWVD 4WT7A 4P98A 3SNKA 1MVOA 1A0OA 2CD7A 1JX6A 1PNTA 4LE1A 2LUOA 4H3KB 4IMJB 4RDCA 1GLGA 2JRLA 2WRZA 4NQRA 4XFKA 5EWJB 2BGGA 3SY8A 2FQXA 2H0AA 3GA5A 3HVRA 1K66A 2PKXA 4PE5B 2OQRA 2WMYA 2QU7A 3LFTA 3DGFC 4G97A 1WETA 4JA2A 4YS6A 1ZDMA 1UDRA 5FWXB 3RQIA 2IPNA 4KV7A 5TQ0B 2FLWA 4JB0A 1SXGA 1J56A 4OG2A 4S05A 4WUTA 2M1ZA 3SM9A 2IYNA 1Z17A 3HUTA 2Q5CA 4KK3A 2MSKA 1P8AA 3IP7A 2E4YA 2N9UA 3TB6A 2TMYA 1OXBB 1ISSA 1DC8A 3OM1A 4L4UA 1JF8A 3ILHA 3L49A 5KQGA 4YGXB 4MS3B 4LE2A 5EWLB 3OQOA 3MF4A 1FQWA 3IP6A 5CNMA 5GOTA 3IPCA 3TX6A 3N8IA 4LE0A 3KG2A 4KQ9A 4Z4EA 3HK2A 1DCMA 1ZN2A 3CTPA 1ZITA 2R47A 3JS5A 3QELB 2PUBA 2FMFA 4ZPJA 4TLLB 3GWGA 3EQ2A 1DRJA 1EWKA 1NXVA 4LDAA 5JNTA 4UHJA 3VNBA 5KWSA 4XXHA 2JCGA 3GV0A 2A9OA 3HCWA 3Q7TA 1P2FA 1VRVA 4RWEA 4XASA 3EDCA 5HKOA 1P6UA 5IUKC 3M6MD 4Z4HA 1HEYA 2V0NA 3BRSA 1F51E 1GCGA 4G0ZA 5CNKA 1D5WA 3HUUA 4WWHA 5TPWB 4HNQA 3LUHA 4KPYA 2X7XA 3QLTA 1QQAA 5F64A 1M5UA 4RK7A 3T8YA 3QX8A 1ABEA 3KYIB 4KRFA 3M9XA 3VNAA 3HZHA 5KQMA 2A9RA 2RJOA 4XLTA 4MS1B 2ZWMA 3H6HA 3MIZA 4D6XA 2FW0A 1PHRA 5B3JC 3FDFA 4QPJC 2IPMA 2PLNA 3O2SB 2ZAYA 3QEMA 1C0EA 3CZCA 3QLVA 4QYWA 3T95A 2FQWA 4NCBA 2VK2A 2FLKA 1QMPA 1OXKB 3H5LA 1QO0A 4W5OA 3Q15C 3HDGA 4OATA 2HJ9A 2W42A 4H60A 5EWMA 1SRRA 4LRQA 1TLFA 3KJXA 4KK4A 1R8JA 5HM6A 1K68A 3NNSA 3JPWA 2DRIA 4M88A 2QV0A 4D74A 4ZMRA 4MR7B 5HSGA 4G0PA 3CKMA 1CHNA 5DGCA 3EODA 3FGZA 1VPWA 1W9HA 3HJFA 3LUKA 4MGEA 5JS2A 1TM2A 5DKFA 5PNTA 3O2JA 1LBHA 4W5RA 3LUGA 5KC9A 5BRJA 4RV5A 4MR9B 4D6YA 3DGEC 4S04A 1XHEA 1RPJA 1JDPA 2VYCA 1M2EA 2R25B 1JH9A 3KSMA 4KVFA 3DLHA 1JWLA 3FFTA 4EYGA 3HM9A 3CFYA 1LJLA 4YO7A 2VUIB 2IDMA 4MRMA 4EYQA 2E4ZA 2CWDA 5ABPA
chains in the Genus database with same CATH superfamily
1P4SA 3TJZA 4OI2A 3VPFA 1VCIA 3DBVO 3A1TA 1A82A 5ALIA 3SQWA 3I32A 2P9EA 1QPGA 4OQXA 4DUYB 3LPMA 5A62A 4HHEA 1O3YA 1R9GA 1CE8A 1JTFA 4DCJA 1CUHA 1N57A 4BLPA 1WZEA 1SOWA 3AKCA 4I9NA 1RI3A 3U4IA 2AYYA 4F9GA 5A2GA 4A8JC 1DAMA 1JFTA 3NDRA 3S2YA 3BMCB 3NATA 1C0IA 3QYFA 4KFCA 3EPHA 1L4YA 1NIPA 4Z0NA 1G7TA 3DWIA 1TCBA 4I99A 2OK7A 5F51A 4PZEA 1WXIA 2MTBA 3LOPA 1ZZGA 5KIAA 4KXQA 2BTQB 2PFSA 3JU3A 2F3PA 4B6JA 3NH6A 2FUNB 1J8VA 1F14A 2ZEJA 5IHXA 3UMSA 3KZOA 4Z4CA 4EWLA 1K7EB 3ND8A 4ZI2A 1CPYA 1TA4A 1YVDA 1WUIS 1XA0A 2JBAA 5J5AA 5K8TA 2GGSA 2OCPA 2EFCB 3C5HA 3JALA 3BFPA 4OJMX 2QNBA 2VHZA 2QVYX 2FQYA 3AF0A 4H3HB 4ESHA 3OIUA 1KMQA 3WMXA 4DMCA 1DTWB 2H2IA 4YVFA 3U61B 2PKEA 4IJ5A 3TJRA 4X91A 1NVEA 1XLWA 1A9XA 2EWMA 1CIJA 2J59A 4ZQIA 4Q3OA 2IPOA 1MTZA 3D6AA 1TE2A 3KJGA 5A4JA 5JALA 3AWDA 3I4LA 1NXOA 2SCUA 5LJLA 1CZOA 2PL3A 2Q45A 5E7IA 2H1SA 2B94A 2W83A 3B78A 2QVGA 3HR7A 4ITRC 3UW3A 2CKDA 3BH6A 3QPAA 4NBWA 4YTEA 3H75A 1N3BA 3EEIA 3OH8A 3QX7A 1ZCFA 2GPWA 2Y4NA 1H9BA 4I4NA 3HB0A 3OJLA 4G5YA 4NJMB 5JG7A 4BFLA 1PL0A 3W06A 4EM6A 3VDXA 1P0PA 4HDAA 1DKLA 5K0FA 1HWYA 4M4SA 4Y2SA 5M34A 4LZLA 3OE4A 4JHXA 4DT1A 1QC5B 5I9NA 2DETA 2XSZA 2H0RA 2P1RA 5CVJA 3RU9A 2VAWA 2I33A 1I6MA 3IHTA 3VAZA 2O6LA 4G81A 2PA3A 4TV8B 5DP1A 4QEZA 5EUMA 5GVSA 3HI6A 2Y1EA 1RZRD 5DHFA 2G3YA 2PU7A 3QXGA 3R3WA 3IIIA 3AIOA 1PTJA 1SQ6A 3AEQB 3AVWA 4IO0A 2DBVO 3H18A 2NO0A 4NDNE 2P1ZA 4ZVSA 4RHFA 3RRJA 3HKDB 3VDMA 1E4VA 2XA2A 4FS8A 5EFOA 3F6CA 4EY6A 2HSEA 4HRXA 4YUYA 2G77B 4M9SA 1Z8HA 3L06A 2HX1A 1EX6A 2GCEA 2YZNA 4GICA 4UBLA 5C31A 4W6QA 5AW7A 5FLEX 1EB9A 1N6HA 1YB4A 4C7JA 3G2KA 1X7WA 4L2IB 1B16A 2O3SA 5T67A 4HXEB 1NLYA 4Y7CA 4XQ0A 1B43A 1PDVA 4ZICA 2OO7A 4GUDA 1ISRA 2X8JA 3LCMA 1L7OA 1L5RA 4Z7QB 3LKBA 2IWHA 3KCNA 2QU8A 1XJQA 1QZTA 4CL3A 4DDWA 3SVLA 4KRXA 4EHIA 1LX6A 3OZRA 4XR9A 1BE0A 2Q9CA 4CMCA 4DPLA 5JAOA 1ADCA 2JFPA 4GGPA 4RFVA 1NVAA 1KQGA 2IZ0A 5LP6A 2OGSA 4G8DA 1LNSA 3ICOA 3B6MA 4OFZA 3VPXA 2Z6VA 5TV2A 4JIGA 5IVDA 4Q39A 1P9WA 4NQZA 1K92A 3UHPA 4ROTA 1XTVA 2OK8A 1EDOA 1WDKA 3GJ8A 4HX5A 4RS3A 5C81A 4TTIA 3BTUA 3E81A 1NQWA 4CFSA 4F60A 4C43A 4CKCB 2XA9A 4QGGA 1QP7A 3OMWA 4YR7A 3ZXSA 1B73A 1KVSA 3G2LA 1HO3A 3BREA 4Z0PA 3G8AA 2ZZMA 5HBGA 3N7AA 2P2SA 4WFQA 3D02A 2UZ0A 2ZKIA 3WAJA 5EJFA 3HMQA 3PQ8A 4P4GA 4ZTUB 5FUMA 5CB4B 5JH7B 1YR9A 1HYQA 3OEWA 1BHO1 1WR8A 3O8QA 3AI3A 1GPDG 1A9SA 2VZ9A 2O8NA 4WZAB 3U3KA 1A7JA 4C4XA 1ZMBA 5IH3A 2YMLA 2EERA 5CT4A 3SQDA 1OGIA 4R9NA 4HX9A 2VUHB 3KUXA 4L72A 3HFJA 2IYLD 3GUHA 5CMLA 4FGLA 3X1YA 5AKGA 2HA4A 3JR7A 4A03A 1S89A 3KEQA 3PYLA 1OYYA 3A31A 1UINA 2OXFA 3I9NA 4JEIA 4LV6A 3U4QB 3HKCB 3PQCA 3MS4A 4IDGA 5DXAA 4RACA 1OI2A 2XCUA 3K5IA 3SR4A 4ZVVA 1TLTA 1N7GA 3TGWA 1PWEA 4Q4AA 1FNNA 2J07A 4UNQA 1CTQA 2PRZA 5EEGA 2GVNA 3CZ4A 2YQ4A 3NBFA 1T5OA 4O29A 5KNBA 1E6KA 1RP1A 1GQRA 4BP9A 4EJSB 4FHFA 3KJZA 4E4RA 1Q1GA 1KBQA 3RC9A 5CXSA 5A2QA 5E6UA 1J5PA 4OHOA 4AZ3B 5B6IA 1ENPA 2VQ3A 4LRWA 1RHJA 5JWHA 1E1MA 2RIPA 3DOJA 1OU4A 4KE9A 4RVCA 1DBVO 1OJLA 1SXJC 1QJCA 4KQXA 4IJ6A 1VECA 1JPUA 1DMSA 2GK7A 1YBHA 3RB8A 4RK4A 3L0ZA 1RLIA 5AVJA 2Q3LA 5KNCA 1C3OB 3C3DA 1F0YA 3TCXB 4FHEA 4ZMSA 2X2OA 1S96A 5F3WB 3FPBA 1LVGA 1E6CA 4OM7A 1NM5C 1Z38A 2C1EA 3QITA 3V7YA 1IVSA 1XEWY 3L4EA 1QHHA 3IKLA 3L04A 3VYTB 3LKVA 4ZVOA 5H9WA 4M36A 1EFHA 1F0KA 3LF2A 1UK7A 4P36A 1E6MA 2C5SA 4TTSA 1AUXA 4E5VA 5FDFA 1J7JA 2AI1A 3A1UA 4ME6A 5BYJA 2R8BA 3WICA 2GF2A 4BFSA 4RPKA 5EIEA 4JQSA 2FUEA 3FWZA 4C06A 4AJLA 2VOJA 3ILSA 3FOBA 1OBOA 2G8LA 3AFMA 1I4DD 1DC7A 3IBGA 3C4VA 3Q2KA 4XA8A 5FOSA 4BO3A 3RRXA 1XK7A 5LCXA 1FYXA 1EVIA 1XTUA 2BFFB 4DCOA 3L18A 5EHZA 2VXYA 1SQ0A 4EQ6A 3E7XA 3GVPA 3PHBE 4AP6A 3LLCA 1E6LA 4FEGA 4N3BA 5JW6A 2C1XA 1O6GA 5FWXA 5TMPA 4L4XA 3O74A 1ZUNA 2IPXA 3BB4A 2IOHA 4DDHA 4KBFA 1FBNA 2IYQA 4M3NA 2L18A 3CUKA 3GO4A 1DKRA 1V26A 1MPTA 3H7IA 1IE3A 2CDNA 2QW0X 5ENZA 3ROQA 3G68A 3QBTA 4IEFB 1NG9A 4U1RA 1BKSB 3TE7A 3SIPA 4EJ2A 2IXFA 1QZZA 1NJ8A 1T4MA 2R1UA 5THKA 4BLOA 1UXIA 3DVAB 4G1VA 2FKAA 1E3TA 4RYDA 1XXLA 2J6HA 4RO0A 5A5EA 2FP3A 2Y3IA 2O7RA 2YNMA 3D7KA 1D6JA 4K86A 2FPSA 2IU6A 4IICA 4BO2A 5EWLA 1EUCB 1GR1A 2FZLA 2D7JA 2J3KA 1X70A 3N2KA 2PZJA 4LNUB 4MUNA 1MAHA 2CJWA 1UPBA 3TOVA 4DSZA 1Z0KA 1YQWA 1BOFA 3R20A 5JFOA 1J7KA 2PYDA 4P35A 5KTSA 2J9FB 3IEMA 4QGFA 1QTQA 3ZH9B 1EYZA 3PWSA 3QFSA 1II0A 5DTMA 4Z4GA 1II8A 5AHRA 1FJ2A 1JKFA 4JC4A 2FEPA 2R5WA 4V3BA 3L4BC 4Q3EA 3O21A 2WEKA 1M5RA 4MDYA 4UHBA 2AN9A 5K0SA 1U2DC 1XMXA 3LRTA 4MYSA 4PY2A 3I72A 5IK2D 2D5CA 3CG4A 1Y9AA 2QROA 3LO5A 4H1HA 4L57A 3H4MA 5FWNA 5L3SB 3PIIA 1JSRA 3T9DA 3G9ZA 1T5LA 1VZ2A 4EHNA 3OQBA 1E7YA 3T38A 2E5LB 2WAMA 1VHQA 3IVXA 2J0SA 2WJVA 2ECFA 1CKEA 5E8JA 1P1HA 2YJNA 4JWTA 2GN6A 2HXYA 4M8IA 4BAZA 1KVQA 1PT7A 4LDRA 3KHTA 1RU3A 1GGEA 5EYPB 3CUEF 5JBQA 3BCUA 1JR3D 4EI7A 1A4UA 3GGDA 4IKPA 5BQ3A 4L9WA 4GMDA 4PYLA 2AOUB 3LDUA 1THMA 3M1LA 4JJIA 2AK3A 3LQ2A 4JL8A 1AKTA 3O1JC 4NENB 2GEDA 1IJFA 1SHJA 3FYSA 4GRAA 1E8NA 1T43A 4NYJR 1PSZA 3O75A 3P9KA 1U2ZA 1FTWA 1ZVVA 1BO6A 1XTKA 1VQ1A 4DB4A 3NC4A 2A30A 3LV8A 4G5FA 2AG1A 1N77A 5KC8A 2ZW9A 1GL9B 2RHMA 2XVMA 1UT8A 2A0WA 3F5QA 2UDPA 2B4AA 1T5IA 1D2RA 1YRQA 2F1HA 4JLUA 4CLRB 3S81A 4KREA 4ZCTA 5JPIA 3PQ4A 4MYCA 2BGUA 4YY3B 1L8XA 3V4LA 3H11A 4OKSA 5KVSA 5DU2A 3PQDA 3FNHA 5K0BA 2RGUA 3A7EA 3H13A 3H05A 4O25A 2Z1DA 3F1LA 3V8PA 3GFTA 1SB9A 5ICSA 1EAMA 4BWVA 1AF4A 3KOMA 1A0OA 4LE1A 4MVJI 4FZJA 3I2KA 3O3MB 2FF5A 4C6SA 3LYUA 2BR3A 3A4IA 1AXGA 4OGLA 3RUCA 4DLYA 3IPYA 3NOOA 3V8NA 5BSGA 1HYBA 4FXOA 4WASA 3JYPA 4PO8A 1P60A 1H2BA 1S7CA 3DCIA 4O2BB 4UAUA 4WINA 4RTQA 4RAOA 5LYJB 4QM6A 1FX1A 3ZCXA 1I4OA 2QPOA 4PN3A 4QPCA 2EP5A 2PZEA 2PXHA 4DSTA 3AEUB 4QJIA 3BXOA 1TJPB 1YDWA 4MAMA 3GN2A 4Z2YA 3EE6A 4YUAA 1EE2A 1HT2E 2NPIA 2X19A 3UV7A 5HPYB 4J0DA 3SM9A 3VPDA 4M53A 3D6FA 2Y1DA 3F7OA 1N6PA 4ZV7A 4L6IA 4JEUA 3I0NA 1IHUA 1C81A 2E4YA 1TCAA 2TMYA 1OXBB 3GIDA 4D44A 1T6BY 3O0DA 4HAXA 1O0CA 5FPYA 4LGYA 4PM4A 1KC1A 3WFJA 1WNTA 2XZOA 3N5KA 2PSDA 5FUWA 2O14A 3IP6A 3IPCA 4QELA 1TQDA 4BNZA 5M29A 1Z6QA 2Z2KA 2PUBA 1ZITA 4EW3A 4HV4A 4EF5A 1R0XA 4N0MA 4ZPJA 3R7BA 3SJCA 3OQMA 2P1DA 1QKIA 2YN0A 1CR4A 2ACEA 3H2HA 5DIFA 4G24A 1HLFA 4WTOA 1Y9DA 2IZOA 1QANA 3EGDA 4S1VA 3ZD6A 2C9ZA 2TMGA 5HXAA 1RWKA 2V0NA 4JQCA 4RMGA 2Q4DA 2B99A 3Q40A 3CUSA 4UARA 4D9MA 2QLLA 1G63A 2BH2A 5AQ1A 4ZVTA 3OM9A 3MWDB 3O0TA 1U7DA 2GEFA 2DSTA 3U40A 1SVSA 5F64A 3UWKA 1HDRA 3AJ9A 3A6ZA 2IXEA 4TT3A 2WUFA 2O23A 4WZBE 2YDXA 1KYYA 3ROKA 4L5JA 2H2WA 3K4QA 2FSHA 1LQUA 1PR5A 3EYWA 3T3EA 4BL5A 4BZZA 1ZCJA 4CHGA 1PDWA 2I4MA 1UXKA 3NBXX 4NEGA 2AG8A 2WJ6A 3I53A 1H5QA 4HRVA 2IXDA 2ZWMA 3EAGA 4MV7A 3ELBA 4UDNA 3SJBA 3M6UA 5B3JC 4EA8A 3OKPA 1KS2A 1FXWF 2EKDA 3EUFA 3NWBA 4X7RA 4DLPA 3CX6A 5B7NA 1GKIA 3HJCA 1MHTA 5FQOA 3LFHA 3CIFA 3P2MA 2CXOA 4KR7A 4MCJA 4EFDA 4UQPA 2XAUA 3P94A 2WJZB 3R6GA 1IM5A 5JAQA 5BV7A 3SQXA 1VIDA 3CPEA 3EXEA 3TSCA 3QE9Y 1XRLA 1Z33A 1GV0A 3RRYA 2NU6B 1MT0A 4A8HA 4CPDA 5B7PA 1MKYA 1OCEA 1N1EA 1PW5A 2SKCA 4W8HA 3PDIB 3MTBA 4M88A 4W6ZA 5KNBH 3JQGB 1BMFD 3KZMA 3E9DA 1UBCA 4MGYR 5KPDA 2Z9DA 3HEMA 4KRYA 1CHNA 2OQIA 1N2EA 2ZRBA 3JQ7A 5DGCA 3UHJA 2FAXA 2QTFA 1EMDA 2VP3A 4G1BA 1YZQA 1F7VA 3O2JA 5CDFA 1C7ZA 2VK8A 4RV4A 1Z5UA 5I51A 2PXCA 4G07A 4Q0MA 1DEXA 3NHPA 5BSTA 4D6YA 2FMUA 2EJVA 2LV8A 2REQB 3COVA 4PG4A 1WIWA 4OL9A 3TNDA 2VXOA 2ZYTX 3H5AA 5I7UA 4MV4A 1NP6A 4Y0AA 3Q8LA 4ZO9A 2X4GA 5IBRA 3MJTA 3UJ7A 3K5HA 3ZV6A 5ENDA 1CF9A 1LJLA 3CFYA 3SLKA 1UBRS 3A9RA 4H1TA 3HYRA 2I8CA 1VL6A 4H1UA 1SXIA 5JBNA 4R54A 1ZBQA 4FHDA 1ODKA 1QRAA 1ULHA 4QNMA 2WJGA 2SNIE 3DJYA 1ZN9A 4D0NA 2V03A 5SYAA 4M1EA 3LOUA 2P5UA 3DV9A 1A8PA 4G8JA 3L77A 1UJNA 2J4CA 2QSYA 4GF5A 3VSDA 1ZUIA 1CJCA 1W9MA 3FVTA 4MVYA 1Z2OX 4UTVA 1I7NA 1NN1A 2F8MA 5EJAA 3A6HA 2RONA 3KPYA 2B2CA 3GAAA 4Q47A 5F5XA 5FFFA 2LE0A 5I47A 3CRNA 3PNMA 1SWWA 3GMDA 3KFVA 3JQPA 3NVMB 5KOYA 4QVIA 4ARIA 1WD5A 1ATZA 3RGGA 3UA3A 4AXXA 1I5OA 3Q3HA 2GEKA 1E2NA 4GECA 1NYLA 4J16A 1XTPA 2W9XA 4OHXA 3GLUA 5KYVA 4AG5A 4CG1A 2CLLB 3QKUA 4TQ9A 3OT5A 4YASA 5GONF 1M2VB 3KBOA 4FUTA 4N18A 4DTCA 1SXJE 1YR3A 1KH2A 1U11A 2R6GA 2XTMA 3QVJA 4KFRA 4MWBA 3QMVA 1XTSA 4HB4A 1NDQA 1X74A 5G3YA 1VDZA 1K97A 2AFHB 4GZ5A 3QG5A 2DOKA 3X1XA 2LTAA 3R4CA 3FWNA 5H68A 4L0MA 1U3TA 3TVDA 2Y0CA 3FPCA 4NCKA 4UULA 4X90A 1TNDA 3A6LA 2EX4A 3Q3IA 1BS2A 1EIZA 3M70A 5IF3A 1N34B 4YJHB 5IAKA 3HKEA 1DKUA 9MHTA 5C0OE 2NNWB 1MU0A 4L3VA 2QL5A 4W5QA 3LUJA 3E9QA 3W5SA 5MN5A 5IAAA 1ZR4A 4GW3A 1IOVA 3LLUA 2R1TA 3Q3EA 4Z9AA 3INTA 3GFPA 4I2VA 4L85A 3NG1A 5G4KA 4AJ2A 5JDCA 1KVTA 1VSQA 1QIFA 1E3DA 1Z5VA 2BFBA 3SIRA 3FTFA 2AC7A 1DIHA 5CLHA 2H7VA 1KNQA 5C5EA 5KYWA 1U80A 1TM3E 2YXLA 5DWVA 2H2AA 3R0VA 4ZCSA 5G02A 3SDBA 4Q9KA 1C4WA 4Q02A 3FDIA 3X1JA 3A4VA 2ECOA 3CKYA 1SUBA 3RSSA 3DAPA 2NU7B 4RXMA 5BOSA 1ID1A 3H0KA 3THRA 5IT0A 3QVVA 1HNNA 4LX8A 3VX3A 3X1ZA 4DUPA 3OEHA 5CT8A 4EPXA 3NBYC 3S5UA 4BWYA 1VHJA 2QVCA 1S0UA 2G04A 1ONOA 2EBUA 5B1SA 5A02A 2WSIA 4O1IA 1IUOA 3KS9A 3WGVA 4KQMA 4R68A 5EEHA 4YRCA 3NJ8A 1UBOS 3CUYA 5CA0F 3A36A 2DQSA 4KEAA 3HXQA 1JZQA 4DA9A 721PA 2NUTB 1ZM2A 1G5FA 4AB1A 3P4YA 2FEWB 2XUDA 1USUA 5H02A 1NKTA 3U7FB 1VL1A 1DAKA 1USGA 3STXA 3FPJA 1V25A 1ZH4A 4RJKA 4DY4A 1M3SA 2F3UA 1ZD3A 3I9FA 5BQOA 2BELA 1E63A 2NQ2C 3L02A 4QD3A 1AMOA 4GL2A 1SWVA 2CXTA 2E1PA 3ZDZB 1TZMA 5K4AA 4OLFA 1JN0A 1TF2A 2Z2ZA 4MW5A 1QRSA 3QUTA 1FUKA 4XIJA 3G0DA 4FSDA 4HWSA 1OLSA 3MRTA 4XM2A 4EY5A 4RPGA 3A2NA 4NOLA 2V7TA 3K09C 1TADA 3OTQA 1TUIA 4M7RA 4YRTA 3AT1A 3ZTTA 3DPSA 1W85A 1KU6A 4XYBA 3Q7RA 1XD9A 5KVCA 1XZLA 4I55F 2ZXUA 1YQ9A 4BLQA 2VZLA 1EM8B 1FP1D 2VH2A 1P2UA 3K1AB 5AJUA 3EVNA 2WIKA 1L7BA 1XRRA 2DFKB 2ZJ2A 3ICQB 3NV9A 4FOPA 3TLKA 1EJBA 3QPBA 2X6RA 4G5HA 1ICIA 1KVRA 1UPUA 3HKBB 4KU4A 5JD5A 2Y05A 5IXJA 1PFGA 4UPVA 5FL7A 3P7MA 2ZWAA 2OO3A 4IMPA 3I3OA 4M9CA 2GZMA 4PCUA 1C1YA 4U7JA 4GBED 4ZT7A 2JJ1D 4V0KA 3N8DA 1CP3A 1W5AA 3AU9A 1KFEB 3IKMB 5LUAA 3EFEA 3LSYA 5H0IA 4LI3X 1L1RA 3GP5A 3L93A 4HMOA 2RHCA 2EQAA 3G2PA 3L6CA 4HPXB 4MRRA 4DXAA 4C0QC 4P0PB 4YT8A 5LZ2A 2R00A 1CEQA 3NWJA 4HB0A 2XTZA 5COBA 5JCJA 1HT3A 2HDWA 1JECA 3QVGB 3GH3A 4WY8A 1MIOB 4JD5A 4R2MA 4ZQBA 5SZKB 5EL0A 2EF0A 1YHZA 3FUVA 4TMXA 1D2MA 3VZCA 1WEKA 1M2KA 3I61A 4FMCB 4QWMA 4RQBA 2CNWA 3B8HA 5ICMA 1IY9A 1JIVA 1FJHA 1TK2A 1S8NA 2CMGA 4HJXA 2UUCB 1PR1A 3NVKI 2NUAA 2OORA 4BNTA 3CVYA 1JT9A 3TLGA 1OLUA 5GP1A 1A77A 3RWMB 4C2AA 3F7NA 5JH7A 1F2TA 3W1EA 1XKLA 4Z86A 2M2IA 4ZYUA 3KLNA 2XVXA 3EZ7A 5HR5A 3MJCA 4DYVA 3RADC 3GPCA 3WGLA 1E62A 1Y7HA 4V1CI 1XRPA 1P8JA 2AF4C 2MSEB 4MWZA 2DPHA 1ANKA 1OI7A 1WS6A 1E2DA 4B4WA 2HNAA 3DE1X 5REQA 1CF4A 2V4ZA 1NBAA 1FP4A 2P62A 1HFWA 3IE0A 3NIBA 2HPAA 3GEHA 3UAGA 3SHOA 4C6TB 1JKMA 1J90A 4BRWA 1WCYA 2BM9A 1B1CA 4J0JA 1WZCA 4X6UA 5I01A 1DJPA 2IC5A 5ALSA 3DYIA 5LBTA 5JYBA 1R6BX 1ORTA 2D59A 2XE8A 3N59A 2OGZA 4UBJA 4JX9A 4JX8A 3KBBA 1D0SA 3JQRA 1EFPA 2MSCB 3GK3A 3T4EA 1G20A 5DBEX 1XTQA 1NF3A 4I4IA 5A4KA 2WMDA 2X14A 4IRXA 4JJ8A 5DXJA 1B2RA 4MINA 2BUBA 2I91A 2B5VA 2ZJOA 4PNHA 5DNYB 4BE9A 1YD7A 1QVWA 4GEGA 1I51A 4WN3A 3EIFA 4XZ3A 4NESA 1NDUA 3OFJA 1RJ9A 2JBWA 5FULA 1NXWA 1R88A 2BGNA 3UMCA 1XYGA 1W5FA 3VTKA 2LKCA 2O7NA 2R5NA 2ZGVA 5A7FA 2IKSA 1AXEA 1R6AA 1RZVA 1ONPA 1QB8A 5D5HA 4MW6A 2SKDA 2QL9A 3KPVA 2G1JA 3WGKA 3QW4B 4B31A 3AGPA 5CP8A 2NU9A 3F6YA 1C5KA 4PO1A 2IV2X 5MGNA 1C9NA 1RWXA 2UYOA 4NEQA 3TRKA 2D00A 2PD6A 1EK2A 3DC7A 1YIAA 4LVNA 4PYMA 4R8LA 3WTBA 1CWUA 4YEDA 4CQMD 4D46A 2AXQA 1HDEA 1NQOA 4EUSA 3U44B 5ISMA 5HJEA 4B71A 5K3DA 1DFIA 3KOYA 2D54A 4MVJD 1R0CA 3AUAA 4DADA 1KH3A 3CN7A 2H8GA 1RXCA 2WSSA 3HP1A 2QTMA 1QHIA 2NVOA 5ECDA 5LDHA 3EWSA 2I3BA 4CN8A 4ZK2A 5DO9A 4X95A 1UC5B 2CK3A 4G9GA 1C1HA 4MV8A 4Z1MA 3LBFA 5TMEA 1E4EB 1UOPA 2OV3A 1NVMB 4GVXA 4AWAA 1X14A 2ACVA 4GKVA 1DX9A 3KTOA 4E4TA 3TKLA 4EG1A 4XVCA 4CEIB 1P4RA 2B82A 3A9WA 2YWHA 1NQXA 3GVHA 3I2IA 2JVIA 4K1LA 1M0EA 1O57A 1S2LA 3OJEA 2WIAA 4GFDA 4PANA 5FOTA 5BQPA 5GQSA 4CTNA 1XMIA 4HGQA 3FGNA 2XW6A 4HNVA 5ALWA 2O0HA 3SFVA 1XV5A 1XXHA 1XZGA 4R2LA 4YDHB 2LCQA 4MQUA 3V1YA 3ZVLA 4AF8A 3IUMA 3TKAA 3COSA 4KCGA 4R7ZA 5T5QA 3UXMA 4MIEA 4PAMA 1QAMA 2G5GX 2PD3A 1YAHA 3BRCA 3GRRA 1REQB 1RCFA 4JBGA 4HLUC 5H70A 1Z07A 1SU6A 1K7CA 1P6QA 3ZV5A 4LS3A 4L74A 1UBLS 1ODJA 1X7XB 4ZU1X 4RMNA 4D82A 1SUWA 2QD5A 1MO5A 1R5OA 1YDMA 3KR2A 3DEYX 3G2JA 4DCPA 4OIFA 2XNCA 1K7SN 3K9BA 1OV4A 1KMIY 2X4LA 1I3NA 2ZJ0A 3HPQA 3QQPA 5BRNA 3T5GA 4ZKDA 1K9SA 3N2NA 5JD4A 4OBWA 2WQ7A 5BRAA 3D8RA 3ASUA 3KVYA 1LB1B 3PB3A 5IEBA 6REQA 2R8XA 3F5MA 2XVZA 3PJGA 4OPMA 2DLNA 1UPAA 5DTRA 1Z4IA 4K9DA 4ESOA 2P40A 3DZBA 3REQB 5HS4A 1YVEI 3NT4A 1NN5A 3P0JA 3OKFA 4TYQA 3GLRA 3VR0A 3UMMA 3JARB 1UMKA 2NZVG 1DIOB 1OI3A 3AYZB 3H5TA 7AT1A 2Y67A 1ECBA 4FLEA 4REQB 2VP2A 3B85A 3SI7A 1YV9A 4DE5A 5BP7A 1CUBA 2PYZA 4LMRA 4ZDJA 1N2CA 2WUEA 4KYUA 3LY7A 4IFIA 2F55A 1EVJA 4WK4B 4I66A 1UDAA 1DL5A 4NSNA 5TGZA 5IHPA 2PMKA 1O9BA 3F6BX 2G28A 4NU5A 2H9IA 3T35A 4GNRA 1XZHA 2A9QA 5E2AA 4OGKA 2PNJA 5SYNA 2PLFA 3UKOA 4L50A 2RARA 4YAWA 4ACAA 2P6UA 4L9AA 4OVKA 1H0KA 5ALLA 1OAOC 4LNAA 1DIGA 4N03A 2UZ1B 4IDNA 4Q1AA 1M7BA 3J81k 1J0XO 1ATIA 5KYKA 3K1ZA 5DULA 2B9EA 3VKGA 3DOIA 4C08A 4PWZA 5DOZA 3L92A 3ROPA 2P9YA 1AQYA 1FNCA 4OA5A 5LA6A 2GM4A 1VIMA 2NZWA 1FPMA 2QG6A 3B1JA 4IV5A 4KR3A 4TGLA 3A3PA 4B40A 7REQA 4RF4A 2QYTA 4PAWA 2H0AA 2VDNB 3IOYA 3GJRA 1T9HA 1WG8A 1UFOA 4PFKA 2GRUA 4TMWA 3V3KA 3KYCA 4U2KA 2IUFA 4NYMR 4E1AA 3B89A 2N42A 1SD1A 2BF7A 2F43B 4YO8A 3I2GA 4EO9A 5CPBA 1XD2A 1HOXA 2OC9A 1VDMA 3NP9A 4O4IB 1QGED 3TOSA 1S01A 1UT5A 2B6HA 2O2ZA 3SS9X 1ZMTA 1TKBA 2VPZA 4R40A 4A8TA 2ZIEA 2G63A 5KTYA 5EXPA 3QV2A 1YS2X 1DC8A 2A0YA 3FYUB 3P45A 5H4HA 4D79A 3UFXB 2L69A 2WYWA 3EPKA 3QU2A 1PQ4A 1C1DB 2CLDX 3DMPA 3HU2A 3JQAA 4L4RA 4N3GA 4X0EA 1M75A 1PLLA 3AOEC 5T57A 3WWDA 4ALIA 2C5FA 1SHKA 3B2QA 4NFYA 1THZA 3OOEA 4B32A 1L8LA 1FQWA 2GXQA 3TXYA 1A4IA 1R4ZA 1RYZA 5GOTA 1VM6A 3KG2A 4Z4EA 1CHDA 2P9QA 3DHYA 4H08A 2O8BB 2JFBA 5DV9A 3OFVA 3GJZA 1RRGA 5K8VA 5DI9A 3A9TA 5H7XA 1XVLA 2ICAA 5LBUA 2DHDA 1AZSC 2PZ8A 1CY8A 2YWCA 3CX4A 3OEYA 4LJ6A 5EJIA 4PHHA 1C8VB 1DAIA 1ZRNA 2R6JA 4TLEA 3PE6A 2F9MA 4FFWA 4WCFC 5IUKC 2O1EA 4A7PA 2IZ5A 4DL9A 1JG4A 1NUQA 1IK4A 4G0ZA 1C3XA 1QGZA 5KTOA 3EFOA 1E4YA 2D4HA 1HI9A 2CLIB 3CZ9A 3LWDA 1RYHA 2CXSA 4DNPA 4CI0B 4NBNA 4DR6B 1NMEA 2PPLA 4KRFA 1E6WA 1EP2B 2HZ7A 5FNVB 4LOKA 1NE7A 1PJSA 2V9CA 1LLDA 2WDZA 3MTGA 4BGUA 3GJTA 5KVAA 5LD2C 2FH5B 4KC0A 3Q9NA 4ZODA 2G82A 1KSHA 1C2TA 2I34A 1ODLA 2JEOA 5F12A 5DYYA 5HZHA 3W4IA 3C14C 2YC4C 4FDVA 4HFMA 4L5AA 2XJ9A 1IWBB 3TZLA 1NOKA 3INGA 2Z4RA 1GA4A 1G3RA 1X19A 5IJ0B 1DB3A 4ZI7B 2ZULA 1UANA 4NCBA 3SU8A 4M0PA 2VYQA 2IHKA 4XFJA 3N2LA 4QUIA 3U7IA 4DM4A 1G8PA 1IM2A 2JFOA 2VZ8A 2OPBA 3CYFA 4PG7A 2DX7A 5K7SA 1ILEA 3P9IA 3NNSA 1HV8A 1E7QA 2GS9A 4KO3S 3D2CA 4KDEA 3BICA 3EEYA 1R8XA 1IPEA 3DG9A 5MFPA 1C9JA 1D04A 2PZGA 2YYAA 3KQPA 4LOLA 2HSZA 4ZO8A 1LV7A 1ELOA 1R4NB 1TM2A 4BZWA 3W8NA 2HDOA 1PR6A 3GLIB 1US8B 2Q1SA 1SC4A 4D92A 1ZOOA 5KYUA 5A03A 1CT9A 5IVHA 2MINA 2REOA 1RPJA 2WU3A 2JFUA 1OT5A 2PWAA 3TL3A 2YJZA 3LBYA 1TPYA 1KDVA 5JSYA 1V45E 1ZNYA 1I33A 1YBVA 1VLHA 3KE9A 3KSMA 4L9RA 4DMHA 4N6GA 4HEA1 3ZHXA 4F21A 2JFWA 3FYHA 4E14A 4JXJA 1XZKA 3OIWA 3RBXA 3UY4A 1WDMA 1DC6A 1NUAA 3SAJA 4PG8A 1B6TA 2E37A 3C6KA 2F2TA 5FWAA 5FIUA 2ZTSA 1JA0A 2CJXA 4CNQA 3K9LA 1CB0A 1XIVA 1VB3A 1Y1SA 1U3DA 3EZGA 3PF9A 4KWTA 4MWSA 2FN8A 4DIFA 5JECA 2GZ1A 1N5LA 4IVNA 4QBIA 1MGOA 4GZ6A 4WNIA 4C7OB 2IYFA 2Q29A 4UOEA 5IG2A 4EIWA 4ZANA 1ZSVA 4PC3A 3ZV3A 3GRYA 2W0SA 2PUWA 4GX1A 3NEAA 4R3NA 5DJ5A 4CHTA 3ZNQA 3WBJA 3V8QA 5EKDA 3OOYA 1TU0A 3V00A 4ER0A 3PXAA 1MDBA 5EE3A 3WRYA 4B6SA 1U28A 1M6HA 3JVEA 4AYXA 2AD5A 4Y1FA 4EAAA 3H5NA 3I9V6 2MYTA 3KYDB 4LJ8A 4QXOA 1DO0A 1GSIA 1NWCA 3MEQA 2ODWA 2NPFA 1C7EA 3TUIC 3V4ZA 4B8WA 1BDJA 3FTQA 4LRTB 4UUQA 4ZCMA 2VAXA 3SE7A 5AVYA 2C96A 3LCVB 5HEKA 3TI9A 5CJ2A 3QTLA 1TVMA 1AZWA 3O1LA 5INTA 1SUCA 2O8CA 3OQJA 2PCJA 1FDWA 1LJUA 3OZGA 1EP1B 1MG5A 2Q3FA 3D6VA 2LP4Y 1FFHA 1E5LA 3CT4A 2PRYA 8ABPA 4WXYB 1QGUB 1SPXA 3MVEA 5B64A 4MCIA 2FZKA 2O1WA 2W8BA 4E46A 5FI1B 4FBLA 3A0RB 1AKWA 1E2JA 1KJYA 1GGNA 4DABA 3CT6A 4MQFA 1X7YB 5C8YB 1OWPA 1SKMA 4F1KA 1U2SA 4DIEA 3P26A 4MPRA 1PJQA 1T2CA 4QXQA 3IEKA 4H7DA 1WTAA 3GJ3A 4IUBS 3HUEA 4GZ3A 3T5PA 4MHSA 2W8ZA 1U9JA 4F5YA 2E21A 3D0RA 3G23A 1LI4A 1NFRA 1C0LA 1XR3A 2D8AA 4O4LF 1SBTA 2D3WA 1I6LA 4OQNA 1I94B 3A4LA 3PFCA 4IDBA 1Q91A 4Q9IA 4XVHA 4DOMA 3JRNA 3GA7A 2PE5A 2PSJA 2BSAA 2HM7A 4OQYA 5LMNB 2RI6A 3ZY5A 1G19A 2HMYB 3B3JA 3ONDA 1QFMA 4FFVA 3EZNA 1UK6A 2ZJ3A 1W0JA 2HR1A 3UT0A 3WV5A 1MB9A 3R8FA 2HA2A 3AFOA 3BSWA 3GFFA 4RY0A 3RTAA 4MKGA 3LZDA 4FIDA 2EAUA 1JEQA 4I50B 1DG9A 3DNMA 2QHXA 3PC2A 2BCJQ 2G09A 3RYHB 2O8EB 2I22A 3H1TA 3O38A 1X3LA 1M74A 3KIPA 3VC7A 1TVEA 4QDOA 4MK4A 1QHGA 5BXQC 1YZHA 2WYOA 2J08A 5JEDA 3NYQA 3L79A 3M49A 5BN3B 1SIWA 2BFDB 1FSPA 2C42A 1TZKA 2GBLC 2CDCA 1P33A 2DVMA 2ZIZA 5K0CA 4BV8A 1V1MA 4FMDF 2PUAA 1R18A 3ZS9A 4I7EA 1DKOA 4JLSA 2XMPA 5JMWA 1ZI6A 4B48A 4L16A 2W43A 2VRCD 3EG9B 5HFNA 5T4FA 1IMOA 2BZSA 3P52A 3O4VA 3EDMA 4EVQA 3PFNA 2II6A 3FHOA 5H59A 1KDZA 2C7RA 1ZU5A 1GKKA 1E0DA 1NXXA 2C2OA 3IOMA 4NE9A 2J5BA 1CDEA 4I8DA 3UF0A 5FI0B 4GBMA 4QAQA 1NR5A 3EA5A 1Y63A 4IIFA 4X63A 1DPFA 2H00A 3EGWA 4DCNA 3UK1A 1H8HA 1E1RD 3EMBA 3ETHA 1CE8B 3OCUA 3DWGA 1HFKA 3P4UA 5LQJA 3MBOA 3PXCX 4W1RA 4YT2A 2JZNA 3P2EA 3PI7A 2D1YA 5TQVA 3CNBA 3KD2A 1SH7A 3LUPA 3MC1A 2NZJA 1EM6A 3WYBA 2X0DA 1RAAA 1WMEA 4TMZA 1FUIA 5IBPA 2ZAGA 1ADFA 5DYWA 4NFLA 4CU5A 1CB7A 1M10A 1RXVA 1Z4OA 3OZVA 4HH4A 2ODPA 4DN6A 2O1XA 3QPVA 5FH9A 2O3RA 2G9UA 2PN1A 1E59A 2ZAMA 5EIHA 1H2EA 4EYSA 3NGMA 1NX9A 4KQFA 3O4IA 3P5SA 5FBQB 3PEEA 1J2JA 1VBNA 3BQ9A 1NURA 1FNSA 2JBAB 2Q1XA 2ZSFA 3DZIA 3KYJB 1JR3E 2CXPA 2JGLA 2PBFA 4V0QA 1JI3A 3JALB 3TLYA 3RC8A 1Y4SA 5JMOA 3IAS1 4P33A 1OH5A 5EJ4A 3RROA 5CU7A 3KSBC 4KHPB 2R86A 1S3FA 3FKSD 4W5JA 2B6NA 4LHYA 2O20A 2UYYA 1KJWA 1EHYA 2SCUB 2X7JA 3GU3A 3RVLA 4Q24A 1TM7E 4KOAA 4LSGA 2XCRB 4OLBA 2AYXA 3HP4A 2BUCA 5FORA 3EOAI 5AM0A 4IZOA 1K8XB 1QU3A 3AF5A 2GCGA 1FVOA 2FEMA 4LDNA 4WFIA 1TTQB 2C7QA 3BE4A 1KZ6A 3QENA 3IVRA 4PC7A 1OWLA 1NP3A 3WZMA 1KC3A 2FK7A 1CNFA 4C01A 1ADYA 1K7XB 3QTTA 1W0CA 3STHA 4ENQA 3KC2A 3JYQA 1QAOA 1YUBA 5I7AA 4CG3A 4DT1B 1MV5A 2VJAA 2JI9A 3OZCA 3BGDA 5LMCA 4RC9A 3JTMA 1H8EA 1KMCA 3FY4A 2RGXA 2OEPA 1Q74A 3CURA 4KVGA 4YALA 4NY1A 4Q16A 4ZJYA 4O2AB 2Q1YA 4JOSA 3AFGA 3I2HA 4BKRA 3WYNA 1EFAA 3IQIX 1AK1A 1R74A 1R66A 1TCVA 2YCBA 3EEQA 3PZRA 4HR7A 2XUJA 3MYYA 3KWFA 5CFMA 4RTMA 2OV2A 4ND1A 1ADJA 4TN1A 1EBUA 4RPCA 4C5AA 3L7BA 2J3LA 4JGGA 4R98A 3MTIA 1JV2B 4OQDA 1OW3B 1KNXA 2C3OA 3FHCB 6CHYA 5LUBA 1YIDA 3FB1A 4HQKA 2QD1A 1QZXA 3QU4A 3ROGA 4AXBA 1YF3A 3NT2A 1NVKA 5AQEA 3OZWA 4KXFB 4URYR 3DZJA 5G3ZA 3HBFA 4S12A 5H80A 1BHQ1 3ZTYA 1M2WA 1YE8A 3O4GA 2BSQA 1PJBA 1ZWLA 1Q0RA 2X8JB 4HTAA 4LBYA 4PQGA 1UKAA 4RZXA 5CDGA 4U02A 3BJRA 2GF9A 1JEAA 3RU2A 5A3VA 1KU0A 5LXTA 3T54A 1R12A 1H2FA 3W4JA 1GPLA 4CM6A 3ANLA 3EZLA 1VLJA 2ZVJA 4FFMA 4K05A 1E5XA 3RWBA 1Q0ZA 3O4RA 5CJPA 1L1FA 5B36A 5LP6B 3WYCA 2JA1A 4C0KA 5FO0A 1WPXA 4JYBA 4HVTA 3TQTA 3NHBA 4IXDA 3L6UA 2PHZA 1V6SA 2BEUA 2I8LA 1DFGA 5DK6A 3CVUA 1H0RA 1EA7A 221PA 4N12A 2HCRA 5IJAA 5BW5A 4G5OA 4WDQA 2JLAA 2AJLI 1LLCA 1GCUA 1KAEA 3IPAA 3WXMA 4IVQA 3WSTA 4N0EA 1P2BA 2CLKB 2NXNA 1ZJ5A 1WE2A 3NHAA 4F9TA 2PUDA 1PJZA 7YASA 5L7WA 2K4MA 2PWPA 1NVTA 4LXYA 4R51A 4MZDA 4TZKA 4BLTA 3GLGA 2VPQA 2WG2A 3OTWA 3GRAA 1K06A 1TQHA 3L0OA 3SHWA 5K03A 2FX5A 2OKCA 5SYMA 4Z0HO 1NMZA 3LQ1A 2C2XA 5HF6A 3QELA 1EFDN 3VOTA 1KAHA 3ED5A 3GOQA 3AL3A 2VS1A 3OZBA 1I4TD 8OHMA 1J4AA 1NJ5A 1XEXA 3UH1A 1Z6AA 2FFRA 3H8SA 1ZIXA 2R6ZA 1V2HE 3O8QB 4UHHA 3ZQUA 3DWEX 2H5EA 3TLJA 1FP6A 2JASA 1EVEA 1Z82A 2ZRGA 4LBWA 4RM2A 4G6ZA 5I8ZA 2CSXA 2AC2A 3CNEA 3FDZA 3FSJX 4ZAXA 1MW8X 1RWNA 1TMOA 3FFXA 5KX5F 1GADO 2COKA 1URPA 4G89A 2KJQA 3N53A 5HCUA 5KKAA 1DXYA 3CUUA 5EKXA 1B26A 2DR0A 3EA4A 3C6ZA 4QJ5A 3EMKA 4Q4AB 5EP2A 5BQ5A 5A5VA 2YWFA 4OP2A 1II9A 3MMPA 5IASA 1AIPA 2VNJA 2IS2A 2H4HA 2ZSKA 4LXTA 2FPXA 1Z4LA 2DLDA 4CCAA 2GPTA 1JHPA 1GP2A 2NSDA 3RVBA 1VYVA 3AI2A 4N0PA 4U9IS 4KYVA 4C4YA 5K0EA 4EGSA 3V32A 5E6UB 5HVNA 4UVEA 3CSSA 1K6MA 4FI3C 1CR6A 4IFTA 1L8OA 2QE7A 3FMOB 3SP1A 2F90A 3NHMA 4PXYA 4AMGA 5CDUA 1FRZA 2O4UX 2QAGC 1TPZA 3NXKA 2E3JA 2VSNA 1X80A 3FJOA 5DCLA 2ISCA 4MO9A 1HXHA 1FA9A 2HMUA 3OHPA 5C9ZA 5AI9A 1BX1A 4K5QA 1QKKA 1U0LA 4LY0A 3U9TA 4LOHA 3V2UA 3AJ8A 1UP7A 4LSMA 2ZRKA 1OHHA 3BIXA 3KK0A 3R5XA 3EJWA 1UC9A 3N0RA 4LVCA 3LXXA 4YMWA 5K3FA 3HNOA 3IAAA 2QQFA 5CIQA 4YACA 1IL0A 3DLBA 2AG5A 1Z6TA 3LM8A 2YJ6A 1HBJA 4E09A 1HE1C 4UW9A 2YJ3A 1JHXA 1NTRA 2OZEA 5GONA 3JSAA 1HE4A 3KSAC 5FA6A 3ZDDA 2GBIA 1EGHA 3F9RA 4HN4B 3W7VA 4E15A 1R0KA 2EXXA 5F78A 3K30A 5YASA 2JFHA 2JRLA 3O8BA 2BGGA 4PO9A 2YW9A 5FA5A 4W99A 4ECEA 3T1YB 2Y1FA 1DOHA 3O73A 3VM6A 2OHFA 3R3UA 3RHZA 4FEAA 3LQFA 5C5DA 4LPSA 4EQ6B 3CVVA 4JXXA 3Q0EA 3RJMA 1BN6A 3I62A 4XQCA 5EE9A 4GWLA 3DF9A 2HNKA 3EQ7A 5FWXB 5J23A 1G2IA 1E9VA 2QTTA 1I30A 1SOAA 1Q1BA 4KV7A 3VSEA 5TQ0B 2E18A 3DDSA 4JB0A 3BT7A 3IPLA 3RUEA 1G42A 1UBEA 4MUBA 4XWTA 4BMVA 3N28A 4K26A 3BXZA 2JLWA 5B7QA 2IYNA 3INRA 3HUTA 3IHLA 4I9FA 1X13A 3LPAA 3N2IA 2PX6A 3I04A 3R9IA 5DM60 2N9UA 4DF3A 3ECAA 4Z9FA 5HA5A 3UHAA 1L8AA 1YZNA 2AUNA 1N2GA 4HGNA 1N6KA 1VL2A 1EVYA 5LQMA 2Q9BA 4NU6A 4ZEWA 3X1MA 4CCYA 1T8PA 1ZVKA 3L49A 5E2IA 1FZTA 1GRRA 2IHYA 2MR6A 3AUKA 5EWLB 3DLIA 3TLZA 4RF2A 3UVEA 4MDEA 2W2OA 3H1AA 3RFFA 1POXA 3N2KB 3ETDA 4HNAB 2FNAA 2CJWB 2Y76A 4FHCA 4YJKA 2DY1A 3S2FA 3VR5D 4N9WA 4D4MA 3X3HA 5FEUA 1EFTA 4QU5A 3ABZA 3MSCA 5HMMA 2CYBA 4UTNA 4XXHA 3GV0A 2PH1A 3TLCA 5C8XA 5EGNA 1II8B 3HCWA 3NVAA 4M55A 4URXR 2IXTA 3PTAA 3ENWA 1QYVA 2FFAA 3L1IA 3M6MD 2NOAA 1GYQA 3GFQA 1MTOA 2QG4A 3DW1X 1ZH8A 2VHYA 3JQ8A 2D0PB 3ZE6A 1D5WA 4B7AA 3UMBA 3J80A 4HVAA 4E70A 1SZJG 1NRWA 2ZVDA 4WSOA 4BCCA 3FNGA 3QX8A 3WQQA 4TXNA 1C9DB 4KX3A 4XB1A 1BCSA 1F2VA 1QP8A 2RC6A 4B3FX 4YCCA 1PEDA 5KQMA 1KOLA 3MTDA 3GT4A 1NVGA 5FFMA 2OHVA 2CVFA 4J0EA 4JP8A 4JZKA 4RCZA 4UKDA 2GM5A 2YMMA 1JU4A 5G1OA 3SYRA 4HDKB 4LJAA 4R5MA 1BRTA 4URZR 4G2NA 3TNJA 1JRLA 5E9QA 5DB4A 3K0AA 4YHHB 4D4GA 4Q4DA 1TAGA 4M1OA 3VKFA 5LIPA 1R27A 3A6KA 3U4DA 4YMVA 1Q7EA 4DAEA 2A9FA 4M1MA 4EH1A 4B4KA 1RSZA 2YV2A 3BOSA 3Q15C 1HL7A 3PC6A 1XQ6A 4PZ9A 4E88A 3KRTA 4KNVA 1Q11A 5EWMA 4KN5A 4H7JA 4FEEA 1SK8A 4LYHA 2ACWA 2EFHB 3DW3X 3MJVA 3O8LA 5CFLA 4TV8F 5HSGA 1Z5OA 3W34A 4CEHA 3PA8A 3AUUA 2YVLA 3EFHA 4DGQA 2A0UA 2H16A 2VAPA 1W48A 1FLNA 4ZZ0A 3EJ6A 1P5RA 2QTBA 4NTZA 3KZVA 4LK3A 3RUAA 3HJFA 4LXQA 1HPLA 1WXFA 2X0FA 3S28A 2Q5OA 3AYXB 4RA9A 1V3VA 3IPRA 5I3ZA 3WJ7A 3H11B 2WWRA 2EC5A 1N8NA 2R4UA 4RPJA 1TVCA 2B8JA 2NYUA 1ADGA 2O5EA 4TS9A 1GGMA 3VRHA 5DTIA 3USES 3BSYA 1JE0A 2WJHA 2HPVA 3INYA 2JG3A 3MMSA 2RSLA 1JAYA 2ERYA 3HM9A 2CJYA 3B51X 4DR5B 1FEZA 4U9HS 3KZNA 2A9VA 1R5NA 4YJ2B 1ULSA 1KARA 1V8PA 3DBRA 4BJ5A 4JBXA 1MDFA 4GPIB 2YYSA 5A71A 2HA6A 4F91B 2AMJA 1KJNA 3AF3A 3DDUA 1XCJA 4TRJA 4UXIA 3V9PA 1XRQA 2PU5A 3VNVA 3G7NA 1ZZEA 3QY9A 4ZC1A 3M6AA 3D6TB 2H4FA 5K6AA 2JFNA 4UNIA 1CJUC 4X1KA 1VCNA 2WAXA 3MWLA 2EGGA 1Y98A 3TLBA 1YK1A 3KJFA 3P32A 4H3VA 2CF6A 2EX0A 4LISA 3O94A 4IEIA 4P93A 5ALHA 4YAUA 4KSBA 4OHVA 3FVQA 3MM4A 4A5OA 3IE2A 3IAFA 1KORA 4B17A 4C78A 4RD2A 4B81A 4D7AA 3AR9A 4E6PA 2ZAOA 3QLUC 4TVBA 4NLLA 4D45A 1JLRA 5IVIA 5ITWA 3GLSA 5DNVA 2AZXA 1Y8CA 2ENWA 3BFJA 4U2CA 3STYA 2N3ZA 1Y8AA 1YR1A 2OBFA 3GF4A 3SEFA 4A2PA 5KOHA 4KQ1A 2QZ9A 4Y9TA 3KQHA 4QODA 4CQJA 3CLUD 4MR8A 1ZP6A 4D8WA 4ZU6X 4AN1A 1DCKA 1WBDA 4EAQA 2HW8A 1Y5IA 2JCSA 3ICVA 2DSNA 3M0EA 4DFDA 1CRQA 3UMJA 3L46A 1PV4A 4H77A 3OZFA 4K6CA 3DMRA 1KI6A 3ZU5A 5JZOA 4XJXA 1SD2A 2H7XA 4D99A 5GY7A 4GMHA 4CM9D 3QVOA 3HC7A 5HQ3A 4EQZA 1QIIA 3WZLA 3EIWA 4TMFA 1PUXA 1LK5A 3PJFA 3PPIA 4JC8A 3EGDB 4UHKA 1JBEA 5C3MA 5GJBA 1R3UA 4IOLA 3HCBA 5HDBB 5F1OA 2AFIE 2M6RA 4CM4A 3SN6A 1EDDA 1IHDA 1WF3A 3PHHA 1P2SA 2Q5EA 3EUEA 1Z4PX 3CU5A 4UM8B 4D9HA 1G7RA 1CJSA 5THQA 2OPHA 4B82A 1UM9A 3C6QA 4KAFA 5DCYA 4D9NA 2P5YA 3UWDA 5EP1A 4MPJA 4JXZA 4KG7A 4I19A 2ZCUA 1W0KD 3IQHX 4Y6SA 2ZI4A 4DR2B 4AZ0B 3W7BA 1VE1A 2RH5A 3VH2A 4BMNA 3E9NA 3EVBA 1DZIA 1R0BA 1O95D 2UYCA 4F45A 4BX8A 2EEPA 2QAIA 4CI9A 3C7CB 2FHPA 4GPD1 3CMMA 4BNLA 5BNZA 2FDXA 1MENA 1XALA 5EKSA 5EUBA 1WVIA 1KR5A 2BFPA 3F4LA 3JPYA 3HVHA 3JXEA 3L8EA 1SKYE 1I3LA 1GN8A 3EXEB 4A0RA 4K0KB 1KJJA 2UU9B 3CBQA 4M1ZA 2J3JA 2X22A 4Y6LA 2BKAA 4ZZ2A 4BWGA 4BVBA 4Q6WA 1BE8A 4DNQA 2HQ1A 2GAAA 3UPDA 5T3YA 5EIFA 4WADA 1CUGA 3ZGVA 3PNYA 4JLDA 2ZB7A 3EC1A 1WY5A 3BHNA 4MVJE 3JD2A 2YV4A 3QA3E 3D6JA 3AVUA 2QVLA 2P65A 3UATA 3JQ7B 3VHLB 2F4VB 1EWRA 2WR8A 3LU1A 4NULA 4KQEA 4P5DA 3AY7A 4H7HA 4KOEC 2QIPA 2O2EA 5IKXA 1OXXK 1AZTA 3K96A 3AZPA 3JY6A 4ZRDA 5I9IA 4WQMA 3X2SA 1TO1E 4FDLA 2QTLA 1QDUA 1LBTA 1TK3A 3CCFA 5AOAA 5J5CA 4KYIB 1PI3A 2JFQA 3QVMA 4TTTS 3RSGA 1Z3IX 3L40A 1YR8A 2YIJA 1YL5A 3WKEA 5GIOE 3DEJA 2C0CA 3EB9A 1AG9A 4X5OA 5DF1A 3SLGA 1AH2A 1RQ2A 4XTRA 1E60A 4EELA 3DHNA 2QOEA 1KKUA 3IVMA 1BROA 1NAIA 3NGXA 4EMBA 1HE3A 2FPMA 2QRHA 2GNAA 3V4SA 1MG0A 3NTOA 3MWGA 1N2SA 2GPAA 1RKQA 3GP3A 5E9WA 3ZCRA 1W4BA 4BNDA 1N9GB 2PS1A 3R0QA 4PGAA 2CXUA 1SY7A 5A0VA 1DX4A 5TS3A 5L40A 4BLSA 4A2CA 3X1DA 1PE0A 1VJCA 1T1GA 4A15A 2YFQA 3G8DA 3ESYA 4BU1A 4L8LA 3ES9A 1T2EA 3AR7A 5B58C 1YR6A 2BI4A 1U02A 2P9CA 4FGKA 3IKTA 3H6GA 2R9VA 3EH2A 1QCZA 2ZVPX 2C7VA 1EVZA 4F1JA 3CH5A 1AN0A 1NGSA 4P34A 4F6RA 1I4WA 2OMEA 2YWRA 3A11A 1ZESA 3G6KA 4BFWA 5A4FS 2C7BA 4DR3B 3N0XA 3LC1O 4OY3A 2NSJA 2HO5A 3HY4A 3RSOA 4KMSA 5JY6A 3A58B 5E9AA 1D7AA 5CNJA 1NVDA 2BDEA 2JC3A 4P0QB 3KOWA 5FHQA 1OBHA 2IYAA 1XAGA 1BQ4A 1XEFA 4GHWA 3KSZO 1KAOA 5A7HA 1N0HA 4GP9A 4ZVRA 4CZ2A 1JKJB 9GPBA 5HRAA 1W25A 5H3CA 5SV2A 4YQZA 2GA8A 3GXOA 3LWBA 4TUYF 1EK1A 3NKVA 2WABA 3K9FC 5IC5A 4YRAA 1K8QA 3IEUA 2BWJA 4GI3A 3UJBA 4IQ4A 3ZOZA 3QM1A 4G0VA 3HKEB 4KH1A 1PR4A 2G70A 2QWXA 3ZJYA 4WKOA 5U1PA 1GV1A 3USZA 1E7WA 1L0BA 1W59A 1H1LA 4PTZA 3EUWA 5LMUB 4LQLA 1NBOA 5CR9A 2R1TB 5JYDA 4PZLA 3U39A 1N6IA 5FTNA 1X8JA 1UP4A 2IHVA 1E89A 1TT5B 1JL3A 2I4TA 1EE1A 2RGEA 2LNDA 2XYHA 1WDTA 2VEDA 4HQRA 4PHFA 5GPBA 5NLLA 2BY4A 3SZ3A 3VVMA 4XSHA 2UZIR 5KYWB 5DM4A 3HR4A 2M1XA 3GFSA 4D98A 3TSYA 4PLVA 5EHXA 3ZZUA 3CVJA 2ZREA 2BEJA 3K31A 4HK4A 4G65A 1PKEA 4HN2A 1DO8A 3HVJA 1WOYA 1DV1A 5BOSB 4B3CA 2HIAA 1M1ZA 4FNGA 1SC9A 2PFGA 2HRBA 1IN5A 4J2OA 2CE2X 4MMYB 3AJAA 3SEAA 2HA7A 1VG1A 3LK6A 2C07A 1LVHA 1P1BA 4H59A 1JDTA 4WOPA 4ENSA 2H1FA 2FPOA 1Y6FA 1O8CA 1KP2A 2VL7A 4OI1A 4B3BA 2WKSA 4RJ2A 5L4SA 3G7UA 1R0ZA 4ICIA 4PWYA 3LIPA 2NV6A 4AVYA 2Z04A 2NWQA 3QU7A 1APBA 1ND6A 1MNAA 5KYGA 2P9FA 1KY2A 3EQ8A 3JQBA 3FTNA 3KKQA 3FYDA 2G9ZA 4JBYA 4EY4A 1R0SA 2DKNA 1JJIA 3CZPA 3H1GA 5LB4A 1H05A 2PKQP 3L8DA 4Q1FA 5IZCC 3SVTA 1UAGA 3TJMA 1YVUA 3IJ5A 4K2HA 2B8WA 4DMRA 2XBMA 2P68A 4KQ6A 4KDCA 4AJIA 1Z13A 2OCDA 3C39A 3CX3A 4RX1A 1G3UA 1HLDA 3CZRA 3S70A 2HL6A 1DBWA 3Q5GA 4N5DA 1IBLB 2FWAA 1O89A 2QENA 4RTJA 3FPKA 3PVSA 3ZU6A 3TMAA 1XHLA 3PQ5A 3PUIA 2CUNA 4RSMA 1E3QA 3E9YA 5JSUA 1R3DA 3EW7A 3R76A 2OSVA 4OQFA 3WDSA 1OLSB 4F3NA 2ZI3A 4FCWA 3Q1KA 4MXDA 2ZM5A 2MMGA 4WDRA 2H1HA 4BIIA 1TEZA 1Z22A 1GPWB 1MZPA 1W85B 2O54A 5CHEA 4MH0R 2FX3A 1PG5A 3PUJA 1KAGA 1N4DA 3OZ7A 5ITVA 3DBLA 4P4UA 5CCXA 3OIFA 1XCOA 5IJ9A 4UVDA 4YBRA 5DNEA 4LYDA 1MVNA 2PKQO 2F3SA 4LHXA 3KOZA 4DAOA 5T7BA 1EK0A 3L41A 3W3AA 4ED9A 4R7TA 1J97A 5ADUS 4MP3A 4DQ0A 1H3FA 1OYWA 2O6HA 1T0PA 4MW0A 3UK0A 1XYYA 2DY0A 3B1ZA 4QECA 4KN9S 3WLKX 1CLUA 4X9XA 2WYVA 2FCRA 5BY2A 4TTJA 1XCMA 3GUCA 4HQOA 2NW6A 4IKOA 4R8RA 1TECE 1TIPA 1WVMA 1KK0A 1GTL1 1Q0SA 2NO5A 3DZ8A 3FCEA 3NKFA 2C58A 5DNWA 4BDTA 1MC8A 3A25A 1GZ4A 4UE2A 1A04A 2J3QA 3RT9A 4B8ZA 4JV5B 3ZIAD 4YQFA 3HN7A 1Y1QA 1CK4A 2OHHA 4HZIA 3R8XA 2YWBA 5T6MA 5TMDA 2NUBA 1N78A 3N75A 2HLDA 1NI3A 1HE8B 2IDZA 3CIOA 3V7WA 3IC5A 3VZPA 2Z5VA 4TQGA 4QLBA 5C34B 3KTFA 1FNDA 4RVGA 2OQ2A 4N01A 4OHBA 5EVCA 3CGWA 5DSZA 3LS2A 3EW9A 1HSZA 2HRCA 2QN7A 2VVTA 3B82A 4H6VA 1EGQA 1OLUB 4MV5A 1L5GB 3VZRA 3A05A 4EW1A 2QX6A 1F2TB 1J22A 2XNJA 2ZVQX 3B48A 1IBMB 1DXQA 2QX7A 1GUZA 4AJ4A 4R01A 5JROA 2Y68A 1ULUA 3O31A 1M8PA 3BRWA 3RAPR 1QK5A 1VHDA 2ZOSA 1OTYA 2Q5HA 3U1VA 4A10A 3VMFA 2HA3A 4ZI5A 4YJ2A 1NR7A 2ZTVA 3DL2A 3NTRA 3OZEA 4YIKA 5REQB 1YOBA 4KQIA 4YRLA 1FP4B 2BFMA 3TQOA 1T1RA 4CG0A 3CEJA 1CUUA 2P4UA 4XYEA 2Z2YA 3G2HA 4FOLA 4GAEA 3FLEA 4MUIA 3PK0A 4Z4QA 2O0KA 3TW6A 2PGJA 4OHFA 4PLWA 2XDQA 5BW4A 3JYOA 3UCEA 4GSLA 1YS1X 2ZRQA 4RSGA 4MB6A 1GWNA 1V8OA 2CJFA 4ZO7A 2PUVA 4Y3UA 1PUJA 3PZBA 1U1CA 3GEPA 4WZBA 1J07A 2XGOA 4CIBA 1T9BA 2BE7A 3ZLJA 2IYSA 1G20B 1KSJA 2VYVA 1M72A 4HNGA 1W581 3OOHA 5HDQA 4E1VA 2D5LA 4NPHA 1QK3A 4IUDS 2EHDA 1R1DA 1JIKA 2ZYUX 3SHTA 3WP0A 3BCSA 4EUEA 2PVPA 2P5TB 2IU3A 3SOZA 1EXWA 2YZMA 1A1VA 4TRMA 4RVDA 4NBVA 2IQ5A 2PZBA 4X54A 5ERYA 4N8DA 3UQZA 1OXUA 1RJ9B 2JJ2D 3OF3A 4NPAA 3REOA 3SYMA 1PFQA 2PLAA 2WMNB 3E5HA 2PTGA 3PUXA 4ZVPA 4FZVA 4HB3A 2DPMA 2VF5X 3JATA 3I58A 3OQ6A 4MULA 5LDGA 4BJ6A 3M2PA 4B75A 4U5XA 2R66A 2JA2A 1KZ1A 4O0MA 4N7MA 4G97A 4LXGA 3E70C 1PNVA 1UDRA 1MX1A 1V8DA 2WOOA 2Z09A 3HXKA 1IBRA 3OPYA 2NU9B 1ZGHA 3UJPA 1E7RA 2QMZA 3NAGA 5CVCA 2EJUA 2VBIA 4M9XA 3ZU4A 3CRRA 5MFZA 2VP4A 4O4LA 2XMDA 1GA1A 3M7IA 3SKVA 1HEUA 4TL7A 1CQXA 2JNWA 3WYGA 1F8YA 2IEYA 3H8JA 4DVGA 2MSKA 2FW9A 4PLPA 3O9VA 2AI2A 4W7IA 1SGWA 2R0QC 2VATA 4G2TA 1X1RA 4MYDA 1JF8A 5JQGF 3CONA 4YRDA 4DEYA 3LA8A 4EFNA 1ESDA 1PLKA 3S8EA 4JQZA 3NEYA 2ZT5A 2VJQA 5SZIA 2W2KA 5CNMA 3NIDB 3TX6A 4AKEA 1T4GA 5F23A 4M1QA 3PD7A 3OKAA 4EKEA 3L1JA 2ZRJA 1CS0A 4U7WA 3UOGA 4JJAA 2PT9A 4N54A 1COZA 2XCLA 4HATA 4LHZA 5CEFA 4XWWA 3I1JA 3U26A 1SUIA 2CLCX 1GDTA 2A9OA 4C2BA 1JQAA 1VRVA 4IQ8A 5CM8B 3RKSA 3VH1A 1YFZA 4LRYA 5FUQA 3DZFA 4I14A 4MI1A 3F46A 1T8UA 3DDHA 1I4LD 2QLJA 3WGOA 3OZTA 3EY4A 2ZT6A 5FTKA 1YFLA 3D6HA 3V34A 4LXHA 2G88A 1TIKA 3LHKA 1Y34E 1S4QA 5AH0A 5DGDA 1QQAA 2F62A 3A1SA 3A32A 1U0TA 1ABEA 1VCMA 4M49A 4DVJA 3O91A 3WQHA 1QB7A 2JIRA 3LJKA 3QHPA 4MV6A 2YXNA 4D97A 1T3ZA 3SX2A 2CXRA 2WU8A 4K9RA 4K9MA 1EJ0A 5H1YA 4NYMQ 4RLSA 4ND4A 4UTOA 3TSOA 4B5LA 1QQ7A 4QO8A 4LF7B 1EFRA 1AGPA 1OVMA 3BM5A 4AUKA 4QTXA 1RRCA 3AF6A 2GZAA 4C30A 5TMBA 1UPXA 6REQB 1V4NA 3BMQA 3K8QA 4JXKA 1CQPA 2JZCA 4GPZA 2RCYA 4OLHA 2XMGA 1SXJA 4EJSC 1X9IA 2WUGA 1TF7A 2JZOA 4Q1CA 5ECGC 5KB3A 4W5OA 4D4HA 2C3MA 1T13A 4H60A 4HG2A 4CUZA 5DNAA 4O4JA 2NM0A 2H29A 1U7ZA 2JDID 2ZATA 2QRKA 2W7TA 5DHQA 1N2CB 3M81A 2Z4SA 4PX2A 1Y33E 3GARA 5A4MS 4US2R 3BKWA 4MITA 3WE7A 4QUAA 2QUIA 1CFJA 4RY2A 4UMDA 4EB6A 2B4TO 3FGZA 2B1RA 2G6BA 1A7KA 3KT6A 2VKTA 2OXRA 1M6EX 2DUJA 3O3NB 3PPYA 4B34A 5I45A 3GLHE 4Y2JA 5L9AA 3U2QA 1BGVA 1ENYA 4UAJA 4YECA 1NBME 5D5PA 4BO9A 2BGWA 3EF1A 1PR3A 1ZC3A 2XCOA 3FJYA 2IYYA 2UZ4A 2D74A 4JBNA 3SXUA 3ASZA 3R09A 4IDHA 3W8RA 4UU0A 1E99A 4BB5A 2JH8A 5CFQA 5KINB 1C9MA 1JQBA 5LA6B 3ZWKA 1E92A 3ZWWA 5BWOA 2E9SA 4L8VA 2FR0A 4QUJA 1GL3A 2VHQA 2CDAA 4XQGA 2X6QA 4EL0A 1HF3A 3LRPA 4GXQA 7REQB 4EA7A 2X0NA 2CB0A 2WTBA 3A27A 3K6RA 1KEZA 3KEMA 1NW3A 1GUFA 1UR5A 1S3GA 4B3HA 5DLDA 1I6KA 1F2DA 3K8ZA 4D4JA 1TZ2A 1JHZA 3RTBA 1Z62A 3VR6D 1VPVA 3KYCB 4O02B 3AI7A 3WZ2A 4DJTA 4JLMA 1PG0A 3EHDA 2XE6A 3AVXA 2O59A 2X2EA 2C5LA 2R3SA 3OCJA 2WE7A 1FU8A 1KEEA 1DAEA 2AXPA 1XD2B 4F4CA 1WU7A 1P7VA 4UEWA 5EMHA 2B98A 2F64A 4DUGD 4EFKA 1P3Y1 1ZN8A 4I6EA 1S9DA 2HJHA 1PW7A 2P69A 3UJAA 3ZXYA 1DWQA 2R60A 4J0FA 1Z7GA 4U2EA 4K0RA 5BVHB 1P6XA 4LNHA 2QZ4A 2VAVA 3A04A 2BGRA 4FNMA 5JNRA 1X9GA 3JQAB 5DLPA 1ZXXA 1C30A 1UFVA 3CCCA 3V1UA 3P2OA 4RLQA 1L5ZA 1T24A 1E58A 2JLBA 4YRRA 1JAHA 5GGXA 4N5NA 1A3CA 3D1VA 1I2DA 4B84A 1TC2A 3CXUA 5E6RA 4DIDA 3BXXA 4MQEB 1TC1A 3TTVA 1CQIA 4KYTA 3A6JA 4UFPA 1NPYA 1DXOA 4PC2A 5DHTA 2VWPA 3FN4A 2ZYSA 3BWEA 3W79A 1S2GA 2UZAA 3M5CA 1WW3A 1N0IA 3PQ7A 4HYTA 3UFBA 4JAVC 2FJPA 5IANA 1KDYA 4RZ3A 2A5GA 1RS0A 3KV1A 1AQNA 2OWEA 1NULA 2QPLA 3F2IA 2RB4A 2H1CA 1BEUB 4IO1A 3W3AH 4KR2A 5HKKD 3UAXA 1V11B 3G5TA 3AEXA 4YRFA 1CEYA 4XOIA 1DLJA 1ECJA 3DMTC 3ZQKA 2O2GA 3JD3A 1O96A 1BC5A 4QYMA 1KERA 3L0PA 3PD0A 5F76A 3GLVA 4S1OA 4BNIA 1HFJA 3JWJA 3R5FA 4RA6A 1GG2A 2LIVA 1O95C 4Y2QA 5AKZA 5TEVA 5TQ2A 3RC3A 4KH0A 4R05A 1VI2A 3R0ZA 3C8HA 2VJLA 4GR4A 4D1YA 1VL8A 4FW8A 3GPDG 1L6IA 2GD6A 1I9CA 3BIFA 2TYSB 3B9BA 1NRXA 3VKHA 1S7GA 1GPKA 1G1MA 2IYZA 2QAJA 1T0BA 2IBMA 2OLJA 1J8DA 1C2YA 2DF8A 3IMEA 1NASA 1EWQA 4OMCA 1V5WA 1WZNA 4OF4A 4J6FA 2OCAA 4Q4LA 2Y71A 4QGBA 3VA7A 3J7AC 5FLYA 1ZYUA 4I08A 4L8YA 2FVXA 1HZZA 4C76A 2BM0A 3IR7A 3ZJTA 1PFYA 1XL0A 1ZH2A 3V7UA 1HORA 3LKDA 3B1YA 4G4GA 4GR5A 5H9VA 1NJGA 4CV2A 1QO9A 3H17A 2A33A 3LVQE 4H0FA 4JY7A 4EGJA 5CEJA 3B53X 3IOBA 3DZHA 4URHA 1YDHA 2VDKB 4U7GA 1LLQA 1V3UA 3D3NA 1OQAA 4WXHA 2XQJA 2Z4TA 4DMKA 1W36B 2X0JA 4HAIA 3ZTWA 4OLJA 4UXHA 3OTGA 5C1IA 3EQ9A 4H35A 5A3RA 3O8OB 5KYUB 5BWLA 3CH6A 3D8TA 4FGUA 2MINB 5KX5A 1PKXA 3IV9A 5DNUA 2GUGA 2KE5A 2R97A 3ADPA 1LLFA 1IIBA 1ZD5A 1Q1EA 4DC1A 1MXHA 1K5GA 4IXMA 4QSMA 3GCDA 3KR9A 3P0RA 1J1UA 2JGNA 1CUYA 3CB2A 4G3XA 3Q6IA 1JEEA 2PJDA 2LDXA 5EQFA 5JD3A 3ZI0A 5IMSA 3D2AA 2GBFA 3IELA 5ILQA 1PSDA 2FSVC 4FONA 4G9EA 1JKIA 1NATA 1CY6A 2O0MA 1E20A 1CS4C 4KB5A 1CERA 5DGIA 1L7DA 1TI7A 3C3WA 3PCTA 1N2BA 5CVTA 4AS3A 4WY2A 5IC6A 1K7YA 1UC8A 5SY6A 4MYHA 4YA6A 1C7QA 3RH0A 5JTTA 4R6XA 2G9NA 4MUYA 2RKOA 2HCFA 2VOEA 1Q0TA 2Q3JA 1WEHA 1OXVA 3LC7O 4LTDA 4C89A 4YLEA 4TV9B 5EXXA 2NQTA 4ZAVA 5KYYB 1TTPB 5TT0A 3RF7A 1PRYA 1BW9A 1T9GS 4BNJA 1XCLA 4D81A 5KJ6A 4M76B 1B6RA 1UBKS 3LUAA 5J2TB 1G21A 2VJMA 3D3JA 4BBAA 4CKYA 2IELA 1JA9A 2RG1A 3MWYW 3TTTA 1OTXA 3O90A 1NW4A 4RXUA 4XWGA 1FUUA 3H4VA 5JXHA 2NZYA 3NUQA 3H5VA 3P27A 3AVPA 1I5EA 1K4MA 2R8ZA 4TKZA 4MUJA 2WNIA 3GDOA 5ER6A 3WO1A 3DUFA 3ZHVA 4PLZA 2O8CB 2Z6UA 4RKYA 4C20A 2O9JA 2Q4BA 2YS7A 5CXXA 5JWRA 1L8QA 3BBLA 1P1JA 3VAAA 5CH3A 2AT1A 4LY9A 2FWBA 3I5AA 4FS3A 3T7EA 5JVDF 1V5EA 1NN3A 2MSWA 3ASVA 2PBZA 1U2TA 4PRZA 3RS5A 3W5BA 3U7HB 5CFNA 2REBA 1XPOA 1UFRA 3PGA1 3PE4A 4MQFB 5CH8A 3ZWQA 1TA0A 4BJ1A 4CLOA 3U7QA 1FQJA 2IYPA 1IULA 3L7AA 1J0BA 1YB7A 1PL6A 1MLDA 5DHPA 3BSFA 3E18A 4LYGA 2JB9A 1QV7A 4UEJA 1TU3A 1VHLA 2MU1A 3TFOA 1F5SA 4OXIA 3QGMA 2G1UA 2C9DA 1GFSA 4MSUA 2J8ZA 2OVBA 2GEVA 1XRNA 4NI5A 1K08A 2W6JA 2YWGA 4Q7LA 4TROA 4BUZA 3G0HA 1OE0A 4D0GA 3KM0A 2CFRA 1ORRA 2P2NA 1RLOA 4RCVA 1W2GA 4X45A 3T5CA 4EKDA 3B1VA 1AX9A 2BC9A 3ISVA 4MLZA 5K2OA 1JEQB 4RJJA 3NBMA 3OQNA 1JLLA 2X3FA 2ZUFA 1IVYA 1CQJA 4NMWA 1Q95A 2Z95A 3PQ3A 3SBOA 1RC8A 2QMYA 5TJ9A 5JRJA 4NV0A 3BMCA 3OAAA 4BTLA 3BZWA 5M2QA 5JO9A 3GZNA 5LNK1 5D84A 4ABTA 1DKMA 1P9LA 2CL6X 4DNFA 3FTPA 4LRUA 3JTEA 1C0PA