4RK7A

Crystal structure of laci family transcriptional regulator ccpa from weissella paramesenteroides, target efi-512926, with bound sucrose
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
270
Chain Sequence
RVVGVVVPLIHTNFADEIIKGLYETTISSGYELLITYLDEDEDHQYQVFQTLLSRQVGAVFMLSLDIPSWMIDKLLEEQISVISLTALLSEQISAVTSNEFEMMNSIVDYLIDMGHKNIALVGDTKLTTNISSTRRTNFIKSMTDHNLAYENIFLYGNDHSYETGYTSVTTGYDINQLPFTAAIATADMVGQGLINAMSDHGKTVPEDLSIVTIDGLQQTEIARPKLTTVKQDFPEIGRIAMQLFLDSDEPQIIYIPTELIQRDSVLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Crystal structure of transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926
rcsb
source organism Weissella paramesenteroides atcc 33313
molecule tags Transcription regulator
total genus 80
structure length 270
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A01
4H3HB 1JL3A 1U8TA 2E4XA 4JB2A 3JY6A 1CYEA 1FFWA 3KTOA 2JK1A 5FWXB 1SXIA 1R8JA 3BILA 5TQ2B 2WWVD 6ABPA 1RZRA 2PAFA 2HSGA 1Z16A 2E4ZA 2M98A 5IC5A 4HNSA 5JNRA 2GX6A 1EHCA 4W5OA 4RY8A 3GBPA 2PL9A 2PLNA 2L17A 3CLKA 3EQZA 3SAJA 1YK0A 4ML3A 3TB6A 2L18A 4MS1B 3T6KA 2FMKA 2CWDA 4EVSA 2JBAB 4MQEB 1LJLA 4EVQA 4TLMB 1QP0A 3MMNA 4E7PA 1DG9A 3EQ2A 3QK7A 5BRJA 1YK1A 3TX6A 3H6HA 2PUFA 2NT4A 5EWLB 4JOQA 3EGCA 1A0OA 2E4VA 1M2EA 3ILHA 1AB6A 2PUEA 3I5AA 1PUXA 3OLYA 5CHYA 1NTRA 1ZAYA 3G85A 5HM6A 1D4ZA 1DRKA 1WETA 1BVHA 3D8UA 1DCMA 1XHFA 3CU5A 2FW0A 4YCSA 3Q41A 1QQBA 1S8NA 4KV7A 1Z26A 4IMIB 4NV3A 3LOPA 3KCNA 3OO0A 4G0ZA 1DCFA 3D02A 5F64A 1FSPA 4F11A 2PUGA 2LIVA 3IPCA 4QPJC 2JVKA 1DBQA 5JNVA 1FFSA 4WZZA 1KRXA 2LUOA 2FQWA 3GWGA 3KYJB 4LE1A 4S04A 1JWLA 2NUBA 3OM0A 4WWHA 3GYBA 1ZITA 1P6UA 4F12A 4YR7A 4FE7A 4IF4A 3O21A 4YRZA 3URMA 1QKKA 4EGSA 3LFTA 2AYXA 3RVSA 2CD7A 3Q9SA 1C0EA 3GT7A 4G86A 2YHBA 1M2FA 3LUJA 1E6LA 4ETNA 4DQDA 3DLBA 2R25B 3RVJA 2TMYA 4MS4A 4IMJB 4W5TA 2JCGA 2E4WA 1PEYA 1F4VA 2P4UA 3HDGA 1DCKA 1YIOA 1QO0A 5TQ0A 4GPAA 3F7NA 1A04A 2PE5A 1ZESA 4W5NA 3KSMA 5TPWA 1NXPA 1Z12A 3N0RA 3KHTA 3Q7RA 1JBEA 4GNRA 4KMRA 1QP7A 3A0UA 2JVIA 4M88A 1QPZA 3IPAA 1U2QA 5TPZA 4G0OA 4D6XA 3O1IC 1JYEA 1E2BA 3CHYA 3LUAA 5BRAA 1MB3A 4RK6A 1NXOA 1D1QA 5TQ2A 4RDCA 4Y9TA 4H60A 2MSWA 3I42A 4YWHA 3HS3A 4FE4A 1T34A 3C6QA 4OLBA 2OENG 3OMWA 5EWMA 4L85A 1TLFA 3H5OA 3LUGA 4Q6BA 4OLAA 3SG0A 1ZN2A 4W5QA 3T8YA 5JNWA 4MS1A 3O74A 3LUFA 3FFTA 3FDFA 4HNRA 2DRIA 1IIBA 1U04A 2JBAA 4TLLB 4MQEA 5IUKC 2RJOA 1CHNA 1YVUA 5PNTA 4YO7A 3I09A 2XDYA 5TQ0B 5KQMA 1SRRA 3O2JA 4DN6A 4MR8A 5JNUA 4OG2A 4XLTA 5TPWB 1K68A 1QQAA 1P8AA 1VLZA 3KS9A 5EWLA 2IPLA 4RXUA 5B3JA 3FFWA 3NNNA 3O1HB 4YGXB 3HSYA 1APBA 2JVJA 4G0XA 1ISRA 1ZDMA 2FMHA 3HZHA 4D74A 1DJMA 4Z4CA 4Z9AA 4RSMA 3LKBA 1TM2A 1DBWA 1U0SY 2A9QA 2IKSA 3OM1A 1PNTA 4RXMA 1QMPA 4FB4A 4Z4FA 4WT7A 4KNYA 2WY2D 1RPJA 1RXIA 4F3TA 5EWMB 3RVQA 2FXIA 2F8SA 3CZCA 3DLHA 3S99A 1I3CA 3Q7TA 4DADA 4H3KB 1JH9A 3OQOA 1NY5A 3RVLA 5JNSA 3ILYA 1SXGA 4QICA 9ABPA 5FBKA 4JB0A 5T7BA 4RK4A 4D6YA 2PL1A 3HCWA 4YLEA 5JNTA 4MR8B 4KVFA 2H0AA 3EAFA 3H5IA 3N8IA 4RXTA 4F06A 1XWWA 3C3WA 2Q5CA 3MA0A 1GUDA 3L49A 5CNIA 5BQ3A 2MSLA 4CBVA 5GQSA 3C3KA 4NQRA 1EFAA 1USKA 4MYRA 4OTZA 5DCLA 3RVPA 1PEAA 3HXMA 1TMYA 2R48A 2CHEA 2FEWB 4LZLA 4TN5A 3RVMA 1NXTA 2PJUA 4O5AA 1CEYA 2L19A 3C97A 3MIZA 3H5WA 4LDAA 4PEVA 4EY3A 1L5YA 1VRVA 2B1JA 4P1ZA 2LP4Y 3VNBA 1D5WA 3NBMA 2FKAA 1RXEA 2FMFA 3K4HA 4LDZA 1JFTA 1ZVVA 5JS1A 3CKMA 3QLTA 2FQYA 4EYGA 1YTUA 3QLUC 3GA5A 3UUGA 1E6MA 2IPNA 4LE0A 1JYFA 3HEBA 2FMIA 4RZSA 5IUNC 4UHKA 5E3JA 3BRSA 1RZRD 5EWJB 1Z2DA 3H75A 1NXWA 4N0QA 5GOTA 3FFXA 5IEBA 2FEPA 4QYMA 1ZH4A 3EULA 3H1EA 1USGA 4RV5A 3CS3A 5DTEA 3C3MA 3MM4A 4EVRA 5DGCA 3RQIA 2MYTA 4PYRA 3NNSA 5FWYA 1M5UA 3CRNA 3KJXA 1HEYA 4YP9A 4QYWA 1DBPA 2WJAA 1ABEA 1URPA 3MF4A 3HUUA 1DC7A 1H9CA 1TJYA 4EUKA 5KQLA 2FVYA 3CTPA 3N0WA 6CHYA 3O1JC 3LUDA 2L2QA 3G1WA 4ETIA 3DGEC 1BDIA 3E3MA 3GL9A 2FN8A 4KZKA 4RK1A 2H3HA 1LBIA 3SY8A 1PHRA 2MYNA 4N47A 1YMVA 1GUBA 4MR9A 2QR3A 3EODA 4XAQA 4PE5B 1NXSA 1PNRA 1F51E 4WXEA 3IP7A 2GKGA 3KLNA 3HVRA 4XASA 3W9SA 3FMVA 3M6MD 1MAVA 3VNAA 5IEJA 4KPYA 1Z15A 2X7XA 3F6PA 1SXHA 2MYPA 4MR7B 1U2PA 1RNLA 3EDCA 5D2CA 4PICA 3O2QB 3BBLA 3HDVA 3IP9A 4Q7EA 2PUCA 1DC8A 1FQWA 2JRLA 3OLXA 5FWYB 3LMKA 1OXBB 3RVOA 3HV2A 2FLWA 3A0RB 1OXKB 3HO1A 2PMCA 1DZ3A 2QVCA 5ABPA 4G97A 3O2SB 4ZMSA 1KGSA 2FSPA 4MGEA 1NXVA 1JFSA 1YMUA 7ABPA 3QX9A 2HJ9A 1KRWA 1Z25A 4LRQA 1BA2A 4RK0A 4Z9BA 4G0PA 3EJWA 3NHZA 1QO0D 4MS3B 4RY0A 4MQFB 4MR9B 3QX8A 2IOYA 2J48A 1BAPA 4OBBA 2FTKE 1LK0A 4L4UA 3QEMA 3QLVC 4JP1A 4RKRA 2JB9A 5ED4A 4NCBA 1E6KA 3CG0A 3H6GA 3JTEA 2FN9A 2WJWA 5JS2A 3OQMA 2A9RA 3HM9A 5KQPA 2B4AA 5TPZD 3CNBA 2PUDA 1P2FA 3QEKA 4XARA 1JHZA 2ZAYA 3LKVA 2NT3A 2E4UA 3NNDA 1L5ZA 3SNKA 1ZY2A 1P6QA 2LBPA 3IP5A 4LE2A 3OLWA 1JDPA 4MRMB 4WUTA 8ABPA 4S05A 2A9OA 3Q7SA 2VUIB 3R0JA 4TMYA 5EWJA 2P9HA 5KQGA 1ZHHA 4HNQA 4XXHA 3TD9A 1JF8A 5CNJA 3KG2A 3JPYA 3N75A 4N41A 3HK2A 3B2NA 2QZJA 1DP4A 2R47A 2VUHB 2IPAB 3OLZA 3JVDA 1BDHA 1EWKA 1A2OA 4MLCA 3I45A 3H1FA 2QVGA 4W5RA 2ID7A 3JPWA 3QELA 5T3YA 4E7OA 3P9YA 4YS6A 2FQXA 1K66A 1BDJA 3OMXA 4Z4EA 3QEMB 3OO1A 2YHAA 3HJFA 3T38A 4Z99A 4G0MA 4KQ9A 3RH0A 3UK0A 2W42A 2NZUG 2QSJA 1JLKA 2FEKA 4WXMA 1NATA 4NICA 1QP4A 3LUKA 2NZVG 2VYCA 2HQOA 2O20A 1LBHA 2QXYA 3RVKA 5IBQA 1JFVA 3IDOA 2PUBA 4RK7A 5TE9A 2RGYA 2I6FA 3BREA 5I4CA 3LUCA 4IILA 2FLKA 5C5EA 1ABFA 3QLUA 2ID9A 1SD5A 1YS6A 4N0PA 1B00A 3JS5A 4MR7A 3KLOA 1LJUA 2AYZA 2IPMA 2M1ZA 4Z4HA 1Z18A 3GBVA 3ROFA 1GLGA 1EAYA 5C5CA 3BRQA 4KK4A 1DRJA 1C4WA 2HQBA 4MAAA 4LX8A 2E4YA 4HYEA 5KI6A 4JA2A 3RVRA 3TO5A 2QU7A 3H5VA 4RKQA 3T95A 5HKOA 3F73A 3NHMA 1KMIY 3QELB 5DKFA 3CG4A 1ZGGA 2BGGA 1TVMA 1Z2EA 2IDMA 1AB5A 5FBHA 3M9WA 4JASB 2PUAA 5CNKA 3H5LA 1M5TA 3DZDA 2KYRA 4IRXA 2GBPA 5CNMA 4KRFA 4Z4GA 3KKEA 4MS3A 5IULC 4MQFA 1MVOA 1ZGZA 3DBIA 1UDRA 1XHEA 3M9XA 4OATA 1GCGA 4O1HA 4O1IA 2QW1A 4RS3A 4EYQA 4PZ0A 4NCAA 3ROTA 4ZPJA 1FFGA 4RU1A 1USIA 4JAVC 2RJNA 2WRZA 3FGZA 4ETMA 3LTEA 5IX8A 4KFCA 3O75A 5KWSA 3SM9A 4MLDA 3MQ4A 4KREA 4Z0NA 4P98A 1QNLA 1YS7A 4ZMRA 4Q6WA 3JVIA 2F8TA 1Z13A 2VK2A 4MPTA 4N03A 3SQNA 3TMYA 1Y1LA 4MRMA 4N76A 2ZWMA 3GV0A 4IGAA 4G0QA 3H1GA 5HSGA 2HQRA 2RDMA 5DLEA 5FWXA 1VPWA 3L6UA 3K9CA 3IP6A 4RK5A 3DGFC 4F8JA 4KK3A 3Q15C 2A9PA 1VKRA 4UHJA 3UKJA 4Z4IA 3CFYA 1NXXA 2WB4A 2V0NA 5IUJC 3RVNA 2GI4A 3MYYA 5BR1A 3OLVA 4MS4B 2CHFA 3GRCA 4G0YA 1Z17A 3HUTA 1ZH2A 2OQRA 2PKXA 3CZ5A 1MB0A 5KC9A 3N0XA 1GCAA 4ZJPA 1D2AA 5B3JC 5KC8A 4B09A 4EYKA 3F6CA 1EWVA 2GWRA 2MYUA 2QV0A 1J56A 1JX6A 2MSKA 3LUHA 3N6VA 4KQCA 4RWEA 4EYOA 4YV7A 5TQJA 3A10A 3KYIB 2HPHA 2R4QA 1W25A 2LPMA 3OQNA 1MIHA 3QLVA 3A3KA 1D1PA 1ISSA 2WMYA 2N9UA 4ZYLA 3H5TA 1EWTA 1W9HA 2IYNA 4RY9A 1JDNA 5HQJA 3N53A 3E61A 4XFKA
chains in the Genus database with same CATH superfamily
5IVHA 1YIDA 2JGJA 1CYEA 3L3BA 1J06A 1M8FA 2C7VA 2PKRA 2JK1A 4XYGA 4X63A 4I8DA 2D7JA 3KQPA 4YR9A 2HU7A 2Z8ZA 3KDSE 2VJQA 5I7SA 1IHXA 2I6SA 1U3GA 1W2GA 1GJRA 4LY0A 1E4VA 1XMJA 3DP7A 1Z06A 1DXHA 4DLZA 4AKSA 2HI0A 4QNRA 4QYIB 5KJEA 3UIEA 1SGWA 2NO1A 3IR6A 3CVYA 3SAJA 5C8XA 2EFHB 1NY6A 2CXNA 1PS8A 2WIFA 4L5BA 4TSFA 2Q1SA 3MCWA 4FOSA 5LIPA 3HUFA 5SYMA 2Q4DA 4D0LB 1XLTA 1YC5A 4ZHQA 4ZRDA 3MMNA 3BWEA 5DSXA 2X8WA 4M76B 2P78A 2CUKA 2DUNA 3EQ2A 1WPRA 1ZISA 1NW3A 1KJYA 5K0EA 3PXAA 2I67A 4ACBA 4YRKA 3NETA 4RVDA 4AJHA 1V4NA 3WDKA 5BWBA 5CHYA 1W35A 1LSSA 2CCJA 1O6BA 1D4ZA 2GD0A 1LD3A 3JQ8B 4DDVA 4H4CA 3DOEA 4MCJA 2RB4A 3AHJA 4ITRC 1DEOA 2AOUB 4FYXA 3EG9A 1N2JA 2XTNA 4X1KA 5FX2A 2C0PA 1GFIA 1LDGA 1S8FA 2D5AA 4J16C 1DEAA 1TOAA 3HVJA 3SBDA 1QVAA 5EIAA 1QGUB 1WCIB 1WWKA 4J0KA 2HJRA 4B4VA 4D2IA 1F9AA 3HNOA 4ZI7F 5ADUS 1KJZA 5DI9A 1IH8A 4R3WA 1MW9X 3NTLA 2IYTA 2B4QA 3ANSA 1AHHA 3K92A 3OJEA 4I9FA 4IZ6A 4PHFA 4WFJA 4MMYB 3RHZA 2X1MA 2HFJA 2RHHA 3AIOA 3KAQA 1PFQA 3O21A 4IF4A 4HAUA 1QKKA 2ZRPA 5I7WA 1NF8A 1O54A 1XE3A 2XQGA 3RTGA 3FOEC 5D84A 2ZSDA 3UMFA 1E18A 2Q0HA 2AEJA 2VP4A 3JV7A 3TW6A 3WLFA 3I64A 2A0KA 2FGJA 4FJ1A 4BP9A 4IHAA 1J8YF 3O95A 5BWCA 1VE9A 1UBKS 1HLPA 2J09A 1DG1G 2P1DA 1M0EA 1CJVC 2FUKA 3DCYA 2I2DA 4RX1A 2C3PA 2W6JA 4JVNA 3U13A 2WKRA 2ZAOA 4YRGA 3H2SA 1KMMA 1RCFA 1XVIA 1U0RA 2PH7A 1QIGA 3CKLA 4S1NA 3KJGA 1RLOA 1UBRS 2G1AA 2WT8A 3FZGA 3E9DA 3UMRA 5FPKA 1VHLA 1DG3A 1WA5A 2H11A 3FZYA 2PRKA 4WFKA 2VUUA 1PGNA 1Y5NA 3OCYA 3RT9A 3RT7A 1X7YB 3OQ6A 1MC8A 3CX8A 3VSBA 4DJTA 1T5IA 2PPVA 5BVGA 1T2CA 2JLSA 1G16A 3LUPA 1BH2A 1FBNA 1LWOA 2WWGA 4NESA 3HCEA 3T7JA 3A6FA 1MIOB 1OF1A 2ZRIA 1YNSA 4N3GA 1U9IA 2WWIA 4IDEA 3T1QA 1XNGA 3KHSA 1V5FA 2H31A 1XRQA 4OHWA 5H3HA 4UD6A 4O8ZA 5CT4A 2LKCA 3UF0A 3ICQB 4Y9TA 2PS1A 4L27A 5FYDA 3QBVA 2H9IA 2QHXA 3TSWA 2CLSA 5E1OA 4HDRB 5HJ5A 3C6QA 1XRSB 3CXUA 3UGTA 1Z7EA 3L2OB 3AW8A 3IA7A 1X9GA 3H5OA 3NHAA 4XTRA 2F1IA 2VTBB 3NIFB 4DIUA 3GLRA 1EFVA 1MAHA 1NW6A 3KO8A 1Z5UA 4N4AA 1GKLA 4KR9A 3LZDA 3VR2D 3ZS9A 3IV7A 4I55F 1C1HA 1V6AA 4NBLA 4DKJA 4HDQB 2O8BB 2EBWA 4KYUA 2X8AA 2F3RA 4MKFA 3U1BA 3RC8A 3X1WA 3BWDD 4CM8B 1IQUA 3G7UA 3Q3VA 4LFCB 2V6MA 1EUZA 4QPZA 4ARZA 3PI7A 2H4ZA 3OZTA 1JI3A 2RH8A 3VYTB 4CUJA 2ZCJA 3FVQA 2O7RA 4JSRA 5KSWB 4JLPA 1TI7A 1CJBA 1JIIA 4RJKA 2IOHA 1N33B 2GJ4A 4KLCA 4RXUA 1NVAA 5F2OA 1Y89A 3NNNA 3PHBE 4A1OA 1BRTA 4YGXB 5JVDA 3I04A 4AF8A 3JZAA 3FDIA 1ZGHA 2CNOA 2P5UA 3JD2A 4G0XA 1SZJG 1PIWA 4WZBA 1JAXA 5KYYB 5A62A 2ZUSA 1WUJS 3U0VA 1VIMA 5AM2A 1VKNA 4EGQA 3RIEA 3PEEA 2IS2A 4RSMA 4MWOA 3LYLA 1XZMA 3K8QA 3WHPA 1XC7A 4DLYA 4JLJA 2RARA 3U6KA 5K2OA 1HKHA 1RXIA 4F3TA 1PX0A 5EWMB 3M6LA 3CZCA 1BEZA 2AJLI 4DAOA 3HKEB 4CM3A 2EQAA 4DY4A 2EZUA 3OKCA 1XDUA 1P0QA 5B53A 2XSZD 1RMQA 2BFBB 3QIAA 3DXFA 5T8KA 2GSWA 2OO5A 1V1MB 2O1WA 1O4VA 3T3MB 3IIJA 4HLCA 1C0KA 2VJCA 1OJLA 3ISTA 3U16A 4Y8VA 3G7NA 3L5OA 3GF4A 2NLOA 3KQSA 3W4KA 2BTQA 1QIKA 2W6MA 3BXEA 3KEQA 3MUFA 3ZLUA 4B73A 3VH3A 5JADA 2D00A 2H1RA 2EP8A 4NQRA 4X66B 4O4JB 3E8SA 3JQ6A 3S2ZA 4LMPA 4YRNA 3B2QA 3NYWA 1TAGA 4NK5A 4B7ZA 4LZLA 2PXHA 4TRNA 1NXTA 1R6BX 2WAXA 4P53A 5FA5A 2Q9CA 4PIVA 3L0ZA 1IOVA 5I51A 3GZ4A 2QTFA 1GL9B 1IDN1 1JDSA 1Y5LA 3ICEA 4PWYA 1RQGA 3B6MA 3DLCA 2ZIVB 2FMFA 3NBQA 4R6WA 4LDZA 1XK6A 1S4QA 4RJ2A 4OK6A 4EG8A 3ONVA 1ULSA 2AUTA 2DPXA 2KQUA 2WILA 2ZOSA 3QHQA 3C7KA 5AOBA 2NNWB 3SX2A 5I4KA 3AP1A 4RMHA 1A77A 1S8OA 3BGWA 4FVTA 3G7SA 4S1VA 5B3KA 3UJAA 3ZV5A 4QVIA 3KZMA 3EH2A 3AUXA 5C53B 1WW2A 3OOSA 1AXEA 3ZCRA 5EHNA 4MWSA 4DSTA 2RJ3A 2W2TA 3KD2A 3VZRA 4DM7A 4R8LA 2MJLA 4GX1A 3AEZA 2X4LA 4COOA 2J1LA 2KE5A 4J8PA 2XA2A 3CISA 3ME5A 4F56A 1UMCB 3MM4A 4OFBA 4JKOA 4P4TA 1ZYUA 3KYDB 4UCWA 1LPBB 4X93A 3RQIA 3WGLA 5HUJA 3MTEA 1CKEA 1MRNA 2VP3A 4CG3A 1G6OA 3BXOA 3VYVA 2V7WA 5EIBD 3VMMA 2FPWA 3R6LA 5FBQB 2O3UA 3FGOA 4MVYA 2WA1A 4POOA 5AW1A 5IAGA 5LMUB 1O8CA 3K20A 3FN4A 2BHRA 2ZAMA 3AF4A 2XB4A 1XZHA 4EUKA 3HRHA 1TK9A 3K1AA 4JJFA 1DQPA 3JSAA 3E2PA 1UPBA 4KR0A 3B9BA 1C30A 1FW8A 4RMJA 3LVQE 2HPZA 2BYTA 3AI1A 4EVIA 3N7TA 4KZKA 1JEAA 1H3EA 5GJVC 1A9RA 1JHYA 3LXUX 1SU8A 4IIYA 4PXAA 3ZLTA 4HBGA 2A59A 2YVKA 2HYDA 4R2XA 3HDHA 2HB6A 3P4UA 3KVOA 1F51E 1CUAA 4KPFC 3RO7A 1SN7A 3GUUA 3DL7A 3W9SA 1RWXA 1L4KA 2XRFA 4EW1A 4M21A 3D8SA 4QUJA 3WB1A 4IXTA 3AR4A 1RJFA 1FFHA 3FJYA 2CD9A 4FNGA 3PXCX 3UQZA 2PRZA 4O25A 3NTQA 5JJLA 3AF1A 5E2AA 5SY9A 2BFEA 3FPLA 1L4FA 4YAWA 5DBOA 3U80A 4B6JA 3CJQA 2OY0A 4BGDA 2I7TA 2I6QA 2OZLB 3LY8A 4OQQA 4K26A 3RODA 4HC4A 2HWUA 4QO7A 1BS2A 3S1SA 4L57A 1DEHA 4GOKA 4J0DA 5JDIA 3HO1A 3ROZA 2GLTA 1ZZGA 3P2IA 3BXFA 1JGTA 1PQ4A 4FBGA 5BR8B 1K5DA 1Y1SA 4MGEA 3IEVA 4OLJA 5AJVB 1PBTA 2YWCA 5EIWA 5FP0A 4EM6A 4YECA 3BE4A 3ONWA 3QX9A 4JLOA 1Z25A 4XWGA 5JWHA 3MLEA 4JBYA 1X2EA 4W63A 3WP1B 4DR3B 1JPUA 2M6RA 4RY0A 1HNNA 5IDYA 3FJ1A 3OU7A 1JEDA 1FDVA 3B89A 4MGIR 2Z3ZA 3A04A 4LOLA 5E2IA 3S5UA 3UWPA 1OUMA 4RDHA 2UVDA 4UHHA 4H4DA 3V1TC 2Y67A 3OE1A 4BB0A 1NUSA 2O0KA 3HPQA 1Y3AA 1AF7A 1K6MA 5BYJA 2BFFA 4MYDA 2HW8A 2LBPA 4ARVA 2DETA 2HUPA 3WAKA 1ABBA 2ZJ5A 4ARBA 3U5TA 4BZPA 1YO6A 4Q12A 2G63A 1CQIB 4ZVPA 3D1VA 4DQVA 4F3RA 1UK7A 4Z1MD 5JU6A 4BRZA 2CVHA 3HK2A 2AOTB 3PXUA 1ZNZA 2OP0A 4NBTA 2W2LA 1DZIA 5FPPA 2PX3A 1LXCA 1DUIA 1U3WA 3ZJVA 4QG7A 2BRUA 1RCTE 2P6MA 1IUNA 1Z39A 1ODSA 2L0XA 3KVNA 3HYTA 3OWOA 3OJOA 4XSHA 1GNLA 1JEOA 1G5FA 5D6OA 4MP6A 1PWYE 1A5ZA 1R7RA 2CBZA 2EJTA 2B9EA 4BEVA 4C7BA 1M1YA 4L0DA 4JR2A 2FEXA 3RH0A 3GJ4A 1UQUA 1U63A 4TT3A 5FBWB 1DDOA 2AZDA 5JAMA 3WZMA 1ZICA 3NHJA 2WQ7A 2QD3A 3ZTYA 1AHNA 2GPJA 2QSUA 3DKVA 1GNQA 3HCAA 1P0PA 4M1KA 3Q7IA 4BO8A 2VNSA 5LXTB 1QIDA 3B3GA 1YRLA 4ZODA 4A1FA 1RI2A 1K2WA 1YQEA 3EWIA 3L7BA 3JS5A 4RMGA 3C45A 4OQPA 2Y05A 4H6WA 5L51A 2ZWPA 3TOCA 2TMDA 4DL9A 1E96A 1BQ4A 1V11A 1GKKA 3X2SA 4M1YA 3ZD8A 3ONFA 2AFHB 4ZO8A 4XM0A 1NC1A 4LGMA 2JW5A 1U81A 4G84A 2E37A 1UPTA 3GNLA 3SLKA 3VYWA 2X0JA 4OLFA 4XCQA 4KOEC 4KMOA 4F9EA 4UPDA 5JXJA 3DVRX 4B4WA 5DHUA 1M34E 1YR9A 2CN1A 4AVYA 4UM9B 3FE2A 1H9BA 3AEQB 4EMUA 4QJBA 3A3YA 3OPQA 1KSHA 4GRDA 4GT1A 3FPAA 2JJQA 2O5VA 3OUUA 4KH0A 4QDOA 1SOVA 2DSNA 2PX5A 4MNTA 3DEAA 1J8FA 4PLFA 1XFAA 2PS3A 3KKEA 3SBEA 1CDEA 1EXNA 5KUTA 5HFNA 4H1UA 1IY0A 4I3FA 1RC1A 2QTLA 1KO4A 5NULA 5KTRA 2B8TA 3DWGA 2ET6A 2BUCA 4X24A 1UBMS 1SHTX 4DIKA 4RL4A 1OH7A 1DC6A 2PJDA 1TC2A 2QUJA 4RCZA 3P2MA 4IBOA 1QCZA 4G6ZA 4IXMA 3ANXA 1YCHA 2WF7A 3QE0A 3WJAA 2B37A 1QNLA 5AXBA 3LKZA 1OU0A 4U9IS 5CT5A 3KUKA 4W7HA 1Z13A 4P84A 4B48A 1M2HA 2ORWA 2XKKA 2O3TA 1QHHA 3HA2A 4MKIA 3A1SA 4U7PB 1NN0A 2PNFA 5HIAA 2C3MA 5A3SA 3KOMA 2AE1A 4G8JA 3R7WA 4BE9A 2I7XA 1LSUA 1VYUA 1YC2A 4PW0A 2RHMA 5EC8A 1KJQA 2ATCA 5FOXA 1P3Y1 1T2AA 4KK3A 2IBTA 3FRJA 3NFYA 5CA0B 3CBQA 4PAOA 5D86A 1NPTO 1R0CA 3AYZB 4BB6A 3STHA 2A5GA 1G4AE 3RSCA 3SQXA 3GJTA 2CFCA 4I5EA 4U2CA 2JC3A 1DC5A 1M1NB 2CCKA 4F6RB 1HDRA 1IPFA 1Y5IA 1K75A 2QYTA 4AMUA 5M2QA 5C34B 3GVIA 4C14A 2J3QA 2XKJE 2VTEA 2R85A 3BXXA 4PG6A 1XZDA 1JWAB 4I3HA 3PC4A 4UQPA 4JJIA 5BN5A 3NKFA 5JSKA 3U4HA 4EYKA 5CLFA 5AW7A 2A0FA 1U28A 3OX2A 1NJ2A 3ELDA 1H93A 2HSDA 4LMBA 3GN1A 3DUFB 2NYRA 5TQJA 3CY6A 3KYIB 5KX5F 3WB9A 1BGVA 1MIHA 1BTOA 1NIPA 1ZCFA 1KERA 1MJGA 1T9KA 2FPPA 2R6R1 5K3AA 3RU9A 1IWBB 2ZRQA 1W9HA 2DCMA 2VTVA 3DEFA 1U8EA 3FTQA 3SFVA 3WMRA 4TX1A 1PGQA 5A4KA 3H17A 1VL2A 3QYPA 5JTTA 1OSNA 1RQXA 2GHTA 4UARA 3G68A 1T0UA 2GN6A 5HCUA 5HJEA 2GEKA 4NU5A 4RZQA 4UE2A 4C4PA 1MX9A 1XZLA 2IF2A 4MV0A 4ZO6A 4NF2A 2QL5A 2FW1A 2XQVA 3COZA 3V32A 3KOUA 1XMVA 1E9DA 3WQSB 3HO8A 2VDKB 2F00A 1Z0UA 2L17A 4ZKEA 3FUXA 4IFBA 2L18A 4BLUA 1F1JA 1CRLA 2BH9A 2CWDA 5FQOA 1OAOA 2O8EB 5TGZA 1OH5A 4JYBA 4PAGA 1Q1NA 4J6EA 1TUEA 4BX8A 4ZALA 5F21A 4EVQA 1MGPA 4ZZIA 4N3AA 4YPOA 1RRPA 2BFPA 1SCDA 1O95C 3B9RA 1KRHA 3IOCA 3IALA 3CZQA 1O6FA 2WNSA 1SXQA 1WB4A 3FWHA 2VT2A 4DXAA 2PK3A 5EWLB 1A0OA 2XCLA 4ARAA 1AKRA 5FA6A 3NOQA 2VT7A 2X0KA 3ADPA 3W79A 4GW3A 1AKWA 3B5IA 3HB5X 3I53A 3ZY3A 1ZSNA 3TPFA 4UEOA 5IJ0B 1K3TA 4GO1A 5JXGA 3SHTA 1JG3A 2CSUA 4RUKA 1KDOA 1Z3IX 1XZBA 2FW0A 3RAPR 1OOEA 1TJ3A 2H2AA 4HPWA 5J2UF 5FJJA 1KAHA 1RYMA 5IWCA 2NXJA 2Q7DA 2QA5A 1X8KA 3DD5A 3OPYI 1FSPA 1JU3A 1RPZA 5ALJA 3PD1A 2DWOA 2WYUA 1SHKA 4ZC8A 4PZPA 2ZQ5A 4X54A 5F7JA 4DIEA 1XZJA 4CM7A 1HC7A 1HE3A 2UZAA 3RF7A 3N2GB 1E3QA 3TLGA 5LBIA 4JT4A 1XX6A 2XHEA 2Q6OA 2RKBA 4P0TA 4TTAA 3WL4A 2GJKA 1E1QA 1ZITA 1YCGA 3ROPA 3ZGXA 1V3TA 4YRSA 4YRZA 1T9CA 1AS0A 3TX2A 4KSYA 4D42A 1INLA 3GDHA 1JMVA 4B6FA 1OI2A 4F6CA 4BQFA 1MPXA 5B6IA 1JG4A 3STXA 4WN9A 1EX7A 1GGEA 3EMBA 5FAKA 1FX0A 1D07A 3ODPA 5IJXA 1B1AA 1DNPA 3O8OA 3CPSA 4QUKA 3MD0A 3V2GA 5BXYA 5DNVA 4ZV9A 5L45A 5KVAA 1DCKA 2RI6A 2NN3C 2O8CB 1SPBS 1W52X 2BDEA 1XJQA 3PT9A 3QKWA 5GGYA 4BLOA 2P6UA 1NE7A 4ECAA 2WM3A 3S7TA 4D0GA 4BU0A 4NEGA 1KH2A 4KWEA 4U6QA 1GPMA 2BVNA 2IBSA 3JARA 5J23A 1NAHA 4KO8A 4TTSA 1QC5A 2Y68A 3IUEA 4MW2A 1PWZA 1TM4E 5KMGA 1ZJZA 3WWYA 4XSGA 4QNNA 3OC0A 3FTFA 1WKBA 1IM8A 1ZRMA 3PHJA 3EVBA 1IY2A 1V1RA 1IE3A 4I9UA 3SJAA 2QRKA 3PTZA 5EJMA 1KDRA 1FUIA 5JXIA 3SJBA 5BWNA 3ELUA 4FP9A 4BNUA 4A0QA 1YUBA 5EJ9A 4BDTA 3HNPA 5CCBA 1W6UA 2DSTA 3U4GA 4BP1A 1E5QA 2JJ1A 2UZ0A 1V8OA 2DPYA 1G3UA 1SB9A 3DFMA 4MYSA 1RYNA 4F3NA 2C99A 1ZN2A 4KWCA 4H16A 1A1SA 1DJOA 2QX4A 1FRZA 4A7PA 2PCJA 4U7FA 2PV0A 2ENWA 4TUYA 2C5LA 1FW6A 1G55A 1NBAA 1OVGA 2Q2NA 3COPA 4MJXA 5PNTA 1T3LA 4GKVA 1FRNA 5FL3A 3ETJA 5DMXA 5TQ0B 5F7OA 2ZJ6A 1FRVA 3D8HA 2UZIR 3L8GA 3MWFA 4KN8A 4MVJI 4WA8A 1E94E 5J4VA 3ADOA 1T4CB 4I50A 1M83A 4NJMA 3MMPA 5A7HA 1RAGA 1U4OA 3ADKA 4I3GA 3E9QA 4B4KA 1YZHA 5T4HA 2QF7A 1NVMB 2OGTA 3B78A 4FMCB 5EPEA 3VYSB 3NOXA 2HHCA 4PYNA 1GYPA 3AI7A 5CK5A 1DJMA 2RC5A 1KP3A 2XT6A 2XWPA 3ECCA 3NKVA 3OHMA 4NE7A 4OMCA 4YNBA 3WLNA 5EJ6A 1IXYA 2YOGA 4EPTA 3B1KA 1N6IA 1DQZA 4RXMA 3IVCA 1RC0A 4Z4FA 2YVAA 4QFCA 3VDMA 3QWHA 3T35A 4J7AA 3U1VA 3V4OA 1KORA 3RUDA 2QPOA 1K98A 2CGEA 3TBFA 1EFPB 1H0KA 1P7CA 1U2ZA 2IT1A 2X0NA 1HK7A 3H4TA 1G5PA 3S99A 5L3VA 3MTGA 1I3CA 4GOOD 1RYDA 4UCFA 1PL0A 2OFXA 5LWHA 3JZMA 4TS1A 2F3QA 3OURA 1FMTA 3ITEA 3TLCA 4R1OA 1L2TA 3NIDB 4FYHA 5DW0A 2GD1O 4Q4AB 2WF5A 5I9BA 1A98A 4QGAA 2PX0A 2Q6VA 3OIVA 3LVBA 4GI1A 3RV3A 1KHHA 4DMMA 2JIRA 1O5IA 2X5NA 4PFJA 4TYPA 5IYZA 3V9PA 1KI2A 2FPIB 4C30A 1NRIA 4RXTA 2HGZA 4WCFB 4CQMB 4RA9A 4R8MA 4B6RA 1VJRA 5B58T 3CLRD 1W46A 3UHJA 5A3JA 1HLGA 4I81A 4R1SA 4FOOA 1IB0A 4ZAVA 2YWBA 4G24A 2AQIA 4C4XA 4B6SA 3O9VA 4RTKA 4PIMA 2QX9A 1H5QA 1VCOA 3GRYA 4EEXA 1W1IA 2VH5R 1TMYA 3H2HA 5HHTA 1LQTA 3AETA 1ZMXA 3KOWA 1KPHA 1P75A 3LBNA 3P5BA 2EBHX 1U6IA 1AHPA 1M3SA 3U4IA 4O4HB 4EABA 3TZCA 2G3YA 3R8CA 4ZI3A 3CW2A 3VNBA 2WSMA 4U7WA 4XDGA 3REQA 3UC5A 1NQOA 1M75A 1OGYA 3NC4A 5EMLA 4DEXA 4EKIA 5BR7A 3G2MA 4Y2JA 3LP6A 2CY0A 1FTNA 4JP5A 5HE8A 5SICE 1B14A 4IX1A 1X94A 2ZK7A 2ZT6A 3WBFA 2HNKA 2ZYHA 1HSZA 4AD8A 5HUHA 4C21A 1CEXA 4IF6A 1C81A 3HEBA 4P5DA 4QOJA 3PV0A 4OHVA 3FM9A 1ORTA 3ZHZA 4XVQA 2AC7A 1P5ZB 1Z4QA 2EW8A 2XUKA 3QMPA 3SBXA 5LDHA 1YBMA 2WAMA 4JB3A 2RK4A 4LHEA 1YQUA 3R7FA 2DERA 4XH9B 4EBBA 2AMFA 1A7UA 1GTJ1 1TRKA 3BMNA 3H1EA 3I1JA 3S1AA 4A8JB 1H2YA 4RV5A 5P8WA 5DNYB 2JGKA 3OX4A 1A9YA 1T25A 3TKLA 4EUSA 4RTQA 3QVGB 4RC9A 1F20A 4OMFG 1FDRA 1LLCA 3IS3A 3V3KA 3NAQA 1PD1A 2WDZA 2INGX 4OL9A 4BNKA 2GBGA 2ES4A 1EM6A 1EQ2A 2UV8A 2GYWA 5ALHA 1O77A 1DS6A 2QUAA 1Q1ZA 2F8LA 2W6CX 5CR9A 5FTLA 3PR1A 1TU0A 4P38A 1K92A 2DE0X 2OK7A 1RJGA 1YZQA 3ZE6A 1MOSA 2JGNA 1KS9A 2ACWA 3QBDA 3NG1A 1T6BY 2CJWA 4LXXA 4E2WA 2NTVA 2EHDA 2O2GA 1ZA2A 4XRGA 4AKHA 2FK7A 5CT9A 3JQ9A 1MB9A 2ZAIA 2H2FA 3BMQB 1ZM9A 3IP7A 3R1IA 5HCNA 3C8DA 1KKMA 1QDUA 4ACAA 1NF9A 1MZPA 3N2NA 1HE8B 1UPFA 3ICCA 4GBJA 2X76A 5G0WA 3QWAA 1QTNA 3U9TA 4J7UA 4IOMA 4ZDJA 1SA0A 1YL7A 4I9HA 2IV3A 2NVUA 5K8TA 1X1TA 2WFAA 3QPBA 3L18A 3C7AA 3GNQA 1BQEA 1H1LB 5KOYA 4YHHB 2R11A 4HMQA 3M3PA 4R1UA 4G0UA 3BWVA 2M6SA 4AUKA 1F0KA 4FQ8A 1P77A 1WQ1R 2UYHA 2VPTA 4ZT3A 2GTHA 1XSEA 4IJVA 1RE0A 3AHEA 3JALB 4TLBA 5CTAA 5ABPA 3PENA 1NXVA 1G98A 1R6DA 2VPPA 1YMUA 2VP0A 2YFQA 3FMGA 4LYJA 5COBA 5CXXA 1MXHA 5KYWA 3KV1A 2G5GX 5DTJA 4D9CA 1JQDA 1LVUA 1UKBA 4LKOA 1J7KA 2NQTA 2OV4A 3K53A 4O2AF 5I4BA 1X2BA 2ZKLA 4MS3B 4JVSB 2AXNA 1BZYA 4FD2A 1B0AA 2P27A 3CZPA 3SZRA 1MA0A 1WUTA 2QTTA 1OA0A 2D74A 2OE2A 4UKDA 4DWOA 1E6KA 1DOHA 2IYZA 3BWXA 3CG0A 1JLHA 3LLCA 2OO7A 4M99A 2HSWA 4MIYA 2FN9A 2RBGA 4ZEXA 5JT1A 1RWMA 3TRDA 1UOQA 3JR7A 2ODTX 4YRMA 1Z4NA 4OSEA 2GS9A 4NX2A 4R1NA 2JKVA 3EMDA 1ANKA 1UMDA 1FSGA 3PZRA 3QY0A 3BM5A 1T1IA 3GEGA 4WUTA 2QTMA 5T57A 5H3LA 5EQDA 1D0VA 2GNAA 4IH4A 5DGXA 3U4AA 2BGNA 5BMVB 1JB1A 5KCMA 1WB6A 1OIVA 4HNQA 4UMDA 1C1XB 3TR5A 1Y33E 4CI9A 3HJUA 5EE5B 2I33A 2VBCA 3SJ7A 3FNRA 4A27A 4Y2SA 1Y3FE 2WMDA 4QXAA 3B2NA 3VPHA 3HB0A 6YASA 5EJ2A 1MVLA 3WK6A 4EQ6A 4ZICA 2PH1A 2SCUB 3OCZA 1BDHA 1I6LA 2IXTA 1J2JA 2VA8A 4ZVOA 1CU1A 1NSYA 4BKMA 4PRZA 4W5RA 4R71A 4RV4A 2QU8A 4E7OA 1ISHA 4FMDF 2Z8YM 1YR2A 4YS6A 4AG5A 4YAOA 4HTAA 5C1OA 4AY5A 1Z2NX 1KZ4A 1R1DA 1U9ZA 2G06A 2HD4A 1E1CA 4EB6B 3INTA 1QIEA 1WIWA 1WNTA 1V39A 3CIFA 3LYAA 4FD3A 2C7PA 3UWSA 2JZOA 4RANA 1WXGA 5BQ5A 1QK3A 5K3SA 3RVKA 1JKJB 1N8NA 4EPWA 3G88A 1SCQA 2FWPA 3CF4G 1JHMA 3LUCA 4RQBA 1V7PC 5DDIP 4ZQIA 1P62B 3D43A 4LJ6A 4Q15A 1Z8DA 1VMIA 1XO1A 4Y30A 2DU8A 4UMFA 2M1ZA 3NKLA 1ZKDA 2ORVA 4WXPA 3DL0A 1EAYA 1JIKA 1GLVA 1NF2A 2FSIA 2WV9A 3E4DA 3JVUA 4KTTE 5DBGA 4I1YA 1LW6E 3LPCA 3X1ZA 2VDMB 2ZRFA 1NNUA 3P96A 5TSDA 4PGMA 4LX8A 5AK3A 5C8YF 1A4IA 5EG5A 2BF7A 3V8PA 3ANMA 3DAYA 4GBMA 2OKCA 4OY3A 4EA8A 3S8YA 1ESMA 1Y9EA 1QQ5A 2ZRLA 1EI9A 1GSAA 1PWXA 3FNEA 4TRMA 2QNIA 1XVLA 1TUBA 1NVKA 1TZMA 3COVA 3H5LA 3A9CA 1DIRA 4NBSA 4M54A 3VU8A 2FOIA 1U2GA 4G1MB 2P90A 1M6WA 4IFIA 2GCIA 4EG3A 2B1QA 1WZIA 5MDHA 1EXWA 2ERYA 2WU8A 2A7QA 1A8QA 3QU5A 4G8DA 2BEKA 4D3XA 1IOLA 5K8VA 1V9CA 4RS3A 3BT7A 1XDGA 3F6BX 2O05A 1YR7A 1QMGA 2I4OA 1FRFS 4WNCA 3RSHA 3S55A 3T94A 3ESRA 3W2EA 1ULTA 2W8ZA 2ZSFA 5CRIA 5BNFA 1WTCA 2JLRA 1VBFA 3FYSA 4HAIA 4PNZA 4QIHA 4EW3A 1UJ4A 1KYIA 1ZW1A 5IAJA 3K15A 5KWIA 3SQDA 2CSXA 2HH9A 2X8BA 5I3CA 3M8KA 4ZOEA 4UBKA 4UEQA 1N5JA 4XB2A 5L7WA 2ZFUA 4L75A 1OW3B 4EPXA 1FC0A 3TMYA 4QDTA 3JXEA 3P0EA 1X8LA 2YHSA 4RYDA 1J2RA 3B20A 1ZM2A 3O5AA 3SC3A 5CEEA 3R8FA 2A9FA 3D6HA 3QPVA 5AHOA 3R0QA 2NMVA 1FEZA 3OFSA 3QKIA 4H1TA 4IXNA 2VJOA 5CT6A 4K03A 1TFRA 3SDZA 3KE8A 1B26A 1FQKA 2X86A 3WKBA 4AZ3B 4DDKA 1CIJA 3T7IA 6NULA 1H65A 3F9CA 3QKSB 2JHPA 1PGOA 1R6AA 3RVNA 1F5SA 1GQSA 4UTNA 4ZARA 4Y67A 3RFXA 1R18A 1SUIA 2Z9BA 5CVEA 4LNUA 4GE3A 2PKXA 5B1HA 4Z7JA 5AW4A 3CZ5A 4IAOA 3FNBA 1RIIA 3TR0A 5FOQA 2GUGA 4RO0A 1UP4A 3N0XA 3I30X 4KE7A 3OZFA 1YJCA 1T8YA 1RKBA 1DRUA 2NTYC 1L7OA 3RFTA 4NVRA 5M5BA 1EVYA 4MV1A 2QLNA 4H6VA 2J0VA 4DR5B 4KRYA 4MPDA 3DAHA 4I5IA 3GR6A 3A10A 1XRRA 5JFTA 1K86A 5ADHA 1LVGA 3DE7X 3EE6A 1ZWLA 3CLTC 4TSKA 5FFNA 2FETA 2PMKA 2X3FA 3TIFA 1NHWA 1YZVA 1D04A 4DABA 3PWTA 2ZYIA 1PHPA 1QKJA 4PBSA 4Z86A 2BFDB 2FSFA 4XW2A 4Y1RA 3TMKA 1PNRA 4IIJA 3AM1A 4AKIA 1AHIA 1N57A 4GC9A 4AIRA 4DR2B 3HY6A 5CBPB 1R8JA 3WQRA 3HU1A 1OX6A 3HP4A 3M2TA 3MAAC 3H2YA 5F2NA 1Z3CA 2P3OA 1J8VA 3R3WA 3BWBA 4G4SP 4TM8A 3WNCA 3KQWA 1I14A 3UN1A 3ZQKA 2ARKA 3C1AA 4X20A 1P33A 4FOTA 4CKBB 1BHJA 3WGKA 3PNLA 3EQZA 4M8KA 3CLKA 4RGQA 3RWBA 1NVVR 2DVMA 2OAEA 2JLZA 1PVOA 3TB6A 1T9GS 3D6AA 1ZO8A 2QMQA 3FWYA 2RKWA 1V43A 3PDIB 3Q3IA 1W0JA 3NWEA 2D3WA 1X74A 2FPLA 4W9NC 4EVSA 1ML4A 1ZWKA 1EGQA 3D4LA 4RF5A 4XUEA 2WYWA 1J9EA 2DF8A 1AD2A 1KI3A 4ND4A 4CQNA 3M4XA 1G19A 2QN6A 1ACJA 4OGFA 1R15A 3LLUA 4E7PA 3HVUA 3NYQA 4UDNA 2K7ZA 5BRJA 2NV2B 4MV4A 2A1UB 3PNPA 5KNCD 3T0GA 4D8WA 4JOQA 2VCHA 1LFDB 4ZOBA 1X9IA 3DV2A 3ILHA 4BWYA 1BX0A 2WZDA 1S7CA 4UATA 3UA3A 3V97A 5IG2A 2I9KA 5TB5A 1KZ9A 3EFBA 3DMNA 1GZVA 1D4OA 3D8UA 5HJ7A 1BYIA 1JZSA 1GA6A 1XHFA 3CO0S 3L77A 3W5CA 4FEAA 1N78A 2HV8A 4KV7A 4HGYA 3FMIA 4WSOA 2CUTA 2I55A 4MWCA 4D80A 3GJ6A 3M70A 3WB2A 3Q3GE 3BRWA 1Z0SA 3FSRA 1F5NA 1SHLA 2BAGA 4GOXA 4PAMA 2ADOA 4C0LA 2CFTA 3JVEA 1ZNQO 4ZI7A 3IMGA 721PA 2XNKA 1ITZA 3DYBA 2MSEB 4RTNA 1HE2A 4YR7A 1NU8A 1L5QA 2NNLD 3GPDG 2C9CA 4EGSA 2B20A 2R5FA 3L6EA 4US1R 1X1RA 1DWQA 4PHCA 3BICA 4Q3DA 3CW8X 5IWAB 2R7LA 2X2PA 3EGEA 1M2FA 3V3TA 1WTAA 3DE0X 1E6LA 1VHJA 2HBRA 3L01A 4X1IA 4E0BA 4MS4A 3CZMA 1OBFO 2WA2A 2QMZA 4FMBB 4FI3F 1F4VA 3HDGA 4V0MA 3RIXA 3ESYA 3CJTA 1F2UB 2OLJA 3CH7A 3GDFA 3SBOA 4I4LA 5EJFA 4Q66C 1L7AA 1Q3TA 3FCAA 3P9SA 4EJ6A 1JG2A 1QCYA 2RHJA 2DFNA 3BSYA 5LYJB 2XWBF 3K31A 3K70B 1VA5A 4JHXA 2GESA 1BXGB 4LTMA 5EGNA 4ZJUA 2CXRA 1O0SA 2F3UA 2QT1A 1JEEA 1WDMA 1CIVA 3N3BC 4LY6A 4OUKX 4MVJP 2X5KO 2X14A 3IPAA 2HLDA 1X1EA 3QSGA 1R0WA 4NI5A 5HRAA 4GM1A 1P18A 1E9FA 1YB5A 5FOTA 2V97A 4XX1A 4YT8A 3ZWCA 1ZK1A 3VDQA 5BYAA 2ONZA 5KYKA 4GQBA 1F8YA 4DNXA 3IAEA 1K8QA 4EITA 5G2OA 2IJGX 3CN7A 1WCWA 3IE0A 5K0CA 4OLBA 4OQFA 3IHWA 4FWIB 2M2IA 3SIPA 2GF9A 3CF6R 3MWEB 4NABA 3WZLA 2PGOA 5L8VA 4OLAA 3CRRA 5CB8A 2AN3A 1S02A 4CR8A 2V65A 3G5LA 4MS1A 4R3NA 4B3JA 4YMTA 4QKQA 1ZHOA 2Z5GA 5IDQA 1B3BA 4MARA 4DCGA 2F4VB 2G28A 4YMWA 2C77A 4BCDA 3SKYA 4JHLA 1MAUA 1Q6YA 3UEOA 3LT2A 1UDCA 3R9IA 4EZEA 4JJEA 1R00A 4HDSA 4YRJA 2AQHA 3GEIA 3KL2A 3MWKA 2LV8A 5KVVA 5BVGB 3H7IA 1E1RA 2WU3A 4AB1A 1VLZA 4DRYA 2HN9A 4MV6A 5DOVA 1WPXA 4OHZA 2F17A 1OC4A 1K6JA 4L76A 1K89A 4Y2YA 2OXFA 5FHQA 5HXAA 2I03A 1TEXA 5LLTA 2EKZA 2J0UB 4X61A 2FWAA 3KYCB 1A69A 1MHPA 3UK7A 3Q2KA 5JCPA 2ZJBA 4P82A 2GN2A 2O2YA 1VE3A 3VISA 1RMYA 3GT4A 2P9FA 1WW8A 4DILA 4EI7A 3A05A 1XG5A 1ZOSA 3MRXA 3OMLA 3VPDA 4WT7A 1PV4A 4HYQA 4YBZA 2H9YA 2XVZA 1I4EB 2C5HA 4EGFA 3QUBA 5IVKA 2QNRA 1Z38A 1GPLA 2BMEA 3JQEA 3MYRA 3ETGA 1TLLA 1V25A 2I3ZA 1WZUA 4JC8A 3EEOA 3IH5A 2WYOA 2WVGA 1QYIA 3GLHB 5GAJA 3O7WA 3RSOA 3VZCA 4C87A 2R6HA 3RNLA 3BJMA 4DPLA 3TZHA 3C3CA 2ZRDA 3Q4GA 2E18A 4C5BA 5KTMA 1S89A 2BHTA 4E2ZA 1G8HA 4CQMD 2NPFA 2G5TA 4FHEA 5KOJA 4G1BA 4QHYA 2O4CA 2QP9X 3UG7A 1TMOA 4DIOA 4BZZA 1XWWA 1L7MA 4CV1A 4NCNA 2H4WA 3B6IA 3CVWA 2MSLA 3L8ZA 2Q3MA 3QPUA 5AJXA 3K1TA 2E49A 4U39A 2OYSA 4X6UA 2AS0A 4EKNB 1QGAA 4XQ9A 4M6WB 2R48A 4XYMA 3CX3A 4YQFA 2YXNA 4LISA 3RS3A 3NMUF 4E3ZA 3GRVA 3HL0A 1O96B 2X0RA 1SIOA 3O9ZA 4PNPA 2GKOA 4FKMA 2QZPA 1CEYA 1E64A 2B1JA 2C03A 4OIMA 4RFVA 5GOZA 2BELA 1G5QA 1BGWA 1SO8A 4JJKA 4LQLA 1I10A 3T9BA 3WP0A 4C4OA 3A2KA 3WK7A 3W1EA 3QMVA 1L1QA 1WUYA 5BVHB 1JLLB 1BFDA 1B43A 2O07A 3QLUC 2DEUA 1XNRB 3UUGA 2YHIA 4NH0A 3WYEA 3DDCA 1EEXB 3IIEA 4N54A 3URKA 2OQ2A 5CA1B 3LPLA 2ODPA 3GCZA 2J5XA 3S8MA 4UHKA 3T1YB 3D3NA 3ZIAA 2CVPA 4JI8B 2FPOA 4FUTA 1P5RA 1NXWA 1PR9A 2G08A 3H75A 1FNBA 5IEBA 2NSLA 1PTJC 3GPIA 3HCRA 4KHZA 4MGZR 1Z8NA 5K3EA 3PGKA 3TLMA 3TTYA 2HY7A 2JCVA 2A67A 1A5TA 1K63A 5DP1A 2MDTA 1SUAA 4D8YA 1WMSA 3TUJC 5JXHA 1M8KA 2ZE6A 1UJNA 3WLTA 3EPKA 2PR2A 1URPA 2OCAA 1QGDA 4Q19A 1UPXA 5LJIA 4NNJA 1KZGB 3RSGA 3VJLA 4Y2GA 2FVYA 1E3WA 1CE8B 5A0VA 3TIXB 1AKUA 4X84A 1M34B 1M72A 2BGLA 3EYWA 5E9WA 3ZPXA 4ETIA 4B5LA 3K1YA 2V59A 3PXDA 1E7SA 1H8EA 1XCLA 2REBA 4G4SO 5REQB 1PR1A 2FFJA 4N47A 2XJ9A 3SY8A 4ER0A 4JSTA 2QL9A 2VRWA 5GWXA 3EODA 1HMPA 2X3YA 4WXEA 1N5KA 3L40A 2WF9A 1GTVA 1EM8B 4MGHA 2XYHA 2Y4NA 1XJWA 3BD9A 4KXYA 1JNYA 3A3NA 3GDWA 1OWLA 3TQCA 1JKXA 2OV6A 4PLVA 3VI3B 1T3SA 3BZUA 2YXBA 3CSUA 1FLAA 4YAEA 1G8SA 1T8RA 5D2CA 2DWQA 5DEOA 1YAHA 4WKOA 3GZNB 3IP9A 2CFIA 2XDQB 4RETA 5DXFA 5ARDA 5J1TB 4C4RA 1AK9A 3G2LA 3U7JA 4W7IA 3PGVA 1AN9A 5FBRB 2HRBA 1H1TA 1ZJ4A 4D45A 3QFTA 1OXBB 1Z0FA 3HV2A 3HUDA 5J3JA 2R62A 1C9KA 3SHQA 4K6OA 2XQJA 1ODLA 4ENPA 3THYA 5C7IO 1WG8A 4HEQA 4M98A 4Q05A 4PSAA 4JI0B 2CHUA 1KYQA 1U2RA 3P0JA 3MWDB 1JFSA 3TK1A 3IVRA 4ND8A 3B1VA 2OGUA 4M55A 3ND8A 1EE2A 3G9QA 4P4NA 4BFYA 2WKWA 3R9XA 2IYAA 4Z9BA 4YIHA 3G2KA 2BEUB 3FKSA 3ZVLA 4MR9B 4I4IA 5KTNA 1FFXA 2GBLA 2A84A 1X80A 1Z74A 4FEEA 2XE7A 3TXYA 4LQDA 3R5FA 5ED4A 4YUVA 4TYMA 4LRSB 3TLAA 5GTDA 1JIJA 1QAQA 1V48A 3ZDFA 1GA1A 2O2EA 3DT6A 4YASA 4ZV4A 5K05A 3MBIA 1P0CA 2OTCA 2H65A 1P8JA 2JEOA 2OHFA 2QTCA 2ZRNA 4H0NA 4ZOCA 4C6TB 3G79A 5TPZD 3D4OA 1A96A 5CVVA 4KXXA 5EUQB 4LXIA 2WHXA 4DLSA 2G9QA 2OC9A 3SSMA 4CGZA 2ISQA 3KJHA 2DH6A 1XA4A 3UWOA 4KPGA 2VZ8A 2ACVA 3FHJA 3BAFA 4Q9DA 3TTXA 4AU1A 3RLFA 2IS1A 1XNQB 4GF5A 3MK31 3MWJA 4AUMA 5HILA 5H68A 1JQ3A 3NH9A 3GUZA 4GXRA 4L7VA 2WUGA 1P2DA 4F5ZA 2IS6A 1ND5A 4GG1A 4EECA 1FMJA 2J5BA 1OU4A 3EBLA 4WV3A 2GPSA 1NYLA 3U4MA 2F43A 4F5WA 2CJXA 1KAGA 2WZCA 1YMQA 4QEZA 4ZVLA 4N7JA 4WZAA 1E2NA 1W34A 4F46A 3QX3A 1PV2A 3C6KA 4RZIA 1RJWA 3W6OA 3WWPA 4UBJA 3H05A 1K0FA 1I94B 2C8JA 1GG2A 2K87A 2XUQA 4EY7A 1DQSA 4LXHA 3O4GA 4QPPA 2FG5A 2QYHA 4HNAB 4Q1FA 4BAUA 2E4AA 3I5YA 2V6JA 2V7QA 1X42A 4KDFA 1JFVA 1FX1A 4GMHA 2DHRA 4LYFA 2I6FA 3ZY5A 4E88A 1U7TA 3F3KA 4DGSA 3KTAA 2WNIA 1KK0A 3ML1A 5J9FA 1U0LA 4U7TB 4E5KA 4ER3A 1LJUA 2AYZA 1DTWB 5LZ5A 2CDAA 1BJKA 2JEYA 1F48A 1LTHR 4XVCA 3BRQA 3OJCA 4KP7A 2X3UA 1EHYA 3G6KA 3OPYA 1KJ9A 4R2WA 4EHDA 3NT4A 2V5AA 3GHYA 2XNHA 1RM5A 4LPKA 5KI6A 3VKWA 4JA2A 3RJTA 5L3SB 3HBMA 5KPDA 1V7CA 4GH5A 2PSEA 1OZGA 5FI5A 3AX6A 5ER6A 2CDCA 4N6NA 2BDUA 3L02A 2CUNA 1ZGGA 1CB7A 1EFCA 1DKRA 3OOYA 1GAWA 4UE6A 2HRDA 4UOEA 4N5NA 2P68A 1O6ZA 1GO2A 1DVRA 3WK4A 3EWAA 1D2NA 5I9IA 2XKAA 1PFVA 4JLMA 2UUAB 2C4HA 4PHHA 3LA8A 5AD1A 1LB1B 2WHRA 1ICIA 3BIFA 4YAFA 5CH8A 2GBPA 5CNMA 2AQKA 1WDTA 4CLRB 4X7BA 3L1VA 1E2FA 2G4LA 1Y8AA 1SCIA 3VDNB 1CVIA 4BO0A 1P1CA 1CQWA 4Y2QA 2EKDA 3SYRA 1MQSA 2AUMA 4OATA 1UDRA 1H85A 2UUCB 4FGZA 4I46A 1XMQB 3L7AA 1TEHA 4X91A 1NBOA 3QKRA 2RGNC 4URZR 4K3UA 2X0DA 3ZR4B 4KQ6A 4Y6GB 4IHJB 3RDPA 4MTLA 3TGWA 1GN8A 3AFNA 3MGKA 3L0PA 2PGJA 3EF1A 4D9GA 2ZSKA 3AG6A 3ESXA 3GN2A 4H1HA 4P98A 1YS7A 2Q6KA 5J4YA 2F8TA 1W4AA 1RRVA 4EENA 4FEYA 1YL6A 4BUJA 1AJEA 1DAIA 2QD4A 1ODFA 2R84A 4Z8XA 4ATNA 4N76A 4GIBA 4URXR 4GS5A 3VU3A 3H2GA 3OQIB 3PI6A 4LG1A 4RSHA 4OIFA 2Y27A 5IHXA 2GFQA 1E99A 4GQAA 4LZAA 4QHSA 3KB1A 3F67A 1KI8A 1SUSA 1NXXA 1IEQA 3E35A 1EGHA 3PKZA 1FB5A 1TQ8A 4BDSA 4HWOA 2F2TA 3EYAA 3I01A 2ISSD 4YP1A 2NPIA 2PBLA 5ADWA 1R4ZA 2OQRA 1ZOOA 1JDTA 5DGDA 3WYAA 3GLIA 3CEPB 4CMGA 2NVOA 3P52A 3WGGA 3RYCA 1U9JA 1KZ6A 1VPVA 4S2UA 2PM8A 3AV3A 2XBUA 1U6KA 5F35A 2P4HX 4TZTA 4WPGA 4EYOA 4EH1A 1I6MA 2OBBA 3HA3A 4LSGA 3AILA 5IPFA 1LF0A 3ZWDA 3ZU5A 4JKIA 4YCBA 3BOSA 5LXTF 3T7CA 5FDFA 1OY1A 4MV7A 3W3AH 1K5GA 4RF2A 5K6AC 5KX5A 4QA9A 2GZMA 1U02A 3DB2A 4L8LA 2YX1A 3SEAA 4BKPA 1T2FA 1G0NA 5TGTA 1Q0QA 1YBHA 2GUWA 3G2JA 4TKVB 4BFVA 3FLEA 2P2YA 4P3OA 2XZOA 1MU0A 2P67A 1WMEA 2QRVA 4TL6A 3E0XA 3QY9A 2JJ2A 2LDXA 4UDXX 3F0TA 5I5EA 5LQKA 1O94D 2SBTA 4WLNA 1NT4A 3VR4H 3IAS6 4HRXA 3ZK7A 1MX1A 1KYYA 4LYEA 4CLOB 2GARA 1KNXA 4HUJA 4ZI5A 3EXHA 3R4VA 3H11A 1RRGA 1EP2B 2JGRA 4TXJA 2PQ0A 4RFSA 2QPAA 4KGDA 4OP2A 2C88A 1KEPA 1A8HA 1BIFA 1X0XA 3Q10A 2Q2QA 3B6KA 2XCRB 1YE8A 2D59A 4FFBB 2O3RA 1EYZA 1QF6A 1XNHA 4ID9A 1NVDA 4RVCA 5C4MA 2PUFA 1YSCA 1DAEA 3IUSA 3PT5A 3ZKAA 1QB8A 2JDID 3FCEA 5AW2A 3BXPA 1ZR4A 1WETA 1AZWA 1UDBA 5E6RA 4KL8S 2QZSA 3GG2A 4CFYA 2G7ZA 4EPRA 2FG7C 5IDXA 3BCSA 4K9RA 4KITB 4XPZA 3WLPA 5K3CA 4F7DA 4N39A 4ZU3A 1G4UR 5BUSA 5IBCA 1JVSA 4UJ3A 3VBEA 1E5DA 2PA3A 2QBYA 3KCNA 1H8HA 3NHFA 4DG5A 5F64A 2Q1YA 2AW3A 3BDIA 3JYHA 4IRMA 5B1YA 5J2UA 2CE7A 5ALWA 4HSEA 1X6VA 5TDHA 2WV7A 3HC7A 2YJNA 4MUIA 5KNBA 3CUEF 2CZGA 3GI1A 5E3HA 4FLFA 2CHVA 3AEUA 3DM9B 4A10A 5CK4A 3E5MA 3LU1A 3OM0A 4K1XA 4YT4A 2IEBA 2OHXA 1Z63A 1XTUA 4F12A 2GVNA 2IV2X 2IXGA 5AQEA 1YR1A 2OCDA 4JLUA 3L8HA 1RYYA 4PYJA 3X2EA 1GRRA 2AYXA 4L2IA 3EDYA 4CTJA 4URFA 5ARCA 2OGWA 2P9ZA 2XCSB 5B58C 2QQ0A 3EW7A 5EIXA 2P4QA 4OK5A 1CCWA 3K9NA 4DQDA 4EZBA 1WKVA 4EEZA 1WZ2A 4MUXA 5CLLA 1CY8A 1CR6A 1NRXA 4DC0A 1SUFA 1Y8ZA 4E4TA 2EWMA 2FWBA 2XMCA 3GMIA 2P4UA 2QP4A 3OZXA 2CWWA 4PX9A 2ZPUA 4CCYA 1FSZA 3C3BA 2NVBA 2OGSA 3HN6A 3C4JA 4YDSA 5TPWA 3IEPA 1AKEA 2ZIXA 3F96A 1NQAO 3N0RA 1D6SA 2ZR8A 1JE0A 3PDUA 1BJTA 3MFQA 3U4QB 1MO2A 4UTZA 1HZZC 2IUEA 3VDXA 4KPUB 3QXXA 4EL5A 3RFVA 1D2RA 4OJTA 4DVJA 4KLNA 1W88A 2ZBVA 1J42A 4YJDA 1CZHA 1SG6A 3P0RA 3TIVA 2HK7A 3U17A 1ND6A 2DOKA 2QVYX 4BVJA 3CHYA 3LUAA 3ZVRA 1ZD2P 4EK9A 4RK6A 1HNWB 1XPRA 3GFQA 3U62A 1D1QA 2F3TA 2XE6A 4EGCB 4K46A 1F2TA 3NM6B 4S1TA 1EA7A 2B92A 3HS3A 4FE4A 2B3TA 3KB6A 1P31A 5EIOA 4ENTA 2RHOA 4MI6A 4RHUA 3BFPA 3LUGA 5BN1A 4FFMA 5HCIA 4MEBA 3DYVA 5DTRA 1E2PA 4QWWA 3HCCA 3T8YA 3OTQA 1ISGA 3F8WA 3TSZA 5CGQB 3H3JA 5JH7B 4DUYB 4TLLB 1Z5GA 3OT4A 3ZNOA 3A1VA 3A8TA 5IUKC 3DR5A 1YD7A 3WRXA 3H6KA 1DXOA 1IG3A 1GL6A 5F2KA 5JRJA 3CE6A 4OG2A 4P58A 3UHAA 3WK9A 1K68A 2A5LA 5DFAA 4M2LA 2G25A 5D85A 1CD5A 1E63A 1LW7A 2IZ1A 3BH7A 3ASVA 4FYPA 5F1YA 5KTPA 2Y93A 5CDGA 4RMNA 5FOVA 3WNZA 1E60A 1Y3CE 5IMBA 1RJ9B 3IO3A 1S4MA 1DT5A 1KIAA 1QHFA 3LUBA 3DVAA 2BHNA 4OBXA 3SMQA 4CQLA 3OWXA 3E58A 1NUTA 3QUTA 2UU9B 1YJ5A 5B6JA 1QMPA 4LDNA 1JLMA 1WU7A 3EEFA 2FF7A 3E22B 2J31A 3EISA 2Q8PA 3G8DA 4IQGA 4OKSA 4ERXA 1FLDA 1B8OA 2VL7A 3ZW8A 1PK7A 3GJRA 4M0DA 5ESXA 3AJAA 4L8VA 3OQOA 1CUBA 1PFYA 3DW1X 1GPJA 1KY5A 1VIYA 1CF9A 1WCXA 1XALA 2MR6A 3OC6A 3RE1A 1FFBA 2KBFA 5IVPA 4D0SA 1Y7HA 4FCWA 2XNJA 1N5DA 4WLUA 4ZAFA 1VCMA 1Y81A 3L7JA 5KSZA 1AQJA 2GRAA 4H7IA 4U2DA 1JLSA 1T8WA 1YRYE 1UOEA 3ZCUA 2VJPA 2JLYA 3R5HA 3NWOA 1M8JA 3FYTA 2QMEA 4PO9A 5AUQA 3DHWC 2DHDA 4EB0A 3OPMA 8MHTA 3UJ9A 1HZJA 5GV7A 1HETA 1USKA 2GERA 2IZ7A 1OXVA 3BL5A 3COWA 4IL5A 4ZAGA 5DIZA 3GX1A 3IMEA 4J2OA 3LDFA 4H7HA 3ECSA 1X19A 5J58A 4OFZA 2G04A 2GCGA 2IYVA 3D9QX 4MQMA 4AP9A 4HEA1 1X1AA 4NZNA 3ZWYA 3AI2A 3GAMA 4B85A 4ER6A 1F9EA 1KH1A 3ZE1B 4ASUD 4D9IA 1SUBA 3EXG2 2CXOA 4NNOA 3RRYA 3HFJA 3QZUA 4PIPA 3F8SA 5GVRA 2QTBA 2WB2A 2CV1A 1JJIA 1ZVMA 2Q3CA 3AEKA 3OSUA 4QOIA 5E3IA 3UXYA 3WGHA 4LHVA 1MV8A 3WNDA 3DAPA 1P60A 3B6JA 3RRJA 4JYAB 2IK8A 3IHLA 2G76A 2JJ8A 3WQQA 4ZVQA 5TMEA 3U5ZB 3I3SR 3VH1A 1JU4A 1AN0A 4RKFA 3HEMA 4IIVA 4QTYA 4RVFA 3OX1A 2YY6A 2EXXA 1MAAA 4XR9A 4JD5A 1FZQA 4WUVA 3QUSA 5DTEA 2H4HA 3GEPA 4BLTA 2PQ2A 3BERA 4TKMA 3VR2A 5JYBA 5HIMA 3KC2A 3OY2A 1SHZA 4ZJYA 1EE9A 1RYHA 5EE1A 1CBUA 2YUTA 3FD8A 3LTNC 4FDMA 1ESEA 3AL0C 1XA3A 4ALJA 3BTUA 3P97A 4D5GA 1CUSA 2CNDA 3C8UA 4J0GA 3OETA 2RE8A 3IQDB 4FMCF 2HF2A 1N0VC 1R4MB 1HSOA 1KMHA 3P9QA 5K0TA 2BGIA 1G3RA 3PHHA 1G20E 4JT9A 1MABB 1Z0ZA 1UR5A 1XMIA 4OB8A 3LQ2A 3BBPA 5AVJA 3THSA 3RIGA 3DBRB 1LBIA 4DC9A 2JLXA 1Z6YA 1ADGA 1PHRA 4BWGA 1RKQA 2CNLA 2QR3A 2X8JB 1P0IA 3GLQA 4DLLA 3LGSA 4LSZA 1EVIA 1SUPA 4PCUA 1Z88A 3M6MD 4FFWA 1XD2B 3JAWB 3TM4A 2AK3A 1TB4A 1VSUA 1CW2B 2VF7A 1RNLA 3E1KA 4C3UA 3WKDA 4RD3A 1BEEA 3FNGA 3W2HA 3KETA 4DNOA 4P2BA 4Y9RA 1E0SA 1BCSA 2AMLA 4XYEA 1FQWA 1NSTA 3GLTA 3AU8A 2XSZA 3NTVA 3QG5A 1NNSA 1X15A 4GFDA 2N42A 3HKCA 3TL3A 4PG7A 2JIDA 3CKYA 3ZS8A 3H2IA 2FLWA 3R5JA 4E07A 4GI7A 5EP3A 4EW6A 2PMCA 2E5FA 2NO0A 3BIJA 1SIUA 3MOSA 4ERNA 821PA 2FXVA 2VHZA 4WESA 2JARA 3A9TA 2VDRB 1QHNA 3KQKA 2IYXA 4J4BA 3W77A 4UZFA 2QMYA 3R4CA 3TQQA 4AQ7A 1WD5A 2HT6A 3GK3A 3MCAA 4CM1A 1QCDA 4GL4A 3BF7A 4NXNB 1P61B 3KUUA 4O4HF 5EKUA 4G0PA 1C7IA 3HB4X 3NHZA 2FAXA 4HGZA 5IAEA 3WMEA 4DLAA 1YZYA 2IYYA 1ISIA 2RHBA 4EFLA 5JQGB 1P2SA 1YGPA 2FTKE 1HQKA 3ZOKA 2R97A 4O2AA 1EU1A 2BGWA 2B1IA 1MO3A 1U2SA 3AUKA 5KEIA 5DM70 1C4KA 1E2QA 3IUNA 3UFXA 2VHVA 3DNFA 1IJKA 1K97A 3EN0A 3O26A 1NIJA 2AEEA 2DUUA 3W6NA 4QM6A 3H7AA 2OUKA 4ISBA 3D3EA 4RWZA 5AW8A 2EZTA 2NYUA 3F9IA 3N8NA 3O3NB 4B3HA 1ONSA 4QRHA 5LUBA 5C80A 2EAUA 4ZEWA 4A5OA 4RVGA 4CMIB 4F21A 3OQHA 1V16A 1SVIA 2FEOA 4UBLA 3TVDA 4LE2A 4MRMB 5FHRA 2ZBGA 3OLWA 1HLDA 3VR6D 4R5MA 4FKBA 3R0JA 2AF4C 2AOVA 2ZSAA 5A3QA 4OHYA 1X1CA 3FPHA 4X8HA 4FPXA 4JLSA 4GVLA 1BW9A 2Z56A 1GGFA 3BGIA 3FOWA 1EZZA 2NG1A 3KR2A 1ZMTA 3TEFA 5K6TA 1RLJA 3ZHOA 2XUFA 2W4QA 4B32A 1KI6A 5KTSA 3CWZA 2JFZA 2APJA 2FEMA 2BV3A 1OX4B 3H1FA 2AMJA 1EBBA 4L5YA 2GB4A 3LWDA 3Q7QA 1K66A 5DE3A 3WV4A 2YRFA 4RH0A 4MUGA 2VF5X 5D5HA 4P7BA 2POCA 5EKDA 2OORC 5KDLA 3SQWA 2YJTD 2D8MA 3N2IA 4RNCA 4Z99A 4WKPA 3N0TA 3T3NA 1UBHS 5JSYA 1V8BA 1NU6A 4FINA 1U2DC 2Q6IA 3OHSX 3FBTA 5AM3A 4E94A 1RTKA 1DJNA 1W59A 5FADA 1KDYA 2FFQA 3LT5A 4IUDS 4ZT6A 1VI2A 2ZJ4A 3DOOA 3FPGA 4DFDA 1XZKA 1G8AA 3GLGE 1QG6A 3L6CA 2CMHA 4DM3A 4UNNA 2OC4A 3JWHA 3OIGA 2H7CA 3KWFA 3RGWS 3N07A 1YA8A 3Q11A 1B00A 5TEVA 3E82A 4Z7OB 2X41A 2C20A 1CV2A 1HFWA 5JO9A 2A9VA 5KQRA 1G8FA 1MBZA 2IHBA 4DR4B 1DQNA 5GZ1A 1NQXA 3AY3A 3Q12A 4YAUA 3KXPA 1T6ZA 2Q3LA 1FNSA 4X97A 2P9TA 4WKNA 3ZLBA 3X1JA 1HRDA 1AE1A 1J49A 3SYNA 1VLQA 2E4YA 1V4BA 4B2LA 4QU9A 3M34A 2Q21A 3IBCA 2X1HA 3EX7C 1IL0A 1VCHA 4RE5A 2PIDA 4CL3A 1BD4A 4R2JA 2HMAA 3QELB 4IM7A 5C8YA 5JS8A 3EXFA 2XW6A 3WIDA 3NHPA 1ZJWA 2Y6VA 4XFDA 1J9ZA 1ADBA 1Q12A 2Y1FA 3RBVA 1KZHA 4LHYA 5AVWA 3JQAB 4JOBA 2PLFA 1PZFA 1QFJA 3CX4A 1JEQB 3MSXA 1SVWA 4XTCS 3O03A 4Y7CA 5CVTA 3LOUA 1PJ2A 2RGCA 3AKEA 2B3DA 4HB2A 1FL9A 3FJOA 3EBOA 1D4FA 1T1EA 3QU4A 4INPA 5AK5A 3MPUA 4JL6A 5CCEA 3Q72A 1ECCA 5ADVA 3U3JA 2VZ0A 5JWOA 1C9EA 5E38A 1N9GB 1U90A 2BBOA 4FX2A 2CV0A 4X3CA 4Z51A 2BONA 4RA6A 3DJFA 1N6HA 2AWOA 3AFMA 4ZPJA 2Q5OA 4BFCA 3S8EA 2B99A 5IZCC 3LRTA 3G0GA 5JZ9A 5LM3A 1I4OA 2C84A 3T15A 4PVCA 3EVDA 3BFXA 4KAXA 5H0IA 2C5AA 4O59O 2D0OB 2WM8A 4Q6WA 1XA0A 3DE1X 3JWJA 2V6FA 4N03A 2QV7A 5AJZA 4BFXA 3PIRA 1MDBA 4Q39A 1P39A 5BMVF 1AGYA 2C07A 2DUJA 4NPAA 4R0NA 4R98A 5EUCA 3B12A 1GVHA 4BJ1A 4PC2A 4UU7A 3A4TA 1GGMA 1B0UA 3PPIA 5DLEA 4BATA 3ESZA 3EGWA 1GGJA 4YMSA 3ETHA 3DDSA 4OGKA 3ZGOA 1GNRA 4OQXA 1ILEA 3GFRA 1W44A 4R1MA 1IFXA 3A1TA 4I6GA 4F8JA 1V0JA 1E3LA 1EPUA 4TXHA 3E6AA 2AEMA 2PAAA 3DXXA 4RM3A 4WK0B 4Z1MA 1TU3A 1C3OB 4J1TA 1EMDA 4EI8A 3ZE9A 4C7JA 1A9OA 3JASB 4IGFA 4GRAA 3OIWA 2W00A 4DWJA 1U8UA 3CPEA 4CG2A 1W5BA 3QVVA 4LY9A 2IHNA 1UBLS 4FTWA 2Y1GA 5AI4A 2XZLA 2MYUA 4L28A 1Z6TA 1VPEA 3ORFA 1OYYA 1Q22A 1PYGA 1TL7C 3PTLA 1Z5ZA 4OAQA 2Q2VA 4EY4A 3GLFE 3MB8A 3CN9A 2HJWA 3PHGA 4YJHA 4TVSA 4I6EA 1X7DA 4B7UA 2AFVA 1R4NB 4PTLA 4DCVA 3O38A 1JXMA 1N7GA 1I7QB 4LV5B 4M0MA 4Z0HO 3GGCA 2HUNA 1QR6A 2H1HA 1VJ1A 3W8RA 1L4EA 2ZE8A 3MS7A 4NMHA 3ZKWA 1U8FO 1AS3A 1C8LA 5AXAA 2OFFA 2WTUA 2G40A 2W8BB 1TTTA 2ZS7A 3V2UA 2ZJ1A 4ZQFA 2JIMA 4U7JA 1N4AA 4D56A 1G4HA 3NRCA 4JP2A 5IDVA 2E4ZA 3KQVA 2JGAA 4MUFA 5LMNB 4F71A 1M8GA 3IQHX 4NWIA 3G0DA 4LJ8A 3SE0A 4CYMA 1N2CE 5D3MA 5BN3B 2PLNA 2Q3DA 8ATCA 3ZDZB 1QH9A 4P2GA 4ABTA 3HBNA 4XGIA 3C39A 2BW0A 4HTFA 2VHUA 3QFSA 4C5AA 5FPYA 3GP5A 4AZ0B 1ZRNA 1M6VA 3PNQA 5E7JA 4F0JA 3G0OA 2A8YA 4ZT4A 3GELA 2J6IA 3JATA 1HDCA 4I4NA 5CFPA 1UJMA 4X6YA 3ROGA 1NT2A 3C98A 2QMUA 1RYEA 1S2OA 1ZH6A 3INNA 2ALJA 3PA8A 4OXIA 3QK7A 4P4LA 2AFIA 2EG5A 1ZNXA 5G53C 3OKAA 3H6HA 4PFSA 1GTMA 5DTMA 3RC1A 3PQ4A 3ZWWA 2YJ5A 3ZGZA 1N6RA 2A58A 2E4VA 5F7ZA 2UXBB 5B7GA 2PGNA 1PEKE 4G41A 4ESEA 3LWZA 1TMGE 4JT2A 2HJVA 3G85A 2ISCA 1DHTA 3H84A 4LWPA 4HDMB 4AZWA 3PQ2A 1NDHA 1W1WA 4TWJA 1MJGM 2HMTA 5JLAA 1C7EA 4LXTA 3MINA 2V8BA 3AOEA 3BSWA 3H4IA 1J2TA 3Q87B 4PAWA 2X9GA 4CM9D 4AG6A 4G63A 3UNXA 1EVQA 3HJTA 4CM4B 3DNPA 4MJ7A 4HZUA 2JVKA 3ZGVA 3K4QA 1T9AA 3DG9A 3S28A 1ORDA 5H9VA 1G5RA 1FFSA 1E9SA 1DTSA 1E3JA 1AGPA 1OI4A 1U99A 1T2VA 4FDVA 4LCJA 4OXRA 3VKUA 5SV2A 3FRHA 3RK1A 1F38A 3IAS1 2VPIA 1EP1B 3B9QA 3PYXA 1PW7A 4FFVA 1N34B 2VBIA 3G2HA 3TLBA 1RHRA 4LHXA 3GT7A 1L8QA 2BKXA 3L0CA 1L9KA 1RPTA 2I1LA 4GYYA 1L3IA 3GLVA 4MP8A 1X92A 1ZI8A 2JKZA 2RGDA 4OU4A 1SIBE 2JAUA 2C3UA 5D1HA 4EMBA 3MHPA 1UXGA 1NHGA 1PEYA 2PGDA 3Q0EA 1Z07A 3D8BA 1Q0RA 1AM4D 1E1KA 3IEKA 2B6NA 3G8BA 2E55A 3UG6A 1H1DA 5T67A 4AS1A 2V74B 2PVPA 2HQ1A 5K6RA 3PD7A 5IT9A 2O9JA 1VLHA 4LTNA 3ZX4A 5MGNA 2W6ZA 3FROA 5IT5A 3R0VA 4NYIQ 2CLKB 2QTVB 3VKFA 5LDDC 1YHNA 1ZM7A 3BSFA 1MEJA 3AH8A 3D54D 4KVZA 4LK3A 1G7RA 3KHUA 1O58A 4TT3D 1A4RA 2BE7A 3JZFA 1EHIA 3QF4B 1HDIA 1JYEA 2JRCA 4H35A 4IIEA 5DJ5A 4C5CA 1AT1A 5KDOA 4LX0A 1PN3A 4YRFA 2BTOA 2VA9A 2GZDA 4BX3A 4JQCA 2FZ4A 1JEYA 2FRXA 1C9YA 2RKOA 3EAQA 1U1DA 3EIFA 3O4VA 3R3ZA 2H6EA 4X9XA 1PQYA 1KIFA 2VAXA 3RS4A 4AL4A 4DQXA 1PFGA 3A4LA 5EFZA 3KIPA 1SCBA 4CF7A 4QYIA 1FJ2A 1N1EA 1SM4A 3KLMX 2HC9A 4JXKA 4LMRA 3HL4A 3ODGA 16PKA 1GOTA 2LZ0A 3I9JA 3LDAA 1QZ3A 1G8YA 3NTOA 4NLLA 1TXGA 1FDIA 3MJVA 3VOSA 4NL4H 4CCAA 4RIGA 2O4UX 1MTZA 1N7HA 2I4NA 2ZQZA 1YVDA 2BZSA 2W71A 4UUPA 4CF4A 4J0IA 4BUZA 4IJQA 4MR8A 4JJ4A 4TLCA 4XGNA 5JCXA 2IEGA 5EXSA 4ITUA 5LMZA 2D06A 3QE3A 3L5KA 1NI3A 1VHQA 2R6AA 1UC5B 3PDHA 2O5CA 4FUQA 5DXAA 1YZ3A 5B3JA 2PPLA 1STOA 3HSYA 1Q14A 2QPLA 1OPRA 3G89A 4O6VA 3V2IA 4ZYXA 1V2HE 1XXLA 2W2QA 3NV9A 4HWTA 3JQ8A 3UJPA 4RHEA 4BNWA 4PONA 3KOYA 2AOUA 4NZMA 3FNQA 3JZIA 1II8B 1XCJA 5IAKA 1GADO 1I5RA 1JR3A 1KMQA 1N0IA 3HHPA 3ENVA 3ASZA 4Z0PA 4BNLA 5U9CA 2IC5A 1ZGJA 1CZNA 4G1UC 4HQRA 1PJAA 1UT8A 3OIDA 3CTMA 3PC2A 2YNMC 5EP4A 5G1OA 1QX4A 2WY2D 5JD6A 4E70A 3DF9A 5ECYA 3WLAA 1QYRA 4OBWA 4BB5A 2C5BA 1IK6A 1KBQA 2E82A 2WQZA 4YEDA 4DADA 4N5MA 1DIBA 1I2BA 4EY6A 2C2OA 2ZIEA 5C7LO 3LNTA 3NBKA 4BE7B 2WJ6A 2BFAA 2CXPA 3OOJA 2B30A 4OXYA 4GEKA 3NHLA 3DO5A 2RHDA 3UUWA 1KOLA 4C0HA 3M49A 4HN9A 3ILVA 1SVOA 4FT2A 3HCFA 1P1FA 3EAFA 3OKFA 1LH0A 3NUZA 2UVPB 4IY1A 3L49A 1TYBE 3VO8A 3WJ1A 1E9VA 1KK1A 1ODKA 5BQ3A 3HWX1 3DD1A 4F1KA 3DXYA 1X7XB 3D2CA 1UL1X 5LYJF 4NOKA 4D4JA 4MPRA 1ATIA 2W6OA 2QRPA 1Z68A 3X44A 2YICA 1KEEB 1SVMA 2A0YA 1RAAA 4AY4A 2NSDA 2WABA 2GK3A 3L05A 4NZZA 4V1CI 4YJ3B 4QX6A 4Z9YA 5FO1A 3SYTA 4AMGA 1T2NA 3NHRA 2W5UA 3RVMA 2B7BA 2OMEA 3C97A 3MIZA 4PEVA 5L6MB 1ISJA 4XD7A 3HGTA 3WK5A 5JMOA 4G0WA 1Q7CA 2WF6A 3A2LA 1HYEA 4LNHA 5CPFA 1V96A 4MUJA 1L1EA 1YIAA 1Z5NA 5CURA 4AFNA 1MIOA 3T1HB 4JX9A 3FLBA 1U1EA 1X77A 2HCFA 4L73A 4FE3A 4WE3A 4DA7A 4EB3A 4RNDB 2LNDA 1ZUIA 2VK8A 3MJSA 4YDRA 1QLJA 4LE0A 3U3OA 1HX7A 3U81A 3P19A 3CSSA 4RZSA 1IK4A 3AXTA 4L5CA 2E48A 2IIQA 4ZWNA 2J9FB 4HLUA 4IWXA 5FWAA 1PRYA 2ZJYA 3N3AC 2MINB 3AJDA 4CG1A 4X65B 1FFAA 3EULA 4G0VA 4M37A 5E0KB 1U9CA 4JYPA 1NE2A 3LZ6A 4F2DA 2QVLA 4UXIA 2O8BA 3L4BC 5D01A 4CM8A 7GPBA 1KO8A 2FFBA 3DTTA 4IVPA 2F1OA 4YT2A 3KT6A 2IEYA 1E7QA 4JJ8A 1WHSB 3UOGA 1OTYA 3R09A 4E15A 3D3KA 3WOHA 2AZTA 3L6DA 1NMSA 4DV0B 4D6PA 4DLPA 4OQLA 2XODA 2HHLA 1J0XO 3A6EA 1LSJA 4PLWA 4RVUA 4BTEA 4V1CB 5T5QA 3E81A 1KY2A 5BUZA 3N0WA 4NATA 5HRCA 2O8DB 4YRLA 4HDCA 1A72A 2EFGA 5KYYA 3TS1A 3BN3A 1P4AA 1BDIA 521PA 4CEHB 4MGKR 3CVUA 2H57A 3GXBA 1YFLA 3CH5A 2BM9A 1NFRA 2VEOA 3ETCA 5ALUA 4RADA 4CLHA 2NUTB 3GGPA 3NQ41 4HJRA 1E9RA 1PGPA 4OYYA 2R65A 1PSWA 5ESWA 4DPMA 3HVRA 4QUBA 4IJWA 4POAA 4QGGA 2C2GA 3FPBA 1GZUA 3OTOB 1TT5B 2X7XA 2ZS9A 4KUGA 3HKEA 3TUIC 1CWUA 2A57A 2R6FA 1BG6A 1AZTA 3IQWA 4AJPA 1E4YA 2Z3WA 3X43A 3F4LA 2XB2A 1YA4A 1S3FA 3CCFA 4QGSA 4WJZA 3VR4A 4BV9A 1K3UB 2QXTA 3P8ZA 3AFHA 4FC7A 1C3LA 1KWKA 3HXPA 4R69A 4OHPA 2H1CA 1T15A 1V1MA 4U2KA 1PQUA 4JUAA 5KWJA 1OWNA 5F52A 1VGQA 2HWKA 4TV8B 1UMKA 4DMUB 2IWHA 3ASUA 4R1LA 1K4YA 4TM7A 1W4BA 2D2IA 7ABPA 1PDVA 2AHOA 3PUZA 3KQYA 3KVRA 1BXRB 3MTBA 4A8PA