4RK7A

Crystal structure of laci family transcriptional regulator ccpa from weissella paramesenteroides, target efi-512926, with bound sucrose
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
270
Chain Sequence
RVVGVVVPLIHTNFADEIIKGLYETTISSGYELLITYLDEDEDHQYQVFQTLLSRQVGAVFMLSLDIPSWMIDKLLEEQISVISLTALLSEQISAVTSNEFEMMNSIVDYLIDMGHKNIALVGDTKLTTNISSTRRTNFIKSMTDHNLAYENIFLYGNDHSYETGYTSVTTGYDINQLPFTAAIATADMVGQGLINAMSDHGKTVPEDLSIVTIDGLQQTEIARPKLTTVKQDFPEIGRIAMQLFLDSDEPQIIYIPTELIQRDSVLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Crystal structure of transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926
rcsb
source organism Weissella paramesenteroides atcc 33313
molecule tags Transcription regulator
total genus 80
structure length 270
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk7A01
3RVJA 3IP5A 2AYXA 1JDPA 3IP9A 1GUBA 3CFYA 4W5OA 4MS4A 4F11A 1EWTA 1JX6A 2VUHB 4QICA 1E6LA 1D1QA 1JL3A 1EWKA 2GI4A 2MYTA 3CKMA 3FDFA 4QPJC 4G0QA 4EYOA 3UKJA 2M98A 2L2QA 2IKSA 2Q5CA 4G0XA 1JH9A 3TX6A 5HM6A 2FSPA 3HV2A 2YHAA 3MYYA 3BRQA 3HXMA 1I3CA 2YHBA 5TE9A 4N47A 5T3YA 3QLVA 5C5CA 1R8JA 5IEJA 2GBPA 5EWMB 5FWXA 3IP7A 1C0EA 4MGEA 4Z9BA 5TQ2B 2IPLA 1QKKA 5JNVA 3DZDA 1BA2A 1DC8A 1TJYA 1YS7A 4L4UA 4LE1A 5EWMA 4D6XA 1QP4A 4HNQA 2H3HA 2M1ZA 2WJWA 4OATA 4F12A 4MQEB 4WXEA 7ABPA 4ZYLA 2PL9A 3I09A 3URMA 4Z4GA 1P8AA 4MQEA 5BRAA 4QYMA 4LDZA 1ABFA 4YV7A 4H3KB 1SRRA 1NXOA 1A2OA 2FQWA 2PLNA 3H5LA 3SAJA 1MIHA 1NTRA 1Z13A 1BAPA 2H0AA 2OENG 3GA5A 3O1IC 3HK2A 4MR9B 3H5IA 4EYQA 3CG0A 2FN9A 1FFWA 4Z4IA 4KVFA 4MR9A 1H9CA 1YS6A 2LP4Y 4MQFB 1GCGA 2NZUG 4F3TA 5CNKA 1U8TA 3KYJB 4MQFA 2JVKA 3LUKA 4G97A 1JF8A 1U2QA 3NNDA 3H1EA 3O2QB 4JASB 4JB2A 2IPAB 3T95A 2WY2D 3KSMA 3N53A 1MB3A 3QEMB 3A0UA 2JK1A 1CYEA 3MIZA 1F4VA 5EWLA 4YLEA 5ED4A 1JWLA 3S99A 3QEMA 1F51E 2ID7A 2OQRA 2VUIB 4LE2A 1TLFA 3N0XA 4O1HA 1USGA 3RVLA 3EQZA 1E6MA 3KS9A 4D6YA 3Q7RA 1Z25A 5D2CA 3KG2A 3SM9A 5HSGA 2ID9A 1QMPA 4YGXB 1VPWA 5KQGA 1QO0A 5TPZD 4Q7EA 1D4ZA 1SXHA 2R47A 3N75A 3C3MA 4O1IA 5DCLA 4HNRA 4MRMA 1Z2EA 3VNBA 3DGEC 2FKAA 4Z9AA 4DADA 4G0ZA 2LIVA 4LX8A 5IBQA 4LDAA 3CZCA 1FQWA 2KYRA 4JP1A 1FSPA 3SY8A 1DP4A 3RVQA 4RS3A 5HKOA 2IYNA 2P9HA 1MAVA 4IMJB 2CHEA 3Q9SA 4MR8B 2I6FA 2IDMA 2PKXA 3A3KA 1YMVA 3MM4A 3JVDA 1QP7A 3F7NA 4MPTA 2A9OA 3C97A 3N0WA 3CHYA 3BILA 3ILYA 4B09A 2MYPA 5JNWA 9ABPA 3C3KA 2QVCA 3NHMA 4QYWA 1JHZA 4W5TA 4IGAA 2MYUA 3K4HA 4IMIB 1TMYA 1BDJA 4ETMA 1ZESA 4S05A 1K68A 4OTZA 2WJAA 3N0RA 1ZH2A 2NT4A 3BRSA 3CRNA 3OM1A 3TD9A 3I42A 2PUAA 4OBBA 1BDHA 3CLKA 4W5RA 1ZDMA 3H5VA 2LBPA 3HZHA 3KLNA 1D2AA 3Q7SA 1GUDA 4JAVC 4Z4EA 1LK0A 1CHNA 2F8TA 4LRQA 1OXKB 4LE0A 5DLEA 1Y1LA 3LKBA 5CNIA 3O2SB 1L5ZA 4MS4B 1RZRD 2PUDA 3TMYA 1Z15A 5DTEA 3RVNA 2E4ZA 3KHTA 4N41A 1QNLA 1YIOA 1DG9A 3LUHA 3CNBA 3MA0A 2QVGA 3IPCA 1Z16A 4ZMSA 2L18A 3FFWA 4ZJPA 1SD5A 2RJOA 3DLBA 4F8JA 3H6GA 3L6UA 5FWXB 3DBIA 3OLYA 1JBEA 3A0RB 3CZ5A 8ABPA 1QQAA 3F6CA 3LTEA 5F64A 1DRKA 1RNLA 1URPA 1NXWA 1A0OA 4IILA 4RXUA 3FFXA 1DRJA 5IX8A 2HSGA 4E7PA 4RK0A 1XWWA 3RVKA 1JYFA 2B4AA 4JA2A 4M88A 4KFCA 1MVOA 1U0SY 2B1JA 1Z2DA 1JFSA 1GLGA 3NNSA 1KMIY 2X7XA 1JFTA 1VLZA 2RJNA 3GRCA 1M2EA 4O5AA 2PAFA 3JPWA 2NZVG 4YRZA 4RZSA 3RVRA 3OQMA 2VK2A 5CHYA 3N6VA 1USIA 3QX9A 2GKGA 4MS1B 3OMWA 2HJ9A 4KQCA 5E3JA 2PJUA 4EVSA 4S04A 1J56A 4MS1A 2E4XA 3QEKA 3SQNA 1Z18A 1NXSA 4RXTA 3SG0A 2F8SA 3LUFA 2A9PA 5EWLB 4N0PA 4XASA 4EY3A 1ZVVA 2HQRA 3LUAA 1AB6A 1PHRA 1DBQA 1MB0A 1NXXA 1PUXA 1USKA 3RH0A 6CHYA 2IPMA 4IRXA 1QQBA 4PICA 3VNAA 1C4WA 2FMIA 3A10A 4RU1A 4RSMA 5TPWB 3T38A 2ZAYA 3CU5A 3TO5A 3F73A 4W5NA 1DJMA 5TPWA 4G86A 5FBHA 4YR7A 3M6MD 2FVYA 1BVHA 4P98A 4PE5B 2TMYA 5BRJA 1NY5A 1Z17A 3QELB 2NT3A 1M5TA 5KWSA 3DLHA 4ETNA 1SXIA 2QZJA 3HEBA 3Q15C 3QELA 3O2JA 5FWYA 2FEWB 2ZWMA 4CBVA 3GYBA 3CG4A 1JFVA 1P6QA 1ZY2A 3KJXA 3FMVA 4KMRA 4MLDA 4PZ0A 3D8UA 4KPYA 4MRMB 3EAFA 3GL9A 4G0PA 3HJFA 5EWJB 4JOQA 4TLMB 1LBIA 3IP6A 3HDGA 4KRFA 5EWJA 2BGGA 4F06A 3O1HB 3F6PA 3N8IA 5IUKC 2FTKE 2PL1A 3OO1A 3T8YA 4EUKA 2WB4A 3OLXA 1QP0A 1JLKA 2FMFA 4WT7A 5T7BA 3IPAA 4RK1A 1Z26A 1LJUA 3MQ4A 5TPZA 3OM0A 3LUGA 2PUCA 4NCAA 2CWDA 3M9WA 4ETIA 4Q6WA 5BR1A 1DCMA 5KQPA 1DZ3A 1TM2A 1EWVA 5DGCA 1AB5A 1UDRA 4OLAA 2FEPA 5PNTA 2RGYA 2WWVD 2MYNA 4ML3A 4ZMRA 3DGFC 1YTUA 1JYEA 4HNSA 2FMHA 4H3HB 3HUUA 3EODA 2JB9A 3BBLA 3EQ2A 1M2FA 4EVQA 2P4UA 4LZLA 4G0MA 1YVUA 3K9CA 4NQRA 1SXGA 4H60A 1RXIA 1DBWA 1VRVA 3G1WA 4FB4A 4MYRA 1DBPA 4DQDA 1EHCA 1YMUA 3OO0A 4RWEA 2FQXA 1W9HA 4TLLB 4Q6BA 3JVIA 4TMYA 2O20A 3LOPA 5FBKA 2JBAA 1JDNA 2E4YA 3QLUA 2FMKA 3M9XA 3JPYA 3C6QA 3GBPA 3HSYA 4RK6A 4UHKA 3H1GA 3I5AA 4KNYA 1DCKA 4MAAA 4HYEA 3KLOA 4MLCA 2PMCA 4RY8A 2E4UA 3LKVA 2JVJA 3H5TA 3HVRA 1YK0A 4RY0A 3O1JC 4UHJA 4DN6A 3QX8A 4EYKA 2QV0A 3I45A 5TQ0A 1DCFA 3P9YA 5KQLA 2VYCA 2MSKA 3QK7A 2E4WA 3RVOA 1RZRA 2WMYA 2WRZA 3RVPA 3EJWA 1ZITA 1NXTA 4G0YA 1Z12A 4FE7A 4NCBA 1M5UA 3E61A 2PE5A 5DKFA 1S8NA 4W5QA 1P2FA 4YO7A 5B3JA 4RDCA 3GV0A 1A04A 3NHZA 2L17A 4RY9A 5HQJA 4N76A 1T34A 4YCSA 3JS5A 2LPMA 1IIBA 1K66A 3QLUC 2JRLA 2R48A 1XHEA 3EGCA 4FE4A 5JNSA 2MSWA 4PYRA 2AYZA 4Y9TA 5TQJA 5GOTA 4WWHA 3MMNA 4PEVA 2FLWA 4N0QA 5IUJC 2L19A 4YS6A 2FLKA 5GQSA 4Z4CA 2HQBA 3G85A 2XDYA 1PEAA 4TN5A 3OLVA 4OLBA 5IULC 4WZZA 1ISRA 2HPHA 4RK4A 4XFKA 2V0NA 5TQ2A 4XXHA 3ROTA 3D02A 3E3MA 2PUFA 1ZGZA 1XHFA 3OLZA 3SNKA 1HEYA 5IUNC 1NXPA 3CTPA 1ABEA 3OQNA 2MSLA 1ISSA 2A9QA 5B3JC 1EFAA 1P6UA 3BREA 3KTOA 1E6KA 3Q41A 2HQOA 3QLTA 2J48A 3B2NA 1D1PA 4JB0A 1L5YA 3H75A 2A9RA 3H5WA 5KI6A 5FWYB 1W25A 2DRIA 2LUOA 1U2PA 3NBMA 1FFSA 4YWHA 1PEYA 3QLVC 4GPAA 4OG2A 2FEKA 5KQMA 3Q7TA 2RDMA 1KGSA 3H5OA 3UUGA 4RXMA 5JS1A 3RVSA 1U04A 5CNMA 4IF4A 1QO0D 4L85A 2FN8A 2QU7A 4P1ZA 4YP9A 4KV7A 3EULA 5I4CA 2R25B 2JVIA 1B00A 3HS3A 3LMKA 3OLWA 4Z99A 3H1FA 1GCAA 3L49A 4RV5A 1E2BA 1ZN2A 1APBA 1ZHHA 3NNNA 5JNTA 3RVMA 4MS3B 5C5EA 3GT7A 5IC5A 4E7OA 2FQYA 5CNJA 1RPJA 1PNRA 3W9SA 4MS3A 3OMXA 1KRWA 5ABPA 4XAQA 3FGZA 2IOYA 3LUJA 3MF4A 4XARA 2GX6A 3GBVA 2N9UA 3R0JA 2PUBA 3HO1A 1VKRA 1BDIA 3HM9A 1LBHA 3LUCA 3EDCA 4G0OA 2GWRA 2CD7A 3H6HA 5JNUA 3HUTA 3IDOA 3LUDA 1OXBB 3TB6A 2NUBA 1NATA 4ZPJA 5JNRA 5KC9A 3JY6A 4MR7B 6ABPA 3KYIB 4KQ9A 4GNRA 1DC7A 2JCGA 3FFTA 3ROFA 1LJLA 3RQIA 4RK5A 2IPNA 4MR7A 4Z4FA 1ZH4A 4KZKA 3C3WA 1KRXA 1EAYA 1TVMA 4MR8A 4WUTA 4EGSA 2E4VA 3T6KA 1QPZA 2JBAB 4EYGA 1YK1A 1WETA 3KCNA 5IEBA 1PNTA 4Z0NA 3KKEA 3O75A 2QXYA 4WXMA 4EVRA 4NICA 3OQOA 2FXIA 4N03A 4Z4HA 2QR3A 4XLTA 4RK7A 3GWGA 4KREA 1CEYA 1RXEA 5BQ3A 2PUGA 3O74A 3CS3A 3ILHA 4KK4A 4RKRA 5TQ0B 4NV3A 3JTEA 2PUEA 1D5WA 3HCWA 1ZAYA 2W42A 3UK0A 3LFTA 4RKQA 2QSJA 5KC8A 5JS2A 4KK3A 4D74A 1FFGA 2R4QA 2FW0A 3O21A 1NXVA 1ZGGA 3HDVA 2CHFA 2QW1A
chains in the Genus database with same CATH superfamily
2LKDA 5DBHX 1G291 1DBIA 1SXJB 1JBQA 3COYA 4K9KA 4DXDA 5I7FA 3NJ8A 4QICA 4MPDA 5HKBA 4GOKA 2VBFA 1D1QA 2R2AA 4QTYA 4RH1A 4ND3A 2HF2A 3L3BA 1VPTA 2EGHA 4DDTA 2QRVA 2WU3A 2AX3A 3MYYA 1I3CA 2NYVA 1GTJ1 4YJ3A 1ZEMA 2PS3A 2X19A 4KUEA 4NXNB 2COUA 3NHYA 4S1WA 4U2DA 1P33A 1R12A 1C0EA 5KHOC 5I3CA 4M6WA 4GG1A 4O8CA 1QP4A 4FDMA 4F4CA 3GO4A 2XRYA 3QIVA 5JD5A 1M67A 1TB4A 2CF5A 2H4YA 2O2XA 3KB2A 4HWRA 2AE1A 3U17A 5IZCA 2PLRA 4YAWA 1ZGJA 3U4MA 5FL3A 3SMVA 3R0IA 4MDHA 3WMRA 2QJTA 4Z4GA 2OCGA 4ZO6A 1KI6A 5CX1B 1Y8AA 4YV7A 3IQDB 1MX3A 3G0IA 2Q3JA 2EF0A 2FX3A 4YUZA 1JVSA 1EA7A 2FQWA 3L7DA 4M1KA 4NS1A 2IHKA 5LQDA 3GRZA 4WK2B 1PX0A 1JLMA 3KD2A 4LHWA 4QUHA 1JN0A 3GOQA 2OXCA 2O3JA 4R3NA 2C7RA 5CVUA 5I7UA 3G5TA 3OZCA 2JEOA 4KVFA 4GIBA 4JI8B 2IX3A 3S2IA 1GCGA 3FOFC 5AW4A 2DWOA 4HO1X 4JC8A 1XQYA 821PA 1W19A 2WA1A 1GRRA 1B8UA 1Q0TA 2WTEA 2BTQA 2XMGA 4GPTA 3JD2A 1XEWY 1KKLA 2FSUA 3O2QB 3FSEA 2NXCA 1EFLA 1XXHA 3A0UA 1AU9A 3B9QA 3PGLA 4HL6A 4IIGA 2C92A 2IF0A 4UBLA 5AICA 1NW8A 4F3YA 3ZIAD 5EPEA 4US2R 1PJSA 3D3KA 1V2HE 2ODQA 5I9BA 3EWAA 4C5BA 1DJLA 3U37A 1PNQA 3REQB 3GD5A 3WWEA 5KAPA 2NG1A 1JR3E 3UY4A 4J4HA 3A4YA 3OPQA 4BJ5A 2A92A 3GCWA 4IF6A 4MKZA 4KR7A 1H69A 1BKYA 2A0UA 5CK5A 4YJFA 4XGIA 1PVDA 4TVBA 1M8GA 5K0NA 1QMPA 1DXYA 4YAIA 3GLGE 1VPWA 4WUVA 4UEWA 3GIWA 5JSFA 4PG7A 5EJ9A 1EUDA 2NIPA 1NBAA 4S12A 2QK4A 2RFLA 2AOUB 2I76A 4A26A 4E33A 2O0JA 3K1TA 1H9AA 2VBCA 1EFKA 3QSYA 1N6KA 3IOMA 1HDOA 1RVV1 1KOJA 3U9TA 4R1MA 4IOJA 3ZLTA 2XB4A 4Z9FA 1F12A 1BX3A 1N25A 2XPCA 2ABWA 4ZT6A 4MYTA 1BHO1 4KXNA 2XMDA 3MJVA 4KO2S 3HNPA 3HQ4O 5HKOA 1XYYA 2FQ1A 1OW3B 2GCEA 4KPFC 2Q99A 3MWGA 3G2JA 1ZK1A 1T9BA 4OHXA 3EZGA 2PXXA 2FN4A 2I6TA 3FAZA 1XZLA 1LLDA 1VG1A 1MDFA 3G02A 4EP1A 1AXEA 1K7CA 1HT3A 4KO3S 3RM3A 4IX9A 4J1QA 3N8NA 4O6VA 5GJVC 1QP7A 4LF6B 1CUEA 4GUDA 3R7WA 1LRJA 1LTHR 4FDLA 4KLCA 3WGJA 4QXOA 3ITNA 2PFGA 3OZAA 4OX9Y 3UH1A 2ODEA 1DEAA 3HV0A 2YR0A 4IQFA 3B6ZA 3OCJA 4OIMA 4IJ6A 1YZTA 4HS9A 5J2UB 1B1AA 3OQVA 1WPXA 3Q85A 1XEXB 2WYHA 2D8MA 3J80A 4PTZA 1T25A 3M1IA 2HA6A 5KSPA 2PY6A 5BMVB 5KQRA 2AC2A 5B6PA 3ONNA 2Z8YA 3PNLA 1XRQA 3KSDO 4MWGA 3DTVB 2O7NA 3IC5A 1SOWA 2WMDA 2PUAA 1SBQA 2O2IA 2BFNA 4R71A 1GL7A 5FNVA 2ZPUA 2F2TA 5KAMA 3DXXA 3T15A 2E1PA 3UGJA 3AQIA 3GDOA 1E1RD 1SY7A 2F1JA 3W2IA 4CR7A 5AM3A 1LK0A 5IT4A 4HSGA 4MZDA 5GVRA 2EKLA 3ER9A 4BNVA 4YJ2B 4MQMA 1XQ6A 3TMYA 3UIEA 4B3DA 3V1YA 4RVSA 3EVEA 2CB0A 2PAAA 3O9MA 4YCCA 3GLGB 3WX0A 4BNZA 3AM1A 4BJHB 4XOUA 1ISJA 3L1HA 2IIQA 3Q3IA 4J0JA 4DCTA 1F17A 3LBFA 4NAHA 5TDHA 4WZAE 4LSGA 4X5OA 4TMZA 1Y5LA 4G1UC 1ENOA 1M7BA 3CX4A 1DKUA 4Z0HO 4JJ7A 1NY6A 1UKVY 4WH0A 1WLSA 4P58A 4QFCA 3N2KA 1EG2A 1Q0RA 1FK8A 3LWZA 2IHJA 2Z1NA 5B3AA 4XIGS 1JT2A 4HP8A 1OWLA 3P2YA 1GAWA 1ZD4A 4E7PA 2J3HA 4KFCA 1ZU5A 3V3TA 4KSBA 2J6CA 2B1JA 3HRHA 3RANA 4JYBA 1ISMA 5ICEA 3P2JA 3OM9A 2X5NA 5KSOA 2R6GA 2JGJA 4Y1EA 1E66A 4NI5A 3AYXB 3BD8A 4TXLA 3ESRA 4Q3LA 3HKBB 3QVWA 4TMFA 4X6UA 4XM0A 3UXHA 4QUAA 2AEEA 1PK9A 3E5HA 3BX1A 1ILWA 3RFXA 4H1UA 2P91A 4KSCA 2Q41A 5CHYA 1U9JA 3WQHA 1JEQA 1R5JA 2DULA 5DM2A 3FYCA 5ALQA 2E4AA 1CV2A 2Z8YM 4GMFA 1D2GA 2EGGA 2WPNA 3VTFA 1AQ6A 2QROA 4ZT5A 4RLSA 1X42A 1PZNA 2E4XA 3QU7A 4GOMD 1W0JA 1U1GA 2VNJA 5FJIA 2BGUA 3FNRA 2XHZA 3V2UA 5KYNA 2V3CC 1QXSA 2VTVA 3RJ5A 2YMLA 4FFNA 1L7AA 1TA4A 3F0TA 3SX0A 3TGLA 2FPMA 2FMIA 5H83A 3RUCA 4DB4A 1JG6A 2HB6A 4E21A 1T8RA 4B82A 2ZAYA 3CTMA 2HI0A 2WWWA 2YWXA 4O2BA 5KNCH 2RONA 1W75A 3Q40A 1GPUA 1AMUA 1E1CB 4P98A 3CUWA 4LRUA 3T1HB 2JZNA 1C3EA 1S2GA 2F9FA 3A1TA 1L8LA 4PSAA 5G1OA 4AUMA 1U5BB 1Y8QA 3N7TA 1Z0DA 4ZOEA 4UEOA 3GYBA 4RX1A 4BAGA 3GLSA 2PX8A 5DNWA 5FCDA 1IM2A 1JFVA 4KDRA 1ZIXA 4XX1A 4DUYB 1WY5A 1XMXA 4JDUA 3QXXA 5AJUA 3D8UA 4BHTA 5BNTA 1HDXA 1KNXA 1NYQA 2W2TA 2WYVA 3ELWA 1B73A 2AI3A 3NVDA 3GPIA 1SHJA 3JSAA 3LDHA 5TJ9A 5A06A 4JOQA 4B1FA 2P75A 4QYIB 1KDPA 1Z6XA 4UFNA 2OK7A 2BGGA 3G6WA 4GZ5A 1FFDA 2O2GA 1Q5PA 3K9GA 5EIHA 2P79A 2HF7A 3RYHB 3JAMA 2BHNA 4B2IA 1NJGA 3SIPA 3KZXA 3ENQA 3X2EA 1K8QA 2PXCA 5BNZA 3DE0X 4PRZA 1BJKA 4RELA 5J5VA 4UNPA 4HAZA 3WNBA 4UNSA 5CFZA 3R5JA 4FD2A 3CLUD 4GMHA 2O2YA 5EMMA 2IPOA 3ZE0B 1OWNA 2D7DA 1U0JA 2CBXA 2XXBA 4U7FA 2WWVD 3NT5A 3DGFC 1HOXA 3ND6A 2FW7A 3ORQA 1R50A 1LA2A 3FMGA 3ZUPA 4M99A 4DV1B 3LT0A 5KZMB 10MHA 5IAAA 4ILKA 3YASA 2FG6C 4IDNA 1Y3DE 1IOLA 2OBMA 5K3AA 4UUMA 3VKFA 4D82A 5ER6A 3MTEA 2PQ0A 4TWZA 2CJWA 5FDFA 2A57A 4K6FA 2VK4A 1TTPB 3FA2A 2QTZA 1YCDA 3DAFA 3HI6A 4JROA 1YMUA 2A30A 3IAXA 1A9SA 4P36A 1FNDA 3ORHA 1YAHA 3JWHA 4PFJA 3EXG2 1K7XB 3AG5A 1OKKA 5C52B 1SXPA 3WWDA 4NHOA 1COZA 1SU6A 3LUPA 3HSYA 1B76A 1LBTA 3SJAA 2ZRAA 1GOTA 3BE8A 1VIAA 3CH6A 3C15C 5LP6C 2Y6VA 2B4KA 2X5XA 1H05A 2YHSA 2WPDA 3LFHA 4N4AA 2JVJA 4R7GA 1PNVA 3L8ZA 2Z0MA 4JVOA 1BVYF 4RY0A 5AM4A 5JRDS 1KOGA 2R8RA 2MU1A 1TD1A 5DGDA 4AKIA 5M04A 1LI5A 1CETA 5BR4A 1L5MA 1X38A 3HO6A 1YR9A 1ZD2P 5IW8A 2XX3A 1NG9A 1M0WA 1X9GA 3QK7A 2PS0A 5L6LB 4KYIB 1XQVA 2FDRA 2AWOA 1NXTA 5JW6A 4KQIA 1Z12A 4BNDB 4EARA 2UZ0A 3QFFA 1NVDA 1OI3A 3ELUA 1ZNYA 1O8CA 3OH8A 5F78A 5HQJA 1N2ZA 4TYPA 5B58T 4BLVA 2RHLA 1SKUA 1KTIA 3LHFA 4JJZA 3QLUC 2VT7A 3E9QA 1OXVA 4X20A 2QM7A 1EK1A 3AJ8A 3BL5A 4LHXA 3PR2B 4YCJA 5F21A 3UHAA 3UWDA 3L6RA 1JQJC 4DCGA 3HBMA 3O4FA 1WDWB 4I1OA 2RBEA 4KIUA 4CT5A 4UTNA 1O95C 1LPPA 2GEVA 2QUIA 4INPA 4LV6A 2ZJ5A 4BKQA 2CKDA 4TS1A 3SQXA 5D86A 3S7TA 5JDIC 3WKAA 4OHWA 1R9MA 1TT7A 2J0VA 4WGGA 3NV9A 1P0CA 3N7AA 5JRJA 3BHIA 2JI9A 5E1BA 1XTPA 5ICCA 3N5CA 2FF7A 1VB3A 3KDAA 2HCBA 4N5LA 3U48A 3GJXC 2HPHA 3QUSA 1M54A 4MHSA 2IQIA 3OU6A 3EC1A 1GNTA 1OX6A 2JGMA 4A0SA 3AXTA 2Y0PA 3GEMA 3H9EO 3WKDA 2AGVA 3EFHA 3PQEA 1KDTA 2CMKA 1HDGO 2W6PA 3H5RA 3AVTA 2JLRA 2QZPA 3F3YA 4WK0B 4W8HA 1NAHA 2FSSA 2BZ1A 2P8JA 3PYMA 4LJ5A 2BYTA 2QAJA 3PI7A 1N8TA 1EZ1A 2O0LA 2ZDHA 5EFOA 4C5CA 1AKNA 1IG0A 2ZUWA 5MN6A 2RH5A 4RHEA 4LYDA 3KR9A 3UJ9A 1XV5A 4LDJA 1DBSA 1OXSC 1L7NA 3PUJA 1UOPA 2AXQA 5GIPE 2QRHA 1LLQA 4FT2A 1X1BA 1RQGA 2C31A 2CEAA 4UARA 4QG3A 3IQHX 3Q7IA 4Q03A 4OHBA 2PMDA 3A70A 2AQ8A 3DBRB 1RYBA 5JS1A 2W6OA 4JUIA 3LP5A 3ABSB 5D3MA 5CFOA 2XITA 3A37A 3JQBA 3T35A 5HPYB 2ZI3A 2VHUA 3TOCA 2BFCA 1UC9A 2FP4B 3C8MA 3KL4A 2JLXA 1Y3FE 5IVHA 4F8EA 1RM3A 2Z5FA 5AESA 2WNSA 3HS3A 2B20A 4K0KB 4R05A 1SCKA 3EXG1 1ML3A 3IQIX 1QH9A 2JFWA 2WFLB 3TE6A 2R3SA 5E6SB 4CM9A 5LJLA 1ZN2A 3I72A 5DX1A 3TKYA 4WESB 1APBA 2IYYA 3H13A 4KQ6A 3R7AA 3VI3B 4AURA 1Y5RA 3R41A 3ZKAA 3DVAB 4ZI7F 1U9YA 3QWBA 1B74A 1DEHA 3OE7D 2FQYA 2I9PA 2IBMA 1U7XA 1PD1A 3EC2A 1YJXA 3G5AA 3OA0A 4MCIA 1ICEA 2YH2A 4N6OA 1KRWA 2XQKA 1L4UA 2IOYA 4KR0A 5KYXB 4I6JA 1U9ZA 2OFXA 3F96A 3RFTA 3CT4A 3T3OA 2F3SA 4FUQA 4KU4A 2C77A 4G5GA 4WXYB 4K1XA 1X1CA 2J87A 3R3UA 4L4XA 3TZQA 2HX1A 4AJEA 4P4LA 3HKCA 3PGKA 1FMCA 2ZBPA 3TI7A 5K2OA 2EJTA 1FBTA 1KYQA 3OQBA 2B25A 3D8TA 3N70A 3UAGA 4CG1A 3IP1A 2M1XA 2VJKA 4IG4A 3CGGA 3H04A 4KBGA 3HLYA 3DPUA 4KXMA 5CMLA 4YONB 4C01A 2OP0A 3RQIA 3RRNA 1K5PA 4ZKDA 5KTOA 1UBMS 3HDYA 3L1KA 4EPYA 1G4UR 3Q10A 4D7AA 2PIAA 1CHDA 1S4QA 3Q3VA 4OI2A 3GFPA 1T9HA 1WXDA 2I6SA 1N6RA 2O3SA 2ZYGA 3GQBB 4ZOBA 1WEKA 1ZJ4A 2WQZA 3II6X 3NP7A 3AY7A 4RV4A 2IU0A 3S2UA 5LNK6 1RWBA 3D3WA 1IAVA 4MAMA 4D4MA 1KY4A 1ONSA 4PGAA 4GNKA 5J58A 4F6RB 3SZOA 3ZNOA 2RAUA 2FR8C 5F5XA 2ZI6A 3ZZMA 2DHQA 2Z8XA 2C9MA 1N3IA 2B78A 1ILEA 3C45A 4KAJA 2OR3A 1ZAYA 3M5CA 1B8OA 3PEYA 5AOVA 3QITA 4PTYA 3QZUA 4CQMB 1PL8A 1C1DA 3WXMA 4DCPA 1S2OA 1F60A 4EL5A 3PQ8A 4PYLA 1TVKB 4WRRA 1EX1A 4D74A 1DEOA 3U7FB 4J0IA 1GG5A 3LQKA 4NJEB 4HGPA 1IH8A 2ECQA 2AL7A 2QE7A 3R0ZA 4FSDA 2J4FA 2R751 3FM9A 1M74A 3CLSD 2JJYA 4NBWA 1I13A 2BSAA 3HJGA 2XR1A 3UPDA 3MCWA 4B4KA 4CKCB 2O7SA 2PCLA 3QTTA 3Q8MA 1K7FB 3ZGOA 1GU0A 2AMVA 1H0KA 1PHPA 4AKEA 4AZWA 4H4DA 2VUHB 4AZVA 3S8YA 4TTPA 4YRCA 2DJIA 3A26A 1NI4A 4MVYA 3MRSA 3GRUA 3UKJA 3ICVA 3WGZA 1JKJA 3F5DA 4L5CA 2IKSA 3U4GA 2Y9MB 5CEFA 4AF8A 5HF9A 1DRUA 3WDLA 3BIXA 2WAMA 5IVDA 1IY1A 2G9VA 2EZ4A 5DHTA 1VA5A 4KR9A 1RCUA 3VHLB 4ALJA 4BDTA 4ZCIA 3WIDA 1MZPA 1BA2A 3BG5A 4EW2A 4CM1A 2R1TA 4HNQA 4Z7JA 3N8GA 4OATA 2J1LA 1L5GB 2B30A 4Q7MB 1O6ZA 1GRQA 3I01M 4NYMQ 4UTXA 3UUFA 1VL2A 4A82A 1P8AA 1AQJA 3PR3A 2GYVA 3FF4A 4JR2A 4D4KA 4P8RA 1XMIA 4KEAA 3SX4A 4RPIA 3TXYA 2NGRA 2XYQA 4NEHB 1SRRA 1XFDA 1G64A 4HNTA 1KXJA 3K96A 5I8PA 4CIXA 1NN5A 3AUKA 2I3ZA 1MFPA 4GLOA 2NNLD 4GYKA 1ADGA 1GV1A 3H2GA 4EJSC 1CUUA 1M66A 3QXHA 4GM4A 5COBA 2W90A 1TTTA 3BL6A 3BQ9A 2BEKA 4O5OA 4Z4IA 1XVAA 4JCOA 4CL8A 1CG6A 4MQFB 1OH7A 1T8TA 5CEJA 3ZD8A 3A1NA 3PF8A 1EXMA 4RJ2A 2GN0A 1X80B 2IHUA 1FX0A 1U2QA 1QFJA 4OSPA 1RI5A 2WTBA 3ESXA 1SQFA 5T6BA 3KSMA 3K9LA 1KI8A 1H2WA 1XF1A 4V38A 2C2OA 2P4HX 3UOWA 5JC1A 1IWPB 2F8LA 3OD5A 1GNPA 2F3QA 1ZWLA 4DXAA 2V6FA 4AY3A 1IZ9A 2C2YA 3E7DA 1NT4A 2GYYA 2IEZA 3UT5B 4YEDA 4DMFA 1DEXA 2J0UB 1Q1EA 1U2GC 2C5SA 3NH6A 1UAGA 3UF0A 2D1QA 1NZFA 3UCEA 2QYSA 2WF6A 2R8BA 4KWEA 4JXJA 4MQBA 4EW1A 2GEKA 4M9XA 4GU5A 2QTWB 5BSTA 3RO7A 3BS4A 4U5XA 1NE2A 3WNQA 4YT4A 2FG7C 4F97A 3FWZA 2RCNA 2XA1A 1HH4A 3ZDAA 4QTZA 2O1XA 1NI5A 4OSEA 4ZMBA 4DA9A 1SXHA 5TF0A 4JKYA 4EOGA 4BFVA 4UTPA 2P2ZA 1Z68A 1ZOIA 2EDAA 2P2DA 2WD8A 4D2IA 4DQVA 2NXJA 3QVUA 1RHMA 1QH0A 3KHKA 1MPTA 3ILXA 3KPVA 4FEGA 4MVXA 5K0BA 4A8HA 3DGEC 3RE1A 4UUBA 4CYMA 3C70A 4BNFA 5DLPA 1ZFNA 1XRPA 1GP2A 5DOVA 4ZOCA 1ZJZA 5CFQA 1SM4A 5KDOA 1R0LA 2HWUA 5ITZB 5HQTA 3D4OA 3CKYA 2RHDA 3SS9X 4E46A 4WZBE 2F3UA 3KZMA 2LCFA 1L5NA 3KLMX 1TM7E 3EGVA 3L79A 4Y6OA 3B8EA 3SR3A 2GK6A 4BV8A 2RARA 4H0CA 3MM4A 5LD2B 4I8IA 2AFIA 4MKHA 2APJA 2G09A 2F1OA 3U81A 1PQYA 3ZD9A 4CM6A 4IIBA 2I3AA 5KTYA 4DQKA 3U19A 1NHGA 1I2ZA 2QMOA 3FOCA 5FI0B 2WIGA 2L42A 1RJFA 4OHZA 4LZWA 4N5MA 1Y6ZA 2ID4A 3DBVO 3KKLA 4GWKA 4Y9RA 4O4IB 5C1BA 3KJHA 5JCJA 4A2WA 3ZBQA 3BXZA 1KYIA 3K16A 5E9AA 1YA6A 2H0RA 1V35A 3NHKA 3L6CA 3INRA 5BYJA 1BDJA 1WEHA 3LBNA 4WLEA 1ZESA 3AOEC 4X93A 1K68A 3FXAA 2LXNA 5SY6A 4DG8A 3CRNA 5FNVF 1I1QB 3FVRA 3VA7A 1L7QA 5BVHB 3V33A 4MP6A 3QQ5A 1MOZA 1ZK2A 1R6DA 1W47A 3AEYA 5CFLA 3GRKA 2XUQA 4LC1A 3SEFA 1T5OA 3HDHA 1RLMA 3GRVA 3KLNA 1W93A 4HDSB 4I4CA 3RFUA 1C1HA 2ONKA 1T8WA 1PYOA 3VOSA 2GGSA 1TQ2A 2Q2QA 3DVLA 5K0GA 2H7VA 3KKQA 2PVCA 3BDAA 2C2XA 3M89A 1J9GA 3LP8A 1L7OA 3PHLA 4M46A 5DTEA 1ZC3A 3M3DA 3F74A 1Z36A 1YIOA 1DG9A 3LUHA 3M7IA 2H1OA 4R1UA 2OORA 1DXHA 1NYRA 1QP8A 3D64A 1TC2A 3I37X 2CT8A 1ESZA 3W6ZA 4W7SA 4XJVA 4EHJA 3BZUA 3OSZA 4GFDA 4AMBA 4DREA 1RJDA 1XDZA 4JI6B 2AG5A 1AH2A 2Q3MA 1H0SA 1HWYA 1H2BA 4FFBA 3VPAA 3TF5A 3PDIA 1A5BB 3DBIA 3HR4A 1V8OA 1L1EA 3KE9A 4HH0A 1EX6A 1XDBA 4H1TA 4LYAA 1A88A 5DVZA 1JZTA 3GXOA 3QE9Y 1VSVA 4Z3KA 4B17A 5ITWA 1I3NA 1GGEA 4M1EA 2O8FA 1JYFA 2QL9A 2A94A 2J9FB 5JQGB 4KAAA 4LMPA 4DQXA 4YLYA 1AK9A 3G5MA 4B2YA 3U39A 3G9ZA 1RCFA 2JIZD 1ZQ1A 4MKRA 1W2HA 4TROA 2G63A 3GC6A 5DRYA 2XZTA 5CGZA 2AUMA 2ZYVX 4R9UC 5LKAA 1SHLA 4QGSA 1GPKA 1E32A 3QUTA 4JU9A 5JAPA 3DAPA 3PGVA 2VK2A 1RHKA 1GA1A 1VL8A 1BWQA 3DE5X 5AK3A 3R7DA 4AY5A 4P08A 2PLWA 1EH5A 1P74A 2ACWA 4S04A 5K01A 3OZXA 4O2AB 3CJRA 4D3FA 2GNPA 1DAFA 1MTOA 2UYYA 2AZTA 2VCEA 3EVBA 3IOBA 3NWBA 1QV7A 1YULA 1Q77A 4M2LA 4RCZA 4D9MA 2W4IA 4FEEA 4KMOA 4ZREA 1NMEA 1RI2A 2C61A 1K9SA 4NEQA 3SC6A 2ZWIA 4M8IA 1Z74A 3U7QB 1XD2B 4B3BA 1F3LA 3PHCA 4HZGA 1GVHA 4OI4A 5EINA 5EQFA 4JR1A 3V3KA 5JD4A 3ASYA 3ZE9A 5ILOA 1M6HA 1WZ2A 5FAKA 1QRDA 4G5RA 4P4NA 2FPPB 1Z33A 2O14A 3L92A 4N0MA 4OXKA 4ZAWA 4MI6A 1YOVB 1WPGA 2JJ2A 2X7JA 3NPAA 3Q15C 4R4JA 1G9XA 2XNDD 1LDBA 3RS0A 2ZRFA 3LLVA 4KGXA 4EMTA 4HUJA 2O7RA 5WRFA 3WLKX 4YRMA 5EHZA 5C7OO 2Q5IA 2D00A 4QELA 2VP6A 4S0ZA 4BVJA 2PWPA 4S35A 2BI8A 3HU5A 4GEGA 3G2QA 1C8BA 1H2EA 2VDRB 4FFWA 1NLUA 2KBFA 2NVWA 3LNCA 3LA6A 3KKNA 1GKKA 3PKZA 3UH0A 3HC7A 4M9SA 1FUUA 3N0TA 3AVVA 1YL6A 1F8UA 4Y2HA 4PTLA 4AG6A 1KBQA 1B2LA 2VDLB 2XOXA 5JEEA 2YVQA 3GLQA 3OO1A 3CY6A 4ICIA 4FP9A 1JLKA 2HV9A 1GO2A 4WT7A 2OC9A 2CWDA 2DH6A 1VFNA 5IMBA 1F6DA 3NVMB 3WAJA 4X7MA 4XGNA 1RKUA 3BMNB 3IQGX 4ZJUA 1K6IA 3HCDA 2CBGA 3I9V6 4X84A 3TEFA 3VKVA 4F7WA 2VRWA 3PLAE 1U0HC 1IUNA 5DGCA 3LPNA 1MT3A 2FEPA 4KGVA 4PSUA 3PGXA 1BHJA 1ESMA 3I9NA 5DW3A 4HGZA 3BT7A 5HP4A 4KC0A 4DBVO 1RADA 5T64A 3PQ7A 3F67A 5LP6A 4N6GA 4DIEA 1MQSA 4RULA 4X1IB 3E15A 1XNQB 2JB9A 4FONA 1MEEA 4GE0A 1FFEA 2HNKA 3PQDA 3HDQA 1J49A 2X2PA 4Z3OA 3GGJA 2HXYA 4RQTA 2ZRGA 3WZLA 2CV2A 4MUAA 2ES4A 2OZPA 1ZCJA 1AQUA 2RG1A 2BTEA 3HHPA 5C37A 3Q3JB 3LYUA 4HX2A 3WISA 4RPGA 3JQFC 1OU4A 2BDUA 4D26A 3NATA 4U1RA 3F6YA 1BO6A 2O0HA 1UPCA 2IYXA 1FSGA 2PV7A 4O63O 4E2YA 3LOPA 2X6QA 2OZEA 4JP8A 3QLUA 4DCNA 1DHTA 3C6QA 5JI2E 2V97A 4MW0A 1I7LA 2EV9A 4QYSA 4TZKA 2EBWA 1Q15A 1DCKA 3BHNA 3U61B 2HPVA 4HQKA 3ZHSA 4C0BA 1HUQA 1BS1A 1XA0A 1C0IA 2J3KA 4YDSA 2PHZA 2BJHA 4PZEA 5T67A 3OZFA 5JDIA 1MJNA 4JELA 3WGTA 1D8TA 1WABA 1P7CA 2F1KA 2BFDA 2AFVA 2QLTA 2R5FA 3EGIA 2FHSA 1K4YA 3MXTA 4FHDA 4F84A 1DAOA 2NVUB 4TYYA 4OK5A 1DAPA 3RVOA 3RRZA 1U8XX 3TN7A 1ITZA 1UMBB 1T5IA 4X64B 3DF7A 2BGIA 4L16A 2Q49A 3P9RA 2CL0X 3WLHA 3RYTC 1S2MA 5AVUA 3NIDB 4KACA 3C39A 4IJKA 4NMXB 1GL3A 3RS5A 5KOHB 2LPMA 2DY1A 2JIMA 4IHKA 5AM5A 5KYTA 4UOQA 1I80A 2JK0A 4GKAA 4NBNA 4DV5B 2NO9A 2FUKA 3GRAA 1NBWB 4INZA 2X2FA 1YCHA 3E2PA 1VFPA 5BWMA 4GYYA 4M0KA 3WOVA 2Q0HA 4NE2A 5A7GA 3N5KA 2BFBB 2P2SA 2BMVA 4KQHA 4GBGA 5JMPA 3G1TA 4CM8A 3EOAI 4KVGA 2VNHA 5BRNA 4FFMA 1Z29A 3JQQA 4Y8VA 1J1IA 4QVKA 1EUQA 2BD0A 2GEFA 1G5QA 2SCUB 3HRKA 3LBHA 4RQBA 1B8PA 1NBME 5EUCA 1YBHA 1BG6A 5LC1A 5A0VA 1LX7A 1ABEA 5AMXA 4MP3A 1G0OA 3VVBA 1VMEA 4MV0A 2OVFA 1EGQA 1PR4A 2P5YA 2WV9A 3KCQA 1XAIA 5EYPA 4ZZIA 1E6KA 3Q41A 2AG0A 4CDRA 1YRHA 3VYTB 1L9KA 5T5QA 4CHTA 4D02A 1U3FA 4RVGA 4QDXA 3T5TA 3H5WA 4FOPA 4YMWA 3VR4D 4TKVB 2R4UA 4AKGA 3FIUA 1BYUA 1K8XB 3DVQX 4TQ9A 3F1LA 3FDIA 5ALPA 2WNIA 1YA8A 1QU2A 4G1CA 3H0EA 4YV2A 3DL0A 3UGQA 1HNXB 1SUWA 4DPKA 1Z8DA 2YS7A 4CG0A 2I7CA 3MD9A 4I1VA 1G2IA 3PTAA 2HLNA 3DWEX 3WYDA 1ZNWA 4CGYA 4ZDKA 5C1PA 1XZJA 2GDZA 1DX6A 3IGFA 2YNMC 3DW3X 3O7WA 3OT4A 1ST2A 2ZIUB 1V6SA 3KJZA 4FYXA 4IIXA 4R5HA 3JD4A 4RD6A 5I4CA 1S8FA 4F2WA 1V16B 4HN4B 5CW1A 4YRLA 1D4OA 1GITA 1QRAA 1A50B 3R7LA 2ACVA 3L06A 4KRGA 2WINI 3NETA 1KS9A 1EEHA 2ZUEA 1NWHA 1LWNA 2LWIA 5EZYA 4CWAA 3GT7A 3FSRA 4IG9A 3AI2A 3TLYA 2WZCA 4QHYA 1Z6GA 2BBSA 4DFDA 3D5EA 2II6A 4RW0A 3DZIA 3F3SA 3GBVA 1EX9A 3R0JA 4MVJI 2CW5A 1UZAA 1V5WA 3ZX4A 1N5DA 1A2QA 1XZNA 4KXWA 2FLVA 4L5JA 2FR8A 4BS9A 2FHPA 5C1DA 2P1RA 3EDCA 1W5AA 1Q11A 4RA6B 5AJWA 4ESOA 4UVDA 1E1LA 2H85A 4XCXA 4ZPJA 4ZODA 2B8WA 5I7OA 3E0XA 4LZJA 5CRIA 2ZUSA 4ZOLF 3S68A 4KQ9A 4BFYA 5LBIA 3PXCX 3C1UA 1LZKA 3SE0A 2DQZA 3B2EA 4EKNB 2P0EA 2BZSA 1N5OX 4KPUB 5JJCA 4W9NC 1Q95A 2P4SA 5IJZA 1KRXA 3NT2A 1P5JA 3SYLA 2AUNA 3GJQA 4FGJA 1HETA 4D3YA 2GN8A 2VJLA 3VJRA 1OYWA 2ZPTX 3A05A 3JU3A 3GGSA 3SSNA 1XTRA 3K92A 4JC4A 1PL6A 2XUPA 4Z0NA 4F93B 5KNBD 3AWIA 2JFUA 3E5RA 3UVEA 4C9BA 4WXMA 4CV2A 1RMYA 3C41J 2ALJA 2IZ6A 4X7RA 2DG2A 4XX0A 3N8HA 1BMDA 2NV0A 1Z4KA 3DOIA 2W2PA 2NO5A 2FETA 4NMHA 3EPHA 4RLFA 2Q27A 1XR3A 3M3PA 2JI4A 2CXQA 2XUJA 2XGOA 1P3Y1 1JRLA 3A9UA 3B9PA 2IW1A 1C14A 1LDGA 4I0WB 4MRNA 2C59A 1ZCFA 5EKTA 3D0QA 1MD9A 3LOQA 3UM9A 4ID3A 1LBEA 1ISGA 4RCYA 1QCCA 2GESA 4D79A 3WO1A 4HLCA 4G1BA 4K8OA 3LQ4A 5CYOA 3IIKA 3IAUA 4HEJA 5DYGA 3JAKA 1DRWA 2V5AA 1G41A 1ZGGA 1Q84A 1HYEA 5EGSA 2OGTA 3BGVA 1GZ6A 5HJ7A 3PHGA 1DLJA 3PC2A 3D6JA 5EHXA 4MS4A 1WF3A 4IJWA 1NVMB 1BJRE 1UMKA 2WHXA 1MCZA 1XGKA 2XLBA 3TFWA 3QM1A 4EJSA 2P7IA 3K1ZA 4FZJA 3TLGB 2FPWA 4JB3A 4W8OA 4BBPA 5KHLB 2WOOA 3ZDDA 4QXAA 2L2QA 1W49A 3GMSA 3BXFA 5E7JA 1KAGA 5KX5A 1IE3A 2GBPA 4NYIQ 4D45A 1LFAA 2WUEA 2IX9A 3D4PA 4OXRA 2FDCA 1J0BA 1YS7A 3OE1A 3ZXUB 4CEIB 1SURA 1E9VA 1DX9A 4LY9A 4EW3A 5CB4A 2ZRPA 4BLSA 1Q0LA 2KPOA 2PGJA 5DX8A 4DDKA 5L3QA 1M1NB 1X7ZA 4OSOA 1R8YA 1V3UA 2OCIA 5D5QA 4B81A 4EYSA 1WPRA 2HMSA 1U2GA 1HY3A 2X0IA 4C0AC 3H5LA 4IR7A 1EBBA 1O6BA 3MAGA 4DPLA 2GCIA 4K9OA 4MITA 1DDGA 5JSKA 3L8CA 3C8HA 1QG0A 5K2MA 3UJDA 4COOA 4ER5A 2CDNA 3HK2A 4UHEA 3H5IA 2ZYRA 3GG9A 2FN9A 1UPAA 1FYWA 4RTMA 1ODSA 2W2OA 2X9LA 4BQQA 1GKUB 4AN0A 4EI2A 3MPUA 3WP1B 4DHEA 2JVKA 3QF7A 1QCYA 4G97A 4JVSB 1D0IA 2W6JD 2NNWB 4QPDA 5ALKA 3TPFA 4AG5A 4ZVMA 1MB3A 1YR8A 3LQFA 1G8FA 6GPBA 5LSAA 1N5MA 1SCUA 2GT1A 3AY6A 4KPEC 1ZN8A 4YAJA 1TA0A 2WWTA 3HJBA 1XF9A 2OZLA 4L6IA 5C34B 1ZP6A 4MUYA 5LYYA 4A6EA 1D2NA 5AFSA 1WCV1 3U09A 1DBVO 4Y2JA 1GRNA 1MX5A 3S8EA 4V3BA 3RLIA 2PRIA 2QTGA 4N1AA 4NBRA 1EVKA 4L73A 2QTMA 2AE2A 1GEEA 1FYXA 3KO8A 3KS9A 3Q3GE 4R01A 1P1CA 1ND6A 2IYOA 2PKCA 3PRJA 3K6KA 3Q7RA 5ECYA 3NZEA 4MCAA 2QTVA 4MWSA 4OU4A 5AUNB 3O47A 5D87A 3ZWBA 1M8FA 3R5HA 1AN9A 2AQIA 3SYRA 4XJSA 1FFHA 4AZSA 4NG4A 1ZXLA 3AKEA 4P83A 4GBJA 4R8RA 4CT0A 5I9LA 3KQUA 5A9SB 1V1MB 2PH5A 2PJZA 2YL2A 1ZM7A 2Z9BA 3ME5A 4DLUA 3TQIA 1Q0QA 1HQYE 3OKFA 3G8DA 2YWEA 3AW9A 3BERA 1RQNA 3AOEA 3QIAA 3AR4A 4FN4A 1QORA 2B98A 4TUYA 4LWOA 1BCRA 3A4LA 3OT5A 4NTZA 3HYCA 3UJPA 4XRGA 2G5GX 4FW8A 5L7WA 3HCRA 4PR0A 5J59A 2I7VA 2PBFA 5DGHA 4TS3A 3KOWA 1QK5A 3RVQA 5FRDA 1UFOA 4GX5A 1UMDA 1EWRA 5K51A 2P3QA 1MAVA 1TU0A 5B2ZA 2CHEA 5CYGA 1C9NA 1L2TA 3AHDA 1OMOA 1VBFA 2XHEA 1DC5A 3KOUA 4LGYA 2Z4TA 4V0LA 2K7FA 1I7PA 1P7WA 2IIVA 3JWIA 1BVRA 3UYLA 3FNQA 1N6PA 4A5SA 3I8XA 4HMOA 1M73E 4I46A 2ZATA 2ZTMA 3E8MA 4LPSA 2P11A 5AI9A 2JIDA 5HGJA 2HFKA 2V9CA 3TCKA 5IH7A 5FOWA 2CXTA 1IY9A 1BS2A 3DWIA 4C6HA 3LQQA 2VRNA 5CT5A 4S1PA 1I10A 4CTMA 4UULA 3R3HA 5KCZA 2ZXEA 4II7A 5B4TA 1MQ8B 3BZBA 4J7AA 1ABBA 1O96A 1ORDA 2HRZA 4E5VA 2Z4RA 3ORFA 3BK7A 4JI7B 1YZNA 3N0RA 1RPNA 4CLDA 3A1FA 1CR4A 5C35A 1OFTA 2JH8A 1P17A 2OE2A 4GQAA 4DZRA 3PL5A 2W93A 1H8HD 3H1PA 4ARBA 2NUPB 3WL7A 4P4UA 4JBGA 3X2SA 4HNHA 4YMSA 1K86A 3KYCA 1PGOA 3Q8LA 2ZTUA 4JN6B 1V0JA 4KRYA 3LC7O 1KSFX 1A5AB 1GZSA 4J7UA 4ISBA 3MILA 3ZKWA 5KSYA 2PRZA 1PZGA 2QLLA 2YZGA 1OXKB 3LKBA 5A3QA 1QV6A 2ORWA 1T9CA 1X9IA 3ZGLA 2JFQA 2ZYWX 1MC8A 1DE0A 3RTDA 3VAYA 1ZIPA 3BDVA 3R4VA 1G0NA 3KHTA 4X7BA 5DGXA 1Z3IX 1RYHA 4I66A 1U3UA 2GH1A 5DYTA 2VDWA 3A6PC 1OXMA 2L18A 3FFWA 2PSFA 3MMSA 3MERA 2I9KA 4AZTA 3L8HA 5LOVA 1MIOA 3C3EA 2E7ZA 1Y7LA 1ZN7A 3JW8A 4TSFA 2O3QA 3PCRB 5DYYA 2ZYDA 4OMFG 2HK8A 3BKWA 1BN6A 2PL3A 3QUAA 4H6PA 8ABPA 3G59A 5JBNA 1NUPA 3HKDA 9LDBA 1JIJA 3JWGA 1IU9A 3L7JA 4UM8B 5IASA 3M3HA 2NQ2C 1NKVA 2XUOA 4HVTA 4TX1A 2FZLA 3DLAA 4XUCA 1CR0A 1UBLS 2BBWA 2HSGA 3Q5EA 5IX8A 3CZPA 1KEEB 1QTQA 1IM5A 3RUHA 3KWJA 1U0SY 4K86A 1CDZA 1P9OA 2NVOA 3NDRA 4QRDA 4FNAA 2C5LA 2F1IA 3QENA 3AEUA 3W6PA 1UF9A 3AGQA 4FMCF 3G2PA 2P4EA 2X41A 1Y7PA 3MCTA 4Y2VA 4ALLA 4KGDA 5DSZA 2J9ZB 1PWXA 5HCNA 3PVZA 3F98A 3BWDD 4KN8A 3HXLA 3OJWA 1X8XA 4PC7A 3KT0A 1AHIA 4C0XA 3PSHA 4EHKA 1T1SA 1IY0A 2C9ZA 4G07A 4MUKA 1JUDA 4BKMA 1TXGA 5K9ZA 2ZDGA 4ZT2A 3RKUA 3U3OA 4ZANA 2OZKA 3L0SA 4GOND 4KKXB 3UG6A 2I65A 5JSUA 2A9PA 5CJJA 4AECA 3GCXA 3Q3EA 3LUAA 2ACEA 2IRWA 4JY7A 1ZVVA 1USKA 1QQBA 1SU4A 3TIGA 2IPMA 1CQIB 3IT0A 2ADMA 1L5WA 3HVIA 5HTKA 3OEED 4PPGA 1WW3A 2G8NA 3IUJA 4IGFA 4LHVA 4MSUA 2NP6A 2WJPA 1B0UA 5KOYA 1VE3A 3VR5A 3OBIA 1FFBA 4GL2A 3D7SA 1QOPB 1DNPA 4QLOA 4KB5A 1NONA 2CVOA 4TLEA 3V9AA 1XL0A 3TB4A 5L3RA 4DYVA 2FSVC 3ZWDA 3EPJA 3HEBA 2CYAA 3DWFA 2V7EA 4PWZA 3BD7A 3CVXA 4AQ7A 1P80A 2B4TO 3W6OA 1SCJA 4IS2A 2OTCA 3HABA 3VISA 2XUHA 1ULHA 4GKVA 2P30A 4DIOA 4BQIA 4DLRA 2VQ6A 5LWQA 1LDYA 1ZUNB 2VRBA 2CNOA 3GH1A 4FKMA 3LC0A 2AZMA 3F47A 5EWJB 4QJIA 3UK2A 5ALNA 4ALNA 5LLDA 5CIWA 2QVLA 3Q9LA 4ZDJA 2ZOSA 2ON6A 4E3WA 3THOA 3IO5A 4D6PA 2PMKA 3WFJA 2D2XA 3N8IA 5IUKC 5B2FA 3G0BA 1K1EA 3B70A 1YS2X 2ET6A 1Q44A 1J5EB 1AUVA 1HLFA 4ZHQF 4BVGA 1QHXA 3MQ4A 3ZCTA 3VZCA 3UMBA 1JEAA 1YB7A 3JQ9C 4P80A 3WLOA 2F3TA 1V71A 1TO2E 5F52A 4BLQA 5KJ6A 2ZJ0A 3DHVA 3LVQE 1U0OC 1ZIOA 4I55A 4IICA 4WY8A 3Q8XB 621PA 5TS2A 2JLZA 4LFBB 4UM7A 3QE3A 3UXYA 1Z3CA 5TF4A 2IIBA 5FV7A 1Z6ZA 3AHEA 2BRUC 4GAEA 3UANA 1GPH1 3HUUA 1SKQA 3NX4A 5G1NA 1YQ9A 3IURA 3MNFA 2AIRA 3PWZA 5AW7A 1USWA 4EFMA 4HTAA 3I6QA 3KV3O 1F1BA 1N3YA 2HTEA 3WRXC 4DPMA 5A5FA 2P4UA 1TVCA 4Q4HB 5NLLA 4HLUA 1ZJYA 2BR3A 3HBLA 1EVEA 5DIZA 3H97A 4MJ7A 7AT1A 1MX1A 1XZEA 2OLKA 1E2DA 1E1DA 3TL3A 1DBPA 1EHCA 1V11B 4L4RA 2XUAA 2A1TS 5DLQC 1S2DA 1T2CA 3C14C 4N01A 1W52X 1JEDA 4JUAA 4R2MA 2IU6A 1OWOA 5EIBC 5JEDA 4X85A 3EGWA 4HX5A 1OH5A 1YQUA 1W76A 4QHSA 3KPWA 3GLIB 5B58C 3U7RA 2HGSA 3AKDA 4PGHA 1G21B 2ORYA 2X8JA 2W6ID 3A32A 4QFMA 2BCJQ 2OYSA 3M1AA 1T0JB 4GW3A 4MYHA 3TZBA 1VGRA 4PAWA 1A3CA 2WIJA 1QR2A 4J3NA 1YK0A 1LH0A 4FYIA 4C0KA 4KFTA 1O0BA 2DEUA 4QUJA 1SK8A 3RSSA 1YZFA 3EXHB 3I45A 1J2TA 1ML4A 4B84A 1CJVC 3ZDYB 4BO6A 4CM4A 1TCUA 1FJXA 1AKUA 4B76A 1RZRA 1XMJA 3NFRA 3PDJA 4WL0A 1CUXA 3E70C 3OPMA 3CW9A 2EFEB 3PT5A 4A9AA 4ZYUA 3TQQA 3I30X 3NALA 2IIPA 4CZ2A 1NLZA 5IPFA 2HT1A 3IT1A 1YR1A 1UDWA 3ER6A 3V4PB 1NVBA 1QWOA 5JAIA 3SFZA 2UVPA 1NOJA 1QIGA 3OCZA 5DNEA 1QMGA 2ZE5A 3ZVLA 3BJZA 2JD2A 4JSRA 3ULKA 3N3BC 1G59A 3WBKA 4PZLA 1CQXA 4MV9A 3Q72A 4PANA 1WW8A 2G88A 1RXVA 3MMNA 3IAFA 2XCSB 3CE9A 5FUBA 4AO8A 1PLKA 1TYCA 5EQJB 2B7BA 3BIOA 3E9ZA 4B35A 3AW8A 1WBBA 2O5CA 3BMCB 4YNBA 5M2QA 1N2CB 2BFEA 1YHZA 3VPCA 3OLVA 5K3OA 1ISRA 1Z4IA 4AKSA 1UQTA 3E1SA 5TQ2A 1ST3A 2HK9A 5AUPB 2Z5GA 4WBNF 1P31A 2CLSA 3AIIA 4B3XA 4B3RB 3FRIA 1NXPA 2ZB8A 3CTPA 5F35A 5IK2A 1UANA 2G1UA 3TNFA 1WQ1R 2EYUA 3A6DA 3JWJA 3NVAA 4KG7A 3HE3A 1W46A 3AY3A 5CBPA 1EB9A 1EDDA 3PE6A 5TMDA 2R44A 5M7EA 1I5EA 4AMUA 1VKNA 3K0FB 3KTDA 5KI6A 3IEIA 1L8OA 1W25A 1KJYA 1JP7A 5L8VA 1E0DA 1QX3A 1FYVA 1G18A 2AOVA 2AQHA 3MEQA 4EPRA 4TV9A 3OG9A 4FFDA 3OFVA 1OTYA 1Z0UA 3KVOA 5FOXA 5J43A 1SHKA 5A6SB 1V5IA 1GM5A 3N1UA 3Q7TA 1Z2NX 2O3UA 4JLDA 4PO9A 3P2IA 1CZLA 1ZRMA 3H84A 1OFVA 2C7BA 3DZBA 3A1EA 2MMCA 4H7KA 5L95A 2GA8A 3EZLA 5JE8A 1SG0A 1S4MA 3A4VA 3R5FA 5HJ2A 4YBRA 1HFEL 2G70A 1NPDA 1V1RA 2QD1A 3NGLA 3Q88A 4M38A 4I5DA 3EULA 4S1OA 3ZXYA 4D8TA 3A4MA 4FLEA 4II3A 1C8LA 2A4MA 2CMHA 1E7MA 4KI0A 5EZYF 2NZJA 1CUSA 1Y3BE 2OHGA 3OICA 5JVDA 4P2BA 3T99A 4UBOA 4W9NA 4NOLA 2ZI9A 5HFJA 3ROZA 2ZS7A 2G4LA 3CLTC 3NU1A 3UAWA 2MINA 1ODFA 3F2IA 2GD1O 3FHOA 3PUXA 2JIQA 3GFQA 3TS1A 4CKEA 4ZI7B 4Q4JA 3JASA 3PJGA 4MS3A 3M34A 4OQZA 1C9EA 3FGZA 4XARA 4ZT7A 1HE4A 2N9UA 4LXUA 2QD5A 2W2KA 5ECDA 2YW2A 3LC2O 5ES3A 4EHIA 1VKRA 4MJLA 4QRHA 2JI6A 2XSZD 4WINA 3TRDA 3FR7A 3LUCA 1ZONA 1MG5A 3WGGA 4WOCA 3TZCA 1XTTA 1JTVA 3MRVA 1JECA 5JNUA 4QXMA 5CVVA 4YAFA 5CA0A 5J9FA 2EKPA 3UMFA 2Z1DA 4E5YA 2R0QC 1YSCA 1ZNZA 1XDGA 4D41A 1I2BA 2GN6A 3CF2A 4REQA 5EMHA 2JAHA 3VDQA 3AV3A 5IN4A 6ABPA 1AKVA 1MLDA 1XQXA 2DFKB 1J0CA 2JCGA 3A1CA 3X1KA 3HJTA 3IQXA 3ZWXA 2PRKA 5CGQB 1XVVA 2C2GA 1RFGE 4IMRA 4NKRA 3TPZA 2J45A 4BE9A 2PEYA 4JKOA 2IS2A 1KS2A 5A7HA 3VR1A 1DMRA 1OBFO 2ZIGA 2ZAIA 3OHPA 2ZJBA 1G8PA 2JBAB 3B5JA 2G4CA 2VJMA 4ZVPA 2GZRA 1FMFA 1UFQA 3KKEA 1OREA 3H4TA 3FPHA 4LHEA 5SICE 5HIKA 1CERA 4B6PA 4BP1A 3M5DA 3A6ZA 3QKSA 4OA5A 3C43A 2PFKA 1DQRA 5DWQA 3FCAA 1N5RA 4XQEA 5EXXA 1XZPA 4KREA 3GNSA 3PHBE 1CEYA 3PEWA 1KOFA 3KWLA 1X7WA 3NYQA 5BT9A 3TSWA 4KXXA 4LVNA 2ZJ6A 3OZIA 4KV9A 3O8OA 1NRIA 5TGDA 4ZEXA 4HH3C 4MV4A 5BNWA 4BEWA 2WPDD 5BSEA 5J23A 3CZRA 2ZJ2A 3H7IA 5KC8A 1BDBA 1QKJA 3LUBA 1L8QA 5K0TA 3WYAA 3UNXA 3D81A 4J16C 1MB4A 1ONNA 3CR3C 2CFCA 3LLCA 4TL9A 5G40A 4J1NA 4ND5A 3T5CA 2P3LA 4F2GA 1JDPA 2COKA 3IP9A 5EXSA 2C88A 3VSAA 4M3NA 5CU7A 4BRZA 3ISVA 4NFYA 4U7JA 1N1MA 2YJ5A 3UC5A 4MWEA 5C8YA 1UR5A 2GUGA 2QRVB 3LVRE 4JR0A 3GHHA 4A8JB 4BQRA 3LCRA 5FOVA 5KTPA 1C7QA 3BGOS 5HM6A 1EP2B 4L15A 3QHPA 5IAOA 4N3CA 1H5QA 1K7SN 1SU8A 3PEUA 4DMCA 1ZOOA 3FUVA 4DYDA 2I1LA 2QL6A 3NT4A 4MGEA 3DL4A 5CB4F 5BR7A 1JAHA 4HXEB 4YECA 3E18A 4L4UA 4EA8A 3U6BA 3WYFA 2W2VA 3GPBA 1BYIA 4QUEA 2F4VB 3IUSA 3SR4A 1TX4B 3X2FA 3ZZUA 7ABPA 1KJQA 2Z2YA 1X3SA 1KI6B 1OFUX 1T2DA 4HKTA 1XA3A 1YVRA 1E4YA 2CWWA 3V1TC 1CQWA 4B3GA 2HMAA 1THTA 3DOEA 4FYPA 5DYWA 1ABFA 1VSTA 2G0NA 3PFNA 3E9YA 2Q29A 4N49A 4OAOA 4P3NA 3AG6A 4RLHA 2OMKA 5CXSA 1X2BA 3IHWA 4BTEA 4A15A 3VKGA 2BZGA 2CDBA 1W48A 4ZEWA 1BAPA 4DNFA 2OT3B 3H0CA 4QAJA 3RBXA 1WWKA 4X63A 3SNHA 5MGBA 4E4TA 3CG0A 4EMSA 1ZMOA 1FFWA 2VHYA 3HY3A 1LC0A 1U11A 2FZGA 3LXXA 3O94A 5GM1A 4AQDA 5REQA 1BXZA 4ZYXA 4LMBA 4QJ5A 4AUEA 1E2MA 3RRJA 4UD6A 5KBYA 1C0PA 1OASA 3KSBC 1XXHB 2Q3LA 3LUKA 4IFTA 1NTOA 4X45A 3FWHA 4WHMA 1EFRD 1T1IA 4JASB 3T95A 3V7FA 3PX3A 1FEZA 3GRPA 2D2EA 3E2IA 2B8JA 1XZMA 4GECA 4Q21A 3COSA 3EOZA 2QM8A 3C8UA 2Y0EA 3RARA 3SQLA 3ZWPA 5CPBA 3RHSA 1M33A 4WX2B 2R6CA 4RKFA 4D1YA 4HN2A 1Y0BA 1JZSA 4GRAA 1U8FO 4CKBB 5ICSA 4EMBA 4LE2A 3V1MA 8ADHA 2VZ9A 3FLAA 4YJFB 3WIBA 4A0QA 1W581 1LPAB 4QPPA 4UAVA 4AYTA 3E1KA 3PQ4A 5D2CA 2O6HA 3I6IA 1QKIA 3AL0C 3MCVA 5U1PA 3L4SO 1N0WA 3SZLA 4J91A 5FYDA 3KWMA 1ZMRA 2F3RA 3DZCA 4XQGA 4TVOA 3KQNA 4MW4A 4JNCA 1CYDA 3KU4A 3G89A 3UWMA 1A8PA 4QSMA 4N7RA 5DCLA 4BEJA 1A7UA 2AJTA 1Q3TA 2EU8A 1HT2E 2PGLA 2NLOA 1PDVA 2O0MA 3S4YA 5C2JB 1JDBB 3N7UA 1GAQA 1M7HA 3AUFA 2JFPA 1W4CA 2C57A 2IEBA 3FCUB 2XZDA 2WM2A 1I6KA 2O2HA 4ZQGA 1A5ZA 2R7AA 2EOAA 3K30A 2O2ZA 1GGJA 2PSJA 3GEHA 1AQYA 2NPOA 2M6RA 3L8FA 4UQLA 3D8SA 3L02A 1YZQA 3HEAA 4IOMA 2OECA 3ZNNA 4MTLA 2IP4A 3D6TB 4BKRA 2FSGA 3W2FA 5FOSA 4PXSA 1FYFA 3R7WB 4YQFA 1AA6A 4NZPA 4CF3A 1ODCA 3OESA 2Q1YA 3CNEA 1R6XA 3CH7A 3BILA 2OCDA 4DXHA 1CF4A 1XI2A 2WBLC 1Z56C 3FLBA 2Y2UA 3VKWA 1W88A 5MFZA 2BT4A 4HYQA 4GOLD 1BU8A 2P78A 1V8ZA 1F8XA 4QXPA 3K35A 1EHYA 4A8TA 2R66A 2OHOA 5TEVA 3EIXA 1ZH2A 1WL8A 3IBCA 5F73A 3RU3A 4AJNA 3O7MA 3AUUA 3H9BA 3NBZC 4NCXA 3EY9A 2W2NA 1GLNA 3MWLA 3I53A 3IQWA 3KKKA 5FNVB 4MOWA 2EHDA 2FZCA 2R6FA 2FCAA 4LZOA 5DBOA 4I7EA 1E89A 1YACA 4IV5A 4CIVA 4MWCA 1CIPA 2HWXA 4MWBA 3ETLA 3UWSA 1BJTA 3PCXA 4GOOD 1CHNA 4I9NA 2DQKA 3E0QA 1Y1LA 3RJZA 4GPD1 1RPZA 4YMGA 3O2SB 3TSCA 4DNXA 2C8LA 5DH9A 5EIOA 2XTMA 2VJNA 3LY5A 4CUJA 3ZZTA 5JBIA 2FXVA 5BNFA 4RD2A 3TI9A 1Y4DE 3TSAA 2Z43A 4BWFB 5LLTA 2ZSJA 3GROA 1RU3A 5KB3A 2ESRA 4XLLA 1ZI9A 5DNDA 2HEIA 4JODA 3CM0A 1IFXA 3BB4A 3R5XA 4AIIA 3GJYA 3RJTA 4DKJA 3N2KB 3PXGA 1HDCA 4QWMA 1FJGB 1NVXQ 3S81A 2YYAA 3P0RA 2YJNA 3WGOA 3X0DA 1RNLA 1S02A 1W29A 4XEHA 1I6WA 5ALJA 1W36D 1S3IA 1O4VA 1MEOA 4LNAA 2JCSA 5K3FA 1G2QA 4PFQA 4Y6PA 5HZKA 4D0LB 4Z5XA 1ZJWA 5B57C 1LRKA 2ZJZA 4JA2A 4TV8A 5JCPA 2IBSA 1WMDA 5FWAA 1WSDA 4LJ6A 1YDHA 3AEQA 3EIHA 1GCIA 3U5ZB 4NX2A 1FMJA 1Z0FA 3NCTA 1DARA 1M2EA 1ZM9A 2FSVA 1DUIA 2I3BA 1E3TA 2PEZA 2GZ2A 4IIDA 4OAQA 5ANRB 2ZETA 4EMUA 5JO9A 1JEQB 4CMJA 2FEAA 3NHWA 3U44A 1UP6A 4Q02A 4QLAA 3SC3A 1RRCA 3FUWA 1CVIA 2O0KA 5AW9A 4OP1A 5HGXA 1HSOA 4UAGA 4N48A 4K6OA 4KLZA 5E3JA 4Y6QA 2J46A 2Q6IA 4EKDA 5CG2A 1EQUA 4LWQA 2B83A 1KP2A 2E85A 4GR9A 3LDAA 4E11A 4EHLA 1IL0A 1DJNA 2HDHA 1UJ2A 2QG9A 4P34A 1A9XB 2DP4E 1N8KA 3T38A 4JQZA 3K0CC 1GT6A 4C08A 4C0SA 3PFHA 1CCWA 1PCXA 5F7JA 4GEKA 3DOHA 4B6EA 4KQEA 1SZDA 1Y8QB 3RV3A 5GMOA 3JQ9A 2PKQP 4M7PA 5B12A 2CLKB 1TQ8A 3NCHA 4OL9A 3JAWB 4B3IA 5EJ8A 2P35A 4YBZA 2CHGA 3AESB 2OC4A 1MH1A 2YYZA 1L1FA 5DNAA 1GRVA 1J8FA 3H2ZA 4DMUB 3K8QA 2DETA 4H1HA 2IH4A 2LCQA 1E20A 1BA3A 1JH8A 1GEGA 1HBJA 4TTAA 3M8KA 4YALA 1TEVA 3RBAA 2HRRA 1Z08A 1PYDA 2BRUA 3THXB 4URYR 4XVCA 1SOVA 2Q46A 2PX6A 1T5HX 3QLEA 4G0PA 1WXGA 4G01B 1TT5B 4QDTA 4J03A 1VL6A 5EHNA 2GZHA 2Q3BA 4W1QA 1G5FA 1W2GA 1XN4A 3WRXA 1M2JA 1YOBA 1E9FA 4MPRA 2VTDA 3IBGA 4YDRA 3F46A 1Z4OA 3VTZA 5G2OA 1MU0A 5J1SB 1E3IA 1JLSA 4FWTA 4CLRA 3EPRA 3HH8A 3OM0A 2G7MC 3V7UA 4UHCA 3AUTA 4I55F 3FBWA 2WV7A 4PIVA 3ASUA 1C9DB 4EW6A 2DQSA 3QYPA 2EFCB 3W78A 1ULBA 3LQ1A 3QHAA 1F8FA 4RM2A 2NU6B 1UDRA 4IQ0A 1C7JA 3H16A 3TTYA 4MYDA 4BYMA 2RHMA 3ZDZB 3AR5A 5IAJA 2HHHB 3T7JA 5CCDA 1WCXA 4O59O 1N36B 4PF1A 1O87A 4MK4A 2G1PA 4KKVA 3GAFA 1QUFA 1TKBA 3DC7A 4M1SA 1L5LA 1H65A 2VYVD 3AHFA 1M2FA 2WEKA 2R8YA 1NJ2A 5JCJD 1CRPA 1R5OA 3KQSA 3PUKA 3F9RA 3DDUA 3GWZA 1HKHA 3QUQA 2EEPA 4QUIA 4C22A 3T9EA 3O5AA 1MAWA 1Z4NA 2JCBA 3ND5A 4K87A 3ZU5A 4KN6A 4HY3A 4NFLA 4IL5A 1ODJA 4F38A 2FQXA 4GDFA 4OP2A 1W34A 1ECFA 2W8BA 2ECPA 2J7PD 4ZVSA 3DMPA 2X2EA 3C5WP 1WOMA 4OUDB 4YASA 3BD6A 1N8NA 4DUGD 4BNUA 3B20A 4FJ0A 4IDDA 3TUJC 3GBPA 2WAXA 3IIEA 3N76A 1FDWA 3H1GA 1GG9A 2WWRA 4UPVA 3DFIA 2QYHA 4M49A 4NHEA 2BEVB 3SLGA 1B16A 3IEKA 2H4ZA 3ROQA 4NJOA 1OUMA 2Q9CA 2FZKA 4FGLA 4ASUA 4RY8A 3ROEA 1YB1A 2FP3A 2QAGB 4CMEC 5AVTA 4HQFA 1PRYA 3HVRA 1ZOPA 4EY5A 1KEVA 2NO4A 3MUNA 2D2FA 1S6YA 4OBWA 2VP2A 4QULA 2C4MA 2C3MA 4CQLA 4DSAA 2QN8A 3N86A 2NO6A 4Y0NA 4TTJA 2MSKA 2XRZA 2VTBA 2PSSA 5DN6A 1G5PA 1MR3F 2FN7A 4IHAA 1UKYA 2V6BA 3F5QA 4MWZA 4O8ZA 4B44A 4C4OA 2A14A 1WXHA 2QD3A 1ADFA 4LXXA 1ZX1A 1NPYA 2GTPA 3A3NA 5DKFA 2C1XA 1KYTA 4BFUA 1MB2A 3I6BA 3UV6A 2X9GA 2FW1A 2LCIA 3HTXA 1QCZA 4X20B 3HMKA 4BO7A 5DI3B 3ZU2A 1IC6A 2IH5A 5BYKA 2PZEA 4KHZA 2B0JA 4FE4A 4YQZA 4CQJA 2EC5A 4E13A 1QG2A 3OQIB 4AZ3B 4Q3NA 4BBJA 2ZJ1A 4PYKA 4Y9TA 1NVVR 3LT4A 4E15A 3PE3A 4QAQA 3HI4A 5EZQA 3HGMA 1EFCA 1GDDA 4JIGA 4PC6A 5HFAA 1JAYA 1ZXXA 3TW6A 3Q0IA 2CFTA 3AVQA 2XDYA 3IKVA 3QYFA 3GLHB 3QPWA 4PHFA 4IDGA 4HAUA 2PX3A 4I81A 3IUNA 4MUMA 4CMCA 3E7PA 4XXHA 5ECWA 3T1VA 3CVUA 4YROA 1XEFA 4ZVKA 4BGDA 4Q37A 1FRFS 1UXKA 4B3CA 1BX0A 2VF8A 3C7TA 1KVSA 1SC3A 1HQKA 5F1YA 1SZJG 2VP0A 3HBAA 3JYNA 3ZW7A 2HQOA 2WKQA 3DDWA 4WLOA 5CX1A 2RAFA 4OYLA 5C5DA 3K2IA 3UQZA 1Z28A 1P0MA 3KM0A 3D1LA 4TV9F 2OXIA 3I76A 3TMKA 3STWA 1G8JA 2J8ZA 3LXRA 4EYEA 3DL7A 1NW3A 3BQNB 3G0DA 4CW7A 4ZAXA 3MBIA 4WOBA 1PK7A 1TAUA 3GJ5A 3O38A 3WK8A 4CJXA 4KJXA 2K5UA 4M0LA 4QOJA 3F8TA 5DASA 3WVNA 2W6NA 2VDJA 1YBVA 3GZTB 3I0MA 3ZC3A 2JI7A 1SG9A 2BI7A 1PLLA 4OHVA 4BV2A 2BFCB 3LW7A 1RP1A 1TF5A 4QHTA 5K4HA 2QMHA 5JG7A 1TAHA 3DZ8A 3VR2A 2O5EA 4GM0A 1ORRA 5JYCA 4YP9A 4WVFA 3W8NA 3RAEC 5A05A 3AUYA 4EEKA 1WB4A 3AJ9A 3KFXA 3I4FA 4U7GA 1IM8A 1H2YA 3NG1A 4GI2A 5C18A 3VYVA 1ECPA 1GCAA 3KUCA 3OZEA 5C4GB 1OT3A 3REQA 3ZW8A 3BULA 3ZE8A 3FUXA 3O4RA 3NNNA 4QOIA 5CVEA 5DHAA 5EIXA 3W2TA 1YUMA 3VZPA 1KEUA 4JHLA 5BOVA 2AKEA 2VSFA 1SCDA 2EG5A 3HFGA 4INAA 4PSVA 3UB2A 4KQFA 1N4AA 4GUAA 4GZLA 5FBRB 2AG1A 3R7NA 4QOSA 4UTOA 3V8NA 1DXOA 4DLBA 3EX7C 3HVKA 3W6UA 4CE6A 3VR0A 4A5OA 3THRA 5BSHA 1EUYA 2IYZA 1XPUA 3U26A 3UAZA 4RZ3A 3HM9A 4U9UA 1BMTA 1SBNE 4ZGBA 3GRRA 3HKCB 4JZYA 1I1OA 5JQWA 1FDOA 2BKXA 3GJRA 3PFIA 1NUAA 2NAFA 3M6FA 1FZTA 4EPWA 5LWHA 3CUTA 2XTJA 2IBTA 1Z0JA 1O5OA 1P2BA 5I4BA 1QPBA 4Y67A 4YPVA 1IQRA 3KYBA 4M0CA 5HG0A 1Z0ZA 1Z6QA 4ZOLB 5CVDA 5ILGA 2Z98A 5T3UA 2IPNA 3GJ4A 4FR5A 4DCVA 1QHIA 1C7ZA 4Z4FA 4MEJA 1DDOA 1Y7IA 1XC7A 1TVMA 4IGKA 4J16A 1CUGA 4TKUB 4WUTA 5BV0A 3L43A 3CNLA 1V39A 3RAFC 1KI3A 4NS4A 5FTKA 3O6VA 4GBED 1NZJA 1X2EA 2HO5A 2P77A 1O77A 2NADA 3FCXA 1CE8B 3A4TA 4RY2A 1UQUA 1W9MA 4LYGA 2FWPA 4O0MA 4DGQA 1F1JA 5FADA 1SOAA 4MRSA 2H2DA 2IUSA 2J5XA 3L0ZA 3ZHYA 2A84A 5KU1A 1OBHA 1O8BA 5J2UA 1OIXA 4Z8YA 4L5YA 1XEXA 1KQPA 1NUQA 1P2TA 3BMXA 3FZNA 3JRWA 4EBBA 1OIWA 2JZOA 2VJDA 4PIPA 5B1HA 1Y6QA 5BMVA 3WGIA 3ILHA 1C1DB 4FLMA 3IV6A 1D5WA 3D2BA 4BRUA 1K88A 4DSTA 1DJPA 4H7HA 4FM9A 1HZJA 3DV2A 5LBUA 3HYNA 4NABA 3O3OB 1QGDA 1I1HA 3CLUC 3OZTA 5DTMA 1R6BX 1XWFA 1NQAO 3DH0A 2MWMA 3DQQA 4ZEOA 3TRIA 3GARA 3KWFA 1E69A 4IHJF 3KFVA 4JIMA 2IUUA 3QW2A 3RVJA 1AKRA 4UU8A 5LD2C 4KX3A 1RHQA 1NI4B 3AJRA 3NDPA 2HCTA 3HPRA 1DELA 1JEYB 3V4SA 2G67A 3HU2A 1JKJB 1QM5A 3CKMA 3INGA 4OYHA 4P7BA 1T8SA 3W8EA 2XMRA 1DAKA 1MXFA 4FFOA 1BCSA 2DVMA 1VRCA 4LBVA 1XHLA 4DKXA 1W36B 1ZK4A 3A6GA 3ZD7A 4UFPA 4WA7A 3O83A 3LIIA 5C5CA 2HQSA 3MS4A 3QLVA 3UFXA 1OLXA 1IJKA 1E4VA 2FI1A 4DV7B 1CX9B 3AO0B 2R1TB 5JTTA 3TQOA 4JEMA 4L95C 1FY2A 3DEZA 4GR4A 2PS9A 4E1VA 5JNVA 1DC8A 3SGLA 4D6XA 4RETA 3DUWA 3KT6A 1YHYA 4DOMA 4Q4LA 1UDAA 4DUZB 3BTSA 1VHJA 4WK6A 2PL9A 5SZKB 5F4ZA 4NCHA 3URMA 1SHZA 4BGEA 3E35A 1QHYA 5KPDA 2FRDC 2AFIE 1FVXA 2HW8A 3AZPA 1JHDA 5BW5A 2Z9CA 4MI1A 4HDQB 4K9PA 2VOJA 1QSGA 2IHTA 3OBBA 3O8LA 2QP9X 2VJPA 1YJ8A 3A28A 3HCPA 4V1CI 3M82A 4NNPA 4UHDA 3PZRA 3HKBA 1V43A 3V1UA 3DE7X 3VNUA 1DZIA 5BOSB 4FHEA 3VPGA 1RFLA 1P7ZA 3RKSA 3NWJA 4H1WA 2PMWB 5JOQA 2LP4Y 3NJRA 1CQPA 4TQGA 3BWVA 5CNKA 4ID9A 1ESDA 1TAGA 1HFWA 1R74A 1VI6A 2X15A 4CU2A 1OHHD 4EFDA 3H1EA 3GA7A 2IPAB 3LWBA 2EKDA 1JV2B 1JFFB 1EMDA 3WA6A 2ASEA 2IODA 1SCNE 3IQEA 5KCMA 1CS0B 4PHHA 1F51E 3C5HA 1KP3A 5DN9A 3UOAB 2REQB 2CJFA 4GT1A 5A4JA 3A6FA 1DADA 4HBGA 2VUIB 1PR2A 2GFHA 1UBOS 1M6YA 1SBZA 2C9OA 3F71A 2GA9A 1SVMA 1U99A 1XWIA 3FJOA 5DHPA 3TRJA 1USGA 4WZ6A 2GERA 4L0QA 1S2LA 3ZE6A 1DWOA 1U7UA 1F6BA 1CDEA 2GASA 2I2BA 1EYZA 1G9TA 3FYHA 4C7MA 3KU1A 2ID9A 1CIJA 1U5BA 3SU8A 4MVCA 1O3YA 1QZZA 2EX4A 2QG4A 2JEYA 2WD9A 4RHFA 3T9AA 5CM8B 4NENB 4QSHA 2MTBA 1UT8A 5TPZD 1FDUA 2NXWA 1MV8A 3NIGB 4Y2GA 4C3UA 1KSHA 3TEMA 2IELA 4O29A 5ETJA 3ZJ4A 1KXZA 1VIMA 4RIFA 5ERXA 2EWMA 4PG5A 5KREA 4JXZA 1XSEA 1BRTA 1SHUX 1ZM3A 2J5BA 3PNYA 1EFDN 4QYIA 4BLTA 3H1TA 1UWLA 3RSZA 5BQPA 4W63A 4C4YA 2LIVA 4ZO7A 1TCCA 2IEDA 3TTSA 1OB5A 2WTMA 5LYJF 1JU4A 1TUBB 3OHSX 1EFVB 4DAOA 4HC4A 2C0PA 4OHFA 2OLEA 1Y34E 3RRXA 721PA 2GQ0A 4E5UA 4IDOA 1ZSVA 5JMWA 2QN1A 1EJBA 3FN4A 1XIVA 4MR8B 2AFIB 3RS9A 1GQYA 1V8FA 4HDAA 5JZSA 3JVDA 4ZAZA 2D6FA 3KDSE 4MPTA 1OGIA 1T3TA 1YU6A 4HQNA 4BCBA 1PLJA 3QSGA 4MMZB 3ILYA 2HV8A 1VSQA 3GCZA 2VP9A 3ETNA 3IKJA 3VPSA 3W5VA 1D2MA 3EUWA 3EVNA 4AROA 4WCVA 3NTVA 4K6CA 2OKCA 1OA1A 1XRLA 4OMDA 2G0TA 1SKBA 3S55A 2ATCA 1TJNA 1JDJA 1BXGB 1RQ7A 3OEYA 4N8SA 2Q1WA 3QU2A 2BKVA 2NZ2A 1MMFB 1VBKA 4G0UA 2O4CA 1TKCA 4HADA 1IUKA 1FSSA 3USZA 1QZ3A 5I9TA 4FXPA 4DQ0A 1W4RA 2QTFA 4DIKA 3T9DA 1J70A 2FPGA 5IJ9A 1M6VA 4NBLA 1K0UA 5DWDA 1VXOA 1RBMA 2V74B 1ZD5A 2AS0A 1AK2A 2PLAA 3KUUA 2G82A 2LBPA 4BZQA 3Q7SA 2A67A 4LYJA 5FR2A 1LPSA 1KQNA 1U0LA 4GX0A 4C4TA 3TLZA 4DM3A 1HZZC 1XCOA 1L5ZA 1CY2A 2O3RA 1C7RA 3NOVA 2PUDA 5E2BA 1P60A 1GLVA 2H7CA 2QG6A 2EBHX 3RC8A 3OTOB 4KBFA 1QBGA 1UXJA 1KHTA 1ZGHA 3AVOA 4FFBB 2FWAA 3B7WA 3OLCX 2NTJA 3PDIB 4G8BA 3WG9A 5FFFA 1SC1A 3DLBA 1E2EA 5FWXB 1WNTA 2HADA 2V6JA 4ZCQA 3W5JA 3L6OO 2D8AA 3F6EX 3CZ5A 3LRTA 3LTEA 2PL5A 3GAMA 3KUKA 3DEIA 3FCSB 1N7GA 2ECOA 1IPFA 2CLHB 2WF9A 4TV8F 1GTVA 1U3VA 5D5HA 3QFSA 1FUIA 4RXUA 3UQYS 4ACBA 4WECA 1P2DA 4EUFA 1DKLA 4BNDA 1QE0A 4L7QA 1XCJA 3PCTA 4GZ3A 1WV0A 3K0CA 3RVKA 5HZGA 2QX9A 3NC0C 3RYCB 1JFSA 1Q3HA 3LGSA 2IU4A 5CPFA 2C8VA 1BEZA 3U2QA 1DWPA 1W1WA 3GRCA 1DKPA 1JQAA 4FMCB 1SEVA 1SAYA 2VHEA 3DL2A 4C14A 5HRCA 2JGLA 4YFYA 3RF6A 3DNPA 1NG1A 1SCAA 1UEIA 4JXKA 4L9WA 3QYAA 4DABA 2YVKA 4JLOA 1FU7A 5ARBA 3FWNA 1E7SA 1CUBA 1XP5A 1ZVKA 2YMMA 4KQCA 1B14A 4OEHA 4DEVA 3D8RA 5A0TA 1X0XA 3K5WA 2SECE 1PV1A 4N65A 3CLSC 5IYZA 2EZUA 3PA8A 2CJXA 4C29A 3L7YA 4FBLA 4JS0A 1HDRA 2ERCA 2X3YA 2DC1A 5EWLB 5I3ZA 1KA9H 1TO6A 1JALA 4HD8A 4FFSA 4HGNA 4N9QA 3K0EA 1A4UA 5JASA 1JTFA 4XDYA 2A4KA 1T9GS 4KL8S 1MORA 4E3ZA 5F9HA 2Q2OA 4MUXA 1MTZA 4JSTA 4E30A 1T8UA 4G86A 2IZ7A 1IVSA 4GF5A 3M4NA 3C8ZA 3EARA 4AS1A 2AN1A 3LBAA 1C3XA 4ABTA 1UPUA 4RF5A 4CIYA 2PPVA