1MV5A

Crystal structure of lmra atp-binding domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multidrug resistance ABC transporter ATP-binding and permeas
publication title Crystal structure of LmrA ATP-binding domain reveals the two-site alternating mechanism at molecular level
rcsb
source organism Lactococcus lactis
molecule tags Transport protein
total genus 63
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 7.6.2.2: ABC-type xenobiotic transporter.
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mv5A00
2P6UA 1OFTA 4ZIRA 3FHCB 4DXAA 4B3XA 1Q44A 4RZ3A 4OL0A 4D81A 4QGFA 3SQWA 3Q5EA 1MO4A 2LKDA 3RS2A 1KO8A 1EWRA 2ZI6A 3EG5A 3SJZA 4DLWA 3EPJA 1IM2A 3BS4A 1SXJA 4XTRA 4M4SA 1W0JD 2RKOA 1AN0A 4YMTA 2K5UA 4HB3A 4CEHB 1NI3A 4TN1A 4LUCA 1QHNA 3NC0C 2WJJA 2X2FA 2GF9A 2QORA 3KKQA 4NCNA 1IQPA 2G0NA 2FSIA 2XXAA 2EVWX 5TARA 2HXSA 3RNLA 1IN5A 3MUFA 1S9DA 4CYMA 1QG4A 1L2TA 4X8HA 2YOGA 1AKEA 4D4JA 3E70C 4LV5B 4NCJA 3P27A 1W4BA 4BEBA 4JLAA 2FPMA 5AJVB 5HTKA 4EJSA 2ZSEA 3RWOA 5AUNB 3U7HB 2KI5A 1II8A 5BWMA 4OI4A 3TVTA 2QL6A 4JLNA 2JLSA 1BS1A 4KCGA 1C4OA 3QE0A 3ZS8A 5M04A 1LVGA 4ZO4A 3TE6A 2QP9X 4PC6A 2QNRA 1UKEA 5KDLA 1NIJA 1CU1A 1E2MA 2ZJ8A 3QSYA 3HR8A 1X1RA 1E94E 1ZM4A 3KKPA 3RHFA 4M1TA 1FNNA 1E2QA 1P2TA 1SXJD 2WWXA 5J5CA 4AYTA 5ELXA 2NTYC 2E1RA 1NNEA 3AVVA 1UF9A 4B3GA 1EFHA 5EE9A 2ODWA 5FBQB 2HLDA 3CX6A 2EYQA 2W58A 3LWNA 4RZXA 3PXGA 4H1VA 4A9AA 4LJ9A 4Q1DA 2ZRJA 1RRGA 1XEXB 3K9NA 2WOOA 1P2VA 5EXSA 1W7AA 1G8HA 3IUYA 1OYWA 1Z2CA 3GP8A 1ZMXA 3PR1A 1S2MA 2DWQA 4U5XA 1NN1A 4Q19A 2HT1A 1ESMA 3ADDA 4C2UA 1JEEA 2FFHA 4D2IA 2QEQA 2EYUA 5EZ5A 3TIFA 3NBYC 3DVLA 2ZI7A 3QVVA 2QY9A 1KI9A 4Q4HB 4DBLC 4EPXA 1P60A 3QPWA 2IL1A 4JJZA 2BMEA 3W8NA 1CJMA 1Z0JA 2QPTA 4K46A 1N6RA 3SBDA 1RRPA 2ERXA 4BZPA 5EE1A 1JR3A 3EZ2A 5KSPA 2QAGA 4Z8YA 1E9FA 1GP2A 4AG5A 1YQTA 1PLLA 3PUWA 1QHIA 2QN6A 5CM8B 2B6HA 3VHXA 1P2SA 3ZVLA 1OIXA 1KMHA 4YQFA 5FBVB 1ZNWA 3K0FB 3I62A 2HLDD 1HE8B 4OHXA 3QEOA 4M9XA 5DISB 2WPDD 1CJTC 4G1UC 1DG1G 1TNDA 4B6FA 1XPUA 2IUUA 3WBKA 3AVYA 2IHBA 5HZKA 1KTVA 2HT6A 5EUMA 5A5GA 2IS2A 5KNCA 4BZXA 1G4AE 3A4NA 1EG7A 1HT2E 1CR4A 2ZRKA 4H9GA 3TNFA 1QHHB 1GKUB 2GXUA 4A8JA 1BYUA 2F1RA 1T3SA 3CB4A 3HYRA 5FR1A 3SI7A 4JT4A 3C5HA 2HJVA 5K8TA 3VKWA 3BERA 1UBCA 2RGNC 3TQFA 3W6NA 5J4KA 3EX7C 5DH9A 4D25A 4C30A 2O5VA 4M8NE 3OIWA 1JR3D 4HYYA 4EDHA 1TX4B 4Q4JA 3MD0A 4PSVA 1YRAA 4PTLA 421PA 3AVWA 1XTQA 1Z83A 1NN3A 3R9WA 3AF4A 4OI2A 1OB2A 5GJWC 3K70D 1I4LD 1M8PA 1QHXA 2UVQA 4RFVA 5HE8A 4DC9A 3TVDA 2WJGA 1UJ2A 3EPHA 1M34E 2KB0A 3GJ3A 3H86A 4OK5A 3WRYC 5JLJA 1YR8A 4N0DA 2ZRIA 3IEUA 4URZR 1AZSC 4RD2A 1QBKC 2ZRCA 2GZDA 4KFSA 3AEZA 3MLEA 4LX0A 4RKFA 3SHWA 1F5NA 2REXB 821PA 1N6PA 1T9HA 4JLDA 5EXTA 2G6BA 2DR3A 1ODFA 1G4UR 2IYUA 3F0TA 4DLTA 4ZDIA 2G1KA 3EARA 1G18A 1TF5A 2VP5A 4JS0A 5AWFC 5JJLA 1W49A 1SVWA 4GZLA 4L5BA 3ZZTA 2CEAA 1GG2A 1QF9A 1FW6A 1U0JA 5G3YA 1AM4D 1N25A 1O3YA 3PEVA 4ZKEA 4GOKA 2QAJA 2C5LA 1DE0A 2DFTA 3NVAA 3QIAA 4FWIB 4IXNA 1S8FA 2Q9BA 3U6BA 1ESNA 4NCKA 1TTTA 1KK1A 3GLFE 1ZUIA 3VFDA 3RC8A 1XFAA 1YHNA 5KDOA 5FTKA 2DFKB 5FFMA 3OEED 4CRWB 1CBUA 3T06B 3KQLA 2O8EA 4XVUA 2GJSA 1JAHA 2X77A 1E2PA 2ZETA 4RVCA 4YMUA 3MSXA 4UJ3A 4UNPA 4LRWA 1XD2A 1EFUA 3LNCA 4C0JA 1OXSC 4US0R 1LW7A 3B6EA 1J8YF 1N6KA 5CITA 4JIMA 5C4GB 4I1OA 4CT5A 4LZZA 2J59A 3B1VA 3AVTA 3QUSA 2JLYA 2B21A 4II7A 1E2FA 3THWB 4W7SA 1UM8A 1IXSB 5E7IA 4MH0R 5HKKD 2GZHA 1VYTA 1ZNXA 3U7GA 2IF2A 3HP1A 4EFMA 5G53C 1W0KA 4CEHA 2JJ2D 2WAXA 2HUPA 4B3BA 1XXHB 4DEYA 4IOKA 3VR1A 1KNXA 5FBWB 2NO1A 1NKSA 4KSCA 3RYTC 1KSFX 4DCNA 2J0SA 2Z6VA 3NH6A 4XVQA 2V6JA 2O8CA 3QKTA 3ASZA 3OZXA 4XD7A 2IT1A 3VU9B 2ONKA 2FGJA 5L3VA 2QM7A 1SGWA 1ZINA 3AH8A 4QGGA 3C4JA 3LLMA 4A6PA 1XMIA 2G83A 5KPJA 1OF1A 5CYPA 1ZNYA 3WXMA 2ZRBA 3K0EA 5DI3A 3QXHA 4S35A 3RVBA 4BFWA 2P6RA 2O8FA 2L0XA 3AF2A 4Q9HA 3A1SA 1KNQA 1P6XA 3LRPA 1ZIPA 2DBYA 2W2VA 4YMWA 1R2QA 2VBCA 4Q7JB 3PENA 1W0KD 3W3ZB 3VR6A 1ZM9A 3VR4A 1FL9A 3BD9A 1DO0A 2ZE8A 1T3HA 1F2UA 2IYLD 3CX8A 1MV5A 1GRNA 4GT1A 2DB3A 4IDHA 3AVQA 2ANCA 2ZVQX 2FU5C 2R65A 4QM6A 1B0UA 2GCOA 3T1TA 2RGAA 4XD7D 1TQ6A 4BFUA 3KXIA 2CCGA 1RFLA 2BWJA 2WMNB 2IYVA 3OAAA 4DLSA 4HEJA 1KY2A 4YMVA 3GLGB 2GCNA 4A1FA 2XSZD 3E2IA 1E2KA 2R6AA 1E2GA 2ZRFA 4HUQA 3EIQA 4PQFA 1P72A 2QM8A 3GLFA 4QM7A 1YZKA 2AFHE 4P33A 4DRZA 121PA 3BC1A 1Z5ZA 1KSJA 2ZE5A 1D5CA 3IBYA 4XOIA 4FI3C 4LK2A 5JWOA 1GOTA 1A82A 5A0FA 4QJ4A 4DDTA 5F9HA 1DAKA 1R0XA 1W5TA 1SVIA 2CJWB 4G5GA 4DDWA 1DAHA 4TQUS 1Y63A 2DY1A 4RD0A 4Q4LA 1GILA 3UXMA 2ODBA 2IF0A 1FOEB 3IQWA 4B47A 4W5HA 3HU1A 1ZYUA 2HEIA 3K0FA 4LOAA 2FPLA 2P6NA 2ZS9A 3R9XA 5BN4A 4R2IA 5DHAA 1MR3F 4DZZA 2W00A 2I1QA 4Q01A 4LBWA 2FMXA 3P4YA 2WKRA 3OAAD 1II0A 1U98A 1SKYB 4JBWA 4CZ2A 4X8MA 2R6GA 5AUPB 4KLNA 3GPLA 1VCIA 1YR9A 3KFXA 1QHHA 2G88A 1KY3A 2BKEA 1DO2A 4U7DA 1KDTA 1B23P 4B35A 1FP6A 2WWYA 3FKQA 2ZRMA 1K8RA 2EU8A 2VF7A 1HQCA 4Q1CA 2YWGA 2CLCX 2DPXA 5AJWA 2NZJA 5C4MA 3AF3A 3KQUA 2ZS8A 3RRZA 3T61A 2N1BA 5KDDA 4ESVA 1CKEA 2CXXA 1SVLA 2PCJA 1GL7A 3EZFA 1TUIA 2V7QA 4PPGA 1T8TA 4IOJA 3WMEA 1I4TD 3QENA 4V03A 4WVFA 1U99A 4AKHA 3TAUA 3UANA 5F9FA 2GWHA 2CHQA 2IC5A 3K0AB 4XVRA 3AKYA 2RAPA 2NIPA 4MGIR 1G3MA 4QXAA 3EA0A 3B1WA 2IS1A 2AXPA 2JA1A 2GVZC 3VTKA 4B44A 4TL8A 3SYLA 2FX3A 2WM9B 2WBLC 4RCZA 4OI1A 4LJ8A 2CHGA 3HU3A 4YDHB 2C2HA 2XB4A 4QHSA 1H8ED 2A9KA 2ZYUX 1NY5A 3CO5A 5JMTA 2YC4C 1KI7A 1NRJB 1LNZA 2W6IA 2XEXA 3I32A 3GLHB 3H4MA 4LJ5A 1AQUA 3IIJA 2BDTA 2V7QD 1CULC 3H84A 1EXMA 2QMEA 1NN5A 2PZFA 3UKDA 3S1AB 1UEJA 3AGQA 2MMCA 4JKYA 2O8BA 2ZUBA 2NPIA 1FX0A 5L3SA 4A82A 4BE7B 4F38A 1NJGA 1J2JA 2J9RA 1ZW6A 4DKXA 2D3WA 4ZIRB 2F3RA 2XNSA 4MYUA 1OXTA 3A58B 4OQMA 3KX2A 2C9YA 3R20A 5CDFA 5E95A 1NMXA 1SXJB 5E7JA 3HJNA 4ZI2A 5B57C 1P2UA 2Q9CA 5E4FA 1IXZA 2GXQA 3NG1A 1K6MA 4MRNA 1VKJA 1OJLA 4TQ9A 1L4YA 1PLJA 1U81A 2IUTA 4AD8A 4WXRA 4EQ6B 3OESA 4ARZA 2XXAB 3GJ0A 4RKEA 4B73A 4B3CA 4B33A 5J4YA 2CE2X 2D74A 1UEIA 1A5TA 5KOYA 2ZROA 4JLMA 1DG3A 1TQ4A 1IN8A 1GSIA 4G01B 4QGHA 1HH4A 2WWIA 2ZI9A 3F5FA 2OAQ1 4EJSC 3AP2A 3HPQA 4UXIA 2NO7A 1D2MA 1XXHA 4YC7A 2RH5A 3BBPA 1II8B 3MCAA 3FVQA 3QKUA 4TL7A 1CEEA 4PR0A 3IKJA 2OO7A 2BM1A 4IDOA 4TMZA 3VX3A 4DSNA 1YZLA 3W34A 4QBFA 4TLBA 1Q3TA 3EC2A 1G3RA 4JJKA 1EFCA 3KUDA 4JBXA 3VU9A 2VIIA 1AJEA 2IYSA 4RD4A 4NH0A 4B43A 2GJKA 1G5PA 4AK9A 5J40A 2QI9C 1ZJ6A 3EPLA 1IHUA 4QNMA 4KXFB 3AVUA 3AKEA 3NTUA 2AX4A 1G9XA 1R7RA 3EZ7A 5FUVA 5KU1A 1XTSA 2PZEA 4U02A 2IXFA 5FUXA 1WF3A 3B60A 1NVXQ 4AKEA 4DEXA 5BYKA 4B34A 3GEIA 1QZXA 1SHZA 2QGNA 3K09C 4HZUA 1E2DA 2Z5FA 2TMKA 2PMKA 1NVUQ 2YWEA 4YXWD 4Q47A 5JBQA 1OHHA 2GAAA 1T5IA 2ZR0A 4B74A 2ORIA 1Q1ZA 1QVAA 2RB4A 2NZ8A 2X8AA 1VDZA 2Z0MA 2ZSBA 3AF0A 4ZCLA 5LD2C 1EFTA 1IAQA 5LD2B 1ZM7A 2VTKA 4R9UC 3O47A 3VMFA 5GADl 4WBSA 2GJAA 2R62A 2ZRAA 1E2IA 1IN7A 3JZMA 3B85A 2QAGC 3KFVA 1LS6A 4LPSA 3SBEA 2QAGB 4Q7LA 4TMVA 4BFYA 4YONB 1OH7A 1AS2A 4I1UA 4LJYA 4UNSA 2GJ8A 3PITA 5BW8A 1NMZA 2LCFA 1D2EA 2G9NA 2YINC 3QNUA 5KHOC 4URUR 4PXAA 3TAHA 2CNWA 1HURA 1UDXA 3LX5A 5HCNA 2Q3FA 4E5UA 5IHPA 1X8LA 4GOJA 2Z4RA 721PA 2BJVA 5KSYA 1Q0UA 1Z6TA 2BEKA 5FOUA 3IO3A 2J5XA 3KXKA 4X8OA 4DJTA 1XCPA 1EK0A 4Q1FA 1LF0A 1US8A 3UMSA 5UKDA 1OHHD 3BH0A 4N3NA 4A8JC 3T1VA 3TBKA 4A8JB 1G6HA 1BIFA 2NMVA 4M0LA 3TRFA 1Z6AA 3K9LA 2A3RA 3LQQA 3ECCA 3SJAA 4MGZR 1N6NA 2IXGA 1OH6A 1XU4A 1AGPA 3BH7A 3OE7D 4HB2A 4AYXA 5KSZA 2OG2A 3MG9A 4R7ZA 5ANRB 2KSQA 3ND9A 4Q4JB 1ZD9A 1G291 4MDFA 1ETUA 4UNNA 2ZU0C 1ONBA 4M9SA 2YYZA 2R6DA 1OE0A 1P9NA 2RHMA 1Y3AA 3CLVA 1W1WA 4RFSA 1OT3A 1E99A 3ZZUA 4JSTA 3UMFA 3BJIC 4HLUC 5FOTA 1A2KC 4PHGA 3X1XA 3CNOA 4QL3A 1S1MA 2ODEA 2WHXA 5G40A 2PH1A 5JEEA 2YC2C 1UBGA 4L16A 3A4MA 3B8HA 4MKHA 4WZAE 2JIZD 2ZUCA 3LW7A 1NKTA 2G77B 2ORVA 3U3MA 4A0GA 1UADA 3GJ4A 3K0AA 1XMJA 2EWVA 4FMDB 2XB2A 3RC3A 3PUYA 4QHYA 4DIEA 1XPRA 2IEZA 3MRSA 2VYFA 4CDGA 5EUQB 1OFHA 3L0PA 2VEDA 2BBOA 3I4LA 1ZU5A 1RVDA 5B58C 4FCTA 1W0JA 4ZKDA 4ASUD 4BRWA 3NBXX 2W0SA 3N70A 3H2YA 4URVR 3IO5A 2NO0A 3IPXA 4HAXA 2VF8A 1SQ5A 2O8EB 1NY6A 2FA9A 2B8WA 2W83A 3AB3A 5C18A 2ZSDA 2R2AA 1XD2B 4MKIA 3GLHA 3TSZA 1RE0A 1IONA 1YVDA 2SHKA 4ABYA 2GBLC 1Q12A 3IEVA 1OH5A 1E2EA 1I2MA 2VA8A 2X2EA 1JXMA 3PUXA 4A0HA 5E3HA 5EP4A 2WIAA 4KO8A 2ZTSA 4WAUA 4AI6A 2VQSA 3PV0A 5LB4A 3DMNA 4TMWA 4R98A 2FFAA 3FGNA 1F2TB 3GEHA 4KSBA 4KBGA 4TLCA 3SHFA 4DB2A 1E9BA 1TUEA 5HZHA 3ADCA 1JAIA 2ATXA 1HEIA 3WNDA 5IF9A 2XNDA 3U3KA 5FL7D 4DDVA 2J1LA 4TYWA 2DYKA 2NOAA 1WQ1R 5DYIA 3Q85A 4IFEA 2F43A 4D4LA 4FWTA 4RD1A 3LVRE 3HDTA 4TT3A 3W3AA 4EQ6A 4UNQA 5JWHA 4MQBA 2ZYWX 4EUNA 5DI9A 3OIVA 4A2PA 3TR0A 1I4DD 1XNJA 4PAQA 4PSKA 2O8CB 1ZVQA 3B78A 1RZ3A 3F3YA 2ZE6A 3PUZA 1ZUNB 1AS3A 1D2NA 1QHYA 1MRSA 5K8LA 1LTQA 5JHGB 2JDID 3WP0A 2IS4A 2OCBA 3QXJA 4LC1A 4JVSB 3WMGA 4IVQA 2YVUA 3PJRA 1FQKA 2AWOA 2H16A 2YOFA 3CR7A 2V6IA 1ANKA 3NEJA 2DCUA 2GRJA 4LYFA 3TLXA 3OIUA 4DDUA 3AF1A 3KB1A 2C78A 2QUZA 5DI3B 4AIIA 3NDBB 2O8FB 2D7DA 2IEYA 1IJFA 2RGCA 2XNDD 3PUVA 2VSFA 1GWNA 3EAQA 3U4QA 1W36C 4TZ6A 5F2EA 3ASYA 4IDQA 1W36B 2VP2A 1DAEA 1R10A 4KJZA 2NPFA 4ON9A 4QJ5A 5G41A 2XOKA 4DSUA 1P7CA 3TMKA 1OW3B 4TT3D 3AVOA 1JEDA 3U7EB 1F2UB 2BKUA 4DLXA 4XSHA 1F60A 5BN3A 1NMYA 4XH9B 2WPDA 2GCOB 4NYMQ 2ZJAA 2ZJOA 1R5OA 1XF9A 4NBSA 4PSAA 4Q9LA 4OQFA 1DAGA 3B82A 3CZPA 5JRJA 1A7JA 4HUQB 3DEFA 3CZQA 1D9ZA 2HF8A 2ZPTX 5L3QB 3GLFB 3BORA 2PLRA 2WTUA 4XWKA 2OBNA 1NP6A 2ODNA 1D9XA 2YHSA 4FINA 4LV8B 1Q20A 3DPUA 2Q3HA 4E09A 1GITA 3R8FA 5H8WA 6Q21A 4F92B 1J70A 2FSGA 4AKIA 3AQ4A 4P31A 3I61A 4IOLA 3Q9LA 2XOKD 1NIPA 4L9SA 2Q0HA 1Z0AA 1OIVA 5JZVA 4TYPA 2IX3A 1TQ2A 1ZM2A 4KYUA 3IILA 3WP1B 1DBSA 2PL3A 3IHWA 3MJHA 2RHDA 1KO7A 4PAOA 3IIMA 3AVPA 4A92A 1DVRA 3B2EA 1GDDA 2QMHA 4O0MA 4PZZA 4HI0E 4E22A 1XTJA 3CRRA 4B2LA 2FFBA 2QE7D 1IN6A 5FPSA 3SS8A 5LDDC 2OBMA 1E4YA 3GFTA 2O8DA 3DM5A 2GZAA 4YMSA 2JGNA 5IT5A 4PO9A 2ZS7A 3FWYA 2QRZA 1E0AA 1GFIA 1G5TA 4OK3A 4PPNA 3P32A 4LV6A 1FUKA 2QROA 5JCPA 1R0ZA 3M6AA 2AL7A 1UBEA 4PAMA 2NO9A 2OZEA 3EASA 2D7CA 4QBGB 2ZVPX 4P4UA 2P0EA 3I1FA 3FOZA 2YJTD 3SYKA 2J0UA 1IBRA 4OQNA 4IVRA 3X1ZA 3OEEA 5KTYA 2XZOA 1E0KA 4CVNA 4IDPA 4AC9A 4FN5A 1YR6A 4QG7A 4I1VA 4N0EA 4NDZA 1Z0DA 3I8XA 3X1DA 2DFLA 4UXHA 2X19A 5EP1A 1SKQA 4GZMA 4LPKA 3GCGA 4DUGA 5HR5A 3KQNA 3TUJC 3QKSB 5LBIA 3CWQA 3WHLA 1ZU4A 1CP2A 3BOSA 4C0AC 3NH9A 4JMPA 1AIPA 1VG1A 2WWWA 2DWPA 3DZDA 2AWNA 1X86B 4D0NA 2RCNA 2FZLA 2WV9A 4QC2A 3U6KA 1MO3A 4DCTA 4TLAA 5AUOB 5HKKA 1MO5A 2AK3A 2ZEJA 1KAGA 4HZIA 4HB4A 3UPUA 2D2EA 2A78A 1ZC3A 2CK3A 2BMDA 3ND8A 2PT7A 3OIYA 4A36A 3SR0A 1A4RA 2F1HA 2JJ2A 4IHQA 5DYGA 5DNYB 1UKYA 2OBLA 2QTVB 3TGPA 4DT1A 3WRXC 2O8BB 1W2HA 1DOAA 1KI2A 2EFEB 4QOSA 1VG8A 4TMTA 5KPDA 1FX0B 2AR7A 3GD7A 1OB5A 3Q7PA 5FBLB 4RZUA 3LFUA 3OHMA 4I81A 4B6EA 4S2EA 4DUGD 4NCHA 1NLZA 4R2HA 1VG9B 3T12A 2P65A 2UZ3A 1XTIA 4FCVA 1VG0B 4DSOA 1F2TA 1P9RA 4ARZB 5FBRB 3JZAA 3DKVA 3PIRA 1T4GA 4EPWA 1Z47A 3UK6A 4EPTA 3GJ8A 3K0SA 4BGDA 2C9CA 3UG7A 2CK3D 4KVGA 3U2QA 3UWOA 3KDSE 4MDEA 1Z08A 4Q9IA 2VP4A 2ORWA 1OXVA 2XITA 1CJVC 4O2RA 3B1YA 2PT5A 1R6BX 5JEDA 1CIPA 3PEUA 3RABA 2ZI5A 3EZ9A 3L43A 3TW8B 3GLIE 1H65A 3QKRA 4JLJA 4JSYA 4AYWA 5JS8A 4C0HA 2G0TA 8OHMA 4DB4A 4D26A 3K53A 2BJWA 4DSTA 3M0EA 5SZJA 2FDCA 1ZBDA 2XSZA 2PCLA 4LHZA 1JQLB 2JLXA 2ZSFA 1ZCAA 1X6VA 1VIYA 5EXPA 1II9A 1A2BA 5EQTA 3QG1A 2OE2A 4ZDKA 3WYAA 4GP6A 2PX0A 3LQRA 4OK6A 3RS3A 5J47A 2J7PD 4YLGA 2WICA 1J99A 2BVNA 1YU9A 3KQKA 1E1RD 3SNHA 2N42A 1YZTA 4HZUB 4BFTA 4C0SA 2ZREA 2FE4A 3BK7A 1XEWY 4HLCA 2O0JA 2YWFA 4Q4AB 3KTAA 2JCSA 4NYJQ 1P61B 4EFNA 4C3ZA 4Q5IA 4OI0A 4PHHA 4Q48A 1Z29A 3CR8A 3L0SA 3QF4A 4DCVA 2GKSA 3W5JA 3D8BA 1BMFD 1E9CA 3THXA 5LPNA 3U3OA 4Y0AA 2V3CC 2DHRA 3LLUA 5CM9C 3CPEA 3N2EA 1KI6A 4FMCF 3FYHA 4I99A 3R7WB 4P0TA 2IYXA 4IEEA 1YZGA 1KSGA 4V0LA 2MSEB 3X1YA 5L3QA 4ZV4A 5JFGA 1PLKA 3V9PA 1YZNA 2IBMA 2JAQA 3FKSD 1JR6A 2D62A 1N5IA 3LDAA 2FSHA 4F93B 2QZ4A 4LBYA 4OHVA 1HA3A 1AKYA 1HV8A 2EFCB 2JATA 2W2XA 3CBQA 1UKVY 4LBZA 4LHXA 1US8B 3J81k 4KHZA 1NL3A 1VMAA 2GXAA 1NSFA 3TW4A 4B75A 4GI7A 2HXYA 4JT2A 3DHWC 3H0KA 5FPYA 2P2LA 3AKCA 1FPMA 4JLVA 1JB1A 3EWAA 3LX8A 5FOSA 3LH5A 1E69A 4DWJA 2MMGA 1G17A 2JLRA 3CH5A 1E4VA 4MA4A 1NN0A 1NVWQ 3P26A 3T15A 2BBSA 3LW8A 3SDZA 4AWXA 4C0KA 2AN9A 1EWQA 1KMQA 3QG5A 4ERNA 1D6JA 4ITRC 3SJCA 4L15A 1OV4A 3QXXA 4RFSB 2OEPA 4NYIQ 2C99A 1H8EA 1T0JB 1RJ9A 1DPFA 3KJEA 1W5SA 4TL6A 1TU4A 2IYYA 1CJUC 2BBWA 2VP9A 2VL7A 3CF2A 1ZM3A 1QHSA 3MWJA 5EP2A 5H1YA 1OXUA 3FDIA 1RRCA 3Q5DA 2QPOA 2N46A 4OBEA 2V9PA 4V0ME 4KODA 2F9MA 3Q72A 3OFND 2QRNA 3VX4A 1VPLA 3QVUA 1XCMA 3MJRA 2IWHA 1DELA 2GXSA 1ZCBA 2FEOA 1BKDR 5JS7A 3ZD6A 3E1SA 3RS5A 5C46F 2BCJQ 1U0LA 5BXQC 4DCSA 2OFOA 1XEFA 5DN6A 2AKYA 3QKSA 1M74A 4DLYA 1K5DA 1S3SA 1N3BA 3C41J 1G19A 3D31A 3UG6A 1GNPA 1U94A 4EAQA 2DWOA 4LBVA 5H68A 1EESA 4US2R 1G21E 3PQCA 3DOEA 2JJ1D 1Z6YA 4G0NA 4MKFA 4HDQB 4LJAA 1HE1C 1CRQA 4QFMA 5FR2A 4JLKA 1COWD 1E96A 3C8UA 1EX6A 2VPPA 5FOWA 4EPYA 3ZIAD 4O25A 3A1UA 2BBTA 3CRW1 3FFAA 4C0BA 4KFRA 3U5ZB 2ZAMA 3NBFA 2QG6A 2H92A 2ATVA 1W46A 2WKPA 4RD3A 3AVXA 1W47A 3A1VA 2AHOA 3FE2A 2GAOA 1SXJC 2CMKA 4EFLA 1MT0A 5DN6D 5TXGA 3WHKA 2P5SA 2ZRDA 2XJ9A 3G82C 1O87A 3KKNA 2EFHB 2F43B 2VP0A 3CF6R 4F7WA 4CGZA 4A2WA 2FFQA 4ZPXA 1Z3IX 1IXRC 2CCJA 4G3XA 2ZI3A 4GDFA 4JVLA 5B30A 1TL7C 1WBBA 3KJHA 1NVVR 2BMJA 2ERYA 2J46A 3VAAA 3RDPA 2ASEA 3FB4A 5D3MB 4YXWA 1F48A 1G5RA 1W4AA 1CLUA 3K9GA 1GKYA 2H17A 2CHVA 3GFOA 5EE3A 2GEDA 4D6PA 3T35A 5K8UA 1G64A 3N5CA 1R5BA 4Z1MD 2IYTA 4ILEA 5FI1B 4BFXA 4XWOA 5JSZA 4LYJA 2FGKA 5FPTA 1N0UA 3C14C 3MWKA 3GJXC 1IJEA 1JI0A 3FHOA 4FD2A 3FFBA 4QKQA 4TYYA 2JEOA 3U4QB 1Q57A 4HB0A 3CF0A 2VHTA 4Q9KA 2HCJB 3I5XA 3AUYA 1OLOA 3U3JA 3SU8A 2WKQA 3A37A 1G3QA 5KYKA 1E79A 2R6CA 3SZRA 1G8PA 1NLFA 3A6PC 2JASA 2Z43A 1YR7A 1QHGA 2WJVA 4BLQA 3CRVA 2YOHA 1GTVA 3WMFA 3T5DA 5C1BA 5H70A 1R8QA 3CX7A 4Q4AA 3U61B 1JBKA 1E3MA 1W4CA 1XRJA 1KDOA 3VR3A 2W2TA 1M1YE 4D0LB 2AD5A 4D80A 2NGRA 3CONA 2HJGA 4KV9A 5JHHB 3THYA 2FG5A 3OE7A 2XTNA 5A4JA 2WOJA 1V43A 5AJXA 3D3QA 3TJZA 3R7WA 2PJRA 2IUSA 4BECA 4IVPA 4GL2A 2G3YA 1JECA 4PANA 4FMBB 2ZYVX 3SFVA 3T34A 3K70C 4PO1A 4CEJA 3K70B 5DGXA 1WXQA 3RRYA 3LBIA 1G20E 1E79D 2VHCA 1J7KA 2ZJ2A 4BEJA 3L2OB 1X8KA 4NP6A 4HUTA 4PC3A 1SZPA 5FH9A 2A7QA 2YNMA 4I1SA 4GOXA 5JCZA 2CLSA 3KL4A 3NEYA 1G6OA 2FWRA 5JI2E 2VP6A 3AM1A 4NYMR 4BQSA 3RLFA 4AG6A 2JIZA 3GJ6A 2O8DB 3U7FB 5BN5A 4C0LA 1HYQA 1Q1EA 5GJCA 3AP3A 1IY2A 4F91B 4C4PA 2ZANA 4TYNA 4ZCMA 3RS7A 3TK1A 2H5EA 1OSNA 4IXMA 4BFZA 3MMPA 1XP8A 4Q7MB 3X1WA 3LV8A 1E9AA 2BC9A 4B2IA 4IKEA 2VSOA 3IBGA 2O0KA 4GFDA 2D4HA 4RD6A 4ASUA 4OHYA 4PHFA 2PX3A 4HDOB 2J0UB 2IK8A 1KGDA 5CK4A 1KJYA 3I72A 4IJMA 4NHOA 1F3OA 3FMIA 1TF7A 4JL6A 4MRSA 1KDRA 4TLDA 1XJCA 1KSHA 2KBEA 2YZ2A 4UQOA 3ETLA 1M7HA 5JJKA 3NHBA 3RSLA 3ADKA 4F4IA 2ZITA 4DLUA 1WCV1 4W9MC 1NBMD 2GTPA 4OYHA 3IDQA 1U0HC 1KZGB 2PBRA 1GRQA 2GJ9A 3PFIA 4BLPA 3L0IB 4RY2A 1YE8A 1K5GA 3KB2A 1Z2AA 4TL9A 1G7SA 5HCIA 4O2LA 2QBYA 3B9PA 3RS0A 2J0VA 1E0JA 1JNYA 2ZRGA 4CIDA 1RPZA 3ZLJA 2YWHA 2QTHA 3G0HA 5CLLA 2NQ2C 5FL7A 4V0NA 3IHLA 5DHFA 4ESHA 2NO6A 3D6TB 3NXSA 4DT1B 5CLQA 1NVVQ 4HSEA 4D4MA 3E5HA 4NL4H 3V4FA 1G41A 1PVOA 4I4LA 1HQYE 1HTWA 3LBHA 4Z54A 2B7BA 1XPOA 3RRNA 1M7BA 1E1QA 1W2GA 3UIEA 5F3WB 5TV2A 2OCYC 2D06A 4KFUA 2JDIA 2IS6A 2IW3A 1WMSA 3QI2A 1N5JA 4ZI3A 2CVFA 1YZQA 2GK6A 4CT4B 2QMUA 1E98A 1Z0IA 2V8OA 5L3SB 3NKVA 4KYIB 1FMLA 1NG9A 1PUJA 3K1JA 4URXR 3B5JA 1GZSA 3CKLA 1T8UA 2ZRLA 2IA5A 1YRBA 3CH4B 3FMOB 1GNRA 3ZQJA 1DTSA 4OQXA 4WXPA 3LBNA 1Z07A 4EKDA 4AURA 2VHJA 5J4HA 2A5YB 2IXEA 2XGJA 3CRMA 4BLRA 5FUYA 5DO9A 1UPTA 4MYTA 1OPXA 4WIAA 3O8CA 3BE4A 4V02A 1WE2A 3QXSA 1XBTA 2PJZA 1EGAA 3HU2A 2OM2A 2CL6X 2YV5A 2IWRA 1FTNA 3NWJA 2ZAOA 2HYDA 4TZ0A 1U9IA 3QKRB 2OUKA 4M1KA 1XMSA 1XTKA 5JRZA 1E1QD 5IDVA 2H8KA 4B48A 2VLIA 5D3MA 4KFTA 4TTRA 5CJPA 2QT1A 3K8YA 3GFPA 2EFDB 3MWYW 5BYJA 2HCBA 4D4KA 5IK2D 2IYZA 2FN4A 4OJQA 1T91A 1Z22A 4JL8A 1OFUX 4N1AA 3BH6A 1RYHA 2B92A 1CS4C 3V00A 1DEKA 1T6NA 4PC1A 2WJHA 3KTAB 1HT1E 2EW1A 1KI3A 1BO6A 2BIFA 4FW9A 3L0OA 1UFQA 1L7VC 1OIWA 3QF4B 4JVMA 4PC2A 4E07A 2R9VA 4Q02A 4Q7KA 3THXB 4UNRA 1VYUA 1OKKA 4CW7A 1N5KA 2A2ZA 3RRMA 5KUTA 1KI6B 1DADA 4NPHA 1EFRA 2QE7A 4AKGA 4M1OA 1CF4A 5HPYB 4M1MA 4LGMA 4A2QA 5F98A 4P4SA 3TUIC 1P9WA 3KKMA 2J0QA 1Q21A 1XWIA 2J87A 3QF7A 2WJIA 5CYOA 4C9BA 2QU8A 1XD9A 3LY5A 4A4DA 3QPVA 3K0CA 4MUBA 4OJKA 2WJYA 3Q8XB 1G3UA 1JPNA 1SVMA 3IPYA 3K09A 4IDNA 1KK0A 4LC0A 1GAJA 2IHYA 4JVNA 2J41A 1VYVA 1KOFA 4LI0A 1G16A 4BASA 2IYQA 1L8QA 2B7CA 4UKDA 2CDNA 2WWHA 3CIOA 1E32A 3NIBA 1C1YA 1XMVA 3KKOA 4OHZA 1SVOA 3O8RA 2UZIR 5GVRA 4JL5A 4NYJR 1XD8A 2FZ4A 2PEZA 3DOFA 4KVAA 4PPFA 3THOA 1OKKD 1Q3HA 3GQBA 3PG5A 1LS1A 3A8TA 3IGFA 3JVUA 5LB2A 5SZHB 4A6XA 4HAYA 4JBYA 3W9YA 2VRWA 2ZJBA 1YKSA 4NCIA 1EFRD 1N6HA 5GVSA 2ZRNA 2FEMA 3R9IA 2OCPA 2Q21A 3BGWA 1KDPA 3NC1C 5AR1A 4DIDA 4PQRA 4IRUB 1RKBA 1UDWA 1P73A 1RJ9B 4GBMA 2JLUA 3ZZ0A 2QQ0A 3ZVRA 1CR1A 4MRVA 3BIFA 2YKGA 1MOZA 4JLPA 2BM0A 4WW0A 3GLIB 4KAXA 2A5DA 3N2IA 5B2ZA 4V0OA 4G5SA 1GIAA 5KNDA 1KO1A 1N0WA 1WP9A 5JJIA 3CRQA 3TSOA 3T5GA 1KJZA 1ZD8A 4MKGA 3ZS9A 4BFVA 2JLWA 1P62B 2FSFA 4ACAA 1CR2A 1G7CA 4NU0A 1N6OA 4P3YA 3MAAC 2QSYA 5SZIA 2XTMA 4Q18A 1R0YA 1TMKA 2ZJYA 1Z6GA 1CR0A 2G1JA 2GILA 2IYWA 2QENA 3CWZA 1DARA 4R71A 3U44A 1SVKA 4A15A 1TPZA 1FZQA 2GCPA 2BCGY 1N0VC 3QJYA 1E2LA 4HLUA 1PUIA 4KU4A 4NYIR 2OSBA 1VCOA 4M9QA 3ONWA 4LJ7A 4BLOA 3VKGA 2PMDA 3KZ1E 1KYIA 2ONJA 4ZDJA 2WIBA 5KO2A 2GK7A 4POAA 1GVNB 1AA9A 1BH2A 1TEVA 3EPKA 4IEIA 4F4CA 5FTJA 1JXOA 3M1IA 5FTLA 3OEHA 4QBIA 2W0MA 2A30A 2H1LA 3ZVNA 5AJZA 4HATA 4XSGA 2QQEA 4FXPA 3VKHA 4MUAA 2Q9AA 2RGXA 3ZQ6A 4GRAA 5CB8A 2I3BA 1AGRA 1J90A 2FJUA 2OHFA 3CM0A 4LDJA 3EW9A 2WSSA 3L8YA 1GKIA 1GL9B 3DZ8A 4HAWA 3AUXA 2RGEA 5FOXA 2FOLA 4B32A 1D8TA 2RMKA 3F8TA 3SOPA 3CPHA 2EQBA 4UXJA 2R8RA 4PC7A 1KKLA 4HLDA 4A0FA 1LFDB 4HLQB 4O3MA 5CK5A 2AD1A 3GJ5A 4LYHA 1Q22A 2J7PA 521PA 1QVRA 3Q3JB 5CIQA 1E1RA 4Q03A 1Z0KA 4PPQA 1LY1A 1E6CA 1MABA 3QQ5A 4NTZA 3ZJYA 4OHWA 3VNUA 1BOFA 5G3ZA 2GBLA 4GMDA 1WBDA 2ZM5A 2OT3B 2ZRHA 4H1UA 3IIKA 3OEHD 4M1SA 4IFBA 1NLYA 2ZU6A 3I73A 1ZP6A 1OFIA 1ZAKA 1CTQA 1X1SA 2FPKA 2VHQA 2BV3A 3BFKA 4JLOA 4XTCS 3EA5A 3WNBA 4F4JA 1BMFA 5JSZB 1JALA 2I4IA 3FMPB 1QRAA 1PJRA 4BLTA 4XIGS 1PV4A 1DAIA 4M1YA 2C98A 5AJYA 2ZR9A 2WSSD 1H8HA 3B9QA 3MFYA 2Q3MA 1CJKC 3C7KA 3U60B 4C7OB 2DFNA 3EZ6A 2CBZA 2EWWA 3A4LA 1P5ZB 4IOMA 621PA 3D7MA 4HAVA 4JZKA 5DSZA 4YDSA 2HDNB 3AV0B 3FKSA 3O8BA 5FTNA 2IYRA 4X8LA 1N2CE 5EE5B 4M9ZA 3VR2A 4DVGA 4URYR 2ECKA 5DIFA 1C9KA 2LKCA 1U8AA 1ZNZA 4NMMA 4US1R 3VNVA 2EFGA 4Q1EA 4M1WA 4LSGA 1Z0FA 4KLZA 3KQHA 4NZYA 1OYYA 3L8ZA 3W6PA 1AK2A 3NHAA 4TWZA 3BAFA 4NKRA 1S4QA 3ZH9B 4Q66C 3THYB 4DLZA 1E2NA 1L4UA 3EXAA 3RWMB 4LYAA 4TTQA 1G8YA 2ZRPA 1GUAA 1AZTA 4PO8A 1H8HD 3DL0A 2WSMA 3FMFA 5FUWA 3RAPR 3ZDQA 1WRBA 2JLQA 1RIFA 2F1JA 4CF7A 3KJGA 4CEJB 1N6LA 3REFA 2AKAB 1IY1A 3QXCA 2ZUDA 3LXRA 2XAUA 3VHLB 4TQAA 1SHKA 1S9HA 221PA 3I3SR 2J3EA 1KZ7B 2OXCA 4GMXA 2C77A 5EXXA 2X1VA 1M7GA 1Z28A 1XEXA 4B2PA 2AFIE 2BMFA 2CCKA 1LF5A 3DM9B 1Q1QA 1ZUHA 3WNCA 1W48A 3W90A 3UMRA 2VHUA 4GP7A 4W5JA 3OFNA 2GVDC 3QEJA 3EWSA 2VO1A 2NG1A 4B76A 3PEWA 5TVKA 1IY0A 2ZQ5A 4Q4HA 3M4YA 4MRRA 1IN4A 1E9SA 3A36A 5EP3A 5CDFE 2JLVA 2BOVA 4WA7A 3A1WA 4BRUA 3I92A 4ZDWA 1IOZA 2F7SA 1XB2A 1P75A 2CE7A 4TLEA 1W36D 2CL0X 2KBFA 2UKDA 1KAOA 2WMOB 1VHLA 4PQYA 2ZR7A 1U8YA 3SYNA 1LV7A 3TH5A 5SZKB 3AKDA 2JJ1A 2V1UA 1UKZA 2XZLA 4LJ4A 1ZRHA 1FP7A 4TMXA 4A0RA 3GLIA 1TADA 3AGPA 3B1XA 4L8GA 3UATA 3X2SA 1XXHE 2GHIA 1COWA 1XJQA 1VHTA 2QA5A 1F6BA 2B8TA 5J4LA 2V54A 2GNOA 2RGBA 3RSOA 4Q21A 3ZIAA 3HR7A 5DE3A 2Z83A 2QSZA 2W6JA 1FUUA 3HPRA 1UBFA 4LHWA 1KI1A 3CPJB 2QBYB 3REGA 2VSXA 2RGNA 2ZSAA 4XJXA 3TSWA 1E9DA 4HDCA 1R5NA 4TSFA 2C9OA 4U00A 1FTSA 1S0UA 4GPTA 1S96A 3B7GA 5TY0A 4LY6A 4ZCIA 5E7MA 4NE2A 3HWSA 3SEAA 2ZJZA 3BFVA 1Z6XA 3SJBA 1G7TA 4FIDA 2A5FA 4MYCA 4L9WA 2XZPA 1JQJC 4NONA 3I5YA 3QOFA 1A1VA 3JVVA 1J8MF 1R8SA 3G5UA 3C5CA 1GNQA 4JYCA 1YJ5A 2E87A 4DCUA 4KBFA 1KO5A 3CNLA 3CW2A 4LHVA 1X8JA 2D2FA 4JYBA 4TTPA 3SC3A 1CXZA 1WA5A 4TMKA 4Z1MA 4KITB 1TU3A 2BHRA 2HV8A 3VR5A 2OFWA 2W6JD 2F3TA 2A5GA 3SN6A 4XWAA 3FTQA 1ZIOA 1VECA 2WWGA 3GLGE 1TAGA 4HAZA 1G8GA 2CVHA 3DMDA 4TSFD 1NBME 3T1QA 3ADBA 3W6OA 3HYTA 3LA6A 4QRHA 1Q1BA 1XZQA 2H57A 4P4TA 4Q9JA 2OV2A 4GSYA 1BYIA 1AQYA 1TEXA 1EX7A 5CJ2A 5FOVA 3BB3A 5P21A 2C95A 2FF7A 1NSTA 2FH5B 3R8CA 2OCAA 2V4ZA 1U9IC 4FMCB 4RJLA 5DLQC 4EIWA 3OF5A 2HF9A 5AK0A 4CEIB 1DAFA 3TKLA 1AS0A 4G5OA 2J7KA 3BXZA 1E9RA 5AUQA 4L4UA 2O0HA 3QBVA 3PEYA 3CUEF 1MO6A 4QJ3A 2REBA 3EIEA 3Q7QA 5JWRA 1KIMA 3GMTA 3CNNA 1LB1B 2GA8A 2V1XA 2C8VA 1CRPA 1KKMA 3C15C 2ZXUA 4DLRA 1FMJA 4IW3B 4G5RA 2R6FA 2OLKA 1WB9A 1KJWA 1XDBA 4OKSA 3THWA 2H7VA 5CIWA 2AXNA 3SFZA 1SKYE 3DO6A 1T0HB 2W6ID 5FPKA 1P4SA 1Z06A 4FMDF 4D0GA 1E2HA 4C7OA 1KI8A 2PEYA 1SVSA 4OQLA 1FFHA 2JJ8A 4LJ6A 4PZYA 1ELOA 1GM5A 3WBJA 2FNAA 4B3FX 3ZYCA 4EJSB 2ZYTX 1G1MA 1E9EA 1RRFA 4M22A 2FV8A 4PHTA 3O8DA 4V0MA 4BUJA 2QMOA 4QBHA 1XJ0A 1KO4A 4LHYA 3BWDD 4M53A 1NJFA 3QPUA 3ZGXA 3TUZC 2KE5A 3LO5A 3W8RA 3B13B 2QT0A 5EE0A 3P20A 3MGCA 3WY9A 2QTFA 2Z4SA 2Q6TA 4Q1BA 2I1VB 2GEVA 4P4SB 3A1TA 1XCGB 2QPAA 3K9HA 4MYHA 1JJVA 5C2JB 4ACBA 3GEEA 5FTMA 4E03A 1FNMA 4JKIA 3TR5A 4QHTA 4WZBE 3K0CC 4WOPA 1RC8A 4K8OA 3FPAA 3WYFA 4C2TA 4AY2A 2OESA 2ZI4A 4QGAA 3PCRB 1QDEA 2C04A 4BZQA 2OLJA 1TF2A 2O52A 2MSDB 2CLDX 2XTZA 3L82B 3W5IA 1U2RA 2C96A 1Z63A 3NDPA 4MGYR 1JPJA 2H18A 5TDHA 3U3RA 1KHTA 2GDJA 2OILA 2XJ4A 1QG2A 2ZJ5A 1DAMA 2KJQA 2HYIC 2QP3A 3GLHE 1X3SA 2WAYA 5GJVC 3I8SA 1OH8A 1R4AA 2GEUA 5TMPA 4PX9A 5FI0B 3LXXA 1TQDA 4JLBA 4V0KA 4M21A 2F9LA 4LCBA 5EJEA 5J4VA 3GLGA 1KI4A 2F55A 3DDCA 5D3QA 1NBMA 2AK2A 2V55B 3PVSA 4Q1AA 4Y0VA 5K8IA 1G3IA 4B3DA 1KMHB 1VCMA 2VH5R 3WYGA 5FPHA 2XX3A 1SXJE 2F1IA 2R44A 1R0WA 2CL7X 5EZ6B 1OXXK 1JJ7A 2CJWA 5L8VA 4DHEA 1T3LA 1KK3A 4HAUA 2GF0A 3FHTA 1U90A 1VTKA 4EPRA 1VIAA 3LAWA 4BFSA 2JLZA 4Q00A 2OXRA 1XEWX 3QBTA 4RCYA 4Z8XA 1S1CA 3C16C 1NG1A 2QP4A 3UWKA 4C0QC 3DKPA 4PZLA 1VCNA 4EPVA 5CB6A 3SQXA 1W44A 1GL6A 1ZC4A 1FQJA 1ZD1A 3BRWD 4URWR 4K81B 2LWIA 3QY0A 3GJ7A 1MRNA 2P3SA 2F6RA 2ANBA 3EC1A 3U44B 2A5JA 4RZ2A 1T5LA 4J0QA 2CNWD 4UJ5A 3T1OA 1NF3A 1P3JA 4MGKR 3IQXA 5GJBA 3ICQB 2P5TB 1V5WA 1HUQA 2WWFA 3AP1A 3LD9A 1PZNA 5B64A 1MH1A 1N5LA 5TB5A 1E2JA 4WZ6A 4QNRA 5KNBA 1M6NA 4BPBA 3TQCA 2GETA 5JECA 1S3GA 3NBZC 4P32A 3B1ZA 3ZVMA 2KWIA 1UAAA 3VQTA 1WDTA 4PFSA 2GESA 4MITA 3RANA 1G8FA 5BQ5A 3SE0A 1M2OB 1U8ZA 2P67A 3KUCA 3P1JA 4RSGA 3RS4A 4GNKA 2PZGA 1HY3A 2WVJA 2C03A 2BEJA 5HE9A 1I2DA 3BB4A 4D82A 5L3RA 5IRCD 2J45A 5JI3E 2E9SA 3LVQE 5IK2A 2OAP1 2RGDA 3EIHA 1RYFA 4MRPA 5KSOA 2QGZA 2Y8EA 4DLVA 1GRRA 2MSCB 2REOA 2ZIAA 3MWLA 4Z51A 1JR3E 2RGGA 4BLSA 4TYQA 3BB1A 4W5WA 1XTRA 4M2LA 4LWZA 1MABB 4B71A 4KI0A 1N6IA 4BWYA 2PLFA 3S1AA 1SULA 1MKYA 1Z8FA 4FCWA 1G7RA 1W4RA 3KXLA 1KK2A 1E0SA 3V4RA 3KJIA 3H1TA 1YZUA 3ICEA 2OFXA 3P4XA 1XX6A 1XZPA 4CEIA 1RW4A 4G5QA 2ZE7A 5FL3A 3BFXA 3ZD7A 2WZQA 1DS6A
chains in the Genus database with same CATH superfamily
3DJYA 3GJQA 1X1TA 4D43A 2CWWA 2UYOA 4DXAA 3EBLA 4LIPD 4YV1A 1ZOOA 4KGDA 3MK31 5CDYA 2BHSA 2AOVA 2I4LA 4FFNA 3ABQB 1UCFA 1ZITA 4ZU3A 1SXJA 5JQGF 3GROA 3K2IA 1AN0A 4CEHB 4G86A 4HB3A 5BV2P 2XYVA 3NC0C 1P1JA 3USES 4QUBA 5HM8A 4TWBA 4K1XA 4BJHB 5BR8B 1MA0A 4OHFA 3DLPX 2JHGA 3UV6A 4E5DA 2O57A 1HLGA 2XXAA 1TYDE 1DFHA 2IE8A 5HF5A 2CZCA 3AJDA 4I55F 5TARA 5A4MS 4IM7A 5FRDA 5LMNB 3VR0A 3HV2A 3DWGA 3JQAA 2JBHA 1C3OB 5I6DA 3WVNA 1AKEA 4GEKA 1YA4A 4JBHA 2QJFA 5T6BA 5LLSA 5I01A 1VJ1A 3D3WB 4I2NA 4NCJA 2JK1A 5A0TA 1SFRA 5CCBA 2VBGA 5M7EA 1WD7A 3VM6A 5AVRA 4O5OA 4CFYA 4JLNA 3GDHA 4OHPA 3QE0A 3R7DA 2NU7A 5EMNA 5KVQA 3TE6A 1CZNA 4PLGA 4PC6A 3W5HA 5C3UA 2B78A 2LZ0A 3GIDA 4G24A 1E2MA 3HR8A 4F45A 1VIMA 2O8BB 3IVCA 1CQWA 1E2QA 1FNNA 5J5CA 1PG5A 1GLNA 1YT5A 5ELXA 2NTYC 1ZPDA 4N54A 2E4YA 4NF2A 2V7EA 4D3ZA 5HFAA 1QIJA 1FLAA 2E1RA 3FZNA 1NNEA 4AICA 2BFEB 1U7TA 1LQUA 4GWLA 1WSWA 5EE9A 3VC2A 3CX6A 1IOLA 2IEBA 3LWNA 3OZCA 2UV8A 4H1VA 4A9AA 2R0QC 1JZTA 1IEWA 4HR7A 4OPMA 4D9BA 1OTYA 2WOOA 1QBGA 1L4NA 1H42A 1P2VA 3NUGA 2AGVA 3QV2A 1HK7A 1AZLA 1QLWA 1U3VA 1UT6A 3R3HA 4DCGA 1YHZA 2C88A 1S2MA 2DWQA 3NWEA 3RFUA 3W78A 4YUXA 2CB0A 3OPMA 4Q19A 5LVAA 4IKOA 3TQTA 3OE5A 1J39A 4HDAA 4TKMA 4C6SA 2YS7A 2ZBRA 3R3ZA 4DAOA 5EZ5A 1L5HA 5DKFA 3NBYC 4OP1A 3GRPA 1YV9A 2DT8A 3DVLA 2QY9A 1KI9A 2XWBF 2XNKA 3KLPX 3KOYA 4D79A 4EPXA 2QXYA 2VYVA 2IL1A 1T2UA 2BMEA 2XRYA 4K87A 3RYIB 4ZV9A 2M2IA 4F2HA 1XL1A 5FWXB 3IE0A 1FK8A 4RMJA 5FV7A 4ZRDA 4CMHA 3W8DA 4EA7A 1RRPA 2ERXA 2DETA 4R84A 1INLA 4QDJA 4YRJA 4DGQA 5CB4B 5HIMA 2EG9A 1I1NA 3D8HA 3Q9SA 5KSPA 2QAGA 4P3XA 4G67A 1E9FA 1GP2A 2XMPA 3GA0A 5C3MA 4BAZA 5KYNA 1PLLA 2DBQA 5DGDA 4DVJA 2B6HA 1UFVA 2PVPA 1P2SA 2R4QA 4G4IA 4F85A 3ZVLA 1U8FO 1AT1A 1KMHA 1N92A 1RBZA 3HA5A 2JIPA 1M0WA 2HLDD 1HE8B 2K6GA 4RXUA 4ZZ2A 1E5QA 4A2CA 4A8PA 4E6PA 1CJTC 3M70A 3OBBA 4I08A 4IXDA 1DG1G 1MCZA 4LZOA 3G2OA 4NZMA 5ALTA 1K06A 2K7ZA 5C32A 3HS3A 4Z86A 1QQ5A 2IHBA 5F2KA 1KTVA 2HT6A 2JEYA 3FCOA 1JDTA 5JYDA 1VZ2A 2PS0A 5DWDA 4JK3A 3KSBC 3SPXA 4ROTA 2GFHA 3I52A 4A23A 3DV9A 1HO3A 1P0QA 3OCXA 4DAEA 1ZHHA 4A8JA 1LBEA 1BYUA 1XVAA 3C3BA 5A9RA 1Z45A 4J7CA 2K4MA 5E1OA 2GN2A 1D1TA 3TDNA 1QH1B 2I5PO 3RIHA 1W19A 2PKCA 3CSDA 3GUCA 3BERA 3EX7C 4BQOA 1HNWB 2HRRA 4Q39A 1LX6A 3USCS 2FPPA 2XVYA 3GG2A 4YHBA 3E9RA 4HAIA 1FYVA 1YS4A 2XA9A 1P4AA 2ZSKA 3OM9A 5TJ9A 4CM9D 4IQ4A 4AS3A 1BFUA 1U80A 4EECA 3RHZA 2Z4TA 4Z9XA 3Q6MA 3PNMA 1YRLA 1OB2A 1PFYA 2DVMA 4UTXA 1DEAA 1JQ3A 3OFJA 2Q1SA 4L4YA 4Y6RA 1JA1A 4BMXA 1PCXA 2WJGA 1ZO8A 3ENWA 3TVDA 4DC9A 1N34B 1M34E 3WRYC 4II3A 2B1QA 2VDKB 5JLJA 1YR8A 6LDHA 1AZSC 1WXGA 3LXUX 3SF8A 4PGGA 3F7MA 4I6JA 2H2WA 4FN4A 3KQVA 4UHCA 5GQSA 2GHRA 3BCRA 5K3DA 4CM1A 5CM2Z 3UWDA 4HH0A 2G6BA 2IYNA 2QTLA 4FLFA 3VBEA 3TN7A 3PHLA 4FFVA 1QO0A 1YHYA 4DIMA 4LE0A 2VP5A 2Z2ZA 2I4MA 5JFTA 1ZN9A 1AX9A 2BH9A 3H1BA 4EKIA 2XCUA 2EJUA 4QE3A 4GZLA 4WOCA 1TD1A 5KHAA 5FB3A 2CEAA 3ETEA 4KE7A 2BUAA 1FW6A 1U0JA 2V7XA 1F4LA 1O3YA 3IKMB 3ZZ1A 5SYNA 2O19A 1XELA 5CFMA 1J07A 2Q9BA 3FPJA 5ALGA 1R1DA 5BWLA 4D8WA 1CUGA 3TLMA 1XFAA 3RC8A 4U4AA 4ZYYA 3LG2A 3DBOB 3LYLA 4ZAWA 5IDWA 2DFKB 3OEED 4UZFA 3T06B 2XGSA 2R96A 1R64A 4HNVA 3JVIA 3GLKA 4M83A 5TQ0A 8ADHA 1XD2A 1ENYA 4FHEA 3LNCA 2XT9A 2QYTA 3M33A 1R0SA 4FFDA 1BCSB 1OXSC 1EXWA 4US0R 2YN2A 1TM5E 1Z4IA 4HC4A 1N6KA 5G1OA 4FQ7A 4UULA 4BQRA 2B5VA 3C48A 1ORRA 2OD7A 1Z2PX 2XHZA 2J59A 4LZZA 3AKZA 4PE5B 4CM4A 1X19A 4AP9A 1R0LA 1H0SA 1J5PA 2VNAA 4AJ2A 2DUMA 4HVLA 1TT5A 4W7SA 3THWB 4KO4S 1UWKA 1GGVA 4C4YA 2Z9CA 1BWSA 5KJFA 4ARSA 1JDSA 4Y2RA 4OM8A 1ZNXA 1YI1A 2ZUWA 4YHHB 3U7GA 4MVJM 2OA0A 4EFMA 3HVHA 1VLQA 4MIYA 3REOA 3AIMA 1Y4AE 3BXGA 4CEHA 3DWEX 2WAXA 3M3DA 3DOIA 3IMKA 4UEOA 3MHTA 4CMEA 3VR1A 2NXJA 4JGGA 5EUBA 2BELA 3VVBA 2NO1A 3I64A 1XQVA 1N57A 1YIAA 5E8JA 1F8FA 1YFZA 3QVGB 3NH6A 2HK8A 2R8PA 1N0HA 1RPAA 4M88A 4CKEB 3P9QA 1DV2A 1QH8B 3ASZA 4XD7A 5IMSA 1NV8A 1NX6A 3N0VA 3VU9B 3P9CA 1UP4A 1QYVA 2LDXA 3NVMB 3P9IA 5L3VA 3M4NA 5PNTA 3D3WA 1TJPB 4HPJB 1ZINA 4F1WA 3C4JA 3B89A 3QEMA 2QVCA 3N0WA 1R6XA 3S7ZA 3WAJA 2APJA 3WKAA 4EHFA 4LF9B 4F0JA 1JW9B 1C1DB 1OF1A 1GJRA 1ZCFA 2BHNA 2XF2A 4HQFA 4MR7B 4N3GA 4WASA 5CYPA 5FPPA 3VO2A 4D56A 4RCVA 3ILHA 4EJFA 4HKTA 4R1OA 5ERGB 4F8YA 1JP7A 3B5IA 1CEXA 4WXYB 4CTKA 2O4CA 1GPUA 1FJXA 2GPTA 3KAKA 2O7RA 5DI3A 3QXHA 3TLJA 4P93A 1EHIA 2P6RA 2O8FA 4Q9HA 3IFSA 5HJEA 3A1SA 4EY4A 5D01A 1Y3CE 4GPBA 3D9QX 2HQRA 1LH0A 2HRBA 1RTTA 2VDRB 4EG4A 1ZHOA 2NVWA 2VBCA 3OJFA 3MTJA 2QT9A 3QJGA 3VR6A 1PJTA 5CW2A 3V8NA 4GMHA 3BD9A 5E3IA 3DWIA 2Y1EA 5KQMA 3CX8A 2IYLD 1MV5A 2ZYGA 3AVQA 2ANCA 3KB6A 2R65A 3FKJA 5HJ7A 1OWMA 2D4AA 3BE8A 3T1TA 4HDSA 3DP9A 4Y9SA 5JXWA 1TQ6A 3RVOA 3NNSA 5JMWA 1KY2A 3LHSA 3TLAA 1ID8A 1XZJA 4C6TB 4YBRA 2YV2A 4RA9A 3E2IA 2LV8A 4AY3A 2QG9A 2DEUA 3KXDA 5E4TA 3R0ZA 1TYZA 3NJRA 3P0HA 2AFHE 3CGGA 4P33A 4XOUA 4DRZA 3QE4A 4I4IA 4F3CA 5CFPA 3BC1A 1Z5ZA 3IPCA 1FSPA 1NJ5A 2Q6OA 2QGFA 3IBYA 1CY4A 3LVBA 3OZAA 4RFLA 3REQB 5K05A 4QYIA 3JR7A 1GOTA 3FOBA 1NXXA 1Z9BA 1PTJA 3D0OA 4QJ4A 1HYGA 3VU8A 3DDZX 3FROA 1JH8A 2CJWB 4G5GA 4LF5B 5LQDA 3D3KA 3I4CA 3KU4A 4RD0A 1RDFA 1EVKA 3I45A 1GILA 3K15A 1PT6A 2ODBA 4TQUS 1JEOA 3LQ1A 4W1PA 3I04M 4WXHA 2BR4A 2J5BA 3V7NA 5LU8A 2FI1A 3HU1A 2ONZA 1L5SA 1NV9A 2DC1A 1QIGA 2FRDC 2HEIA 2R1ZA 5JDIC 5H0IA 1VI2A 1EDEA 1V2HE 3W1EA 4DZZA 5CVTA 3CY6A 2SKEA 4Q01A 1PIWA 2XKBA 4MMZB 1N36B 3ZY5A 2WKRA 1B0PA 1II0A 4IDCA 2ZSJA 2B1IA 4IHJF 5DTIA 2XA2A 4BKRA 4ZZ1A 1T4CB 1SU4A 3DZGA 4GWKA 4JBWA 4ER5A 4X95A 4KLNA 2GS9A 4JB0A 3PF9A 1ZNQO 2G88A 1WVIA 2HD4A 4ZJZA 4P7KA 1JTFA 3HN6A 1I7QB 1ECFA 4EF5A 3MRTA 2EX1A 2VF7A 2W2OA 3ETDA 1JUDA 2CLCX 2DPXA 2IHZA 2YWGA 3I09A 2K7FA 1IBLB 1E5DA 2X1HA 4UVIA 1RHJA 4YP6A 3T5AA 3ADPA 2I7CA 1FMTA 1NYLA 3OQJA 5JCJD 1Z6QA 4ESVA 1XKQA 1ETHA 1K98A 2JD0A 4YP5A 1DDIA 2CXRA 2EIXA 3P9YA 3T3EA 3ZK9A 4N5NA 4RM3A 5LA6F 1MFZA 1TUIA 2V7QA 3CZMA 4ZVTA 4C3VA 4DLSA 2HA5A 2PYIA 2JD2A 4F9FA 4LNHA 1X1EA 1ZHFA 4UCXA 5HFJA 4E15A 3O93A 1B4DA 1UJ5A 4M54A 3TAUA 3UANA 3AEQA 3DDSA 2HR1A 2OB1A 2DPLA 2PBZA 1V8BA 4FKZA 2Q2WA 2NV2B 2PX2A 4XVRA 2RAPA 5CT8A 4RTMA 1G3MA 1V95A 1DFGA 4RK7A 2IS1A 2B7LA 1GNTA 1MEJA 2GBPA 2AN1A 2GVZC 3DL7A 3TJMA 1Y8AA 3VTKA 4TL8A 4YCLA 1CUJA 2G76A 2FX3A 2WM9B 4L78A 4FQ8A 4EB8A 4JC5A 1E7SA 4RETA 1JMYA 3FIJA 2BFBA 2CHGA 2G82A 4QAQA 4FTWA 3UEOA 3SQNA 5LQSA 4OFZA 1GG5A 3M2PA 4OU5A 4UHDA 4ZV7A 4UAUA 1NY5A 3T7IA 2OOSA 3INTA 3K92A 2YC4C 3C85A 3F78A 3PUJA 4LRTB 4O6VA 1K6JA 2C9ZA 1YH3A 1V3UA 1Z82A 3QPCA 3I32A 5K4GA 2GO7A 5BR7A 4NBLA 1O0CA 4IIYA 3ZCSA 1IBCA 2RIPA 3RVQA 4RELA 5KB3A 5KOHA 1Y82A 3QWHA 4GPIB 1NN5A 1LK7A 4MWTA 4Q24A 4Y1GA 2PUHA 3VDNB 2R86A 3COSA 4H1HA 4JQZA 7MHTA 2YMPA 1PN3A 4ND4A 4E51A 2JI7A 1UEJA 3AGQA 1KRXA 4JKYA 3UWMA 2V74B 2JRCA 4NBRA 1FNCA 3C6BA 1E4EB 4R1SA 3GBVA 3BQMB 3AXSA 2PH5A 1KQNA 2WU0A 2WFLA 2UUPA 2ACEA 3L77A 1NJGA 1J2JA 4A82A 4E46A 3LP8A 1HYHA 3L05A 3L3BA 5JVDA 1TEZA 4BMPB 4EI7A 3BD8A 4CMJA 3NB0A 1EBFA 5FNZA 3A58B 4OQMA 1IH8A 5B1EA 1I0LA 5E95A 3A9RA 4I5GA 4R1UA 4UEJA 3SOZA 4ZI2A 4RNCA 1P2UA 1COZA 1CUZA 1M1NB 3LCUA 4H6PA 2PXCA 2XCIA 1STOA 3UHJA 1AN9A 4QVGA 3V8QA 4TQ9A 1Q7TA 1OJLA 3K30A 1U81A 2IUTA 2Q3LA 3PPIA 4WXRA 4Y2PA 2A84A 2HHCA 3K6SB 1G0NA 3GJ0A 4X91A 2IELA 5CTJA 2JL1A 1XCJA 4YRQA 1NDQA 3MB5A 1UEIA 1QJCA 2GPSA 3E5NA 3GCDA 1O97D 2W22A 1IN8A 4KN9S 4HEA1 4OUKX 4R9SA 5MF6A 3CYFA 1UH5A 2PH3A 3ER9A 1R0CA 2ZI9A 1WKBA 2ZQZA 1QGOA 3H83A 5CT4A 3RFFA 4EJSC 5AKJA 1ZJ4A 3L7MA 2NO7A 4EF6A 1O95C 5CU7A 5HTOA 3BBPA 3QKUA 1II8B 1PQPA 3FVQA 4FOLA 1N7GA 3EHEA 1T4DA 1JDBC 5BY2A 3TIGA 2PUBA 3LRTA 1JDBB 5GPBA 4FXOA 3TW8A 4J94A 4YECA 2A1IA 3ZDDA 1RQ2A 1JQAA 1K4KA 1QH8A 4JJKA 1BAPA 3VU9A 1KBQA 2IYSA 4NH0A 2LD4A 3WLQA 5EJ9A 3AEUB 1G5PA 3NETA 4IH1A 2QI9C 1ZJ6A 4BBJA 4Y2QA 1ECJA 4QICA 3QEBZ 1ADJA 3EF0A 3AVUA 1RLMA 2QM0A 3GX1A 2AX4A 1G9XA 1HDYA 3RVRA 5C5CA 3MXTA 4DIOA 1XTSA 3F46A 3N0TA 5HRAA 1C8KA 2PZEA 5FUXA 2P2DA 3QVOA 4IIEA 5J5AA 2DXIA 2GHQA 2AVNA 3LC0A 3ZXYA 1XTTA 3P9KA 1B74A 3RSFA 4YX9A 1QZXA 4TX1A 4ZT7A 3IALA 4BNDB 1QR2A 1YDWA 5E6UB 1NT2A 1KEWA 3G9UA 1XRRA 2Q5QA 4J7AA 4Q47A 1OHHA 2GAAA 2ZR0A 3K1AB 5CVJA 3WQBA 3L8MA 1NVKA 1Q1ZA 2Z6QA 1DJNA 3Q3EA 4KH0A 5T8KC 2HIMA 2R2GA 1FP2A 1QP4A 1U9YA 3TRHA 4A27A 3IULA 3B12A 4ZCLA 4DA0A 3SYMA 1IAQA 2F1OA 3QSGA 1ZM7A 4BDTA 4TV8F 1VOTA 4ABTA 5GADl 2C00A 1FUEA 2VWGA 4YRAA 1QDUA 1LS6A 1GAEO 1PNQA 4Q7LA 3ND7A 3K4HA 1L9KA 4TMVA 4YONB 4BFYA 1OYVA 4QLOA 2QMYA 4BMZA 5AVXA 1GZ5A 2PS1A 1D2EA 5C5IA 2BFCB 1PSDA 5AOVA 5J5VA 4C4ZA 4G5YA 2I2XB 3G2LA 1EM8B 1MAAA 3TAHA 4ZC1A 3PX7A 1ZWLA 3REQA 2Z4RA 5JZ9A 2H9AA 3A6ZA 1RXSA 3H5NA 1AV7A 2PR2A 4Q82A 1TKCA 3MT9A 3WGZA 4LGYA 1Q0UA 1Z6TA 1UMBA 1U0RA 4X8OA 1RAAA 4Q1FA 2GJ4A 4EITA 4NJMB 3UJHA 4TQGA 4ETIA 1E1NA 1US8A 2BMAA 5UKDA 5HGXA 5IZ4A 3T1VA 4MZXA 2V9CA 3TEMA 3WWEA 4D1YA 4JH0A 2FWPA 2EXXA 2HIHA 2AMYA 4A91A 5MFZA 2MYNA 4UBMA 3K9LA 4Z4IA 2VH2A 3ECCA 3MAJA 4H7FA 2BE7A 3N2ZB 1OH6A 3HY3A 4HRAA 1L7NA 3SZOA 5C5DA 1XKTA 3SXUB 5B3AA 1N8KA 3BH7A 5E2IA 1ACMA 1M2VA 4HB2A 1L1QA 5EPUA 1GT91 1LDGA 1W85A 1HE4A 4AYXA 3TZBA 2VQEB 4CHTA 1JH9A 4LQCA 3WHIA 1R50A 3VH1A 4NENA 2BR3A 1T4CA 3LQFA 4R7ZA 2KSQA 1V16B 3CCFA 2DT5A 3OZ7A 4Q4JB 5GZ3A 1G291 1N3IA 1T6ZA 4PZUA 2ZU0C 1ONBA 4K9KA 4XGKA 3I2KA 2ZJ1A 2RHMA 1Y3AA 4I9HA 4RFSA 5T3YA 3KLMX 1UMDA 4Z6KA 3ZZUA 5KTPA 3BJIC 4PLYA 4BV8A 2FZGA 2G8NA 1EXDA 3SSNA 1A2KC 2VCHA 4C5AA 2FUNB 2HZ7A 1SR8A 3WL4A 5G40A 5IZCA 1WZCA 3DAGA 4MW0A 5C8YB 3O3CA 5D84A 2P7HA 5GP1A 1Z8HA 3MMSA 4ZYVA 2YC2C 3WJAA 1U2GC 2I33A 4DPLA 4MKHA 1KXZA 2BH2A 3BAZA 1NKTA 1PT5A 3LT0A 4JI8B 4A0GA 3V3KA 4GGPA 4MPTA 4WBNA 2HSDA 3ERCA 3HEMA 5LQKA 4ZPJA 3NTQA 4RL6A 2RHHA 3IEKA 1WOYA 2VPQA 2XDWA 4G56A 4J6EA 5LZ9A 5IAKA 3IR6A 1R8YA 2JKYA 4QHYA 1Z74A 3MRSA 2VYFA 3X44A 4FGJA 1NW8A 2ZWMA 3BIXA 4A6DA 3NT2A 3SG0A 3M3HA 3RRJA 1V5IA 4E5VA 1U7ZA 4ASUD 4BRWA 3ZW9A 1GUZA 3UT5B 3VSAA 5FA8A 2VQDA 3N70A 3H2YA 1AE1A 5E7QA 2PZBA 3FTCA 4UUOA 2NO0A 2O8EB 4HAXA 3NNNA 1SQ5A 4LY9A 1W9MA 4PG4A 5SV2A 3ZTTA 5JDCC 4KO1S 2FA9A 2W83A 1QV7A 2C4MA 3H42B 2VHWA 2ZSDA 3IDSA 2XDQB 3AW8A 1IB0A 3LK6A 2H48A 1NUQA 1I0ZA 1IONA 1LD3A 2FEWB 4ZEXA 2GBLC 1IG0A 1NVFA 2PUCA 4JQCA 4MSUA 5H02A 1X7DA 2Q8NA 3IEVA 1Q7EA 2VA8A 2H5JA 3RJTA 2XKJE 1X2BA 3ANLA 3PUXA 4U1RA 1GSOA 4F2DA 5EP4A 1G2PA 5EWLB 3EQ8A 2CUZA 4EO4A 2ZTSA 2Q46A 4AI6A 2VT3A 1J2EA 3PV0A 4NJOA 1Y3HA 4BO7A 3TNYA 4TLCA 1F2TB 3T9FA 2C54A 4IWXA 3ADCA 3MEQA 3Q1LA 2FYTA 4O2AB 3TL3A 4RZSA 1AY0A 1PT9A 4YWHA 3AHHA 4PO3X 3TFQA 5IF9A 2XNDA 2K87A 3S27A 3AO0B 3B1JA 3HSSA 5AM1A 2AXEA 3OP1A 3UAZA 1GD1O 1UP7A 3IP8A 3NHZA 4OXYA 4ZVUA 2NOAA 4H1TA 2PV7A 2VDPB 3Q85A 4IFEA 1MQSA 2F43A 4KAAA 2O07A 5DBEX 5IUKC 4F84A 4RD1A 3LVRE 4FWTA 1GTL1 1PT8A 1CUAA 3IA7A 3N2GA 1PL0A 4TT3A 1M1UA 4RS3A 3AY6A 2HN9A 2OMEA 2IV2X 2FW0A 1B42A 1ZSYA 2P9BA 1CWUA 3W6UA 2Q2OA 1YVEI 1DXOA 2JCVA 5CURA 3PJFA 2P40A 4PSKA 1NOKA 1L7PA 4ZWNA 4DNFA 1RZ3A 1GPNA 3F3YA 3PUZA 4X97A 3R8XA 1J8DA 1AS3A 3L0BA 4FEYA 4LY0A 2JZOA 3EVDA 4XXHA 3KOUA 1LTQA 1FVFA 5JHGB 3JQFA 3QXGA 3WP0A 4Q3OA 3I9V6 2CF5A 4IVQA 3RV3A 5JYBA 6ABPA 2YOFA 1SHJA 3WIEA 1A71A 1PTKA 1K08A 2WJPA 4FX5A 4ME6A 2H7XA 3NEJA 2GRJA 2RDMA 3L4BA 3ACCA 4LYFA 4CQJA 4DANA 1AK9A 3H87A 1JG7A 5B5SA 2CLOB 5CFNA 1LBSA 3R6LA 2C78A 2KYRA 2QUZA 3THSA 1OFUA 2BGGA 5AW9A 4GUAA 2D7DA 3G85A 1Y5RA 1XTUA 4JFAA 3V33A 3N7UA 1Q14A 1BGVA 1QIMA 3EAQA 2ZGVA 1GUFA 3G1UA 3ROGA 3RO7A 3AHJA 2NPFA 1YBFA 1EXNA 2XOKA 1F8YA 4TTVA 3ZY2A 4DSUA 1EK5A 4EENA 1EH5A 3AVOA 1JEDA 4KQ2A 1FVHA 1F2UB 3FGZA 4DLXA 3I2YX 4P4NA 5AW7A 4XSHA 3ZIUA 4NULA 2ILVA 3JSXA 1MPTA 4MICA 3UMCA 3D6UA 1XF9A 2B94A 3H05A 2XUQA 4NAHA 4Q9LA 4BNDA 3L01A 3WSWA 4M0CA 3ENZA 4I3GA 3O5AA 3UWPA 2IY9A 2EF0A 3EYWA 1T8WA 4LZLA 3BTUA 1NI4B 5JRJA 4Y2JA 4HUQB 2FR0A 3H2JA 4TM8A 4WNAA 2PKRA 2CLKB 4F9GA 3F6PA 1ICEA 1W93A 2XB6A 3EPPA 4LYDA 3L79A 2I29A 4FBLA 5BXYA 4KIGA 4XWKA 2OV1A 3NHKA 1NP6A 2XUIA 2IZ7A 2R6HA 1QE0A 4Q9AA 3WRWA 4Q34A 4LV8B 5JTTA 1Q20A 1XPJA 2PY6A 2FZWA 1B7GO 3I5AA 4Z4HA 5H8WA 5ARCA 1NATA 3SBOA 1R6DA 4OA5A 3HCWA 4F92B 3ZHZA 1K8XB 2WTAA 4AKIA 3WLLA 2EC5A 1O9HA 5ICMA 4C21A 3T7CA 2GN6A 5HOEA 1IVNA 3I61A 1QV9A 4UUMA 3H9UA 3D2BA 3VZSA 4N01A 3ZD9A 2Q0HA 3L7YA 1OIVA 2J9FB 4UPVA 3AHEA 1IE3A 1FDTA 3KVNA 2YWDA 1DEHA 2OORC 5BN4B 3R7BA 2CD9A 5LZ2A 1KO7A 4PAOA 2C4UA 1S02A 3S99A 3STYA 3AVPA 3IQFA 2DMRA 2JGMA 1SUPA 2WG2A 5AW5A 3TD6A 5H3CA 1UC4B 4HI0E 5EHZA 2D8AA 1MZVA 1D0SA 3FZYA 4JIGA 4WX2B 5ILQA 3EZYA 3S1LA 4QYMA 2WWTA 2VDNB 2XGGA 3C4VA 4L6CA 1IN6A 5FPSA 4GR5A 1SURA 1MENA 3RYCA 4GD3Q 4YMSA 2AG6A 4H4EA 5FORA 3G8DA 2VJOA 3ROTA 4DJDC 5KOJB 1ZJWA 1NA5A 2M1XA 3FHJA 1GFIA 4LXGA 5C7OO 4A2PA 4D0SA 3P32A 4FGUA 1XWFA 2DSNA 4JI3B 1R0ZA 4EG6A 3M6AA 4JLSA 5BN5A 2AL7A 1UBEA 1JSRA 1RYYA 3LKVA 1EGHA 3FDJA 3C6QA 1V16A 4MW1A 2YDYA 4QBGB 4WL0A 3TX6A 3FOZA 1ESDA 2NAPA 5TE9A 3H5AA 4Q3KA 3T4XA 4LZNA 4R7TA 3TIVA 1RNLA 1VLLA 3X1ZA 4JJ8A 3EZNA 4UU7A 2R6R1 2YCLA 3RC7A 3H5RA 5DSTA 4I9FA 4RABA 5CA0F 4KQWA 2DFLA 3LPAA 5FUMA 4UXHA 4N7RA 3HWX1 4IH4A 3V2IA 3GCGA 4KKXB 1I6WA 2IKSA 3KEOA 4QDXA 5D8DA 2WQ6A 1QX4A 2CXNA 5JY6A 3TUJC 3WHLA 1CRLA 1FFAA 2C42A 3O94A 4XQEA 3F8SA 4P22A 4JMPA 2PZLA 2AXQA 3HQ4O 3E4DA 2P41A 3H04A 4RY0A 3WLMA 1SCQA 3FRHA 4I8IA 1JJAA 1SCAA 2QZ9A 4WQMA 1M73E 2GQ0A 2FZLA 2WV9A 4D02A 2AZ4A 5DXFA 3QJ5A 4DCTA 4ZI7B 1CEQA 3AF5A 3U7QB 4HZIA 3W3ZB 2D2EA 1UQUA 1SHLA 1XRLA 2CK3A 3DUWA 3ND8A 4A36A 3R5KA 3SR0A 2KHZA 3NC4A 4YQEA 2JJ2A 3H97A 5BYBA 3UT5A 4DJFC 4EHJA 4BQIA 3F7OA 2XE4A 4KJXA 3PBKA 4RKQA 2H4HA 3ODPA 4RK6A 3W5BA 4LYEA 1TJ4A 1DOAA 1KI2A 2PAFA 4MI6A 4UEQA 1BCRB 2ZUUA 1EQ2A 1GSHA 2AR7A 4E12A 4ZTUB 3MCTA 1MG5A 5FBKA 4XWYA 1C7JA 1CVIA 3AI3A 3DAHA 3RSQA 5DX1A 5J43A 1THMA 3EFOA 1XRSB 3OHMA 4I81A 2XMQA 4QDTA 3WWYA 4S2EA 4AECA 3JATB 3E6AA 4MXDA 5LN1A 3CVUA 3I30X 1L4EA 3AJRA 1LCIA 3SZ3A 2IOQA 4LI3X 3SSOA 1Z4KA 4M46A 3RAJA 1RXWA 4JYMA 1Q7RA 1FFXA 1SH7A 1TYBE 1VG9B 4KMOA 2YHBA 5EWLA 2ATCA 3A70A 3RJZA 5EJAA 4TRRA 2R1VA 4DV5B 5L3SA 1VG0B 4DSOA 1F2TA 1P9RA 1SOWA 2OCIA 3G8BA 3HABA 4ARZB 5K6AC 3KAQA 1T4GA 4EPWA 1GV1A 3CB2A 3UK6A 1EAMA 2I87A 3U4DA 2JFZA 3HBAA 3K0SA 3R5XA 4RJ2A 4FYXA 3W6ZA 4U7FA 4ED9A 3SLRA 4ZALA 3WTBA 5MDHA 1OZ0A 2H08A 4KVGA 3U2QA 2H4YA 3N76A 2EKQA 3V7YA 4DREA 4GLJA 3C5WP 1MW8X 1MBZA 3C43A 4G09A 2I4OA 2WSBA 4IPTA 3JY6A 1PV1A 3I12A 1UFRA 5HZGA 3NONA 3LC1O 2QX7A 2ZI5A 2QTBA 4AVYA 5AW8A 4REOA 4MV4A 4XEUA 3R3WA 5LDHA 3GLIE 4CIWA 2MYPA 2RHLA 1VE6A 8OHMA 3CSUA 4BN4A 3K53A 3N7TA 5FWYB 4DMHA 1ODIA 4KQEA 1HL3A 3BJRA 2OM6A 5JADA 5C1PA 1YBVA 5KYTA 4IV5A 1GYRA 3RS8A 4LHZA 4UFPA 3BE5A 3JPYA 3ZR4B 2CNLA 4K0KB 1J6UA 1T2CA 3OM8A 4GP6A 4H7EA 4XX1A 3LQRA 4PVDA 4YLGA 1V7QA 2BVNA 1M2FA 1YU9A 4CLXA 3S0JA 2V7GA 4YMGA 1YZTA 2GK4A 3PXEA 3KJZA 3WGUA 4L0DA 4C0SA 2E1PA 2FE4A 1N0IA 3IBFA 3RG8A 4BNZA 3ZHUA 5FI5A 5DX8A 3SHQA 4PBRA 1MLDA 3C3XA 3V4VB 1HGXA 3H13A 2P2YA 3EXIB 1IUOA 4V2IA 1DWQA 4EFNA 3ZWMA 1WU7A 4B82A 2QW1A 4Q48A 5JD6A 3QU7A 3CR8A 4X3OA 3HDGA 3FGPA 4BO8A 1TUBA 1EZZA 3FDZB 5LPNA 1P2FA 1U65A 4AU1A 1UK6A 1W5EA 1OLXA 3GVIA 3QXSA 2AOUB 3LMKA 3CPEA 4QEZA 1KI6A 4FMCF 3R7WB 2M6SA 1O0BA 4P0TA 2IYXA 3JQBA 4W8HA 4L50A 4KYTA 4XPIA 4B84A 1YZGA 2Q4DA 1GZ3A 2VCEA 5FPQA 4V0LA 4KLRA 1TJ3A 5AESA 3X1YA 4ZV4A 1X14A 4UMDA 1PR5A 4ECEA 4ND8A 2HEGA 4GXNA 3V9PA 1YZNA 3S5JA 1WETA 2D1YA 1S01A 2IBMA 5A5VA 5ALUA 2OO5A 3TLBA 5AOAA 5KQRA 3SZGA 3E53A 2FSHA 4YXFA 2QZ4A 1V3TA 3HJUA 5G2OA 1WL8A 2Q6VA 4HDKB 4LBYA 4OHVA 1HA3A 4P81A 2YWCA 2W2XA 1OWOA 4EHDA 4UBOA 4LHXA 3EG9A 4MP8A 3V4SA 2RAUA 2RD2A 2CUTA 1VMAA 1GRCA 1ZCZA 2VSQA 4B75A 1XDZA 3RK1A 3GRUA 4XQ0A 3MQ2A 5FA6A 4JT2A 5FPYA 2P2LA 2P1RA 2ZUFA 2IU6A 1JB1A 4AZ3B 3MMXA 3LUDA 3EWAA 1SOUA 1K63A 3BGIA 1E69A 5E4YA 4ZC8A 1NZDA 2NSDA 4M7OA 3GNQA 2NUPA 1EJ6A 2YZ7A 3OMWA 4RIGA 4TV9A 5KU7A 4R8SA 4XW2A 3P26A 1T9BA 3T15A 2BGJA 2BLNA 4OY3A 3LW8A 2UYGA 3N3AC 1KMQA 4YLYA 4YVFA 1QFMA 4RQUA 5DM0A 4P8RA 1AKNA 3BIOA 5LYJA 3SJCA 1P9OA 1A04A 5KOJA 1Z56C 1E6KA 2C99A 4QPZA 1O94D 1T0JB 4DV0B 2N3ZA 2OCXA 3KJEA 2IYYA 4XB6B 4F5WA 1U5AA 1UQTA 3UWSA 1FW8A 2NU8A 2X0NA 4F3KA 4KO2S 3TKAA 2VL7A 3CF2A 3MMZA 1N2ZA 3IRUA 1QHSA 2JVKA 3F97A 2HH9A 4GU5A 1X0XA 4DA4A 2C07A 4IIUA 4XJTA 2NVUA 5G0WA 3LTNC 1SIWA 3B1KA 3U4GA 4AZVA 1XQ9A 3Q5DA 2N46A 4OBEA 4X66B 2LNDA 2ZIVB 4NSNA 1UK7A 4AZ0A 1Z5OA 3OFND 2QRNA 3PC6A 3UYLA 1KVUA 4Q3NA 1XCMA 3AFHA 3MA0A 4TS4A 3PQDA 1EWVA 2GXSA 1UWCA 4BNHA 5BNWA 2AF4C 3GBPA 4B1FA 4BVLA 1C7FA 5C1DA 5JS7A 4DN6A 5JXJA 5EJIA 2R25B 3E1SA 1ILWA 3EGEA 4AJLA 4BO3A 3L4EA 1YULA 3EHDA 4DIFA 2B4AA 2ZOSA 2OFOA 3MT7A 3R4CA 4DCSA 3UJ6A 2G71A 2Y0EA 2ZTUA 2HBYA 3QWAA 3RM3A 3HZHA 2XBMA 2P27A 4FD3A 3E22A 5IMBA 4LCEA 4DLYA 4EW2A 1K5DA 3C41J 5C52B 1NULA 3KSAC 3U3ZA 4OX9Y 5H68A 1G21E 3PQCA 3U1VA 1Y7LA 3NOOA 1ZVMA 4ZI7A 4ICIA 1BVUA 1TVEA 3U7QA 4LJAA 3BF7A 3X1MA 2R48A 2XW6A 4J4TA 2Q1YA 1PI3A 4KR0A 3I9KA 3A6FA 1QYDA 3MHPA 5T4EA 1K7EB 3AG5A 3L4JA 3O75A 3WZ2A 1OZGA 3AOEA 3IAUA 2VRCD 4D44A 2BSAA 1SBTA 1E96A 4HGPA 3OIFA 4L85A 3NJ8A 2HAEA 2X7JA 4DOMA 2C9MA 1P1KA 1Q3KA 5FO0A 3A1UA 1R6AA 2BBTA 1YK1A 3CRW1 3E9DA 4KPFC 5M04A 4WLNA 1WTAA 2XE6A 3PXUA 4GE3A 4J1TA 4AJPA 1YD7A 1EHCA 1P1IA 1D07A 4RD3A 4DA7A 4LYGA 4TSKA 3CVJA 2AHOA 2GPAA 3FE2A 3P45A 1SXJC 2CMKA 1LLUA 3UUGA 1SC3A 3A4IA 3AY3A 1E3WB 3IT0A 1Q74A 5JNWA 3VAZA 1LU9A 3ICWA 2PX6A 5E9QA 4KRYA 1PJBA 3CF6R 4LDPA 5EQJB 3UTCA 1JQBA 4F7WA 4NR0A 4CGZA 4JYAB 2FFQA 4L8YA 4ZAYA 1GZDA 1YR1A 2JAWA 4ZPXA 2HA3A 4I19A 1IXRC 1YQDA 4G3XA 4GDFA 1Y1TA 3HP4A 3KJHA 3G2IA 2I6TA 2AJTA 3RDPA 1YBHA 2ASEA 4REMA 5D3MB 1URPA 1QU3A 1MT3A 1W4AA 3D8SA 1W30A 2NXCA 3T35A 4P5DA 3JWEA 2VTBA 2IYTA 4NEQA 1OWNA 3VR5D 4ZZ0A 2VDWB 4KRFA 1U31A 1NQWA 5DN9A 3BXOA 3MYRA 2PSHA 4EDFA 5JS8A 3ZPXA 1I5RA 4X64B 3QELA 1OU0A 3LUKA 1TJ5A 4PICA 2V59A 2XQFA 3GJXC 2IOFK 1JI0A 2OVFA 2RHOA 2PUTA 3KD3A 2YUIA 4KNVA 2D0DA 5FWYA 1PBNA 3LL7A 5F5XA 3ICPA 4EO9A 2ILTA 5MN5A 3HBNA 4CKWB 1DHRA 2VHTA 4J6FA 4Q9KA 1MU0A 1OLOA 1J25A 3A9SA 3AESB 3SU8A 4OGKA 4S0XA 3CEAA 3AR5A 3A9VA 3PGKA 4Q05A 4B80A 4ZEMA 3OC6A 2HRZA</