1MV5A

Crystal structure of lmra atp-binding domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multidrug resistance ABC transporter ATP-binding and permeas
publication title Crystal structure of LmrA ATP-binding domain reveals the two-site alternating mechanism at molecular level
rcsb
source organism Lactococcus lactis
molecule tags Transport protein
total genus 63
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 7.6.2.2: ABC-type xenobiotic transporter.
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mv5A00
1MO3A 2IS2A 5FTKA 4NE2A 3GJ0A 3B82A 2C5LA 3FMPB 3MRSA 1D6JA 3E1SA 3KXKA 3GJ4A 1XMJA 1TF2A 4A82A 3CZQA 3B60A 4MRPA 3KQLA 3T61A 1OHHD 4DCUA 2ZJ2A 1OXTA 1IN7A 4XJXA 4B74A 1S8FA 2J0UB 2GBLA 2REXB 3KKQA 4LX0A 5JZVA 1Z22A 1FMLA 3CF6R 4DSUA 4JL8A 2ODWA 3T5DA 1EESA 1NLZA 1IJEA 3P26A 2WMOB 2GJAA 4EFLA 1E96A 2FN4A 1G17A 4B3DA 1E2EA 3I8SA 1Z6AA 3CO5A 2ZVQX 1G6OA 1T3LA 2QMOA 4TL9A 1W36C 2C9YA 2QY9A 3EIHA 5CDFE 3K9NA 1Z63A 2AFHE 3GEHA 1E2FA 1SXJE 3EARA 2EYUA 2XNDA 1QHIA 4I1SA 4JS0A 4UJ5A 5IK2A 1HA3A 5J4YA 2YJTD 1U0LA 1OFTA 5FUVA 1NNEA 3LH5A 2OXRA 3FKSA 2H8KA 2R8RA 1XD2B 3AEZA 3EAQA 5BQ5A 1PVOA 2IUTA 4ZDWA 3WHLA 4RFVA 2JLXA 1FX0B 3TVTA 4ZKDA 3GFTA 3BAFA 4QRHA 5EE3A 5EUQB 4CEIA 1CIPA 2ZJBA 1ZINA 2DBYA 2OBMA 2B6HA 5L3RA 2NQ2C 3WBJA 5FUXA 2FF7A 3TKLA 4BLOA 3NH9A 1SKYE 3CM0A 2DWPA 2OBLA 4G0NA 4I4LA 5FTJA 4LHYA 4RD6A 4XWOA 3EX7C 2XGJA 3RYTC 4CZ2A 3WYAA 4IVPA 2HYDA 4B43A 1MO6A 1E98A 1P60A 3U3KA 2ZE6A 5AJWA 1T91A 1T6NA 4XSHA 3THWA 1TQDA 3WMEA 4DT1B 3CPJB 3OFND 2K5UA 2OXCA 3BFVA 3VX4A 2BMJA 1ZRHA 1DEKA 4NP6A 1UM8A 2WWWA 4IKEA 4YXWD 1XTJA 1U90A 1VG9B 1QG2A 4HI0E 2ZJ5A 2D7DA 4KFRA 3SDZA 4FCWA 1KJZA 4FN5A 4HLDA 2FMXA 2KBFA 3SI7A 4KHZA 5DI9A 2PH1A 1GILA 1DAEA 1NMYA 3QBTA 3AGPA 4A1FA 1KSFX 2VHJA 4Q4JB 5KPDA 1QHYA 3QVVA 4KXFB 1QG4A 1R10A 1NN1A 2CVHA 2Q3FA 1UBCA 1XF9A 3LW7A 4JYCA 1J7KA 3LV8A 4LRWA 1NBMD 2WSSA 3K70D 1CJMA 3K0FB 1Z0AA 3WYFA 1JPNA 3C8UA 2X77A 3OIVA 3EWSA 3K09A 4PX9A 3GFOA 1QRAA 1E9BA 3QKRA 3MMPA 4KFUA 2FE4A 5DSZA 1NN3A 2FG5A 1ZNXA 2AX4A 4UNQA 5DIFA 2Q3MA 1BMFA 1SVIA 4KAXA 4OJKA 3R7WA 1TU4A 2ZJYA 1Z6GA 4WVFA 3Q3JB 5FBQB 2WV9A 2JDIA 1D5CA 2BVNA 4TT3A 4IOKA 3ZGXA 3HPQA 1QF9A 1F48A 5LD2B 3C15C 1LF0A 4QNRA 1UEIA 3K09C 4IDPA 4TT3D 3W8NA 4ZDIA 2G0TA 2ONKA 5FL3A 2GF9A 1CU1A 3GMTA 1LTQA 2EQBA 4PR0A 3TAUA 4XSGA 3Q85A 5EQTA 1KAOA 4DLSA 1ZCBA 4FMCB 2CNWA 2FFHA 3WMGA 3KTAA 3LLUA 4FMDB 4KBFA 1DAIA 2PLFA 2XNSA 3GJ8A 4Q9IA 4X8HA 4CEHB 2IW3A 3NBYC 2B92A 3CLVA 1YE8A 4LBWA 4IEEA 1KMQA 1Z2CA 3DPUA 3Q5EA 3JZMA 3SQXA 521PA 2XSZD 3GLGE 2YWEA 1G19A 4EPRA 1VYVA 2DFKB 4P3YA 3LLMA 221PA 4LZZA 3W5JA 4CYMA 3R9XA 2FSIA 2FV8A 2QI9C 2IUSA 4TN1A 3O47A 3WY9A 5HCIA 2R6FA 3A1TA 4JLMA 1L8QA 1OH8A 1FNNA 1ZC4A 3A36A 4HDQB 2KE5A 3QQ5A 3KXLA 4PSVA 1TF5A 2NPFA 2ZRIA 4TQAA 1R5BA 1SXJC 5AK0A 2XZOA 2BV3A 2ZR0A 3V4RA 4MKFA 4EUNA 3OEHD 3ZVMA 4DRZA 4C4PA 1A4RA 1VIYA 4PPFA 2ONJA 5C2JB 2OSBA 5C4MA 4MKIA 1ZMXA 2QNRA 1MKYA 3J81k 3IIJA 1BH2A 2QSZA 1HEIA 5GVRA 3SU8A 1XTQA 3BGWA 4P4SA 5JSZA 1FTSA 2DPXA 3QKSB 4DUGD 1TF7A 4YLGA 5FOTA 5TY0A 2FFQA 4L5BA 4M1OA 4LY6A 1TUEA 1F2UA 2FFAA 3A4NA 4JBYA 1G3QA 2CJWA 2NIPA 4HYYA 3VTKA 5EP3A 3CR8A 1GSIA 3DL0A 1DTSA 4PQFA 4X8MA 1S1MA 1YR9A 4A0HA 4MGIR 4A4DA 1I2MA 2OFWA 3AKCA 3LX5A 1LV7A 3ETLA 2H7VA 4QGGA 1EFUA 5FL7A 5SZJA 2QT1A 2OFXA 2A5DA 2J7KA 2VSFA 3ZH9B 2WBLC 1T0JB 4HZUB 2GXUA 2FSGA 1CP2A 1ZU5A 2BEKA 3BS4A 3L8ZA 2IK8A 3TQCA 1QZXA 3N2IA 1OXSC 1B23P 2CHGA 4OYHA 2WSMA 1DAHA 1W0JA 2FX3A 2VHUA 3NC0C 3TR5A 3LAWA 1YZGA 1QVRA 1Z0JA 2JJ1A 2GEVA 3MG9A 2Z0MA 2IT1A 3FYHA 3VQTA 4UNRA 5TV2A 5FBVB 1W0JD 3LD9A 1NY6A 2J0UA 3A1WA 2DWQA 4RD2A 1W44A 2OE2A 5IT5A 3SC3A 4Q7JB 3QI2A 1A82A 2H18A 3CX8A 3QVUA 4LBZA 3I5XA 4FWTA 2VP6A 3TQFA 1AJEA 2IYRA 1JQLB 1N5JA 2CL6X 2BM0A 1SVKA 4GP7A 4KYIB 3RVBA 4BECA 5KTYA 2QTVB 3QKUA 3B1XA 1GNPA 1RRGA 1ZM3A 3TLXA 2O8DB 1C4OA 1VYTA 1P62B 1VHTA 1JR3A 1WCV1 1XEFA 2HLDD 5G3ZA 4Q1AA 3CBQA 1AA9A 4NYIR 1MABB 4AYTA 5KSZA 1OPXA 1EWQA 1Z06A 1N0VC 2FPMA 3B6EA 2QSYA 4JL6A 3W3ZB 1YZNA 3I72A 1AS0A 3H0KA 4URZR 1JR3D 4JKIA 3QXXA 4E5UA 5L3QB 2A9KA 4BZXA 2Q0HA 1P2TA 3L0OA 1XEWX 5EE0A 5JBQA 4H1VA 1XPUA 1KMHB 5EXTA 3BH6A 2QA5A 3AKYA 3KJHA 5JJKA 4A0FA 4KI0A 3V00A 1L2TA 5JI2E 1YZQA 2Z43A 3BH0A 3MWYW 1KK2A 1P6XA 2HV8A 1RIFA 1OLOA 2GK7A 2V6IA 4HUQB 4MRVA 1E1QA 4BFXA 2BCJQ 4E07A 1KO7A 1XXHB 2HUPA 3LFUA 4QM7A 2PZGA 4Q00A 2ZI4A 5CM8B 1E2IA 2QAGC 5H68A 2GKSA 4U5XA 1UEJA 1E1QD 3ZIAA 4QM6A 4GPTA 4C2UA 1KK1A 5LB2A 1CJKC 2ZYUX 3VR6A 1NG9A 1CBUA 1F3OA 4NMMA 3G5UA 1Z6TA 5CK5A 1OH5A 4OI0A 4LV6A 1VHLA 3FMOB 2P67A 1JBKA 3M0EA 1ANKA 4WZ6A 1E2DA 2JJ2A 2F7SA 4I99A 1C9KA 2F55A 1RW4A 1ESNA 1YR8A 1UKVY 1N6IA 2QROA 3LW8A 5FTMA 4B48A 4TLDA 2NO9A 4M9QA 2GILA 2GWHA 1K8RA 2IYLD 5HE8A 4P33A 4KITB 4MUBA 4GSYA 3KQUA 1CS4C 4Q4JA 5F9FA 2F1HA 4QBFA 3BRWD 3CRVA 1YZUA 3E70C 5A5GA 2NMVA 4B3FX 3R8CA 4OI4A 3B5JA 4XWAA 4BFSA 1I4LD 3KKPA 3EA5A 3DM9B 2LKCA 5BWMA 3RRMA 2ZRFA 4S35A 3A58B 4M9XA 3K0FA 3AVOA 4LV8B 4X8LA 1YR7A 5LDDC 2BMFA 1SHZA 2N1BA 3SYKA 1OJLA 4Q66C 1S4QA 3IQWA 5HTKA 3SYLA 1ZIOA 4HSEA 1P4SA 2JLQA 1FNMA 3RC8A 3LQRA 1E0SA 4GDFA 1GOTA 1NKSA 4AC9A 1G7SA 3U3OA 3AP1A 1SZPA 2GEDA 2ZJZA 2JLUA 1O3YA 4QBIA 5J4KA 2JASA 3W6OA 4TLEA 5DHFA 4EQ6B 5FOSA 1X1RA 1E2HA 2ZRKA 4AYXA 1KHTA 5J4VA 4JLPA 1EXMA 1U8ZA 4PSAA 4TL8A 5H70A 2D7CA 2ZRMA 4PC2A 1RJ9B 1U0HC 2IYZA 4PO8A 5DLQC 3VU9A 1UF9A 5TARA 5CLQA 4KVGA 4JVNA 2QE7A 3AB3A 2ZITA 2IC5A 4GMDA 2AKAB 4II7A 3NBZC 2ZAMA 2ZE8A 4NYIQ 4KSCA 4UXJA 1R5NA 3LVQE 1BKDR 2ZPTX 3V9PA 4CEHA 1AZTA 2FU5C 1F60A 4IJMA 2F1RA 1QDEA 3PUYA 1A5TA 3FKQA 5LD2C 2JLRA 2QE7D 1X8KA 4MYHA 2TMKA 5HE9A 4G5QA 1W0KA 1TUIA 2ZYVX 2ORWA 4NONA 1A2BA 1SVSA 3BH7A 4O2RA 1VCOA 1R4AA 1Q44A 2KB0A 4MYCA 4R71A 2GVDC 1M74A 1W49A 2GHIA 4TYQA 4B3BA 1KI8A 3QPWA 1NRJB 3S1AB 3C14C 2V8OA 1G8YA 1KDPA 1MRNA 4OQLA 3M1IA 3PCRB 4E22A 4W5HA 4H1UA 4TYWA 4DXAA 4AG6A 1UJ2A 1ZVQA 4B2LA 2D2EA 1ZM9A 1IJFA 4KBGA 3D3QA 4LJ7A 2NO6A 3I8XA 2YNMA 1XJCA 1D2NA 2A3RA 3MFYA 1ZM7A 2QG6A 3WNDA 4A36A 1V43A 4BEBA 4LI0A 4EPTA 4M1MA 2WVJA 5B2ZA 1GUAA 3VR3A 5JJLA 1MH1A 1GNRA 1ONBA 2P6UA 1E69A 5GJCA 5J4HA 2FEOA 2OT3B 2O0HA 3LO5A 1BYUA 1YZTA 2ZI9A 4GBMA 2C2HA 1MO5A 1ZBDA 3QKSA 1TPZA 3EG5A 1U2RA 4IOJA 3C5HA 4M1KA 5GADl 2OM2A 2XTNA 3EZ7A 5TB5A 4PTLA 3PFIA 4ESHA 4QFMA 3KX2A 1E9DA 2ZSFA 3U7FB 2WKPA 5FOWA 3SHFA 5KU1A 2DFLA 3K70B 1G4AE 4V0OA 4ZCLA 4XD7A 3RRZA 4DZZA 3TGPA 2EFHB 3LDAA 1TMKA 3PIRA 4US1R 4JJKA 4D81A 1COWA 2A5JA 4R2IA 1G291 3U5ZB 4ZCIA 1NJFA 2ZSAA 1S9DA 1GVNB 4EJSC 2FZ4A 3KQHA 2MMCA 3TK1A 1VG1A 1YJ5A 3IPXA 4HLUA 4HZUA 1VIAA 2J5XA 1T0HB 1VKJA 1ZCAA 3IHLA 4XTCS 2EU8A 2CCGA 3T35A 1R5OA 2D4HA 5KNDA 1G1MA 1P61B 3WNCA 1GITA 1RZ3A 2W2XA 5LB4A 3U44B 3CONA 1OYYA 4LK2A 2HJGA 5FI1B 5FI0B 3EIEA 4DLYA 4CEIB 3JVUA 1A1VA 3AKEA 2IXFA 1ZM2A 2EVWX 4WXRA 3AV0B 3R9WA 5TMPA 3T06B 5FFMA 4CT4B 2J0VA 1O87A 1PV4A 2ZSEA 1RRCA 4DCVA 1R6BX 1XJQA 2RGAA 2VIIA 3A8TA 1FQKA 1MT0A 4PQRA 4CW7A 5EUMA 3OE7A 3T1TA 1KKLA 2DR3A 2QMEA 4MRNA 2WMNB 4ASUA 1AKYA 1XJ0A 3L8YA 1EFRD 4FD2A 3CR7A 1FFHA 5JWHA 1E9EA 3HR7A 1SKQA 1R0XA 1MABA 5KDLA 3SYNA 3TRFA 4TLAA 1FW6A 1PZNA 5L3QA 1PUJA 5AUPB 1SVMA 4LC0A 2GJ8A 2ANCA 3NC1C 3PUXA 3RS5A 4IOLA 2QORA 2GXAA 1T8TA 2QL6A 2A2ZA 4GOJA 5FBLB 3QG1A 2V1XA 2BJWA 4Q1FA 2JLYA 4PAQA 4OQNA 3H84A 1KSJA 3K0EA 2A30A 4BFWA 3TSOA 2VL7A 4EAQA 3DMNA 4F92B 2E1RA 3WNBA 2Z83A 1P73A 1Z8FA 2FH5B 2PLRA 2DFNA 4D0GA 1G5TA 2X2FA 2CEAA 2X1VA 4HUQA 4QHTA 4RFSB 2AR7A 3AP2A 5LBIA 4A6PA 1XXHA 4HAWA 4NU0A 1G16A 2WOOA 4G3XA 1K5GA 3B9QA 5K8TA 1J90A 1E2NA 3PENA 3L43A 2ZREA 1NMXA 1Z6XA 2ZETA 3SHWA 3EPHA 5HZKA 2ZU6A 2ZYWX 4HUTA 1W2HA 3U2QA 3HDTA 2WPDD 3EZ6A 1DOAA 4RD1A 4JLAA 3NVAA 1AN0A 4LJ8A 1E1RA 2C95A 4B3CA 1YKSA 5AUOB 4B76A 2Q9CA 1GRNA 2C9CA 1CEEA 3GLIE 4D6PA 3BIFA 3ADDA 3K1JA 1E1RD 5UKDA 3QOFA 2GCOB 2W0MA 1YRAA 2DCUA 3R20A 5B30A 4JZKA 3VKHA 4HZIA 3HR8A 2NG1A 3TSZA 4UXHA 1E9CA 2OLKA 4PZYA 3BB3A 3T5GA 1Q22A 3HU1A 3A1SA 3AF3A 3KUCA 1X86B 4M1WA 3PR1A 3CW2A 3SOPA 5L3SB 3K53A 1OHHA 1ZU4A 3AH8A 3RHFA 5JCZA 2VHTA 1OYWA 4NCJA 3W9YA 4IW3B 3KUDA 3OEED 2YWGA 3B1WA 3GPLA 3AVWA 2CK3D 4MGKR 5FBWB 1H8ED 2HT6A 3CRRA 5AJXA 5K8LA 1MR3F 1T3HA 4AWXA 1OIVA 4L16A 2WJGA 3SJCA 2OILA 1LVGA 2H16A 3E5HA 2Z5FA 1DELA 2IXEA 4LC1A 2ZI6A 3FMIA 3MCAA 2IWRA 3FDIA 4NYJR 4RD0A 4URUR 3DOFA 2ANBA 1E94E 4LV5B 1KDOA 2XXAA 3T12A 4A8JB 2ATXA 1NSFA 2NZ8A 2ZSDA 4OK5A 1M8PA 3AVQA 1G18A 2QMHA 4EQ6A 4TZ0A 4FINA 1TNDA 1RRFA 2WKQA 2EFCB 2QGNA 2EYQA 2GBLC 2ZRAA 5CITA 3VR4A 2MSEB 3PUVA 3NTUA 4LYFA 3AVXA 1KNQA 1U81A 2Q21A 1E2LA 1HE1C 1N0WA 1IOZA 2BEJA 2VO1A 1Z3IX 3RS7A 3HPRA 4Z51A 1R0WA 1R8SA 3LBNA 3QF4B 2CDNA 2HJVA 3ICEA 5J47A 3CNOA 1ZM4A 1L4UA 2IEZA 5JS8A 1DAMA 1U9IA 1FUUA 3HJNA 3QSYA 5FPKA 2PX0A 4LJAA 5LPNA 4C2TA 1X3SA 2UZIR 2JLVA 4DKXA 3B85A 3SJZA 2EWVA 4C0HA 3IEUA 5KYKA 2FOLA 2R6DA 4JVLA 1E2PA 3IDQA 3OFNA 4D0NA 4GMXA 1GIAA 1I4DD 2GTPA 2O8CB 2JEOA 3S1AA 1QHGA 2G1KA 5AJYA 4YXWA 5C4GB 4WBSA 5AWFC 1U98A 2VLIA 4LUCA 1NIJA 4NKRA 4M8NE 4Q4AA 3IKJA 4PZZA 3TR0A 2O8BB 1M7BA 1U9IC 2ZVPX 2J41A 3RC3A 1K6MA 4FCTA 3QXHA 4JT4A 1EK0A 1P9WA 1P2UA 4Q47A 4XVQA 4BFTA 1XEXB 4FI3C 2ZROA 1E9AA 3GLGB 3X1ZA 1HV8A 1DADA 1XTIA 3AF0A 2R6AA 2RCNA 3AF4A 1JAIA 3GLFB 2GJSA 2UKDA 2OAQ1 2AN9A 2B8WA 1HUQA 1NBMA 3DEFA 3TBKA 1ESMA 3BWDD 4RVCA 1Q3HA 1XTRA 4N0EA 1YU9A 2VF8A 3AKDA 2RHDA 3QPVA 2RGEA 4N1AA 5CB6A 2ZS8A 4NPHA 2D2FA 3A37A 1JAHA 2AL7A 4O0MA 1W48A 2F9LA 2AHOA 1XPRA 2WAYA 3QNUA 121PA 2HCBA 2ZJAA 4R2HA 4ZO4A 4IVRA 4TTQA 2AD1A 3NXSA 4CF7A 3R8FA 3RWOA 1N6KA 5E4FA 4JLDA 4C0BA 1TADA 1HYQA 3U61B 1WE2A 1JQJC 2ZAOA 5KUTA 1OW3B 3O8CA 2QN6A 3TVDA 1SVWA 2F1IA 2FDCA 3RRYA 3K70C 3MWLA 4B73A 4GOXA 1JR3E 5E95A 1NKTA 4LJ5A 3U44A 3Q7QA 1QHHB 3ADKA 3IQXA 2BJVA 3RSLA 1AQYA 1LFDB 4URWR 4B2PA 4A15A 2PEZA 1E0KA 3SE0A 5G53C 1EWRA 6Q21A 2N46A 3I73A 4NYJQ 2B21A 4AKHA 1KI2A 2ODNA 1G4UR 4DC9A 2JCSA 1KJYA 3BB1A 2FEMA 3KJEA 4AI6A 2C03A 2ZUBA 2NO0A 4RKFA 3AVYA 3I5YA 5DNYB 1GL7A 2WWIA 1XMSA 3L0PA 4TL7A 4HDCA 2VTKA 3QEJA 1XRJA 2Z6VA 4A6XA 2P6NA 1XP8A 1P9NA 2H92A 3JZAA 5KDOA 2YZ2A 3FHTA 1AQUA 5ANRB 4PHHA 1GFIA 2ODBA 4XH9B 1N6HA 4OBEA 1PUIA 3D6TB 3NIBA 3PUZA 5KHOC 2XSZA 2ZEJA 3N5CA 3LA6A 2CCKA 4D2IA 1AKEA 2CHVA 1KNXA 2VA8A 2WWGA 3EIQA 3KKOA 4B75A 4DDUA 3EC2A 2RGGA 3VR1A 5FR2A 4RD4A 3GJ7A 4NCIA 3UG6A 4XVRA 3SFVA 4Y0AA 2IYQA 3OEHA 4G5RA 2WM9B 3GJ5A 4D0LB 4HATA 4MGYR 2DB3A 5HCNA 3B1YA 4G5OA 3L0SA 2FGKA 4TTPA 3I1FA 3MSXA 3VX3A 2X2EA 4B35A 1WBDA 2Q6TA 4B47A 5G40A 1US8A 4OHVA 4PHTA 1H8HD 1PJRA 4DUGA 2AWOA 2QM8A 4C7OB 3RRNA 2GXQA 4XOIA 1AGRA 2P5SA 1IXSB 4EDHA 4TYYA 3SEAA 4TSFD 4ZIRB 1FP7A 2W6IA 4BZQA 4FMBB 1ZNYA 2FSHA 4BFUA 4AYWA 1E2MA 1FZQA 1UBGA 1VG8A 1KJWA 2BCGY 4GP6A 5DGXA 4WZBE 1M1YE 2ERXA 2W6ID 3QJYA 2Z4RA 3IBYA 3NHAA 2ZRLA 2ZRCA 4MYTA 2HXYA 5E7IA 3AF1A 2IYTA 1TAGA 1U94A 5KPJA 4F7WA 2O8EB 1RRPA 2FJUA 1KO8A 1N5KA 2WIAA 3BD9A 4X8OA 3BFXA 3BORA 3H4MA 3OHMA 2RKOA 5AR1A 2BKEA 2O5VA 5BYKA 1SQ5A 1XTKA 2HXSA 2W6JA 1D8TA 1W4AA 4HB0A 3T1VA 1Z08A 5L3SA 1DAFA 1MRSA 1HURA 1BYIA 3GD7A 1G3MA 1NI3A 1GRRA 3KKMA 1ZD9A 2XAUA 4Q9HA 3WP0A 4EFMA 4EKDA 4TYNA 4TMKA 4WZAE 2W6JD 4IHQA 1ZJ6A 3LY5A 3ASYA 1LB1B 1LW7A 1KY2A 3DKPA 4V03A 4IRUB 5EXPA 2OCPA 1HTWA 3OIYA 1GM5A 3WHKA 4HB4A 4WIAA 2QP9X 1WF3A 2RMKA 2FNAA 4AIIA 3HYTA 3H1TA 3NKVA 2HLDA 1OV4A 4UKDA 1PLLA 4A8JA 4JLOA 1XMIA 4NH0A 3NBXX 1DBSA 2CL0X 1RPZA 1S96A 3MJHA 3C41J 3VMFA 1XD8A 1UDXA 3U4QB 2YVUA 1JI0A 5EP4A 1CJTC 4GOKA 4OKSA 4PXAA 3Q5DA 3AQ4A 3V4FA 4BFZA 2JLZA 5F9HA 1G5RA 3F3YA 3MWKA 3JVVA 1WP9A 5A4JA 1CLUA 4CEJB 1XD2A 4CDGA 1E2JA 3Q8XB 2C9OA 2GAOA 4MH0R 4W5JA 3G0HA 4B33A 3BXZA 1KSGA 4D26A 1FX0A 1R0ZA 1DPFA 2JIZA 3FE2A 1JJ7A 4OQXA 1Q1ZA 1EX7A 2A5GA 4A8JC 4HAVA 3QF4A 4U02A 3GJ6A 4PHGA 4ZDJA 1Z28A 3OAAD 4BLSA 4F4JA 1OKKD 1KTVA 3GLHB 2QPAA 2JIZD 1ZYUA 2IYYA 2XITA 1KO1A 5DISB 4F4CA 3U3JA 1QHXA 3PEUA 2J3EA 1IM2A 4GI7A 2ZQ5A 3O8DA 3X1YA 4BQSA 1E4YA 4DLRA 3EASA 4OL0A 2ZRJA 1N5IA 1OB2A 3GFPA 5JRJA 4DLTA 5F3WB 1IHUA 3GEIA 1CF4A 1NN5A 1E99A 1MV5A 1X8LA 3TIFA 2ZRNA 4DT1A 5EXXA 2G83A 3ZQ6A 2XTZA 3FMFA 4D80A 2O8BA 1GKYA 4DCTA 2BHRA 4IDOA 2GEUA 4Q4HB 5HZHA 5CK4A 4NDZA 5DHAA 1GNQA 3P32A 1YQTA 1FP6A 5DE3A 2B8TA 5H1YA 2CCJA 1HY3A 1P2SA 2WJJA 2VP2A 2R65A 1XEXA 2CVFA 5J5CA 4CIDA 2QPOA 5DN6D 2B7BA 3CH4B 4L9WA 4DCNA 4LHWA 1QHSA 4LJ6A 3BB4A 3UMRA 4B34A 4KJZA 4Q7LA 1NN0A 2VF7A 4MYUA 5IDVA 4U7DA 1KZGB 3GLFA 4JSYA 4UNSA 3SFZA 3NG1A 4AKEA 2GETA 3I4LA 2FSFA 4KODA 4QGAA 5G41A 3SBDA 3VAAA 3PUWA 2G6BA 4BRWA 4LSGA 1SVOA 4JMPA 1RYFA 1OH7A 4Q1EA 4DIEA 1DG1G 2ZE5A 2AKYA 4BLTA 3NWJA 3DOEA 3IIMA 2A78A 2ATVA 3QIAA 2XZLA 4LPSA 1XEWY 1ZP6A 3OF5A 5JHGB 4M21A 3SZRA 5KNCA 5KOYA 3GEEA 1CTQA 1KO4A 2FGJA 2R44A 1JXMA 2ZTSA 1W5TA 3VKWA 2ZRPA 2B7CA 5CJ2A 5CYOA 4B2IA 2O0KA 2WICA 3P27A 1KDRA 3EZ9A 4RJLA 3U7HB 2VHQA 2P5TB 2YC4C 1Z0FA 3CPHA 4M9SA 1VCMA 4RZ3A 4TZ6A 1ETUA 1QHHA 5A0FA 3VHLB 1RC8A 4QNMA 3WMFA 2AK3A 1CRQA 2Q3HA 2QM7A 2AFIE 2VH5R 2A5YB 4Q18A 1Q1BA 4LBYA 3KJIA 4LHVA 1XB2A 4NCHA 4QGHA 2JJ8A 3W6NA 3LXRA 4QJ4A 1W47A 1E9FA 1KIMA 2QUZA 4L4UA 4Z1MA 5IRCD 3DO6A 2PMDA 3CRMA 4MDFA 1E32A 3IO5A 2P65A 2CE7A 2OEPA 2PT5A 2QAJA 4GFDA 4PPQA 4B71A 4DVGA 4YMTA 2CLCX 2H57A 3DKVA 4Z1MD 1KKMA 1Z83A 3RDPA 2QPTA 1XXHE 4I1UA 2BBSA 2I1QA 3AUYA 4Q7KA 3A1VA 2YWFA 3MAAC 4PAMA 4LGMA 4Q1DA 1FUKA 2V6JA 3BK7A 1D2EA 4YONB 4FMCF 1N6NA 1NLFA 2NGRA 3ZVLA 2ZR7A 4A2PA 3ZYCA 4FMDF 3FWYA 1F2TB 3AVPA 2NOAA 1KSHA 1KOFA 1R8QA 1IAQA 3MLEA 2I3BA 3U3RA 1M6NA 5CIQA 4YQFA 5IF9A 5JRZA 3IPYA 1G3IA 4QG7A 1NVVR 2P3SA 5CM9C 1AZSC 2WWFA 3QKTA 4KLZA 4M4SA 3TW4A 5IHPA 5M04A 2KWIA 1Q1QA 2PZFA 1VMAA 2CLSA 3OESA 5EZ6B 2NO1A 3ADBA 5CLLA 1YVDA 4A0RA 5JEEA 3FFAA 4N3NA 5G3YA 1W4CA 4ZIRA 2DWOA 2W00A 1GWNA 3B1VA 3C5CA 2G1JA 4QJ5A 3EWAA 2C99A 2WHXA 4V0MA 1BIFA 2JATA 2YV5A 4DB4A 2O8FB 4OI1A 1RKBA 1UBFA 2A5FA 2G3YA 3DMDA 2OV2A 3BOSA 2H1LA 4BUJA 1E2KA 5J4LA 1E79D 2V1UA 3VR5A 1V5WA 2QRNA 3O8BA 1A7JA 5L3VA 2O8EA 1ZIPA 4KFSA 2W58A 4TMZA 1T4GA 4MQBA 2ZRGA 4D4KA 4L8GA 2QQ0A 2C8VA 2ZS7A 5FH9A 2PZEA 4TMTA 3ZJYA 5BXQC 4ESVA 1WBBA 2VP9A 3CX7A 3KQNA 2EFEB 3FHOA 1T9HA 4QL3A 2GA8A 2EW1A 1AS3A 4U00A 1M7GA 5FBRB 4DBLC 3GLIB 5JS7A 1KI3A 3ND9A 1QVAA 2DYKA 3QENA 3F0TA 1TQ6A 1AK2A 1SHKA 2ZXUA 1W7AA 1ZD1A 4MITA 4BLQA 5P21A 1LF5A 2J9RA 2VPPA 2Z4SA 4HLUC 4PANA 1EFRA 3NH6A 4YDSA 1F5NA 2ZI7A 3PXGA 5EE9A 2UVQA 2PJRA 2C96A 2O8DA 3UMSA 1WMSA 1D2MA 3LBHA 1U8YA 4QJ3A 1G21E 3NDPA 1J70A 3H2YA 4TMWA 3A6PC 4EFNA 1ELOA 2NO7A 3U4QA 5GJBA 4HLCA 1G9XA 1N25A 1XX6A 1W4BA 2MSDB 2PX3A 3KB1A 4HB2A 3AM1A 1Y63A 1IQPA 4CEJA 4Q5IA 1KI9A 3U6BA 2J7PA 5JECA 4FCVA 1KMHA 4AKIA 2HF8A 1IXRC 2BDTA 2XOKD 3THXB 2OUKA 4LWZA 3KDSE 5F98A 1Z07A 2BC9A 2OCBA 3IHWA 1N6RA 4RD3A 2J7PD 5HPYB 4HAXA 4HAYA 1W46A 3GLHA 3KTAB 2D62A 3GJXC 4NBSA 2VP0A 4NTZA 4R9UC 3EPKA 5AJZA 2IYUA 3ZS8A 8OHMA 4W7SA 1S0UA 4LBVA 1G7TA 4EPXA 1SXJB 4DHEA 2WOJA 4K81B 1T5LA 2C78A 4A2QA 4AK9A 4EPVA 2WWXA 4JLNA 2AD5A 4XVUA 2IX3A 1G8PA 2EFDB 2WPDA 1G7CA 5CJPA 3K9HA 4TQUS 4E03A 1WRBA 2P6RA 1XTSA 4BE7B 4PAOA 1NVVQ 4B3GA 2OZEA 2GJ9A 4G01B 2O0JA 4DSTA 1DAKA 2AXNA 3UATA 1NBME 2QP3A 3WXMA 5FUWA 2XEXA 3FTQA 1TTTA 5JMTA 2X8AA 2RB4A 4Q4HA 4DLWA 2BBOA 5EXSA 2FPKA 1VG0B 5DYGA 3W90A 2ZIAA 4DSNA 1G3UA 1KK3A 2VP4A 1R2QA 1W1WA 5FOUA 1SKYB 3X1XA 1YRBA 5GVSA 3K8YA 3L0IB 4YMUA 1XZPA 2OCAA 3FVQA 3O8RA 3ADCA 4P4UA 2J45A 2ZR9A 3PG5A 1T8UA 2QQEA 3THYB 1CR2A 3OEEA 5DYIA 1F2UB 4F38A 4LCBA 5DH9A 2CK3A 4MDEA 1H8EA 3K0AB 3RS4A 2W2TA 2ZRHA 4UJ3A 4P32A 2OAP1 3C4JA 3DM5A 1JEDA 1TU3A 4NYMQ 5GJVC 2F9MA 621PA 4DEYA 2WWYA 1JR6A 5EJEA 1KAGA 4MA4A 2C98A 1W5SA 4ZCMA 5TVKA 4ILEA 1Q20A 3LBIA 4JT2A 1E2QA 4L15A 2KSQA 4DB2A 4A0GA 2ORVA 2RGDA 3KFVA 2J0SA 3QUSA 1JALA 5B57C 3ZVRA 3WBKA 1ODFA 3W5IA 1IN4A 3L82B 5DI3B 4HAZA 2REOA 2IF0A 4EIWA 2CL7X 1L4YA 4HAUA 1NP6A 1ZNWA 2R9VA 5D3MB 2IHBA 3SN6A 3UWKA 3FOZA 2IUUA 3A4MA 2EWWA 4L9SA 4WW0A 1W36D 2IS1A 2OO7A 2BOVA 3EA0A 1XD9A 4D82A 2QBYB 2Q9AA 1RJ9A 4KCGA 1Q1EA 2AXPA 3P4YA 2HEIA 4LOAA 5KSPA 3EZFA 2G88A 1TQ4A 3PEVA 4GNKA 1G7RA 4HLQB 2F1JA 4F91B 3CRW1 4PO9A 5D3QA 2AK2A 4CT5A 3QY0A 4ABYA 5KDDA 3X2SA 2V9PA 4IDHA 2IYVA 2RGNA 3LX8A 1X8JA 3GP8A 5DO9A 4JLJA 4PSKA 2VBCA 2ZE7A 2XNDD 2QAGB 5IK2D 4ITRC 2QEQA 5BW8A 3DZDA 2OCYC 3IEVA 4LDJA 2VSOA 3IILA 1YZLA 2ZI5A 1XU4A 1F2TA 2H5EA 4M53A 4OHWA 4C3ZA 4KO8A 2YYZA 3FKSD 4PQYA 4AD8A 1II9A 1TX4B 1RYHA 5JI3E 4DDVA 1JJVA 3IIKA 2GXSA 4YMWA 2GRJA 2BKUA 4F93B 1T3SA 2GESA 2VYFA 3CUEF 1WXQA 4JBXA 2RGNC 1J2JA 2ODEA 3B78A 3QE0A 4V0LA 2G77B 4WXPA 1LY1A 5JJIA 2ORIA 4OHZA 2GZAA 1ZW6A 2OG2A 1XDBA 5GJWC 4Y0VA 4PHFA 2ZSBA 2JA1A 2PJZA 3B2EA 1X1SA 2V54A 2XJ4A 3FB4A 2UZ3A 3SR0A 1DVRA 2Y8EA 3AVTA 5AUQA 1KK0A 1P7CA 4JLBA 4G1UC 1JPJA 1OIWA 4W5WA 4Q9KA 5CIWA 3UWOA 5K8UA 1G5PA 3ASZA 2O8FA 4XIGS 1EFTA 2R62A 3NHBA 4BFYA 3KL4A 3TUZC 1NVUQ 2V7QA 3SS8A 5ELXA 1S3GA 2ZUDA 4PC1A 4S2EA 3W6PA 5FOXA 1I2DA 3X1DA 2BM1A 3ZLJA 2BMDA 4PFSA 1OXUA 1JXOA 4RZ2A 1E4VA 3RLFA 3K0CA 3EPLA 3D8BA 4OQMA 4WAUA 2V7QD 2KJQA 1G8GA 4IDQA 1P9RA 3FPAA 4TMVA 3VFDA 3CF0A 3P1JA 5H8WA 2J0QA 4QHYA 3R9IA 4C0QC 1E3MA 1A2KC 4H9GA 2G9NA 2ZS9A 3A4LA 1S3SA 1IN6A 3X1WA 4LHXA 4URVR 1KYIA 2NTYC 3KJGA 1J8YF 4ARZB 3WRXC 2C77A 1GKUB 4Q4LA 4BFVA 3GLIA 3UPUA 2G0NA 3K9LA 2REBA 1KDTA 1OT3A 4D25A 4E09A 1GTVA 1NVWQ 2EFGA 2LKDA 4LYJA 3K0CC 5BN4A 2OFOA 5KO2A 1N6LA 3P4XA 2QZ4A 4BLRA 2W2VA 2GJKA 4C0SA 3HU2A 1HQCA 1KGDA 2WSSD 2F43B 1NF3A 2C04A 1OF1A 1RE0A 2IYSA 3AUXA 1P2VA 4IVQA 1Z0KA 2GDJA 4NCKA 4PC3A 5C46F 5C18A 2IL1A 3MWJA 1KZ7B 4O2LA 3PEYA 1XBTA 5SZHB 4JBWA 4RZXA 4M9ZA 3U3MA 4DWJA 2QU8A 4C0JA 3D31A 2WJIA 5FPTA 4JKYA 4DLZA 1E9RA 2IYWA 3DVLA 1BMFD 1VPLA 3QEOA 2D74A 2WJHA 1DAGA 2JLSA 3BFKA 1Z5ZA 3FGNA 4JYBA 1OFHA 2WKRA 2ZANA 3M6AA 5EE5B 2JDID 1TEVA 2SHKA 4TYPA 2I4IA 3DHWC 2ZUCA 3ZVNA 2CLDX 3VU9B 4IEIA 5JFGA 1XCGB 2WJYA 4BZPA 4CRWB 3RS0A 1IN8A 1XWIA 2FA9A 3CPEA 4C9BA 2YKGA 3THXA 1NG1A 1NIPA 1E0JA 5BN3A 3TW8B 5JCPA 4KV9A 1XMVA 4DLXA 3A1UA 4V0KA 4JJZA 1G64A 3QXCA 4UNPA 1H8HA 5CDFA 4CVNA 4RFSA 2LWIA 4Z8XA 1N2CE 1SXJA 2CNWD 3WRYC 1FTNA 4OJQA 4EPWA 3NEJA 1Q57A 5JHHB 3THOA 1HT2E 1ZC3A 5FPSA 2ECKA 5BN5A 4TSFA 2XB2A 2GF0A 1E2GA 4OHXA 3PQCA 4MKHA 1SXJD 3Q9LA 4JLKA 4LJYA 3CZPA 3GLFE 3CX6A 3VKGA 4Q03A 4AURA 1JNYA 4HDOB 3H86A 1HT1E 2VQSA 2ZRBA 4B44A 3PJRA 1VTKA 1QBKC 1FQJA 5E3HA 2PL3A 4TLBA 1WA5A 3TSWA 2RGBA 3BBPA 3WYGA 4V02A 3CWQA 3CH5A 1AGPA 1GRQA 3AF2A 2IYXA 4MGZR 4YC7A 4NHOA 2GCOA 5BYJA 3W34A 4HEJA 3MGCA 3P20A 4TWZA 2PMKA 1LS1A 5B64A 1CKEA 2RGCA 4US0R 3HWSA 3IBGA 1J8MF 3ND8A 4EJSB 3TH5A 3ZZUA 2FPLA 4DEXA 3THYA 4LPKA 1DO2A 3U6KA 4DDTA 5KNBA 2HYIC 5FR1A 3ZZ0A 3UANA 3K0AA 4Q48A 4A9AA 2GZHA 1YZKA 1XNJA 4W9MC 4G5SA 1VDZA 3MUFA 2WTUA 4YDHB 1Z29A 4BPBA 2PCLA 5SZKB 2LCFA 1M7HA 1OFIA 1RVDA 4ACBA 4YMSA 2BMEA 1Z0DA 2CMKA 4OI2A 1QHNA 2VRWA 4M1TA 4GRAA 4R98A 4Q9LA 4UXIA 2X19A 1E0AA 3GJ3A 3LRPA 3CRQA 2OESA 2ASEA 3AVUA 1UFQA 1E9SA 1CXZA 4IDNA 2IS6A 2Q9BA 3B1ZA 1UADA 5DI3A 4OK3A 5FL7D 1EFHA 3SNHA 3LXXA 4PC6A 821PA 2OLJA 2GNOA 2XZPA 1NLYA 4KSBA 5AUNB 1EX6A 1T5IA 2XX3A 2HDNB 1Z2AA 5D3MA 5L8VA 4JVSB 4GL2A 1D9ZA 2J87A 3CIOA 2JJ1D 1UAAA 1OFUX 2P0EA 4POAA 2QBYA 3EC1A 4QXAA 2ZYTX 4JSTA 1N5LA 1U0JA 3OAAA 1OKKA 3C7KA 3CNLA 3QPUA 2ZRDA 1DG3A 5EP1A 3TUJC 2CBZA 4RKEA 3ICQB 4GZMA 4LJ9A 4K8OA 3KZ1E 2J46A 3B8HA 1CJVC 4Q02A 4GT1A 1L7VC 1OXXK 2PT7A 1NVXQ 1DARA 1GL9B 4UQOA 2L0XA 4M1YA 1OSNA 3N70A 2QRZA 3GQBA 5J40A 3HU3A 1U99A 2FFBA 3BC1A 1PLJA 1RFLA 3PITA 4QKQA 2HT1A 3I3SR 1GZSA 1G41A 1R0YA 1FOEB 1H65A 4Z54A 1II8B 2QAGA 3I61A 4ACAA 2QGZA 1XCPA 2WIBA 3GCGA 2A7QA 4DDWA 4MRRA 1N3BA 2O8CA 2GK6A 1SVLA 1ZUNB 3QF7A 2I1VB 1ZUIA 2RGXA 1Y3AA 1PLKA 1LNZA 1P75A 1Z47A 5TDHA 4V0ME 1G6HA 1EG7A 1S2MA 4IFBA 1OH6A 5DN6A 2XB4A 5K8IA 4TL6A 4P4TA 2QTHA 1KI7A 4P31A 3UIEA 2F3TA 1J99A 2CHQA 1Q21A 2BIFA 3L2OB 3GLGA 3NBFA 2R2AA 1JECA 1GL6A 3FHCB 2FZLA 2KI5A 5HR5A 3BJIC 2RHMA 4O3MA 1AM4D 4N0DA 3ECCA 4EPYA 1LS6A 3ZIAD 1NL3A 2QT0A 1HE8B 3RNLA 4B3XA 2DY1A 3RSOA 3T1QA 3T34A 5EZ5A 2YINC 5E7JA 1IN5A 1CJUC 2W83A 5CB8A 2HCJB 2CXXA 5JWOA 3E2IA 1SGWA 1KY3A 3LVRE 2IA5A 1KI6B 4CGZA 2PEYA 4P0TA 1DE0A 2JJ2D 5FPYA 2GVZC 4ON9A 4K46A 2IF2A 2FWRA 2ZJOA 4ZPXA 3TJZA 3HP1A 4Z8YA 2VSXA 3PV0A 2OHFA 2ZU0C 3M4YA 2J59A 4ARZA 3I62A 2YHSA 3DDCA 2PBRA 4M22A 2IS4A 1G3RA 1UBEA 2D06A 1GKIA 3RABA 1W36B 2W0SA 3CWZA 3MJRA 2CE2X 4KFTA 4JLVA 1EGAA 3RAPR 3BE4A 4DLVA 3BERA 2WWHA 3B13B 3IGFA 1GG2A 3LQQA 4I81A 4BLPA 4A2WA 3RANA 2XJ9A 3D7MA 3VR2A 4J0QA 2ERYA 1TEXA 4Q7MB 4FIDA 2F43A 3CKLA 4Q01A 3ZS9A 1G20E 4R7ZA 2IWHA 2YOFA 4TLCA 5CYPA 4ZKEA 3T1OA 2RH5A 2XXAB 2R6CA 4G5GA 3VHXA 2BBWA 4PC7A 1BS1A 2DFTA 4D4LA 3GLHE 4M1SA 4ERNA 5FTLA 2YOHA 4ZDKA 3ZD6A 4AKGA 4BASA 4B6FA 1P72A 2NZJA 1FL9A 1XZQA 3OIUA 1Q12A 4WA7A 5JWRA 3AVVA 4TTRA 1WQ1R 1GP2A 1CR0A 3CF2A 1NSTA 4D4JA 3T15A 4JVMA 3G82C 3I92A 1N0UA 3SQWA 1CRPA 1C1YA 2YOGA 3I32A 1TL7C 1YHNA 1YR6A 3TMKA 1S9HA 4OHYA 4BWYA 4A92A 2MMGA 1GDDA 5FTNA 4DIDA 4KU4A 4M2LA 3TUIC 1G8FA 1IY0A 3UXMA 4XWKA 4XTRA 3VNUA 4URXR 3FFBA 4RSGA 1R7RA 5EE1A 3CNNA 4M0LA 2XTMA 1S1CA 1VYUA 3OZXA 2PCJA 4IFEA 5EP2A 1JB1A 1HQYE 4LHZA 3ZQJA 4MKGA 1G8HA 1OB5A 1M34E 1OE0A 4C7OA 1W0KD 3F8TA 3N2EA 5FUYA 1SULA 4Q1BA 2ZI3A 3THWB 2V3CC 2BWJA 4BEJA 4Q4AB 3LNCA 4KVAA 3K0SA 1E79A 3QG5A 1AS2A 1NMZA 2YWHA 4NL4H 1VECA 4YMVA 2VEDA 1KI1A 2GCPA 3TE6A 2QENA 2KBEA 1WB9A 4LYHA 2ZJ8A 1U8AA 3UKDA 1VCIA 3LWNA 4Q21A 2GZDA 3QXJA 4AY2A 1IY1A 2QTFA 4NYMR 1GAJA 1IXZA 4EJSA 3U7EB 1P5ZB 3B9PA 1EFCA 2GAAA 4O25A 1UPTA 2WAXA 3K9GA 4V0NA 4I1VA 1M2OB 1Q3TA 2E87A 1UKZA 2WZQA 2HF9A 4LJ4A 4LYAA 1I4TD 3TNFA 4DJTA 1IY2A 2R6GA 2ZM5A 3MD0A 4Q9JA 3EZ2A 3DZ8A 3OIWA 4PO1A 4ZI2A 1D9XA 2YC2C 1HH4A 5JEDA 3EW9A 1XFAA 3WP1B 4JIMA 4XD7D 1FMJA 2VHCA 2N42A 1COWD 2F3RA 3IO3A 3RS2A 1VCNA 3REFA 4QOSA 1N6OA 4RY2A 3U7GA 2F6RA 3HYRA 3QKRB 4KLNA 4ZI3A 1UKEA 3AP3A 1Q0UA 4C0LA 4Q19A 4RZUA 1DO0A 1AIPA 4QBHA 2AWNA 2QMUA 4C0AC 2RAPA 3KQKA 5E7MA 3R7WB 4FWIB 1OXVA 5KSOA 4C0KA 4OK6A 5B58C 3KB2A 5AJVB 421PA 2IHYA 1Z6YA 1XCMA 2VP5A 1UKYA 3PVSA 3UMFA 3ZDQA 3C16C 3Q72A 3SBEA 1F6BA 3NEYA 3W3AA 5KSYA 2XOKA 4DLUA 2BBTA 4PZLA 4US2R 3F5FA 1ZNZA 1N6PA 4ZV4A 1CULC 3REGA 1IBRA 1W2GA 1DS6A 1BOFA 1CR4A 3RS3A 3B7GA 4FW9A 4NCNA 4MUAA 4Q1CA 4RCZA 1OIXA 1Z0IA 721PA 3OE7D 3VNVA 3KKNA 1KI4A 3QXSA 4ASUD 4DSOA 3QBVA 1NJGA 2JLWA 5JLJA 2WJVA 4QHSA 4IXNA 1II0A 4D4MA 2IXGA 2O52A 1II8A 2V55B 3Q7PA 4QC2A 1WDTA 2J1LA 2JAQA 3EPJA 5C1BA 4HB3A 4JL5A 4GZLA 4IOMA 1XPOA 5FPHA 3TAHA 1IONA 4PPNA 3KFXA 2E9SA 3ONWA 2IEYA 4QGFA 1B0UA 4RCYA 4WOPA 2OBNA 5F2EA 4AG5A 3SJBA 4F4IA 1MOZA 2V4ZA 2P2LA 3UK6A 4IXMA 3EXAA 4B6EA 3RWMB 1X6VA 3CB4A 4NZYA 5TXGA 3U60B 1US8B 1ZD8A 4BRUA 2NPIA 2JGNA 4C30A 3NDBB 2DHRA 4BGDA 3KXIA 4I1OA 4FXPA 4TMXA 4TQ9A 3ZD7A 1TQ2A 2QP4A 5HKKA 4OQFA 2MSCB 4QBGB 1P3JA 1FPMA 1K5DA 3AGQA 4P4SB 4B32A 5JSZB 1UDWA 1BO6A 1E6CA 4DCSA 1ZUHA 2IBMA 4MRSA 5HKKD 4URYR 1MO4A 2CJWB 2D3WA 3PEWA 3IUYA 5SZIA 1ZAKA 1KO5A 3SJAA 1JEEA 1NY5A 2GCNA 4KYUA 3W8RA 3ZZTA 4PPGA 4UNNA 1CR1A 5FOVA 3UG7A 2H17A 1KI6A 1W4RA
chains in the Genus database with same CATH superfamily
1I7LA 1HM5A 1M72A 2QW0X 4K6OA 1TM3E 1Q6YA 4JC5A 3VV3A 1O0SA 3L4SO 4BYGA 1GUDA 2C5LA 5LR6A 1RIIA 3P9QA 1A4IA 3AF6A 1JSRA 2NVBA 2B1IA 3OMXA 3ED5A 5J5VA 5BUZA 3MQ2A 3EULA 4TM7A 3ONNA 2W98A 4YIKA 2JGDA 5F33A 2Q1UA 4NAUA 2OC9A 5DXJA 5B1HA 3T61A 1PDVA 1I14A 1CETA 2QQ5A 3FOBA 3TBHA 4LYGA 3GUZA 1Z5WA 1S8FA 4MDHA 3DFUA 2REXB 2BGLA 3KKQA 2JANA 4WACA 3NV9A 1AKMA 4BVGA 5AVJA 4OYLA 5DW0A 4DSUA 5HP4A 3LUFA 2B3DA 2IZ7A 3T5DA 1QGOA 4L07A 4LZPA 4R01A 1N33B 1IE3A 2WMOB 4EFLA 1I1HA 2RAFA 1S5PA 2IEGA 1A9ZA 3RK1A 5I4BA 1RWPA 1QP4A 3I8SA 1EUDB 4GLOA 2ZVQX 4H6XA 4TL9A 2ZJ1A 1FU4A 1SD5A 1X1DA 5AQ1A 4FNMA 1Y80A 3DAFA 1XNHA 3NEAA 5DHPA 3ES9A 1WS6A 2EYUA 5IK2A 3KXPA 1NXXA 5C8XA 4JX8A 3AETB 5JD5A 3ODPA 7GPBA 5FUVA 3ESXA 1M8JA 2H8KA 2R8RA 5DLDA 3FNEA 3AEZA 3EAQA 1HE2A 1XT6A 4H0NA 2C7OA 3S2IA 1NW5A 3PQ6A 2IUTA 3I0ZA 1PT5A 4FFBA 4D99A 2RI6A 1RU3A 1RI2A 1XJ5A 2BGMA 1FX0B 1ZUWA 3D43A 3D4LA 3FR7A 3TEJA 3TVTA 5KWSA 5EUQB 5J58A 3NIDB 4MJ3A 5JYBA 1EQAA 1TC2A 3BZUA 4EJFA 3OPXA 2RC6A 4MWDA 3GUYA 2OBMA 4N6NA 4D8TA 5IFKA 5D2CA 2XMZA 2NQ2C 1HFKA 4B4WA 1YOVA 3FYCA 4U7PB 2FF7A 3DV2A 4DLLA 3TFWA 3NH9A 4X24A 5JRDS 1SKYE 5CPFA 5IAGA 3EFOA 4KUGA 2OHHA 1T2EA 2DWPA 5AYVA 5K0GA 2PXXA 1T4BA 2HWUA 5JFTA 1IUOA 3RUFA 4XWOA 1TZ2A 3KP1A 1KOGA 3D6AA 4IVPA 3WYAA 3AWDA 4JASB 5HTOA 1HOTA 1MO6A 1IG0A 2JKZA 3OZTA 4AKSA 4BVEA 2ZE6A 4EK9A 1T91A 4XUCA 2Q3LA 1LLQA 4FUTA 5LXTB 4FGLA 3RJMA 2CMDA 4WGGA 4PF1A 4JWTA 3VX4A 1ZRHA 1DEKA 4ESOA 4DR2B 1SBNE 1TYBE 3GFBA 1V16A 4YJHA 4O4IB 2PXHA 4DY4A 2FEPA 1DC3A 1QG2A 4HI0E 5JH7F 2D7DA 4CN8A 3LOQA 3D8NA 4AMVA 4DDMA 3SDZA 2JFWA 3S28A 5L45A 2XNCA 3WDLA 3NV7A 5BW5A 1PYGA 3F9RA 1A9QA 3EPRA 3OCVA 1RM4A 2PH1A 1DWPA 5A5EA 1MAUA 3O3CA 2OCDA 5AK4A 1PWHA 1Y1QA 5A6SB 3SKXA 2OCXA 2YJ3A 4JWKA 1I2CA 3F3MA 4KDFA 4L3OA 2ZIEA 3NP7A 3S2FA 4BQFA 5TPZD 2VUIB 2Q3FA 3B2QA 3R3VA 3VSBA 1W0CA 1RWNA 1XF9A 1XQ1A 1WMEA 1YJAA 2IEBA 3FTCA 2I6XA 3KSDO 3LW7A 3C45A 4FS8A 1YQEA 3O31A 5IMSA 1M1YB 2P6MA 4EUSA 2Y6UA 1I24A 1Z4IA 3ICPA 1VCHA 1H6DA 1OROA 4TLMB 1QPBA 3RROA 3I5MA 2GUGA 3K8ZA 4XWGA 3WYFA 1JPNA 4CV0A 1RS0A 3L0CA 1N92A 3C8UA 5F4ZA 3C3EA 4X1YB 3RIXA 3RUCA 3W1EA 4EI9A 5EIHA 1GQFA 1BROA 4FYYA 3K09A 1USUA 4PX9A 1E9BA 3HKEA 5F35A 2RK3A 2ZWVA 2ID7A 3RT7A 3J81A 3INYA 3IRVA 4AS1A 3VPCA 3AB7A 4C6TB 4YJ3A 4H16A 3R6WA 2Q3MA 1GSOA 3KSRA 1OLSB 2X41A 2JAOA 4CF6A 1NA5A 1M2VA 3C48A 1UC5B 3EDCA 1SRRA 1TU4A 2BAGA 3IMFA 4KQEA 1IPEA 3PC3A 1ISFA 4WN3A 4JOQA 3MJ4A 3PJDA 5E6SB 4IOKA 4X63A 2Y4OA 2GTIA 1QF9A 3DCIA 3H1AA 1UIRA 2C4MA 2NU6A 3KR0A 3LKBA 1JQKA 3N74A 5FFFA 5FA5A 3RUHA 5CCXA 4DR1B 4P4LA 2Y4NA 4M7PA 3QIVA 1GFWA 1LK0A 3HDQA 1UEIA 4IIDA 3SPXA 3W8NA 3SHVA 4OMDA 3M3PA 2WINI 3L9XA 2FZEA 5HF8A 3RJZA 1LTQA 3CEPB 4U7WA 5A9TA 3VU1A 1Z4MA 2WWVD 1YB5A 1K9SA 4DLSA 1OAOA 5FWXA 1RLIA 1U7UA 3U31A 4ZO6A 1JSZA 3WMGA 4BQOA 5GQSA 5B4TA 5LSAA 1JV2B 4FMDB 4KBFA 3GJ8A 2RHBA 4Q9IA 4ZVOA 4CEHB 3L8FA 2CNKA 1DUSA 3NBYC 1WG8A 2E4XA 3ELDA 4MVWA 4X94A 3SZUA 3L84A 1YE8A 2Y1EA 3TIVA 5IJ0A 3DF7A 2JJYA 1QKIA 1W9MA 3AR7A 3GJSA 2NP7A 3DHVA 3Q5EA 1F9AA 3NTXA 521PA 3Q3CA 2P2CA 2YHUA 2AC7A 2YWDA 3DNPA 1VYVA 2DFKB 3DZHA 4LZZA 221PA 5A3JA 4LIPD 3DCJA 5LFAA 4B3RB 2VNAA 1XQWA 2D0OB 1K9VF 5GZ1A 2FSIA 4IGIA 1KEZA 1MVOA 2FV8A 1C3VA 3L9WA 3NBUA 3LQFA 3QMWA 3GK3A 4L22A 3WY9A 2R6FA 3A1TA 3MK31 4PNHA 2H9IA 4R54A 4XLLA 1OH8A 2GD1O 5TT0A 2ZRIA 3IOEA 4OCZA 5JC8A 1R5BA 1SXJC 2ON6A 2Q1TA 4YJFA 3SX0A 1R0KA 2CLEB 4KFCA 3S8EA 3ZCPA 4DCJA 4WLNA 3V4VB 4EMSA 2QUBA 3EXIB 5K3SA 3ZV3A 1CQIB 1BD3A 2AXEA 4JLMA 3RLIA 4MPDA 4LGCA 2FUG6 5CX4A 2QYHA 4AMBA 2V7TA 1M83A 3KBBA 3L1KA 1SOMA 1ZMXA 2QNRA 4N5LA 4EOGA 4MVJA 5B1YA 2X8JA 5IJ9B 5L53A 3ZR4B 1HEIA 2W2KA 4P4SA 5JSZA 1QLWA 1YCDA 2DPXA 2B1QA 2WWRA 4YLGA 4PCVA 1KRWA 4J3JA 4L5BA 5SY6A 2HY7A 4A2CA 1TUEA 1LXCA 2F3UA 3A4NA 1B3BA 1EWYA 4HGOA 4BMDA 4ZOQI 5EKTA 1RQRA 3H11B 13PKA 4BKOA 4Z5XA 4RTPA 1SUSA 1GSIA 1S7CA 3CR8A 1ZISA 3DL0A 1GU7A 2Q41A 1X80B 3HUTA 1P44A 3N2KA 5B1SA 2I66A 3LTNC 3FSRA 1MNAA 2HRRA 1SPBS 2HREA 2ENUA 3FBWA 3TQOA 1F4LA 3LX5A 2HKIA 3JQGA 4IZHA 5DT9A 3HWX1 2G71A 2ZJ7A 3QMVA 3W7VA 2WF7A 3OZAA 5SZJA 2IZOA 1WU8A 3CJRA 4L95C 1FJHA 2E89A 2QT1A 4QTTB 2LP4Y 4PZCA 1A88A 2HPVA 4ZHQF 2J7KA 2VSFA 3IXQA 4UTNA 1T0JB 1H2XA 3H9UA 1KYZA 2GXUA 1ZU5A 2GJ4A 4D9NA 2IK8A 5H3HA 2ATEA 3GY0A 1B23P 2AE2A 3T9DA 4QYTA 2WSMA 2VHUA 5TC4A 5ITSA 1NYLA 2FZ5A 3TR5A 5KBYA 3MN1A 5LP6F 4NICA 3K35A 1Z0JA 4IMIB 3X1MA 4XQEA 3WGUA 4KGZA 2IT1A 2O0LA 3FYHA 4KL8S 3VQTA 4M1EA 3HBAA 5TV2A 1W0JD 3FYTA 3FUCA 3MYYA 1TCVA 3C6ZA 4HQKA 1F4VA 1KJ8A 4L5YA 3KQYA 4GXRA 2PUHA 3IPRA 1CWUA 4R5HA 4YP0A 3ZNNA 4I9NA 5KWEA 3P2JA 1JSXA 4MDYA 1N5JA 4XX0A 2BM0A 3FOWA 4Y1EA 4KYIB 2JVIA 1UMCB 4DL9A 2I78A 3TLXA 2RGWA 4POOA 5HJ7A 1C4OA 1H2HA 4GX1A 4RY8A 2F8SA 1RBYA 3L18A 3TQHA 1WCV1 4EABA 3IBTA 1P7ZA 5AJHA 3P9SA 2FUNB 3CBQA 3H2GA 1AA9A 4NYIR 4FDVA 1MABB 4AYTA 2HLNA 2B6NA 2OV4A 5KSZA 4JL6A 1N0VC 1ZLYA 2JFUA 3D2BA 4A5SA 3I1YA 1N2GA 1AS0A 1DBIA 3DB2A 3KVOA 1PFGA 2GD2A 3QTLA 4GXTA 1EFVA 1GU1A 4LWPA 5CYFA 3HBJA 1Z15A 1FNCA 4BVFA 4BZXA 3LPDA 1VBMA 1YZFA 3L0OA 1N32B 1XEWX 3C3BA 3T5MA 2XPCA 5EKDA 5AKYA 4HX5A 1KTIA 4BV8A 5EXTA 2CSUA 3UCXA 1RBMA 1WX1A 4JYPA 3LYHA 3WADA 2OHJA 5JJKA 3JZDA 1XAIA 4U3JA 4KI0A 3RVNA 1CUVA 3GD5A 1L2TA 3V00A 3WLTA 3BH0A 3DBRB 5E4JA 2P3OA 4UEJA 1XZCA 3AU8A 1WTAA 2XH8A 2HV8A 3DCNA 1GKKA 1K86A 1Z0ZA 2GK7A 2V6IA 3JQFC 4BFXA 2IELA 1XCBA 1P74A 4E07A 1KO7A 1KIAA 2ZI4A 3ILVA 5CM8B 3WGIA 3H2IA 2DH5A 3PXXA 1E2IA 2QAGC 2YWBA 4FJ1A 2IDJA 3ABSB 2CMFA 4U5XA 1X7GA 2CNNA 1E1QD 1P77A 4N5NA 1PZFA 4GPTA 4C2UA 3MGKA 2FPXA 3ABOB 1TT5A 1GTG1 1CUEA 1YHZA 1JEQA 1P17A 5LB2A 1PYDA 4ANFA 5HOEA 5T7BA 2ZYUX 3SHTA 4HP8A 4BE9A 3EDQA 1SCDA 1NBAA 2F8LA 3KKEA 4HWPA 3ZJVA 2WMDA 4FQ5A 1RKVA 2A88A 2BPOA 2BGIA 3N0VA 2BFFA 1EU1A 2P67A 3FMOB 3KSMA 4IYJA 5DKFA 5JR3A 3ER6A 1ANKA 2XYQA 5JD3A 1TM1E 1E60A 2JJ2A 2WSBA 2EL9A 4TRMA 1RW4A 1YR8A 2IZ5A 4CFYA 1N6IA 2Q2VA 3LBAA 3ETEA 4P80A 4B48A 3CJQA 4R8RA 5AVTA 4LZOA 3HQ4O 1J06A 5CAEA 1PVVA 8LDHA 1K8RA 3G89A 4PGFA 2IYLD 4DNQA 4P33A 3ZWKA 5EMNA 2I3GA 5KYGA 1BVYF 4Q4JA 2DT8A 1MC5A 5A0TA 1UJNA 3DLAA 1RD4A 3NBQA 5A5GA 3AX6A 3WLIA 4ALLA 4FZVA 5B36A 3R8CA 4XWAA 4DJAA 4E3ZA 2MYNA 3KKPA 2CKMA 3EA5A 3TOVA 3PFGA 2X9QA 3DM9B 4J1NA 4FFPA 4BKPA 4D56A 3L6EA 4DSAA 4JY7A 1WMFA 3IAM6 1UK8A 4KTVE 3EUFA 2C88A 1D0VA 4YACA 4ENQA 3FA2A 4M9XA 5J2TF 3F6PA 4FXOA 5IN4A 4DR5B 2WG1A 4EFDA 2OPBA 3A9TA 2HBQA 2QV7A 2BUBA 3GGDA 3MILA 1GCAA 3WC4A 3G8AA 3O82A 4RU1A 3C8HA 1EJ2A 4ZU1X 4YT8A 3ZCTA 4TZKA 5HTKA 2GM3A 3LY8A 5H4GA 5HIKA 5DP1A 1ULSA 2HDOA 2K87A 2RONA 3MT8A 4UTOA 2GYYA 4E5YA 4UUQA 2JLQA 2VHEA 1G9TA 4JJ6A 4QA9A 4IDBA 3SHOA 1P4HA 1SOUA 3O03A 3UC9A 2HRDA 4GDFA 1KYTA 2QSUA 1G7SA 3U3OA 5BMVA 1Z16A 1SZPA 4QEDA 2JAUA 5AKXA 4WZAA 4C89A 3IFSA 1SK9A 2EZ9A 3GDGA 3LUBA 4TLEA 9ATCA 3IULA 3LS2A 5K51A 3V46A 5FOSA 1E2HA 4IDDA 4TSKA 4XPIA 2ZRKA 1MP0A 3MF4A 4JLPA 1U8ZA 5SV2A 4TL8A 5H70A 5JE8A 5IUJC 3OZDA 2OC4A 3NATA 2UXDB 2FXIA 2G36A 2QTZA 2K4MA 1DXHA 2ZRMA 3PUIA 1DL5A 5DLQC 2PKYX 4PO8A 2YW2A 3VU9A 4J91A 1JL3A 1Q1NA 1QLJA 2HLHA 2VSYA 3C8ZA 3I1JA 4OHBA 4L8YA 5BSWA 5JANA 4KVGA 4JVNA 2QE7A 3AB3A 2IC5A 4UXJA 2C2MA 2NQTA 2WFLB 2BEUB 1D4FA 2X9VA 3LIPA 3VKFA 2Z2JA 1J4AA 5JNRA 2G25A 1FFXA 1IL0A 1Z5PA 2COKA 2ECQA 1U3VA 2F1RA 1OZFA 3HSSA 3NEPX 3PUYA 3E27A 1IJBA 5LD2C 3PC8C 1QOPB 4MYHA 3DTVB 2JL1A 2C5FA 2TMKA 3TNDA 3DLCA 1JKFA 1KH3A 4G5QA 1P7PA 4MA5A 4CMHA 1A5BB 1MOPA 3BXHA 1PSWA 1YVEI 3IOCA 3QU9A 4DGQA 2A33A 4NONA 2ORWA 3LA8A 1A2BA 5G1OA 1P1CA 2AN4A 2R84A 1NSYA 3QK7A 4INAA 2KB0A 3DMFA 2OMEA 3S1LA 1FYFA 1JQDA 3OM9A 4EGJA 3IE1A 3EF1A 3CCBA 2HD4A 1KI8A 4EG3A 2QN9A 3LECA 1TKCA 2OORC 4Q3OA 5C3MA 2IVFA 1G8YA 5KYWA 1E20A 1P4JA 2FW9A 4COOA 1DNPA 3QKWA 1HFWA 1J6UA 1UJ2A 4JI7B 1ZVQA 1AMOA 2PQ6A 1HT3A 3D3QA 4GE0A 2FZVA 1NNUA 1XJCA 1VZ3A 1D2NA 1E3SA 1GZHB 2A3RA 2WIGA 3GZJA 4J1TA 4A36A 2AXQA 4M83A 2GWRA 3M6FA 2WVJA 1C5KA 3PRKE 4FFSA 1BA3A 3VR3A 5JJLA 4MZDA 1GNRA 1T5TA 2AMFA 3OZIA 5EESA 5JAIA 2B0JA 5GJCA 2NACA 3TQRA 5J4HA 3B3QA 3TZLA 3WRWA 1VE6A 4HD8A 4ZI7A 4M1KA 1XKXA 1OXKB 3A2MA 2OM2A 5NLLA 3UAZA 4EYOA 4RWEA 4E6PA 2CVZA 4EI8A 5K5EA 1E9DA 3U7FB 3OLZA 3V1TC 3OQ1A 1Z38A 2DFLA 1FYXA 1X74A 2HU7A 4KXVA 3K70B 1H9CA 3GA7A 1ZOLA 3V1LA 3RRZA 1ABEA 2WUGA 2AJ8A 3OLCX 2ALJA 2PA0A 4JBLA 4JJKA 3V1YA 1COWA 1JW9B 2A5JA 4D81A 3DBVO 4K86A 2DJ5A 5BSFA 4UAUA 3EG9A 1E7QA 4ZCIA 2EV9A 4HFRA 3IOMA 3CLSD 3KQHA 2DBVO 1TYDE 4B0OA 4D3YA 1Z4KA 4JHLA 5FADA 4ALKA 4HZUA 4B3MB 4DGSA 1I9CA 1UR5A 2OP0A 1EXNA 2CYBA 3IP6A 3T35A 4F9GA 3RIMA 5JMOA 3L3BA 1G1MA 2O0MA 3L8DA 3RYIB 3AY3A 1E6WA 1XLUA 1D3AA 1VIVA 4Q4DA 5CD1A 2IZ1A 3WGNA 4WDQA 4EATA 4RE6A 5E1MA 2HJGA 2EP5A 3BCHA 3EIEA 4PLVA 4Y1RB 4FNGA 1A1VA 3AKEA 1NW7A 2IXFA 2VQ6A 1EFDN 3DL2A 4JNKA 4E3WA 4LKOA 2FPPA 2Y71A 1W35A 4EB3A 3R9WA 2ZTMA 4HAOA 1XZIA 1Y6RA 4RGYA 1O87A 2DKNA 2ZSEA 5F2KA 4IZIA 2IH2A 1XJQA 2RE8A 4MV4A 3QW4B 4WOBA 4C05A 3OZSA 3H7AA 5EUMA 3OE7A 4LXYA 2PRYA 1KBQA 2QMEA 4BN0A 4GDMA 1U2GA 1AKYA 1U5CA 1XJ0A 2HDHA 1A8PA 2YY7A 3BN3A 1QV7A 3FSJX 5E9WA 1CQZA 4B82A 3GW8A 3UUGA 1O77A 1N34B 3G9TA 3NU1A 1J1ZA 5EKXA 2YXPX 1PNVA 1NPYA 3EGVA 3GZ4A 1PJ3A 2IYFA 4Q3EA 5KDLA 3VJLA 2AFIA 1JDNA 2I54A 3UB4A 3L8MA 1FW6A 5L3QA 1PUJA 4H31A 4RW0A 5ALUA 4LZNA 3NC1C 3RS5A 4IOLA 4AO8A 5ALQA 2GXAA 1VKNA 3IB6A 5LQUA 4FYKA 1J21A 1ECCA 2BJWA 2IPOA 2ZUEA 4MZXA 3QU4A 4V38A 2JLYA 1QFJA 2HF2A 4PAQA 2I5PO 4AN4A 1WOYA 3K0EA 4XEHA 1ZOSA 1MA3A 3HI4A 1YB4A 4Y9SA 5E1DA 4EAQA 2SNIE 1RXVA 4F92B 4ERXA 2Z83A 4I1RA 1VJDA 2FH5B 2ADFA 2X0KA 1L4KA 2YRWA 4M0KA 2DFNA 1T6YA 1WD7A 2XB8A 4UHDA 3R24A 2X2FA 1O89A 2QQGA 3PFKA 5ELMA 2WAOA 5D8DA 4FFNA 1GLGA 3SDBA 3MWFA 3JQPA 4DABA 1U5AA 4O4LF 3AHEA 2WOOA 3B9QA 4ZYWA 1XDWA 5ED4A 2DFVA 1DQRA 1E2NA 2AG0A 1V11A 3H8SA 4GNRA 2V6BA 1NJ5A 1ZD2P 2IPMA 1Z6XA 5K3AA 3DO5A 4PSUA 5AIBA 1Y8CA 4UOEA 1PJCA 3PF8A 4XYEA 1JDVA 3HDTA 4E4RA 1Y4AE 2X6RA 1B15A 2HHLA 4GECA 4RMNA 4WMLA 2VOJA 5KB3A 1AN0A 2VBGA 4HJRA 2W11A 2ID9A 2TYSB 3LCJA 2C95A 2QYTA 2C9CA 2ATIA 4OO3A 4WOCA 2ZIGA 3BIFA 4LSMA 3UWMA 5DM0A 4D6PA 4BNDB 5J2UF 1QYDA 3ADDA 1U0SY 3K1JA 5UKDA 2AHRA 1VMEA 1PX2A 2ZYGA 2W0MA 2HRZA 1PS9A 1OLUB 2W6ZA 1KPGA 5DM60 3TLGA 4UXHA 1G4HA 2OLKA 2J3IA 4JDUA 3T5GA 5JNLA 2FZKA 4HDNB 3QE3A 4P2GA 5BVHB 1IHPA 1FTGA 3INNA 1ZK3A 2B69A 3CW2A 4GWLA 4ZOBA 2WTNA 3S2YA 3SOPA 4CMEA 4F9FA 4CLEA 4XIFA 4XM0A 1FFSA 1UBLS 2W6PA 2R4TA 2RDMA 1Q1AA 3A3NA 4MUIA 3RU7A 2VHTA 1OYWA 3CQ9A 3EMKA 1G6KA 1CY0A 3E81A 1YTUA 3CWCA 4XIIA 5EERA 4FONA 1ZVKA 2ZIUB 1DCKA 1JBEA 2IP4A 1H6CA 4FT2A 5CX1B 3AVWA 1VL5A 1B74A 5FBWB 1O58A 1M2HA 3CRRA 5AJXA 4FJ2A 1FIUA 3U3XA 2FE1A 2RB5A 1ZJYA 1GXSB 2OILA 4GEGA 1PHPA 1YA4A 2I33A 2Z5FA 1DELA 1MJ5A 4QKQA 3MCAA 4IM7A 3FDIA 4L74A 1ORIA 5LYJF 1Q95A 1PGNA 4UAGA 2FN7A 3DOFA 2GNPA 4LV5B 4ZRNA 4JOCA 4ZT4A 3L05A 3PYLA 3T12A 1P2FA 3E0QA 2PYIA 4D0SA 2NZ8A 3M8KA 1M8PA 2Q1SA 3AVQA 2VJBA 3H4TA 2QMHA 2PS1A 4YAWA 1KVUA 1TNDA 1RRFA 2EFCB 3LHKA 2EJCA 3AW8A 2QGNA 3DDSA 2GBLC 4WY8A 3W5UA 4DA4A 3I23A 1AGNA 3F7MA 2W48A 2MSEB 4HEA1 4M76B 3ZBPA 3W5HA 1DQZA 3CINA 2QR5A 4Q9NA 1JZSA 3DLHA 1K92A 2MINA 3AVXA 3BGIA 2WVGA 1JGTA 4HNHA 4CQMA 4DARA 4YDQA 2HF7A 3D6JA 3JQ8A 4CM9D 1SUFA 2VO1A 3DW1X 4OA8A 3RS7A 3A6JA 3N5KA 1K68A 1R0WA 1ESDA 2EFYA 1UM9B 2R6R1 4YAEA 4ZZIA 3Q10A 1G21A 1QIGA 5J47A 4XSVA 2F4VB 1L4UA 2IEZA 1DAMA 4FQ8A 1NATA 5CVUA 1UL1X 4KLAA 2XD9A 4NESA 1L6IA 3OE1A 4LJAA 4WTOA 3ZNPA 3I6ZA 1X3SA 1L5NA 4EEZA 4D96A 2BTQB 3NUGA 5AK6A 3DH0A 3ROZA 5BVGB 1M1XB 2BGJA 2LBPA 4EJ6A 1M2EA 2X0NA 4GE3A 3WYNA 2EWVA 2P9TA 3IEUA 4K9SA 5FI3A 3OFNA 3IDQA 1P9OA 2X1HA 4GMXA 4I6GA 1TYZA 4IXWA 1N7GA 3GNLA 2GTPA 3VVBA 5LU9A 3A7EA 2JEOA 3JQBA 3C39A 1CUFA 1JU9A 3S1AA 4BMNA 4EKEA 3NIFB 5LU8A 2G1KA 2V0CA 3E61A 3TZCA 3BXOA 2AIRA 2XF8A 3H6GA 4U9IS 4TV8A 3PFWO 3TR0A 3ABRB 4ENWA 5AW7A 2BEWA 3FGOA 1U9IC 1DQPA 2RG1A 3PNPA 2J41A 1KP9A 3L07A 4Z9YA 1H4QA 3W2GA 2L42A 4KC0A 2GN1A 2P78A 5BSGA 1P9WA 1F8YA 1MIOA 3UUWA 2YN2A 4C3VA 1A8QA 5H02A 2GRAA 3HJRA 4MWOA 4QUIA 4AP5A 1K06A 5B7GA 5JH7A 2NW6A 2ZROA 1E9AA 1CY6A 3AY6A 1YQ9A 2VDWA 1HV8A 3CZ5A 1DADA 2R6AA 4WKNA 2WHQA 4LEIA 1JAIA 2PV7A 2UKDA 2ZAYA 1CSEE 1M2OA 3ORFA 3VZRA 4XUGB 1KPHA 3IEPA 4MQ5A 4U2BA 4K0KB 3GJZA 3TBKA 1ESMA 3BWDD 3VDXA 1MXFA 1SUBA 1AG9A 2CBXA 2R8PA 4FYHA 1S2OA 4BJ5A 3VM6A 2RGEA 3D6FA 4R8VA 4XYGA 5JALA 3PZBA 1OX4A 4K6HA 9LDTA 3A37A 1FFYA 5JNWA 1W48A 2R66A 1EGHA 1YRYE 3QNUA 2C07A 2HCBA 1OLXA 2JKYA 2VUTA 1H3EA 1TI7A 3TX6A 1MPXA 4TTQA 3R8FA 3SM3A 2O59A 1N6KA 1H05A 4C0BA 4L27A 1TADA 3RSCA 3U61B 5AHKA 1UBHS 4E4YA 2P5YA 2ZAOA 4AXBA 1OW3B 3GPCA 4G0YA 3TVDA 2E4UA 1EG2A 1FDVA 2YHBA 2NTNA 2XRMA 1LX7A 4MWTA 2VH1A 3INGA 4OSOA 1JZTA 2GN6A 4QQNA 4YJGA 1BRTA 2BE7A 2JHGA 1OWMA 4B73A 5CDHA 4L7QA 4X0EA 1NKTA 1YCGA 3FAKA 4EMTA 1W4ZA 4U2EA 1NRXA 1CEXA 2FW0A 2H1HA 3ADKA 1LPNA 7REQB 3MRXA 5IX8A 1AQYA 1LFDB 1B8PA 4GKAA 4Z4IA 4IO0A 3KDAA 3N2GA 4M3NA 1LPBB 1SEVA 5G53C 4RPJA 3WKEA 2B21A 3PIDA 1KI2A 2IDMA 3QBDA 4DC9A 1G4UR 1LPPA 1KJYA 2FEMA 4N47A 4DQ0A 4QAJA 3SZMA 4AI6A 3W04A 4FEAA 3AVYA 5TEVA 2EZTA 3COSA 1GL7A 2WWIA 1XMSA 1UZAA 4NCXA 3LBFA 2PH3A 2HNKA 3EIOA 3FPLA 5TGZA 5ITVA 5IKPA 1VHWA 4YJ2A 1SKUA 3DE0X 4UE2A 1Y6GA 1P91A 3D8RA 1P9NA 1TM4E 2QRPA 5B1DA 3VYUB 2XA2A 4Q37A 2Q4RA 3NI2A 3GLRA 5AJTA 2PLNA 2QS9A 2XSZA 3R7SA 1EP9A 4HVCA 3D7NA 3N5CA 2CBGA 2CCKA 3OU2A 1JZQA 1W93A 3P0HA 4QDUA 4KNWA 4Y98A 1KNXA 3FTDA 1D6NA 4R68A 4RK5A 3KKOA 4B75A 4Z3KA 5K01A 4FYJA 2YJ4A 4FS3A 3Q15C 2RGGA 3F49S 1F4PA 3VR1A 4A8HA 3DWEX 4FHFA 2ZBVA 1DT3A 5IC4A 2SCUA 3VU8A 4EW1A 4ENSA 2P7HA 2W6NA 3GROA 1UBKS 3LRTA 4Y0AA 4O4JA 4EZEA 5LNK6 2RI1A 3OEHA 4G5RA 2WM9B 3DFZA 1GGKA 3GJ5A 4ZQHA 4EUHA 3V8NA 2QVZX 5DLPA 2RHOA 1HLFA 2CV0A 2DB3A 2WHPA 5LZ8A 4LX8A 5HCNA 3DGEC 3HGMA 3M6WA 4R1PA 5A3SA 3VX3A 3CNQS 1I94B 2X2EA 1MC1A 1RWXA 1WBDA 3FNQA 3QMPA 1US8A 4Y2VA 3M1AA 3X1JA 4KMOA 5FYQA 1QIDA 3EGXB 4DUGA 2AWOA 2QM8A 3H5AA 4UAVA 2AYXA 2H0AA 2O1EA 1T0PA 1WLYA 3KOXA 3QVLA 4D57A 2C2OA 3ZI7A 3CLRD 4TYYA 3E3NA 3HE3A 4WXYB 1X7YB 4IGEA 1N9GA 3MTEA 2WT9A 4HNAA 3VNBA 4ZIRB 1MB2A 5I7UA 2Z04A 2IYPA 4DV3B 4P83A 3WV5A 4BN5A 3DPIA 2QDKA 3BCUA 3PQ5A 4CMIA 2AJTA 2X5NA 1IMOA 1E3LA 1KP2A 1SC6A 2X13A 1VG8A 2ONZA 4MS4B 1P9LA 1RP7A 1M1YE 4K03A 3QJYA 4V3CA 3R9KA 2CVPA 2Q6OA 3IBYA 3IKLA 1MX5A 4JP2A 5ALKA 3P9KA 4OP3A 2V7WA 3D8HA 3IBCA 3N0RA 4RLFA 4BNWA 2QRLA 5KPJA 5ADVA 2OHVA 2FCAA 1SJ9A 3PFNA 4K2HA 4NDNE 4J29A 1KO8A 1N5KA 4JEMA 3DXXA 3BD9A 4X8OA 3U1TA 1JHUA 2JHCA 2RKOA 3PFFA 1GHTA 4X90A 2C4HA 5BYKA 4LK3A 2HXSA 3KE8A 1D8TA 1W4AA 4HB0A 4EZBA 1Z08A 2YWXA 1Q50A 1HURA 3EQ9A 3OX4A 4FYXA 1N4AA 4MQFA 5HM8A 2OOSA 1BYIA 1MG0A 1PR5A 2XAUA 4EKDA 1U28A 2DE0X 3CT6A 4G8CA 4TMKA 1ZHFA 3R7NA 4IF6A 1D4OA 1ZO8A 4Y2RA 1CQPA 3ASYA 3Q2KA 1LW7A 4MPJA 5LP6A 3DJYA 1VGVA 2CY0A 2ZW9A 3OIYA 4S2UA 3ASVA 4TV9F 5HYVA 3L92A 2IOHA 3I2KA 2W2LA 5HQJA 2JI7A 5EGSA 2G70A 1WF3A 2W2OA 4AIIA 1VKZA 1RPNA 3HYTA 3FYDA 4U39A 1GQQA 3BRQA 1A9OA 1S6YA 2C0QA 2HLDA 2XMQA 3KIPA 4UKDA 5DHSA 1NM5A 4TXLA 2CXOA 1RAEA 1EUDA 3T3GA 3TMAA 3ZY4A 1LNSA 3BMQB 1R00A 1DBSA 1IM8A 4XJSA 1U4OA 2J09A 2CYCA 3NRJA 2AX3A 1HQDA 1XD8A 4C6HA 1Q83A 2YVUA 3WZMA 5JZBA 3PGJA 4QZVA 2HMSA 2DUNA 3AETA 5I9LA 3HCDA 1X19A 3Q5DA 3EISA 2JLZA 3O84A 1O4VA 4B6PA 1G5RA 5BRNA 1MZPA 2NAPA 3F3YA 1Y1RA 5JDIC 5KWJA 3EQ2A 1TIPA 3F2IA 4MWZA 2VXBA 5KINB 2GAOA 4MH0R 1PK7A 4LAFA 4OLFA 4W5JA 1L8XA 4KGDA 2BLLA 4B33A 2B0CA 3QHPA 1FX0A 4CHGA 5I3ZA 5KQRA 3FE2A 2JRLA 2NZWA 1JJ7A 5ICSA 1OI2A 2FN9A 4A8JC 1YA8A 4HAVA 4NI5A 3DV9A 3R74A 5IT4A 4V1CB 3QF4A 3PNKA 3GJ6A 3I0NA 4PHGA 3O94A 3BZBA 4D8YA 3KK0A 1KTVA 2Y3IA 1ZBQA 3AM4A 4UDOA 3N28A 2IPNA 1E89A 4J0IA 1V3UA 5HF6A 1XLVA 4KACA 2P1RA 2XT6A 4IUDS 3H9GA 5JAPA 1IM2A 3EODA 1ODTC 2EW2A 4H4CA 4AJOA 4HH3C 3SQMA 2OBXA 2A1UA 4BQSA 4C4XA 4DLRA 1FDOA 4YASA 3GFPA 2P5UA 2X7HA 4YCDA 3T9EA 3V97A 1CF4A 1NN5A 4KPUA 1ECGA 3WMRA 3WWZA 2W2PA 2AW5A 4KPEC 2E48A 2C31A 1QFXA 5EXXA 1EZZA 2V96A 4H4DA 3H3FA 2O8BA 3JXEA 1TYCA 4OHUA 3WHPA 1ONOA 3Q1LA 4P8RA 4YPVA 5CVDA 4IDOA 6YASA 4TT8A 2GEUA 4R83A 1QB8A 2D0DA 1ES9A 1PV1A 2R68A 2X4LA 3BHNA 1XZLA 1T36A 3NKFA 1GNQA 1QORA 1X7DA 1YQTA 1OI3A 3GPDG 2B8TA 5DE3A 5H1YA 1J7JA 1JQEA 1HY3A 2JFFA 2EKPA 5IAAA 1WPQA 1A7UA 1UWLA 4QUHA 4UEOA 3RV4A 4L9WA 4DSZA 3J7TA 4DCNA 3BRWA 5DIZA 1IHDA 3GBSA 1T9AA 5EZYF 4XWWA 3GVPA 1MQAA 2VF7A 3QVOA 4KJZA 4R0VA 4Y6RA 1KZGB 1TK9A 3BULA 3O2QB 5I9SA 3OIFA 3VDNB 2ZSIA 3C98A 1BWSA 1OI4A 3JQRA 4QGAA 2WILA 2HSWA 4LSGA 1SVOA 3O5AA 4EI2A 2XUIA 1RYFA 5T4EA 3SOZA 4HDAA 4Q1EA 4DIEA 2O3SA 1OH7A 1NXQA 1FSSA 1ZSYA 1X39A 2EWMA 3HFGA 3I01A 3DOEA 3NWJA 4UU1A 5K6AA 1PZMA 3D7SA 1PD1A 2ZVDA 2XZLA 1XN4A 1WDMA 4RYLA 5AHXA 4LPSA 1XEWY 3WL4A 2H2IA 4N8EA 2VCYA 5KOYA 5JJCA 4EQZA 1K3UB 2FR8A 3DZGA 1UDCA 1ZD4A 1NF9A 1E3QA 3G8DA 3U0VA 5IM4A 5LL6P 2ZRPA 4GF5A 5CJ2A 3AR4A 2LZ0A 3WYCA 2O0KA 2B3TA 3P27A 1KDRA 1ZGAA 1PL0A 1EAMA 2A4KA 2XA9A 3STYA 3VBCA 4C6TA 4DCMA 5JBNA 1SZCA 1X9GA 4R8LA 2IW1A 3GZTB 4QD3A 4Q05A 3RV3A 7AT1A 3CEHA 4RZ3A 2ADOA 4WBXC 1JDSA 2G07A 3DDZX 3KYDA 1NASA 4GEKA 5I3CA 2O2DA 4MR9B 3FDFA 5TJHA 3MWGA 2FHPA 4GD3Q 1YC2A 4H0CA 2VH5R 1IBSA 2WNHA 1Q1BA 4D92A 2ONCA 2BP7A 5I7OA 5ESWA 5EXDA 3SLKA 4RELA 2Z6UA 1UBSB 3CVXA 4P1ZA 2FWNA 5EA2A 3NLLA 4DA7A 4QJ4A 2PX4A 2WTAA 4YY3B 1IIRA 3LPAA 3DO6A 1J9GA 2PMDA 1PX0A 2JK1A 3U49A 1RHQA 1XZHA 2OEPA 3G68A 1O5IA 1ZXXA 2H57A 2UUPA 5EI5A 2Q2WA 4ZVMA 2JHFA 2GN9A 3QFFA 5ICGA 3L41A 4H59A 2C1ZA 3FTEA 4MA0A 3OIGA 5BPHA 1O94A 2Y68A 4L5JA 4R1QA 1YBMA 1TAUA 3IHKA 5CB4A 1MW9X 4CUKA 1D2EA 3EGOA 4YONB 4FMCF 1CRWG 1N6NA 1NLFA 1NOJA 1V5IA 1Z6PA 5EHGA 4PLWA 3TRDA 1JYEA 3D7LA 3ZU2A 1NWHA 3AVPA 3H83A 1QZTA 3M89A 4X45A 5JQGF 3NVMB 5EMMA 1KOFA 2ILVA 3NAZA 3K6SA 3NUQA 1YIAA 2B34A 1MOSA 1M6NA 3CH6A 5AVZA 5JRZA 3IPYA 3R3JA 4FOLA 4ABTA 1FBTA 2IFTA 3F2VA 3Q3IA 1VPTA 2ZSUA 3DBLA 1OV6A 3GZNB 3HKCA 4KLZA 3C3CA 4DCCA 5M04A 1O08A 3MEQA 4QUEA 4YR9A 1Q1QA 4TXNA 3IRUA 1S2LA 3QOWA 3R0VA 3VH1A 1QFSA 2B4TO 1CVIA 3T7TA 1ZD5A 4U7HA 4HNGA 3D1LA 4PE5B 3AONB 4L78A</