1MV5A

Crystal structure of lmra atp-binding domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of LmrA ATP-binding domain reveals the two-site alternating mechanism at molecular level
rcsb
source organism Lactococcus lactis
molecule tags Transport protein
molecule keywords Multidrug resistance ABC transporter ATP-binding and permeas
total genus 63
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 7.6.2.2: ABC-type xenobiotic transporter.
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mv5A00
4MRVA 3E1SA 4JVLA 3S1AB 1LW7A 4GFDA 4BFSA 1M34E 2JJ8A 4Q03A 2IXEA 4URWR 4B35A 3L43A 4Z1MD 5EXTA 3BXZA 1AZTA 2ZS8A 4QL3A 4M53A 4B44A 1XPRA 1GIAA 1A1VA 3KTAB 1W4RA 1XWIA 5KPDA 3FHTA 1XF9A 5E3HA 1OXUA 3IQXA 1ZINA 3UK6A 2FX3A 1XCMA 5BYKA 2W0MA 2HCJB 3S1AA 3EIQA 3PQCA 1ZM2A 1P2TA 4XWAA 1XD9A 1K8RA 1O3YA 2V7QD 1FQJA 3GP8A 2ZRJA 3LQQA 2O8DA 3IPXA 4GRAA 2FZ4A 2JLVA 5FPTA 3CZQA 4C9BA 4KITB 1P9RA 2QZ4A 3QXHA 3GMTA 2P6NA 1YJ5A 3GLHB 4LV5B 4WW0A 4C0SA 1OV4A 1U0JA 1S1MA 2O0HA 1CF4A 1P73A 4OQMA 2ZI9A 4JLOA 4A9AA 3THXB 2WJVA 5EUQB 1IQPA 2ZJBA 3DOFA 1KI2A 2EYQA 2GKSA 1SVSA 3QOFA 2ZSAA 5TVKA 3U7HB 4C7OB 1Q44A 1UDWA 2B8TA 3TW8B 4NCHA 4EAQA 3VNUA 4LJ9A 4DUGA 3GPLA 1IJFA 1Q20A 4FMDB 1COWA 3KQNA 2HYDA 1KMQA 3B13B 2DWOA 2IYYA 2PZEA 3T5GA 4XOIA 2JJ2A 5CJPA 2GEUA 4LJ8A 1NKTA 3V4FA 1TNDA 2BMJA 1T3SA 1N5IA 4B71A 3AUYA 1X3SA 5CJ2A 4QNRA 5KNCA 2QU8A 3AP1A 3I1FA 2A7QA 1OH7A 2ODEA 4DXAA 3VR3A 3H0KA 2BOVA 1GL9B 2REBA 4F4CA 4KBGA 2EFGA 2IBMA 2IEYA 3H84A 2CEAA 4LBYA 1DOAA 2OFWA 2D74A 1JPJA 4PR0A 3IPYA 2QGNA 4Q5IA 1A2KC 4MQBA 2JASA 1BH2A 1YZGA 4OI2A 1II8A 4TZ6A 1LB1B 3K0CC 2K5UA 5DI3A 3D7MA 1MR3F 2V9PA 2O0JA 3FWYA 5AJVB 1W4BA 1M6NA 1OHHD 2R6DA 2J7PA 4DZZA 3J81k 5FBVB 4CZ2A 4AYXA 3WYFA 5AUNB 1CJTC 5C46F 1DAMA 3GCGA 4UJ5A 4JS0A 2DFKB 3QENA 3NHBA 5L3RA 4ZDKA 2XZOA 2ZS7A 3L8ZA 3Q9LA 4LPKA 1VKJA 4PHHA 4BFVA 1EWRA 1A7JA 1E2QA 4KJZA 4YONB 4CF7A 2ZVQX 3OIVA 3EWSA 5L8VA 2C9YA 3DHWC 2ZEJA 4BFWA 4LY6A 2BM0A 4BE7B 1XEXB 4BPBA 5DSZA 2IHYA 4QHSA 1YZQA 2RB4A 5G53C 5SZIA 3T06B 2QMEA 3W6NA 5D3MB 4BQSA 4U00A 5BN3A 1LY1A 3TR0A 3RSLA 4EQ6A 4CYMA 2C9CA 1KIMA 5B64A 1TQ6A 3REGA 4EPWA 1HA3A 4I1OA 1IONA 2PMDA 3MWYW 3UWKA 1S1CA 1ZBDA 3TVDA 2QAGA 3JZAA 3AF1A 3HYRA 4LJ6A 1X1SA 3THOA 1IN8A 2GHIA 3K8YA 4YMSA 2AD5A 2JATA 4OQXA 5DIFA 2RKOA 3OF5A 3KL4A 2VP9A 3AB3A 5HR5A 3RC8A 1W2GA 2CCJA 3SJAA 1S4QA 1E1RA 1TQ2A 2WMNB 5EUMA 4MDFA 4C30A 4PXAA 4GI7A 3WHKA 1EGAA 2R65A 4ITRC 4LYHA 1HQCA 2ZAMA 4EJSB 3UKDA 4DEYA 4LHWA 3CX6A 3LQRA 5BQ5A 3B7GA 4V0NA 4UQOA 2NMVA 3PUYA 4M1TA 5F2EA 4NYJR 5IK2D 3JVVA 4RZXA 4FWTA 2A78A 5C1BA 3VQTA 1PUIA 5JCPA 1XJQA 3K70B 5JJIA 4R7ZA 3U3RA 4FCVA 1RRCA 2J41A 4LDJA 5TARA 3VKGA 3NEJA 4RZ3A 1N3BA 1ZIOA 4D4MA 2VHUA 2JAQA 3W6PA 3QVUA 2JLSA 2OE2A 2QA5A 2WWXA 4P4SB 4TMZA 2X8AA 3NTUA 2OAP1 3A1TA 4NU0A 2PLFA 4DCNA 5IK2A 2QE7D 2E1RA 4IOLA 1JR3A 1A4RA 3CRVA 2ONJA 1CR4A 3GLGA 1MABB 3EIHA 1E69A 4TL7A 3KZ1E 2H17A 2EVWX 1GL7A 3O8DA 2VHJA 3CUEF 3OE7A 3ZZUA 4BEBA 4XWOA 5M04A 4DRZA 2OXCA 3EA5A 1SVIA 5FTKA 3IHLA 5JS7A 3R8FA 3F5FA 2OCYC 3AF2A 1W36C 2C77A 3QJYA 3EA0A 1Z29A 1DADA 1UM8A 2WJYA 1B0UA 5DHAA 4CEHA 3MD0A 4LCBA 1UBCA 1EX6A 2RMKA 2GJSA 3NDPA 1Z5ZA 2VO1A 4S35A 4MRPA 1Q1ZA 1XD2A 2FV8A 3UWOA 4O2LA 3U44A 2RGXA 1XJCA 1KI4A 2CE2X 3K09C 3MWKA 1YR6A 3TSZA 3V00A 1YZKA 2JJ2D 1GFIA 4NYMQ 1AS0A 1QDEA 3C8UA 2CHQA 2KBEA 3X1DA 1RYFA 4X8HA 4EKDA 3SR0A 1ZIPA 3NH6A 1KI9A 2GCPA 3W3AA 4Q9LA 4Q4HB 5JWOA 4C3ZA 5H68A 1ZNZA 3U3KA 2OSBA 4NH0A 5EXXA 4UXHA 1D8TA 3SJZA 1R5NA 4RJLA 1OYWA 2JDIA 1Z8FA 5HKKD 2PX3A 3N5CA 3MUFA 4CDGA 1AN0A 4GMXA 4EDHA 3WP0A 4LI0A 4MYUA 1E2PA 3OZXA 1TUIA 2XTZA 4HAUA 4P4TA 1F60A 3SFZA 2QL6A 1KI6B 1UF9A 4O0MA 2J46A 4JLNA 1LVGA 4ILEA 1U90A 2YYZA 2ERXA 2J7KA 3TK1A 1S2MA 1CLUA 1RE0A 1Z2CA 4RSGA 1YR8A 1OB5A 1Q1EA 2P67A 4BLQA 3TQFA 1W46A 3ZGXA 3GLIE 1N0UA 2REXB 1F2TA 1W0JD 4M0LA 1KO1A 4QKQA 2PEYA 4JT4A 3UATA 2ZE6A 1OFUX 2F6RA 3U6BA 2ZVPX 2W83A 3NDBB 3BAFA 4KFSA 4RKEA 4KYIB 2J0SA 3A36A 1NI3A 4RD3A 2ZS9A 3F0TA 3LVRE 1LTQA 4RZUA 3SOPA 4MKIA 3OFND 4JSYA 4M1MA 4F38A 2PLRA 3PG5A 3AM1A 1M7HA 3AKCA 5IT5A 1Z2AA 1VIYA 3TGPA 3G5UA 2A30A 1BMFD 1RVDA 3ZLJA 2IYVA 3GLFE 1DAIA 3PUVA 4I4LA 3GJ7A 5SZHB 5CDFE 2YOFA 5CK4A 2FJUA 1ZC4A 2J7PD 1R2QA 1J90A 2CDNA 3L82B 1HH4A 5DH9A 2GJ9A 3RABA 3RS4A 3GEHA 1CJVC 1GTVA 2HYIC 1Z0DA 4HAYA 2QSYA 3LBHA 1CR2A 3B1VA 1OT3A 2PT5A 4A2QA 1E2GA 2FFQA 1FL9A 1XPOA 1QHGA 4L8GA 1E9FA 4FWIB 3Q7PA 3GLFB 4FCTA 2VHQA 2ZIAA 3A1WA 3L8YA 1A5TA 1MOZA 2DWPA 2ZSDA 4YQFA 1OKKD 3FVQA 5IDVA 2G83A 2GZDA 3EC1A 2LKCA 5CB8A 4NHOA 2B7CA 2FU5C 4TMKA 4JVNA 3EPHA 4JZKA 2AXNA 4MGZR 4BECA 4K81B 1M1YE 5KSOA 4KVGA 1DVRA 1J7KA 1U9IC 4ZDWA 2ZR7A 2OV2A 3VFDA 4M1OA 1X8KA 2ZJOA 1TF7A 2W2XA 3D31A 3W90A 1AGPA 4B43A 4TYWA 4Q01A 1WDTA 5F3WB 2E87A 4PQYA 1FZQA 3LBNA 3PR1A 4LYFA 4B3FX 1E6CA 4Q7MB 1G4UR 4HAWA 4BZPA 2VEDA 3P27A 721PA 4RD2A 2HUPA 1IN5A 3ND8A 4PHTA 3CZPA 3IHWA 2ZJ8A 5JS8A 3AVYA 4YMUA 2BIFA 2QE7A 4B74A 3DKPA 3KFVA 1N5JA 3KUCA 5C18A 1Q57A 2AWOA 2WWHA 2CNWD 3FTQA 2NO1A 3QBVA 3Q5EA 1AS2A 1D2NA 1DO2A 1SXJC 2XTNA 4TN1A 2QAJA 3RC3A 3IQWA 4CGZA 3K0CA 1OLOA 3AKEA 3OESA 4I1UA 1SVOA 3V4RA 4B6FA 4DCVA 4LBVA 3B2EA 5IHPA 3GLIB 3C16C 1KJZA 1XEWX 3BH6A 3KX2A 3RS5A 2EFCB 2C98A 3CPJB 3LBIA 5J5CA 5K8IA 3IUYA 2DCUA 2DR3A 2GAAA 2HJGA 2N1BA 3MFYA 4ERNA 4Z8YA 1QVAA 2CNWA 5EP3A 1YZUA 2G77B 1NLFA 4ZKDA 4A15A 4US2R 1Q3TA 2WAXA 2WVJA 3R9WA 5FUXA 3VX3A 4H9GA 2RGGA 1OIVA 3U4QA 1SHKA 1KO8A 4A6PA 4UNNA 3VAAA 3VHLB 1CJKC 1CJUC 1S96A 4ZI2A 2ZROA 1AZSC 5FTJA 4UNRA 3QVVA 1KDOA 1RW4A 1GKYA 3RVBA 3AVOA 5LDDC 3B1ZA 5L3VA 3FMOB 5HZHA 3A6PC 4NYIQ 4DT1B 3I72A 2IYTA 5G3YA 4HI0E 4HDCA 5DISB 1OIWA 2AR7A 2RGBA 2YVUA 2QAGC 5HCNA 1E2JA 1HEIA 2IUSA 4IEIA 4D0GA 5CITA 3CWZA 3K53A 2HF9A 1XXHA 1P3JA 4GMDA 4U5XA 5TV2A 2YWHA 3DEFA 4ZDJA 3A58B 2QRNA 2QTHA 1N6RA 1CULC 2RGEA 1Z0IA 4V02A 4E03A 1MRSA 3CRRA 4A8JC 4C0QC 4C0AC 1DEKA 5CM8B 3QKRB 3E5HA 1GRNA 5KNBA 4A8JB 1WP9A 3DZ8A 4B2PA 1JQJC 4XTCS 4OQFA 1QHYA 1R6BX 3T35A 4G1UC 2GAOA 1E2EA 1GP2A 4ASUD 4DLXA 1JR6A 1XXHB 4OI1A 2X2FA 3SBEA 2HCBA 3WRXC 1TQDA 1NJFA 2J45A 3QXJA 4JL6A 2FSHA 3RSOA 4DLRA 2IHBA 4KFUA 4WIAA 4L9SA 1D6JA 1NVVQ 2Q21A 5DE3A 2BHRA 2FN4A 1EESA 4LV8B 1G16A 2ZRPA 2QPOA 2FA9A 1II9A 1SXJD 2VH5R 4QRHA 1VMAA 4BLPA 2R6GA 1GWNA 2H1LA 4TT3D 1P61B 1GVNB 4ZIRB 3LNCA 4RFSA 1PUJA 2OLJA 3ICEA 1F6BA 1NIJA 1H8EA 2ZRLA 1BKDR 5G3ZA 5EP4A 1VG9B 1G3IA 2RAPA 1U99A 4CW7A 2YHSA 2IUTA 1DTSA 4G5RA 1WBDA 2AL7A 1J8YF 2FSGA 1KNQA 5SZJA 1YQTA 2QMHA 4IRUB 4AI6A 1WQ1R 4C0LA 2XSZD 1PLJA 3PUWA 3FB4A 2VBCA 1QHXA 3MGCA 1HE8B 2NO7A 3K9HA 2CXXA 3RS7A 1RRPA 4JVMA 3KJHA 3GJ4A 1ESMA 2BMDA 4LJ4A 4KSBA 1P9WA 1Q0UA 1NKSA 2DPXA 3SS8A 5UKDA 4JYBA 4AG5A 2YWGA 3KKQA 3CX7A 1KOFA 3K9GA 3ONWA 1NIPA 2QG6A 1E94E 4DLTA 4IKEA 3WBKA 1G3UA 3MG9A 3LX5A 1ZUHA 3UXMA 3HPRA 4Q1DA 4TTRA 1UBEA 3QEJA 4H1UA 4KFTA 3TMKA 4CEIA 4PQFA 5EE9A 1S3GA 3PEYA 3RS2A 1ZVQA 3NHAA 1KDRA 4D0LB 1E4VA 4B2IA 1E99A 1CP2A 3GLHA 5KOYA 4PSVA 2F55A 2WWWA 2A2ZA 2ZAOA 1CIPA 3CONA 3L0SA 2AD1A 4P32A 1E0JA 3VR6A 1EX7A 2XGJA 2ZRCA 3LLMA 3CX8A 3WHLA 4YDHB 2OG2A 3HPQA 1R8SA 2JLYA 2VP2A 1HQYE 4HZIA 4B32A 1OH5A 3SHFA 1R4AA 2OM2A 3TSOA 2O0KA 1JJVA 3FPAA 1Z47A 1YZLA 1XTQA 2CE7A 3BERA 1E3MA 2GK6A 1KKMA 3QXXA 1U8ZA 3AP3A 5FUYA 4MYCA 4RY2A 2MSCB 3CF0A 3HDTA 2R9VA 4L5BA 4DLSA 1FUKA 4GZLA 2H57A 5JWRA 3L2OB 1DAEA 1XTKA 1G9XA 1UKYA 3UMSA 3KXIA 1JPNA 2LWIA 4LPSA 4DCUA 4HB2A 5TXGA 2EFEB 1OFIA 5CK5A 3B9PA 3Q7QA 1SZPA 2BMEA 2V1UA 1Z07A 2D7CA 4DT1A 4ZCIA 1KHTA 1V5WA 1Z6YA 2RHMA 4QJ5A 1OXTA 3RRYA 2QNRA 3U3MA 1N6IA 3P1JA 3Q8XB 4WXRA 1FX0A 1ZM4A 4MRNA 4NCIA 4QGHA 3VHXA 1WCV1 1S3SA 3LH5A 2Z6VA 5J40A 1ZJ6A 2IS2A 2Q9CA 3EZ6A 2FG5A 2FPKA 1KJWA 1FTNA 1XNJA 2RHDA 5SZKB 4B3BA 1OSNA 3G82C 5JEEA 1LF0A 2H7VA 1NBME 4QG7A 3U7EB 3KXLA 2WJJA 1RJ9B 3GD7A 3HR7A 3SI7A 1G5TA 2BC9A 4LHVA 2YWFA 4C4PA 1XCPA 2EFDB 5EE1A 4ON9A 2RGNA 3HWSA 2ZETA 3PUZA 4D80A 621PA 3KB2A 1XEFA 4QM7A 4JLBA 4A8JA 1L7VC 3GJ6A 1DPFA 3T12A 4IOMA 4TQUS 2CL7X 1E2DA 4US0R 2WKPA 4PAQA 4AKHA 1KI1A 2IYRA 3KKPA 1CRQA 1DARA 4MKGA 1PVOA 2O8FB 5FTMA 1JQLB 1XDBA 8OHMA 5C4GB 4YMWA 1GILA 1HYQA 4Z51A 1F2UA 1KI6A 5AWFC 2X1VA 2B92A 4HEJA 4XVQA 3HU2A 3R9XA 3IBYA 3H4MA 3U3OA 4BZQA 5JMTA 4GZMA 2ZJ2A 4IDHA 1SHZA 1J2JA 2ZR0A 1QHNA 4LK2A 6Q21A 2BBOA 3P4YA 5DI3B 3AVTA 1KTVA 1VG0B 3KJEA 4JLJA 4K46A 4PC6A 1SXJB 5FTLA 4B76A 3AGPA 2ZYUX 3EW9A 2OHFA 4ZIRA 1NF3A 2AK3A 1Z0AA 4MKHA 1AM4D 2ANBA 4I81A 4LC1A 4EFLA 2BCJQ 4IXMA 2BWJA 4TYQA 5J4HA 1CXZA 3BH0A 2QMUA 1N0VC 4PHFA 4DVGA 4RZ2A 2V6JA 1T0HB 3VKWA 3T1TA 1NVUQ 3D3QA 5CM9C 4EFNA 2F7SA 1SXJA 1TF2A 4FCWA 3WYAA 1E0SA 1Q1QA 2WBLC 5FOWA 2OXRA 2PJZA 1BS1A 4KYUA 2WKRA 1ZCAA 3AKDA 2CJWB 1Z0FA 1IJEA 4KHZA 3VR5A 4GDFA 1RYHA 1UEIA 4OJQA 3A8TA 1L2TA 3C4JA 1Q12A 5JJLA 3QG1A 4FIDA 4A0GA 1Z63A 2A5YB 4PFSA 4WBSA 4ZCLA 3C5HA 3CPEA 3AUXA 3FFAA 4HUQB 2QQ0A 4FI3C 2JLZA 4HDOB 2ZU6A 2XB2A 2ERYA 2R8RA 1KK2A 1NMXA 1Z06A 1ZP6A 1QHIA 1WRBA 2QN6A 2YOHA 3T5DA 3TAHA 3X1YA 3BWDD 2D2FA 2X77A 4M4SA 1VHTA 4XD7D 1MT0A 4D4JA 1TU4A 4A82A 3I5XA 2ZYVX 3I8XA 1N6PA 4YMTA 3BS4A 1QBKC 1LFDB 3CRQA 4YXWD 4HUQA 1AJEA 1IXZA 2YNMA 2CLCX 3PIRA 4B3GA 4QC2A 4EJSA 2J1LA 1EFTA 2O8EB 3FFBA 4WVFA 2A9KA 2GETA 4KXFB 2IF0A 3QPWA 1EFHA 1G7CA 2WWFA 2N46A 4TL6A 4QHYA 1K5DA 1TU3A 1VCOA 2IEZA 2NZ8A 4NTZA 3ZD7A 2QP9X 1I4TD 3DDCA 3Q72A 3CM0A 3ZVNA 3KKNA 4YDSA 2QENA 5FBRB 1ZM7A 3I62A 1EG7A 4PANA 2EFHB 4LHZA 1SULA 3FKSD 4MUBA 4FMDF 4DLZA 1KSFX 4DSOA 3UMFA 3K0FB 5CIWA 4L16A 4IVPA 5FPSA 2V7QA 3I3SR 3NXSA 4BLRA 2XXAB 3DPUA 5KDDA 3LX8A 2ZJZA 2G1JA 1DG1G 2C9OA 2HF8A 4Q4JA 3TLXA 2FE4A 4UXJA 3WYGA 3WMFA 4NL4H 2AFIE 3BORA 2X2EA 4BFUA 3WMEA 2OUKA 4QBFA 3CO5A 3GJXC 1JR3D 4CT5A 2ATVA 2L0XA 3VX4A 4W5JA 1KDPA 2WM9B 4OK3A 4C2UA 5H8WA 4IVQA 121PA 2I1QA 4HLCA 521PA 1IN4A 2IWRA 2MSEB 3X2SA 5A0FA 1HT2E 4JL5A 4IDPA 3ECCA 4X8OA 1QF9A 2OCPA 4NONA 2VP6A 5FUVA 2IYQA 3SEAA 1VIAA 4TMWA 1XEWY 2CL6X 1UAAA 2VHCA 2ZPTX 1E2NA 1N0WA 1R10A 2RGNC 4UJ3A 5B2ZA 3M1IA 1OIXA 4AD8A 4XWKA 2PEZA 3U44B 1Q1BA 1NMYA 1X86B 4F92B 4D25A 2ORIA 1ODFA 3CF6R 4V0MA 3WXMA 3DM9B 3ZS8A 2O8FA 1JAHA 2GNOA 1RKBA 4YC7A 2ZRKA 5JFGA 4M1WA 1U98A 1X8JA 2XNDD 1P2SA 1KDTA 1H8ED 2V4ZA 4Q4HA 4R2HA 5GJVC 4CIDA 1WBBA 3A4MA 1N6KA 4R2IA 4HSEA 5AUOB 4C7OA 1E9DA 1KK0A 5AUQA 1W36B 1KSHA 3W5IA 4TL9A 1XJ0A 1OKKA 4YLGA 3B60A 1ZD8A 1ZNYA 4TLCA 4LSGA 2B21A 2VIIA 4I1SA 3LA6A 4MDEA 2E9SA 4XTRA 3IKJA 3DOEA 3KQUA 1E2HA 5JCZA 1VYUA 2HT6A 2BMFA 1G64A 5GJCA 4YXWA 1I4DD 4Q48A 1N25A 4LHYA 2CLDX 4KI0A 1ZD1A 3IIMA 3EWAA 2IL1A 1ELOA 1GITA 4NYJQ 5FL3A 1F2TB 3GJ8A 4EPTA 5B30A 1ZU4A 1KK3A 2H92A 2P6UA 4G5QA 2Z43A 4AK9A 4URVR 1W0JA 2RGDA 5HPYB 1TL7C 3A1UA 3THWA 3EPJA 4IDQA 2NOAA 3KKOA 1XB2A 1GM5A 4DEXA 2IXGA 2KB0A 4AYWA 4D4KA 2Z0MA 1NL3A 4B3CA 2QPTA 2N42A 2F1RA 4DCSA 5J4LA 1KZGB 1VHLA 1Z0KA 2KSQA 3KQKA 1H8HD 4Q9JA 3P32A 4NYIR 1FOEB 1E96A 1GNRA 3VR1A 4R98A 2VPPA 5KO2A 4M9XA 5BWMA 1PLLA 1XTJA 4JL8A 3MSXA 4PAOA 1XX6A 4M2LA 4NCJA 3WRYC 5D3QA 1AKYA 1N6LA 2JA1A 3X1ZA 3DO6A 4UXIA 2ZM5A 3CWQA 3ZQJA 4J0QA 1KAOA 2IK8A 4NZYA 2XNDA 1HE1C 3AP2A 3BE4A 3KFXA 3B78A 5JSZA 4TLDA 1CRPA 5ELXA 2OAQ1 4H1VA 4DC9A 4GSYA 4JYCA 4B3XA 2ORWA 4V0OA 1UEJA 2O5VA 3L0IB 1G4AE 2WAYA 2V3CC 4Q66C 4RD1A 1N5LA 2IX3A 4DDVA 4HLDA 3TH5A 1DELA 1SQ5A 2OT3B 4AIIA 4ZCMA 1LNZA 1X1RA 4JLAA 5EZ6B 1EFCA 3W34A 2XAUA 2X19A 1YE8A 4QGFA 5E7MA 5HZKA 4HUTA 821PA 2VF8A 4LX0A 4TLEA 4G3XA 5FOUA 3TRFA 4QGAA 2NG1A 2Q9AA 1TADA 2V55B 3W8NA 2ZSBA 4OI4A 2DBYA 4PC1A 2J9RA 1NN3A 1BOFA 2WKQA 5JJKA 2J3EA 5BYJA 3SN6A 1P62B 1NSFA 5LPNA 2W6IA 4BFXA 2GRJA 2P65A 4HYYA 2Q9BA 3ADBA 4V0LA 4DB4A 4A0FA 4BEJA 1MO6A 1WB9A 1FNMA 3B9QA 2HXYA 3BJIC 2Q3HA 2FGKA 3SQXA 1QHSA 2GXUA 1E32A 3QE0A 3WNDA 1BYIA 3RNLA 3REFA 1OHHA 4HLQB 3TR5A 3VMFA 4F4IA 1F3OA 3G0HA 3UIEA 3H1TA 1P5ZB 4XVRA 1M2OB 1D2MA 3FGNA 4W9MC 1DAKA 4PSKA 2F43B 4A2WA 4GL2A 1OW3B 2OBLA 1QZXA 4FD2A 1UKEA 3D6TB 2FSIA 2ZRAA 2AKYA 1E79D 4A0HA 3GLGB 2YOGA 4LWZA 4BLTA 1CJMA 4ASUA 1UBGA 3NEYA 5FI1B 4IHQA 1R8QA 4Q18A 5GADl 2VQSA 3LXRA 1OF1A 1Z28A 1P2UA 3GJ5A 2ZRIA 3PUXA 4OK6A 4US1R 4TQ9A 2PCLA 1IOZA 1IN6A 2OBMA 1GL6A 1YR7A 2F9LA 4FXPA 4GPTA 4IW3B 3AV0B 2WMOB 1VCIA 3F3YA 3VR2A 4Q47A 1W48A 5B57C 1R0ZA 2FMXA 2MSDB 3TE6A 4Q19A 2IA5A 1ZYUA 3OAAD 4G01B 1Z6XA 4B33A 4M9QA 3U61B 3GFTA 3LVQE 3A4NA 2GA8A 3DVLA 1CS4C 1SVLA 1Y3AA 1UPTA 2XNSA 2D62A 2J59A 3N2IA 1II0A 2GWHA 2JIZD 5JRZA 4AKGA 4EUNA 5HTKA 4RCYA 1KJYA 4JLMA 2Q3FA 1CR1A 3LRPA 4URUR 4A92A 2REOA 3OAAA 2QY9A 3NG1A 1M74A 3BFVA 4IOKA 2G6BA 3LAWA 4Y0AA 3M0EA 4Q00A 3HJNA 3A4LA 2FEMA 4PPGA 2VHTA 4LV6A 3FMFA 1ZCBA 2WPDA 1FX0B 3C14C 2VSOA 5E95A 3SYNA 4L4UA 1CR0A 3VU9A 4DLUA 4DHEA 1NVXQ 2V1XA 2WOJA 1XCGB 2QT0A 3DMNA 4Q4AA 3BFXA 2BKUA 3ZVRA 5AJXA 2JLUA 3ND9A 3EASA 2NPIA 3UG6A 4JLVA 1TX4B 2HV8A 4L9WA 1FW6A 2I1VB 1KK1A 1G8PA 2FZLA 3NKVA 1QHHA 4UKDA 4W7SA 1FPMA 5AUPB 1MKYA 2YC2C 4PPQA 3P26A 3NC1C 1MH1A 4AYTA 1SVKA 1M8PA 3NVAA 3T1OA 2UVQA 3RAPR 4LJAA 2WTUA 2VRWA 4Z8XA 2ANCA 1M7GA 2UKDA 1G20E 3IGFA 3PV0A 4NE2A 4W5WA 3VU9B 2PX0A 3W9YA 1W36D 2IXFA 3PCRB 3HYTA 3EZFA 1W49A 4AG6A 4MYTA 5LD2C 3PFIA 3I73A 4GOKA 5E4FA 3AF4A 1BIFA 1DG3A 2EW1A 3KJIA 5KDLA 4D0NA 3NBFA 2WJGA 4X8LA 2CMKA 3TUIC 5K8LA 3AVWA 3AEZA 1C4OA 1NG1A 1AGRA 2GF0A 3ADDA 5EXPA 4HAXA 2Z5FA 2PZFA 1S9HA 1IAQA 3IBGA 3ZYCA 1Z08A 4HAVA 2OESA 2JLXA 4JBYA 1XBTA 1N5KA 2WJHA 3QKSA 2IYSA 4NBSA 3W6OA 1QG4A 3EXAA 4B73A 1KMHA 3I32A 1T3HA 4MH0R 2WSMA 2YC4C 1VG1A 5FFMA 3I4LA 4E07A 3ICQB 2YWEA 1PLKA 4C2TA 4HATA 4PC7A 2WJIA 5L3QA 2DYKA 2H5EA 1JJ7A 5DI9A 5H1YA 3PVSA 3WBJA 2DB3A 3TVTA 2GJ8A 4TYPA 5KYKA 1UDXA 2CK3D 4OQNA 1S8FA 3FE2A 4OBEA 4C0HA 4NCNA 3LW8A 3AVPA 1E9BA 1IY2A 3SDZA 3IILA 1P60A 4QNMA 4KCGA 1T5IA 3VTKA 1KO4A 4PO8A 4NCKA 4HDQB 3CB4A 4U7DA 1KZ7B 2FEOA 4XD7A 3UMRA 5L3QB 3V9PA 4TLAA 2QGZA 4OL0A 2VP0A 2WWYA 4KO8A 2QM7A 3O47A 2C78A 5EJEA 2D2EA 2UZIR 2W6JD 4OJKA 1XZQA 4TMTA 2P0EA 4QBGB 3IO5A 4JVSB 2A3RA 5EQTA 4DKXA 3H86A 4DDTA 2AN9A 4ACAA 4DIEA 5TMPA 4Q1AA 1T0JB 4PZLA 5F98A 2O8DB 3FOZA 2GILA 2JDID 2BJVA 4F7WA 1NN0A 5HKKA 2ZI6A 5KSPA 1VPLA 3U3JA 3DL0A 5FOXA 1MRNA 4BRUA 1DAFA 1OH8A 4AWXA 4P33A 3PITA 4LRWA 3CH5A 2D4HA 2ZRFA 4DCTA 4G5OA 3JVUA 3M4YA 1KO5A 4P4SA 2MMGA 4TTQA 3RS3A 1ZC3A 2R2AA 2GJAA 1OH6A 2ZYWX 5KDOA 1KNXA 3K9NA 4V03A 3SJBA 3CNOA 5L3SB 5J47A 2GVZC 2W2TA 4EPRA 4FMCB 2GCOB 2ZTSA 4LUCA 4BZXA 5CDFA 1E2LA 3B1XA 2WSSA 5A4JA 1WXQA 3K0SA 3CW2A 1FFHA 4M9ZA 1W0KA 3OEHD 3U2QA 2ZQ5A 1N6NA 1RJ9A 2V54A 4IDOA 3O8CA 1JR3E 2DHRA 4Q4JB 4MITA 1D9XA 1YZNA 2VP5A 4F91B 4CT4B 2WIBA 5C2JB 4JLDA 2HDNB 1EWQA 2ZRNA 2YKGA 1NJGA 2JJ1D 5AJZA 3R7WA 5DN6A 1UBFA 4GOXA 4Z54A 1XFAA 2P5TB 2C95A 2BBSA 3LXXA 1TF5A 3B1YA 3C15C 4MUAA 4Q21A 4DUGD 5DLQC 3RLFA 4C0BA 4NPHA 1Z3IX 1CTQA 3EC2A 1U9IA 1JECA 2EQBA 2WOOA 2D06A 2ZRBA 4ARZA 3LW7A 2CVHA 2NTYC 1QRAA 1T5LA 5JRJA 2KBFA 1AK2A 4TQAA 4WOPA 3PXGA 1GNQA 2F9MA 3RWOA 4DSNA 5FH9A 4TWZA 1J99A 1KYIA 3UANA 1IHUA 2EWVA 2O52A 1EXMA 2Q6TA 4QFMA 2IS4A 1KO7A 4NP6A 2QORA 2F1JA 1KY2A 1IY0A 4GP6A 1P9NA 3NC0C 3B5JA 2XB4A 4JJKA 3ZQ6A 2QBYB 1T3LA 3QF7A 2XTMA 3FKSA 4ARZB 4GBMA 4KODA 4JLKA 4L15A 3QNUA 4URYR 2D3WA 2IYXA 4DBLC 1SKQA 1R0WA 2C99A 3QKSB 4LOAA 4FW9A 4D2IA 1O87A 3X1WA 2F3RA 1R7RA 5EE5B 1JBKA 3MAAC 1KMHB 4B48A 2I3BA 4D26A 3ASYA 3Q85A 2OEPA 4OKSA 3WNCA 1P72A 3QF4A 1VECA 1Q22A 2QBYA 2F3TA 1SKYB 1MO3A 1ZNXA 5K8TA 3DKVA 3K09A 2AWNA 2QROA 4QBHA 2J0VA 2CCKA 5DN6D 2HT1A 5AJWA 3A37A 2JLQA 4UNPA 4N0EA 4RFSB 1HUQA 2GF9A 1OB2A 4RVCA 1VCMA 1TTTA 5CIQA 3WMGA 1G7TA 1FQKA 3OIYA 1XMSA 1E9AA 3MLEA 1XP8A 3R9IA 3QY0A 1EFRD 4MGYR 4JJZA 2JJ1A 5KPJA 3ZVLA 4B47A 3E70C 1ZUIA 3ZJYA 3HU3A 2G88A 4EJSC 3BK7A 5JZVA 4KAXA 5FBLB 3TAUA 2XZLA 4LGMA 4Q02A 1CU1A 1LF5A 4R9UC 2NO0A 4I99A 3DM5A 4ZO4A 5P21A 3T1VA 3GLFA 2VL7A 2ODBA 4XJXA 4A6XA 3FHCB 3I61A 2O8EA 3W8RA 2OZEA 2IF2A 2B8WA 3QEOA 1TEVA 1C1YA 2BBWA 4UNQA 2F1IA 2R6FA 1F5NA 4HB4A 4Q9IA 1GRQA 1I4LD 1SGWA 1T91A 1MABA 2J0UA 3KDSE 5KUTA 2PJRA 3KKMA 2ZUDA 3KQHA 4CRWB 3OFNA 3IEVA 1OFHA 2EYUA 1KI7A 2HLDD 3DZDA 4M8NE 5FOTA 3UG7A 4C0KA 3THYA 5BW8A 3L0PA 5EP2A 3QXCA 4LYJA 4ZV4A 3AGQA 4K8OA 4JT2A 1US8A 1R0YA 3PJRA 3BB4A 4E22A 1NBMA 3CRMA 3F8TA 2ZSFA 4MKFA 2AFHE 1D2EA 1NP6A 3U4QB 4EFMA 3BGWA 3LFUA 1IY1A 3P4XA 4NKRA 4LYAA 2FSFA 2R6CA 1XD2B 2XX3A 2WZQA 2BVNA 1S0UA 4KBFA 1NBMD 1N6HA 2QQEA 5HE9A 2P6RA 2MMCA 3AVQA 5GVRA 3MJRA 3ZZTA 1W7AA 1G3QA 3LV8A 1GRRA 4MRRA 2VSFA 2G0NA 2QRZA 1ANKA 1PZNA 1XU4A 1IN7A 221PA 4HZUA 2Z4RA 4LJ5A 5BXQC 3H2YA 4JKYA 5GJBA 3EPLA 1XTIA 4DDWA 4A2PA 2BM1A 1DS6A 5FI0B 3TIFA 3EPKA 1HV8A 1ZUNB 1G6HA 1DE0A 1R5OA 2JEOA 4EIWA 3I5YA 4BFZA 2ZSEA 2GXSA 5IF9A 2PBRA 1PJRA 5G40A 1FMJA 3IEUA 4TLBA 1KAGA 1G3RA 4NDZA 4Q1CA 1ETUA 3Q3JB 4JLPA 1BO6A 2R44A 4B34A 3B85A 3GLGE 2XOKD 2A5DA 3SNHA 3WP1B 4AKIA 2FFAA 2BBTA 3ADKA 4Y0VA 4BGDA 2XSZA 1G17A 5KTYA 2O8BA 1AA9A 4PSAA 3BRWD 4WAUA 1AS3A 1ZU5A 1DBSA 5DNYB 2I4IA 2WWIA 5FR1A 4MGIR 5FBQB 1P7CA 4KU4A 4PTLA 4A36A 2F43A 1GSIA 1KGDA 5CYPA 1P75A 2DY1A 2BDTA 3W3ZB 1GKUB 4WZ6A 1YZTA 4AKEA 1E0KA 2YINC 5EP1A 5EXSA 1JXMA 4EPXA 1U0HC 1GDDA 1KI8A 2QT1A 2B6HA 4LZZA 4E5UA 1ZRHA 2IS1A 2BEJA 2VP4A 3GJ3A 5JLJA 1NMZA 3FDIA 5DHFA 2QTFA 5AJYA 5FUWA 2VF7A 2IYUA 1II8B 1E4YA 2IYWA 2ZI4A 3TKLA 5C4MA 3T15A 3GJ0A 4XSGA 4D6PA 2J87A 4DDUA 4QXAA 1JNYA 1W47A 5JEDA 5FR2A 1JXOA 1A2BA 3A1VA 5CB6A 3PEWA 1F2UB 1XTSA 1E9EA 1KY3A 1E79A 3IIJA 3LDAA 5F9HA 2IS6A 1T8UA 4F93B 2PCJA 1FP6A 3N70A 2TMKA 3QKRA 2KI5A 2XITA 4P3YA 3SFVA 1G8HA 3NBYC 2C5LA 3ZVMA 2ZRDA 1U2RA 5KU1A 1X6VA 3UPUA 3KJGA 1SVMA 5FBWB 2A5FA 1YRAA 1N6OA 2IWHA 4BLOA 5J4VA 1XXHE 1U81A 4Q7JB 5H70A 4DLVA 2ZRMA 2UZ3A 2XJ9A 5A5GA 1Z6AA 1T8TA 1B23P 1G5RA 2GESA 4U02A 5EE0A 3CPHA 2OCAA 3EARA 5D3MA 4M22A 1JAIA 2ZYTX 3CRW1 3SZRA 2JIZA 1KKLA 3VR4A 3GLHE 2QEQA 1CBUA 4Q4AB 2C96A 3K70C 4FN5A 3RHFA 2NPFA 1UKVY 1E0AA 1Z6GA 1E2KA 2IYLD 2FFHA 2ZANA 1G3MA 2ZUBA 1RRFA 4PZYA 4LBWA 4WA7A 3RDPA 4KLNA 4O2RA 1TQ4A 4X8MA 1NY6A 2PL3A 3ZH9B 2IUUA 2VSXA 1PV4A 4ZKEA 3AVVA 2H8KA 3B1WA 4XH9B 3TBKA 3FKQA 1VYTA 3HP1A 3BC1A 3KXKA 5CLQA 1XMJA 3T34A 1IXRC 3SYKA 4AY2A 2A5JA 1XPUA 2SHKA 1NNEA 4WXPA 1P2VA 4KVAA 3K0AA 4OI0A 1EFRA 2NQ2C 3MJHA 1TEXA 2GVDC 3THYB 3RWMB 3SE0A 3OEHA 1W4CA 4BLSA 4M1KA 2ZRGA 3EAQA 1R5BA 1QG2A 4RCZA 2F1HA 4EQ6B 2CHVA 2GBLA 2ZU0C 2OCBA 3IO3A 3MWJA 1NSTA 4BFTA 1OPXA 5JI3E 2XJ4A 5FOSA 1XRJA 2A5GA 3RRZA 3M6AA 3L0OA 1AQUA 1OFTA 1L4YA 2GXQA 2ZJ5A 3WNBA 3ZIAA 1VCNA 1NVVR 1E1QD 3AH8A 1Y63A 3PEUA 4IFEA 1T6NA 1SKYE 1RC8A 1NG9A 1KSJA 1VG8A 1ZW6A 2C8VA 3QKTA 3T1QA 3LO5A 1ONBA 1Z83A 2BEKA 2VTKA 2NZJA 3U6KA 2NIPA 1G19A 2PZGA 4HAZA 3FMIA 2GEVA 3OE7D 2ZREA 4JSTA 2NO9A 4V0KA 4O25A 4P0TA 5TB5A 5JHGB 5BN4A 4IXNA 4Q1EA 5FL7D 3EZ9A 2LKDA 1DO0A 3AKYA 4JBWA 1ZM9A 1E2MA 3GQBA 2HJVA 2GJKA 2NGRA 2ODWA 1G8GA 2ZITA 1JI0A 4JKIA 4QGGA 2NO6A 3RANA 1N2CE 4Q7LA 3K1JA 4D82A 4CEHB 4QOSA 5FL7A 4PHGA 2XZPA 2W00A 2DWQA 3B6EA 2IW3A 4KFRA 2RGCA 4HLUA 3IIKA 3U5ZB 5AR1A 3EZ7A 3R20A 3VKHA 2FFBA 4RFVA 3JZMA 3SU8A 3KQLA 2KWIA 5TY0A 2H18A 5LD2B 1W2HA 1Q3HA 1P4SA 1YRBA 3QUSA 2ZE5A 4I1VA 4PPFA 4ABYA 1TMKA 1U0LA 1R0XA 2OO7A 1F48A 2HEIA 2GK7A 4PC3A 5ANRB 1JB1A 4BASA 1VYVA 2CCGA 4MGKR 3NWJA 1DAHA 1IBRA 1W1WA 2GZHA 1P6XA 3MCAA 1FMLA 1W5TA 1SXJE 3ZD6A 2ZI3A 1GAJA 1A82A 3OHMA 4Q1FA 4TSFA 4XIGS 1E9SA 3CKLA 3SHWA 4GT1A 2ORVA 1COWD 4ACBA 4IFBA 2AKAB 4GNKA 5LBIA 2B7BA 2FWRA 4OHWA 5FOVA 2Q0HA 3BB3A 4IDNA 4IVRA 4O3MA 4KLZA 4OQLA 5L3SA 3CR8A 2BCGY 4EPVA 1IXSB 2ECKA 1AIPA 4ZI3A 2GCOA 2KJQA 3QXSA 1E98A 4B3DA 2VYFA 2FPMA 4TL8A 2ZXUA 5E7IA 4XSHA 2QAGB 1WMSA 3EIEA 1QHHB 1Z0JA 4IEEA 2CJWA 3ZZ0A 2FDCA 4MYHA 4FINA 5J4KA 4Q4LA 3LY5A 1RRGA 4NYMR 4W5HA 2OFOA 2PH1A 1FUUA 3FHOA 2H16A 2QM8A 1G8YA 5JWHA 4CVNA 3A1SA 1G7RA 4OK5A 4TMVA 5J4YA 2RH5A 5DGXA 3C5CA 1Q21A 1JEDA 3CIOA 2W0SA 4N1AA 5DYGA 2YZ2A 1EK0A 1T9HA 1AKEA 4DSTA 2ZR9A 2OLKA 1C9KA 1E2FA 1RFLA 1ZNWA 1T4GA 3LD9A 4IOJA 4PQRA 5EZ5A 2VLIA 4ESHA 4DIDA 2ATXA 1TUEA 2HLDA 2AXPA 1UKZA 3QPVA 3ZS9A 4TTPA 1MO4A 3TW4A 3U7FB 2WHXA 2GEDA 2PMKA 1L4UA 5E7JA 2JLRA 3QQ5A 1FNNA 4HB0A 2WPDD 4QJ3A 4N0DA 4IJMA 5CLLA 3GFOA 2Q3MA 4Q1BA 5GVSA 5JI2E 3VNVA 1Z22A 1ZAKA 1DAGA 4GP7A 3TSWA 1E9RA 1NRJB 3BH7A 1LS1A 4OYHA 4A4DA 1NN5A 1L8QA 5K8UA 3U7GA 3GEIA 1V43A 4CEJA 1G6OA 4MA4A 3TJZA 4CEIB 2O8CB 3BBPA 1U94A 5LB2A 5G41A 2IYZA 1G5PA 4DWJA 1FP7A 2G0TA 1OXVA 3OIUA 3IDQA 4KSCA 1K5GA 2HXSA 3RS0A 1MO5A 2CVFA 4RD6A 2ZJAA 1W44A 2FF7A 3QPUA 1OXXK 1XMIA 2JCSA 1MV5A 2BKEA 2GBLC 3RRMA 2CK3A 3E2IA 2W58A 3OIWA 4M9SA 1W0KD 2Z4SA 5IRCD 4TYNA 1J70A 1GZSA 3QSYA 5DO9A 3O8RA 1VTKA 2W2VA 2EWWA 5GJWC 3TUJC 2O8CA 1QVRA 1HT1E 3BD9A 2QTVB 1XD8A 2FNAA 4B2LA 4B75A 4HB3A 1FTSA 3RYTC 3TQCA 4TT3A 3T61A 4D4LA 4ESVA 1XMVA 2RGAA 3KB1A 1H65A 3ETLA 4FMBB 1LV7A 4PPNA 2QP4A 2GDJA 1KSGA 1ESNA 1GKIA 5FPKA 4POAA 1HTWA 3AVXA 3EG5A 4B6EA 1LS6A 3CF2A 1UJ2A 1J8MF 1UFQA 3QKUA 1D9ZA 5JHHB 2KE5A 2V6IA 1BYUA 1OXSC 4Q9HA 3K70D 1BMFA 4OHZA 1E1QA 5DYIA 4C0JA 2FH5B 2ODNA 3AF3A 2ZJYA 1I2MA 3ADCA 4OHXA 2C04A 4OHVA 3NH9A 3ASZA 3I8SA 1KI3A 2W6ID 3AQ4A 4QHTA 1G18A 4QM6A 2PT7A 2G3YA 4GOJA 2J0QA 2FGJA 3K9LA 1G291 4UNSA 4LJ7A 3R7WB 1ZD9A 4HLUC 1NY5A 3FMPB 4DLYA 2ASEA 2QUZA 3KTAA 1GUAA 1ZMXA 2WICA 5FPHA 3R8CA 4LHXA 1XTRA 1AQYA 3GFPA 5HCIA 4DJTA 5AK0A 1G21E 2ZI5A 1GOTA 1YHNA 1YVDA 5KSYA 3LWNA 3QG5A 4RKFA 1CEEA 3SYLA 3BFKA 2G9NA 3EZ2A 1IM2A 2QPAA 4NMMA 1G8FA 3P20A 4LBZA 3BB1A 1RZ3A 4N3NA 5EE3A 4OHYA 4G5SA 1US8B 3X1XA 5HE8A 2P5SA 2IT1A 3GEEA 2WSSD 1Z6TA 3MMPA 4G5GA 3THXA 2ONKA 3HU1A 3GLIA 4II7A 1W4AA 4LJYA 2AK2A 4XVUA 1NLZA 1SVWA 4E09A 4YMVA 2AX4A 5JBQA 2FOLA 4WZBE 3SBDA 2D7DA 3Q5DA 1HY3A 4AC9A 2J5XA 4JMPA 4M21A 3KUDA 4BWYA 4EPYA 4Q9KA 3NBXX 3TUZC 4A1FA 3FYHA 1U8AA 1U8YA 3OEEA 3RRNA 2OBNA 2QI9C 2DFTA 2EU8A 1XZPA 2YV5A 1HURA 3C7KA 4WZAE 3ZDQA 4DSUA 3THWB 1NN1A 4JBXA 2JGNA 3BOSA 2QMOA 2CHGA 4ZPXA 2P2LA 4P31A 2CBZA 5FTNA 4AURA 1G7SA 1K6MA 3DMDA 1WF3A 1WA5A 4RD4A 3QI2A 3SQWA 4DLWA 3CBQA 3O8BA 2ZRHA 4V0ME 2WIAA 5KNDA 1W5SA 3MWLA 5LB4A 2BV3A 2Z83A 2LCFA 2GCNA 2ZUCA 1TPZA 1E2IA 4Q7KA 4DB2A 4TZ0A 4R71A 4JIMA 3CNLA 1WE2A 5F9FA 4M1SA 1G41A 1GG2A 2C2HA 2O8BB 4M1YA 1NVWQ 3CLVA 1G1MA 3TNFA 1GNPA 1D5CA 3U60B 3LLUA 2OFXA 4RD0A 2W6JA 3NIBA 4D81A 1EFUA 2YJTD 2IC5A 2ZE7A 4KV9A 2GXAA 1I2DA 2XOKA 2WV9A 2Y8EA 3QF4B 5TDHA 5CYOA 2GZAA 3ZIAD 1TAGA 4CEJB 3D8BA 1OJLA 5JECA 1NLYA 2WWGA 4BUJA 2CLSA 4F4JA 4P4UA 2QSZA 421PA 3NBZC 4PX9A 1YR9A 4G0NA 1OYYA 4PC2A 2DFLA 3W5JA 4PO9A 3CH4B 3AVUA 4URXR 5BN5A 1XEXA 1OE0A 3PENA 1E1RD 2XEXA 1M7BA 3OEED 3K0EA 1JALA 4PAMA 2R62A 3MRSA 1JEEA 4BFYA 2QP3A 4TSFD 4ZDIA 1X8LA 2DFNA 2VA8A 5KHOC 3BIFA 1E9CA 2RCNA 2JLWA 2ZI7A 4LC0A 3SC3A 3WY9A 1H8HA 3I92A 4S2EA 4TYYA 1ZM3A 2FPLA 2OILA 4QBIA 3AF0A 2V8OA 1RIFA 3C41J 4FMCF 3N2EA 3SJCA 3CR7A 2BJWA 1VDZA 4PO1A 1CKEA 2CL0X 2P3SA 3K0AB 4PZZA 3QIAA 1RPZA 5FPYA 2C03A 5KSZA 1YU9A 3QBTA 5B58C 3CNNA 1YKSA 5JSZB 3K0FA 3PEVA 3EX7C 2R6AA 4Z1MA 4BRWA 2ZE8A 4URZR 3HR8A 4TMXA 4A0RA 1UADA 2XXAA 1S9DA 4HZUB 4MRSA 2AHOA 3B82A 4QJ4A 3B8HA 2GTPA 2J0UB 2G1KA
chains in the Genus database with same CATH superfamily
4MRVA 4AICA 2QD1A 2NSLA 2QX6A 2WAAA 1ZVVA 2CXRA 4GFDA 1F8UA 1FEZA 4BFSA 1NVEA 1ULHA 2JJ8A 4Q03A 3KR2A 5ALLA 1SCKA 3K32A 4NAUA 4B35A 4CLRB 3SQNA 1U2EA 5ICSA 1AZTA 3WJ1A 1IUNA 1NUQA 1R6VA 1V8DA 4MQUA 4G4IA 4P53A 3EEIA 3T7TA 3KTAB 3Q7EA 5FWXA 5AI0A 2QRUA 4UVIA 1W4RA 2QTGA 1MD9A 1CJCA 1TCVA 3BAZA 4LQLA 5DW0A 4F9TA 1XF9A 2CD7A 3B6MA 3DMRA 4KG7A 4C78A 1ZINA 2PPLA 4MUHA 4BMZA 5F1KA 3ZHBA 1SPXA 3C6BA 2ZRQA 4BJ3A 5KB3A 1OA1A 4WEQA 2NO5A 3ZI4A 2N75A 5G0SA 3TPFA 4D3FA 1ZM2A 3BZBA 5GOZA 1J24A 1QZUA 1P2TA 4MPPA 4MUYA 1TUBA 1JKFA 1YB4A 4TQGA 2GWRA 2R47A 1MJFA 3AOEA 4ML3A 3WYDA 4LTMA 1EA5A 4INOA 5AYVA 2N47A 5A5FA 2OORA 2Z09A 3DJFA 3K1YA 1MO2A 3UWDA 1P9RA 2JH3A 4WW0A 1RJFA 3GMTA 1YJ5A 1G98A 4LV5B 2F8LA 5T64A 4BU1A 4C0SA 4EG4A 3O5AA 1B26A 1P73A 2CFOA 1GQRA 5E9AA 4ZVLA 5EUQB 1AZWA 1IQPA 2ZJBA 4M99A 3T7SA 1KI2A 1S2LA 2GKSA 4IP0A 3UV3A 3VC2A 3S2IA 1XMPA 2ZSAA 3U7HB 2M2IA 4G25A 1XSEA 2VDLB 4REOA 1LXCA 2IHTA 2C9MA 4HVTA 3ANTA 3O9MA 4EKYA 4GKBA 5I9TA 1REQB 3MINB 4QXOA 3GPLA 2A4MA 1OVGA 4E5YA 4O1MA 3EMDA 1RP7A 1KMQA 3B13B 3CLTD 4XOIA 5EAIA 1U8XX 5MGBA 5H9VA 2Q6IA 3PICA 1RXIA 1YQGA 1NKTA 5LA6B 3RGGA 3V4FA 4ENWA 3NTXA 3AY3A 2H1RA 2Q2QA 4B71A 2LDBA 1FW8A 3E58A 2G1PA 3TZBA 1WQ4A 1X0VA 5K3CA 3W4JA 1OH7A 1KYWA 2P6OA 3VR3A 5CVJA 1R4NA 1PJ3A 3IDAA 2IH5A 3GLQA 4H3HB 2G08A 4IPTA 2IBMA 3H84A 2IEYA 3ZW7A 4P83A 2F8SA 3BTUA 4QUGA 3GAZA 2FJ0A 1EAMA 3IPYA 4BAGA 4K6FA 3GWGA 1UUFA 5EI5A 1EM8B 2BRUC 3C3XA 4FPXA 1UM9B 4Q5IA 3KAQA 4S12A 3TLMA 1YU6A 3W5CA 4DSAA 1YZGA 3GK3A 4I6GA 3GLTA 1IBCA 3LHKA 3MLAA 5HZGA 3VR4H 4EATA 2HM7A 2ZTHA 3W06A 2Z2JA 1JGTA 2Q4BA 2KQUA 4YAGA 1U6JA 4DZZA 4KVZA 4WH0A 3PGLA 4M9CA 4Y2GA 3KL2A 5FBVB 1ILEA 3DO5A 3VC7A 4UFNA 4EGFA 1BE8A 4FOTA 1QIFA 3A10A 3JQFC 4OB8A 4AYXA 3TBFA 3V4PB 4CFYA 5AUNB 2G80A 2POQX 3FI0A 4FDVA 4ND5A 3TOCA 5JBIA 1GJRA 5BN1A 3EPPA 3NHBA 5HBRA 4G9GA 2EEZA 1N7HA 4BFVA 1VKJA 3FDZB 2UV8A 2UZ4A 1K7FB 1E2QA 1IRIA 3MMZA 4CF7A 4YONB 1PE0A 3DBHA 1D2HA 4OYRA 3RO7A 4D56A 1DSSG 1XCOA 5FWAA 3BMOB 1EB9A 3G5TA 4HGQA 5CNJA 2AJDA 3DAHA 5DSZA 4M8LA 4I4TA 4W99A 1YZQA 3DMFA 3T06B 1CUSA 2QMEA 4YT4A 2R1ZA 5D3MB 1SCAA 2CJPA 2YCLA 1FNSA 1K1EA 5JNUA 1LY1A 1S2OA 3TR0A 2PV0A 1Y6QA 3PA6A 2YY5A 4I46A 1O1YA 1NPDA 4MQFB 1V7ZA 5F5LA 3DFFA 4UBLA 2FSVA 4BNTA 1U7XA 5THXA 3KAPA 5J1SB 1QJ4A 4ZAVA 4J2OA 5A7HA 4CNQA 4UVHA 4GUDA 2BGKA 1BHJA 5DNDA 1IATA 5AW3A 4MB0A 4K3UA 4ZQIA 5CFQA 2IQ5A 3DXFA 4OKIA 2P91A 3HBAA 3L1KA 3C7CB 1WPQA 2GPYA 3OF5A 4UEKA 4DIMA 4KR2A 3DW1X 3UCXA 2P5YA 1ODCA 3RC8A 3WWDA 1W2GA 3AK4A 3JWJA 4DLBA 1RCTE 1X80B 3UJ6A 4Q93A 3R3XA 4RA6A 5LIRA 2Z95A 4YJ2B 4C30A 4MDFA 4H3KB 1S2NA 4FD3A 1EGAA 5F7OA 5F12A 1JLHA 2YJGA 2XCIA 2QRVA 3WLMA 4ENRA 2QX8A 4DEYA 1WBJB 2BW0A 3CX6A 1FJHA 4H6WA 5KNLA 4V0NA 1SK8A 4UQOA 4MS3B 3K6RA 3PUYA 4IGKA 3PUKA 4M1TA 4MICA 2QS9A 2F3SA 3KDAA 3DTVD 4NYJR 5CDUA 1EP1B 2A78A 4FKMA 3ZTYA 3PQ5A 1EQUA 1K0UA 1F6WA 4LE2A 3WZMA 1VQ1A 2E4WA 3KLOA 4FCVA 5K0JA 3G7SA 2EZ8A 1A9ZA 5EIHA 5KJ1A 4FFSA 3V1YA 1SCUB 3A9UA 1U3WA 1NYRA 5BWOA 1HEUA 2R4TA 4DBZA 1N3BA 1JX6A 4JI2B 5BWLA 3HVRA 1OU4A 1NBWB 2C94A 2JLSA 3QUAA 2OE2A 2QA5A 2JCYA 2CFCA 1ULBA 1O0CA 4NU0A 2OAP1 1Z7EA 3G2QA 4NX2A 4DCNA 5CEFA 5I4IA 1HRKA 2QE7D 1O6ZA 3C74A 4LDNA 3STHA 1A4RA 1L7NA 3GLGA 4WUVA 1MABB 2I22A 4HX5A 3EIHA 4TL7A 5CA0F 5JVDF 1BXGA 3MTEA 1KAQA 2F67A 3R23A 4Q34A 1ZICA 2RI0A 4XWOA 2VHJA 3ZZUA 3OUTA 5IAOA 5JU6A 2O4CA 1TT5B 2AOWA 5G02A 2OXCA 4HMOA 3O91A 3IMCA 1IYZA 2OECA 1XZNA 1SVIA 4RTOA 3IHLA 2XI4A 3VR6H 5JS7A 3R8FA 3F5FA 3AF2A 3LBAA 4HX2A 3STWA 3E1KA 1LRLA 3QVGB 1UK6A 2C77A 4AXBA 4DRXA 1PT7A 4B8YA 5HKBA 4KPUB 1K3TA 3U4GA 1B0UA 2VPZA 4M37A 2WEKA 3SFTA 1G8SA 4G67A 3R9XB 1C2TA 2GJSA 1YRYE 3Q9SA 3NDPA 4QRDA 3M33A 3G59A 3WB1A 4OHBA 3ELYA 5FULA 4MRPA 3AR3A 1USUA 1Q0HA 3CTMA 1XZEA 2PH3A 3LX4A 3K09C 3A9WA 4FJ0A 1DX9A 3TSZA 3WKEA 1YZKA 4N3BA 2JJ2D 4XUCA 4DV6B 4B09A 1GTMA 3G23A 1AS0A 5DYTA 2CHQA 4KTTE 3GNSA 1RYFA 2KMLA 4X8HA 4EKDA 4QZVA 4GE0A 3SR0A 3COWA 1G2PA 5AW0A 4KMMA 3HADA 4QOFA 4U0KA 5IJAA 1Z82A 3D2LA 4Q9LA 1CIVA 5JWOA 1APBA 1T0IA 2WSIA 2YWCA 2EFYA 2QQ5A 4QOHA 4ZU1X 4B6OA 5F64A 3BICA 5EXXA 1TIPA 2XYHA 4QXMA 1R4MA 2VH1A 3FRIA 4UXHA 3HCRA 3E0QA 4E51A 1JPUA 1DJLA 3HVKA 3D0QA 3OBIA 3SJZA 1ST2A 4OAOA 1DG9A 2FZVA 1MOSA 2JDIA 2Q5HA 4NNJA 3ZLBA 5HKKD 5K2OA 4YA6A 3G8BA 4S2UA 4EDHA 4YJGB 3ONDA 4X1YB 3CXRA 3QX3A 4MYUA 4TT8A 5EKDA 4DBLE 5CCDA 4DM3A 1F60A 1KI6B 1M72A 4BX0A 2PXXA 4GGOA 4O0MA 4XYGA 1ZJJA 3ORQA 5HDBB 4ILEA 3S81A 4OVKA 3HYSA 1JHUA 4M8KA 3DB2A 4N7MA 3FIUA 4ZVSA 3RIHA 4JUBA 3TMYA 3DV0A 1RE0A 2AR9A 2WSYB 2IV7A 5JCJD 3ERCA 4BMSA 2X2OA 4BV2A 1JKJB 1UFOA 1W46A 4LVUA 3T4UA 5K8JB 1N0UA 2REXB 2FUEA 2VQ3A 4GEGA 1RAGA 4L8LA 4M0LA 2YASA 1N2HA 2YFYA 2PEYA 4JA0A 4FZ5A 1OFUX 2Y1WA 4DG9A 3ZWDA 5FUQA 1I0IA 2FP4A 4FU0A 5H59A 3ESYA 4RKEA 1BHSA 5H9WA 3EGXB 3SOPA 2UVDA 1TVKB 3UB3A 5K8CA 4S05A 1PNQA 3WGOA 1EDBA 2C8LA 1V41E 4IAOA 1MAAA 1NXQA 1O08A 3OCZA 3MN1A 4ZT5A 4NBRA 3WLSA 3PE3A 4C7KA 1GZ7A 1W2WB 2PNFA 1Q74A 2ORYA 1Y5IA 4N8DA 5FA5A 5IEBA 4QAQA 4U2FA 4ARVA 4OB6A 4DMKA 5IT5A 5E1MA 1XIVA 3R3UA 2X0JA 2NO4A 1PW7A 1UBMS 3G5UA 4L27A 4LWOA 1CPYA 2XT6A 2A30A 3VSDA 3ZLJA 2Z9CA 2IYVA 2MR6A 2UVPB 2EFJA 1V4BA 3BCHA 4XYBA 4DN6A 1T8PA 2BP7A 1TM3E 2H2HA 1JIJA 2X5XA 3VTAA 5CK4A 2FJUA 2HWUA 3FTCA 3G02A 1R2QA 2J7PD 3B1KA 3L82B 2O2SA 1HH4A 4OBXA 2JGKA 2EKDA 2Q1YA 5LA6F 1C80A 3WGLA 3E3AA 5CFMA 1NW4A 3DAPA 1SU4A 5COQA 3K9BA 1SCJA 3QVSA 4RIIA 5AVRA 1RLTA 3X2EA 4EHAA 3CUWA 1VRWA 4O4JA 4ZI5A 4J0CA 1YTUA 5J2UB 4FWIB 2FXIA 3Q7PA 2WUFA 4HEA1 3GLFB 4YPVA 2YVKA 1FFYA 2L19A 2ACWA 2QUIA 1YUBA 1A5TA 2Y2VA 3KYDB 4BJ1A 5IT9A 2NTJA 2HA7A 5IDVA 2OD9A 2GZDA 1VE9A 2HMVA 3MWEB 4IX1A 2AFHA 4G0WA 4NHOA 4EYQA 2FU5C 1W73A 5BSMA 3EPHA 2GSDA 2AXNA 3D5EA 4YJHA 3IAM6 4K81B 1UEXC 4Z4CA 2ZZMA 4RK5A 4FOPA 3HJAA 5HUJA 3WLFA 3CSUA 4CF6A 4ZGBA 1J7KA 1A9TA 1U9IC 3KHSA 4ZDWA 2WU0A 2XCTB 2RH9B 1XHFA 5IMBA 1TF7A 2W2XA 3K73O 5E1OA 4B43A 1J07A 3KD2A 4DAOA 4Q01A 2IDJA 2RH8A 2E87A 3E7FA 4PQYA 5TS3A 3IVCA 3LT4A 4PAWA 3LTNC 3GVXA 1GA1A 1EJBA 1AX9A 1SUCA 3I9V6 3ENVA 4OHUA 4Q7MB 2P2DA 3HKDB 4B3FX 4HAWA 4BC1A 3TG2A 1OLUA 2VEDA 2QQGA 3P27A 1IWBB 2CXSA 1M6HA 2GN2A 2P9BA 3KZNA 5AJUA 3KLNA 1M1YB 4L4RA 4E12A 3NHMA 4PHTA 4WCVA 1G4HA 1NRIA 2BIFA 2QE7A 1BW9B 1K08A 2C2GA 3DFIA 3KUCA 1JFFA 1X2BA 2WWHA 3GNQA 5IJWA 4ENVA 1U9CA 1DO2A 2XTNA 2Z98A 3NC4A 4HPJB 4RWZA 5EIWA 2HWKA 1SVOA 1Q0QA 4YRBA 3V4RA 2V96A 2O2YA 3K8OE 2HBYA 4P8RA 4B6FA 2R66A 5IHPA 3ESXA 2B1GA 1YS7A 3OA2A 1NI4A 2VT6A 1Y37A 2GLXA 1O7JA 1KJZA 2BGNA 2Y93A 3WK7A 1NTOA 3BH6A 3H9JA 2IP2A 3OJFA 1VOTA 4ROSA 3RS5A 3ZCQA 4W8OA 4KXQA 3QU9A 3R3ZA 4FEYA 3ZG6A 5JJ5A 4EG6A 5K4HA 2XA9A 1U0TA 2WUVA 3X1MA 2B2NA 1ISGA 2JHPA 5EP3A 2JVKA 3QP9A 3LQ1A 3D0RA 1HLDA 2X4DA 4GM0A 5EJ9A 1I9CA 1SG9A 5JMOA 4RTRA 3COJA 4F2GA 2WFLB 3F6YA 5E6SB 5JANA 1PT9A 4DV0B 3P9KA 5BN4B 4DIUA 1B16A 4GYKA 2XUZA 2FQXA 5HF8A 1HPLA 4ZI2A 2XNHA 3ANLA 3RS9A 2ZBUA 5FTJA 3TD2A 2Z3WA 1KDOA 3BGIA 3L6EA 2C61A 1GKYA 3MYRA 3SX4A 4EO9A 1ADFA 5EHXA 4EB8A 3ZC3A 4DZTA 4PSUA 1G8AA 5L3VA 3TOVA 4AN4A 5AK3A 2ZOSA 4DT1B 4RX1A 3I72A 4AUKA 3E22A 2IYTA 3FLBA 1Q0TA 3F98A 4CIVA 1EFLA 1E3EA 4O8CA 5EJ6A 4NR0A 5ESWA 4JBGA 1TCCA 2A1TS 3EGCA 2O8NA 2YVUA 3H1BA 3OBBA 2DQSA 2QAGC 2R5FA 5C51B 2IUSA 4D0GA 1T9KA 1N0IA 3K53A 2HF9A 1UANA 1FA9A 5E38A 2WM2A 1XNHA 3WGTA 1TKRA 1Y1KE 3SF8A 1CY1A 3O4IA 3J7AC 2QTHA 3DE7X 2XUAA 3AR5A 1F1JA 3BE6A 2RGEA 4V02A 1GZ4A 1G8KA 2FETA 1ZMTA 3NDIA 4LZOA 4WESB 2RI6A 3CRRA 3UMMA 1Y7TA 1X92A 3NTLA 2VTBB 1K86A 1ZQ9A 2XBLA 3JU3A 3HR4A 5BSGA 4FX2A 4IGFA 1WDLA 4LW8A 4MUEA 3REQA 1RLMA 5AK5A 4O2AA 1JQJC 5H4GA 4OQFA 5AXCA 4CMHA 3FNIA 4G1UC 4I3GA 3I01M 4EG1A 4F11A 3MGAA 1RCFA 1XV5A 1XXHB 3I83A 5DLDA 5IAJA 4DXHA 3EW7A 4Q16A 3SXJA 2VDPB 1ABEA 1KPIA 4MCHA 3BILA 3CLHA 3HB5X 4UHEA 3K1AB 4DLRA 5IU6A 2QB5A 2IHBA 1FNCA 4LRYA 2AG6A 2DBVO 3ABQB 1V4VA 5ALWA 1D6JA 3EJWA 1NVVQ 3ILHA 5K6RA 4RVDA 3S29A 1R3DA 2BHRA 3GDWA 3K5IA 4RCVA 4UHJA 4BEVA 1FUYB 3DXYA 4D9FA 4B17A 3T0FA 5T4FA 4QFBA 2GBCA 2JZNA 1P1RA 4L9RA 5BV8A 1GA6A 1O4WA 2Y68A 2Q41A 5BR7A 2WFMA 1WZEA 2VH5R 4R54A 4QRHA 2ZLBA 4C4YA 3OFJA 3WK5A 3DP7A 2EQ5A 4TT3D 1KMCA 3EDYA 2A59A 1GVNB 3LNCA 1R4NB 2OLJA 4QWMA 4WI1A 5CM2Z 2I3AA 4KI7A 1EYZA 1NIJA 2QY6A 3ABOB 1WB5A 4JROA 1KH3A 4C43A 1PG0A 1KTIA 3KLPX 4KKVA 1V5IA 2H9YA 5EP4A 1KEKA 1U99A 1JV2B 4GX0A 3OPMA 4YO8A 4ZANA 4S24A 1L7PA 3ISVA 2B4YA 3VH4A 3D3EA 1UM9A 1DUIA 1NUHA 4C6HA 3M70A 1NOJA 1SHLA 2AL7A 4CKCB 3SX0A 1Y6GA 1FLVA 3L6RA 2AYXA 4KAJA 3U7RA 1MIOB 4IRUB 1WQ1R 3EVTA 3OURA 5ED0A 1M2EA 1OAOA 4UAVA 4C0LA 4Z0HO 5TE9A 2W8ZA 4OJYA 2J4DA 4EG5A 3ZGOA 2YQ5A 3A6HA 2VFAA 1QHXA 1PP4A 2ZB3A 4YCDA 3SS7X 4A5SA 4GR4A 2CXXA 4QUEA 3RS7A 1PGJA 5FWYA 4QUDA 1QB8A 3LPDA 2OG1A 1I4OA 1A71A 2RI1A 3GJ4A 3KJHA 1ESMA 1HZZC 2QX9A 4LJ4A 2ZYSA 5ENDA 4EDFA 1Q0UA 2GZ3A 3OLYA 1H05A 1C1HA 1XTPA 2DPXA 5UKDA 3UM9A 3T7IA 4C5CA 4PIPA 1VSUA 4UAUA 3ONWA 3ZHZA 1NIPA 2BGWA 1E94E 2J0EA 1BD3A 5K0LA 5CDSA 4RE5A 5KKCA 3WBKA 1G3UA 2RHHA 5ARBA 3AI7A 3BHIA 1ZUHA 5ILQA 5DWQA 1XYYA 4K87A 4DJ5X 2X8LA 4GWGA 4MROA 4TTRA 1DWQA 4NWIA 2JFBA 4RSMA 3WNQA 3FB1A 4M1ZA 1UBHS 4NBNA 1SOUA 5EE9A 3JASA 1S3GA 3L0ZA 1KDRA 4KIJA 1E4VA 1U3TA 1PJ2A 4B2IA 3VPGA 3LCUA 5LZ4A 5CVUA 4F3KA 2OCXA 2WWWA 4UNIA 2ZAOA 3CONA 5C7OO 1WXGA 2HKIA 4P32A 2IP1A 1SZDA 2W4IA 2ZRCA 3CX8A 3O8LA 2OG2A 3AJ8A 1R8SA 3P9QA 4HZIA 4B32A 3L8FA 3C6YA 5TJHA 1WTAA 2PSJA 3T3PB 1YHZA 2O0KA 2XQFA 3FPAA 3BL6A 3PRYA 3R7FA 3TW0A 3BERA 1POXA 4PYNA 1E3MA 2LIPA 1KKMA 2C1XA 3R7BA 3GUCA 3AP3A 1DJQA 4YP7A 3EH2A 4MSUA 2CN1A 4HDSB 4CIWA 3NUQA 3F4LA 2I8LA 4RY2A 1H2AS 4IG4A 1PWZA 1UC4B 2QNBA 3UH0A 1W4ZA 3HDTA 3ISTA 3KZVA 3RYCB 2DERA 4EAAA 5K0TA 1OBCA 2I7XA 4BVBA 1PL6A 3HEAA 3I37X 1UKYA 3FZEA 3KXIA 3HY6A 2BY4A 1YR3A 1J8QA 2C2OA 4UW9A 5TXGA 3ZDFA 2EFEB 1OFIA 5CK5A 3HJHA 1Z07A 2D7CA 4ZCIA 1V5WA 3L5KA 2RHMA 2Q6LA 4ARBA 1ZPDA 3ESAA 1ITZA 1I1QB 2I9PA 1DKQA 1SUWA 2C5BA 4R6WA 4NULA 4XYMA 4MRNA 4QECA 4JIGA 4NE7A 5J40A 2Z6VA 4RHEA 1IZZA 5BRNA 2DUUA 1W1IA 5AW1A 2I2AA 5BRJA 2FG5A 4RL4A 1SBNE 2XUDA 4JN6B 1BSVA 4N6GA 3L93A 5A7GA 2PFGA 3STVA 3KOWA 4B3BA 3RBZA 1WVMA 2OK7A 1NBME 3GEGA 3KXLA 2WJJA 3PNQA 2ZTUA 2DM6A 1G5TA 5C8YF 4C4PA 2YWFA 4ND8A 5A9RA 2EFDB 2O3RA 4JP1A 621PA 5AW6A 5A0TA 3KB2A 2QLBA 4F8YA 3P19A 2G63A 1E59A 1ZI6A 2JFOA 3EBLA 3H5IA 1Z7GA 4WKBA 1DPFA 2GEBA 4EG3A 3RFCA 2FLVA 5DK4A 4DW8A 2CL7X 1E2DA 3G7NA 3QMMA 5I45A 3QM1A 4PYMA 1KI1A 1YO6A 5GZ3A 1ECCA 1CRQA 3I9OA 1DARA 3C5WP 1EWTA 1J2EA 4ZTUB 5FTMA 2O8FB 1N1MA 2YWJA 1XDBA 2D2VA 1U0SY 1EK1A 4YMWA 1HYQA 5KHAA 2J31A 3B6IA 2IE0A 5KVCA 4KPUA 4HEJA 4BNMA 2OB2A 1K06A 2BT4A 4AY5A 1SBHA 4R3NA 2IHNA 4U3JB 4PZ9A 3EDRA 4UREA 3IBYA 1LPNA 3BJMA 4I8DA 3ACBA 1JHVA 3VJKA 2MYNA 2BBOA 1L8OA 1T5DX 2AQHA 2ROQA 3P4YA 5BSKA 5CBPA 3AVTA 2JFUA 3KJEA 4K46A 2C2ZA 2R68A 4F1KA 3AGPA 1DKOA 1XKQA 4BMVA 1I5EA 1SHTX 3EMKA 4D3DA 4N8EA 1SG0A 1FP1D 2PWAA 4EFLA 5IZ4A 1VXRA 4IXMA 3OHPA 3ZWNA 4E3WA 4DNFA 1Z2OX 2PWBA 2NP7A 4IJWA 4IINA 2ILVA 1N0VC 3O3NB 3C3CA 1QSGA 4J1QA 2W43A 3K5WA 3JV7A 4QU8A 2JFGA 4YIKA 3ND5A 3EWIA 2JHGA 1Y1RA 3T1TA 2O1WA 1NVUQ 3D3QA 3H42B 4L07A 2HIGA 2QJRA 1NV9A 3HVHA 3ZCVA 1SXJA 3QVWA 2HNAA 1ZKMA 1S01A 1Q1QA 1RI2A 4LYEA 2OXRA 5FOWA 3B9BA 2WKRA 4KXUA 1T2NA 3AKDA 3SR4A 4CKEA 4CTOA 1N8NA 1IJEA 1Z0FA 2Y67A 3NM6B 3LC1O 1UEIA 4X1IB 5HG0A 4F3YA 3S2EA 4NENA 2B3DA 4YJ2F 3UV7A 1RLIA 2IIPA 2XF2A 3HDHA 2JH9A 3K4QA 2DP4E 3QG1A 2A5YB 1E3LA 1BE0A 2E4UA 2HSZA 4W9RA 4ALMA 1C3OB 1W88A 2F4VB 3C1OA 5HIKA 4NOLA 4WBSA 3NUZA 2BTQA 4AJIA 3ABZA 2B78A 2BZ1A 1SMKA 3QRWA 1J9EA 1THTA 3CPEA 3IIIA 3KFLA 3PIIA 3K30A 4HQNA 4O2BA 4Q3BA 5AKLA 4IHAA 1ND6A 2PQ6A 4I6JA 2C3PA 2I71A 2ZU6A 3QU5A 3T5MA 2XB2A 2ERYA 2DFPA 1CSEE 4IL5A 1QHIA 2YOHA 3X1YA 2PL5A 1AUOA 2MR5A 2YNMD 2YV1A 4OG2A 2IFTA 4YAFA 5AW7A 3ONNA 4YUXA 5CU7A 4IHJF 4D4JA 1VJTA 2EW2A 1ESDA 2PLWA 4RGVA 4WPGA 5JG7A 2BFOA 2QU7A 4E32A 3T5AA 4YMTA 5DM70 3RKUA 1NP7A 2RAVA 2M1ZA 1T2UA 3BS4A 4UBIA 3I2KA 5J23A 1LFDB 2VPYA 1QDUA 4RGQA 4A10A 1A04A 5JQWA 1SA0A 2YXEA 4Y1EA 1QO9A 1EFTA 3FFBA 1KEZA 2F90A 3IUPA 4RK7A 4MZDA 2A9KA 1NT4A 4MWCA 2IF0A 3AV3A 1K6XA 3QPWA 1EFHA 5B6PA 4TRRA 1NQ5A 3FETA 1WDMA 4TL6A 4QHYA 4A5OA 1FIUA 1BGVA 3I23A 3RTEA 2LTAA 3ZD7A 1PTJC 3FCOA 1P4RA 2E4ZA 2D1QA 3DDCA 4B83A 1GAXA 5J3JA 3CM0A 4G5HA 2GM9A 4PANA 4E15A 4LHZA 5AVZA 1P3Y1 3F5MA 3GX1A 4TWAA 2O7QA 3VYSB 5L95A 3V9AA 4L16A 5FPSA 1GCAA 3I3SR 1FSPA 3BKWA 2BFCB 2CLOB 2XXAB 1V1JA 3CR3C 3N86A 1FRVA 1DG1G 2C9OA 2HF8A 4A73A 2YJ4A 4UXJA 4P92A 4ZCRA 2YRXA 2X2EA 4LECA 5EJGA 1MPXA 1HDIA 2WAMA 2WZCA 3HUTA 3KYCA 4BMPB 3CO5A 3GJXC 4CIXA 1QC5A 1WKVA 3PD1A 2H4ZA 4GGMX 4HGOA 4OA8A 4ZVQA 4W5JA 1NBAA 5KKAA 4CLRA 1TXGA 121PA 3WQHA 4TTVA 4TM8A 4HLCA 4YACA 1IN4A 1Q95A 5GONB 5BPHA 2MSEB 3I1YA 4TV9B 1HT2E 2Z5VA 1OWPA 4BDSA 2HAEA 2CXOA 3R5FA 4BNYA 1QZTA 3V4ZA 3ZHQA 2OQRA 4IYJA 3EBOA 4N7JA 4RIEA 1OLUB 3C1TA 5JCJA 1CJSA 3KOOA 3ZBUA 1WSBA 2Z4TA 3Q9NA 2OBXA 1GTSA 1OZ0A 3KV1A 2VHCA 2ON6A 2ZR8A 5KYYA 1UAAA 4UJ3A 4LXUA 1Y82A 3OZBA 4XWKA 3GVCA 1IH8A 3U44B 3HJFA 1PKEA 1PR4A 3E9QA 4YAEA 1TYEB 3IUSA 1KA9H 1KOJA 1P33A 2IP4A 1DC4A 2ZAIA 3DMTC 3G2HA 3OZVA 4L72A 2IX9A 2V97A 3CF6R 1GUBA 3OM9A 3DM9B 4OXNA 2DBRA 2E82A 3WXMA 3RI3A 4C4RA 4ENQA 4QRIA 3WJAA 4Z7OB 1C3JA 5KVQA 4G07A 4TZKA 5I3ZA 1T2DA 1X8JA 5BT9A 2F1OA 4OAPA 1ECPA 2C5HA 5EWMA 1RHMA 4Q4HA 1QGUB 3SYRA 2YHUA 4DDKA 3VVCA 5HGXA 1TZBA 4K03A 4CIDA 2R6HA 1JMYA 1ADJA 2GDZA 4U2KA 5K7SA 4HSEA 2O2EA 3JQRA 5AUOB 4C7OA 1M3SA 2BKLA 1E9DA 4X1KA 3E7XA 3M5CA 4MUJA 1ZD3A 2HK7A 5KU7A 2XDYA 5EJ8A 1REQA 4DR4B 1LTKA 4J29A 3OU6A 1Z74A 1HOXA 5JAIA 4HNQA 3EH1A 4F6LA 1YFJA 4RH0A 5AW9A 2WUEA 1GN8A 3I58A 3IKJA 1GRVA 1VYUA 2HU7A 2BMFA 1G64A 3QVMA 5IM5A 4DTIA 5ALZA 3QNWA 4HNAA 4U8HA 1JAZA 4YXWA 3SEQA 5T4HA 2CLDX 1ZUNA 2IH2A 4X6YA 1Z4KA 2IELA 3EWAA 2IEGA 3EK2A 3ZLUA 1PWYE 1U6KA 1GITA 1IIBA 1T9BA 3OG9A 2X9VA 2AW5A 5FL3A 4D9IA 3KELA 1TC2A 3RYFA 3GJ8A 2PLNA 4FFBB 1ZU4A 3SM9A 4Y1RA 4FW8A 4MUFA 1VA4A 2Q49A 4G5QA 1HEYA 1OX4A 2IHUA 2Z1MA 1TMGE 3O2JA 4RKRA 1N7GA 3OQHA 2QVZX 4BC0A 5B2FA 1KZ6A 1QFXA 2RGDA 2CEKA 4P34A 2BE9A 2VATA 3LBYA 3UOWA 4F5WA 5IC4A 3KQTA 1XB2A 4ZOLA 1ZJWA 1M34A 3FXAA 4IIGA 4D4KA 4DEXA 3MXTA 3PTZA 4ZHSA 1NL3A 4HG2A 4B3CA 2HPAA 1KEWA 3M81A 2IV2X 4UQLA 4NI5A 2OLEA 5J4LA 1BWPA 3RKSA 2RAUA 4RVOA 2KSQA 3KQKA 1J25A 1L4NA 3AWIA 3CKKA 4G41A 1QK4A 1E96A 1GNRA 5KNBH 4A0SA 4PLHA 1DXYA 1QPBA 1PLLA 1ZOIA 2O2CA 2IPOA 3DA8A 2HL6A 2JI4A 1VLJA 4M2LA 3ZXXA 3WRYC 3H8JA 5TQ0A 2F8TA 1AKYA 3UXYA 5HKAA 4O2BF 1MQSA 3V8VA 1C30A 1Z56C 2BL4A 4BO1A 3DO6A 1V8BA 1QPGA 3ZHVA 2UUBB 4HRYA 4J0QA 2HI0A 4RTKA 5JVDB 1GQQA 3ETDA 3CLUC 1ZHOA 2XNDA 3DFMA 1CQPA 1HE1C 3FMGA 2J6HA 3AP2A 3BE4A 2H3EA 4XDGA 2AOTB 4CU5A 3KFXA 4FFPA 4HTAA 2AFIA 2K87A 1NQAO 2VWQA 5ELXA 2WYWA 4H1VA 1YK1A 4DC9A 5I7VA 1BX1A 3UPDA 4ZVOA 2JB9A 2ORWA 3F46A 4WXEA 3LLVA 1M5TA 1TECE 2W93A 4GD3Q 4JQCA 4HAOA 2BF4A 1FFDA 4RD1A 4LRTB 3RJ5A 3V7WA 3QEMA 1OI7A 1WCXA 3WAKA 4JKOA 3GLUA 4DDVA 4JBIA 3K0KA 4YRMA 1DELA 1SQ5A 4HRAA 1C8VB 4H7HA 4X0EA 1KC3A 4HT3B 3VBEA 2O7NA 3VOSA 3SQDA 2WE8A 3SZGA 2XAUA 4K26A 1YE8A 3U9LA 1C3EA 3GGOA 1OLSB 4HUTA 5HZKA 1KJIA 2A86A 3OX4A 4TLEA 1AK9A 1ZL2A 3JAKA 4ONEA 3CG4A 2KX7A 2WSLA 4XB6B 1TADA 3QVTA 3U56A 2BEUB 3ZWBA 4CKXA 1U4SA 1X80A 2PGLA 4CM8A 2J9RA 1WW2A 1XVUA 1GG8A 1OOEA 1GDHA 2AI3A 4GNRA 2WKQA 1AKRA 4QWWA 5JJKA 4GLFA 3SN6A 3K8ZA 5LPNA 3O2QB 2GRJA 2Q9BA 1O94D 1L6IA 3KHKA 1Q5PA 3MCVA 3ADBA 3KPUA 4KHPB 4A0FA 5FFFA 1MO6A 1LKZA 1LZKA 3B9QA 4KEAA 5FNZA 3GV0A 4R1QA 1WB9A 2HBRA 2FGKA 4KQIA 5EJ7A 4QXPA 1LPPA 3WNDA 7ADHA 1HI9A 1JDNA 2G4CA 1FMCA 1OHHA 1SHUX 2VAPA 2HGSA 1MA3A 3E23A 2B8EA 3LYUA 5TT1A 1VM6A 5A1TA 1NXTA 2G07A 3O4JA 1T36A 3MGBA 1P5ZB 4K40A 2A9FA 3N87A 2I6XA 4W9MC 1DAKA 4PSKA 4QPJC 4F06A 1ZL0A 2FPUA 4A2WA 2OBLA 2LNDA 1I51A 3HK2A 2WB2A 1AY0A 3HKBA 3D6TB 2AGVA 4F84A 2AKYA 4A0HA 1BDJA 2J08A 3ZW9A 3GLGB 4LWZA 2HV9A 1N9ZA 3HU5A 1PT5A 1R8QA 1XQVA 2JG3A 2DPHA 2VQSA 1NNSA 3RUPA 4LEIA 1HYEA 3KETA 4B7XA 4ZVRA 3GJ5A 3KHUA 5C8XA 1HE2A 2B3TA 1PL8A 2ZSJA 3D3WA 4G0QA 4CMJA 4FOLA 4K9LA 5ICFA 4PZ0A 3FOWA 5C9ZA 2I65A 4HH4A 1ZNQO 2FMXA 2H0RA 2MSDB 2O7VA 5A3SA 4F60A 2FN8A 3OIFA 5FLKA 1Z6XA 1T3TA 3ND6A 3LSYA 1WS6A 1NUUA 3MNFA 5KJFA 3H0EA 3CURA 3UJ9A 1ADBA 2QLLA 1HYBA 4HDSA 4U2CA 2J3JA 4OBBA 4LYGA 4DMCA 3KSAC 5ALEA 5ES3A 2AKEA 3ZDAA 1QH8A 5HTKA 2ASVA 1CR1A 1XWWA 1I4EB 3I34X 2EL9A 4A92A 4R5HA 1FNBA 3A6EA 4FBGA 3OAAA 3UPTA 2QY9A 3INNA 5EYPA 3B2NA 4IOKA 1JDJA 2AEMA 2G6BA 5IAAA 5KOIA 1FCJA 2DH6A 4TN5A 4CPDA 1ORVA 4PXYA 2QL5A 3P5BA 1K6JA 3IAS1 4MOWA 1U9ZA 1C1XA 2PL9A 4L4UA 4DLUA 1BX0A 1K3UB 1H4TA 4QUAA 2V1XA 2XOEA 4BQOA 3GPDG 4FOSA 1HDCA 5AJXA 5HF6A 2JLUA 4Q37A 4CLDA 4B82A 4ID3A 2G40A 1ZO8A 3UG6A 4JLVA 2XE6A 1QM5A 3UO8B 4L9WA 4B7UA 4IUYA 3VPDA 1G8PA 1SZJG 1V2GA 1QHHA 4W7SA 4TV9F 2J8ZA 3MRVA 3G0CA 5AUPB 1MKYA 5FPPA 3M6FA 3AL2A 1MH1A 1EWKA 1M8GA 1M8PA 1FFBA 2GBPA 2UVQA 3NVAA 2FPOA 4LMAA 5DOZA 3WGHA 1X7YB 3BM5A 2ANCA 3U13A 4FEEA 1G20E 3NPMA 3VU9B 3DV0B 3R77A 4GMGA 1W36D 3NHZA 4DWVA 1W49A 3N0VA 5TS2A 2DPLA 4RTJA 4UVGA 2FUCA 4HQ0A 3WG9A 1ZITA 2OR3A 2WT8A 2ZTMA 3PFIA 3UT5B 1I7SB 3NW9A 3AF4A 2WNIA 2EW1A 1L5RA 5KYWB 1EE1A 2WJGA 3K4HA 4X8LA 3TUIC 5AXBA 2XY4A 2OOSA 2IOQA 3DOOA 3HFSA 1C4OA 4U7HA 2CXUA 2JD2A 1RQNA 1Z2DA 3AR2A 4LTDA 3GFVA 2JFNA 4HAXA 2Z5FA 3Q41A 3KQWA 4CMIA 5BQPA 3IBGA 2V58A 3ZYCA 1XZMA 3KSBC 2XGJA 2OESA 1H5NA 4JBYA 5KVSA 3NZEA 4W5OA 2XLCA 1HQKA 3F78A 2JGEA 4D9CA 5GZ1A 1TEZA 2A1IA 2PQ0A 2FMHA 2RHWA 3PFWO 4IMIB 3U1BA 3P9NA 3GGGA 4KVFA 1T3HA 3INYA 4YRSA 1GCUA 1OC2A 4QDXA 1TRHA 1YBAA 4DRYA 1PLKA 4HATA 3O73A 4KR0A 2XIQA 2B9VA 2BONA 1LC3A 2GBGA 1OZFA 2ZWVA 4IIFA 4MP6A 1WMFA 1GYPA 2V5VA 4MA5A 3PVSA 4UU8A 5H1YA 3RFXA 2EX4A 1X1EA 2Z1DA 4CLHA 4TYPA 3ZZNA 1SQGA 3MUNA 4U2EA 3RJZA 3TL2A 4UFPA 1S8FA 2GPWA 4E6PA 3H5VA 3B6ZA 3DYBA 2WF7A 4G8CA 4J76A 2IVZA 1P60A 3I30X 3VDXA 3L1JA 4A1OA 1P9LA 2VYVA 3FZYA 1UFVA 2XZTA 4PO8A 4RJIA 4XZ3A 4B6PA 1ZVMA 1KZ7B 2GYVA 3ESRA 2FEOA 2ORED 3V34A