1MV5A

Crystal structure of lmra atp-binding domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Multidrug resistance ABC transporter ATP-binding and permeas
publication title Crystal structure of LmrA ATP-binding domain reveals the two-site alternating mechanism at molecular level
rcsb
source organism Lactococcus lactis
total genus 63
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 7.6.2.2: ABC-type xenobiotic transporter.
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mv5A00
4ACBA 1NG9A 2J0UB 5DIFA 3GEEA 2J59A 4L15A 4IDQA 4EPWA 4HAVA 4YDHB 2GWHA 5FR1A 4ZV4A 1VECA 1VG1A 2KBFA 4Q9HA 2YVUA 2ZJ5A 4P4UA 4EPRA 4A15A 3KJHA 4Y0VA 3SZRA 3PXGA 2DY1A 2GCOA 2BKUA 2ODBA 4C4PA 4DCUA 3A4NA 4CEHB 2AD1A 5FUXA 3WY9A 3RDPA 2O8DA 2N46A 3QBTA 4C2TA 1LS6A 1GZSA 2QT0A 4PHHA 1K5DA 2ZRJA 4D4KA 1GTVA 5E7JA 4L5BA 4QHYA 3WBKA 4L8GA 4M22A 4WZAE 4MGKR 4MRNA 2P6UA 5LB2A 4AKEA 3DEFA 3GFPA 1TQ6A 2LCFA 2OLKA 1GNRA 4F91B 4PX9A 4N0EA 3ZLJA 4CEJB 3ZIAD 1XBTA 1ZC3A 3B6EA 3FMFA 2C9OA 2V4ZA 4B6FA 1SXJD 3TK1A 3CZQA 3UATA 3IDQA 4EPXA 1NIJA 3AVXA 1FP6A 5KTYA 2PBRA 3A1TA 3U7EB 4DCSA 1P60A 1M7GA 4KVGA 1FMLA 2DFKB 3T12A 3U3MA 1QRAA 3U4QB 4PSKA 4HDCA 1JPJA 4KSCA 2QI9C 1Z3IX 1PVOA 1FTNA 1ZCAA 4UXHA 3HU2A 3KJGA 1W46A 2C5LA 2ZITA 3KKPA 1KY2A 5FUYA 1VKJA 3N2EA 1VG9B 4Q1FA 4A0GA 2D3WA 1Q1BA 1S4QA 2XZLA 1HT1E 1OW3B 2GXAA 1SVMA 1G8PA 4H1UA 3WP1B 5KOYA 4WBSA 2ZUBA 3KXIA 4MYCA 4XD7A 4ZCMA 5L3QB 2EW1A 4BZXA 3RRMA 2N1BA 4UQOA 2F43A 2FSHA 5JHGB 2ZRNA 5CLLA 1FUUA 1HUQA 1U0JA 4R71A 1E2QA 4PTLA 1WRBA 4IEIA 2Z0MA 3U2QA 2V6IA 1RRFA 1B23P 2IT1A 5J4KA 1QHGA 2QZ4A 4ARZB 2XEXA 3W8NA 3GJ0A 1RJ9B 4DLSA 2ZR9A 3CM0A 3I73A 4KV9A 1LF0A 3K1JA 2FA9A 1XP8A 3RRYA 3RABA 3AVOA 4L16A 1EFCA 1G8HA 2QTFA 4JS0A 4NBSA 1KO5A 2IYSA 3BH7A 4P0TA 3QOFA 3GJXC 3RS2A 1Y3AA 1Z8FA 1NKSA 1PZNA 1HE8B 4DHEA 3VNUA 1NP6A 4DCVA 2CHGA 3SHWA 2OUKA 4QNMA 1SQ5A 3A37A 4NYIQ 2OBLA 4XSHA 1UM8A 1CR4A 4DDWA 3EC2A 1Q1EA 4F38A 4AKGA 2IYVA 3VTKA 3I1FA 3ADKA 3EASA 3CRQA 1TX4B 1XDBA 3OFND 1G5RA 3ONWA 3GD7A 1OXVA 4YLGA 2ZI3A 2GXSA 2G3YA 2H8KA 4OQNA 3WXMA 1SVIA 4LJ5A 4LK2A 1Q1ZA 2OBNA 2NTYC 3N70A 1XXHE 4PO1A 2H1LA 4FCWA 4W7SA 2NPFA 3LA6A 2XOKD 4PAMA 4WVFA 1DAMA 2F6RA 3PENA 1KO7A 2NO9A 3B9PA 4KAXA 4WA7A 4EIWA 5C46F 3ADCA 4GNKA 2GKSA 3QSYA 3QUSA 3T35A 2IWHA 1JQLB 2BEKA 5FH9A 4DSOA 4CF7A 1NL3A 3GJ6A 1MT0A 3LD9A 1UEIA 4XJXA 4MDEA 2XZOA 1KAGA 2QG6A 5KNDA 3L0PA 2HYDA 5BWMA 1E2JA 1W48A 4LHWA 3AP3A 2KE5A 4HDQB 5FTKA 1U8YA 1N6NA 1QHXA 3TSZA 3CPEA 2IW3A 3EXAA 4P4TA 2IC5A 4R9UC 1U81A 2O8EB 1K6MA 2O8FA 3FKSD 1Z5ZA 2BMEA 2XSZD 5D3MB 1OLOA 5EP1A 1XPRA 1Y63A 4BLPA 3G0HA 2QGNA 3TAHA 3GLIA 1A2BA 4LY6A 2WJVA 1Q1QA 1KOFA 2O0JA 2QRNA 4DLYA 4BFTA 4NE2A 2PL3A 1S8FA 4Q7MB 5C2JB 3B1XA 3CUEF 3S1AA 2ATVA 2GXQA 2WMOB 4JLOA 2R6GA 3TUZC 1EFUA 2ZE5A 1Z0JA 4AG6A 3FMIA 5HCNA 1SKQA 1BIFA 4TYQA 2C96A 5DHFA 3I4LA 4IHQA 2RB4A 4B44A 2PZGA 1AJEA 2AXPA 2XXAA 4PO8A 3CPJB 1XNJA 4TYNA 4Q9IA 4NH0A 4QGGA 3EC1A 2X8AA 3HPQA 1H65A 2DFNA 2GJ8A 3SI7A 2FGJA 4OJKA 3VAAA 1COWA 3BB4A 2FFHA 3G82C 4AWXA 4TMTA 4EFMA 3ZQ6A 1XEFA 5FOVA 1G19A 2YWHA 1S96A 3HR7A 2C9YA 4B3XA 3SYKA 4C0QC 4HB2A 4QHTA 2HLDD 3CBQA 1W44A 1ZJ6A 1XCGB 2WVJA 4GPTA 3RHFA 1X8LA 1ANKA 2GCNA 1AS3A 1WE2A 5EUQB 5JSZB 5IRCD 1U0HC 2XTZA 4R2HA 2R6FA 5CK4A 1W4RA 1OKKD 4R2IA 1ZUNB 1W4CA 3VKWA 4ZCIA 2CHQA 4HZUB 1E99A 5SZKB 4ACAA 4V0NA 1TUEA 1VCIA 3NH9A 1UKZA 1N0WA 221PA 2E87A 4B47A 1BMFD 1QHNA 4LGMA 4TYWA 2Q3FA 2W6JA 2ZE6A 3MG9A 4ZPXA 2AD5A 5FTJA 3UMRA 3N2IA 3QKSB 2VA8A 4G5RA 1JPNA 1N0VC 4KYUA 3T06B 3VMFA 3THYB 3GLFB 2EQBA 1G41A 1NBMD 5K8IA 1XZQA 4BLSA 5GJVC 1NMYA 1US8A 2H17A 2ZJ8A 4CVNA 3IUYA 4HUTA 1OB2A 3LVRE 4CYMA 3ND8A 1P9NA 1FFHA 4JL5A 2AFIE 2G0NA 2GTPA 3R20A 4IJMA 2MSDB 3GLHB 3BH6A 2R65A 1JEEA 3ASYA 3BFVA 5B57C 1LS1A 4Q1BA 2FFQA 2PT7A 3P1JA 4RJLA 1XPOA 2CMKA 3RANA 4UJ5A 3TUJC 2QSZA 4EPTA 3LH5A 3ZVLA 4QJ3A 1CF4A 2C78A 1E2FA 2I4IA 1OHHA 1XEXA 1NVVR 2UVQA 2H92A 3D8BA 4URYR 3QF4A 3ZH9B 4IKEA 5FBVB 4OQLA 1FUKA 4CRWB 5AJXA 2HF8A 4MKFA 2CJWB 4C9BA 4NYJQ 1IXZA 1MR3F 4FMBB 1CJUC 4XTCS 2B21A 2XX3A 2VTKA 1D9XA 1E2HA 2AWOA 2CLCX 1M34E 3JVUA 3K9LA 3SBDA 4JLDA 2NO6A 1BYIA 3BH0A 2QMOA 1I4LD 4V0LA 2GJAA 2YKGA 5ANRB 1UBFA 1XF9A 2ZRFA 5DO9A 2H16A 3KQNA 1KO4A 1JECA 2GK7A 2CL7X 4A6XA 1QDEA 1R0YA 3ZS8A 1UFQA 4M9ZA 3OEEA 3MD0A 4Q4JB 3B1VA 4US2R 4ZI2A 3BC1A 4LPSA 4Q9LA 5FI1B 2ANCA 2ERXA 3T61A 2W0SA 4ZDWA 3A8TA 2BM0A 4ZKEA 3TR5A 4ZCLA 3RS7A 1OPXA 1QHYA 5EE9A 3THOA 4A2WA 2OCAA 2IK8A 3RWMB 4M53A 1GFIA 2IYRA 2QEQA 1N5KA 2F3RA 3QPVA 4MA4A 1EESA 1RYHA 2GNOA 1P5ZB 4Z8XA 3MJRA 4D4JA 1IJFA 2PMKA 4GDFA 2BMFA 2NPIA 2WWHA 2F55A 1LY1A 5JWOA 1FQJA 5CIWA 5HCIA 5J5CA 2VP9A 4LRWA 1VYUA 1F2TB 1F2UA 3K0AB 3ZQJA 3GLGA 2PZEA 1NJGA 1ZUHA 2ZPTX 3SOPA 5KPJA 1II8B 5FOSA 1HE1C 5A5GA 4PFSA 1TF7A 4C0HA 2I1QA 4C2UA 4C30A 3BFXA 2GJSA 3OE7D 3IHLA 3WYFA 4TLDA 2ZEJA 2ZS7A 1G7TA 3ZYCA 4FCTA 3RLFA 1NI3A 5KDLA 2WV9A 1RRGA 2IXFA 2P6NA 4BFUA 1ZD8A 4JKYA 2AL7A 3UK6A 3U3RA 3BOSA 4HI0E 1OFTA 4RKFA 4JLPA 3NDPA 4HZIA 1YE8A 4K81B 4DUGA 4OJQA 2HEIA 3FTQA 1D5CA 4TLCA 2PJZA 1IAQA 5DYIA 3B5JA 4NP6A 4OQXA 3KB2A 3W3AA 4JBYA 1EFRA 5JWHA 3BFKA 2OFWA 3SYNA 4NTZA 3X2SA 1FNMA 3AP2A 3SFVA 1TNDA 2JAQA 4LV8B 2FGKA 4WXRA 3UKDA 1OT3A 3K53A 3B1ZA 4KLNA 4PZLA 2NO7A 4RFSA 4FINA 4Q1EA 2R62A 1TEVA 2F1JA 2GCOB 4A92A 3EARA 3CONA 5EJEA 1A7JA 4HAWA 2ZSFA 2O8DB 4A36A 5K8UA 5EZ6B 1EG7A 2QPAA 3TIFA 2CNWD 2ZU6A 4PAQA 3GEIA 4LYJA 1KK2A 3T1QA 5TXGA 3V9PA 5JRJA 4DDVA 2FOLA 2BM1A 2P5SA 1NN1A 3WMGA 5LDDC 4MH0R 4QFMA 4RZXA 1L4UA 2QSYA 4XVQA 3E1SA 3K0EA 4M2LA 1E1QA 3FMOB 1CR0A 4B33A 5J4HA 4RD1A 3T1OA 1KKLA 1KDOA 4EPVA 1QHHB 8OHMA 4UNNA 2XNDD 3BERA 3TQCA 5IF9A 1XXHA 2WWFA 4B76A 4FXPA 1X86B 2K5UA 1MOZA 3MFYA 3SYLA 2W2XA 1S9DA 5TB5A 4W5HA 2VBCA 2JJ1A 2NMVA 5AK0A 3DPUA 1DADA 3R7WA 1Z6GA 4CEIB 2NGRA 1RVDA 2LWIA 3DO6A 1VIAA 5KYKA 3QXCA 4LBVA 3W3ZB 2OM2A 4NCHA 1KMHB 3MCAA 3SS8A 2BBOA 4KJZA 3X1XA 4QGAA 2GJKA 2VP6A 4NKRA 4AG5A 2Y8EA 4ZO4A 2O8BA 1R5NA 4WZ6A 3TQFA 4URVR 3UG6A 3CRRA 4XSGA 2FE4A 4MQBA 1YZGA 2GBLC 1CXZA 4PPQA 4TQ9A 3PITA 1CR2A 1D2MA 4Q4LA 2CE2X 2FPMA 5FBWB 2OAP1 4B2PA 2OLJA 1E0AA 1TL7C 3M1IA 2PJRA 1NSTA 1ZP6A 2PMDA 4GFDA 1DE0A 1MV5A 4G5GA 5CM9C 3IIMA 1N5IA 2JJ2D 5GJBA 2WICA 1E4VA 3NVAA 2ZYVX 2J41A 5DI9A 1GKUB 1U98A 1P2VA 1YRAA 3DMDA 3OHMA 3TW8B 3AF0A 5L3SA 4DSNA 4KBGA 5B64A 4DJTA 3LRPA 2D2FA 3DDCA 4I81A 5E7MA 5KSZA 3CNOA 1E2MA 1G17A 3F0TA 1E0SA 2HV8A 2VLIA 5ELXA 1D2EA 2QMEA 1XCPA 2FN4A 1UBCA 2ANBA 3EAQA 3L0IB 4EQ6A 3VHXA 4D82A 3CF0A 1ZCBA 5J4VA 3BJIC 2FFBA 1GILA 2FMXA 1YZKA 1LVGA 1YZUA 2QN6A 1JB1A 4L9WA 4IOLA 4AYTA 3EZ6A 2A5GA 3U7GA 1RRCA 1E1RA 3C16C 3ND9A 4TL6A 121PA 1PUIA 1H8ED 3NC1C 4MKGA 4TYPA 4ZIRA 1OIXA 2GVZC 2FZLA 1E9SA 2QAJA 3K9GA 5AJZA 1G18A 2PCJA 2CVFA 3SE0A 1ZYUA 2D7CA 3MGCA 3FFAA 2WOJA 3UMSA 3AGQA 4Q4AB 2F7SA 3L2OB 3VNVA 3P4YA 4ZDIA 4X8LA 4Q1AA 4V0OA 2ZRMA 2WZQA 1IQPA 1G21E 4WZBE 4MGIR 1NN5A 3OZXA 2C95A 1E0JA 4M0LA 1E69A 4HATA 1UKVY 4LC1A 1QF9A 2VHJA 5TDHA 5TARA 1KHTA 5JCPA 3OIWA 4QOSA 2EWVA 5FR2A 4IDNA 3EZFA 4G5SA 4DT1A 3MWLA 1X8JA 3RS3A 3RWOA 4AKHA 4TMZA 4PQRA 3AB3A 3TSOA 3S1AB 2EU8A 1MO4A 1HY3A 2IYYA 3VU9B 4PQFA 2V1XA 2O52A 3I8XA 3DHWC 1JR3E 1RKBA 3DL0A 1XTSA 2EFDB 4NYMQ 5KSPA 2XXAB 1N6HA 1Z0KA 2DFLA 4EUNA 4US0R 2QTVB 4MUBA 3C5CA 4Y0AA 3D7MA 2ZJAA 1DPFA 1WF3A 5BYJA 3JZMA 1G3UA 4KFSA 1XD2B 5FBRB 2OEPA 3K09A 3Q85A 4LYHA 4MYUA 2XGJA 4B73A 1N5JA 1IM2A 4NONA 4BLOA 4BFXA 2AKYA 3U7HB 3TVDA 1EX7A 4DCNA 3WHKA 1R8QA 2CCGA 2ONJA 1SVLA 3ZZ0A 621PA 4NU0A 1G3QA 1VCMA 3MWJA 4QNRA 1T0HB 4F4CA 4TYYA 1TAGA 3W5JA 5JRZA 1YR9A 3HP1A 4HAUA 5B30A 4UNSA 1J7KA 4XVRA 5H70A 3EW9A 1CBUA 4RZ3A 1W49A 4ON9A 5B58C 3ZGXA 3EG5A 2IYWA 1E9CA 1OXUA 2WJJA 4LJ9A 4RCYA 3SJZA 3C41J 2OCBA 5FPYA 5EXSA 1P2TA 2QPOA 3LBHA 1D6JA 1EXMA 2VP5A 4M1WA 3KTAB 4LWZA 3A1UA 4OHXA 5E3HA 1Z6AA 1CU1A 2GEUA 1NRJB 2MSEB 4QBHA 1D8TA 3LNCA 5EXXA 1IJEA 4P4SA 2BHRA 2HT1A 2GAAA 2X2FA 1US8B 4YMUA 3FOZA 4AK9A 4Z1MD 2IS1A 2Z4RA 1NSFA 2PX0A 3I8SA 1SKYE 4M4SA 4C3ZA 2GDJA 1DAGA 3D3QA 5L3RA 4BFVA 3V4FA 2DHRA 4KVAA 2WM9B 2V7QA 3BD9A 4BFYA 4YMVA 3R9XA 4GOKA 4WIAA 4GZMA 2PCLA 3NDBB 3F5FA 3RVBA 4D4LA 2IS4A 1H8HA 3AGPA 3QEJA 3T1TA 3B82A 4L9SA 4B3BA 1FPMA 1ZUIA 3RC3A 2GEDA 4KLZA 4E5UA 2VSFA 1F6BA 4FMDB 1KDRA 2HJGA 5CIQA 1XJQA 4HAZA 2ZUCA 3IO3A 1JAHA 2HCBA 3KB1A 4B71A 1XMVA 4TZ0A 1KMQA 2JIZA 3GQBA 1DG3A 1EWRA 2B92A 4QBGB 1XTRA 4LV5B 2QBYB 4LJYA 2N42A 2DWOA 3CX7A 1KI8A 5B2ZA 2Q6TA 1CJKC 4GP7A 3EPHA 4ZKDA 3QI2A 2ZRDA 4MDFA 2JATA 4Z54A 1A4RA 2ZETA 1X3SA 1RIFA 1HV8A 4JT2A 1YKSA 4OI2A 2JEOA 3QNUA 1E96A 1OB5A 2WAYA 2GF0A 4WOPA 2QNRA 1RZ3A 5EP2A 2ORVA 3EPLA 3SJAA 4IRUB 2JDID 1GM5A 3GLGE 4M1SA 2Q9CA 2EFEB 2VRWA 2ZI4A 3J81k 1TF5A 4E09A 1FZQA 1O87A 4Q18A 2W6JD 1T4GA 2YWEA 2FNAA 4YONB 1OXXK 4YMWA 1VCNA 2ECKA 2FSIA 3WNCA 4GRAA 3SJCA 3IBYA 1GL7A 4C0KA 5LD2B 5BW8A 1O3YA 2F1RA 3BBPA 4HLDA 2J7KA 4PC3A 3DMNA 1KO1A 3CPHA 3KJIA 3AEZA 2R6DA 1G8FA 1MO3A 1UDXA 3I3SR 5FL3A 4OI1A 3W8RA 2ZJOA 3ICEA 3AVVA 1AS0A 4JVSB 2QE7A 4LJ4A 2EFGA 4PHFA 4ERNA 1P75A 2GA8A 4GT1A 4ZDKA 4NDZA 2CXXA 4FCVA 3QKUA 2J9RA 3O8BA 3WHLA 2GXUA 1GITA 3KL4A 2IS2A 5K8LA 3C5HA 4LX0A 5FUWA 1DELA 1L8QA 1DOAA 2P3SA 4RD2A 1M2OB 4PC1A 1W2GA 4A8JB 1TQDA 1P7CA 4I1OA 1S1MA 1UBGA 1G291 3SHFA 3PEYA 3KX2A 3PUVA 4FMDF 4MKHA 4LBWA 4TLAA 2XAUA 3AV0B 1GRNA 4DC9A 1G16A 5JS8A 1DAFA 5CM8B 3AP1A 3IKJA 1GL9B 4JVNA 3WNDA 5JHHB 2RGGA 3P20A 3Q3JB 4V0KA 3PEWA 1G4AE 1M1YE 2ZRPA 3H4MA 5AJVB 2W6IA 1MABA 3VR4A 1FNNA 2XJ4A 5GVRA 1S2MA 3DM5A 3P26A 3QQ5A 4N0DA 5E4FA 2PLFA 5HKKA 1W36C 1E9BA 4IDPA 4C0SA 3OEED 1VYTA 1XMSA 5FOUA 1NVUQ 3NHAA 1XU4A 2IUTA 1WB9A 3MAAC 4JLMA 4B34A 1SHKA 3NHBA 2WMNB 4PXAA 4TQUS 5BYKA 3QBVA 2A78A 1RRPA 2W2TA 2ZSEA 3Q7PA 4PSVA 4M1TA 3SBEA 4PHGA 2ZRLA 1JEDA 3K0SA 3RS4A 2IL1A 2EFCB 4Q4HA 1T8TA 5SZHB 5LBIA 3KUDA 3CWZA 2QMUA 3TR0A 2VP0A 1Z0FA 1IN5A 1S0UA 4ASUD 4BFSA 1W0KA 2QAGA 4CDGA 1DAKA 2BCGY 5DISB 4MRVA 1T9HA 3RRNA 1NLYA 4PQYA 2OXRA 2RH5A 2IXEA 2NZJA 4KFRA 4YXWD 1NMXA 3RSLA 2A5FA 4V03A 2Z43A 1II9A 1DAHA 3NBZC 2AN9A 1IY2A 1JI0A 2ZSAA 2C04A 3ADBA 4UNPA 4DCTA 2WTUA 2VIIA 5F3WB 5FL7D 3NC0C 5FTNA 4NMMA 2HYIC 4F93B 1E2PA 3ZS9A 1CJTC 5IK2D 1KZGB 1PJRA 2HCJB 3DOEA 3IEVA 3R9WA 1E2GA 3IQXA 4I4LA 4E03A 4UXJA 1YZNA 1OE0A 1ZMXA 1VHLA 2REXB 4I1VA 1FX0A 3K09C 4KODA 4TTPA 1LF5A 4FWTA 4NYJR 1ZM2A 1X1SA 5JFGA 4DB4A 3T1VA 1Z0IA 1KIMA 1G3IA 3NEYA 4X8OA 2CLDX 2BBWA 3AVWA 2RHDA 1HA3A 2GBLA 5HZKA 2RGEA 4WAUA 4AYXA 2WSSA 1RFLA 4Q7LA 4JLNA 4P31A 5DN6D 4O25A 4XTRA 1JR3A 4B48A 5M04A 2DFTA 3A58B 4DRZA 2XJ9A 1M74A 1VTKA 3A36A 1VDZA 5JI2E 1HURA 2IUUA 1JBKA 2ZJ2A 3KJEA 3FE2A 2H57A 4CIDA 4EQ6B 2FSFA 1NF3A 3CRW1 3W5IA 5KU1A 4PAOA 4B3FX 2O0HA 2V8OA 1M6NA 2ZRHA 1HH4A 1Z06A 1XTKA 4ITRC 4HLQB 2FSGA 3VR2A 2VSOA 3NBFA 4TLBA 1W4AA 2ZI7A 5TV2A 2ZAOA 3EPKA 2BV3A 2PEZA 1N25A 5CITA 1G64A 1NY6A 3GEHA 4QBFA 4AURA 1Z6TA 3ZIAA 5P21A 3B2EA 3K0CA 1OF1A 4OHYA 1HQYE 4OK5A 3FHTA 3K0FB 1ODFA 2A3RA 3BRWD 4N1AA 4OQMA 4QBIA 4W5WA 4AIIA 2ZQ5A 4C7OA 4O0MA 1UEJA 4O3MA 3KUCA 4M1MA 2ODEA 2FF7A 3AF1A 3VX3A 3QKRA 3EIHA 3CKLA 1YQTA 5JWRA 4HAYA 3ZDQA 2G83A 2P5TB 3EIEA 1UKYA 4M9QA 3O8RA 1AKEA 1KI6A 3ZVRA 4EJSA 2E1RA 2XB4A 4US1R 3UIEA 1R5BA 3B60A 1ZNZA 2JLYA 4DKXA 1QZXA 1XJCA 1KYIA 2V6JA 4AYWA 5CB6A 1WCV1 3U44B 2NQ2C 3VKHA 2CCKA 1PLKA 3CR8A 3NEJA 4L4UA 2RAPA 1UAAA 3KQHA 4B3CA 1R4AA 3H84A 1PV4A 1XD8A 5KDDA 2C2HA 1ZNYA 1E2NA 2P2LA 1M8PA 2J0UA 4MUAA 1WP9A 2J7PD 3BS4A 4KCGA 5JJIA 2DBYA 2XITA 1M7BA 2RGAA 1TQ2A 4BASA 2B7BA 3TMKA 5EXTA 2RGDA 4PZYA 2GZHA 2AKAB 1XCMA 1Q20A 1QG2A 3FDIA 3QE0A 4KO8A 1XMIA 3KZ1E 4BEJA 4CEHA 4YDSA 3GJ4A 2E9SA 2YWGA 4TTRA 2WJHA 4WXPA 4TL7A 5JECA 1E1RD 4DSUA 1XFAA 4V0ME 2A5DA 4TT3D 3WMEA 4GI7A 2D74A 4P3YA 2IHYA 3DVLA 1N6PA 3GJ7A 4JYCA 4QKQA 4BFWA 3BORA 1G8GA 2ZAMA 2B8WA 2MMGA 4ZI3A 1MRSA 1G7SA 1UF9A 3ZVNA 3OFNA 3D31A 1OJLA 3UMFA 1Z07A 4TSFD 1ZM9A 4B2LA 1DVRA 721PA 3OEHD 1KJZA 2A7QA 4AY2A 2X77A 3PFIA 1TU3A 1N2CE 3HJNA 3U4QA 2XOKA 5JBQA 2JLVA 3EPJA 2BIFA 4BLRA 4BRWA 4IOJA 3ZJYA 4FW9A 4CW7A 3CO5A 3HU3A 4MYHA 4JLAA 1IONA 2YOHA 1MO5A 4CZ2A 1OH6A 3QG1A 3QPWA 5JZVA 5GJCA 2O8CA 3BXZA 5TMPA 1AZSC 2KB0A 4FI3C 2OESA 4PSAA 2VHTA 2QA5A 1EK0A 2I3BA 3VX4A 4LBZA 1VG8A 4DWJA 3E2IA 3AVQA 2Q9BA 3BAFA 2A30A 4RFVA 1FQKA 1I2DA 1RE0A 4LUCA 4KSBA 3FKSA 3PEUA 1R0XA 2QRZA 4PHTA 3WRYC 3X1ZA 5HPYB 3K70C 3OAAD 3W34A 1CULC 3CX6A 1X8KA 4ARZA 1KZ7B 2BEJA 3KXLA 4LPKA 4DDTA 1RJ9A 5AWFC 2GVDC 4E22A 1NJFA 2FFAA 3B13B 1DEKA 1W47A 2IA5A 1XTIA 4KU4A 5TVKA 1CEEA 1QBKC 3DZ8A 1E2EA 1FW6A 2CLSA 1FMJA 1IBRA 1NVVQ 2WWIA 2VL7A 1TPZA 1S9HA 1KO8A 4BWYA 4MRRA 2RGNA 1CKEA 1ZNXA 3U7FB 2AK2A 5FOTA 2FEOA 1NY5A 1Z28A 2IYQA 2QAGC 3QY0A 4A0RA 2YWFA 1U9IA 1Z47A 2ZTSA 1TU4A 2HLDA 2BJVA 1NNEA 2IS6A 1GL6A 2VHCA 3AF2A 1MKYA 2KJQA 5HTKA 4D4MA 1IY0A 3EIQA 1YR6A 4XWKA 5FI0B 1AZTA 2ZYTX 1E9RA 2GETA 4RVCA 3LV8A 4DLRA 6Q21A 1ZAKA 2VSXA 1OKKA 1T3SA 1SVOA 4DZZA 3W6OA 4FD2A 2A5YB 2IYLD 2UZ3A 2W0MA 5CDFE 3PJRA 4D80A 4F92B 3V00A 2AXNA 2ZREA 3IEUA 3EZ9A 2ZANA 1JQJC 1AK2A 2HXSA 1CP2A 1NIPA 3GFOA 3PEVA 3NH6A 4UKDA 2BMDA 5AUNB 2J0SA 3BB3A 2X1VA 2YZ2A 1NBMA 2KI5A 3ETLA 4PC6A 2RGCA 1HEIA 1KI4A 2F43B 2WHXA 2ZSBA 3CZPA 4IEEA 4GL2A 2J0QA 4PR0A 1UKEA 5DI3A 4PPNA 3RS5A 1FTSA 4DXAA 1GG2A 4EFNA 1T6NA 1Z2CA 1KDPA 1CRQA 4IFBA 1ELOA 2R6AA 2O8EA 3R8CA 1FOEB 2Q9AA 3M0EA 2RKOA 4LBYA 2C8VA 2HT6A 4XWOA 1MO6A 2GILA 2B6HA 3IO5A 4JLKA 3SC3A 1VIYA 1E79A 1LV7A 3QXXA 4TTQA 3RSOA 3SU8A 1P72A 5BN5A 2J45A 4B6EA 4A0HA 2IUSA 4ZDJA 2QY9A 1ZM7A 1KDTA 3I61A 2JGNA 1IN4A 1E2LA 2J46A 3A4MA 5C4GB 2RMKA 2WPDA 1SVWA 5HR5A 1W5SA 2IF2A 1F5NA 5L3VA 5BXQC 4URUR 5EP4A 4B74A 3CIOA 2EFHB 3K8YA 2AHOA 5G3YA 3NXSA 3VR5A 2OBMA 3L8ZA 4DVGA 4ABYA 2JLXA 3BIFA 1BH2A 1GIAA 1D9ZA 3MWKA 3W9YA 3K0CC 2YOFA 4FMCB 3EZ7A 1YRBA 3NWJA 2ZS9A 4JBXA 5F2EA 4KITB 1XD9A 4URWR 2QP3A 5DGXA 3DOFA 5EE3A 2G88A 2XB2A 2VHQA 2JLWA 1U8ZA 1ESMA 2ZRCA 5JSZA 4A4DA 2BJWA 2EYQA 2QMHA 1JXOA 1WDTA 4PPGA 4XVUA 2OCYC 4GBMA 1I4TD 2PX3A 2WIBA 4HB0A 4HZUA 4NCKA 1YHNA 3U3KA 4EJSC 1GKIA 1GDDA 3ZZTA 1BOFA 3L0OA 3ZD6A 2ZVQX 2ZRBA 2AR7A 5C1BA 2YHSA 3QKSA 3CLVA 4XD7D 2WWYA 4H9GA 1X6VA 2O8FB 1EX6A 3VFDA 3AKCA 3ASZA 4F4JA 2PZFA 4TMVA 2JLZA 3GLIB 3OESA 5F98A 1W2HA 2QM8A 3OIYA 3SQWA 2IHBA 1JJ7A 3OE7A 2GJ9A 1KSHA 1E6CA 4Q7JB 1RYFA 1ZM3A 1P9WA 3CH4B 1W1WA 3L0SA 4G3XA 1P9RA 3A4LA 2JA1A 4UJ3A 5DH9A 1KY3A 3D6TB 3PCRB 2ZI5A 4JT4A 3W6PA 5EXPA 4GOJA 2CK3A 4NCJA 1OV4A 2V9PA 4NCIA 1GWNA 4Q48A 1ONBA 3AKYA 4O2LA 3M6AA 1IOZA 1C9KA 1J70A 5HZHA 4D0GA 3BB1A 5C4MA 2ZJBA 4LOAA 2JCSA 2ODNA 3RRZA 2V1UA 4LHYA 3O8CA 2DPXA 2X19A 2Z5FA 2IBMA 2RGXA 4J0QA 4IFEA 1ZD9A 3A6PC 3ICQB 2PEYA 1EFTA 1Q3HA 1GUAA 1FP7A 4M9SA 4PO9A 2QROA 5FPHA 4A9AA 4PANA 2GESA 2ZUDA 1R2QA 4DDUA 2BOVA 2NIPA 4E07A 2ZYWX 3PIRA 4FMCF 4EPYA 1YU9A 2CNWA 1ZU5A 1UBEA 2NO0A 1SXJE 1MH1A 4Q4JA 1J8MF 3LDAA 1G6OA 1Q44A 1U8AA 4TL9A 2YYZA 3AM1A 4V0MA 4Q00A 1KI7A 3KDSE 1LFDB 2IYZA 4LSGA 5DYGA 5HE9A 2G1KA 1YZQA 2IEYA 3SN6A 3WBJA 2A2ZA 3V4RA 1ZIOA 1Q22A 2D4HA 4DLUA 2WWGA 4NCNA 4HLCA 4YC7A 2BBTA 3LWNA 1BYUA 1TQ4A 4V02A 1R5OA 1PLLA 1E2DA 1P2SA 4MRPA 3QEOA 4TMWA 3CX8A 1CJVC 1F2TA 3K0AA 3UG7A 4DLTA 3A1WA 1KI9A 3Q5EA 3L8YA 1G4UR 2KBEA 3AF3A 1II8A 3LW7A 4W5JA 5DE3A 4IW3B 4IVRA 4Q9KA 5JJKA 1DBSA 4RD0A 3CF6R 1TTTA 4QG7A 4ESVA 2FH5B 3EWAA 4I1SA 1SKYB 1WA5A 2Q3HA 4HB3A 1V5WA 2W83A 1GVNB 1Z6YA 1XEXB 1K5GA 4GP6A 2OG2A 2LKCA 4RZ2A 3QF4B 4HYYA 3SEAA 2NOAA 1A2KC 3E70C 2RGNC 1HT2E 3GFTA 2ZRKA 5KHOC 2W58A 1JR6A 3QIAA 1NVXQ 1P73A 1G5TA 3H86A 4NYIR 1KTVA 3PUZA 3RS0A 5E95A 4OHZA 1COWD 2VPPA 3HR8A 4KBFA 3QENA 3UWKA 1OXTA 2WSSD 1U9IC 1E4YA 1N6IA 2F9LA 1ZRHA 3QG5A 2JJ2A 4U7DA 1JR3D 3KKMA 3I5XA 2C77A 1E9FA 2D62A 5F9FA 3FKQA 2FPKA 2QL6A 1ZBDA 3HYRA 4TN1A 2D7DA 5IHPA 3UPUA 1G6HA 1R7RA 3FFBA 2BBSA 4Q21A 2ATXA 1Z0DA 4B32A 3U60B 1E98A 5AR1A 1BKDR 3QVUA 2YC4C 3FYHA 1ZIPA 1XWIA 1HQCA 1G9XA 4NPHA 4P33A 2ZRAA 3Q5DA 3AKEA 4JKIA 3LXXA 1NLFA 2ZJYA 4QGHA 1AA9A 4PC2A 2YJTD 2J3EA 2VP2A 2ZVPX 1P2UA 4Z51A 1H8EA 3N5CA 4HLUA 2OT3B 2VQSA 3KKNA 4LHZA 1Q0UA 1F2UB 3FPAA 4MITA 1GNPA 2WJIA 3GLGB 1QHHA 521PA 1XZPA 1OH7A 1A82A 1E9EA 1T5IA 5GADl 5L8VA 1DO2A 3THXA 4C0AC 5KNBA 1HTWA 5CDFA 2XZPA 4JSTA 3AUXA 1KNXA 4CEIA 5SZIA 4F7WA 3AF4A 4TMKA 2O8CB 3Q72A 4S2EA 3ZZUA 1F48A 3W6NA 4TL8A 5K8TA 2BDTA 1KMHA 4DBLC 2IYTA 3FWYA 4LHXA 2VYFA 3RNLA 1OHHD 1X1RA 3DM9B 4HEJA 3CW2A 2XTMA 3RC8A 2GCPA 4IXNA 5KSYA 1GRRA 5BQ5A 1NN0A 2A5JA 2AWNA 1WMSA 4DEYA 3I72A 3LX5A 3T5DA 2LKDA 4BECA 3TSWA 5JCZA 1N6OA 3I92A 4QXAA 1JXMA 4AKIA 1ZW6A 1E3MA 2FZ4A 2WOOA 4OKSA 5EQTA 1AS2A 3T34A 1KK0A 4OI0A 4RFSB 5EUMA 4KFUA 2C03A 4B2IA 1AIPA 1NMZA 3C15C 2C9CA 3QPUA 1CS4C 4OQFA 2BCJQ 3L43A 5GJWC 2P67A 3HU1A 1T3HA 2CCJA 2IYUA 5H68A 1JNYA 1JALA 3DKVA 2H7VA 3NBXX 4N3NA 3TAUA 4QHSA 3T15A 1UDWA 3I62A 3C7KA 1G20E 3W90A 2CBZA 2G1JA 4KYIB 4QL3A 5FTLA 4WW0A 2F9MA 2CVHA 1XTJA 4JIMA 2HJVA 1P61B 3I5YA 2OZEA 1XXHB 1C1YA 5J4LA 2G6BA 1E2IA 1T5LA 3QVVA 3EWSA 4EAQA 1U2RA 1L2TA 1L4YA 1P4SA 4MGYR 1NBME 3R7WB 3BK7A 4A6PA 5FUVA 4BUJA 2DWQA 4XWAA 4Q4AA 3RYTC 4RZUA 2EYUA 2WKQA 1N6LA 3LO5A 4BEBA 1EGAA 3O8DA 2REBA 3U5ZB 1W0JA 1P62B 4A2QA 3NKVA 5JMTA 2O8BB 1TADA 2OHFA 3EA0A 3FMPB 4Z1MA 3TBKA 3IPYA 5DI3B 5FOXA 3VHLB 4POAA 1QVRA 1T0JB 3DZDA 1LW7A 1LNZA 1Z08A 2D2EA 1XRJA 4MGZR 4DUGD 2HXYA 3AKDA 4IOMA 4JJZA 4BE7B 3FVQA 4BZPA 2R6CA 4AC9A 1EFRD 3GCGA 1G8YA 3ZVMA 2IXGA 2ZJZA 4GZLA 4Q02A 4HSEA 4DLWA 4QJ4A 1Q12A 5EZ5A 5L3SB 4HUQA 2YV5A 2ZU0C 3KXKA 5KUTA 1GSIA 3VR3A 3CB4A 4K46A 3VU9A 3NTUA 4JBWA 5G40A 2O5VA 3PG5A 1R0ZA 3GMTA 5FFMA 4C0BA 4JLJA 3BGWA 4X8HA 1QG4A 1S3SA 1TUIA 2BWJA 1S3GA 3MJHA 2FEMA 1K8RA 2G0TA 4S35A 1OIVA 1GKYA 2ZYUX 3P4XA 4H1VA 1RPZA 3IQWA 1XD2A 2EVWX 3U3JA 2RGBA 3MMPA 3ZD7A 1G3RA 1UJ2A 3IBGA 4FWIB 3LY5A 1GP2A 1E1QD 4C0JA 2KSQA 3AUYA 4IDOA 1T8UA 4O2RA 2PH1A 2FJUA 2VHUA 3HYTA 4ZIRB 2DB3A 3U6KA 1VCOA 5EP3A 4M1YA 4Q19A 1GNQA 1Z0AA 2R2AA 3KFXA 3THWA 1PUJA 1CIPA 2V54A 2OSBA 1SXJA 1J2JA 1W36B 2J1LA 5CB8A 4QJ5A 2JJ1D 2J0VA 3GLFE 4Q03A 4R7ZA 2JDIA 1CJMA 4TLEA 4U5XA 3TJZA 1U0LA 5G3ZA 5LB4A 3LFUA 4B75A 3GP8A 3I32A 3Q7QA 1N0UA 2RCNA 3LX8A 4YQFA 1T3LA 3KTAA 5BN3A 3TGPA 4X8MA 1GOTA 1OIWA 5DLQC 5A4JA 3B7GA 1IY1A 4DIDA 3GLHE 4A2PA 4M1OA 1WBDA 1JJVA 1XX6A 3O47A 2ZXUA 1Q57A 2OAQ1 5FPTA 3WYGA 2GZAA 4A1FA 2FDCA 4M21A 1OYYA 2IWRA 1KJWA 4DT1B 1P3JA 5H8WA 1QHIA 2GK6A 1W4BA 1KK1A 2WSMA 2Z4SA 3AQ4A 1OH5A 1NN3A 2REOA 2OO7A 3PV0A 1E0KA 1XTQA 2ZI9A 4I99A 1DARA 2GAOA 2VH5R 3TH5A 4AD8A 4URXR 2ZI6A 4BZQA 3TE6A 5KNCA 4RCZA 1RW4A 1E2KA 3REFA 1E79D 3IILA 3SFZA 4JL6A 2Q3MA 1SGWA 4LHVA 1AGPA 4BLTA 1MRNA 3HWSA 5H1YA 3B1YA 1YZLA 2OV2A 1AQYA 1R6BX 3MWYW 4DLZA 1R0WA 3AVYA 4G01B 3H2YA 2WPDD 5D3QA 3PR1A 5JS7A 3IGFA 4NZYA 5G53C 4DLVA 5AUPB 1AQUA 2Z83A 3IIKA 2FX3A 1OFHA 2QBYA 1U94A 1F3OA 1NLZA 3K9NA 3CR7A 3KKOA 3LXRA 3PUXA 3ECCA 4HAXA 4HLUC 4LDJA 4OK6A 2J87A 4RD6A 4RSGA 1E32A 2QPTA 3GPLA 3FHCB 4OHWA 5FTMA 2CL0X 4IDHA 4OK3A 4TWZA 3SR0A 4D25A 4AI6A 4KI0A 1ESNA 2JLQA 2GHIA 4HB4A 3KQLA 4CEJA 2J5XA 1N5LA 3F3YA 2O0KA 4GSYA 2HF9A 4LZZA 3QKTA 4KHZA 3LQRA 2A9KA 3R9IA 1NKTA 2D06A 1I2MA 1ZU4A 1N3BA 3PUYA 1B0UA 4GMXA 1W36D 4BPBA 5KPDA 4U02A 1KI1A 2ODWA 3IIJA 1DAEA 4PPFA 2ZE7A 4Q5IA 2OILA 5G41A 1FL9A 2MMCA 1KSFX 5FPSA 4Z8YA 3RAPR 5TY0A 4W9MC 1HYQA 3FHOA 4P4SB 5JJLA 3TVTA 2GEVA 1OFIA 1OSNA 4ASUA 2B7CA 2ERYA 2NG1A 4KFTA 2P65A 1RC8A 3U61B 2ZS8A 1IXRC 1E9AA 5IT5A 1IHUA 1CRPA 3SDZA 1W7AA 5JLJA 1OFUX 1DTSA 2YNMA 5EE0A 1XEWY 3WNBA 2VP4A 4YXWA 1KJYA 3UXMA 1SVKA 2P0EA 2ONKA 1LTQA 1Z22A 5L3QA 3VR1A 2WWWA 1SZPA 1KKMA 2XSZA 1KI3A 2BC9A 3H0KA 4YMTA 2L0XA 5FPKA 3X1WA 2BVNA 3MLEA 1ZM4A 2OXCA 2FU5C 2W2VA 2QP9X 1E9DA 5FL7A 2AFHE 2HUPA 1DG1G 1YZTA 4URZR 3R8FA 3T5GA 3FGNA 1G7RA 5IK2A 2CK3D 4U00A 1M7HA 2ZRIA 2ORWA 3E5HA 4K8OA 1J99A 4A8JA 4EDHA 3TLXA 4QM6A 2FG5A 4OI4A 4D0LB 3A1SA 2CL6X 4QC2A 4LJ6A 2P6RA 4NHOA 2WBLC 2JLUA 3AVTA 1AGRA 2WWXA 5SZJA 2R9VA 4B43A 1IXSB 3CNLA 5DN6A 3SNHA 4D0NA 2WKRA 3LLUA 4Q66C 1ETUA 1GAJA 4IXMA 3QF7A 5KO2A 1OH8A 1AKYA 2QP4A 1U90A 2IYXA 2SHKA 2BKEA 1KSGA 4G0NA 3U6BA 4JSYA 1VYVA 4CT4B 4KXFB 2IEZA 1OYWA 1VHTA 2OCPA 2YC2C 4JVMA 3NIBA 4M9XA 3LQQA 2FPLA 4UNQA 421PA 4BLQA 1CR1A 1TMKA 2R8RA 2F3TA 5KSOA 2F1IA 3LAWA 4I1UA 4LJAA 3MUFA 1L7VC 1XMJA 1YJ5A 4D81A 3BWDD 1IN6A 3H1TA 1KAOA 3EX7C 2WIAA 4FN5A 2QU8A 3PUWA 4PC7A 2TMKA 5FBQB 1BMFA 3CNNA 3UWOA 1GRQA 2IF0A 3CH5A 1ZINA 2JJ8A 3LVQE 1G1MA 3BE4A 4LJ7A 1G3MA 3VQTA 1YR7A 2H5EA 2OFOA 2QTHA 2ZSDA 3C8UA 3THXB 3VKGA 2G77B 3OF5A 1QHSA 5CLQA 2HDNB 2V3CC 1ZVQA 4ILEA 5JEDA 4TZ6A 2V7QD 2RHMA 4MRSA 4LYAA 4FIDA 4BGDA 5F9HA 3GJ8A 3IPXA 5D3MA 3A1VA 4TMXA 3C14C 1H8HD 3F8TA 3HPRA 1I4DD 3OIUA 3L82B 3P27A 4EKDA 4EFLA 4B3GA 2OFXA 4NYMR 1F60A 2QT1A 4QM7A 3FB4A 5C18A 4JMPA 2AX4A 3TNFA 2XTNA 5FOWA 2PT5A 2WAXA 2VO1A 5CK5A 3OIVA 3Q8XB 2GF9A 4Q9JA 3EZ2A 1QVAA 2JIZD 1WBBA 5J40A 4Q7KA 3JVVA 2AK3A 3QJYA 2R44A 4UNRA 4M1KA 3KQKA 5EE5B 4OHVA 3B8HA 5BN4A 2QGZA 1A1VA 3K70B 3SQXA 2UZIR 5HE8A 3CRMA 1MABB 5CJPA 1N6RA 3M4YA 1KNQA 3Q9LA 3LW8A 2IX3A 821PA 2J7PA 2QQ0A 1ZNWA 5EE1A 3EA5A 1SXJC 1WQ1R 1JAIA 3IHWA 4TQAA 4OBEA 1EFHA 4R98A 3MSXA 4JVLA 1IN8A 5DHAA 4B35A 3AVUA 1R8SA 2YOGA 3WRXC 3G5UA 4YMSA 1WXQA 2GRJA 4Q4HB 1CLUA 1PLJA 3AVPA 1XJ0A 2Z6VA 3MRSA 1V43A 5FBLB 3B78A 4JYBA 1VMAA 3KKQA 5DNYB 4RKEA 1BS1A 2QAGB 4HDOB 4TT3A 4G1UC 1VPLA 4LI0A 4LV6A 4MKIA 1SHZA 5AUQA 2ZRGA 1D2NA 2Q0HA 1BO6A 2X2EA 3X1DA 3U3OA 1TEXA 2PLRA 5AJYA 2F1HA 3THYA 4D6PA 2B8TA 1IN7A 3GLFA 4IOKA 2DR3A 4TSFA 4M8NE 3K0FA 4BFZA 3OEHA 5J4YA 3P32A 1KSJA 2JASA 4B3DA 1DAIA 4IVPA 3TW4A 4DIEA 4DLXA 2FWRA 4DB2A 2QE7D 1Z83A 3TKLA 5CYPA 4OYHA 1C4OA 5JEEA 3GLHA 4LC0A 1P6XA 1XPUA 3GLIE 2CE7A 4JL8A 2I1VB 2VF7A 4PZZA 4C0LA 2VF8A 4D2IA 1Q21A 2NO1A 5IDVA 1T91A 2QQEA 4G5OA 1FX0B 4Q01A 1U99A 4DEXA 3VR6A 1SULA 4RD3A 2V55B 4Q47A 1R10A 1S1CA 3B9QA 2ZIAA 1DO0A 2VEDA 1A5TA 4QGFA 4QRHA 4MYTA 3PQCA 4GMDA 3OAAA 1NVWQ 3U44A 1G5PA 2CJWA 4HUQB 1OXSC 2XNSA 5JI3E 3K70D 3GJ5A 3JZAA 3X1YA 5GVSA 1J8YF 3LBNA 3TUIC 5KDOA 2CEAA 2H18A 2GZDA 2W6ID 3NBYC 1AM4D 3REGA 2QUZA 4IVQA 2UKDA 1ZC4A 2ASEA 3NG1A 5HKKD 3HDTA 4JZKA 4LJ8A 2DCUA 2WKPA 4JLBA 4UXIA 2C99A 3C4JA 3KQUA 2QORA 2Q21A 4LCBA 3SJBA 3B85A 4XIGS 3QXJA 4A0FA 1UPTA 5J47A 2QENA 2WJYA 3LLMA 4XH9B 4OL0A 2ZM5A 3UANA 1Z29A 2DWPA 2FV8A 2KWIA 4JLVA 2YINC 4D26A 1AN0A 2EWWA 1NG1A 1XB2A 4DSTA 2QM7A 4Q1CA 2CHVA 1W0KD 3THWB 2JLRA 1W5TA 3QXSA 3WMFA 5LD2C 2ZROA 2WJGA 1KGDA 1N6KA 1SXJB 4BQSA 5LPNA 1YVDA 3WP0A 2XNDA 4BRUA 4CGZA 3KFVA 2JLSA 5A0FA 3TRFA 5AUOB 4P32A 5DSZA 4LYFA 4F4IA 4C7OB 4II7A 1G7CA 5CYOA 1YR8A 4G5QA 1Z6XA 4CT5A 4RY2A 5AJWA 3K9HA 3GJ3A 4A82A 1Z2AA 2MSCB 3QKRB 4XOIA 2ZR7A 1E94E 3ADDA 3LBIA 2ORIA 2ZE8A 5UKDA 1DS6A 1LB1B 2NZ8A 5CJ2A 3CF2A 2BMJA 1KI6B 4ESHA 1W0JD 4EJSB 2C98A 2DYKA 2W00A 1CTQA 4RD4A 3QXHA 1II0A 4JJKA 1KK3A 4A8JC 3B1WA 1Q3TA 4NL4H 2G9NA 1TF2A 1UADA 3PVSA 1Z63A 1EWQA 2CDNA 1J90A 2ZR0A 3AH8A 1SVSA 3CWQA 4Q1DA 1KI2A 5E7IA 1XEWX 1VG0B 3CRVA 3DKPA 2OE2A 1ZD1A 4GOXA 3WYAA
chains in the Genus database with same CATH superfamily
4ACBA 2X6QA 3MNFA 3TD2A 4O4HA 1H5QA 2H59A 2AFHA 4CF5A 1NG9A 4DLLA 2J0UB 5EPOA 4D5GA 2J59A 4L15A 3JQQA 4LWOA 4WN9A 4DA0A 1UJ5A 3VYSB 4EPWA 2FXVA 5IDWA 1C50A 5H3HA 2GWHA 1OTHA 2QDKA 2V8BA 2UXBB 3PDIA 1ODKA 3IUPA 3SC2B 2YVUA 2ZJ5A 3AW9A 4P4UA 3D6UA 4R0NA 3LZCA 1K0FA 4ND7A 1T4DA 1USUA 2HBYA 4NBNA 4OGWA 1TDJA 1V8FA 2HA5A 3PQFA 4ZD6A 2DY1A 1IBLB 3ZWPA 4C4PA 5KVVA 1QF7A 1U0EA 1AK9A 3KYDB 4AJ9A 1VSUA 3QBTA 3V4SA 2P8JA 1KXJA 1ORVA 4CM8A 5KVSA 3G5MA 1PDVA 2ZRJA 1HEUA 4BKPA 4L5BA 5KMGA 3PWZA 4L8GA 5AOAA 4EVRA 2YY7A 3MWEA 2NU6A 3WK7A 2ORYA 4AJ1A 3HNPA 1T9GS 4RHFA 5KVQA 2QUHA 1ZSVA 1BHSA 1GKLA 1G8JA 1R64A 5I9TA 5HZMA 4FIZA 4AKEA 3DEFA 2I1WA 2OLKA 3N2YA 4PX9A 4N0EA 1LQ2A 4C5CA 4M0PA 1XBTA 3BXPA 3V4ZA 1ZC3A 3B6EA 3FMFA 3LA8A 2H4ZA 4IHAA 1P3Y1 2C9OA 2XRYA 4EMTA 3N0TA 2V4ZA 3BZUA 3VAZA 2Y4NA 1ZN2A 1FP6A 2I3DA 5IUJC 4MWOA 2ZB3A 3A1TA 3AVXA 4DCSA 4RKQA 5ALPA 4KVGA 4DIUA 1KA9H 3U3MA 1QRAA 1ZOLA 4HNHA 3DE7X 4HX2A 3ZTYA 1HNWB 2YJ6A 4CCYB 1Z3IX 3E2PA 3TVTA 4Y9RA 4UXHA 1ZCAA 3HU2A 3VMMA 1UXJA 3FF1A 4DV0B 1SQGA 4EYKA 4KIGA 5TMDA 1VG9B 4Q1FA 1KYYA 3UUEA 4S12A 4JXXA 1J8VA 1WBJB 3L4KA 4FS8A 5FDFA 3N76A 4G1CA 5I9MA 5IX8A 4FR0A 3KXIA 2GJ4A 4WBSA 3AJRA 4E3ZA 3MGAA 1WHSA 3O93A 4TV8A 1YR1A 4BZXA 2FW9A 1CUUA 1NVMB 1CDDA 1VKRA 2N1BA 2Q1XA 2F43A 2FSHA 1PT9A 2LIPA 3RRMA 5KWVA 4FX5A 1L5FA 4FOSA 4R71A 1DKOA 3BMOA 4Q3LA 4RXTA 2QZZA 2ZBVA 2IVFA 4PLWA 3PSHA 5F9MA 4RETA 1RRFA 5GWXA 3LUJA 3CG4A 3N7AA 4BAUA 4YJ3A 1IQRA 4ARZB 4IYRA 1PZGA 1DRWA 2IY9A 3BULA 3PLRA 3QV1A 3W8NA 2OB2A 3ECAA 3FD8A 1LC3A 1GZ3A 3GFFA 4WTOA 3K1JA 2Z1NA 1BU8A 3PU6A 3V80A 1EXWA 4F84A 2B4RO 2BI8A 2BSXA 2ZYGA 4G4SP 3L0CA 3RABA 1SUWA 3O82A 3ZNNA 3NHYA 4IIVA 3VO9A 1Y6FA 5FXMA 4JS0A 1UC5B 3L02A 2IYSA 4WY8A 4OB7A 1V1MB 4I9HA 4NV0A 2QYHA 4ZCRA 1WPQA 5JH7B 3IAXA 1Y3AA 1Z8FA 5EGSA 4YUZA 4H18A 4YRSA 2Q6IA 3IPRA 1HE8B 4MV6A 1RC1A 2I5PO 3VHRA 3T8YA 4MIEA 2WNIA 1MNAA 4W8GA 1A9SA 3AJAA 3CA8A 3A37A 1WXGA 3CUWA 5C5CA 2OBLA 1MC5A 2Z2YA 3GPIA 4WESB 3CISA 2GO1A 3K6SA 4L3VA 5LJIA 1CR4A 3EF1A 4GI1A 3U4GA 1JEJA 3DDNA 3H3JA 1FXSA 4JCOA 3JD3A 4D8XA 3ZVKA 4E0BA 3U16A 5AXCA 2HAEA 2OK7A 4MKRA 3EASA 1MAAA 4X90A 1TX4B 2M98A 4MLCA 4PGHA 1VBMA 5D5PA 4D45A 5A3JA 3C98A 1G5RA 3LQKA 3GD7A 3ONWA 5B5SA 3SEQA 4HMQA 2H8KA 4OQNA 2TRSB 5HIMA 5HSGA 4DV5B 1H4SA 1JE1A 1OMOA 2ZWMA 1YZFA 1XALA 4LK2A 3A3NA 1SAYA 1KE1A 3EA4A 1JSLA 2YYSA 4H4CA 3CYFA 3I5UA 1JMVA 2R8PA 1CVRA 4UTNA 4IVNA 2BKVA 3LA6A 4PAMA 5TRTA 2GSWA 4UEOA 3B9PA 2PK3A 4FDUA 4WA7A 3R9KA 3G8CA 3ADCA 3M89A 3T35A 4XLZA 2HADA 2A4KA 1VHQA 4GE3A 4WK2B 4BN0A 3A2KA 1U7XA 1NL3A 3STHA 2NU9B 4EWLA 1JEAA 3F5SA 1B1CA 1JH8A 5CCBA 3OCWA 1RTKA 2HYDA 2M6KA 2Y76A 3AP3A 3BK2A 1WW8A 3MHPA 1ECPA 2CVPA 16PKA 1RKUA 2EWMA 4OM8A 5E0KB 1KZHA 1NXPA 2P4EA 2OG1A 2ECFA 4G0OA 5D3MB 3C5EA 4Y6OA 1B8VA 2H4HA 4EQZA 1NI4A 2WM8A 3G0HA 2QGNA 1C9MA 1O95A 1ZH6A 4LY6A 1V11B 1GVHA 1FQOA 3I4FA 4MW1A 4QYMA 2C8JA 2O0JA 4E7OA 4KMRA 2BPOA 4YV0A 3ZXXA 4BFTA 4R54A 3B1XA 2B37A 1YI8A 2ATVA 4CUJA 1JVSA 1LK7A 5ERXA 2XUGA 4R2JA 3AJDA 4RAOA 3FMIA 4AG6A 3RGWS 3P9XA 5DHFA 2HJHA 4F85A 1NOJA 1PO7A 2XA1A 3TQQA 4B44A 4DQUA 4LXGA 1X1TA 4J1TA 5ALYA 2QTVA 3O2JA 4RAQA 4C06A 3FZEA 3O9VA 1RYBA 4NH0A 3DDWA 4OHOA 3PC7A 3RK0A 5I4CA 2FGJA 5CLHA 3VAAA 3BB4A 2EIHA 1P2FA 5EQFA 3E23A 4KC0A 1ZDMA 4BNVA 3MS7A 4P1ZA 2I03A 1LBIA 3WZMA 1I7NA 4MYRA 4QHTA 3F4BA 2P2ZA 3LPLA 1JDNA 1PR2A 2HLDD 5DP1A 3CBQA 5ALRA 4RGQA 4A0QA 5A0VA 5IVDA 3TMYA 1ZLXA 2C2XA 2C7QA 3ZHTA 1X8LA 2HLHA 3PZRA 2O3TA 1WE2A 3ENWA 5JARA 1DIHA 5CK4A 5D7BA 4CQMA 1OKKD 3T4EA 4NAUA 3BYZA 3K2IA 3WL4A 4LJSA 5A5VA 4DC1A 3HXOA 2A59A 3CG0A 5AKZA 3SIWA 1TUEA 1VCIA 1LSOA 1UKZA 3NH9A 5KYXA 221PA 1W93A 4EF6A 4O08A 1XF1A 2J6HA 1KYXA 4KX5A 1BMFD 4V0RA 3ZV6A 4D57A 1RYDA 2W6JA 2VT3A 3HCBA 4DLKA 3HEBA 4Q0MA 4HQOA 2PWBA 4FP9A 1SO8A 3LY8A 4MB0A 3LBAA 5C7IO 5K8IA 1XZQA 1US8A 1Y8AA 1M72A 3L84A 2DTXA 1DXQA 1VI6A 4CYMA 3FNHA 2AMFA 2O6HA 4NDAA 2I7TA 5DX0A 1P9NA 2D6FA 5EIXA 2YWBA 3O8QB 2AQKA 2RBEA 3PFNA 4J0CA 2MSDB 4AJHA 1KRXA 3GLHB 2XADA 1AMNA 3L7CA 3IDFA 3C1OA 3FAZA 5HFNA 2QTRA 5DU2A 4Q1BA 1E1CA 3AINA 4XPIA 2IH5A 1RBZA 3RANA 3NWBA 4HDNA 1UBHS 2RE8A 2C2GA 3WWOA 5JU6A 4YAFA 3LH5A 2NVUA 1Z5GA 4I9FA 4KAJA 3ZCPA 4JJFA 2PVPA 1Y1RA 3G0IA 3DBLA 4DV4B 2VWGA 2UVQA 3D8BA 2DQYA 3H9UA 4EA6A 1BTOA 4QPPA 3QUTA 1RM4A 2EJBA 3FYUC 5K4AA 1NJSA 2Z95A 4RLFA 4EENA 1FUKA 5KYGA 2IYFA 2PRZA 4BO4A 1USVA 4XTCS 3BHMA 1SUFA 4BNTA 2WHPA 4R1MA 3VDQA 1ZHOA 1YTLA 4TS4A 1E2HA 2PMFA 2CLCX 3K9LA 3EQ2A 2DKNA 4CLXA 4PTYA 5IKMA 3SBDA 4JLDA 3M6LA 1P77A 1MX1A 5F1PA 4LVUA 1YQ9A 3Q2IA 4L5YA 2GJAA 3A4YA 4JK3A 5ANRB 5AM4A 4H2DA 4IHJA 2IPNA 4G1EB 2CGEA 3H5OA 3PGA1 5G1NA 4NCXA 5IBRA 3ZCRA 2JFWA 2VJKA 3IUQA 3S5JA 2ATCA 2JLCA 1H4TA 5FRDA 1UFQA 3U5TA 1ORDA 3EXHC 5FI1B 2C29D 2GYWA 3CGWA 3N0WA 2HB6A 3NP7A 4M60A 5AVWA 1YHZA 1VSQA 3P9SA 4CKEA 3QIVA 3A8TA 3C5WP 3TR5A 4R05A 2CZCA 2J9XB 3RS7A 5TT0A 1Y7IA 1OPXA 3SYMA 4EHKA 2Q3LA 4A2WA 4LMAA 5TMBA 4M53A 1GFIA 5BVGA 1UDAA 1QKJA 1EESA 1RYHA 3HCOA 3JATA 4N82A 3MJRA 1FTYA 3NHSA 4G67A 4NFSA 4F71A 5FWYA 5JWOA 1JVNA 3AUFA 1CQIB 1XPJA 5CIWA 5HCIA 5J5CA 5KOJB 4ONEA 5JALA 1F2TB 1N2CB 2ZSKA 1D07A 3K0AB 4W1RA 3I53A 3UMMA 2ZPTX 1Q0RA 1RU3A 3NFYA 2QT9A 4R84A 1L7OA 1II8B 1VPEA 1A8PA 1QC5A 5FOSA 3Q98A 4XUDA 1V2GA 4B8ZA 4PFSA 4LIPD 3FOWA 6LDHA 4ARSA 2CD9A 4C0HA 3D4OA 1D2HA 4C30A 2WUDA 3BFXA 5EHNA 2GJSA 5MFZA 4UVDA 4Y7CA 2ZEJA 3IEIA 3AHEA 3H6HA 5ECDA 1H69A 2ZB7A 1OFVA 3GVPA 1RRGA 2B1GA 3E5NA 4ZT6A 2I33A 2IXFA 5B53A 3W5UA 1G5HA 3OLYA 3JVIA 4JKYA 3ZBTA 9MHTA 1CX9B 2P4QA 2PTGA 5L95A 1DP4A 2D2XA 1SRRA 1CC1S 1OFTA 5LZ2A 1OA0A 2O2GA 5DTJA 2HMWA 2X58A 4LOHA 5HIIA 4DUGA 4OJQA 2JEYA 1MIHA 3DMGA 3FTQA 5K0ZA 1EA7A 5AFSA 5KNDH 2NNLD 1L5RA 2EJCA 2EBHX 2UUOA 3H11B 3KB2A 3U37A 1DV1A 4XZ3A 3W3AA 1YA4A 2BM8A 1N9ZA 2O06A 3LLSA 4L3OA 4OO3A 1D5WA 4BNDB 1JE0A 4GKBA 1B15A 4V2IA 5BV0A 2AYZA 1C29B 3X2SA 3ERCA 3DWGA 3SFVA 2JAQA 4IG4A 4MDYA 2X6RA 4QDJA 3FPBA 2FGKA 2R6ZA 4QIHA 4BPRA 4F5YA 5K9ZA 1RLOA 1FDVA 5FA8A 3SY8A 2NO7A 1GCGA 4RFSA 4AU1A 4DS3A 1TEVA 2GCOB 4NR0A 3EARA 3CONA 3KQTA 2XQGA 3F96A 5F7JA 5EJEA 3LOUA 1QH8B 3HP4A 1M6EX 3IAUA 3H2KA 5AXAA 4UE6A 3C6XA 3NHJA 4PAQA 3ES9A 2OV6A 2A6PA 1PRYA 3MPUA 4H1WA 2DVMA 4TV9A 3V9PA 3A14A 1LXCA 1X8XA 2FOLA 1JS1X 1RJWA 4I1IA 3OU2A 5HIKA 1VKHA 2X42A 1D6SA 5AW4A 4BNMA 1R27A 3JALB 1R1DA 2FTKE 2NW6A 2NV0A 1BQEA 2QSYA 4M2LA 4NHEA 4YASA 1O9BA 1T6ZA 1CR0A 2A92A 2R7KA 1N8TA 3LIIA 3IR6A 5CB0A 5IEJA 3TVYA 1B41A 2HKIA 1S7CA 2FETA 5CD1A 4L28A 4FEEA 1P1FA 3BCRA 3S4YA 8OHMA 4Y7DA 4ND2A 4XIYA 1P4JA 4ZV7A 2YZMA 4PLZA 2WWFA 4R4JA 4D56A 4BVLA 2FDXA 3QOYA 2K5UA 1MOZA 3MFYA 3QX7A 1S02A 3QJGA 2O54A 1S9DA 5JYCA 2XUPA 4DR7B 2VBCA 3KE8A 2JJ1A 3VOTA 2PUEA 2NMVA 2ZR8A 1SBYA 2V7PA 1DADA 5JXJA 4C7XA 2NGRA 5C51B 3HVJA 2A5LA 2LWIA 4QD3A 2ZIZA 4L50A 2JGDA 3QXCA 1XG5A 4N49A 2GF2A 5C0OE 2ZUEA 5LVAA 5ALSA 3HU5A 2IDKA 4IRMA 4U6QA 1H1LB 5TMEA 5K7SA 4DKJA 4IV5A 4Y2JA 2OQ2A 4KJZA 3T0GA 3W5AA 1K9SA 1T8RA 2OV1A 3H16A 1IHOA 2YFYA 1EK2A 3L9WA 1DB3A 4KG7A 1SCQA 1V16B 5IYZF 2O8BA 1DIBA 2GLUA 3UJCA 3W7VA 2MYNA 2LPMA 3AR4A 3CRRA 3FSRA 3L6CA 4YRDA 1B6GA 2FE4A 3KO8A 3CVVA 2GBLC 4IM7A 4TQ9A 5FBWB 3PITA 3WGIA 1D2MA 1O03A 4Q4LA 2AI2A 1M6VB 3C3MA 1VKOA 1TL7C 3WGHA 3FGPA 4E3WA 1BDJA 2XD9A 1YMUA 2PJRA 2NT4A 2PMDA 3DVRX 4GFDA 4J1SA 4MV0A 1MV5A 1P8JA 3P9QA 4DUYB 2PSHA 2D54A 3IJPA 4RLHA 2HHLA 2WICA 1E4VA 4YO8A 3RF7A 4E13A 1IHXA 1FVOA 3OHMA 5IMBA 1C3XA 1VZ3A 1K7EB 2FPSA 4KBGA 3UK7A 4O4HF 4JV5B 3KU4A 3DDCA 3OY2A 4UAJA 2HA7A 5KSZA 4FSDA 2TECE 4GYYA 3CNOA 2P2YA 2QX4A 4EATA 3T7JA 3KQOA 1E2MA 4EG1A 3E8SA 5KS2A 2XE4A 3PFKA 4JUBA 2VLIA 3BKXA 4XSVA 3WQRA 3ND5A 2XGOA 4RACA 3L0IB 4RM3A 3AY6A 2YHIA 2ZXEA 1ZCBA 4DMFA 1Z13A 1Z4NA 1CEQA 1XVLA 2FMXA 1YZKA 1LVGA 2QN6A 4RPKA 5C1IA 1L4GA 3H8JA 3HQ4O 4LSZA 3TGWA 1FSFA 2I6SA 4AYTA 3A1EA 5AVTA 4DV3B 3MYRA 4AWBA 3U7GA 1RRCA 1U1IA 4WZZA 3RVJA 1K0UA 3TX6A 1U3TA 1XJWA 2G25A 3UCEA 1B73A 1UJMA 1R6UA 3AEQA 3DLPX 4O1HA 3WWDA 1X77A 3W7AA 3MWGA 3K9GA 3HCRA 5SY9A 2EP8A 2BGGA 2PCJA 4RZ3A 1E5XA 3OUTA 5JSKA 3GN1A 3RGGA 1SU4A 3MQFA 1BE8A 1FRNA 3F7TA 4GLJA 3UMSA 4YCLA 1BA3A 2CNKA 2HCRA 4WDQA 2E4WA 2M32A 1Q7CA 3D4IA 3V5NA 4EA8A 1G38A 3L2OB 4CQNA 3M6IA 3P4YA 4ZDIA 3R7BA 5CNJA 3X1JA 1UR5A 5SICE 3JD0A 5CT4A 3F4KA 2WZQA 4UNIA 4UTPA 1IQPA 5FLKA 1GQ2A 4BTEA 1EDBA 4XCVA 3DE3X 1I3LA 1OGYA 2AMVA 4KE8A 3GPBA 4EZEA 2RG1A 4HATA 1UKVY 1TCBA 1FSSA 4AS3A 1GR0A 3RK1A 2H5JA 2OGTA 4Q1VA 5TARA 1HLFA 1CJBA 2WUEA 4QU9A 1DZ3A 5JCPA 2FPXA 5H0IA 1Z37A 3EFHA 4M9CA 3T99A 3ZWDA 4B85A 1HDZA 3HMQA 2Q6VA 2D1QA 4IDNA 2JI9A 5CA1F 2WFMA 3MWLA 2AMYA 4XD2A 1RWKA 4TV8F 3RWOA 5DYWA 4J9UE 1E3TA 3N3AC 5CJJA 4AKHA 3TSOA 2Z98A 1ZI8A 1P4HA 2HJRA 4JZYA 4OIFA 5B3JC 2WDPA 4OU5A 2PMCA 2PRSA 1GGKA 1QWOA 3O4FA 3OLCX 3RU2A 2V1XA 3H04A 3R76A 3TZLA 4EDFA 4YJ3F 1U02A 1RHRA 1TXGA 3DOIA 1A96A 1PR0A 1ZCZA 4IJVA 1HF3A 2Q27A 4J0HA 5KSPA 1Z0KA 4YRRA 1F8GA 1X39A 3D6MA 4KQIA 1IZ7A 2WG1A 4OV6B 4DMLA 4DMGA 2HXGA 3GRKA 4JXKA 4MPRA 1XQXA 5L7YA 2P68A 3M49A 5ARBA 3PCTA 4KN5A 4TVKA 4Z1OA 1GGJA 3K71B 1I80A 3WAKA 2PRIA 3Q3IA 3JZMA 4KFSA 2QTGA 1XD2B 1C3EA 3Q85A 3K09A 1XMQB 4N41A 2XGJA 5HEKA 3IAS1 4B73A 3JWGA 4X62B 2H85A 1KPHA 4MP6A 4U2EA 1PGPA 1Z7YA 3KR2A 4JHXA 4K86A 4M0FA 4BFXA 3WK4A 2PUBA 2WYUA 3WHKA 2CCGA 621PA 1SVLA 1TCUA 3NBUA 4KWIA 3ZZ0A 5KTMA 4MAMA 3PQ5A 4QNRA 1T0HB 5GMOA 1N4DA 1BVUA 1TAGA 5REQB 4K9SA 2OBFA 3KR0A 2VBGA 4OKIA 3SIPA 1R8XA 1KE2A 3NEPX 3DDUA 3CVUA 5F5NA 1G6KA 3P9RA 3I34X 5B58C 1UDBA 2ORED 1MEJA 3TNYA 4YCMA 4B79A 1OXUA 3UTDA 4BKMA 3UKDA 2G40A 2B5WA 3ZDXB 4AJKA 5EXSA 1ADGA 3HA3A 1PZHA 3PXCX 4ILKA 3GT3A 2PWAA 3LBHA 1EJBA 1EXMA 5JXGA 3KTAB 5FP0A 1N92A 1RSZA 3KEQA 1P0QA 3OICA 1Q11A 1J8DA 3SZUA 5HHTA 4JXZA 1CU1A 4L5CA 5BP7A 2W8BA 1ONNA 4QQKA 4QBHA 4F9GA 1D8TA 2RAFA 3SSOA 1U2DA 4QXQA 1UXKA 4NOMA 5L51A 5JT1A 5DV9A 3DE1X 2BEUB 3ESCA 4QTUB 1CDOA 2PX0A 4U9IS 3BWYA 1J22A 1GADO 2OK8A 1KVQA 4FZVA 3LLCA 2WLSA 2PGIA 2DHRA 1DFGA 3EVGA 4FC7A 1WXDA 2D1SA 4EG5A 3H1BA 4KVAA 4KUHA 5JQGB 1WUIS 2XMSA 3U39A 4ROTA 3V6MA 4DUZB 1L0BA 3BD9A 4YMVA 1DKQA 2EGHA 4GOKA 3TX2A 3R9XA 2W9XA 4V0SA 4N3CA 2PCLA 2JH3A 3KTOA 2CV2A 3DV2A 3RVBA 4D4LA 1L8OA 2SNIE 2MR6A 3T1TA 1I33A 3C85A 4L9SA 1FDWA 4B3BA 3LMKA 3WFZA 4Z7NB 1XQVA 4RA6A 2GEDA 3RW9A 1E58A 1MJNA 2HJGA 4N0QA 1YCFA 3EGCA 5CIQA 2B9EA 3TOCA 1P1RA 1CQZA 1TK2A 1M8FA 2B69A 3PUKA 5JD3A 4C4AA 1P1BA 3SJ7A 1RYZA 3GA7A 4GWLA 1JKXA 2YCBA 1Y1KE 3OPNA 3HS3A 1DKLA 1O08A 2JIZA 2K2QB 4LRXA 1L7DA 4E2YA 2XV1A 1IVNA 4LJYA 3AG5A 3I6QA 3PRYA 1XA4A 2X7JA 2DHQA 1EKXA 2DWOA 3DCIA 1NE7A 3FUXA 3L1KA 4ND8A 3L77A 2WE8A 3EDCA 4DYVA 4KGDA 4AN0A 4AY6A 1T2CA 4MUHA 3OQ6A 2ACEA 5IM4A 4YPOA 2JATA 4W9NA 5ALKA 4NFLA 4G0PA 1A4RA 2WG0A 1B0PA 1RIFA 4PNHA 4IJWA 5CDTA 1WTAA 1ECCA 1E96A 2FMTA 2WAYA 1OD6A 2R1UA 3QVWA 4HAOA 4TYMA 1IK6A 4WOPA 3FPHA 4I19A 4B7XA 4WZAB 1CWUA 3KVVA 4IZHA 5CVVA 3UNXA 3KLBA 3QH4A 4M1SA 1T1EA 2KQUA 1GM5A 1NW9B 2IU3A 4U7HA 2Q9CA 2EFEB 2BFOA 2O59A 1PN3A 1TVKB 3BZWA 3SGLA 5IBPA 2WJWA 1E5LA 1HORA 1TF5A 1Z7WA 2P30A 3LDGA 4HEHA 4E09A 1O87A 4P3OA 4HOYA 1T4GA 3EMDA 2FNAA 1Z73A 3TLYA 3FAKA 3SMVA 5JOQA 2Z8YA 1IWPB 4FJ1A 2FSIA 3OCVA 3NU1A 3B6ZA 3WLNA 1Y4UA 1GL7A 1ECLA 1UM9A 3VTFA 5LD2B 1O3YA 1N2JA 4UFPA 5AVYA 3RV3A 4ZVNA 3D5EA 4M88A 5BNZA 3CPHA 3R4VA 1RZRD 1Z0ZA 1QGUA 4AY3A 2VQEB 1QGYA 3AEZA 2CBXA 3PKJA 4OI1A 1ZRNA 5FL3A 1EIZA 1WDLA 2P9FA 2ZJOA 3OMXA 4FZJA 5P8WA 1AS0A 4JVSB 1OVMA 1JTEA 4DJDC 4LJ4A 1KQPA 4ERNA 1UODA 1WLSA 4PZPA 4DANA 4GT1A 4WERA 2Y1OA 4ZDKA 5K01A 2OMKA 2OA0A 5A6SA 2C4TA 2OHHA 5LQJA 4OU4A 1O6CA 2VDLB 4NBTA 2PHZA 5JAOA 1P9OA 2EL9A 1C1XA 3WHIA 4MHTA 4CTNA 2AI3A 5KVAA 3ZCTA 1Z6QA 1HFJA 1L8QA 3HJCA 4A1OA 2P3SA 3D3WA 2FCAA 3PL5A 4TSKA 4YP1A 1O6GA 1M2OB 3HHPA 4I6JA 4A8JB 1FP4B 1YQEA 3X0DA 1EFPA 3O75A 5CFMA 3GGCA 2FG6C 1UBGA 2JH9A 3JQGA 4QJ3A 2VTBB 5FF9A 3DAOA 2C0QA 3RFXA 5GP1A 4HYTA 3DLCA 1GRNA 1JDUA 4FOPA 4UE2A 5IWCA 1DAFA 2BFCA 3NALA 3RBVA 3FCCA 4JVNA 1PSWA 3WNDA 4QPDA 1M2GA 4PZEA 3P20A 5T7BA 4KZKA 4RF4A 4V0KA 4YLYA 1W9HA 1G4AE 1M1YE 2CHUA 3TXYA 2WWRA 2OGZA 5EHGA 5EKTA 1TJ4A 2W6IA 2ZG6A 4G5XA 1YB4A 4DXHA 1W59A 2XJ4A 3NFRA 3R24A 1UBNA 3AW8A 4KQ9A 4N0DA 5B12A 1UKCA 1E9BA 3E22A 2ZB4A 2WT4A 3MLBA 3NRJA 3OEED 4C0SA 4CL8A 3K3PA 1LSUA 5FOUA 2FRDA 3NHAA 4JYMA 4MB2A 4IHJF 3U40A 2Z8ZA 4TQUS 3KU1A 1M8JA 1YU6A 2A78A 5LQCA 3NGLA 4OCZA 1CUSA 4PSVA 3SIXA 4M1TA 1SG9A 1BS9A 1JEDA 2ZRLA 3A6ZA 3F6CA 3HJGA 2Y1DA 3OJXA 1SKUA 3DO5A 4HP8A 2XCSB 1RHKA 2BMWA 2IDJA 2BE7A 3CKMA 1XTBA 2YMLA 3CWZA 3LBYA 4NZZA 2Z2KA 3SLKA 3TR0A 1IN5A 3NOVA 2PPLA 1W0KA 4B6GA 1DAKA 4LVOA 5DLDA 4AMYA 3OPVA 4OHBA 3W4IA 4WNAA 3GLRA 5GIPE 4PQYA 3N0RA 4BVJA 4WT7A 4YXWD 1ESCA 5CVUA 3RSLA 2HRZA 3EVCA 2A5FA 5E6UB 5HK8A 4KR3A 3V2UA 5GZ1A 2QX8A 1W94A 1P7YA 4HGPA 4IIJA 1P5FA 4HS9A 5SV2A 2VOEA 3I9JA 3UMVA 4LQCA 3RAJA 2AN9A 4MINA 4M1ZA 1JI0A 2GCEA 1JJAA 2ZSAA 3EXIB 3NRCA 1YAHA 1IY9A 2RHGB 3M1LA 3OTQA 4RF2A 4UNPA 3ADBA 1B0ZA 2WTUA 2H1WA 3IVAA 3SE7A 5AVVA 2W6QA 1XDSA 1JQ3A 2FQWA 3QGMA 3AZOA 4IDAA 1YJXA 3DE5X 1DWQA 1YS7A 1KEKA 1ULUA 4AIRA 4AT1A 4R9VA 4S1OA 4YIKA 4JJGA 5EZYA 3ZE7A 1NDUA 5EFOA 4MS1B 3REOA 1KZGB 1PJRA 3SJUA 4MMZB 3KDAA 3IQXA 5TT1A 4E03A 4UXJA 3G9TA 1OE0A 1FX0A 3SSAA 5LKRA 1FSZA 1X1SA 4FYJA 3T1VA 1JU4A 2ABWA 3JVDA 5BN4B 3NEYA 4X8OA 2CLDX 5IG2A 1I1NA 1FFXB 4GR5A 1RP7A 3WGVA 5LXTB 1QSGA 2OD7A 1M75A 1KAEA 2RGEA 4AYXA 3GW8A 1RFLA 1UC8A 3TIXB 1K86A 4YR9A 4JLNA 4FB5A 4P31A 4X6XA 4O25A 2FN9A 5KYYB 2C3OA 2XCQA 4P3XA 2P11A 3R5TA 1OAKA 3K72B 4WA8A 5M04A 4E2FA 1BC5A 1T0UA 2BFPA 3DBOB 1VDZA 2IUUA 2PUFA 3BFJA 3TCNA 3PNVA 1LDEA 4AJ2A 2FSFA 1NF3A 3H0CA 4OVKA 3H5WA 1YIOA 3PDJA 2V59A 4B3FX 2VZEA 4WINA 1YOVA 2O0HA 1NVEA 2V8OA 3U62A 3DXXA 3PNYA 4AX8A 5LMZA 4JC8A 1H2XA 3JCZA 1M6NA 4HLQB 2FSGA 2VSOA 2FSVC 4TV9F 5B37A 4TLBA 5G4LA 3VNQA 2ZAOA 4CI9A 3EPKA 1WG8A 5IXSA 4QBFA 3GEHA 5AW7A 3A9VA 4R9RA 3KYCB 4RK0A 1K92A 4DIKA 3FB1A 3G9ZA 1G0OA 1QRTA 2OYRA 3B2EA 3I01M 1C41A 1P17A 1Z2EA 3F47A 1U7TA 3FHTA 1JN0A 3R0ZA 3QLVA 4ZC8A 3Q1KA 4RJJA 4DG9A 4OQMA 1RIIA 5EN4A 5CDHA 2F90A 1WV0A 4AIIA 3K6KA 1UXOA 2ZYSA 1TEHA 1DAOA 2ZW9A 4OQEA 3ROGA 3JQFC 2HPVA 3C6KA 4MZXA 5HBRA 2IX9A 3KUCA 3RVOA 1QF6A 1JILA 3IR5A 2FF7A 4KLRA 2X22A 1Z62A 2CDAA 4HAYA 1G9TA 1JHZA 2B8JA 2G83A 1UKYA 3EIEA 3N7UA 4M9QA 3T7SA 4ZEMA 1KI6A 2DFPA 2X9LA 3W0LB 3IEMA 3PQEA 2E1RA 2XB4A 4HGYA 5DTQA 1LEHA 1LJLA 3UIEA 4TXJA 4U2CA 1B6RA 10MHA 3GPDG 2AFIB 5DK4A 4ZYYA 3F98A 4I9NA 5ADWA 1EVYA 3TL3A 1OY1A 4BV3A 2PS1A 1XGKA 1W9MA 5LZ5A 2BFFB 3RSSA 1RXVA 2FW1A 3EXEB 1AC5A 5IDXA 2XF8A 4DY4A 1F12A 3VKHA 2CCKA 3LKDA 4PZAA 1BWRA 2I2XB 4FPXA 4L4UA 1RAIA 4XM1A 3ZG6A 2W2PA 4PAGA 1OLXB 5GOTA 4BRUA 3H84A 1MLDA 1DJPA 1T2EA 2GM9A 2Y05A 3R0VA 4XDHA 1XD8A 4JP8A 1T1RA 1L5ZA 1GPJA 2PV7A 2CZGA 1E2NA 2P2LA 1M8PA 2VZ8A 4MUAA 1M6YA 1WP9A 2J7PD 4KCGA 4QELA 2DBYA 3U0VA 4GO1A 2FJPA 2WF9A 4PYNA 1TQ2A 1U6JA 5EZQA 3DVAA 4OHPA 5FCDA 4KX3A 3FNBA 2B7BA 4FHZA 1VSVA 4GZ3A 3K8QA 5EXTA 1QCDA 2OTCA 2J6CA 5TF0A 2X8JA 2GZHA 2J5RA 2EJUA 4FX2A 3GP3A 1XMIA 4G85A 4BEJA 3EQ8A 4YDSA 2GNPA 3QHPA 3QM1A 5CBPB 1VFPA 4HNAA 1HRDA 3GFRA 4BV8A 2HTFA 4WXPA 4EARA 2NU8B 4KL8S 2Y6UA 3QUBA 5B1SA 3N28A 5C37A 2Y2UA 3LHDA 3LPAA 1ZOPA 2DBZA 1XDZA 1Y81A 2ERCA 2FLVA 2IHYA 2WTAA 3FR8A 3LGSA 3QELA 4IIEA 3EIFA 3IQEA 4IY1A 1OWLA 3BORA 1G8GA 3HBFA 2W2KB 3KJNA 4JYCA 5AXDA 4ZI3A 6ADHA 3K32A 1UF9A 4MI3A 4WLNA 3ZVNA 5DXAA 3D31A 1I4WA 5E8JA 3EGDA 3FR7A 3BN3A 3DE6X 5EXDA 5FBHA 5CTJA 4TSFD 4AQDA 1DVRA 2ZBDA 1Y48E 1OLSB 1E6WA 1J9EA 3LWZA 4A73A 4D9MA 3AL0C 2WJ4A 3N2GB 3IODA 3SKXA 5CEFA 5LJLA 1TU3A 1NQTA 3U4QA 1XZLA 2XTJA 4FHGA 4HZGA 4IOJA 1QAQA 4FW9A 3SBXA 5KEIA 2AQ8A 3CO5A 1QRUA 3OIDA 4FNGA 2O14A 4FGJA 5JBNA 3KXDA 1NUSA 4V3CA 1UK7A 3QPWA 4PXSA 4YT4A 5JZVA 2A7XA 4KE7A 3VJMA 3DBIA 3E8XA 1HK7A 1DT5A 2YY6A 1K8YB 5J9FA 3FTFA 2GX6A 1BW9B 2EERA 2QA5A 3H18A 2ZJ4A 3KZMA 3WLRA 4IO0A 4EKEA 5CVJA 2YY5A 3RC7A 1VG8A 5DNEA 3E3NA 1NXOA 1FYWA 3WB2A 4GPAA 4RFVA 4EO9A 2BFDA 4C7VA 1I2DA 1RE0A 4Y6SA 2BDUA 1ENOA 2YYAA 1NRWA 1I0IA 1GAWA 1U0SY 3PEUA 4PHTA 3QBJA 3OAAD 2ONZA 5I8WA 2P3OA 4V2UA 1JQAA 5C32A 3I83A 5B4TA 1J2YA 1WPXA 2BEJA 4KR2A 2BEVA 2PA3A 2F62A 3BGOS 5BNFA 2FFAA 3IAAA 2FSSA 2RI1A 1XTIA 2A0YA 2B7LA 2CF6A 4NXNB 4YT5A 3S99A 2FHPA 3D2BA 1X7ZB 2ID4A 3PTLA 4FOOA 2NUTA 5DHUA 1K7CA 3DR3A 4PWZA 5ISMA 2XE7A 2IH2A 2SKCA 1Y8QA 2IXBA 3E1GA 4BVFA 3FYUB 3KZKA 3ZYZA 2RGNA 4K28A 4YJGB 3UV3A 3L79A 4DCGA 3UY4A 1CKEA 3H4TA 3FSEA 5FUQA 2AK2A 4PZ9A 2XMBA 2G4VA 3ET5A 3GEPA 4EVIA 1Z28A 1M1YA 1YB7A 5C31A 4DW8A 2QAGC 2HK8A 1V7QA 3QUQA 4A0RA 1JHYA 1AK1A 1F4VA 1Z5WA 2OAEA 5AHRA 4YUVA 3V48A 5LQMA 3F67A 4D9GA 4XDYA 2HLDA 4EKNB 3UAVA 2BJVA 2HRCA 3UT5B 1GL6A 2VHCA 4BQEA 1L4HA 1LV8A 1Q0LA 2ECPA 5HTKA 2I2BA 2WZDA 1BSVA 4IJKA 2GN0A 1NU8A 4QWMA 3ZXUB 4YYZA 2JAXA 3TW6A 4BB9A 3B3GA 3VVLA 1FW8A 3CRNA 3QUCA 3TQIA 2PRYA 3LV8A 4DLRA 2VSXA 2UYHA 1H6DA 1OKKA 1JLMA 3K35A 3EXHB 4CV1A 1K7FB 1GV0A 1H66A 4FD2A 3OA2A 3OKAA 1Q1GA 1QP8A 1ADCA 2I87A 1QHFA 2IYLD 3ROTA 2W0MA 2HIHA 3GDHA 5B4VA 4D80A 4F92B 2YS6A 3KD3A 4UTXA 3VC1A 5CA0B 2ZREA 2ZANA 2ZYAA 5BNWA 4RV4A 2V9CA 3LPMA 3GFOA 4PLHA 4HGRA 3H5AA 2C5FA 4KXQA 2ZIXB 3CURA 2OOSA 3QFHA 2Q2QA 2J0SA 3PC3A 4EYQA 3BB3A 2P91A 4R68A 2YZ2A 3D7LA 4RLSA 4R7GA 5E9JA 2OAGA 3UQZA 4GL2A 1BXRA 4IEEA 2ATIA 4PR0A 5DI3A 3D5QA 4CHTA 2MT9A 3RS5A 1FTSA 3ML1A 3TSCA 1GG2A 3EZGA 2PT6A 2H51A 4XPZA 2HPZA 1VBNA 1KDPA 1ZMOA 1CRQA 4HQFA 4YALA 2O8EA 1UQRA 1VJRA 4OHUA 2HMSA 3BMCB 4LBYA 3R8CA 1A50B 2C8VA 3V2HA 4ARCA 3BQ9A 2D13A 1ZAYA 1WO8A 3CLKA 5WRFA 4DNOA 1IN1A 2H7YA 3HKDA 5KOHA 2XYRA 1E79A 1GNSA 1Y9AA 2Q5CA 1V41E 2TYSB 1RLMA 2QQ5A 5AM1A 2FMUA 2FRXA 4UQPA 1KORA 4G1MB 2DE0X 3ABRB 4YR7A 3LT0A 1ZXLA 2HQRA 3MILA 3TTVA 2OENG 1K7XB 4X0EA 1Y37A 4Z0HO 2HCTA 3F49S 3MTBA 4WADA 3ZW8A 4LSWA 3TR6A 1XKLA 4NICA 4EKGA 2YXPX 2O7QA 1GCOA 2YJGA 3GG2A 1U6IA 5A05A 1ZK0A 3DV9A 4CMBA 4KMOA 5EP4A 3KYBA 3USZA 4RENA 2AHOA 5G3YA 2W90A 1ZY2A 3L8ZA 3QFFA 1L5HA 4DVGA 3G2MA 1RLIA 3D7SA </