1MV5A

Crystal structure of lmra atp-binding domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
242
Chain Sequence
MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of LmrA ATP-binding domain reveals the two-site alternating mechanism at molecular level
rcsb
source organism Lactococcus lactis
molecule tags Transport protein
molecule keywords Multidrug resistance ABC transporter ATP-binding and permeas
total genus 63
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 7.6.2.2: ABC-type xenobiotic transporter.
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mv5A00
3ZIAA 4CZ2A 4XTCS 2R9VA 4B2PA 1DEKA 4KLNA 3BXZA 2JA1A 3GFPA 2QTVB 3ICEA 3FKSD 4NYMR 2GVDC 3ZZUA 1DPFA 2ZAMA 1N6LA 2FN4A 4B3DA 4BLOA 2ZUCA 3X1YA 2C8VA 4WZBE 2ERYA 3ECCA 5HZKA 2C03A 3RDPA 4M1MA 4Q4JA 2A9KA 2R6FA 3RRYA 1T3LA 1GFIA 5FTMA 1KGDA 4B71A 4EFLA 2BKEA 3TQCA 1RPZA 3RS7A 1NJGA 1NKTA 2YNMA 3VFDA 4WZ6A 4OQFA 5BN3A 4ZDIA 1XZPA 4A2PA 3FPAA 1OXXK 1ZCAA 2OV2A 4D82A 4BZQA 2P6NA 4NZYA 2GZDA 2VHTA 1S0UA 1UEJA 3U4QA 4I99A 4FI3C 3QXCA 2GZHA 3GJ3A 2FWRA 4GNKA 4EQ6B 5AK0A 1QF9A 3Q8XB 1J2JA 3OEEA 4LHVA 1SULA 3RRMA 2YZ2A 2QMHA 2FFAA 2YVUA 3D6TB 1UKZA 4RFSB 4MRSA 1O87A 1Z6GA 4TLAA 4DLSA 5EP4A 3GLGB 1SVKA 3LXXA 2K5UA 3K8YA 2GXUA 2P65A 1S1CA 2GJSA 4V0LA 3W90A 5JJLA 1SXJD 1EX7A 4YXWD 4NH0A 5HTKA 2C9YA 4ASUD 1E0AA 4KITB 2XB2A 1U0LA 1E9AA 2ZSAA 5P21A 1U8AA 5L3RA 4Q7LA 2VP4A 4P33A 1VIAA 2PCLA 2IXEA 1T91A 1QG2A 1ZINA 3NBYC 2NO1A 4NYJR 5H1YA 3W5JA 5HR5A 3EZ7A 1TQ2A 4A9AA 4DEXA 2P2LA 2ZS7A 3KFXA 2ASEA 3A4LA 5DYIA 3FB4A 5J47A 4PQRA 2W0SA 2BDTA 1ZAKA 3MSXA 1N6RA 1EFHA 2RKOA 1YZTA 3TKLA 5J4HA 3J81k 2J7PD 4PO9A 2XNDA 2XAUA 5AJVB 1E0JA 2JIZD 1Z6YA 1TMKA 1ZNWA 3GLHE 3OFNA 3A6PC 5UKDA 4DT1A 2R6CA 1Z2AA 2P5SA 3RRNA 4JSTA 1EWRA 2IA5A 3K9NA 4FN5A 1XEWX 1AZTA 2WJYA 1E2LA 2F3TA 4BFXA 3QBVA 4WXPA 1P6XA 1W5TA 3CBQA 4TT3A 3QKSB 2EWWA 2MMGA 2OZEA 1YR7A 2ZAOA 3GLIE 1NY5A 1QHIA 4IJMA 4M1TA 4A6XA 1XXHA 3NXSA 4RKFA 1ZD8A 4HB0A 4DDUA 1II8A 4UXIA 5K8UA 2PH1A 2FDCA 2VHJA 2R44A 3IIMA 4BRWA 3A37A 2V6JA 5JSZA 1G4AE 1F48A 3AF2A 3P27A 1Z6XA 4DCTA 4URVR 4OL0A 4DZZA 2YINC 1F5NA 2WMNB 4PO1A 2NG1A 3RS2A 1M6NA 3JZAA 4UKDA 2V55B 3OHMA 1K5GA 4EPTA 2FU5C 2VQSA 1GDDA 2IWRA 3QPUA 4KVGA 5DNYB 2P6UA 4GFDA 4TL6A 1X1RA 1JR3E 2G3YA 3DVLA 4FW9A 2XTNA 4DCNA 3PJRA 4CEHA 2G0TA 1CRQA 4C7OA 1AQYA 3VR4A 4YMVA 4F93B 5KDLA 4RY2A 1EFRA 2Q21A 5KNCA 1E2DA 4D4KA 3IDQA 5J40A 3DOEA 5FPTA 1EK0A 5C46F 3KQKA 5JCZA 3C7KA 5GJCA 2D7DA 2C95A 1NVVR 3WHKA 2V3CC 4DDVA 2XB4A 3G82C 3N5CA 3FMFA 3LBNA 5KTYA 2QEQA 4NKRA 5D3MA 4AY2A 3RAPR 4JLPA 1CR1A 3EZ6A 3LD9A 2C2HA 1OJLA 1GNQA 1YJ5A 5CM9C 5EQTA 3UMRA 4IEIA 2OAQ1 1KKMA 3IQWA 1W2GA 5E3HA 2RGAA 3ADCA 3EXAA 1AS2A 4DIDA 4R9UC 1OFUX 1Z29A 1XTJA 4HB3A 1ZUHA 1G20E 2AK3A 5DI3B 3CNOA 3P32A 1NMYA 1M7HA 3D3QA 1L4UA 4MGKR 4U00A 2PEZA 1KI9A 2ZROA 1RYFA 1G8YA 1GL6A 1NBME 1GM5A 1US8A 4Q1FA 4PXAA 2H57A 2IYRA 3ZQ6A 2A3RA 5SZIA 3VMFA 4CW7A 4ASUA 5EE9A 1T3HA 2HDNB 3B9QA 3BE4A 4L15A 4A8JC 1J90A 4KFSA 1CP2A 2VTKA 3SYLA 4LJ6A 5L3SB 4PQYA 1KO4A 4M1YA 1M8PA 5DIFA 4RD4A 3W3ZB 2ZTSA 1ZM4A 3QF4A 4DC9A 2W2TA 4HAXA 2QE7D 3ADDA 4FXPA 1W0KA 3IKJA 1E2FA 2VP6A 1DAGA 4P0TA 4QKQA 1LNZA 1E1RA 4RFVA 2JLQA 3U7HB 4Q4JB 5IRCD 2V6IA 4LJYA 1FP7A 1VCIA 1DAMA 2CLDX 3FWYA 1MRSA 4HI0E 4OK6A 2ERXA 4QXAA 4TWZA 3NVAA 3T35A 4C0KA 3W6PA 4ZDKA 5TY0A 3DHWC 2DHRA 1KMHB 4LZZA 5JZVA 2QZ4A 1KSGA 4CT5A 3BH0A 2J0UA 5AUOB 1P72A 5CDFA 3ICQB 1TU4A 1VMAA 4DLRA 3BOSA 3VU9A 1EG7A 1CBUA 1E79D 5GADl 3QENA 1RRPA 3TBKA 3TSWA 3AF3A 3GEEA 2WWXA 1X86B 4RVCA 2WIBA 2J9RA 3EC2A 4LYFA 2PJZA 3R9IA 3ZVRA 4U02A 1G7TA 4BEBA 1P2VA 4S35A 3LV8A 4G5SA 4ZO4A 5JRZA 5JJKA 1U9IA 1KI6A 4KSBA 4ZPXA 3I72A 2NO0A 4QJ3A 5LD2C 1R0XA 3LXRA 3MWYW 4MITA 4OQNA 2CK3A 3H86A 1LVGA 3VR2A 3FGNA 4OI4A 3BB4A 3Q85A 4AIIA 5JCPA 3B13B 1PJRA 2F9LA 2GCOA 3NG1A 3T1VA 4Z1MD 2WOOA 4BPBA 1E2KA 1AIPA 1CTQA 2ZRFA 2G6BA 1YKSA 2ZS9A 1WRBA 5E7MA 1ZC3A 5DE3A 5DYGA 3THYB 1SKYE 1GAJA 2ZYTX 1AZSC 1CRPA 3E70C 1S4QA 2FF7A 2ZRLA 2AWOA 1O3YA 4K81B 4W5WA 5JFGA 3PUWA 4KU4A 2RGDA 1LV7A 4YMUA 2WKQA 4Q7JB 2CK3D 2BBTA 3M1IA 4V0NA 3E1SA 3F8TA 4JBWA 2EVWX 2ZI4A 4PPFA 1TU3A 4BLQA 1DELA 1BO6A 4W7SA 2RGNC 1Q20A 2NTYC 3CF0A 3PIRA 2O8DA 3IBYA 3B6EA 2ZRPA 1EGAA 2YWFA 3VKGA 4HLUA 3T34A 3GLGE 2A5FA 3JVUA 1S8FA 1PLKA 4ZCLA 1B23P 1IJFA 1V43A 4ILEA 1W4AA 2AXNA 4R7ZA 1TF7A 2P67A 3AUXA 4B76A 1E79A 3GPLA 2DFTA 1Q44A 4G5QA 1P9WA 4QM6A 1FTNA 1RJ9A 4IHQA 1JXOA 1LB1B 1BS1A 1WXQA 4MRRA 3ZQJA 1XDBA 1ZNZA 1HYQA 3OEED 4OHZA 3T12A 3U5ZB 5KNBA 1HQYE 4HEJA 2Q0HA 3AUYA 2ZRCA 1Q57A 1LY1A 3ND8A 2P0EA 1N0VC 4PZYA 3O8CA 2C9OA 5JMTA 1R5OA 2F1IA 1QBKC 4XH9B 5EXXA 3FHOA 3EX7C 2Z43A 1YZLA 2FFQA 2IYQA 1FUUA 1TF2A 2UZIR 4KFUA 4OI1A 3U3MA 3FFAA 5FBQB 4B34A 4B44A 1BYIA 1AJEA 2F1JA 2V1XA 2E1RA 5TXGA 4QFMA 4IOJA 3GD7A 4IFBA 2J45A 5EXSA 1ETUA 1MO3A 1GTVA 3SFVA 4HZUB 3WMGA 1AS0A 3AM1A 1HH4A 4NCKA 1XF9A 4I1SA 3T1QA 4DLYA 2G88A 2RGEA 3U3RA 3ZIAD 1TNDA 4TLDA 3IIJA 4UXHA 1KO5A 1PVOA 2PZFA 3LX5A 1YZGA 5C4MA 4FINA 1XRJA 1Z07A 3QPWA 3RS3A 3R7WA 4TYPA 3BH7A 4YONB 2KSQA 2Z4SA 3EZFA 3WP1B 4JJZA 1FOEB 3G0HA 1N6OA 5G3ZA 3TNFA 3LY5A 3U3JA 2PMDA 1SVWA 1GRNA 1QDEA 3P4YA 1IY2A 2LCFA 4LY6A 1W36D 1NSTA 2QRZA 4IEEA 1FMLA 3FHCB 1TQDA 4LJ5A 4M9XA 1NN5A 2RB4A 4PAMA 4QL3A 4PC1A 2WBLC 5L3SA 2JDIA 1X1SA 3B1YA 4PPGA 3QSYA 1S3SA 4XSGA 1EFRD 3BORA 2QBYA 1ZNXA 1UADA 1N2CE 4BECA 1X3SA 1BMFD 2V4ZA 1QVRA 1ZRHA 2FPKA 4TLEA 4A6PA 1QHHA 1M34E 1G5PA 2AN9A 4AI6A 3Q5EA 1FQJA 1XD2A 3QF7A 3SN6A 1G5TA 2WICA 2FGKA 2ZRHA 4GP7A 2JEOA 2FZLA 1OSNA 2H17A 3N2IA 2VRWA 3FMIA 4EUNA 2OBNA 3FOZA 2VLIA 2EFHB 3O8DA 4NDZA 4DSUA 2DPXA 4PHHA 3ZDQA 2QUZA 1XEFA 2ECKA 2IXFA 2HEIA 2R6DA 2NMVA 4KCGA 2FE4A 4NYIR 3CPHA 4BWYA 5CDFE 4NPHA 1RRCA 3A4MA 2XSZD 4LV8B 4DLUA 4LYJA 4X8HA 1KKLA 3C41J 4YQFA 2OBLA 3NBFA 1U2RA 2WJGA 2G1JA 1IXSB 1K8RA 1NLZA 1YE8A 2WM9B 3BFXA 1DOAA 1Z06A 3CPEA 3DZDA 4Q1BA 2G9NA 3KQUA 2CLSA 2ZYUX 1R5BA 4H1VA 1J8YF 2Q6TA 1E9FA 2DWQA 1N5JA 1OF1A 2UKDA 1E9BA 4IRUB 2W6IA 4NHOA 1XTIA 4Q5IA 1XXHB 1E96A 2RGBA 1R8SA 5KU1A 1ESMA 3ZGXA 1RVDA 4O2RA 4ACBA 1NSFA 2O0HA 1OW3B 4QGHA 3VKHA 1WCV1 4I1VA 5FTJA 5DN6D 1A2BA 2J7PA 2ZRDA 4WIAA 5BYJA 3VKWA 1KO7A 4GOKA 3GEIA 2GJ8A 4Q9HA 4ACAA 4R71A 4XD7D 2A5GA 1SVMA 3MD0A 4U7DA 2IYYA 4CEJB 5KYKA 3A1WA 2WAXA 1N6PA 3PUZA 1DAEA 1M74A 2CCJA 4FCTA 4R2IA 2JJ2D 4P3YA 3PENA 2QAJA 2AL7A 1U0JA 1FNNA 2A7QA 1W4RA 2FH5B 4PANA 5J5CA 4UNRA 1IN5A 2GJAA 3C16C 4Q4HB 1L2TA 3SQXA 3LRPA 4YXWA 4Q4AB 2H1LA 2OCPA 3K0FA 3CZQA 3MJHA 1ZMXA 4HLUC 1ZC4A 3TUJC 3CNNA 3FMPB 3TR0A 2WJJA 1IHUA 1L7VC 3CPJB 4HAVA 2YKGA 3GLGA 3PVSA 4LUCA 4RFSA 3Q3JB 1QHHB 4AYWA 2OSBA 3SHFA 4RD1A 1E2EA 1UFQA 2GCNA 5KNDA 3V00A 2QBYB 3EASA 3TVTA 2BWJA 4IXMA 1T8UA 4B33A 1J99A 1FNMA 4LJ9A 5EP1A 1OFHA 2DBYA 3QUSA 3UKDA 1KHTA 1W1WA 2HXYA 1P9RA 4X8MA 4NMMA 3H2YA 4QG7A 1QHXA 1V5WA 2JAQA 1FX0A 1E9EA 1KYIA 1N25A 2I3BA 2CBZA 3IQXA 5CM8B 3VNUA 1TQ4A 4LBWA 3CUEF 1ZVQA 2RGCA 3U7GA 2ZJBA 3IUYA 4E5UA 1CIPA 3CM0A 1XCMA 1OYWA 3CWQA 4LRWA 3GJXC 3K9GA 3FKSA 3OAAD 1E2NA 1R0YA 1SKYB 3KXLA 4D4JA 1NLFA 4LHWA 3QEJA 2WSMA 3OIVA 5IK2A 1FUKA 1AQUA 1LFDB 4O0MA 3WNDA 1G6HA 3CX6A 3MFYA 4WVFA 1N0UA 4C2TA 3V9PA 2B8WA 1BYUA 2CCKA 4TMVA 2ORIA 4I4LA 1EX6A 1QHGA 2JLRA 2A5YB 4URYR 2Z6VA 3SNHA 2JCSA 2OLKA 2YJTD 2QN6A 2W00A 4MKFA 5B64A 2FOLA 2DFNA 4FWIB 2DFLA 4AKIA 2AFHE 2OILA 4Q03A 3K70C 1WBBA 3RWMB 2ZE7A 4Q47A 1KI1A 3CR8A 3WNBA 2GZAA 1YVDA 4M53A 5BN4A 5JI3E 1WF3A 2BJVA 2KE5A 4BZPA 2C98A 4PC7A 1P7CA 4EDHA 2HF8A 1IBRA 1AA9A 2PLRA 1ZYUA 5FBRB 4B3CA 5LB4A 4D4MA 1SQ5A 4JLJA 4DLWA 4LK2A 4DHEA 1N5IA 3ZJYA 3RSLA 1XCPA 4C0HA 3WMEA 4HAYA 1XEXA 1DAKA 3SYNA 3DM9B 1ODFA 1XD9A 2WWFA 3CO5A 2QT1A 4JVLA 1XWIA 3CLVA 3GQBA 1F2TA 2QP9X 3GCGA 3MGCA 1S9DA 5EZ5A 3WBJA 2BOVA 1EFTA 1SVLA 3DPUA 3FKQA 5JECA 2OO7A 4HB2A 1W7AA 3ADBA 3QXJA 1ZIPA 4B32A 1KOFA 2C9CA 3L43A 3Q9LA 4DCUA 1TUEA 2ZXUA 4JL8A 4TMKA 4XOIA 1DS6A 1TAGA 3IEUA 1KNXA 2YHSA 3LLUA 4QNRA 1HEIA 4QHTA 3F5FA 4TLCA 2ORVA 3I61A 4HUTA 1G7SA 2X77A 1XMIA 4I1OA 4XD7A 1JJ7A 4QM7A 3AVVA 5GJWC 3NBZC 3UMSA 3PXGA 3EPLA 2GBLA 4FWTA 2IUTA 3C8UA 2DR3A 5TB5A 2IHBA 1ONBA 5BXQC 1E1QA 5JJIA 1FL9A 2FA9A 3FE2A 4GZMA 1E2QA 2A2ZA 2W6ID 1KY3A 3BGWA 3OE7D 1KK2A 3THXB 1R0WA 5GVRA 3RC3A 4MUAA 1G3IA 1CULC 1G9XA 2QP4A 3OIWA 5CJPA 1NKSA 2ZSBA 2XJ4A 1TL7C 3MWKA 4LJ7A 1PV4A 4JBYA 3BJIC 5A5GA 2HV8A 3U6KA 2J0UB 4LC0A 1D5CA 1ZIOA 2IBMA 1E9RA 4J0QA 1D2EA 3SJZA 8OHMA 2LWIA 3BBPA 2WJHA 1AS3A 4Q9KA 4DEYA 1E2IA 5FOVA 2OAP1 1I2DA 2PZEA 3KFVA 2ZE8A 1KIMA 1OLOA 3KKPA 2OFOA 1KAGA 4OQMA 1IAQA 4LBYA 2VL7A 5GVSA 1J70A 4EPXA 1GSIA 1YRBA 3C14C 2ZJ5A 2GXAA 3QKRA 1ZM7A 5KSOA 4BUJA 3EG5A 3OEHD 1WDTA 2GJ9A 4YLGA 4F4JA 1UKEA 2I1VB 1OH7A 1E94E 3KB2A 3U61B 4A2QA 4GP6A 5L3QB 1BMFA 1H8EA 3IHWA 3UANA 2OXCA 2LKCA 5FUWA 4LC1A 5CIQA 3KQHA 1IY1A 2WWIA 4GRAA 2G0NA 1K6MA 3I92A 4MGYR 5IHPA 3RHFA 4DJTA 1VYVA 4MKGA 3REGA 3KQNA 3LDAA 4HUQA 4PZZA 3KKQA 3NTUA 2ORWA 4IOLA 2O52A 4MYHA 1CJKC 3A8TA 2OBMA 3THWA 3GFOA 4G0NA 5FOTA 1XPUA 3A58B 4TMWA 3B9PA 2F3RA 4I81A 3I73A 4JJKA 4DCSA 1WQ1R 3SU8A 1NVUQ 4M9SA 1E2MA 4XTRA 2CL0X 2JIZA 4LGMA 3SJAA 2BMJA 1U94A 2VA8A 2XNDD 5E7IA 3DKPA 4R2HA 4BFTA 3G5UA 2MSCB 3I32A 4Q66C 4QHSA 2QSZA 2VH5R 4O25A 1Z83A 4PR0A 4RZ2A 4TTQA 1H65A 3TVDA 4D0GA 1XNJA 2R65A 6Q21A 2ATXA 1ESNA 3EA5A 2DYKA 1W5SA 3I8SA 5L8VA 5EP2A 1VCNA 4EFMA 2CVFA 4C7OB 1W48A 2PZGA 3EC1A 1G5RA 4GOJA 3TAUA 3K9LA 2QAGB 3GLHB 5AJWA 1NF3A 2MMCA 4JLAA 4M21A 5E95A 3ONWA 3QOFA 3CRW1 4MDFA 2QM7A 4FMCF 1IM2A 2IHYA 3SFZA 3WY9A 4C2UA 2CE2X 1Y63A 1GNRA 3QY0A 1OH8A 1Z28A 4L4UA 2XOKA 5FUYA 2REOA 3CONA 4Q9LA 1DADA 2J3EA 4KYIB 5EE3A 5CYPA 4HDOB 5B30A 4M1OA 4PSAA 5JSZB 5TMPA 4HYYA 3AP2A 4YMSA 1GL7A 4LBVA 1NMZA 3IGFA 2KJQA 2QRNA 2CHGA 3VX4A 3O8BA 2ZYVX 3CH5A 3HU2A 2O8CB 3ZYCA 4ZI3A 1RJ9B 3IO5A 3TH5A 1W0JA 2F1HA 3B7GA 1YZKA 3BFKA 4NCHA 4G5OA 2CHQA 4L9WA 4FMDB 3QKSA 1JEEA 4ZIRA 2HUPA 2H7VA 2HLDA 2QGNA 4UNSA 2WVJA 5DISB 2CNWA 3ZVLA 3EIEA 4IOKA 4KSCA 4OYHA 2NO7A 4B3BA 3HP1A 4A0FA 1GITA 2DCUA 1W36C 1GWNA 1UF9A 2PEYA 2QTFA 3KJEA 3NIBA 1SXJC 2JJ1A 3IHLA 4Q48A 1NG9A 1JQLB 4UQOA 3BH6A 1TPZA 4DSNA 2B21A 1W47A 4LX0A 3TW4A 1JECA 5BWMA 2IT1A 4JVMA 3RRZA 4EJSA 3VHLB 5FPYA 3QVUA 5FI0B 1M2OB 1FMJA 3OIUA 2ZRJA 3EWAA 2XXAA 1SKQA 2BCGY 1JQJC 4Q7MB 1MH1A 3L0SA 1XU4A 4NL4H 3PEVA 4DXAA 1MO4A 1GKYA 2WPDA 4B43A 3SYKA 2J1LA 2RGNA 4LSGA 3WHLA 1E32A 3P26A 1Z3IX 2D7CA 2W6JA 4JKYA 1F2TB 2JLSA 4LJ8A 4HDQB 1CJUC 2GJKA 2X19A 2YC2C 4OHWA 1Z0IA 1KSFX 4PX9A 2WWWA 4JZKA 5JS7A 5CB8A 3PUXA 2QROA 2WJIA 2EFCB 3CKLA 2QP3A 1NG1A 1DO0A 2QMUA 2FG5A 1G3UA 1Z0AA 2J5XA 4LJAA 4N0EA 1G1MA 4YMTA 1Z08A 4C0JA 2AD1A 2KB0A 2Q9CA 2IK8A 3M4YA 2NPFA 1PUIA 4TMTA 4DUGA 1HV8A 1XBTA 3QJYA 4M1SA 4CEIA 4G01B 2XITA 5JRJA 1MOZA 2CMKA 2ODNA 2WZQA 1WE2A 4YDSA 2GKSA 1GRQA 4KAXA 5TARA 2EU8A 1DVRA 1DO2A 2BEKA 2CXXA 3B1VA 2NZ8A 3DOFA 4IW3B 4D26A 1SXJE 3TUIC 3AVXA 3GLFB 3D31A 1Z0KA 2IF2A 2J46A 5G41A 3UATA 3MAAC 4IDHA 4PHTA 5LBIA 4NCJA 3LNCA 4OJQA 5FUVA 3GLFA 3KDSE 2OCYC 5H8WA 1CF4A 3TSOA 3UK6A 1NLYA 2ZRNA 3BERA 4BFVA 4XVRA 1E1RD 2JJ8A 3OF5A 1G3MA 4HSEA 3RS4A 3SJCA 5AJYA 4ZI2A 2XTZA 4TYNA 1W0KD 4R98A 2JLWA 2CHVA 2ZEJA 1W4BA 3W9YA 3LLMA 1G64A 2VHUA 2P3SA 4OJKA 2H5EA 2O5VA 2Q3MA 2ZJ8A 4B48A 3THOA 4E03A 4M2LA 4P4SB 4TQ9A 3V4RA 2GHIA 4TSFA 3X2SA 4HUQB 1IN4A 4F38A 2OEPA 3KKMA 3AVYA 2OESA 1OKKD 1SHKA 3TUZC 4P31A 4KFTA 5KPDA 1G7RA 1GKIA 2W2VA 1ZU5A 4AKEA 4JLKA 1XMVA 3PCRB 1MKYA 3AVOA 4IVRA 5FOWA 3QXHA 4LPSA 2OLJA 1JEDA 3PV0A 2GNOA 2D62A 4PO8A 2WSSD 1UKVY 5C2JB 3QEOA 2V1UA 4LHZA 1P62B 1YRAA 3KUDA 5L3QA 1MO5A 2FZ4A 2F43A 3SS8A 5EJEA 4BE7B 2RGXA 5DI3A 4M9ZA 3IPXA 3MWLA 3QE0A 5BN5A 2BBWA 3CIOA 4JYBA 1XCGB 4A15A 1FTSA 1ZD9A 2H92A 4XIGS 1VG9B 4DKXA 1KJZA 3A36A 3TIFA 1NIPA 3U60B 1F2UB 2GF0A 3AVPA 3U7EB 3P20A 3B78A 1GL9B 2QM8A 1E99A 5HCIA 2O8EA 5EE1A 1Z6TA 3HWSA 3HR8A 1Z2CA 3LA6A 5TV2A 4AG5A 3M0EA 3GJ8A 4TTPA 1GOTA 3PEWA 3NHBA 5DSZA 2JLUA 5KPJA 5DN6A 4M22A 1N6IA 2E87A 1XX6A 2XOKD 2KI5A 5DHFA 4M0LA 4EKDA 3W5IA 4QGGA 2Q3FA 2D4HA 2GETA 3B60A 4XWAA 1DG1G 3BC1A 1ZM3A 3T61A 4IDPA 3EAQA 4UNQA 2HT1A 1MT0A 4JL5A 4PAOA 3KQLA 2IYWA 1Q1ZA 3C4JA 5CK5A 1RYHA 1YR8A 1Q12A 2YC4C 3FVQA 3I1FA 4UNPA 4DWJA 5K8IA 3ZS9A 3K0CA 1R6BX 521PA 4EJSB 1UBFA 1RC8A 3B1XA 3WBKA 4AURA 4K46A 1NN0A 1UBEA 2QY9A 4D0NA 2C77A 5CK4A 1OHHD 4TZ6A 1HT2E 3GLIB 1C9KA 2XSZA 3I5XA 1Z0JA 2ZS8A 1IXRC 1GVNB 5A0FA 1KO8A 1KZGB 4P4TA 4NCNA 1RZ3A 1WB9A 5H70A 1NBMA 5HCNA 5AUPB 3L8YA 2AHOA 3OESA 4O2LA 4RZXA 4OKSA 5H68A 4A36A 2ZM5A 2DB3A 3I4LA 2O8EB 2F55A 2YYZA 3LVRE 1KNQA 2D2EA 1JPNA 1M1YE 3BWDD 4V0ME 3QKTA 4JYCA 3IEVA 4CGZA 3E5HA 2ZPTX 1Q1QA 4HLQB 4G3XA 4V02A 4IDQA 2EYQA 4A0RA 1CEEA 2GVZC 4YMWA 4AK9A 2EFGA 2CLCX 2QPOA 3QKUA 4CF7A 2JDID 2KBFA 4GOXA 1PZNA 1WA5A 3AVUA 5E4FA 1DAHA 3O8RA 2IYUA 2HJGA 2ZI7A 4KO8A 221PA 3CH4B 2PLFA 4D4LA 1ZM9A 4PTLA 1LW7A 1T0JB 3ZZ0A 4BFYA 4S2EA 3MG9A 1HQCA 3AV0B 1TUIA 3KKNA 2Z4RA 2J59A 3BB1A 3LFUA 3K0CC 4MKHA 5C1BA 1SXJA 1T4GA 2RMKA 4OI2A 3QQ5A 4MGIR 4A2WA 1XPOA 2VIIA 4DSOA 1AKEA 1G41A 1R2QA 4PPQA 3QBTA 1XEXB 3HJNA 5FTLA 3LO5A 2C96A 1OIWA 1VG0B 2PBRA 1N5KA 1XMSA 2ZR7A 4YC7A 5FTNA 2WSSA 1C1YA 5KSZA 2H18A 3EPKA 2W83A 3R7WB 4DDWA 1XMJA 3E2IA 4US2R 4RCYA 2OCAA 3CR7A 1A7JA 2E9SA 2OFXA 4WZAE 2BV3A 1P2SA 4QJ5A 4LV5B 4NCIA 4C4PA 1HTWA 1U99A 2ZI5A 1Y3AA 1F60A 3U4QB 1GILA 1G18A 5J4VA 5HE8A 4AG6A 3A1TA 2HJVA 4W9MC 1FZQA 1KK0A 2ZVPX 1G16A 4B75A 2QL6A 1JPJA 2UVQA 3GJ7A 3AVTA 2AFIE 4IKEA 2R62A 3U6BA 1KI3A 4JLNA 4CYMA 821PA 2CDNA 1OB2A 4F92B 5DH9A 4DCVA 2X8AA 3B5JA 3FDIA 2JATA 1B0UA 2XNSA 1S1MA 4LOAA 4TL8A 4DLTA 2GBLC 3N70A 4Q18A 5J4KA 3KKOA 1OFTA 2AX4A 1E2HA 1XP8A 1A1VA 2RHDA 4NE2A 2WWHA 4Q7KA 1L8QA 3EW9A 5HKKD 3P4XA 4BLSA 2GK7A 4PC3A 1QVAA 2GDJA 1NVXQ 4AC9A 1OIXA 2CL6X 5IF9A 4IDNA 3BIFA 2QG6A 3EZ2A 3KTAA 3KJHA 5ANRB 3HU3A 4C30A 4HAUA 2IX3A 1SZPA 5LB2A 2N46A 1IQPA 3BFVA 5KDOA 4XSHA 4RKEA 3BRWD 4OBEA 4F91B 3TLXA 1AGPA 1R7RA 4GL2A 3K70D 3RWOA 2WKRA 5FFMA 3WYGA 4M1WA 2ZANA 4CRWB 1G7CA 4WXRA 2TMKA 4TQUS 2IEYA 4TZ0A 3I8XA 3AKYA 5FBLB 2XXAB 1NP6A 2ZREA 2IYSA 1DAIA 1MRNA 3R20A 5DGXA 3BK7A 2VO1A 4DIEA 5FH9A 1RE0A 2QMOA 2JLYA 1DBSA 3A4NA 2O0KA 1U9IC 1CKEA 2QENA 2VEDA 4PC2A 2W0MA 3L8ZA 1KK1A 1W49A 4Q9IA 2CJWA 3RS0A 4EPWA 5HZHA 2IYXA 3O47A 2RH5A 4D25A 3TMKA 2XZPA 4LCBA 4A82A 4F7WA 2IYZA 2R6AA 1OXVA 3PFIA 4QBIA 3CRQA 1N0WA 2OE2A 1UJ2A 1D2MA 2QPTA 1R5NA 5M04A 5HKKA 1R10A 1VECA 4TQAA 1RRFA 4K8OA 5KOYA 2BCJQ 3L0PA 1YZQA 1OXUA 2A78A 2ANBA 2DWPA 4KBGA 2HCJB 2VHQA 5CLQA 5FPKA 1XPRA 2IYVA 3I3SR 3L0IB 2WTUA 1DG3A 1NL3A 1CJVC 3W8NA 1L4YA 2V7QD 3FYHA 2YOFA 1VCMA 4TL9A 2JJ1D 3L2OB 2WKPA 3GJ5A 621PA 1XZQA 4HZIA 3AP1A 1JAHA 3SBDA 3TK1A 2ZU0C 3LWNA 5KDDA 3IO3A 5SZJA 1Q3HA 3ZLJA 4O3MA 2B7CA 3SDZA 2C04A 1KDTA 3TSZA 4QBGB 1TX4B 4IXNA 1P4SA 2CNWD 2VSOA 4WA7A 2JASA 1Q1EA 5C18A 4KYUA 2FSIA 1KDOA 2A5DA 3TQFA 4ZKDA 5J4LA 2B7BA 2GF9A 4HLCA 2ZRMA 2O8CA 2D2FA 1KDPA 4DBLC 4L16A 3D8BA 4A8JA 2X2EA 2XEXA 3T5DA 2R2AA 1XJCA 1E69A 3TE6A 4A0GA 4ARZA 4DVGA 4Q21A 1FFHA 1GUAA 2ZVQX 1Q3TA 5FOSA 2WV9A 3U3KA 4XVQA 2VYFA 4JIMA 1ZUNB 3L82B 2OM2A 1UPTA 5FL3A 3QF4B 3TGPA 2Z83A 4Q19A 3FMOB 3EWSA 4Q01A 4QGFA 5B58C 2QE7A 3SHWA 2MSDB 4Q9JA 4BFUA 3R8CA 1R0ZA 3AP3A 1UAAA 2RHMA 4QJ4A 3HPQA 3R8FA 4QGAA 5EXPA 2QSYA 2VSXA 1P73A 2DY1A 4ABYA 5SZHB 2R8RA 3CF6R 4GSYA 1P3JA 2FEOA 1XXHE 1LF5A 2IF0A 4BQSA 3X1ZA 4B47A 2GA8A 1I4DD 1JR3D 1MV5A 1IJEA 2WHXA 5GJBA 1CXZA 2GEUA 4D6PA 4DLXA 1W46A 2C99A 2NIPA 4N0DA 5TDHA 3ZZTA 3LVQE 3TJZA 1K5DA 3QPVA 3R9WA 2VP0A 2QTHA 4FCWA 4HB4A 1Z63A 2RAPA 1JI0A 2F7SA 2IXGA 1ZCBA 3CX7A 1OB5A 1OKKA 4Y0VA 4PSKA 5BQ5A 2YWHA 1TEVA 1OV4A 2L0XA 5IT5A 1NVVQ 2P6RA 3T06B 1UEIA 2QU8A 3QXSA 1HT1E 5G40A 4DSTA 5CIWA 2VHCA 3KXIA 3VR5A 3QG5A 3K1JA 1ANKA 1D8TA 3RSOA 5JHGB 1IONA 3VR6A 4D81A 4B2LA 1XJ0A 4B35A 4WAUA 4E09A 5CITA 1IOZA 4LV6A 2ZITA 1Z0FA 2VPPA 3SZRA 4V0MA 1ZW6A 2V7QA 4MRVA 2FGJA 3ZS8A 1OHHA 1SXJB 3AF0A 3DL0A 2IYTA 4N1AA 5AUQA 5JS8A 1KSJA 2PMKA 1GIAA 1EFUA 3THXA 2QT0A 3AVWA 3ASZA 3MUFA 4MUBA 4KVAA 2J7KA 1E6CA 2ZE6A 2OXRA 2ZYWX 3AGQA 3EIQA 4V0KA 2ZSEA 4W5JA 2AK2A 2QORA 3MCAA 3SC3A 4FMBB 3HU1A 2Z5FA 4NU0A 1P2UA 1XTQA 1COWD 4OQLA 4P4UA 1D2NA 3LQQA 4M4SA 4Z54A 2IWHA 1AM4D 1P5ZB 1BH2A 4JBXA 2ONJA 4P32A 4RD6A 4CEJA 2CCGA 5DI9A 2ZJYA 4QRHA 1T9HA 2B8TA 1P75A 1T8TA 3KZ1E 4DLZA 1DARA 2FEMA 2IW3A 2ZRGA 2ZQ5A 4ESHA 3BS4A 3PITA 2AKAB 2BEJA 1OFIA 4BLRA 3WRYC 4A4DA 2YOHA 1W36B 1KTVA 1MABA 5SZKB 4EPRA 4BFSA 1JB1A 1OXTA 2ZETA 1OE0A 4M9QA 1RW4A 2EWVA 2EFEB 1W44A 3K09C 1TQ6A 4Y0AA 1CJMA 1OXSC 4XJXA 2QPAA 1E9DA 5EE5B 1A2KC 3WRXC 4CT4B 2DWOA 1JALA 1YU9A 4F4CA 4Q1CA 4JT2A 2QMEA 4GDFA 2VP5A 2BKUA 1QHNA 4XWOA 1MR3F 3OE7A 2GILA 3UPUA 1RIFA 1X8LA 4UJ5A 1MABB 5LPNA 1UDXA 1PUJA 2QAGC 4EIWA 4II7A 5L3VA 2I4IA 1KJWA 4EJSC 3OIYA 3RNLA 4DT1B 1UBGA 4PPNA 2BMDA 1EXMA 3KJIA 4V0OA 3KXKA 1E4VA 4MA4A 5LD2B 5F9HA 2ODWA 3X1XA 1CU1A 2BMEA 4LJ4A 5C4GB 3RS5A 1WP9A 3SEAA 3DKVA 3N2EA 3K53A 4GPTA 5FR1A 3WP0A 3BAFA 4LHXA 3SOPA 5LDDC 3DMNA 4MYTA 3AGPA 1CLUA 3THYA 4YDHB 4TSFD 5EE0A 2D06A 2GXSA 1BIFA 1IY0A 2V54A 3X1DA 3NKVA 1KY2A 4RD0A 2AR7A 2GEDA 5HPYB 3EPJA 1KI4A 3W8RA 3C5CA 5GJVC 5JLJA 3EPHA 4C0BA 1NN1A 4POAA 1XD8A 2CL7X 3LW8A 3PR1A 1XFAA 1KI7A 4URUR 5FBVB 3H0KA 3ND9A 2JLVA 3RC8A 3SQWA 3REFA 4MRNA 4ESVA 4KODA 4E22A 2ZRBA 1SGWA 2QAGA 3GLHA 3AKDA 1OYYA 3WNCA 3WXMA 5K8TA 5EZ6B 3NH6A 3PEUA 1ZJ6A 4FIDA 4ZV4A 3IIKA 1G3QA 2QQEA 3LW7A 3IILA 4P4SA 1OIVA 4M1KA 1YQTA 3B8HA 3ZVNA 1EFCA 3F0TA 4DLVA 4B74A 4US1R 5CYOA 1XTRA 2ZJ2A 4EFNA 5G53C 2VP2A 1G6OA 4PHFA 3EARA 2XGJA 5FOXA 1U81A 3GLFE 1F6BA 4BLPA 3WMFA 4L5BA 1COWA 3GMTA 2QA5A 3PUVA 4B3XA 1N6KA 2OHFA 1SVSA 5IK2D 2F6RA 1GP2A 4TMZA 3NDBB 2ZJZA 4LHYA 3K0EA 3A1UA 3ASYA 3QNUA 2NZJA 2BMFA 3VHXA 2FSHA 3OAAA 5DLQC 1X6VA 1NIJA 3RLFA 1FX0B 1Q22A 5D3MB 2ZJAA 2ODBA 3Q72A 5KO2A 4PAQA 2IUUA 4AKHA 2WPDD 3PEYA 3B82A 3D7MA 2RGGA 2MSEB 2YWEA 3TW8B 4MYUA 3VQTA 1SVIA 1T5LA 1E2JA 1DTSA 2GAOA 3SJBA 4US0R 4Z1MA 4JMPA 1LTQA 1Q1BA 2V9PA 2YV5A 3ZD7A 2IS1A 2VSFA 3RVBA 4D80A 1BKDR 1AN0A 3W34A 5ELXA 1VYUA 3QG1A 4CIDA 4AKGA 3GEHA 4Z8XA 1N6NA 1UKYA 1GRRA 3NHAA 4GZLA 4LPKA 2GWHA 2FPLA 3TR5A 1JNYA 3Q7QA 3CWZA 3KUCA 2IUSA 4Q4HA 1S3GA 4XWKA 4TYYA 1UBCA 3MRSA 1VKJA 4OHXA 3LQRA 4PC6A 3UG7A 3VAAA 4MDEA 3K0FB 3T1TA 3RANA 3Q7PA 4MKIA 3WYAA 1JR3A 4C3ZA 1EWQA 4C9BA 2OCBA 4GMXA 2CEAA 4Q4LA 5E7JA 2REBA 2BBOA 3DEFA 2QNRA 3OEHA 3LAWA 2HLDD 2O0JA 4I1UA 4A1FA 2I1QA 2VBCA 2B92A 4BZXA 5K8LA 1QHYA 1N6HA 3L0OA 1II8B 1H8HD 1R8QA 2BBSA 4IFEA 4FCVA 1D6JA 2G1KA 1AGRA 1W0JD 3GFTA 4RCZA 1T3SA 3CNLA 1NY6A 2ZRKA 1E0SA 2XZLA 3GJ0A 1M7GA 2J87A 4H9GA 2VP9A 2O8FA 3BD9A 1FQKA 4RZ3A 1TEXA 2KWIA 3UMFA 4Q1AA 1XD2B 3VTKA 1VHLA 1ZU4A 5EXTA 2C78A 5DO9A 3KB1A 4JLBA 5FBWB 1YZNA 3MMPA 3GLIA 4A0HA 2ONKA 1Z5ZA 3T1OA 3AEZA 1S96A 4TYWA 4IVPA 2QI9C 5D3QA 2VF8A 5B2ZA 3P1JA 2Y8EA 1JBKA 3NH9A 3PUYA 4TTRA 5FPSA 2GESA 2NPIA 3A1SA 1AKYA 2GEVA 2ZI9A 2WWYA 1W2HA 2AD5A 4JL6A 4Q1DA 4X8OA 2ATVA 3T5GA 3C5HA 2WWGA 1HUQA 1OPXA 3V4FA 4ON9A 1PLJA 3LH5A 3W3AA 2ZIAA 4JVSB 5JWRA 1ZBDA 4Q1EA 5KUTA 4UJ3A 3VX3A 3NEYA 3K9HA 4G5RA 4Q02A 3WYFA 2F9MA 4UXJA 4BRUA 3AKEA 3CW2A 2NO9A 4Z51A 2EFDB 1US8B 4B6FA 3DZ8A 4AD8A 1KMHA 4H1UA 3SBEA 4OK3A 2SHKA 3B1ZA 3AKCA 2HT6A 4QNMA 1HE8B 2BC9A 2Z0MA 3CX8A 1E2GA 1VPLA 3IPYA 1G19A 2G77B 3CRRA 4FD2A 4KI0A 2IS2A 2FX3A 2PX0A 1GKUB 2W2XA 3AVQA 1D9ZA 2ODEA 3PQCA 3Q5DA 4W5HA 2BHRA 3C15C 4ARZB 5KHOC 1GNPA 1A82A 2QGZA 2FNAA 2PT7A 4LBZA 1VHTA 3U2QA 4QBFA 3AF4A 3VR3A 2D74A 4JLOA 5AWFC 1NNEA 4V03A 3NC1C 3AH8A 2QQ0A 2REXB 1NVWQ 4PFSA 1JJVA 1ZNYA 4JVNA 1EESA 3QXXA 1KAOA 4C0SA 4BLTA 2IL1A 4GT1A 1E9SA 2O8BB 1I4TD 1RRGA 1QRAA 2IYLD 3W6OA 1G4UR 3ZVMA 2ZUBA 5BYKA 3R9XA 1JXMA 1KZ7B 2J0SA 4URXR 4F4IA 4URZR 5FL7D 3ADKA 1OH5A 2Q9BA 1KSHA 3U7FB 4RJLA 1SVOA 4E07A 5HE9A 3MJRA 1NN3A 2W6JD 4TN1A 1Z47A 1FP6A 1G8HA 1JR6A 2FPMA 721PA 1Q0UA 2ZR9A 4HDCA 5F98A 4UNNA 3RABA 3OFND 4KHZA 1J8MF 1E1QD 1NJFA 5IDVA 1KMQA 1LS1A 3K0AA 4NBSA 1IN8A 3SI7A 2IS6A 1ZM2A 3EZ9A 2X2FA 2NQ2C 3A1VA 3I5YA 2Q9AA 2WOJA 5FTKA 2XX3A 5KSYA 1HA3A 1C4OA 1HURA 2HYDA 1Z8FA 2AKYA 1TTTA 3W6NA 2ZR0A 3GJ4A 3DMDA 2GAAA 2X1VA 1CR2A 1OT3A 1S2MA 4URWR 3ZH9B 2FSFA 2BJWA 4ZCMA 2EW1A 2NGRA 4FMDF 4HATA 3CRVA 4KFRA 4ZDWA 3LBHA 1S9HA 4EPYA 2GCPA 1X8JA 5EP3A 5JI2E 3NBXX 1T0HB 4C0AC 2G83A 5G3YA 4C0QC 1G8GA 2W58A 421PA 4GBMA 1M7BA 2PT5A 4GI7A 2FFHA 4B2IA 2XJ9A 1YZUA 2OFWA 2GXQA 4OK5A 2ZSDA 3HDTA 1KI6B 3M6AA 4BGDA 3SR0A 2FMXA 2CJWB 1U0HC 1W4CA 2ZRAA 1OH6A 5TVKA 2ZI6A 2N42A 1HE1C 4PSVA 4G5GA 4ITRC 4QC2A 1IN6A 3FTQA 2PJRA 4IDOA 3OZXA 2EQBA 4WW0A 5FUXA 3U3OA 4LDJA 4NP6A 5JEDA 3H4MA 2YOGA 3ETLA 3BB3A 5FOUA 4A92A 1P60A 2Q3HA 1LS6A 4QOSA 1IXZA 4RZUA 3B85A 4MQBA 1VCOA 2ZRIA 3K0AB 3QVVA 1XTKA 2AXPA 3UXMA 3S1AB 3AF1A 1N3BA 5CLLA 2ZI3A 4JT4A 4DB4A 4AWXA 1F2UA 1U8ZA 4CVNA 4LYAA 2WIAA 3NWJA 4QHYA 1XB2A 1I4LD 4B3GA 2JGNA 1G21E 1A4RA 3H84A 4KLZA 3AQ4A 2AWNA 1QHSA 4EQ6A 1U98A 2KBEA 1II9A 1YR9A 1NBMD 4ZCIA 2NO6A 2GRJA 2A30A 5FL7A 3UIEA 1UDWA 4JLMA 3KTAB 4L9SA 4LWZA 1ZD1A 3FFBA 1Z6AA 1FPMA 2NOAA 4JS0A 5FR2A 1CS4C 1I2MA 1P9NA 2ANCA 3VNVA 1KI2A 1VTKA 1MO6A 2ZE5A 3PG5A 2LKDA 2ZSFA 3MLEA 1D9XA 1P61B 3U44A 1CJTC 4Z8YA 2A5JA 1GZSA 3RYTC 5JBQA 2ZUDA 1J7KA 1KK3A 4RD3A 1F3OA 3NEJA 5FPHA 4DB2A 1G17A 2UZ3A 3NC0C 1X8KA 3LBIA 5J4YA 2F1RA 4X8LA 3SE0A 2O8FB 1VG1A 3K70B 4DRZA 5JWOA 4JSYA 5F2EA 3B2EA 1YR6A 4JLDA 2IEZA 3X1WA 4OHYA 1E9CA 2HCBA 5EUMA 2N1BA 2P5TB 1FW6A 5DHAA 3HYRA 3THWB 2YWGA 2O8BA 3HR7A 2RCNA 1H8ED 4QBHA 5AUNB 1U8YA 3I62A 1G8FA 4TMXA 4PHGA 4OHVA 2OG2A 2JLZA 3UWKA 3FHTA 2FSGA 4IVQA 2H8KA 3JVVA 3F3YA 1LF0A 4AYXA 4BASA 1NRJB 3KL4A 1RKBA 2J0VA 1GG2A 4NYIQ 1YHNA 1E4YA 1G8PA 3QIAA 4FMCB 5FI1B 4AYTA 2HXSA 3U44B 1VDZA 2PCJA 2JJ2A 3TAHA 1BOFA 2WAYA 1VG8A 2C5LA 5BW8A 1CR4A 4DDTA 1R4AA 1KO1A 4HZUA 1JAIA 4MGZR 2CE7A 1CR0A 4A8JB 5AJXA 1T6NA 1WMSA 3QKRB 4ZKEA 4ZDJA 1ZUIA 3EIHA 1NMXA 2D3WA 3K0SA 3T15A 1E98A 1RFLA 4BEJA 4TYQA 1WBDA 4L8GA 3CB4A 2PL3A 3HPRA 4PZLA 4GMDA 4HAZA 1E2PA 4N3NA 2CVHA 4MYCA 2BM1A 4CEHB 3UG6A 3CZPA 1DE0A 1G291 2XZOA 4ERNA 4NTZA 4NYMQ 4HAWA 1P2TA 4LYHA 2B6HA 4RD2A 2BVNA 2HF9A 3EA0A 1ELOA 3CF2A 3DM5A 1U90A 4KV9A 2J41A 4M8NE 2ZJOA 2ZU6A 4MH0R 5B57C 1Z0DA 1QG4A 2OUKA 4KBFA 4WBSA 5JWHA 5F3WB 4CEIB 5CB6A 2FJUA 1DAFA 2H16A 1Q21A 2V8OA 3GP8A 1XTSA 3GJ6A 4Q4AA 5JEEA 2PX3A 4G1UC 3ZD6A 4HLDA 2XTMA 1E3MA 4D0LB 2IC5A 121PA 1ZP6A 1H8HA 4WOPA 3TRFA 1VIYA 2GK6A 3IBGA 1II0A 2R6GA 2O8DB 1N5LA 1XEWY 5KSPA 4C0LA 4BFZA 3K09A 3KJGA 3S1AA 1HY3A 4JKIA 1G3RA 3MWJA 3CRMA 1KI8A 4B6EA 2DFKB 3KX2A 3VR1A 2EYUA 5JHHB 2BM0A 4DUGD 1E0KA 3HYTA 1TADA 3JZMA 5EUQB 1T5IA 4KJZA 4Q00A 2J0QA 2GCOB 2IS4A 2F43B 4CDGA 4EPVA 4KXFB 3LX8A 1AK2A 4BFWA 1QZXA 1XJQA 2BIFA 4NONA 2OT3B 4TT3D 4RSGA 5F9FA 4OQXA 1KJYA 4U5XA 5AJZA 1Z22A 5A4JA 3B1WA 4IOMA 4D2IA 2JLXA 2GTPA 1KDRA 4PQFA 1A5TA 1TF5A 2VF7A 4TLBA 1IN7A 4B3FX 4B73A 3DO6A 3QI2A 1SHZA 2WMOB 2HYIC 1NI3A 3H1TA 1PLLA 3DDCA 2WJVA 5AR1A 1VYTA 4NYJQ 4LI0A 4TL7A 5CJ2A 4EAQA 4MRPA 3AB3A 2FV8A 4OI0A 1UM8A 4JLVA 2FFBA 3UWOA 4XVUA 3VU9B 3NDPA 4ZIRB
chains in the Genus database with same CATH superfamily
4Q82A 4XTCS 2R9VA 4B2PA 1DEKA 1E9VA 4RF4A 5DTQA 3GFPA 3S55A 3ICEA 5LP6B 3F6BX 5BRNA 4XR9A 3HMQA 4BLOA 1QFXA 1IK6A 4WFJA 3I2GA 1KE1A 2C8VA 1OTYA 4OFZA 1UBKS 2ERYA 1MJ5A 2Q5HA 3G8AA 3MGKA 2LBPA 3EJ6A 4CKEB 4YO7A 5E6UB 4M1MA 1G66A 1MG5A 1U8EA 2HWUA 3LK7A 3TINA 1I14A 1AKWA 1GFIA 1D4OA 3N6XA 4N12A 2ZWMA 3HI6A 5IANA 5K05A 1I7SB 1TGYA 1NURA 4XEHA 1PE0A 3D7LA 4OQFA 4WZ6A 5AXDA 4CL0A 1OXXK 4IWNA 4E13A 4IIGA 1G8SA 2OC4A 1PRYA 2HO5A 4UC0A 3N8GA 1S0UA 2CDCA 1UEJA 4ZO6A 3SSNA 5LLTA 2FX2A 4OXIA 3L0CA 1WU7A 1XZMA 1EHCA 3TSCA 3GDGA 1BS2A 3PVZA 5KQMA 4GNKA 2XUDA 4DJJA 5AK0A 1KIFA 1PGPA 2M98A 1J2JA 4K6HA 4RDXA 2XRMA 2Q6LA 5KOHA 3G2JA 1NVGA 2YVUA 3E9NA 2PMWB 3DB1A 5DTIA 1XUOA 1BGVA 4RFSB 3WGMA 4X6LA 3RTDA 2QUKA 2I6UA 4DLSA 4MUJA 4DC1A 3R7BA 2IZZA 4PZ9A 1JA0A 4Q05A 4BLWA 3OPQA 3I01M 1TCAA 1JAZA 2GXUA 1SIOA 1S1CA 2XQFA 1FW8A 1VLHA 2I03A 3HZZA 3JD0A 3QP9A 4AS3A 1EX7A 3BHNA 3NBQA 4R0VA 2QSUA 3UV6A 4NH0A 5FAXA 5HTKA 2I55A 2JIOA 2C9YA 4PXYA 4ASUD 4EKYA 2Z09A 1S89A 1T1SA 3CX4A 4L07A 4YWHA 4HWOA 5HQJA 4XWWA 1E9AA 5KNCH 3P9PA 1IQRA 2P2GA 3BGDA 3BIJA 3Q3VA 4EUSA 1CY8A 4FI3F 4G4SP 4GKJB 3FOEC 1R6TA 6CHYA 4CM9D 2RC5A 4J6EA 5CLGA 1K1EA 2PCLA 4EB8A 4CF4A 3MT7A 1L5SA 1T91A 4MHOA 1ZINA 5A6SA 1EKXA 4NYJR 5HOEA 2IS2A 1R12A 1TQ2A 4A9AA 4AKTA 2ZS7A 5J47A 3A4LA 3SMQA 4BVAA 1LBEA 4YRJA 2BDTA 2YJ5A 1MJGA 3B70A 3OKCA 4RH0A 1RZRA 2AMYA 1T9BA 2VUTA 1VHDA 1WNFA 2A8YA 2FVYA 3GT0A 3KWFA 2WTEA 3GLHE 1USGA 4JXKA 1BOOA 1QWOA 3PKZA 5UKDA 1MTZA 4EHFA 1WHSB 3QVWA 2NSDA 3MB5A 1JG6A 4FD3A 1HQKA 4JSTA 3RRNA 2O54A 1MVNA 1AZTA 4B84A 4IXDA 1E2LA 5A4DA 4JLWA 2F62A 1NVFA 1XTTA 3DT8A 2EX4A 3RIMA 1OYOA 1ULAA 5LKAA 4KACA 2D0IA 3T7KA 3EXG2 4EZEA 1YA6A 4C06A 5K1ZA 4DNXA 2EWWA 2P7HA 3LUPA 4U2EA 4Y7CA 1X2BA 3TLKA 1U8TA 4IJMA 2JHPA 2GBGA 4RKFA 1VL0A 2VDNB 4HB0A 2PL1A 3ENKA 5A5VA 3F5SA 3L4JA 2E4XA 2Q9UA 4UXIA 4YUZA 2OHGA 1NW4A 2R751 3AY0A 3RF6A 3THRA 4OV6B 4ENSA 4ZAGA 4Z4IA 2PRZA 1EX1A 4J3FA 3OLVA 2QTZA 3F2VA 2VJNA 4BRWA 1GR1A 2VDWA 4EX7A 1GQSA 1IYZA 1RLTA 4BP8A 2W11A 5J2UF 1FXWA 1Z6XA 3Q7EA 1KFBB 1JSZA 4C29A 1SZDA 4URVR 3TMAA 1QJCA 1GGNA 2YINC 3TECE 4S04A 3D4PA 2NG1A 3RS2A 1JA1A 1M6NA 1TLLA 3CZRA 3VZPA 1ABBA 2V55B 5ITZB 3WGYA 4QT4A 4EPTA 2FU5C 6LDHA 3ZE9A 4D9IA 1YZVA 3OQ6A 3IUMA 3DYVA 2CDAA 4GFDA 4TL6A 1X1RA 1BDMA 3AFHA 1JR3E 3WK7A 2GBPA 2G5CA 3F71A 1H0SA 1BHQ1 4FS8A 3WLHA 3ZY4A 4F1KA 4CEHA 4C7OA 1D2GA 4YMVA 2HCFA 2P4UA 1ATZA 1VFPA 4AJ4A 5CBKA 4CKCB 2DFDA 4MWOA 4MX8A 2V59A 2PKQO 4RGBA 5EIOA 5B7NA 4TROA 5I4BA 3IDQA 4LDNA 5KKNB 4YP7A 5KNCA 1MX3A 1XVTA 3D4NA 3DOEA 3RS8A 1HORA 3F5QA 3IFSA 4JC5A 3LZCA 1X8XA 2D7DA 2C95A 4KPEC 2EJVA 2V3CC 4DDVA 2X0KA 3JQ7B 4HDAA 3RVRA 3MCUA 3O9VA 1AGNA 3KOWA 4ZQBA 3G0DA 2QEQA 4N3CA 3OECA 1ISFA 2WKWA 4EB6A 3EZ6A 1YQUA 2Z2IA 4RLFA 1FLNA 3PXDA 5CM9C 2HQBA 2OAQ1 4TRRA 1T8SA 4J0CA 5SICE 1MPXA 1Q19A 4GL4A 4DIDA 4PX2A 1EA7A 1OFUX 4R9UC 4JU8A 2AK3A 4G5XA 4II3A 5J5VA 3P32A 3WHPA 2GAFA 3SHQA 1B6TA 4MGKR 2NNLD 1Z2PX 2VDPB 3I64A 4X0EA 4GPIB 5EHQA 5G0WA 4NNOA 3V8MA 2IV7A 3W2TA 3TLZA 1RYFA 3CSUA 3IXLA 3LHFA 4M7PA 3TDKA 4CKXA 1X7ZA 4XUCA 3S4YA 4EECA 1GM5A 4FM9A 3PA8A 5JXWA 5IUKC 2HA5A 3MNFA 4RVSA 1O9GA 2IYRA 3A6FA 4DKJA 2CNNA 3S27A 1VLLA 4YT5A 2Z2YA 5EE9A 1ORTA 3HA3A 1D7OA 4RS3A 4A8PA 3SYLA 1KO4A 3QY9A 2P2ZA 1CUSA 2P9TA 3RAJA 1ZM4A 1QHEA 3HVHA 3R3WA 2H1OA 2W2TA 5IWCA 2QE7D 3SIPA 4Z4EA 1H66A 1OVGA 4FXPA 4QEZA 3IKJA 1PEKE 2GI4A 6YASA 3Q6IA 5B3LA 2WIFA 4NEHB 2O2SA 1VXOA 3F9IA 4HEA6 2R6HA 4Q4JB 4TXNA 4LJYA 4ZVUA 4H3SA 4ZFNA 4ZOQI 5B1HA 3ZDXB 3DTTA 4OK6A 2N47A 2ERXA 2B82A 1EA5A 3T35A 3H5AA 5KJ1A 3LOUA 4MUGA 5DBIA 1JXQA 1SWWA 4FLFA 3PHGA 5KKAA 5TY0A 4TZTA 3DEIA 3UK1A 1OWOA 1KSGA 2DT5A 4C2AA 3BH0A 2QVZX 2FY8A 4G1VA 3PSHA 4IHJB 4OREX 3U0VA 1P72A 2YTZA 5AUOB 1TU4A 4DLRA 1KVTA 4MPPA 1X7YB 2CJPA 1NWHA 3DTVA 1RRPA 4G4SO 2Q7OE 3TBKA 3FRHA 2NUAB 4B31A 2AMVA 5DOVA 1XVUA 2VZ8A 2WWXA 4Y2XA 4IH1A 2BMAA 2QTVA 3GY0A 3R9IA 3ZVRA 4QLAA 2AF4C 4U02A 3QNWA 2PV7A 4P98A 1P2VA 1TMGE 1U4NA 4S35A 2ADMA 1ILWA 1SWVA 3LV8A 1TQ8A 4ZU6X 1TZMA 4BGIA 5JRZA 3P45A 4JUDX 4OSEA 5TC4A 4WOJA 4ECEA 4BNLA 1WB4A 3RSQA 1QOPB 1QK3A 4MB6A 3H86A 3VR2A 3TTYA 3FGNA 2HQOA 3PFHA 3KT8A 3BSFA 4AIIA 2ZW9A 1B3BA 4IGEA 1RMQA 2VYNA 1FTYA 2ECPA 1PJRA 2F9LA 2XCUA 4OU4A 2P2DA 4FILA 4U2CA 3T1VA 4MUIA 5B1DA 3SLKA 3PJEA 4E2XA 1E2KA 4Z1MD 2AQKA 2EKQA 4U6SA 5T3UA 1ZC3A 1L1RA 1AD2A 3LSTA 3NBKA 1NR7A 2NACA 3S2YA 5C7IO 4DTCA 2HA4A 3BTOA 1YVEI 3E70C 1P0MA 4DEVA 1Q3KA 2ZRLA 3K1AB 4EFDA 3EGEA 5LUBA 3NT4A 5JFGA 1J07A 1HFJA 1ZG3A 1LV7A 2RGDA 1HSOA 3GFQA 2WKQA 4B7CA 3HDHA 5L6LB 1P9LA 2A3NA 2W2QA 1ZOSA 2YFKA 2XWSA 3HEMA 3M1IA 1RHKA 3UGJA 1QGOA 1PQWA 1QORA 3TOZA 3R5XA 2EVWX 3WLRA 5EC8A 5FD8A 5IS2A 4KH0A 1BW9B 4L3VA 4YRCA 2NTYC 3PIRA 3IBYA 4HN4B 3HO6A 4HQ0A 4YCDA 1U2TA 4WINA 1WLSA 1C9DB 4ZCLA 3MEQA 1IJFA 3OU2A 3FZNA 3FF1A 3KAQA 3ZZ1A 5JPDA 4OU5A 1RQLA 3I9MA 1W4AA 2AXNA 4KJXA 2P67A 2FQ1A 3DXFA 4R7ZA 2XD9A 2CYAA 4WGGA 5IVIA 3CWCA 1Q44A 4G5QA 1GYRA 2WINI 3BKWA 4QM6A 2CLMB 1R15A 1YZYA 3NAGA 1WQ3A 4RHYA 1WXQA 5DMXA 3RC7A 1F1JA 3UMYA 2CF5A 2ZJFA 1EFVB 1BVHA 4JSRA 5BQ3A 3FKJA 3BXXA 5K4HA 3LSYA 3E3LA 4HEJA 2Q0HA 2XECA 3ND8A 4PZYA 3O8CA 3DE7X 3UHFA 1U04A 2C9OA 4WL0A 4F9GA 2C83A 6ADHA 4MV1A 4J0IA 2AZMA 1OI4A 1WD5A 2X2OA 2PN1A 3GRVA 2IX9A 4QU5A 4JCOA 3HLYA 4LNAA 5DZSA 1JDNA 1JKFA 4HMQA 1GQYA 4D9FA 4CDRA 2Z43A 1MHPA 4MW4A 2FFQA 1WD7A 3N87A 4OI1A 3EQ9A 1RAHA 1JAYA 3FFAA 3PD0A 5FBQB 4B34A 5L51A 1FFXA 5E1MA 1AJEA 3L6UA 1QQ7A 2F1JA 2V1XA 3QX8A 3EBLA 5EIHA 1YS2X 2H11A 5EXSA 2AEEA 4UE2A 1A95A 2IYOA 1MO3A 1GTVA 1CW2B 2Q5QA 1EK2A 3AM1A 3L7YA 3MXOA 3R6TA 2WYIA 1N8KA 3NCTA 4OTZA 2Q3JA 1GRVA 4K87A 2R1TB 5M34A 1EHYA 1U3FA 3EZYA 5B5SA 3SX4A 2HJRA 2JH3A 3P2YA 3U3RA 2QZJA 2WG1A 4TLDA 1KO5A 3I23A 2PZFA 3N2YA 1J0BA 5B1EA 5JI2E 3E81A 1BFDA 2A9RA 3Q88A 3R5TA 1KEWA 4OM7A 3KD3A 4M9CA 5HKLA 4FT4A 1GPJA 3GMDA 3VC3A 3QUAA 1XRJA 4BX3A 3RS3A 1NF9A 4G0YA 6AT1A 4TYPA 2J3LA 5GP1A 3EDMA 1P1IA 3OLZA 5K03A 3D8TA 2KSQA 4WZBA 1DKLA 2WDPA 1U7WA 3G2MA 3G0HA 4BMYA 1A72A 5JJBA 4DBZA 2F48A 3FZEA 4MQEA 3PEEA 4IHJF 1TKCA 4MIEA 2QRVA 3NI2A 3NYWA 2YHBA 4K6OA 3P4YA 1L5GB 1EIZA 4XIFA 3VH1A 2WP8J 2QRZA 4HNHA 3FHCB 4IEEA 4M9XA 4PAMA 4EMUA 2RB4A 4L6IA 4QL3A 1HE3A 5T4BA 4Y2QA 4LCEA 2HXGA 3QSYA 3C85A 1EU1A 3WZ2A 1AE1A 2A4KA 1CQWA 3HCBA 1DMRA 1H1LB 4XSGA 4YAJA 2QBYA 1ZNXA 3WGTA 1QR6A 2XT9A 4N0MA 3NIFB 4NCAA 1D4AA 1BMFD 4C22A 3T3HA 4AS1A 4Q39A 2RBEA 1QVRA 4JMLA 4UZSA 3D9QX 3WLTA 2E4VA 2CFRA 4IQFA 1FRZA 4HNRA 3WFIA 2AN9A 2KQUA 2BEVB 4P2GA 1HETA 3SN6A 5AVUA 4FR5A 1GZ6A 1V4BA 1EM6A 2FGKA 2KW5A 4GP7A 3TZHA 2FZLA 4UTXA 1KXZA 3UXEA 1PJ4A 5D5PA 3VBEA 3FMIA 4J4HA 2QW8A 3GC6A 3DBVO 5JC8A 3P5SA 3FWHA 4P34A 2HFJA 4OOFA 2CXRA 2HEIA 4MLPA 2NMVA 5K3OA 3FM9A 3NDJA 4R9NA 3CPHA 5CDFE 3VDMA 2JBAB 5AJUA 1EIWA 5GONB 3IJRA 4LV8B 4X8HA 2KYRA 1KKLA 2C5GA 5KSWB 2NX2A 4DUPA 3LGAA 3NBAA 2CHFA 5DM60 4JX9A 5D8DA 1PFYA 2RHLA 1BJTA 3ES9A 1FFWA 3B3AA 4DOMA 1ZK2A 4FE3A 1NLZA 1YE8A 2IOYA 3DZDA 4Q1BA 5EJAA 3NDIA 4G56A 4ZAVA 4BFLA 4HD8A 1ZVMA 4GW3A 1R6VA 2JKZA 2HUNA 2IOQA 1UPFA 1U2EA 1YK1A 1ZWKA 2HF7A 2XGGA 2I8CA 1MOPA 2C2BA 4P8RA 2A59A 3MAGA 4QOIA 4AP9A 1N5JA 1FNSA 2VT6A 5FXMA 4AFNA 1XTIA 3FCEA 1XXHB 4DS3A 3IAS1 3QMWA 1YJ8A 1RVDA 3EXIB 4OFXA 1NSFA 3ZGXA 1HG1A 1MX5A 4P82A 3OKAA 4QGHA 3SFZA 4M8LA 4WIAA 2J7PA 3MS7A 4ZZ3A 2B98A 3VKWA 1LPAB 1KVRA 4ACAA 4Q9HA 3OQOA 1OBOA 2GO7A 4KAFA 5FQNA 4CEJB 5EJ6A 3HZRA 2XH8A 5C34B 2IPXA 3OCUA 5LIPA 1QJ4A 4FCTA 1M2KA 2XDQA 2VDLB 1F2DA 3GB9A 5AM4A 3RBVA 3R3UA 2AL7A 1FNNA 1VBKA 2A7QA 2IHZA 3ANLA 4MCAA 4XZ3A 2X40A 3GNSA 5A7GA 2YWBA 4Q34A 4UNRA 2IHVA 1IN5A 3C16C 3DE2X 1D2HA 5KWJA 3OA0A 3SQXA 4EG5A 2COKA 5HZMA 5EZQA 3LRPA 3BMOA 2IOFA 3K9QO 4Q4AB 3ENZA 2DSNA 4JUCA 3ROGA 3GR6A 1MX1A 3CZQA 3K0FA 3PPYA 1OZHA 4KR2A 1OAKA 1Q7CA 3E2MA 4FFPA 2XODA 1GYQA 2GPBA 3G2IA 3TUJC 3ZTTA 4PBSA 3FMPB 1TFUA 4R1TA 2WJJA 4J43A 2AJBA 8ADHA 3ELWA 1CPYA 3JVIA 4HBGA 4O3FA 2BI7A 4CMIB 4EKIA 3UJ6A 1GCGA 4E5DA 2HHAA 4DR6B 2PUWA 2FJ0A 1WHSA 1AHPA 4RFSA 3RVSA 3EDOA 4DIBA 3QPCA 3BMCA 5FLXA 4FNAA 4BVLA 2X14A 3LT2A 4TOIA 5BNWA 3L01A 4IO1A 1GCUA 1FVHA 3KLMX 3ROMA 3T3NA 2OB1A 2AQIA 3FYDA 4NC9A 3LCVB 4UAUA 1E2EA 5LA6A 4PPYA 1CHNA 3V00A 2FQXA 1ZN8A 2BWJA 5DW3A 1PR2A 3A70A 1T8UA 4S12A 4ZVTA 4MLDA 3GJRA 5EP1A 2XUQA 4AJLA 3QUSA 3KT3A 1OASA 2PLAA 2DQZA 3EVTA 5JDCA 3B2NA 4QYSA 1P9RA 3WA6A 4Q4DA 1TVEA 1OBCA 3ZHQA 1QHXA 1Q91A 2JAQA 4PYLA 1N25A 1W88B 3IQXA 1AURA 4GZ3A 5JBIA 4CLXA 3II6X 4LBWA 4F9FA 1OWNA 5KWSA 4YV2A 2WWVD 1E1NA 3GUYA 4IVNA 4ZT7A 1PD0A 2GBCA 2LR0A 4R01A 4YAOA 5K0LA 4CI9A 4E5UA 3NNDA 1NT4A 1YJBA 5E6UA 4I50A 3LLCA 4UMVA 5AICA 1OYWA 1ZUD1 3CWQA 3OM8A 5IT9A 3L4BC 4DV2B 3ZDBA 3OAAD 3IALA 4ARSA 1SKYB 3AZOA 2PMEA 3KUKA 4BWFB 4AECA 1T4CA 1HMPA 3OM9A 5KTRA 3BDAA 3AI2A 3QEJA 2WSMA 2GX6A 2UZ1B 1FUKA 3FUTA 1AQUA 1LFDB 1V25A 1U1IA 1G6HA 1NRWA 5TMBA 4OG2A 4WVFA 4C2TA 4FONA 5H16A 1BYUA 3G7UA 2FRDC 2ORIA 4FGUA 1C30A 5LZ2A 2GFIA 2HD4A 1ESDA 2JLRA 2JCSA 1M9NA 2QN6A 2W00A 2FOLA 2DFNA 3AJ8A 1GU7A 2Y27A 2HMAA 2YXDA 4IGIA 4LTNA 3FPKA 2AFHE 4QX6A 3PQ6A 4ZICA 3GFSA 1H2YA 1IHDA 3GNQA 2HR1A 2NO5A 1XYGA 5G0SA 2GZAA 2OY0A 3WLSA 1KYZA 1WF3A 5GIOE 2E5FA 1G6Q1 2XQGA 1G55A 3K9BA 4PC7A 1ZUWA 4RE5A 4EGQA 1AOXA 3SQMA 5MN6A 4EDHA 4DSAA 5KWEA 3IJEB 3IQGX 1ZYUA 4TM7A 1NONA 3C3YA 2W2LA 1IUKA 4MZDA 1QYXA 4GZ6A 2PGOA 3FCUB 1QYRA 3WMEA 3D2BA 1UBRS 1T9CA 2H54A 3ZHOA 3COYA 3E3OA 2WWFA 4JVLA 1KA9H 3L1VA 2YMMA 3O0DA 2P27A 2H5JA 4RU1A 1F2TA 5H4HA 3FMGA 4BNDA 1YD7A 1H3EA 1V8ZA 5AFSA 3D7SA 1HRKA 3WBJA 3G6KA 2BOVA 2FWBA 2J5KA 4K9RA 1PV1A 1M1YA 3ZX5A 3HYCA 8ATCA 2OO7A 2QOEA 3VPGA 3ADBA 1CDOA 1ZIPA 5FO1A 1DWUA 2ZWVA 3Q9LA 2C7PA 2OCXA 3K6SB 4RTMA 2G70A 3T7TA 2ZXUA 1IU9A 2P68A 4Z49A 1DS6A 2PZBA 4GIBA 1KZ9A 2VXBA 1L7PA 3SSMA 3Q3EA 4UAJA 3OQIA 2CLHB 1MB4A 3DULA 4QHTA 3DCJA 4W1QA 1BXZA 2H4XA 1H05A 2QJRA 2VJDA 3BXHA 2CKDA 1XWWA 2BELA 2C2OA 2QN7A 3T9FA 1PFVA 4KLCA 4A0SA 1MVOA 3ZWVA 4J9UE 5F73A 5J3JA 5G4KB 1JN0A 3AVVA 1DXQA 2WVHA 1GQOA 3PHIA 4DBVO 4JGIA 1V5IA 3C8UA 5ALTA 5HJ2A 1A9QA 4FWTA 2IQ5A 3CKMA 3I9NA 5DNAA 3A9UA 2IHBA 5EKDA 3MWFA 3AIKA 3QXGA 2VRCA 4MJXA 2V7PA 3FE2A 1E2QA 1UWLA 2A2ZA 3JASA 3RUPA 1LC3A 3THXB 3M9LA 2B3DA 4XSVA 1CULC 2XDWA 2AOTB 3OIWA 1TM5E 1ZDMA 1PFKA 2QV7A 3JQAB 5D5QA 5ALFA 2GM5A 2HJHA 2XJ4A 1FP4B 3P9YA 2HA0A 4MUXA 4QGBA 2NSJA 2YWCA 3UWSA 1XQ6A 4NS1A 4D6XA 2Z1DA 1P8AA 4DWWA 2HV8A 1SUFA 3ZI0A 4C5BA 2J0UB 4EG3A 3S2FA 2H52A 3P2MA 4Q9NA 1IBCA 2B94A 4CXMA 5C51B 4RPHA 3BBPA 2XUFA 3PTZA 1RQGA 1JZSA 3W8FA 3VH3A 3FNIA 2FN3A 2IZOA 1KP2A 4O2AF 2IGTA 2Y0DA 2J3QA 3IIIA 3IB6A 3KKPA 1WCIA 4FFWA 5C7LO 1IAQA 1JJFA 1DQPA 2W6CX 3Q2KA 2P9BA 1J70A 1SCBA 1GSIA 3FYUB 4PF1A 3EF1A 2VJCA 4IG9A 4EPXA 1CDDA 2GXAA 2P9QA 4HTFA 1Z68A 2J6IA 5ERYA 1J24A 1CQZA 4QDJA 5F64A 4YYEA 3OEHD 1IQUA 1MJHA 3O3MB 5EWLA 4CUZA 4DLLA 3DZBA 1KC3A 1ADFA 2PD4A 5HK8A 2CNLA 1W5FA 3NKLA 4YRIA 3DLAA 1Y3DE 1DKUA 4QBKA 1WB5A 2VXOA 3GJYA 4A2QA 4E7OA 3U61B 1G63A 4PSCA 4D99A 4GKAA 1JIIA 5F7ZA 1RPNA 3ORYA 3NJ8A 3EIFA 4HNGA 2OAEA 2JGRA 1SQFA 4YCJA 1XZDA 4EGJA 1IY1A 4OSOA 3HJUA 1U0FA 3QJ5A 2XCRB 1F4LA 3ZJTA 1XRPA 3E22B 1NJ2A 4YI3A 3I6IA 3NHLA 4NENB 3A31A 2XW6A 2DSTA 1I3KA 3C7TA 3FI0A 4Y1FA 3D8UA 3KKQA 2PUCA 2HWKA 4ZXFA 1UBLS 4JY7A 5BORA 1X42A 3E9CA 5EWJB 5LQMA 2OBMA 2VWGA 1SVNA 3HB1A 3VO1A 4IY1A 3U9SA 1KJNA 4ZCRA 3R7DA 4F8JA 1ZXXA 1PTKA 1LI7A 3RHSA 4JJKA 4ZRNA 2X6RA 3SU8A 1YB2A 3H11A 2CL0X 4MVXA 3SJAA 3SX2A 4MTLA 3RTEA 1YFZA 2W90A 2XNDD 1I80A 2OQVA 4RMHA 4BFTA 3UH1A 3G5UA 1CZLA 4D02A 1PNTA 2W4IA 1DT3A 3I32A 4TTQA 4QHSA 4O25A 1BVYF 4KQEA 2VT7A 4ND3A 3G5LA 2G0AA 1H65A 3RBAA 3TVDA 1XNJA 2JFWA 5JR3A 1L0BA 3WYBA 5IEJA 3EA5A 1ESNA 2DYKA 3F9RA 1JG4A 2OENG 5EP2A 1VCNA 1KAMA 1X7DA 2VTVA 3HUFA 2ORED 4ATNA 2V3WA 3DPSA 4WCDA 3CEAA 3I5AA 3VHRA 1F7UA 5KYWB 3FPHA 2AC2A 3LUDA 1U9CA 3LNTA 3MCZA 2J07A 5AI4A 1JG3A 4N9WA 1NAIA 5HIKA 5E95A 3ONWA 1AUQA 3CRW1 4FMCF 1IM2A 2IHYA 1D07A 1H0KA 5IMBA 1X7HA 4GSKA 2ZYIA 2CE2X 1Y63A 3QY0A 5IC6A 1JKMA 1H5UA 1F17A 1Z28A 4L4UA 3HRHA 2V74B 1JQBA 3D4IA 2VYCA 3HMKA 2REOA 2JRCA 1JLKA 2J3EA 4KYIB 2LCQA 1DHRA 2DR2A 2H7XA 2FLVA 2WFMA 2NT4A 4Y2VA 4ZN6A 4M1OA 5B30A 1VMEA 1DBVO 3M5PA 3VU1A 4F6LA 4JFAA 5FEMA 4YMSA 3SZ3A 4E1AA 3KTFA 2R4TA 2UZ4A 3O8BA 1WZNA 1UOEA 4E32A 3HU2A 2JG3A 3O8NA 2Y68A 1ICIA 1P4HA 3BILA 3ZCXA 3ZYCA 4B0PA 1RJ9B 2FN7A 4ZT6A 2C54A 1LJ8A 3D6VA 2HA3A 2EL7A 3F1LA 1YBAA 4MCHA 2BR4A 3QKSA 1XLWA 3UBTA 2WVJA 3I09A 4URHA 1XAHA 3H17A 3COJA 3ABQB 1RADA 3C70A 4GPZA 2NO7A 3I4CA 4B3BA 1GGVA 2WUFA 3L06A 1QM5A 4EYEA 2DCUA 2EHDA 4U7TB 1U0TA 4J2HA 1USWA 4X7BA 2PEYA 4ZOAA 3O4HA 2W71A 1L9KA 1WEHA 2AG5A 2E3JA 2ECOA 3KJEA 3BGOS 1YBHA 3JSAA 4ND7A 2FB9A 3VI4B 3X1JA 4Z86A 2DHQA 3W78A 3BH6A 1WPXA 1TPZA 3MWEB 4JYZA 3QMPA 4GM1A 4D8VA 3HJAA 3S2EA 5YASA 5EIEA 5LQRA 3ZY2A 3WISA 5F3DA 4ZYWA 2IT1A 4JVMA 3RAGA 2DCMA 4R0MA 4HQLA 3RRZA 4EJSA 4L78A 5FPYA 2WAAA 3K5PA 1BD4A 3OCVA 4P58A 4QOFA 3E9DA 3FY4A 4P3XA 1Y4SA 4X44A 5CM2Z 1XO1A 2B4RO 1XZEA 1E89A 4PO3X 3OJFA 4IXWA 1MH1A 5J9FA 1XA3A 2A0YA 1WUKS 1LTKA 1E3JA 3DJYA 1F6WA 3DHNA 4HQ6A 1PNRA 1D4FA 1GKYA 2WPDA 4B43A 2UYHA 2RGNA 2V8BA 3J7AC 1E32A 3P26A 4X62B 3JSXA 2JLSA 4HXFB 4HDQB 4PX9A 4NG4A 1POWA 4N5HX 1KSFX 4G67A 3U7GA 1U2GC 1ZLYA 2GYVA 2Z8ZA 2BGJA 4JZKA 3K6JA 4Q3DA 2QROA 2VYQA 2WJIA 3EAGA 3Q9UA 5ALYA 5CFNA 4B3SB 3IVGA 1KU0A 3V8VA 4LJAA 1MHTA 1MJGM 2O07A 1GPAA 2FMIA 2IEDA 4B85A 1Z4MA 4O2BF 1GVHA 3ZU2A 2JZOA 2KB0A 5DV9A 4E6PA 3AHDA 16PKA 4TMTA 2PK3A 5CYGA 1AKRA 1XBTA 3D1VA 2OHVA 5EJFA 3HBFA 5TJ9A 2LNDA 5AKYA 1FTQA 2IIPA 2BGLA 3IB3A 1JQEA 2P4SA 4L4ZA 3HXLA 4UBKA 2D1YA 1WE2A 3HKEB 1Z56C 1C5KA 4MV6A 5ALIA 4EEZA 1FYVA 3LO8A 4KAXA 4UUMA 4ER0A 4D26A 2D5CA 4IW3B 2XQJA 1W6RA 1UFOA 3IEPA 5HDBB 2QLFA 4KPUA 3M4ZA 1JQAA 2PR7A 1ZH4A 3F46A 3D31A 2J46A 3Q40A 4PM4A 5G41A 2X0EA 1T1EA 5JNUA 1EWVA 1NFQA 4PHTA 4NFYA 4UVIA 3UPDA 2W42A 4J2TA 4GXQA 3I01A 2NQ8A 4KRFA 4OGFA 3ZV4A 3HCAA 3F7TA 1BXRA 5LBIA 4RF2A 3PC8A 4OJQA 1UZAA 4X94A 1OC4A 3DVQX 1ZMTA 5FUVA 4YRPA 3GLFA 3QFFA 1EXDA 1VJ1A 3B12A 4NARA 2JHAA 1AQLA 1NBEA 4R7GA 4YB8A 3VPCA 1W6UA 1NHGA 3W9UA 4HSEA 3RS4A 3L0ZA 2AQHA 1SXIA 4ZI2A 1M6EX 3GCZA 4TYNA 3C1OA 1V11A 3FNHA 3GLVA 5FJIA 2CHVA 1YZ3A 3KSMA 1CC1S 1O94C 2VHUA 4KVZA 4AQYB 3N76A 2FWAA 3THOA 1AA6A 1I3LA 1KFCB 4MW2A 3UCEA 3A26A 1PL6A 2WWRA 4TQ9A 5IH3A 4BGUA 1RC1A 4RWZA 3U9TA 4TSFA 4N9QA 1JTVA 3LWDA 2IYAA 4L4XA 1QVWA 5DEOA 3KV1A 1BA2A 2CLIB 2Y4NA 1L1FA 1XNGA 1FLAA 5KOIA 1K0UA 1UMDA 1E8MA 3TUZC 3BT7A 1GKIA 4EEXA 2W2VA 3HO1A 5LMZA 3SQLA 3SC4A 2LRHA 4CUJA 1JEOA 1LSUA 1PGJA 3QXHA 5KTOA 2PY6A 2ON6A 1AKTA 3KG2A 2GNOA 2D62A 3H3JA 1FEZA 2HKIA 1J5PA 5EMKA 3B9BA 3OE4A 3ZK8A 2V1UA 2BFFB 2DKNA 3R5SA 3P5BA 2E7ZA 2R5FA 1Z33A 2RGXA 1H6CA 3KCQA 3MJ4A 2YMQA 4TS1A 4OLBA 1QGAA 3HXKA 4LJKA 4N5DA 4S1TA 3ZJ5A 4F5DA 5BN5A 3CZAA 3V33A 4IL5A 4A15A 3BDVA 3FPCA 1CJSA 3G2LA 3RKUA 3COWA 1VG9B 5M2QA 4FIZA 3WO0A 4DKXA 4YJKA 3SKXA 3WL8A 1NIPA 1AUOA 4RW0A 4JHLA 2JCYA 1ZI8A 2PO7A 3HU5A 1Y8QB 4PAWA 2B78A 3H97A 5AVRA 4XCVA 4ZO8A 3SCZA 3AR8A 2O8EA 3HR8A 5SV2A 2VYVD 3VH4A 3GJ8A 1O96A 3BHIA 3F6YA 4IQGA 4UEQA 3FCSB 5JVDA 1UBUS 2OHHA 3I3OA 3KL2A 1OBHA 2X13A 2B20A 2Z5GA 3IQZA 4GXRA 4PS0A 4YP9A 3GUZA 2WNIA 4E6EA 2HAEA 2KI5A 2HLHA 1CZOA 3W5IA 2BFCB 1FP4A 2ZUVA 3L8CA 3QUCA 2POCA 4NAHA 1DG1G 1PL7A 1ZM3A 3E3MA 3KCNA 2Q29A 3EAQA 1CRZA 3NWPA 4IDPA 4JDPA 2X0DA 2H59A 4KXLA 3H5WA 3KPWA 2OBBA 3P9NA 3Q15C 2P1ZA 2IYWA 1U2ZA 3BTUA 5CFMA 1RYHA 1TCUA 3GAMA 1O54A 3TRHA 2FEAA 4NZPA 4UNPA 4DWJA 2IZ1A 2HRBA 3DA8A 1CETA 4X6YA 1R6BX 3OC6A 3DTNA 4LWOA 3WBKA 4EBFA 1Q2UA 4NX2A 4BQRA 4HT3B 1MB3A 1B8UA 1ML4A 1WMDA 2R7KA 2Z5VA 4G5HA 4B09A 5KI6A 1HT2E 3I04M 2Z2KA 4YBRA 2MJLA 3GRPA 5F7XA 3KQSA 2UYOA 1GNTA 1Z0JA 2ZS8A 1TT5B 2V98A 2P9HA 3GJZA 4HGQA 2AKEA 1IXRC 1Y81A 3IV7A 4ALJA 1N1DA 5ICEA 4QO7A 1RZ3A 3PSAA 5H70A 2RK4A 3PQEA 2P90A 2D8AA 4F6RB 1Y5NA 4GLFA 5T8KC 3HB5X 3RSSA 1SPXA 3ETNA 1KXJA 1OWPA 1JV2B 3CLTC 4G0ZA 1SUDA 5EGSA 2CZCA 2YYZA 3HDGA 3IVMA 3LVRE 3GZ4A 4XGKA 4ADSG 1L6RA 2D2EA 2OBFA 2DKFA 3DDWA 4YBZA 3RK4A 1UQUA 1M1YE 2CKMA 3H9CA 1DJLA 1EK6A 3MWDB 3BWDD 1H2EA 3DZFA 4KO1S 4W9RA 3OJLA 2O7QA 4J4TA 5FNVF 3VSAA 5H9VA 5FWXB 2ZPTX 5H59A 4HLQB 3ANMA 2UUPA 4P7FA 4V02A 5AMXA 1UR5A 1C1DB 4IDQA 4R1OA 2ZDGA 1YJCA 1N32B 4LF8B 4X5OA 2GVZC 4CQMD 2H5LA 1C2YA 4IDGA 1WG8A 1Z75A 3OZFA 4KPGA 4CF7A 4FW8A 4LOIA 6GPBA 5E4FA 1R0KA 1YI8A 4RV9A 3FWNA 5ALUA 221PA 2QM3A 3E7FA 3O2QB 4TTVA 1D6NA 3F47A 1L7AA 4XQGA 3EIWA 1ZXBA 1RHJA 2ISCA 3WL7A 2IPMA 5I7AA 2JK0A 2FSSA 2J59A 2B1GA 3G9UA 3K0CC 4RPLA 4OGWA 2IVZA 5C1BA 1YKGA 3T1YB 2WABA 3QQ5A 4D45A 3ZWYA 3JRXA 3PZRA 1XPOA 5JCOC 1Z4JA 1L3CA 2FPUA 1Q0PA 1MZVA 1ABEA 3BWBA 3R8XA 2VDKB 3QBTA 2MU1A 3HJNA 1C30B 1GLGA 4IZ6A 1QK4A 2OCLA 1VG0B 2J3HA 2PBRA 3C4QA 1N5KA 4CU5A 3DV0B 1Z4NA 2WSSA 3KLPX 2H18A 1Z45A 4RABA 1XZ8A 3AOEC 3G7NA 3O8QA 4OA8A 1LDEA 4LXYA 4RCYA 3IE2A 2OCAA 2X1HA 3A6ZA 3KOUA 3ONVA 4F2GA 3PFWO 3ZGZA 4TQGA 3C8HA 3N2ZB 3JAKA 4WZAE 5IWAB 3MVEA 1K88A 2YJ6A 3PL1A 4LV5B 3HK2A 3DOUA 1JUDA 4E33A 2GF2A 5AM5A 1TOAA 3U7QA 1IVYA 3ZE7A 3GH1A 2QVLA 2CVQA 3SZUA 3OU6A 1G18A 2WHPA 3HG7A 4AG6A 1E5TA 1U7XA 1V5FA 1X38A 2HJVA 3JQCA 4J7AA 4KXYA 3DMYA 4WY8A 5DYWA 4ZZ2A 1KK0A 4CCYA 1W96A 3V8NA 3BMNB 1R1DA 2W2KB 4B75A 3I53A 1V6SA 1JPJA 5GV8A 4DQDA 4WK2B 1DQSA 4FJ1A 4YV7A 3UT0A 1Q5PA 3U3ZA 1GAXA 3BXEA 1JDBB 3FHJA 2EP8A 4TVSA 1YNOA 2ODPA 3KJNA 4MROA 1Y7IA 1F9EA 5LA6B 3FDIA 2JATA 4DIOA 3AC0A 4DLTA 3R3VA 2GBLC 4QUDA 3K32A 1OFTA 1LDMA 2AX4A 4OXXA 3WYDA 2EJWA 4IDAA 4NE2A 3NATA 5I47A 2BFNA 4Q7KA 3DBHA 4AF7A 4EF4A 4EVSA 3P4XA 1WAMA 3QQPA 4LS3A 1PR0A 5FQOA 4PC3A 3TLMA 3GYBA 3L8GA 3NTRA 4BKUA 4BLSA 1SC9A 1NVXQ 2G4CA 5IF9A 3Q2IA 4JA0A 3UA3A 3GRKA 2YW2A 5JASA 2G1AA 3TSYA 1A9RA 2QG6A 2Q1SA 1L5QA 3GP5A 2XNHA 3KTAA 2Q0XA 1UWVA 3KJHA 1F0NA 2CW5A 1WM1A 3E82A 5K99A 4DY6A 4KKXB 3GBPA 4HAUA 2XADA 4BMXA 3RYCA 3BFVA 3GPDG 4MW7A 1XG5A 4I4NA 4XSHA 5JS6A 1SXGA 4MSUA 3LBAA 2C5FA 4DMKA 5BSGA 2UU9B 5K51A 3FW1A 4XVCA 3K70D