3UPDA

2.9 angstrom crystal structure of ornithine carbamoyltransferase (argf) from vibrio vulnificus
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
357
structure length
346
Chain Sequence
HHHHHHYFQSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ornithine carbamoyltransferase
publication title 2.9 Angstrom Crystal Structure of Ornithine Carbamoyltransferase (ArgF) from Vibrio vulnificus.
rcsb
source organism Vibrio vulnificus
total genus 133
structure length 346
sequence length 357
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3updA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3updA01
3R7LA 6AT1A 4JFRA 1C9YA 2QG9A 1NBEA 2FZCA 3CSUA 4KGZA 1I5OA 9ATCA 1RAEA 4KH0A 3NPMA 8AT1A 1RACA 3L02A 3KZOA 1EP9A 1A1SA 1F1BA 2AT1A 2W37A 1VLVA 1R0BA 3E2PA 2FG7C 7AT1A 4FYXA 4A8HA 2FZGA 1RAFA 3KZMA 3MPUA 1D09A 1RAHA 5G1NA 1EZZA 4IV5A 3M4NA 2HSEA 3M5CA 4KH1A 3D7SA 1ORTA 1XJWA 4OH7A 4AMUA 4A8PA 2BE9A 3M5DA 3KZNA 4F04A 2QGFA 1Q95A 4E2FA 5G1OA 1ZA1A 1AT1A 3TPFA 3TXXA 2G7MC 8ATCA 1ZA2A 1EKXA 3D6NB 3UPDA 1RABA 2FG6C 1JS1X 1OTHA 3SDSA 3LXMA 1RAGA 3GRFA 2EF0A 3R7FA 1DUVG 3L06A 4EP1A 2BE7A 4A8TA 3KZKA 2I6UA 1TU0A 3GD5A 1RADA 4FYWA 2IPOA 2P2GA 2A0FA 4WTOA 5ILQA 2OTCA 4EKNB 2YFKA 1FVOA 3L04A 4KGXA 4ANFA 1R0CA 4KWTA 2RGWA 4AT1A 5G1PA 1ACMA 2H3EA 1PG5A 2ATCA 4JQOA 4FYYA 4AM8A 1TUGA 3KZCA 3R7DA 3AT1A 1AKMA 1RAAA 2FZKA 1ML4A 4NF2A 1FB5A 4FYVA 1SKUA 5AT1A 1PVVA 4BJHB 4F2GA 4JHXA 3L05A 4H31A 1TTHA 1RAIA 2AIRA 1DXHA 4KGVA 3Q98A 3M4JA
chains in the Genus database with same CATH superfamily
5KREA 4NPCA 2NZWA 4KI7A 1HI9A 4MRVA 4HQLA 1IWPB 2ZRGA 3U6BA 4E4YA 3EHDA 5EKSA 3ZNQA 3C1TA 3K8YA 4J0HA 3X2SA 5LLDA 3F46A 1P2FA 4V0OA 2XUGA 1JH9A 4C21A 1II0A 7ABPA 1ZD5A 3W5JA 4CEJB 3BT7A 2ZOSA 1DIHA 2E4YA 2O14A 1NP3A 2X0IA 1EJBA 4KKXB 2JLSA 3ITEA 3ZY3A 2IBTA 3VPXA 3VH3A 3SVZA 5KYGA 2YWBA 2ZT6A 1DKLA 4XASA 3BGIA 4PS1A 3AV0B 1DIBA 1NLUA 2NVWA 2QTAA 1NUSA 1LI7A 3OHPA 1R3DA 1ODIA 2XD4A 3U3RA 1BGVA 3Q5DA 4XUGB 1GV0A 4L0DA 4Y2SA 1II8B 2HNAA 2X0NA 2XGSA 4G0ZA 3RHZA 4P84A 4U3JB 4P81A 4Q7JB 1EEXB 2CY0A 5EQDA 3UJ9A 4PN3A 5BRNA 3RFTA 3F4KA 2IIPA 1X7ZA 5E1MA 2DSNA 4CN9A 1CNEA 5A0FA 5EIBD 2NXCA 2CXPA 4LC9A 2QM7A 4TWJA 1RM0A 4FNGA 1NMXA 2PSJA 3AHJA 1YR6A 1LV8A 1NR5A 1EGQA 2QLJA 2WTNA 1ACLA 3NT2A 3WL3A 3KOZA 4CMKA 1Q1NA 3ZBTA 4QQ8A 2C4MA 4KE9A 1KH3A 5H3HA 3HGMA 3IVXA 1MKYA 1WDTA 4KO1S 4P4GA 1L1EA 4UPVA 3AR7A 4DHWA 4MKRA 1P81A 1FUUA 1PK7A 1O6BA 2O8NA 3TXAA 4AJJA 5KJ6A 4DY6A 2AHOA 1PO7A 1D07A 1DIOB 1SFRA 1ZM2A 2YN2A 2O57A 2ZVJA 4NHOA 4RVFA 3LF2A 4URHA 1G42A 1T2VA 2RI0A 4I1UA 4LK2A 1FJXA 1ACJA 3IP7A 1XTBA 3FYTA 4MPRA 1X87A 1T2NA 4LA4A 3FTPA 2PMWB 3KTAA 1XTSA 2QNRA 3L0CA 5HUHA 2YX1A 3AB7A 4UNNA 2D4AA 2ZFUA 2ZGVA 5E8RA 3SC4A 1K06A 1U94A 3C97A 4XWGA 2A6PA 1DJQA 2E37A 2GN0A 3DMDA 5AKYA 3KKOA 4D2IA 1D8TA 4Q7KA 3H9CA 3QX8A 4FFLA 3UT5A 3ZWAA 2Q4RA 1GR0A 1OPRA 4XVHA 1M2EA 3LWZA 3AEYA 3H6KA 6YASA 1E2PA 4D4HA 1YRQA 1M8JA 1LDYA 3M83A 2H17A 4O0MA 3V48A 2EKDA 4YRDA 2OUKA 3O03A 4YLGA 2B8NA 1DKPA 1X92A 3DOOA 1GLVA 4EDFA 3M4ZA 1J00A 1NVVQ 2OO5A 3L7IA 3GLIE 3KB2A 3OQJA 4ME6A 1XQXA 4ZMRA 4PO8A 2M98A 4C7OA 1X14A 1SJ9A 4LXYA 2WAXA 2QKYA 4N12A 5IYZF 4PO9A 1GYPA 3R4VA 4LFAB 4MUIA 2B3TA 2X6TA 1LPPA 5G0SA 3RTGA 3ND5A 3UZUA 1JUDA 3DTVA 4Z4IA 2VPYA 3GI1A 1T6NA 3WRWA 2GA9A 2CNWD 2QQGA 3JYOA 2VHCA 4UOEA 5IYZA 3DP7A 3LHKA 4JROA 4ND1A 6AT1A 3SFZA 1D4AA 4B6FA 1WXFA 4CIVA 1Q16A 4N3NA 5JW6A 1KXJA 4N5MA 4CHTA 2G88A 2SHKA 4UZFA 5IT4A 5K6RA 4PZEA 4L15A 3VHQA 2EL9A 1XZJA 4RCVA 1WF6A 4FJ2A 4OM7A 1KYTA 3SQDA 5AJXA 4AO7A 8AT1A 1P2DA 3Q2OA 1G8PA 4X1YA 1UDRA 3SICE 4QDOA 5J58A 3CXUA 2RGGA 3K6KA 4DR2B 2C61A 2QMOA 3F3KA 2GHTA 3N05A 3L93A 1DCMA 4O63O 1NZFA 5C3UA 4DA7A 4JUAA 5CIYA 2H2HA 4IWNA 3D6VA 3TBKA 1J2YA 1J06A 3NT5A 2F4NA 1FXSA 2VAXA 3UOGA 3M82A 1VE7A 2C2MA 2FE4A 3R5FA 1ZYUA 2G28A 4LNUA 5G4KA 4EG7A 2OLJA 2NSHA 1GUZA 2QM8A 4I1OA 5BP7A 4LF9B 1E2QA 2EZ4A 3T3MB 4EW2A 2WJ3A 4TV9F 2Y99A 2VP3A 3DFIA 2FFHA 1MFPA 2WD7B 1T4CA 4U9HS 4L76A 4LGMA 4MRAA 4TV9A 5TX7A 3CZQA 1HYQA 1W2GA 3H5NA 4HNUA 5FV4A 2V1UA 1F0NA 2C4KA 2JKVA 5ALOA 3C70A 4D6PA 3HFSA 1DG9A 5HDQA 1L7RA 2OSBA 1R00A 1WV1A 2J3IA 3KLPX 1UPXA 5BVHA 2VSYA 2ZYVX 3ZXXA 4BMVA 3IVCA 3DC2A 4GFDA 3HCCA 3SOPA 1L7MA 2CDBA 2JH3A 4I81A 4I5FA 2R79A 3D6AA 5HZHA 1L9KA 3SSNA 3QENA 1P60A 1SRQA 3S28A 3U4QA 3AL0C 1VPWA 1O2DA 1QF9A 3QKRA 1NOKA 4QGHA 3OOJA 4O25A 1CQJB 1NN3A 2OESA 2ZAGA 3NI2A 3MTDA 2P40A 1Z9BA 1L9XA 4JVOA 1GQFA 3NYIA 5DI3B 3VR6A 4BMXA 3S2GA 4ND5A 3D59A 3E2IA 2BR3A 3LBNA 1ZUD1 1KIFA 3GDGA 1EGMB 2YYAA 5CA0B 3HB5X 2GTIA 3WFZA 1RJ9A 1D3AA 3WXBA 4MLZA 4X8LA 2F67A 3TVTA 2Q5LA 1F14A 5ADHA 1PGPA 2BLLA 2FQ1A 2PT9A 2ZRLA 3IUEA 2FUG1 4R1UA 4IQ8A 3CS3A 4JX8A 2JL1A 3DL2A 1T15A 1OWNA 2YFKA 3RJZA 3HM9A 2RK4A 2X15A 2XNCA 2ZI7A 1D6MA 3W5UA 3BX1A 2C04A 2VNHA 4HN4B 4L0CA 5D51S 3CY6A 4D9NA 4N0DA 4V0ME 5B1HA 4FYYA 4D3XA 3PB3A 5JR3A 5JMPA 1ZWKA 1Y9EA 3IURA 1TZJA 4UDXX 2D1RA 2WUFA 5FWXB 2PZJA 2FQXA 2OP1A 4XWTA 4PR0A 4M38A 1LVHA 1O0CA 4Q4JB 2OV6A 2RI1A 1A9RA 2P69A 3IHLA 5FOUA 1TTHA 1YDHA 1UBUS 4LZPA 2Z2ZA 2BKXA 3HZHA 4NYIR 5BYAA 1WB9A 5KDOA 4DDTA 1JG2A 1OXSC 4G5HA 1KVRA 4M89A 3PNYA 2P2LA 2OXIA 1N34B 1PQWA 3CKMA 2XCSB 3E5NA 3LLCA 3JPWA 2N75A 1ZICA 5AYVA 5AM2A 4ZOAA 3KSZO 2OXEA 2BH9A 4AG3A 5KVAA 2HIAA 2IEIA 1X9GA 4ZIRB 1DT5A 1ONOA 1MJFA 5CAEB 1O77A 1T3ZA 4GPEA 4KSCA 3WLJA 3KG2A 1CEEA 1XIVA 2F17A 2FY8A 3H8JA 5KNCH 2IZ6A 2BEVA 5CFRA 2HGSA 3IP9A 2HT1A 2JIRA 2IVZA 2BHLA 3F78A 4OP3A 3URMA 1KARA 2ZSJA 1TM5E 1WXDA 3JWIA 2NVUB 3KYBA 4UBKA 2A4MA 3OEED 3V00A 3MB5A 4DWOA 1S2DA 3OY7A 3BDVA 1J5PA 2A1TR 2VPQA 4R1PA 1T36B 1EBFA 2AF4C 3HUDA 4HDKB 1Y98A 2JI9A 3H99A 2R1VA 2GEBA 4HTFB 3EG5A 4XLTA 1N5OX 1SVKA 5FQNA 2V4UA 3EW9A 3WLPA 1E94E 2X6QA 4Q37A 1E2LA 5SICE 1X7YA 2BGJA 2E2WA 4QUJA 1QIJA 3EEQA 3JQGA 4HWTA 4F9TA 2NUPA 3DE0X 2O4UX 2OYRA 3UJDA 4JDPA 2VHWA 3OTOB 2B98A 1QVWA 3RABA 3PC8A 4K81B 3TBHA 4BV3A 3DWFA 5IXSA 4E46A 1OWOA 4ALNA 2O8BA 1U1CA 1AKRA 2JJ1A 4AD8A 4GLOA 3DAOA 3LRTA 2AVDA 2G76A 2VP5A 2K7FA 1E9CA 1JT9A 4GI7A 4UFNA 2L82A 1PWZA 2RFLA 4BASA 2C3YA 3R3UA 1C7IA 3JY6A 3RTDA 5ALHA 1RABA 1G3RA 5HKOA 3HADA 3CTMA 1IQ0A 2Q2VA 4K9NA 3A3PA 1X1CA 1JQDA 4FMCB 3ZDYB 1EFUA 3THYA 5GTDA 2X58A 1HBJA 1DINA 3KAPA 3SLGA 5T8KA 3WMRA 3JD2A 3NRJA 4OHBA 3WGLA 2GHRA 4EO7A 4JU9A 4OI0A 1GNTA 3NBFA 4W1RA 2GEDA 2O0HA 1T3HA 4NNPA 4P32A 3BTOA 1RRKA 4R0VA 5EP4A 1Q3TA 1RCUA 2JAQA 4AMBA 2FEAA 2XE8A 3OQ1A 3TDMA 1J8FA 4R83A 5ECGC 2DP4E 2IPOA 2IEAA 2WD8A 1EFVA 1RS0A 2A0FA 2XQKA 4LY6A 3AJDA 4DEXA 2PUJA 4OPMA 1Y3BE 1N9GB 2D5IA 2P6PA 2RARA 3QF7A 1Z6TA 2XH8A 4YT5A 3GX1A 3VZBA 3DDSA 3LHSA 1GSOA 1H2HA 2ZUSA 3CPSA 1KJIA 3E53A 4P4TA 4KUEA 2WIKA 4RSGA 4ZJUA 4FYPA 3G5AA 4TL7A 5DM4A 1YK0A 4ZTBA 1GXSA 1W85A 3SEFA 4B3RB 1KU6A 4I7EA 3PX7A 1VG0B 4G1FA 5EE1A 4UD2A 2W2MA 3WHLA 2WHXA 1ZSVA 1KK0A 2QUBA 1RQ2A 3I73A 4KNVA 2PSFA 1T6YA 4M54A 4RKWA 1ADYA 3IBGA 3ZKWB 4F92B 5IKXA 3P9CA 2BFAA 2XA1A 3NB0A 3DE6X 5E3JA 4I3HA 5CA1B 3C7CB 3HBMA 4H08A 3HNPA 5HIIA 5SZIA 1VZ3A 2WK1A 1I7NA 1DXHA 1XKQA 1XZKA 2BMEA 2JCXA 2ZDGA 4JLKA 3RH0A 2VL7A 3TEFA 2GOYA 4ND8A 4TVBA 3TIGA 3TTUA 2RCNA 1GD1O 1NMQA 1V43A 2V5VA 3BEDA 5I4KA 3NHZA 2PR7A 2PZKA 4CM9D 4I2VA 4EKGA 5GZ1A 2OKGA 1JPVA 4Y18A 5BR4A 3QPAA 1P7WA 2JHPA 3GFBA 3ZZMA 3ETGA 1NW9B 2XZPA 3AP1A 1HGXA 4U63A 4AY3A 4EI2A 2J3MA 3PWZA 5FUBA 5EJ8A 3L0DA 5A6VA 4CKWA 3K9CA 4UATA 3ZWVA 3UGQA 4DSNA 4X61A 3VKUA 3WQRA 1W36B 3P2JA 3IEKA 2L0XA 4PFSA 2R87A 4ZT5A 4Q05A 2FFRA 3KB6A 5BWOA 5DTJA 1YDWA 2MSLA 3SCZA 4Z2YA 1RTKA 3COVA 5CLHA 1W48A 5DRYA 4D6XA 1WDWB 3GJ6A 3NIWA 1TYZA 3AU8A 2PU7A 1YQGA 1E1QD 4TX1A 4CCYB 4P83A 4N03A 3FETA 3BILA 3VNSA 3HTXA 2BZGA 4U8GA 1YS1X 4WOKA 1YE8A 1H1TA 1RHUA 4HDMB 4F11A 5COBA 2XWPA 1ES9A 1I4TD 3KKKA 3ZKAA 5JZMA 1MV8A 3L7KA 1B6SA 1OHHD 3RU7A 3UCXA 3WGZA 1QTRA 3ST7A 4KWIA 4GM1A 4LFCB 1Q7GA 1MH1A 3H16A 3E61A 4YRIA 2K2WA 1R4AA 1PBTA 2O2CA 4DV7B 2J7PD 4NU0A 3KKLA 3EGXB 3SIPA 5K3AA 5FCDA 4EHIA 5ICEA 1J5EB 1E2BA 2PR2A 4PG6A 4ZO7A 3SS8A 4LGYA 1T5SA 3AVVA 4IMIB 4QPZA 5HSGA 2BMJA 1LX7A 4N1AA 2XITA 4M0EA 4M1WA 4UQLA 1GDHA 1C1YA 2Q4OA 2VJQA 3F6BX 4U0KA 2OC9A 4JUBA 1HC7A 1SUDA 3AR9A 4PHFA 4YRPA 1T2DA 3U0BA 3OO0A 4CEIB 4YGXB 5KNBD 2IWHA 3CT6A 5JSKA 4MR9B 3TUZC 2QZSA 4JL5A 4CQLB 1CUCA 2YJTD 2ZIWB 4B8WA 3TJMA 3O47A 2ZRAA 3FMPB 5PNTA 3D4OA 2CNLA 4YJ3B 2MINB 2NZ8A 2YFHA 3WMGA 4BNFA 2PWYA 3O9ZA 3T52A 2VSOA 5C5IA 4CMCA 4BU0A 1N4AA 4BC0A 1AO0A 4BXOA 3F9CA 1VXRA 3TE7A 1B0AA 4Q1BA 1XMOB 2EFYA 3B6MA 2FLWA 4EPVA 4DR3B 1QH0A 4KFTA 4CG1A 3L7MA 5IVDA 4QM7A 1HLGA 3A6KA 3GGDA 3OU6A 3WGOA 4B6SA 1NY6A 5DNCA 2A9QA 2E0IA 2J9ZB 1O0SA 4DADA 1W30A 4NL4H 2RSLA 1MEEA 3B8HA 4XM0A 4UMVA 1XXHA 3H9JA 3RK1A 3RV4A 1T24A 3IR5A 4N7MA 3VAYA 1F8FA 4MVJG 3CLRC 4ESHA 3T5MA 3OVMA 1P1RA 3S5JA 3V4LA 2V7UA 2IODA 3PNKA 4JASB 2Z56A 2ATVA 3KQOA 4LW8A 1W0JA 3FRHA 1V3QE 2TSYB 1SCUA 1WA5A 4MEAA 1J0CA 1R9NA 3STWA 3T94A 1M34E 2HV8A 4D4IA 2LRHA 4QASA 2CJXA 3PKZA 1EX7A 5DN6A 3EVTA 5C8XA 1QUFA 4WJZA 1K5GA 1SCKA 4JLPA 1YCGA 3CWQA 2MJLA 4AKEA 4HDRA 1TVKB 3NTRA 1RW4A 1IZZA 1ODSA 2XT9A 4CLXA 4CDRA 4W7SA 2GK6A 1IDN1 3NUGA 3O82A 5ALFA 2R85A 1YBAA 1ULZA 4BV9A 1TW2A 3SHQA 4HGZA 2P6MA 4HATA 2O0KA 3TX2A 3ASUA 4DSZA 2JI4A 1W96A 4IXNA 3FTQA 3WKDA 1QHFA 1VLLA 1U8CB 1ZUWA 2P1RA 3SBEA 4M0MA 1XAIA 2OD9A 1YBMA 3R77A 3A06A 3HJRA 3LQRA 1FEZA 2JI6A 1PDVA 4PFJA 1F2TA 3TQCA 5KYWB 3R3HA 1AURA 1H2FA 1GPBA 1VL1A 2GCOA 4MS4B 3BA6A 4FHCA 2OOSA 3MIIA 3RS2A 4HQFA 3UWSA 2B1GA 3IUYA 2W2NA 4BGDA 4HC4A 5CDUA 1R9JA 1NBMA 3W1EA 4PYIA 4EUKA 1KEPA 1YI1A 4KBYA 4XTRA 4RXUA 4GXRA 5ANRB 2AC7A 1XMQB 2OFPA 4WZAE 1GADO 1CUAA 1OI3A 1YACA 2IT1A 4L4XA 5LVAA 1Y6FA 2EZUA 1REQB 2PXXA 2Q5HA 1RZ3A 4PLYA 2XVAA 3DBRB 1CE8B 2OV8A 4TZKA 1VA5A 1CRLA 5KTRA 3VDQA 3NNDA 2QR3A 2XA2A 1G3QA 2XUJA 3I72A 4DUGD 4RD2A 5LD2C 1C0IA 3WO1A 3C6QA 3K1ZA 3T9FA 2XMSA 1VJ5A 2A0WA 1LBIA 2Q49A 2UZ0A 1JB9A 3K35A 4IFIA 3WWOA 2DEUA 2R8PA 1WB6A 2VF2A 3EW7A 4N6OA 4OHVA 3O8QA 4RDIA 4X44A 4WLFA 4ZVTA 2NU9B 5ALIA 1N5DA 1KK1A 3SHFA 2BEUA 3DMNA 3IIKA 4AJOA 3NFYA 2B3DA 1Q21A 1GUFA 1WSWA 4G5SA 1NRJB 4BFZA 5HIAA 1RYNA 5EQFA 2C4WA 2GRUA 5EJ5A 4RE5A 2PRYA 3F3SA 4U2KA 4RZ2A 1OIVA 2R60A 1L5LA 2BM8A 3GQBB 3N8IA 1BDJA 3THRA 3ZGZA 2JPDA 1C8BA 5EI5A 5ESDA 1KU0A 3USES 1CHDA 4G09A 1EUCB 1H8HD 5AVJA 4C29A 3TOVA 3R7FA 1QRAA 4EP1A 2WU3A 4U2GA 1UR5A 1VI5A 2QRZA 4FFWA 3TW4A 5CCEA 4IDGA 3V7NA 2PT5A 2QF7A 1WE2A 1B16A 4JR2A 4MJ3A 3N2NA 1YK1A 3L8EA 1E4YA 4C7KA 2IDMA 1XTRA 3A28A 4JOCA 1JDUA 1JHPA 1TQ6A 2DUWA 4PSCA 1W19A 2A14A 2BR4A 3X0DA 5JCPA 3ULKA 3I92A 1RSZA 2VQSA 3S55A 4YY3B 1FQWA 1WZUA 2O5VA 3GELA 5J40A 3QJGA 1KH2A 5C1DA 3KQHA 2CBGA 4DG8A 4OBWA 1MOSA 1W87A 1OI2A 2PIAA 2Q8QA 4UHJA 2QRMA 1KZYC 5EEGA 5ADUS 3C1UA 3BMQB 1QIIA 4BFXA 4RA9B 4Z6KA 5G1PA 3AJEA 4UXJA 4MVYA 3HJBA 5DCLA 4XIFA 3CEMA 1C9MA 4Y0NA 4AZTA 4RE6A 4RSMA 2BFDB 1SUAA 2Y1LA 3FZNA 3HKDA 1BHJA 5CK4A 1LH0A 5DZSA 4PY2A 5LLTA 3BFKA 1MAWA 3NKVA 3OT5A 2YYSA 3ESXA 3MT7A 4HYEA 4JYCA 4PX9A 4TT3A 3EPKA 2M1ZA 1JWAB 1FXUA 5J2UB 1PTJC 4XR9A 4FCCA 2YWHA 1KGSA 1RIIA 1XEFA 2XOEA 4BATA 1NNLA 1STOA 3GJ7A 4LYEA 4QA9A 1TGYA 1K6MA 4IAOA 4LZOA 4MP6A 3VTFA 3VKVA 2C7RA 2H9YA 2ICAA 1D6NA 4QXPA 4W5WA 1ONSA 1G41A 4RSHA 1UM9A 2W2PA 4R9UC 3DV2A 4JIMA 3JVIA 2DLCX 4UQOA 5EUQB 2DUJA 1CDOA 1W4RA 1R8XA 3ZWWA 2D0IA 1I80A 2HRCA 2IUSA 1I3LA 3VKWA 1G8FA 5SY9A 4ACBA 4YCSA 2F9MA 1PJBA 2O2SA 4WOPA 1ITZA 3WBBA 1F6DA 3VOSA 1FSGA 1FFWA 3SMQA 4DXAA 3KE8A 1HNZB 4CR7A 1JDZA 1ZD2P 2A9KA 3KDPA 3GCZA 3OF5A 2R1TB 2I7TA 2O3UA 3BRWA 3LD9A 3UN1A 4KXWA 1GZ7A 2ASEA 3TLZA 1H2RS 2AUNA 4JJFA 2ZETA 1H22A 2J5QA 3VA7A 4N49A 4AL4A 2PH1A 1F2DA 4HAZA 4NBLA 2IHUA 2PSDA 2ZTUA 3TNYA 2PH7A 5G1NA 1FNDA 2JC3A 3FFAA 4UTOA 4YP1A 3NX4A 3B3QA 4MR7A 4QOGA 5F1YA 4QVGA 5TS3A 1AC5A 4D43A 1KAHA 2AW5A 4TWIA 4F4CA 4TS1A 1JF8A 4S12A 1FX0A 3TRDA 2FCAA 3D1JA 2JK0A 2QTRA 4F46A 4GBED 1KMIY 2WF8A 1PR4A 2E18A 1RWBA 1EJ6A 2FMFA 1U0NA 2C8VA 4QOJA 3R2JA 2XKBA 4CHGA 3L4EA 1HMPA 4UHEA 4W9RA 1SU4A 3D4PA 5A1TA 2C97A 3U44A 5ETJA 2DH5A 3AR6A 4V02A 1KNXA 2G17A 3JAWB 2Q2OA 2QW0X 3ISTA 2ZM6B 1HE3A 1RLJA 2Z1DA 1QHNA 4GECA 2Y71A 3I58A 2JGKA 3PD1A 3TOXA 3VR2D 1RE1A 4NONA 4HVLA 1TEHA 1K97A 5HXAA 4MWBA 5IG2A 4YRTA 1BMQA 3AFHA 1PFWA 5IKEA 5FLEX 1RWMA 2AFHA 3SYRA 1SXJD 3IYLW 3A4MA 3LH5A 1K68A 1AKUA 4NBVA 1XQ6A 1ONBA 1KZGB 4BX2A 1IOLA 1Z0ZA 3QVOA 3I9JA 5JNSA 3S7TA 4CM8B 1DKNA 3R6TA 4Y8VA 5DMXA 1OXTA 5DRTA 1CY2A 3LY7A 3L4BC 1M1UA 1X1EA 3QE0A 3ZHTA 3N70A 3FHOA 8LDHA 4IGFA 4L28A 2FJ0A 5L40A 1OKKD 1R8YA 5JCOA 1BE0A 1F48A 1E32A 1MC1A 3F5QA 2NN3C 1XPJA 2ZUDA 1NBOA 3EXFA 1PG5A 5AQEA 2C9CA 3H1GA 4D0LB 2JCGA 5A06A 4GKKB 2EVWX 2NYUA 2RMKA 3P0RA 3ED1A 4K6KA 3FA2A 1BMFD 4GT1A 1GCGA 1VIYA 3F1LA 3JVVA 4V3CA 3KV3O 1RYYA 4YWHA 2PGAA 2SNIE 4EMTA 1ODFA 4L4UA 5LN1A 1SD1A 1FLAA 4HNGA 5A6SA 2CLIB 1K4YA 2NV0A 2R5NA 4WNCA 1PVVA 1YOBA 2VTEA 3QYAA 1QO7A 1WTCA 1CEXA 3HVUA 4BRZA 4F8JA 3BXGA 5HF6A 1CJBA 1IB0A 2Y6UA 3IODA 3ND9A 3ODGA 3ZGVA 4DLYA 1KDOA 4YO8A 1C7EA 2GR9A 4EA9A 2YNMD 5KINB 1XRSB 2ZQ5A 4DYDA 4ZTUB 1Z4QA 4CG2A 5FTLA 1CRZA 4WFQA 3OMWA 1KJZA 3KAJA 4CPDA 1VKOA 4DCCA 4QUIA 1I10A 2JCBA 3WLTA 3SJ7A 1NVBA 1Q20A 2NZJA 4S1VA 2CLHB 3ZUGA 1X1DA 5B6JA 3S8YA 3A2MA 2J0EA 1GLNA 1PUJA 3UKJA 2H57A 4UKDA 2QSYA 4WZBE 1JJAA 1KK3A 1M7GA 2ETVA 3GR6A 2C2ZA 1PQYA 1ZN9A 3PR3A 3Q3EA 4B46A 1DLJA 1M74A 3QXCA 3L0ZA 3K94A 2KSQA 1L5YA 5BO5A 1M73E 3L6RA 2EG5A 4JBLA 2NU6B 4FINA 1MTZA 4MWGA 3LX8A 4P98A 4ZPJA 3RSCA 3OZCA 2MT9A 2W6IA 1HQDA 1OLUA 2E87A 4JLNA 4V24A 1K7SN 1AO3A 1EVQA 1E3MA 2G1PA 2YS6A 3SMVA 1AD2A 3SIRA 5JJLA 1R0SA 4P92A 3OIWA 2NUTA 2GD1O 2VJYA 2IX9A 3TUIC 1RI5A 1TJ5A 3TF5A 4J2OA 4JVSB 3BG5A 4DTIA 1P1BA 1DMRA 2DTEA 4D7AA 3COPA 3T61A 3U61B 4FE7A 5AP9A 3H2HA 2CKMA 2D1TA 2VJPA 4MK4A 3K32A 3HDTA 4KZPA 2IY9A 1BS9A 3VR1A 2SCUA 3PK0A 3GCXA 3B8EA 3HLTA 1VYVA 2IZZA 2EERA 4C0KA 1R50A 5LQRA 1NN1A 1E9DA 1IXZA 3TGPA 1P1JA 2C3PA 3AJ8A 2JA2A 4QL3A 1N6NA 2ERCA 1B1CA 3QTLA 7ADHA 4YB8A 4AUNA 4KPFC 1R4NA 1UBKS 3OEYA 2O7SA 2W6JA 2GILA 3OM9A 4B34A 1DX9A 1XD2A 3A6HA 4RSRA 3ENNA 3GCDA 4L16A 2QTBA 3V8RA 4Y2PA 2HH9A 1HFKA 3WLIA 1BVUA 2QR2A 2V0GA 3F6SA 1BKYA 1E3DA 5A9TA 5C8YF 2JCSA 1JYSA 4ZT7A 3QVTA 5FX2A 1Z7WA 2V3VA 3O8NA 1T6XA 3PFBA 3FTCA 1SUBA 1TMYA 3TSCA 5HRCA 5C8YA 1SBZA 2ZI6A 2XCUA 4OV6B 1A8SA 3DT9A 2WY2D 4UDNA 1X1QA 3EIQA 3ON5A 4ZAZA 4BKRA 4CEHA 3G13A 4P9NA 5H82A 1WMEA 1P4JA 1JQJC 3QWAA 5KQMA 2WSIA 3HVHA 1NU8A 3PRJA 2VDLB 3N0VA 4KL8S 2Z2YA 3IHTA 2RE8A 5JSQA 1ZOSA 1OFVA 1R10A 2ATCA 1L3CA 3QG1A 1JDNA 2FKAA 3PWKA 2PJRA 3H04A 3M6UA 4GZ6A 1TIPA 3NP7A 3FGZA 1IEXA 1EXWA 1ZH8A 3AUFA 3M2TA 3R1IA 2ZWPA 1WXEA 3KDSE 4R1LA 1UT6A 1PNQA 4EEZA 3OJEA 1JI3A 4KIFA 4IRMA 3L7NA 2XB6A 2XBMA 3FM9A 2GAFA 2V5AA 4B40A 1DHTA 5TGZA 4B7AA 2RH9B 3A04A 4HMOA 4JMPA 4XVQA 5FBRB 1Y9AA 1N36B 1X8KA 4F91B 2BGKA 3HCAA 2HJGA 3TEMA 2RHCA 8GPBA 1M8FA 1TUBA 2P27A 2PGXA 2R8BA 2G4VA 2EGUA 3D3KA 1XKLA 2DLDA 3M70A 1Z2OX 3O84A 1LA2A 3TNLA 2Q6LA 2N1MA 3PRYA 3PA6A 4KMSA 5CYFA 5KTSA 5CDSA 1YR2A 3ZLVA 1V1MB 3H97A 2BI8A 2XYHA 5TEWA 3ZHRA 2VJKA 2VBCA 4TT8A 1ZGZA 2BI7A 1BCSA 1Y1TA 2NSYA 4M55A 3UAVA 4AMVA 4EUHA 2A35A 3TUJC 2FEXA 4ZANA 1JJIA 3NTQA 4Q9HA 5BW5A 1MAUA 2Z2JA 5FTMA 1X7WB 3WDMA 4G1BA 3JYHA 2FAXA 3PSHA 1OX5A 4WDQA 2X7HA 1QONA 2WKQA 1I4OA 5REQA 1CQZA 3IOMA 3HL0A 1PEDA 5M7EA 4GW3A 4MUFA 3ABOB 4C6TB 2CYCA 4MIOA 4G26A 1EVIA 4B3JA 4O0LA 1TF2A 2JRCA 3HJFA 3JU3A 3NW9A 1WW8A 1YRAA 2IPXA 1UPUA 2Q3CA 2O23A 3GUYA 2G71A 3DZJA 3G2NA 3M4YA 4NK5A 5A3VA 5TV2A 2HADA 3LT4A 3MT9A 3LQ2A 3TM4A 2FSHA 2H51A 1A27A 1X1AA 3RW9A 4LRWA 1CP3A 1X7DA 2Q7XA 4EF5A 1NUQA 4Z53A 2GERA 1AQYA 4OMDA 4B7XA 3K0BA 3GRAA 4GYJA 3EAGA 4CKEB 1X39A 4U9UA 3O1LA 4DV4B 1Y7IA 4CF5A 3QH4A 5AJUA 5IX8A 5KKAA 3NJ4A 4PGGA 3J7AC 3BGOS 1KO8A 2FZ4A 2PGIA 3K8ZA 4E21A 4B5KA 4JI5B 2DBZA 4CUJA 1ZCFA 3K9HA 3N5CA 4F9FA 2H92A 2LIPA 2ZI5A 4L9RA 2QOEA 1HDZA 2P9CA 3BBLA 3EYAA 5C4MA 5JDIC 4NNJA 3W5BA 1FTWA 3EGOA 4QVKA 2W93A 3FWYA 4JA2A 4QKQA 5CNKA 2NSDA 1UBNA 4JI6B 3F8TA 4K40A 2G72A 3L8CA 3QLUA 3QQPA 5H80A 2FEKA 2Y0EA 4QJIA 1SIUA 4KB5A 2X0DA 1B23P 3GA0A 4WDRA 4A73A 3RUHA 2H4WA 4IJUA 4YDSA 2FXVA 2HBZA 1T5DX 1U4OA 4C3OB 4HN9A 3FGOA 3OQPA 3TD9A 4MAFA 4ESEA 3FSRA 3AFMA 3PNPA 3ZWNA 4JI1B 4FGUA 4PLHA 4JYZA 3WKEA 2Q2QA 2VDWA 5M2QA 1B41A 1GA4A 1ODCA 2IW3A 2XJ9A 5HZMA 1XA4A 2W6PA 1OMOA 3BXXA 3EVEA 4TROA 4XQ9A 3L7YA 4BKQA 2YBDA 4D45A 4RTSA 4P3OA 4AKHA 1P6XA 5J5VA 1S3GA 1JW9B 2JFUA 5EJ2A 3PDIB 5FWNA 1Q83A 3MD0A 1RJFA 3WWDA 4CM6A 5IT9A 4HT3B 4X9XA 1L7BA 3AHIA 3TI7A 1I30A 1LNSA 4XB2A 1YC5A 3GUZA 4MRMB 3DMTA 3KJHA 3CX8A 1F7UA 2RJ3A 3T99A 1X0VA 1M75A 1DFIA 3LTNC 1BG6A 2I6XA 4OHFA 2NSLA 3HN6A 3M6AA 1E2DA 3DBOB 2IUFA 4A5OA 4DJ5X 1X0XA 3H86A 3BIFA 1E77A 2A5FA 2CDRA 4ADSG 1UBHS 3E0QA 2IYSA 2XNDD 3FOBA 1IJKA 5DHSA 3WMFA 1MX5A 4GVPA 3ZUPA 1EVYA 1WOYA 2OQVA 4BOYA 4IX9A 4XUDA 5LXTA 1HL3A 3JS5A 4PAWA 5DLYA 521PA 3ENWA 4PLFA 3QFSA 3IRUA 3FIJA 2ZJZA 1NBMD 1KWKA 4FLFA 1PR0A 1PFVA 4BB5A 1YI8A 1WCWA 1F20A 1OIWA 4WKBA 1WP4A 4GOND 2HBQA 4WASA 1NPYA 2NO4A 1GTL1 1UWVA 3CG0A 4QPNA 4QU9A 3QA9A 5L4NA 1RPZA 2HA7A 2PZAA 3CLTC 3HY3A 3K70D 4HAWA 5KYXA 1JA9A 3FPGA 1G21B 2Q0XA 4YHHB 2HIGA 2ZQYA 2EEZA 5HFNA 5JLAA 3C3JA 2G7ZA 4MMYB 4QBKA 1DJMA 5CIQA 5A4JA 1PYDA 2AOVA 3V4RA 1O6GA 1QGAA 1R15A 4LYAA 1KVQA 1V96A 1W8IA 2Q5FA 3E7FA 1MD9A 4NRDA 1M5TA 2HEIA 3CGGA 3HDHA 2HMTA 4KMOA 4AY4A 4BGVA 1QQ5A 1U31A 2TMKA 4CL3A 3TJRA 4IV5A 4W9MC 2JAHA 5FUWA 1J99A 1XFDA 3GLFA 4G1UC 1U1DA 3JAMA 1V5FA 4E70A 3CPHA 4JC4A 3CGWA 3RS7A 3RYCA 2HJ9A 2BE9A 1B0ZA 2OO7A 1KOLA 1U6KA 4H7IA 3KR1A 4MROA 1V3UA 1ZNWA 1OXBB 3B1JA 2F3UA 3AM1A 2LTAA 4Q18A 4R1MA 3ZQ4A 3QY9A 1CERA 2IZ0A 1W73A 2BFPA 2ET6A 2YIVX 3M9WA 3LU1A 1U8EA 5G1OA 4BPBA 2I78A 1K63A 1RWNA 1VP9A 2ZCUA 4KNYA 1E1NA 2HLDA 3ETDA 1Y80A 1E7MA 3L82B 4DSAA 1RBZA 1K7XB 2CHUA 1KI8A 3CCCA 3LPMA 3QBDA 4OQQA 1JR2A 3I39X 3O8BA 4AZ0B 3D2BA 4EVQA 3N0TA 2BMFA 3AXSA 5HF8A 3U1BA 1S01A 3QBEA 4LF8B 1CJKC 4DG9A 3L1VA 1CVRA 3CO5A 2P9QA 2BTQB 3H3FA 4BFUA 4CL0A 1WB5A 3HRHA 2YIDA 2CXTA 3L84A 3U17A 4Z5XA 1QLJA 2QYOA 4A8TA 3R3WA 3DOCA 1KH1A 2FPSA 2I34A 1E2EA 4IQGA 4J94A 1E0DA 1KAOA 1OZHA 4L6IA 3SSAA 2RBKA 3ZZ1A 4RTMA 1DJPA 4Q4HB 1XNJA 1HDGO 1LVUA 1DCKA 1T1EA 1SOWA 3U7JA 4F9GA 5C7LO 1SNYA 2H8GA 3DDWA 3GVPA 2WWYA 4CEJA 4GF5A 2CLKB 1LPBB 3KHSA 2IOFK 1RQPA 3S2EA 1ACMA 2CLMB 2GAIA 5GM1A 3KETA 3OQNA 4F85A 4HK4A 4ZZ3A 1YRYE 4KQIA 3IEMA 1I36A 1JZSA 1E7YA 1L4GA 1Q3KA 4HSEA 1E0KA 3VUEA 1LLQA 3WLHA 5I9NA 3W5IA 4DDHA 1DQNA 4JI7B 2ZPAA 4Q16A 3SYTA 1JBQA 1ODTC 4M49A 3TH5A 3ENQA 3DZIA 2W22A 2XWSA 4GI2A 1L5FA 4GPBA 1L4YA 2LWIA 2QTFA 4IGEA 5DHQA 5E7QA 5A05A 4YUVA 4U3JA 2QTGA 1Z0JA 3VHLB 2ERYA 1M7BA 4KQ6A 4EX6A 2VTVA 3ESAA 1NVTA 5EE0A 3OIYA 2PT6A 3TX6A 4NAUA 1SM4A 2JIBA 1ORRA 2GLUA 2OLEA 2J3KA 3RASA 2D59A 3LO8A 5BXQC 1I24A 3GJTA 2O2XA 2H48A 2VKTA 3KE9A 3DEJA 4ETNA 4QQFA 3OI7A 4J0CA 3CNBA 1Q14A 3GWZA 4JZYA 1ZCAA 3WL7A 3HNOA 4OI1A 1GZ5A 3ZQKA 4F6LA 1DVRA 4DQ0A 3GP8A 1JPUA 3BKXA 3GNTA 3B82A 4YPVA 4KN6A 5BWMA 3H4VA 3M3PA 1N8KA 2AF3C 5E6SB 3K0CA 3KKZA 2ZR7A 2OHGA 4FS8A 2BHSA 4TYQA 3OE7D 3S2UA 4DLNA 3TNFA 2D0DA 4HQRA 3QWFA 4P22A 2MSEB 2EBUA 2IV2X 3PUZA 1CUWA 3MGCA 2HWWA 1V2GA 2Z3ZA 5HUJA 5I9IA 2RAUA 3IV7A 4NVRA 1C4KA 4UULA 4Y2GA 1R27A 1WZEA 3GBSA 5C1IA 3IKJA 4Z1MA 3T7KA 5DNYB 3EH2A 4Y30A 4C1BA 2JD1A 4TXJA 4F21A 5C7IO 5D2CA 2PRKA 4HGRA 5ER6A 3E5HA 2VATA 5BNTA 4J1NA 4Y2VA 3VC1A 2P7HA 4X84A 1E61A 4US2R 5FAKA 1E2HA 1SMKA 4RV5A 1RVDA 3GU3A 2I7VA 1V8FA 3IQIX 3Q7SA 4D9FA 4E1BA 3PXDA 4ZRMA 1TTTA 5TIIA 2EFHB 1JPJA 1HPLA 2EU8A 5BNFA 3DV0A 2PVPA 2GF0A 1JDVA 2ST1A 3PUXA 3MWGA 4PZDA 4H16A 2VZ0A 2RH5A 1CF4A 1GFSA 2FW9A 4ZO8A 1UIRA 1X80B 3AYXB 4D79A 1XK7A 4DDUA 3GBVA 3IQFA 3DJFA 3GEDA 2BUBA 3RNOA 5HBRA 4MGIR 4L95C 1Y3FE 4ZVUA 1AZTA 2IUUA 4L3WA 5DX1A 3ZI4A 4JT2A 4FFOA 3ZWBA 5FDFA 1P7VA 1MH9A 1ZK3A 4CMEC 4FHZA 4BO2A 1EK5A 1H94A 2IH5A 2A3RA 4DUZB 5L7WA 2PA3A 2ZUEA 1VE3A 1J0EA 3FLBA 4ZYVA 2JDID 5JRJA 4Q5IA 1VRCA 5A02A 1G7RA 3H5WA 4EH1A 1PHPA 1OAOC 2XTZA 3N39C 4OQYA 1ZKDA 2HPHA 1IATA 5CR9A 5JCZA 4Q7MB 3D02A 2C5FA 4TOIA 3UWOA 2VUUA 3ZS9A 4HXYA 4AIRA 4KVFA 2XNHA 3OEHA 3UB3A 4X91A 3S3TA 1UQTA 2IYUA 2QNIA 4BQQA 5IVHA 4GDMA 1WMAA 5CNJA 1XCJA 2AQIA 2BR5A 3TR0A 2RGBA 3DS8A 3W06A 3NS7A 3BZBA 3I01A 3P97A 4TVOA 4WZ6A 4JOBA 1G6OA 2BBWA 2GWHA 4BB6A 2H59A 1ZNQO 4V2IA 4PLPA 3X44A 3R44A 4HP8A 5KKNB 2FZCA 4FFSA 3GEBA 2RHTA 3FX2A 4L07A 3HV0A 3H4MA 1J25A 3C5CA 1XJQA 2XYPA 3B1KA 2TS1A 3GARA 3IC5A 3LYAA 4RK7A 3W2IA 2VPTA 5CT9A 3FNGA 3F7TA 3EIHA 4GLLA 4IF6A 2JFFA 5K51A 1XK6A 2ZIFA 1UFQA 1QVVA 1YULA 2AYXA 2ZJ1A 2ZUVA 4L57A 3ZD9A 5I8PA 2XTJA 1F1BA 3Q3GE 2X76A 1L7EA 1JXOA 1Z12A 3G2KA 3O1JC 3AESB 4W7HA 3UNXA 2VA8A 1UKYA 2A84A 4ZDWA 4XSVA 1ZL0A 1GAEO 1WVMA 1XN4A 3P71T 4EJFA 1CQJA 3KWLA 4LHXA 1ODJA 3RR2A 2VJLA 4EKIA 1JNXX 4OX9B 2UXDB 3BK1A 3LHFA 4JBGA 2ZB3A 4HZIA 4L4RA 3TXYA 4X20B 1A7AA 5DP1A 2HJSA 4Z0TA 4JEUA 5JWHA 2PT7A 1NL3A 3M4NA 1CJUC 2ZSBA 1RVV1 2V0NA 2B5VA 5CA0A 5LIPA 3LOUA 4X97A 4JV5B 3M6FA 3IXLA 1TKRA 2FMIA 2QN3A 5K0JA 2W6CX 1E5LA 1P0MA 2WBLC 3RGGA 4UUOA 1TC1A 1V35A 3LUDA 1SPXA 3SKXA 1SOVA 4I4NA 1F12A 1MB3A 1S89A 2FUEA 3UANA 5LMUB 5K3OA 3WB2A 2VF5X 3GDWA 3LLUA 1YVUA 3EWAA 4NOJA 1RM3A 2CEKA 5FFFA 3MUFA 2CJWB 5CHEA 3FR8A 1UK8A 4PPQA 1C1XB 4Q47A 2GLTA 3DKPA 4KHPB 4C4PA 4A0SA 4GGMX 3E4CA 2R6JA 2HHHB 1U9IA 5DASA 2ACKA 4B74A 4NFYA 1ZGAA 5EP1A 1WJGA 4QIHA 3UHOA 4BC1A 3ESZA 3LSYA 1ADBA 1KYIA 2RONA 3QVGB 4P5DA 3ZYCA 3V97A 2CDAA 3JR3A 2NQ8A 3REQB 3KSRA 2ZJ3A 1ZD9A 3R24A 4Q4JA 3AF3A 3KKNA 3TZLA 1FP4B 3QEBZ 2GXAA 3CVVA 3FOCA 2GASA 3MCUA 3IRVA 1K98A 2G63A 5AHRA 1SURA 4IIFA 1EX6A 3Q2KA 3AZPA 4G2TA 3UK6A 4BLOA 3WZ2A 4RDCA 4BFLA 4DLUA 1SQ0A 1LK0A 2BGNA 2X8AA 3HUTA 3R0JA 3V2GA 3Q3JB 3GEMA 4GL2A 1AKNA 1BHQ1 1GGNA 2RHGB 3KXKA 3LIIA 4L5YA 1RQXA 3UMGA 3MD9A 5C35A 5LNK6 5HA5A 3ZJUA 3VJRA 5AW5A 3X43A 4PC2A 2EFEB 1GQSA 4C0AC 5CAEA 3TKAA 1CUUA 1WB4A 2X1LA 3PDHA 3IBFA 4TUYB 3EUFA 4YDQA 3VR4H 1DTEA 3NVDA 5L51A 2OMEA 3IX7A 1FFXB 3R0IA 3NM4A 2YY6A 2G8NA 5LQSA 3PLRA 2CJYA 5KO2A 1JLRA 1W5TA 4IH9A 1FY2A 3KT3A 1XXHE 2C9MA 3PPYA 3W9BA 1IZ0A 2AZXA 3DEKA 4A7PA 5JBIA 4ZQGA 3FMGA 4LF7B 3WIEA 4HBGA 4KEAA 5F9FA 2PU5A 3ZN2A 4O5AA 1LJ8A 4MWEA 3U7QB 4L9SA 4BQPA 2NQ2C 4LJRA 3BCUA 2GSDA 3FTNA 1SXQA 4GGPA 2C94A 3O8OB 4RM2A 3FPBA 3UPTA 4X41A 4ZOCA 5CCXA 1M6NA 2AGVA 4JC0A 4MB2A 1E8DA 5AO9A 2VZLA 2HSZA 4Q39A 5CDGA 4D25A 1HORA 3A6JA 3G9ZA 4K1LA 2GEVA 4H3VA 4N8DA 5I7VA 3VZQA 1YA6A 2VC2B 2D1QA 1XAGA 3VI4B 1G60A 4YECA 4PG8A 5JMTA 1Z68A 4FMCF 3MHPA 3OE4A 1UXOA 1LZLA 5ALWA 1IPFA 4PZAA 5GPBA 3WE7A 4XPIB 3FVQA 1DSSG 1ISPA 1OLXB 2ECQA 3E22A 1OFTA 1XDBA 2C2HA 2G9ZA 4O5OA 3PFGA 4UJ3A 1HV8A 2EEPA 5EKUA 1USUA 4EW6A 3OWHA 3C8UA 3EOAI 4Y2TA 1ULTA 2AXQA 3BL5A 3IIIA 2ODWA 4X71A 3RJTA 2YVAA 3RRZA 2QQEA 5T4FA 1AQJA 4F72A 2IS4A 4C87A 1PVOA 4QBTA 1NQVA 5JDCC 2BHRA 4CMBA 4YQFA 1L7OA 4C3VA 4ISCA 5B3JC 3VDNB 2XGOA 3F6YA 3K16A 4FEYA 5ICCA 2DQKA 2R1ZA 1V16A 3IB6A 4QYMA 1PK8A 5TB5A 3VJKA 2G09A 1E7SA 3EG9B 3N87A 4XI9A 1G17A 1MXFA 5IJAA 3I3SR 5ER9A 2XXAB 3S2SA 3S2IA 4AY2A 5BW6B 5GVSA 4PNEA 1Z4OA 4H7EA 2FWJA 4P58A 5AM0A 2O2ZA 2FXIA 2WT9A 2JJ2A 1CY1A 5JT1A 2CNBA 2REXB 4ZDIA 5JMOA 2LVBA 5FD8A 1K3UB 4BJ6A 1M76A 2AOUB 2ZRPA 4H1TA 4R6XA 3Q9UA 2ZYHA 2OLKA 4P5PA 1ZR2A 3DNFA 2PUEA 1NNI1 2NACA 2F00A 2HRQA 2N1BA 1KJJA 1ULUA 2WTAA 3IKMB 3K0EA 3ZKWA 3MSCA 4DSOA 3L79A 3BOSA 1IVNA 3W3AH 1Q84A 4GXTA 1EA7A 3PCTA 4J43A 5B12A 5L7TA 1C3XA 4WKNA 3PXXA 3IPRA 5AKIA 4OHYA 3L9WA 2P0AA 1KDYA 2NP6A 3RWOA 1Q6ZA 1YJXA 1ZJYA 2GZ1A 1Q74A 2QN1A 1QFXA 4MVJA 4BVHA 1JGTA 2VT3A 3K1TA 3D3WB 4ARAA 2X0JA 1VHWA 4WY2A 2KBEA 2YJGA 1T29A 4MUBA 5AXCA 2XNKA 4NE9A 3DGEC 5IZCA 1RI1A 1U2EA 3M3DA 2DHRA 2Y05A 3ICEA 1TMOA 2TMGA 2ARKA 3C41J 1Z0IA 5AKLA 1TNDA 3SHOA 4BAZA 1KZ9A 5SY4A 2A2ZA 2O48X 4XGRA 2RC6A 2C7GA 2EZ8A 2NPIA 1HKUA 1P6QA 1P8JA 2VPPA 2WDZA 3AJ9A 3QLVA 4RM3A 1YMUA 2ASVA 4XDHA 1BVYF 3EIFA 1ZUNA 3O38A 2OO5C 3DKVA 4ZVSA 3F6RA 1QTNA 2X6RA 4HNAB 4CCYA 3KS9A 3HR4A 5BV2P 2YBEA 1PG0A 5IDWA 1T1JA 3BAFA 1T2UA 3N2EA 4HDMA 5B1DA 3ZXUB 2WE7A 2ZBUA 3KSDO 2P1DA 2VT6A 1OB5A 4FVTA 4J9VA 1I2DA 3E2MA 2BCGY 1SQ5A 2E49A 3PQ3A 2EBWA 5I9BA 4RPIA 5SYMA 3FMVA 4IZ6A 3V4SA 4UFPA 2CXHA 3G2PA 3JD1A 3OLXA 4AG6A 1EDDA 4J3FA 5J2TB 3B13B 1B8OA 4M9ZA 1E2FA 3G89A 5KNDD 1X2EA 3BD7A 3EGXA 4JVMA 3BQ9A 1IM2A 1NULA 5JNVA 4FZJA 4CLRB 1OAKA 3UM9A 3U31A 2GEUA 4TZTA 3H2JA 3RSFA 3T3HA 5JATA 4HZUB 2Z2IA 3VZPA 3MMZA 3ZOZA 1G5RA 2YHAA 4D56A 5JFOA 1EI9A 1HDIA 4KFRA 3F5FA 1QNLA 2WJJA 2HPVA 2JS7A 5EMMA 1E5DA 1J1IA 1PR5A 1PZEA 2IYZA 2V65A 4NY1A 4BO7A 1MO2A 2IYLD 1U9ZA 5KIAA 3HMQA 1R64A 4WLVA 4LZNA 2M6KA 4OLBA 1F0YA 1M0TA 1T4MA 2Z0MA 1YU6A 4AF8A 3BK2A 2QTHA 4AS1A 3NHJA 4N0EA 5JNLA 1HG0A 2FCRA 4MLDA 1I33A 2JGAA 2B1RA 2JH9A 4JWTA 2AR7A 3H19A 4G0XA 2IS2A 1HNXB 2QX6A 3DBIA 4KDEA 3RSLA 1KZ1A 3IESA 4EEKA 1L4BA 1F2VA 2GZMA 4KVGA 2ZBEA 4HMPA 2Y66A 4LGVA 3RIHA 4BVGA 5I7UA 2HMYB 3U19A 1FUKA 2PZBA 1UWCA 1JSZA 1RMQA 2BZSA 2B83A 2XQJA 1WG8A 1N1GA 3DAYA 3MGGA 4XJTA 1ECJA 4P3YA 1F4LA 2G5CA 3QYPA 3VZCA 4ZI3A 5L4LA 3GZNB 1JG3A 1G8KA 2DWQA 2RCYA 3KTOA 1IHPA 4LYYA 1H4SA 2VRCA 3A6DA 3MLEA 1SZJG 3HA2A 3OX3A 1AQNA 3FD8A 5FTKA 1QDUA 4GEKA 4P3PA 4DVJA 3ANNA 1XZHA 3RTEA 3BHMA 3SDSA 3EDYA 2HHCA 1C7JA 5KAPA 3ZXSA 3QRWA 2ZJBA 2C96A 4HBZA 4A16A 1HLPA 1Y48E 1S8OA 3WHIA 3ZI0A 4NDZA 5I3CA 1SC4A 1XU7A 4NBRA 2PJDA 4P8RA 4KKVA 5A5EA 1ZXBA 3QJ5A 5JVDB 4G1VA 1SZPA 2NO5A 1NIJA 3G3EA 3FHTA 4Q4LA 1UDBA 1JHVA 3K31A 3BS4A 2IYXA 3ZTTA 1G8YA 4FFBA 1FLDA 1UBLS 2QAGA 5GGXA 4AJ2A 5AXDA 4KRFA 4KR7A 2PV7A 2PNJA 4CLEA 2XHZA 3A3NA 1YA8A 3IA7A 5LZ7A 4WXHA 4GPD1 1KAEA 4RD4A 5AKKA 2AKAB 4BKMA 4KQJA 4FU0A 4OYRA 4IH4A 1JKIA 1ZLYA 4B4OA 4I9UA 2AD5A 2DG2A 2X9GA 3UJHA 3HVJA 4CUKA 3LVBA 2FH5B 3SZUA 3KYDB 1RI4A 1FMCA 1OVMA 2FPKA 3NH6A 2HBRA 4NJOA 3PR1A 4MS4A 4EGCB 2V4ZA 4NU6A 4Z4GA 3C74A 1RFLA 1LQ2A 1T43A 4I36A 5B7QA 1E60A 5E9WA 2N9UA 3MGAA 2AJDA 3LNTA 1M6VB 2D3TA 1Q0ZA 2VK2A 3NRBA 3Q9SA 5AKEA 4ZU3A 5A7FA 2OV1A 4PG5A 3UO8B 3DDOA 2OD2A 2H2AA 2ZAIA 3DBRA 2K4MA 1CE8A 1NP7A 3W6NA 4U5XA 1G4UR 2F3PA 1KI4A 3LGXA 1G9SA 4G84A 5EJ6A 1NYLA 1D2MA 2EYUA 4RCZA 3N75A 3A6LA 1BO6A 3A26A 3KD2A 5LL6P 4PCAA 2R25B 4Z7NB 1JBEA 1LSOA 4KN9S 4O2AB 4NBKA 3PYMA 4O4LB 4IOKA 1WABA 4ACAA 2BONA 1HG1A 1U02A 2I03A 3KX2A 2HDWA 1TJ4A 4W6ZA 3ZDRA 4B8ZA 5KS2A 2NU9A 5BY2A 1K6IA 1XMPA 1HFWA 2ZU6A 3HDJA 3PHIA 3KHKA 5DTRA 4TZ0A 4FDTA 3PFFA 4H4EA 1CEQA 4ZVKA 3CE9A 3R3XA 4UD6A 3VC7A 3CSDA 2HHLA 3QZUA 1XPOA 3IBSA 3LUPA 3TLXA 4PO1A 4V0NA 3RBXA 4GS5A 3I9LA 3BPSA 4CQNA 4IJWA 1OV6A 1BH6A 1NXXA 2A1UB 3P4XA 4LZJA 3U60B 4L74A 3GIDA 3L1JA 5EJAA 1YF3A 2UZ1B 4FGLA 2VYND 1I4WA 2G9VA 1UZLA 3IE0A 1W5SA 6GPBA 5MDHA 3OZIA 3GIWA 4KFUA 3ESYA 1MJNA 2B35A 4Q7QA 4WBNB 3DHVA 5LQMA 3B3JA 3KJGA 1AU9A 1R1DA 3FI0A 4MWZA 3KVNA 1L1FA 2VJMB 2YQ5A 4U7HA 2PYDA 3D2CA 3T5DA 3KUDA 1Z3IX 3L7BA 4RADA 3ETEA 4WFIA 1NKSA 2BIFA 2BFDA 4D9HA 1MQSA 3G8YA 2C2KA 2JK1A 4XARA 2V54A 4BZXA 2P4QA 4HEJA 5DOVA 4B35A 3TTWA 4TYPA 4XXHA 3FBGA 3LPLA 4YDRA 5DEOA 4AP5A 3RVJA 4PYNA 5J2UA 2FUNB 1RC8A 1EM8B 2BSQA 3Q41A 2MSKA 3FUXA 2B4AA 4KOAA 1Q57A 1SVLA 1XA3A 3FOWA 4OXQA 1L7XA 1ESNA 1N5LA 1TLFA 3FNHA 4D0SA 3TECE 5LP1A 1U9CA 2RC5A 4OJNA 4NCAA 3CRZA 1ETHA 3H05A 3PNSA 4XOIA 3KQQA 5ABPA 4N7RA 3EGDB 4U7JA 1P1KA 5K0TA 5F4BA 1V47A 3SC6A 3CF0A 5C0OE 3FTFA 1EZ1A 1V1RA 2Q3MA 3DOEA 3H1AA 3HDYA 4DXHA 1W581 2YICA 3NKFA 4DFDA 3BTSA 1H9BA 3HMKA 3T7SA 2QP4A 3CNOA 3IAXA 4FB4A 5HF5A 1KAGA 4ZOLF 4LXQA 3S2ZA 2PKXA 3T54A 5JD6A 2UUPA 2WNIA 3G8BA 3LW8A 1IPEA 4D96A 4JJAA 1P33A 3CV3A 3K0AA 3TOZA 2KM1A 2R1TA 4LDQA 2IXBA 1WMFA 3NVKI 4TM7A 1JB1A 4YDHB 3I2IA 3WYEA 1MJHA 3M49A 3LUJA 2UXBB 5K3FA 2O2DA 4GSYA 2PJUA 1CYDA 2L42A 4QGAA 3NOOA 4L6AA 4Z86A 5F4ZA 1Y7TA 1YJQA 2QYHA 4UEJA 5FBVB 4YJFB 4A5SA 1XHEA 1GTZA 5IAEA 4OSEA 3UHFA 3HXOA 3D6HA 4CI0B 4F4UA 1KWGA 2VRBA 1MAHA 4MR8A 1EG2A 4E5DA 1M6YA 3ZQ6A 1COZA 2HMSA 1UXIA 3LOQA 1E99A 1UMBB 2FWRA 1O9GA 2BY4A 4ILKA 4I3GA 1T5TA 2CLCX 2BTOA 3U6KA 1ZNZA 2Z30A 5K03A 4GAEA 2J3QA 2AXNA 2X4IA 4J7AA 4DA4A 2YV3A 2YJ3A 1X86B 2V9ZA 4IHJB 4WEQA 5FKJA 2XCRB 2QTVA 4F9EA 1WBJB 2V97A 3JAWA 3EMBA 3JQQA 4IIJB 3CJRA 5KHAA 1V7QA 5ALXA 2IEYA 5HIMA 3WZLA 4FHDA 1FE8A 1U3GA 2BSXA 1YFKA 2XUHA 5DLQC 4JBIA 1THZA 4XD7A 2PQ6A 1ABFA 3IDZA 4K9SA 3DO8A 3JYQA 4INPA 4RWZA 5I8ZA 5LQKA 3AINA 5HDBB 1JG4A 4AMZA 3EX7C 3KLMX 4LXGA 2I4OA 2P5SA 4NR0A 4CM8A 4N8SA 4Y1EA 1N0UA 4V39A 1CZRA 4MQLA 1A9YA 3LA6A 1IN8A 3I32A 3U3KA 2P9HA 1CS4C 1GNLA 1R74A 2HIHA 3LC7O 5KX5F 5LUAA 4I4IA 4RS4A 2JH8A 1MABB 2XW6A 1QRUA 3COSA 3URKA 4B1FA 3O8CA 1UPBA 1SKQA 3P96A 1GLGA 3R6DA 3UWKA 5J23A 4K86A 1QBGA 3HYNA 1LDNA 1XCPA 2BUAA 1LC3A 1G5IA 2GAJA 1QANA 2DGDA 4L73A 1DJLA 1SUEA 4JYPA 5DM1A 2NZVG 4R40A 2Z58A 4E88A 4X3OA 4UJ5A 4S04A 1SIWA 4ZI2A 5IF9A 4OHUA 3RYIA 4QE3A 3FJYA 4UTPA 3LRXA 1QB8A 1R3UA 1PEYA 2EYQA 1BDMA 2XBUA 3D0OA 5E7JA 1NUAA 1B43A 3H2YA 1KI2A 2CXNA 1L5OA 1LQUA 3HU1A 3N2YA 2BE7A 3Q15C 1GQYA 5AR1A 3ZQUA 4UTRA 3ZY6A 1JQAA 4YAFA 1RRFA 5EKXA 3HI6A 4C07A 2MYNA 4R68A 2HXYA 4RORA 3MJDA 5K8UA 3RT1A 2WPNA 2VG8A 1SVUA 2BBTA 2VNKA 1CY0A 3MJVA 3MWDB 4HQOA 2QMYA 3VSAA 3ROGA 2RGWA 1E9EA 2L69A 4TKLA 3LAWA 3AW9A 2XWJI 1JR3A 1ZGCA 2IV3A 4RMHA 1ATIA 1YKSA 3AG5A 3KZCA 2CL0X 4R51A 1GQRA 4IIGA 2WJVA 3E27A 2A94A 1SQGA 3NOQA 5I7FA 1NI4B 2KBFA 1H0KA 1UKAA 3PBKA 1R6VA 1BXGA 4GQAA 4DLAA 4Q12A 2R68A 3LI2A 4KOEC 5FOXA 2W5UA 3VR3A 3W5HA 2VCHA 1PR6A 4RL4A 3A25A 5CK5A 4RABA 1W88A 3A6PC 1N0WA 4MIEA 5JEDA 1GPJA 2C59A 2I71A 2QVBA 2XQVA 3M4JA 3BXZA 4LFBB 2QIOA 4MKFA 4TTPA 2F8SA 1NJSA 4C0LA 2B2CA 4B7UA 3RAFC 2C5BA 4QBGB 2W6MA 3G0DA 1Z13A 5A4DA 2V4MA 4TMKA 1H2WA 3LM8A 4ZT4A 5LZ2A 2VQ3A 2H2GA 4DXDA 5A4AA 5HX7A 4QJ5A 5BN5B 4JT9A 1TZMA 1QB7A 3LJKA 3Q87B 1EYZA 4FOSA 2FSGA 1IULA 1UK7A 3JQ7A 2J32A 1VSQA 4M0FA 3R9XB 3TN7A 3QVKA 4QU5A 1FMJA 4QM6A 2L19A 2Q6OA 4E1AA 2I2XB 3P26A 3PNLA 4C20A 2VTBA 3GZ4A 2GFQA 4XWKA 2AYZA 2V7VA 1U7PA 5GP1A 4L2IB 2AMVA 3Q8MA 1PSDA 2I8AA 2P4HX 1W1UA 2FLKA 1WPGA 3L7AA 2I1WA 1LLUA 4MP8A 1VJDA 3VM6A 3C3EA 3CEHA 2ORWA 3D8BA 3NTUA 2AN5A 2WEKA 5FYDA 1DQPA 4C7BA 4US1R 3HCFA 2PKYX 1T5HX 2B20A 2WFLB 4ZCLA 2ZITA 3VPBA 1OWMA 3QVUA 4XPZA 2ZI4A 1AMNA 1C4WA 2QJRA 3E9YA 1IVSA 2QPTA 5BSVA 2C29D 4HVAA 4X60A 1V25A 4Q3KA 4D9KA 4NYJR 2X4LA 2HF9A 1KFBB 3GVIA 1RJGA 2OCBA 3K9QO 3GLFE 3K6SA 2YS7A 2G77B 3CE6A 4AG5A 5LYJF 4KQMA 1KNQA 2CXQA 3HCEA 5EVJA 4O59O 3OZAA 1GUAA 1Q6YA 2JIDA 3F5MA 3R7SA 4LYHA 1Q1BA 2P77A 3D3EA 4R31A 5JXGA 4KREA 2YZMA 2PWZA 3GFFA 5LYJA 1AA9A 3GVHA 2H65A 4K2HA 4JY7A 1NRWA 4PTLA 5H68A 3BDIA 5DFAA 3NIBA 3INNA 4QYXA 3HKEB 5F51A 3DCYA 1VMEA 3ZHVA 3K9WA 5I9MA 3TEJA 1RAGA 3WA6A 2ILTA 1BC5A 2PS1A 1MENA 1IUOA 4B4KA 4GI1A 2QROA 1LNQA 5JFGA 2EC5A 2ABWA 2ZBVA 1YR9A 4PGMA 2X1HA 4D3FA 4EO4A 4TL6A 3KXIA 3GOHA 4DR7B 1VSUA 2VOEA 1BXRA 1VJRA 2CL5A 4GPIB 1TFUA 1PJLA 1FSSA 4NCXA 1C41A 4U2BA 3B1ZA 4NQRA 1P4AA 3LLVA 5EJEA 2GCPA 1BQ4A 3S1SA 2OAGA 2Z3VA 3DBLB 4R9VA 1RKQA 5TNXA 3LHDA 5U4QA 4ARSA 5LJLA 1WUHS 1NYQA 1JNYA 5A3SA 4BYMA 5CFOA 1XVAA 3NWOA 3EQ9A 1GTSA 1Z5GA 3UC9A 1WXHA 1G5PA 4OGFA 5HQTA 1ZI9A 1X7WA 1PZXA 1KSJA 2RAPA 3NVAA 3QSGA 3RRFA 2HW8A 4YNBA 1B0UA 2FJUA 3NBYC 1XZEA 3Q7RA 4C7MA 5IXJA 1EFAA 1D6JA 1E92A 1BROA 2FRXA 4QOFA 1ZI8A 3MWFA 3AFGA 4LJ4A 2H4HA 4ER7A 1QU3A 1G7CA 3ZE2B 1KJNA 4FE4A 3UICA 3W1VA 4NECA 4C6TA 2L18A 2IYOA 4FI3C 4H31A 1PHRA 1PV2A 3H9GA 3O4VA 1A7UA 4RBNA 3TG2A 5A04A 2QMZA 4WY8A 1OH8A 4RETA 2J9GA 5HJ7A 4JGIA 4Q02A 3BB4A 3NO4A 2PQ2A 3LRPA 4LOJA 2G04A 5FI1B 1LLCA 2B34A 4GZMA 1DBPA 1FU8A 3PC4A 1HE1C 1GRCA 2TECE 1IHDA 1V7ZA 3B7WA 3E5RA 3OZTA 4NHEA 4PFKA 4PGHA 3UATA 3ZW7A 4CKEA 4ZCRA 3GWGA 4EHLA 2QZPA 3AEQB 4IHAA 2BEWA 2HQSA 4F38A 2CK3A 1V5WA 4DANA 5JH7F 3GPLA 2GJSA 1TRKA 3AR8A 1UBOS 3GFRA 4AYXA 3LVRE 1G4AE 2VPIA 3AKDA 1C3LA 2EWMA 3JQFC 3C4QA 3MJHA 1Z6QA 2ZJ2A 4QD3A 3VR5A 4F5DA 4LBVA 5BRAA 5JLJA 5DB4A 4O1MA 2GBFA 1U2DA 5AMXA 5CDFA 3QP9A 5CB4B 2X5JO 4IM7A 4L4ZA 3G2HA 1T1RA 4OXIA 1UPAA 5GJCA 3U9LA 3TR6A 3HBJA 5JI2E 1A77A 4RK0A 1AIPA 4B43A 1VM6A 1XNHA 4DARA 4DE5A 4DJTA 5JAMA 2IZ1A 1M5RA 1DC5A 4DGQA 4ZI7F 3AM4A 3ZGLA 5KPDA 3OBBA 4QTZA 3UXHA 5BN3B 2F43B 3AR4A 2PXCA 5A9SB 1GKUB 5B7PA 5I7HA 1YASA 2CLSA 2XUAA 3ICPA 3TNJA 3BQNB 4URZR 2H9AA 2FHSA 3BHIA 5ALEA 3GJ5A 4BCBA 4ER5A 4L27A 1WCV1 3DLHA 2WHPB 3DZBA 3GRPA 1B3BA 1TT7A 2YHIA 1P2SA 4F04A 4KCGA 4DLZA 4RKQA 1QGOA 2ZSIA 2JG3A 4G85A 2C4HA 2P8SA 3PDIA 1QKIA 2GYYA 2GUGA 3H4IA 2QGZA 3QVWA 3L7JA 1M83A 5FOQA 4I50B 3GLGB 4YREA 5JAHA 4MRMA 1G55A 3KOWA 1JYEA 3AY3A 2HK7A 1Q7RA 3OFVA 1PK9A 4PLGA 3OTWA 3EWNA 1HZZA 1Z4KA 2AJTA 4PZUA 1TO1E 4OXYA 4RK4A 1BDHA 1HL7A 2PUVA 3JARB 3SXPA 2GK3A 3JQPA 5B7GA 4YJFA 2FOIA 3SZRA 5BSMA 5ALUA 2O3JA 2OP0A 2Y9MB 2G3YA 4RKYA 1K4MA 4UW9A 4YP6A 3UAGA 3HVRA 3MILA 1OLSB 2QEQA 4H0NA 1FP7A 3V2IA 1X94A 2QXTA 1IZYA 2O2GA 2MWMA 2G82A 2C00A 2DMRA 2Q2WA 4HR7A 4KO2S 3CR3C 1G8HA 3ML1A 2OBXA 4FOOA 4KAXA 2C58A 5AD1A 3NMUF 2CVQA 2JFBA 4YRFA 4L5CA 1B8UA 3WNBA 1K8YB 2AG6A 4E7PA 4Q93A 1GQ2A 2H11A 1W4LA 2GBIA 3INGA 5ARDA 3IJRA 3ZTWA 3LY5A 3U7RA 4AT1A 4D5EA 3M0EA 5JCOC 3D4IA 2OENG 3C8MA 3DZHA 1UOEA 4YJ2F 5C2JB 2ZPTX 2CXOA 3AHFA 3ZK7A 2IHYA 5ALJA 3A05A 3F6CA 3T3IA 5GMOA 1C3OA 1Y0BA 4WEOA 2PFKA 5CB0A 1U8AA 1R6TA 3CZCA 1FFDA 1G21A 1CDZA 1DHRA 1POXA 3B85A 4YJ2A 4QYIB 2QENA 4A23A 1NA5A 2VJOA 3LWNA 3OWXA 4WI1A 5DEIA 1GPH1 2QRUA 5K6AA 2QUZA 1YB7A 3VNBA 1Z6GA 5GAJA 2QMUA 3DZ8A 3OX4A 4UDOA 4BJ3A 3ZDDA 1NY5A 1P44A 1KDTA 1CU1A 3MMSA 5DT2A 3I8OA 3DL7A 4XFJA 3MLAA 1AXEA 2PMEA 4XTCS 2DHEA 1TL7C 3UWPA 3IFSA 4B3DA 1TYEB 1DGQA 4B45A 1IFXA 4M0KA 4X3PA 3FSEA 4KK4A 5E3IA 1FMFA 1IVYA 1C9YA 1JPNA 4QJ3A 4IDFA 2WWRA 5D87A 4JAVC 4E7OA 3MWKA 2DKFA 1Z0AA 1S4QA 4MQ6A 3MTQA 1GHTA 3COZA 4BO4A 4BWVA 5F9HA 2DC1A 2P2CA 1KP3A 1ZMXA 1DTSA 2QORA 2X19A 3EOZA 3BXFA 4JEMA 3QE4A 5EFOA 1X7HA 3SE7A 3T5CA 4DCSA 5IK2D 3KQLA 4DCNA 5JMWA 3HYRA 3G0IA 3S40A 5LU8A 4K28A 3KWFA 2F64A 5CVDA 3W5AA 4L8FA 3O4RA 1XZBA 1GZDA 3JSAA 2HM7A 1HE8B 4YRGA 3I8XA 3PFCA 1TKCA 1K8RA 2GUWA 4S05A 3GGSA 4AZ0A 1M9NA 1A88A 3H5AA 1JA0A 2C4NA 4DC9A 1FNMA 3HE3A 1HE2A 2QL6A 2BCEA 2I55A 2QY6A 2YZGA 2A9OA 4RLFA 1WHSB 4X94A 1JAZA 2CNNA 3K9GA 3U40A 4ALIA 4P5EA 3LWBA 3LXUX 4R5MA 1N8TA 1P9NA 3FLEA 1CZKA 2NYRA 3EGVA 2C2BA 4QUKA 4OH7A 2XE4A 3UBMA 1RYMA 4MEBA 4TKUB 3RVOA 3KU1A 4GMHA 4INAA 4LVUA 1I9GA 4Q4HA 3UT0A 2I1VB 2HO4A 1HTWA 3KQUA 4MDEA 2PNFA 1T25A 1KMCA 1T0HB 3T41A 4YYEA 1BOFA 2VYFA 1CP2A 2ID4A 1AK2A 4NDNE 4I5DA 3DSRA 2WWGA 3HDVA 3K73O 7REQB 1O8CA 5THKA 4XUCA 4B2LA 1Y8RA 4TSFD 3MXTA 2PY6A 2DULA 3I5MA 1GPWB 2ONZA 2XRZA 2I6FA 2A88A 1JTEA 1KY5A 4OXNA 1PS8A 2PUCA 1P4SA 1KKUA 1AK9A 1VIMA 3AONB 4TTVA 1UBMS 1J0AA 1SA0A 2HWUA 3HXPA 4UEOA 4KV7A 3FVTA 4I1IA 3L8YA 2ALJA 4ECEA 1XR3A 2JGDB 2JIZA 3CKLA 3T8YA 3VKFA 3NWPA 4GE0A 4CIBA 3PFIA 3PGKA 3WMWA 1YZ3A 4DA8A 1A0OA 2EFDB 2FMXA 1Q0QA 4TLDA 4UBIA 2X8BA 4YGYA 4RDHA 4A03A 3L2OB 4TS9A 2VFAA 4L22A 4WL0A 3D8NA 3AUTA 3ITKA 1E6LA 3GAAA 4D9EA 3V4VB 2AX4A 3PYLA 1OFGA 3GJ0A 2W2LD 2ZP1A 2IA5A 3COYA 3H11B 4YALA 3TTVA 2QB5A 4Z4CA 1JQLB 3V55A 4WJKB 1DAPA 1E20A 2GDJA 5CLJA 3OJXA 1J7KA 1EGAA 2FEPA 2H4JA 3AT1A 3CISA 1V6AA 4D8TA 5HR5A 4NXMB 3FKJA 4WBXC 3KK0A 4D5GA 1HDCA 2R86A 4C4OA 1A9QA 4HDNA 3B53X 1V4NA 4A0QA 5CIWA 3IKVA 4PX3A 3E23A 5DWVA 5HE9A 1OH6A 3CLSC 2D54A 3RS3A 1IB6A 1VRVA 4KGVA 2JBWA 4V0LA 5TY0A 5L95A 2C54A 3I6ZA 4E5MA 1UIMA 2D0OB 1DXOA 3M81A 5KDDA 1W0CA 4DZTA 4MCAA 3ITDA 3N8KA 1W4AA 4RYLA 1NRXA 1Y7LA 3U9SA 2PSSA 1RI2A 3W9SA 2WILA 1U0HC 1XZQA 3UYLA 3ABZA 1JU3A 2ZR8A 4K46A 1Z15A 4NCIA 3ZCVA 3IE1A 2J9FB 4U4AA 1NLYA 2FRVA 4MUAA 1G0NA 2Y0BA 5BQXA 5TT0A 1NXTA 2HGZA 3EAFA 3F2IA 2ZYSA 1RRGA 2XRMA 2BFBB 2YVUA 3HLYA 3HSYA 3PIIA 3AERA 5CPBA 3L0IB 3A3OA 4XKJA 8ABPA 1N3LA 3C15C 3GZTB 5I4CA 1L4MA 2IP2A 2WZBA 3MM4A 1QH8B 4KXUA 3MC1A 1GGKA 4FDVA 4LJLA 3QFHA 3PYXA 3SX4A 3OE5A 3F67A 3HKCA 2CYBA 3R5TA 4C5BA 1EINA 2GX6A 3AQ4A 5BYJA 5J63A 5KTKA 2ANBA 2D2XA 2WUDA 3CONA 2QN8A 3OJLA 1DZIA 3E1KA 1R4MB 5FJIA 2YINC 3SC2A 5FB3A 1CB0A 1EP3B 3IHKA 3G17A 3PPWA 2D8AA 2E55A 1Z0FA 1RYFA 3HXMA 2VTDA 3UV6A 5TMEA 3C3YA 2IK8A 3F4LA 1DDGA 1I3KA 2I9KA 2DFVA 1UMDB 3TDKA 2P9TA 1M2GA 4KPUA 4IF4A 4QTTB 1EWQA 2Y67A 1B2LA 1P3JA 1NJ2A 1I5RA 5CYPA 4YMSA 4D0GA 1PUXA 2QUKA 4I4TF 3NHUA 2NZUG 2PLFA 3CZPA 4EFDA 3BN3A 1CZOA 3QOFA 4B2YA 4QPJC 3FPAA 3EUAA 4DREA 3WBJA 1N2SA 3O83A 1TTPB 4J0QA 4MUEA 1YONA 2PRIA 3TYXA 1KP9A 2QHXA 5BVGB 2RG1A 1E3LA 4C7VA 1NP6A 3FWNA 2WVJA 1J0BA 3G6WA 3HHEA 3OIVA 4HB2A 4IIDA 2EGHA 1PJTA 4OJYA 3R5KA 5JECA 1NI3A 2RGXA 5HS6A 4R5HA 4DRXB 4JVNA 1QGED 1NW7A 2FB9A 2JLWA 3VVMA 3Q1LA 3QLUC 2XCQA 4TRJA 4UUNA 2VP6A 5IUNC 1URPA 1PQUA 4BNVA 4DWWA 3UMYA 4AY6A 1O4WA 3O93A 4HQNA 1WOMA 5M34A 2ZI9A 4D9GA 2OCLA 2WVGA 3JWGA 5KAMA 5JCJD 4X66B 3RC3A 2G4LA 5HKKA 3THWB 4CWAA 1WMDA 1RU3A 3MBOA 4ZVOA 1VPLA 2NT4A 4URVR 3HUFA 1FSFA 2I7CA 5CX4A 4CF4A 4N6GA 5JZSA 4R0MA 4MVJE 1N5JA 1E8NA 4N4AA 2FFAA 5DF1A 1N6IA 3WYDA 5LR6A 2F59A 4MV4A 4PG4A 1KQPA 4I8IA 2NNWB 5TPZA 4ZYZA 1VGQA 3EZNA 3HXTA 2OHIA 3PENA 3I0MA 4G9EA 3JTMA 4MW0A 5GZ3A 2NX2A 1A5TA 4KR9A 2GCIA 1KC1A 1VXOA 3DMTC 4FMDF 4OGLA 1CETA 2VSNA 4FUTA 1NNSA 3USCS 4LHYA 4NE2A 1MQAA 1NXWA 3OKPA 3LDFA 2G0AA 4IJMA 4O2LA 2D2FA 3ZD7A 2UZAA 1FMLA 3GFQA 4X20A 1AMOA 3CZAA 2DRIA 3J7TA 1C0EA 1A96A 4G9GA 4X92A 5TT1A 4F60A 4CF7A 1CZLA 3DHNA 2CUNA 4NFSA 1P5ZB 1KF0A 2OHVA 5HKAA 4KJZA 3NYRA 3WS7A 1ICEA 3I2FA 3HR7A 1LS1A 2Z04A 3UWMA 1U3DA 1GTVA 2H6EA 4EY6A 4WKPA 3EVCA 4GXNA 4L4YA 4WXEA 5AI0A 3OP4A 4CKBA 1HQKA 2LV8A 3ZV6A 2W0SA 4ZQHA 4ETMA 5IT0A 1DC6A 2FVYA 3BWMA 4NU8X 3W2EA 1L8XA 1R0BA 1ZJZA 3D54D 4RY0A 5H1YA 3F5DA 2WWVD 1QC5B 1C1XA 1ZBDA 2Q6KA 2XADA 1DOAA 1B8NA 2AN4A 2MR6A 3ED5A 4QTYA 4PNZA 2I91A 3WIVA 5DBOA 1KVUA 4EX7A 4R1OA 4N8EA 5EUBA 5K3DA 3MAGA 1FK8A 2MSCB 5JSZB 3REQA 4A0GA 3G68A 4WA8A 1O0BA 3UV7A 4YMIA 1FP4A 2IEBA 4I9NA 2FW6A 2H7CA 1E18A 5H9VA 1VKJA 1VPVA 2F62A 3B6JA 5CB8A 3LUCA 4FKMA 4FSDA 4A8JB 2PYIA 3LC1O 3M6LA 1MG0A 2NO9A 5ITZB 5A4MS 1YCHA 1V1JA 4PZCA 1QK4A 1YBHA 2CFIA 2RGRA 4H1WA 1TECE 2RK6A 3CKYA 1KS2A 1XEWX 3DFMA 3F9IA 4R2LA 3Q40A 3RIEA 3PC6A 2CWWA 2ZYDA 3RHFA 3UJ8A 1BW9A 2QD2A 3UAXA 4GLBA 3M9LA 1KTVA 2FDXA 2WABA 4TUYA 1KBQA 4FGSA 4N0MA 1GGHA 1ST3A 4IDQA 3VU3A 2ZK7A 1UXKA 3ZEIA 3VHXA 3RIGA 2QXUA 4HRVA 1PQPA 4BE7B 2A57A 1CUSA 4R7TA 2ZAOA 5EXXA 2WT4A 1Y3IA 1R6BX 3B6IA 4WCVA 4EGAA 1AN0A 1L5RA 5B3KA 5CBPB 4Y3UA 2X8WA 3WADA 4DLXA 5CURA 1CY4A 1L5VA 1YGPA 4BBAA 2OO3A 3ZU6A 9ABPA 2XKJE 5H3LA 4GBGA 1E64A 3P9XA 3PRKE 1XALA 4MOWA 2B4RO 3SZ3A 2HSGA 3A1DA 1NVFA 3LBHA 4P7BA 5EKDA 4YP9A 3OPMA 1FRNA 3SXJA 3WO0A 3O8OA 1OTYA 5E6RB 5ITVA 5KVSA 4MHTA 1H6BA 1JXQA 3DLPX 1Y1LA 2A5DA 4BX3A 1YCDA 3HBAA 4O4JF 4GWLA 4XGIA 5K5EA 2V6MA 1GNVA 5DYIA 1CSEE 2XKAA 4MGYR 3MS7A 3PGMA 1BQEA 1X1BA 1C9JA 1Z5OA 2F1IA 2G5PA 2JRLA 2Q5IA 3OOEA 2OXRA 2RGCA 3MMPA 2ZTMA 3MTIA 4RXMA 3SJAA 5B3AA 1EBUA 2HDHA 4UHKA 2ZLBA 3ECSA 3N8NA 2WVAA 1SXJB 4GKBA 4ITVA 5B1IA 1I7DA 3ZCXA 5TF0A 2JLVA 4PZLA 4NF2A 4XPIA 4K6MA 4JDUA 1DRVA 1AQ6A 1OLXA 2HIMA 2WTXA 3I9KA 2Z6QA 3SBXA 4K6GA 3ENZA 1D2EA 4F45A 4PANA 1KY3A 4B71A 3TTSA 3Q98A 2QD5A 1SBYA 3CH6A 5BMOA 2P7IA 5BV7A 5JQGF 1D9ZA 3D8HA 5KB3A 3J81k 1S8FA 3EMVA 5HPYB 3LMKA 1OYWA 1OBHA 2ZB8A 3DOHA 4MV9A 4BTVA 5EFZA 2ZEJA 3FI9A 3PC7A 4G8BA 1TCBA 2II6A 3PC2A 2JFWA 3PE3A 2Z57A 5DSXA 1D7OA 3U5ZB 1RLIA 4JHLA 1LBTA 1PJZA 3OA2A 3KQMA 3SY8A 3WL6A 2C8LA 2FNAA 2AR0A 4LQDA 4YBRA 2Z08A 1IUNA 3CLUD 1NN0A 2GM9A 4DJFC 3LPDA 2GBGA 1QG0A 4AP9A 5KQRA 2XXAA 3IUMA 3FR7A 1VLVA 4KTVE 1E9SA 2Q62A 4KWEA 4KQ1A 2OV3A 5AVQA 3HY4A 2FMKA 1QIFA 1YU9A 3IAHA 4OXXA 5HEKA 2OYCA 1ZHOA 4F4DA 5HZKA 3A1SA 4XCXA 4HNTA 5IJXA 2V6IA 2VF7A 3AH8A 3BSSA 4KYIB 1Q22A 3K0CC 4C3ZA 2BMWA 4X95A 4XLZA 3RC8A 2CXXA 4J1TC 5JD3A 4UNSA 4INZA 4JJKA 4DWJA 1ZUIA 3H1TA 1P6UA 4R9NA 2WMOB 2Z1MA 3NVMB 4KH1A 1S96A 721PA 3D7SA 3QHQA 2VDRB 8OHMA 2E9SA 5AOBA 3UBTA 3FFTA 2FSPA 3EY9A 4OLJA 4RY9A 5GIPE 2WAYA 3P4UA 5T4BA 4E6PA 1IRIA 5I9TA 1RLTA 3RYCB 1U99A 3SQOA 2Q0HA 3NEPX 1FC0A 3OD5A 2CHGA 3NRCA 1Y33E 3LLSA 3PQ7A 3OZUA 1YGYA 2ZR0A 3GLHB 3RU3A 4DILA 1U3TA 4XVUA 3UW1A 4C0QC 3O2NA 3EUWA 2Z8ZA 3UB4A 4NCBA 2P9YA 2WQ7A 2YN0A 4I6GA 6REQB 3UPDA 2PO7A 3GLSA 3VO1A 4HLNA 3TS1A 5ISMA 2O59A 3VPGA 2O6LA 3P19A 2IEZA 2OUIA 4S1PA 2EDAA 2PO5A 4FCWA 4FLEA 5DNVA 2F9FA 3IP3A 2O8FB 2WKRA 3C8ZA 1KEVA 4FQ8A 4UU7A 2ZUWA 2OCXA 1NU6A 1C7FA 3D4LA 3QX9A 2OZEA 4MMXB 5E2BA 1EK0A 5JJKA 1R9MA 4JT8A 4IP0A 4DNXA 2HKIA 4TXLA 2HU2A 5IEJA 2FRDA 2VJAA 1GY8A 2R66A 5FA6A 5FADA 1QH9A 2PKRA 1S3FA 4EJMA 1PF7E 2F2TA 1F7VA 3VSCA 1TCVA 2PYZA 1MVLA 4J4TA 5FUQA 4XX0A 2W70A 3LBYA 1E96A 4U5QA 1M6WA 5J2TA 1FU4A 3JR7A 3ASZA 4KGXA 4NZOA 3L7DA 3N6VA 1YTUA 1LS6A 1M2VB 2PH3A 1RPAA 1SZCA 4CLRA 3U37A 2FSFA 2JGRA 5I47A 3EZFA 1DC8A 4IL5A 4BDSA 4DLWA 5H4HA 2WSSD 4HZUA 5KWIA 4P7KA 3BWBA 3KFLA 4DLVA 1U3WA 1VECA 3CQ9A 3EJ6A 4K9OA 1WEHA 2FUCA 3FJ1A 1ND6A 3CVJA 5AKZA 2YMQA 4IGAA 5EYPB 2IY7A 3SBOA 2F1HA 5BPHA 1SKUA 3FIUA 1C30B 4S3MA 4EG4A 1Q0SA 4MKIA 2B0JA 2J08A 1NXVA 4H15A 4H60A 3WKCA 1CUZA 3QKWA 2XV1A 3DT8A 3ELUA 3N2IA