3UPDA

2.9 angstrom crystal structure of ornithine carbamoyltransferase (argf) from vibrio vulnificus
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
357
structure length
346
Chain Sequence
HHHHHHYFQSNAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase
publication title 2.9 Angstrom Crystal Structure of Ornithine Carbamoyltransferase (ArgF) from Vibrio vulnificus.
rcsb
source organism Vibrio vulnificus
molecule tags Transferase
total genus 133
structure length 346
sequence length 357
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3updA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3updA01
4KGZA 1F1BA 1EZZA 4JHXA 3M4NA 2FZGA 3SDSA 3D6NB 1ZA1A 4KGXA 1C9YA 6AT1A 1PVVA 4FYYA 4E2FA 3UPDA 5AT1A 3KZMA 7AT1A 1I5OA 1SKUA 1NBEA 2BE7A 3KZNA 1Q95A 3AT1A 4ANFA 4AM8A 1FVOA 2OTCA 3M4JA 3MPUA 4KWTA 2FG6C 5ILQA 3TXXA 3NPMA 1RAIA 1RAAA 2G7MC 4FYXA 3L04A 3M5CA 1XJWA 2ATCA 3LXMA 1VLVA 1A1SA 1DUVG 4BJHB 3R7FA 2P2GA 2EF0A 3R7LA 3KZOA 1ORTA 1PG5A 1RAEA 1R0BA 4F2GA 9ATCA 2A0FA 3L02A 3GD5A 3M5DA 4EP1A 3E2PA 2BE9A 2YFKA 8AT1A 1OTHA 4NF2A 1R0CA 1JS1X 3KZCA 1AKMA 3R7DA 3Q98A 1FB5A 4IV5A 1RABA 1RAGA 5G1PA 1RACA 4AMUA 1EKXA 4KGVA 3L05A 4JFRA 4EKNB 2W37A 4KH0A 4A8PA 1D09A 2HSEA 4KH1A 1TTHA 3L06A 2AT1A 3D7SA 4AT1A 1ACMA 4A8HA 2FZKA 1TU0A 3GRFA 5G1NA 1TUGA 4A8TA 4H31A 5G1OA 2IPOA 2FG7C 1ZA2A 2RGWA 2QG9A 4FYVA 1RADA 2QGFA 4F04A 4FYWA 8ATCA 1RAHA 1DXHA 3TPFA 3CSUA 2FZCA 1AT1A 2AIRA 4WTOA 4OH7A 2H3EA 3KZKA 1ML4A 1EP9A 1RAFA 4JQOA 2I6UA
chains in the Genus database with same CATH superfamily
2X9GA 4DBLC 3DD5A 3WLNA 4PN3A 2Z8YM 5GIPE 5JALA 1Q92A 2IPAB 2Z8ZA 3REQA 1T2NA 1GGFA 3C39A 5TVKA 1SIOA 3W5HA 1SBNE 4US0R 4WZAB 2BDEA 5LNK6 3H3FA 1COWD 3PDCA 3ZTWA 4DL9A 3MMZA 5AUNB 4ZP1A 2E0IA 4GBJA 3W05A 3D4BA 2RI6A 3MWKA 1FTQA 1M34E 3R76A 1X1QA 5DWQA 1B23P 1QG0A 3JRWA 1NBEA 3AINA 1UODA 3ZC3A 4FK8A 1V8DA 1M2FA 4MUFA 1M8PA 3FNQA 4AM8A 5TQVA 4EFLA 2IHBA 2B1RA 3HS3A 1JLSA 2FG6C 3HKBB 1Q6YA 3C15C 1E3TA 3DE0X 2GJ8A 3EGIA 4R98A 5HA5A 1ONSA 3UXHA 4JLUA 4X90A 3FLBA 1Q1AA 3KKZA 1O9BA 2I3DA 1E8NA 1XCMA 3QIAA 4YAJA 1IXKA 2FRXA 4I55A 5KNCD 2QM8A 3L6RA 4C2UA 5L40A 3A11A 3V7YA 1RYHA 2O3RA 3EVTA 3LS2A 3DWFA 4RA9B 4XWKA 3KPWA 5DK4A 1C3LA 3CX3A 3GLTA 5JQGA 3NOOA 2WJWA 1F6BA 4Z6KA 4G9GA 3X1DA 2DXIA 3C8HA 1FQWA 1DADA 2E4YA 1Z6GA 4NOLA 1S3GA 5FWXB 1QLHA 2XNKA 1MW8X 2I71A 3LTNC 3PNOA 2FPGB 4R31A 3MBIA 2FR8C 5EQTA 1DUSA 3EN0A 2BR5A 4TS9A 3CISA 3U4GA 4UUPA 3AFOA 1B15A 3AIMA 3GJ0A 4FQ7A 4OK6A 4WX2B 1PR4A 3IAS6 5EWLB 1PIWA 5FBWB 3PR1A 3SLGA 5CBPB 5AW5A 2COUA 1JFFA 2G82A 4HNRA 5AHXA 1FDOA 1FPMA 4CI9A 5IWCA 2WQ7A 2AZXA 1T6XA 2X2EA 3JQ8B 1KH2A 2DWPA 4TRMA 5CIWA 4UNRA 4Z54A 3ETHA 3HHEA 1W47A 1Y4UA 3SIWA 4Q03A 4C6TA 1BDIA 1E32A 4LY6A 3V8MA 5F2NA 3C6KA 3EZLA 2R68A 1WMBA 1OGJA 3I9FA 4GFDA 3K94A 4L50A 2RHTA 2IOFK 5F7XA 3GA7A 3QY9A 4H6XA 3UGKA 2ORWA 2YWRA 3OE1A 4LS3A 4B32A 3WA6A 5IJ9A 3EAQA 3I2GA 4DSUA 3CZPA 3UWDA 2NAPA 1P1JA 2H1LA 1JHUA 5EHGA 1FZTA 2RH5A 2MOKA 2ZUBA 1DJQA 3RS9A 5L3VA 1P5HA 3AEUA 3U5TA 5B2FA 1XZMA 4KSYA 4Z4FA 2BC9A 1Q3TA 1KI6B 4JYAB 4D92A 3THWA 4UARA 4ZCPA 4I1PA 3GJ5A 4NZOA 1MVNA 3Q11A 1PWYE 2ROQA 1JDPA 4EHNA 3ZJ5A 4F11A 5K3FB 2C8KA 3CVOA 4P0PB 5FTMA 1ZW6A 2R2GA 1TM7E 2VJBA 1K66A 4FHEA 5CA1F 2WD7A 2EIHA 3PUYA 5EE0A 3LQ2A 3RKSA 4P0QB 1N9KA 1W4AA 1ZH2A 2IYQA 2QAGA 4MV7A 4GKBA 1IY1A 2VJPA 4LSWA 3TW8B 3ZD6A 3KLBA 4A1OA 1BYIA 5TVGA 3V2HA 4BKOA 3WBJA 4CTKA 3HMKA 5DO9A 3FOEC 5TR9A 1GZSA 2OCGA 2VYVA 2X3FA 2ZQYA 4UVIA 5DXFA 4BLSA 5T4HA 1XAGA 2P68A 3D3QA 3T9DA 1L5HA 2V55B 3TRHA 4MS1A 5AKJA 3B1ZA 4L0CA 4CMCA 1SOAA 1Z7BA 3AJAA 3VOSA 3MRXA 4AG5A 2B34A 3A9UA 4QO8A 3RVKA 5CXSA 4R5MA 1LSJA 1N2XA 5FL7D 5IT9A 3EEFA 2OM2A 1M1NB 2C5BA 4Y3UA 5CT9A 4MGZR 2JH3A 1MCZA 1HWYA 2FX3A 2WAAA 2XBLA 3DHVA 3ND8A 5DHFA 1Z6YA 3RE1A 2GZMA 1JEQB 2XMCA 3AT1A 1AQ6A 1ODJA 2JFWA 1TVKA 4R4JA 3MJCA 4NK5A 4WJZA 5I7FA 4JLBA 3IR7A 4WZ6A 1EWRA 1Z2CA 3DOUA 4YEDA 3TX2A 5HJ7A 1ICEA 2B0CA 3NKLA 3S28A 4CG0A 1WXEA 1BCRA 2H3HA 4M22A 4RTSA 1VSTA 4HEA1 1XZGA 1Y9AA 5DBIA 5BN5A 1E4YA 2C82A 1UBHS 1NBME 3WP1B 4PX2A 4M1KA 3NBKA 4ADSG 2GPWA 1NHWA 4MVJG 3SI7A 1U8FO 3IC5A 1K92A 3LXMA 4DADA 2J5RA 3WJ7A 4P38A 2R96A 2CXRA 1XMPA 1FUUA 2EWVA 2QRMA 2OQVA 4MLCA 3WQSB 1T3SA 2G77B 4ZRMA 2KMLA 1TYCA 2VDQB 1CK4A 3O93A 4OUKX 3KPVA 5JS1A 4ZOLB 3H5TA 3E9EA 4A9AA 1O97D 3OZAA 5LZ4A 4Q24A 1CWUA 2J67A 3R23A 2ID9A 3FSEA 2HTFA 5DNEA 4EGQA 2MWMA 4PO9A 4X93A 1CUUA 3DE7X 3NNNA 4QXQA 4KE6A 4LNUB 1OWLA 4H4CA 2ZR7A 1SXJC 2WJIA 2WYWA 2G6TA 1B6GA 1FRFS 1PUIA 1QZUA 2D5IA 3PEFA 4G5OA 3ETNA 1K08A 1Q19A 5J1TB 4N41A 1BZYA 1JMVA 3PC4A 3DVRX 3Q88A 3D6JA 5EUBA 3ROPA 1UP6A 2BP7B 2YS6A 4LTNA 5FLKA 3FFAA 4LJ6A 4R3UC 1HC7A 4M9SA 4KQKA 5ER6A 2XCIA 1F4VA 2A8YA 2Q6OA 1N5OX 3W5UA 1FC0A 2H5LA 4TV9A 3VPXA 1V7CA 4HBGA 3C6BA 3MILA 5A6SB 4GM1A 3TEMA 3IVXA 2K6GA 5M5BA 1TU0A 1U11A 1B6SA 3F4KA 1LPBB 1MX1A 4PXAA 4Q1FA 2BFCB 5CVCA 5ESWA 1WEHA 2J45A 3I04A 3PFHA 5FCDA 2AYZA 5IPFA 2ZSAA 5HSGA 4KACA 1M6WA 4HDAA 1MENA 2RFLA 1JLMA 2C9ZA 2OHOA 2A9PA 4I50B 1KZ4A 2JHCA 2QTHA 3HKEA 4NMHA 4FWIB 3K6SB 2F3PA 3GFOA 3QVTA 1P9OA 2VRCA 1MV5A 2EATA 2HI0A 2VHXA 4PONA 5K2MA 1XELA 1GZ5A 1T5DX 4YCSA 4JI0B 3EA4A 5FI0B 2VR1A 4DMHA 1IM5A 5LUAA 3CX6A 1NJ8A 1NJ1A 1T2VA 2I3AA 3F1KA 3L41A 5H81A 3ZHZA 1TU3A 1KBOA 1T4CA 3GPDG 4KXYA 4S1NA 1ORVA 4QTYA 3I9LA 3UYLA 3DL0A 3WYDA 3Q3EA 2D0DA 1W4ZA 3RVMA 5K6TA 1O54A 4K9DA 3TJRA 2H16A 3SEZA 2IA5A 3H05A 2IODA 4FN4A 2WF6A 3PX7A 3EGDB 4AS3A 1NBAA 4UJ5A 2GNPA 4JVOA 5DYIA 4GMXA 4Q1BA 4B3BA 5CFZA 3P0HA 4O25A 2PEZA 1X7YB 4WBXC 4XI9A 1PQ4A 1YE5A 3E8MA 3OIVA 1KERA 3V6MA 2F55A 2O8FB 2R0QC 1LD3A 1W0JA 1X2EA 2VF4X 3VZDA 2WJJA 5ALDA 5C46F 4XQCA 4IFEA 1CQIB 1HZZC 5HFNA 1RI2A 3NTUA 2XXJA 4M6WA 4JQYA 4J91A 4OAOA 4YUWA 3ZX4A 1R0KA 1PKXA 2CXXA 4IRUB 3WO1A 2BR3A 2OHFA 1M1YB 2F2TA 2VP9A 3EIUA 3HR8A 4MP8A 3SZOA 5DOZA 4I55F 1IVYA 3MA0A 2H5IA 4ZZ0A 4RTPA 4L85A 3DAOA 1USUA 4RHXA 2Q3MA 1U3TA 4FHCA 1YAJA 4OJKA 4B79A 4BWGA 1JGTA 2CHFA 4PSCA 4DG8A 3OZDA 4BX8A 2FG5A 5JQGF 4DCVA 1MMFB 3SSNA 3ITEA 3AXTA 4PHFA 2O8VA 2R1ZA 4CV1A 2VH5R 1U9IC 5JWHA 3I58A 1HH4A 2ZUVA 2O8EA 2VP4A 3CF6R 4M0KA 1L7RA 2D1RA 2PG3A 1I24A 3DB1A 3UB2A 1NUSA 3FUCA 5F5LA 1WHSA 1WXDA 1HYBA 2FMFA 2WTMA 1XN1A 2GTHA 4R2KA 3VJRA 4WBNB 2QW1A 4IDGA 5BSFA 1I3MA 3P9RA 4JLJA 5C8YA 1AGRA 3OQHA 4Y2RA 1D1TA 4L9SA 3J7AC 5CNIA 4MMYB 4DWJA 1AKMA 3QYJA 4EVQA 3QPCA 1J2JA 1DB3A 1Y4DE 2AL7A 1ZN7A 3ELWA 1Q74A 4BN4A 4C04A 4C6RA 4L15A 4KR2A 1GCGA 1C0PA 4R1TA 2FTKE 2X7XA 1NMEA 1WZEA 4HDCA 3U2QA 4YJ2A 4WKPA 3BS4A 3Q9SA 4AK9A 1T9AA 4YFYA 3AHIA 3A3YA 2WEKA 5JCPA 2HMTA 4OIMA 2JLRA 1EUCB 2GR9A 4L6IA 2Q2WA 1N7GA 1XI2A 1GNLA 3RYCB 2IHKA 4C3VA 4DIKA 2XUGA 4TL8A 2WDZA 3EFOA 4Z0NA 4WXRA 2IWHA 1V41E 1Z4MA 5IN5A 1ZNXA 3G9XA 4EX7A 4UOEA 4OAPA 1Q0TA 1XTZA 4W7SA 1A9TA 4EIWA 4FHGA 5L3ZA 3ND5A 1QWSA 1QCYA 3GFSA 3DVQX 3E9RA 3X2EA 4FYIA 1W5AA 3NHRA 4HGRA 3PGXA 2CV1A 4FCWA 3DA8A 2QXTA 5CM9C 3CPJB 1OWNA 1ZFNA 4E4TA 4NHOA 4XWTA 1N2CE 1Y6QA 2AK2A 3M33A 3GARA 4LDJA 1WZ2A 1ZGAA 4LZLA 2FZCA 1UKEA 4K7JA 4M2LA 3INTA 3ECCA 2PKEA 2WIFA 4QUJA 3I4FA 5AXBA 4YPFA 2QG6A 3FF4A 4JVMA 3EQ7A 3SBEA 4CV0A 4EJFA 5KTMA 3F46A 3G8AA 1QKKA 1IN4A 4LZOA 4P1ZA 1DAPA 2VK1A 2ZRCA 5IJXA 3A27A 3AO0B 4XR4A 1K6EA 4B3HA 3GLIA 5JOQA 3BRQA 3DPSA 2XB6A 3UJHA 4DVJA 3CPEA 4LRTB 1UZNA 4NEQA 2F3TA 2ZJBA 3QPUA 4NPHA 1F4PA 4WUVA 1HE8B 4EKIA 1RJDA 4FVTA 5KMGA 4DY4A 4GNRA 5JW6A 3AM1A 3FUWA 3B2NA 3IT0A 1Q14A 1CNMA 2D3TA 1GQ2A 2XTMA 2WHRA 2DFKB 3FIJA 4KLCA 4ZV9A 1BVYF 1F1JA 4FCTA 1IY8A 2GDZA 3ZG6A 3ZIAD 3ZCRA 4B8ZA 5C81A 3Q72A 4G5XA 4B75A 4C0AC 5KJ6A 3QPWA 4Q4DA 4BGIA 1DVRA 1NWCA 4HDNA 1IJEA 5CGQB 1XNJA 2FEXA 4EATA 3U7IA 1VJTA 2A5JA 1UJMA 1CP3A 2G9VA 4WY8A 3SQOA 4LW8A 5CDSA 5FNZA 4BJ5A 2B3TA 2V9PA 5EY5B 4NDZA 1EA5A 4FCCA 1I10A 5B58T 2YVKA 4A16A 4DPLA 4DSTA 5HWSA 3TAHA 2DH6A 1N0WA 4P58A 1M67A 1GZVA 3PK0A 2HO4A 2DE0X 5WRFA 4TS4A 4BFSA 2BFFA 1ID1A 1NYTA 2XYGA 4GQBA 3FB1A 4ALJA 4FDMA 2NP7A 1E0AA 2W2VA 3DKPA 4YCDA 3NIBA 1VMAA 5DI3A 1SM4A 1QONA 3MB8A 4XR9A 3Q9UA 4HSEA 4TXJA 3EPLA 1EE1A 4E46A 3P71T 1KO7A 3F67A 1WHTA 2OHIA 1CVLA 1MAHA 4DLZA 2P2ZA 5CLIA 3NVAA 2WTXA 2ZCJA 2F1OA 5K8TA 3QLTA 4PANA 5KTKA 1YI1A 3UPTA 4W99A 3ZVNA 4GE3A 2XYHA 2YTZA 2C57A 1GQYA 2FWJA 3EXG2 2GESA 4NULA 5CVJA 2V3CC 1TAUA 4JXXA 1DKUA 1FB5A 3FNFA 4BNGA 4B3IA 4D4LA 1C1DB 5J63A 1KVSA 1G60A 1CEXA 5DSXA 3INNA 1I3KA 1ZIOA 3DBLA 4TV9F 3TBHA 4OXIA 5I8ZA 2NQ8A 3TQIA 1VPVA 5GY7A 5BSEA 1HORA 2R6ZA 4GX2A 3UFXA 3ER6A 4LQ4A 4A7PA 1ZK3A 3Q3IA 1YTLA 2GKOA 3OI7A 1DTWB 4Q0MA 2NV6A 1MB2A 3I2IA 4KPFC 1QC5A 4B83A 4P0TA 2XEXA 3GZNB 3IT1A 3OEHD 2V9CA 3Q7EA 2P40A 4O2AB 4A0QA 1S01A 1SU6A 5I7UA 4LY9A 1I4WA 3U7JA 4BPBA 1GSAA 4NU6A 4OXYA 3PRHA 4COOA 5IXSA 1NXTA 2ECQA 4MUBA 3SS8A 2DCMA 2OY0A 4BN5A 4QT4A 3COPA 4PO3X 2H2IA 2X5NA 4QJIA 3EXG1 5ALUA 2VHQA 1LFDB 3LBYA 5TSDA 3MC1A 5FBVB 3PXXA 2ZIZA 4TWJA 4A0SA 3BDAA 3MTDA 1RAHA 3QKSB 4XJSA 2WF8A 1WXWA 1ENYA 3EGXB 1VPWA 2QPOA 2GZ1A 3ZWMA 4QDKA 3IOMA 5JAMA 3ANTA 4QBHA 1PF7E 2ACVA 5BVHA 4V0RA 1E1QA 3TLAA 2OPBA 3NETA 5G4KB 5LP6B 1M72A 3OOEA 2J0QA 2ODWA 5J2TA 5FFMA 3Q4GA 1YU9A 1A5TA 2ZR9A 4P22A 4QU0A 5AI4A 5A7HA 1ZK2A 3TIFA 3VR6H 1ABBA 1CF2O 2H17A 5MDHA 4H3SA 1XEWY 1YQUA 3GEHA 4JQSA 4KGZA 4QQNA 4F72A 4I9GA 2BYTA 2JPDA 3HFSA 2CHUA 2P6OA 4JHXA 2EIXA 3UPUA 2AX3A 4KO8A 1HGXA 3AF1A 1FZQA 4LMAA 4OHWA 2O2ZA 2YS7A 3AVXA 4M21A 4K5QA 1FRQA 3CCFA 3BTVA 2EG9A 4Q01A 4B87A 4DIUA 1EUYA 1DFGA 4KQ9A 5C37A 2QZJA 1Y80A 3FYHA 3NKFA 4MWBA 3JW8A 4UPVA 3RLFA 2IEGA 3EEBA 2JA2A 2X6TA 4GI2A 5D5PA 5LQNA 3DEFA 1USWA 3OOYA 1VCOA 3ZGLA 1TAHA 4HEQA 3N87A 1XROA 2PN1A 1MC4A 3A4LA 4N5NA 3QU4A 4PW0A 4S24A 3RAJA 4CR6A 4QG3A 3FVTA 4MZDA 4BMOB 4CYMA 3FDZA 3P4YA 1FQOA 3RVNA 3WRVA 2GZDA 3LLCA 2VZ8A 2HLDD 3VU1A 3ZBTA 3ZHRA 1R18A 5KU1A 5IKXA 3FTFA 1DT5A 2HNBA 4IQ0A 3GOQA 2LTAA 2IV7A 1PS0A 3DO5A 2PX2A 1VLQA 3M5CA 4J7UA 1ADGA 2C3OA 3KJIA 3EY9A 4ROSA 3ZS8A 4OUDB 1SNYA 3G8YA 3LDFA 3DHYA 2JFPA 5C8YF 3OJFA 1EFRD 1RZRA 2XLBA 4JOQA 1XTJA 3I8OA 2VHYA 2E5WA 3ZE2B 2JFQA 3BD6A 1QX4A 1BFDA 1J9GA 4I4IA 1XHEA 1GNPA 3IKTA 2CVFA 4X1KB 2AXNA 3FKSD 4C07A 4DA4A 1M6VB 4YMGA 3PXGA 4RZ3A 2UUAB 1I6KA 3QSYA 4AZ3B 1FYVA 3IT3A 3QWFA 1P4GA 3UY4A 1NXSA 3H2BA 2H54A 2HJRA 3ZJVA 4OL0A 4YJ2F 5K03A 1H1LA 3AF4A 3T3MB 3VR3A 3JQRA 4FINA 1VPEA 2FJPA 3D4OA 4EUKA 5HKAA 1CUAA 4RUKA 2QZPA 3FNEA 2OQRA 1DDIA 1MPTA 2QP4A 3O95A 3REGA 4X65B 4P3XA 3WOHA 2AFRA 2X3YA 4BFZA 1DJOA 1U8XX 3ENQA 4C5AA 4G1MB 3LUFA 4BY9E 1ZX1A 5AW2A 1E79A 2QLNA 3WGYA 1OTXA 2GK6A 3GX1A 3HCAA 4AJJA 2ZDGA 4K6MA 4MGIR 3I62A 2PUFA 2DLNA 3MT9A 1SUFA 4RY8A 3C7DB 2AHRA 2B61A 2CBZA 2JJ8A 1TFUA 2M9MA 4I7EA 1Q50A 3FMFA 4DCNA 1OI2A 4F5WA 1RC8A 4UFPA 2FE1A 4AG6A 2E55A 4OHCA 3TYXA 2ZUTA 1ZJ6A 4MSUA 3F3MA 4XAQA 1I33A 1N2EA 1NXQA 1ZJJA 2GA9A 3EZ6A 4TMKA 4IQ4A 5THXA 2H9AA 3WLTA 3G0OA 6YASA 3ZW8A 2EKPA 4ZCIA 1Z62A 1RWVA 4JWTA 5DZSA 5EAIA 3TD9A 4CMBA 2NZUG 2P90A 3QVMA 4ZOEA 1XTSA 3HV0A 1GGKA 4DRXA 1DJMA 1VLHA 1H4VB 4MW1A 4MW2A 4B4DA 2QB5A 4Z7QB 5JZMA 1RKBA 3P20A 1AIPA 2JHGA 5H68A 1ISIA 3RLIA 3WRXA 3PJRA 2O8CB 2ZXEA 2O52A 2BGNA 3S29A 3N75A 1FSZA 3BFKA 3CLTC 5EZYB 1U94A 1QGYA 4UBKA 1S5PA 1ZVKA 2CB0A 3ID6C 2P9HA 2YINC 4Z7OB 5ICEA 3M81A 5L9AA 1AMOA 1SZJG 4PG4A 1Z4OA 4UNIA 1YIAA 1EWVA 4P31A 5D8DA 5G0UA 5HDBB 4BQRA 1OH7A 1J8MF 3BICA 3ZJ4A 4UTNA 5LLTA 4RTNA 4IOJA 3V4LA 3E22A 2OR3A 4QGBA 2CFSA 3HVRA 2VSOA 3G9QA 3U4HA 3A6KA 2AQKA 5ELMA 2K5UA 4ERNA 2V1XA 4NAVA 5BV2P 3CUEF 4FE4A 4RPKA 1A9OA 4JZYA 2BFBB 3IUPA 3RHSA 2VSFA 2VL7A 5E1OA 3W0LB 4DLAA 5JISA 2D1QA 2DP4E 4MP6A 1E1DA 4N0DA 4F6RA 2AN9A 5K0CA 1GV0A 3IO3A 3S44A 2YN4A 2UXBB 4JR0A 5KTSA 1YVEI 2HU2A 4TT3D 4RDIA 1L5YA 4V03A 3T7IA 4H15A 2D59A 2XGGA 4DZRA 4YXWD 2C03A 3VPAA 4DMGA 2P4UA 3S68A 1CY0A 1E9BA 2QRPA 3ZI7A 3GCWA 1G98A 1YUBA 1EFKA 2K2QB 4N39A 4W5HA 2WFZA 4RLHA 2KHZA 1V11A 2YWHA 3IL2A 2DWCA 4PS1A 1Y4SA 2RONA 1EK2A 1N3YA 3OECA 1EK1A 1T2CA 2C9MA 1B3RA 1VLMA 2IEIA 4GYKA 4LHVA 5HF5A 3EFHA 4C14A 3MD0A 2JARA 4QYWA 4X54A 2I7CA 5LN1A 2QX9A 3DWGA 3N28A 3IEUA 5DM70 4X1OA 3B60A 1V9CA 2H0AA 1IMJA 1SRQA 2OV1A 3GHHA 1TIBA 4GXNA 2PWBA 3M89A 5E6RB 2WP0A 4PLFA 3GT7A 3RK0A 1A71A 5JAHA 2XVYA 2QUJA 4WOKA 4LI3X 1L4HA 1Q3HA 4EY4A 4RZHA 4NNJA 3AVYA 1P0CA 2JIOA 4HLUA 4AF7A 4UMFA 3L43A 2XOXA 4GWKA 2JD2A 3D8HA 3OFKA 3DZHA 1GQQA 4R7ZA 5KYKA 3V48A 2CLCX 2BUBA 2HGSA 2WHQA 3C5EA 4OYLA 1RYZA 1J7JA 2GJ4A 2QSJA 3E23A 3F7NA 2EL9A 2Y1WA 1TQ4A 4K6OA 4TKLA 4D5EA 1Q0ZA 3MSXA 3EVNA 1QU2A 4Q9DA 5AW1A 3DTYA 4RLFA 3CM0A 1Y3CE 3EHEA 3CRRA 1USVA 1DXOA 2R65A 1RXYA 3H65A 4OX9B 3LY7A 4TUYF 4X6YA 2NUTB 2J30A 3OE7D 4F4UA 3T7TA 1E2PA 4OLHA 5JJ5A 1ENZA 1RZ3A 1A88A 3PYXA 3AZPA 2H1SA 4JNCA 5AOAA 1R8XA 2ZULA 3RRBA 5KVCA 1VIMA 1D2RA 2JCBA 1X7WB 1DKPA 2E18A 4X6UA 3KVNA 3AVTA 3EEYA 5L3QA 1RBZA 2C4TA 2OZVA 4K6KA 3M0EA 4OSOA 1XP5A 3TGWA 4G56A 1JQ3A 1AXRA 3DV9A 5CR9A 3GPCA 1MB3A 5J2TF 2XRMA 2Y67A 1FYFA 1U9JA 3ZE7A 3QG5A 3LNCA 2WE7A 3KOYA 4JL8A 1SH7A 4RPLA 4IW3B 3WGZA 2W2TA 2OC9A 4CJXA 5IDWA 1KI9A 4I81A 4YO7A 2VQFB 4FKZA 1M1ZA 3PDUA 3LO5A 3DP7A 4MJXA 3ASYA 4PFKA 4U2BA 4AJOA 2W4QA 4GP6A 4B3SB 3GT3A 2HV9A 2WVHA 2XHZA 3GI1A 3I9KA 3K7EA 5EMLA 2FYTA 5TPWA 2EQBA 4OMUA 2H8KA 2OHJA 4DZTA 5JSZB 1BA2A 4ZYYA 1VJ5A 3TG2A 1ANKA 2CBXA 4IJMA 4MWZA 1X13A 3TQTA 3F47A 1L7QA 1OBVA 2QU8A 1JYEA 1PWEA 2FETA 2TMGA 1RRPA 4TM7A 1JG6A 1FFHA 1U7DA 4B80A 1JI0A 1VKRA 3O83A 3T52A 4DCOA 4XFJA 4CKWB 3VFDA 2IU3A 3JQ9A 1KVUA 1XL1A 4J6EA 5LA6B 3RSHA 5AXDA 4DIMA 2QD3A 2VTVA 1CDOA 3F2VA 2YJTD 3NXKA 4XRGA 1F51E 1PTJA 2GBCA 4RKWA 4S3MA 1O95D 5DTJA 1Z07A 1JA9A 4GOMD 1C7QA 1T9ZA 3Q5EA 4JBXA 3OCUA 1OFGA 2R8ZA 1WDTA 2YH2A 1X74A 3KDPA 4PR0A 1NTOA 2QTVB 5CCXA 1DO0A 1D0SA 4EA8A 1ZGHA 2E4AA 2XOKD 5JYBA 1WDMA 2G72A 4X0EA 1NN0A 4XB6B 3DVSX 2PD6A 1E9DA 1EGHA 2OHGA 4YRCA 3R0ZA 5LZ7A 1H8EA 3EA5A 1DPFA 1JHYA 2PQMA 4RPIA 2QQ5A 3ED5A 5FLXA 3PQ5A 1GZ7A 4I36A 4YRJA 4CT0A 4J1QA 1OLSB 1YCFA 1U2DA 3PC8A 3P9PA 1LJ8A 1IPFA 2OHVA 4UNSA 4D6YA 3SJUA 4N0QA 3HBNA 1K98A 4V02A 5A04A 3N6XA 3SMVA 2A9OA 1QDUA 1GPWB 2QN2A 3RYIA 1P9RA 2WB4A 2Y76A 3CBQA 1Z0DA 3NUZA 4HAWA 4HK4A 4TTRA 4YRMA 5L51A 2J3EA 1BDHA 2GD6A 2R66A 2HIAA 3PA8A 4IIEA 5I7SA 1JEAA 2B92A 3MFYA 4CIBA 2I8CA 1CFZA 1HT0A 3IVRA 2CWDA 2GILA 5CEFA 3UANA 3HPQA 1AZSC 3VOTA 3VYRB 3U39A 4DKXA 4IIBA 5KCZA 2DKOA 1NR7A 3TFOA 3DTNA 1JE1A 3L05A 1J1ZA 1JPJA 1CDDA 4QE3A 2E85A 1VKOA 3IA2A 2ETXA 4LYDA 1IONA 3JAWB 3PHLA 3CO5A 4GYJA 4E6EA 5TQ0A 4EELA 4XIGS 4F92B 4FKMA 2R00C 2QMOA 1SOVA 2D4HA 1J25A 1Q83A 2A58A 1Z75A 2JFNA 4N0PA 3ABOB 5K3CA 1TO2E 4EG4A 2ASVA 2C0PA 1JDBB 1SC6A 2HJHA 2W6NA 2CSUA 1NKSA 4HDKA 4L8YA 4MIYA 4W5JA 4J1SA 4TKUB 4Q37A 5HZHA 1QDLB 2WHEA 4LI0A 2P3OA 2W8ZA 5EUQB 4NYJQ 3C87A 2BTQA 1MT0A 2F1HA 2EZ4A 2H06A 2WUEA 4ENUA 3Q7RA 4P92A 4F4DA 1OB5A 4NJMA 5FXMA 5AJTA 4CKXA 3L6CA 1OFUX 2FN4A 3G2MA 3K92A 4L8LA 1OR8A 1HQCA 3L8DA 4E7OA 4LTDA 5I9MA 3HO1A 1UOEA 4N40A 4MHSA 3PVSA 2IZ7A 1J24A 3OKFA 5HMMA 4CNBA 2VP0A 1C9KA 1Y5RA 3K9NA 3NBFA 4XRRA 4CEJB 3NFYA 2ZZNA 4R8MA 1IEWA 5HR5A 2XTZA 1QKIA 2NVUB 4BX9A 4O5OA 2YY6A 1O8CA 4PQRA 1BOOA 1I1NA 3L7MA 4G01B 2QI9C 4IJVA 2FPMA 4MYRA 2WABA 1X14A 2GRJA 4HBZA 3UAVA 3Q7TA 5JRZA 1SCAA 3KKKA 3O8LA 3WHLA 4F56A 5KSOA 3FYUC 1SPXA 3N6RA 1FP1D 4WA7A 4PICA 3UJ8A 1QFXA 1ZN8A 4ID9A 1E20A 5ICMA 2O5EA 3EGVA 5FOTA 4Z0HO 1L4MA 3RWMB 4URXR 3FYTA 4X1YB 4XM0A 1EE9A 2GCEA 3K5HA 1NASA 2QD5A 1QNLA 1GU0A 1YDGA 1MO6A 3AP1A 3SVLA 3DDNA 1KWGA 2ZWAA 3U9SA 4ZI7A 1TCUA 3WMGA 4LJSA 3LX5A 5CJJA 5A7GA 2OP0A 2WKWA 2WTNA 4RDHA 4UAUA 4C4YA 5H16A 3QG1A 4DDKA 1ESNA 2ZBGA 2R5FA 2CYCA 4YMTA 4K1XA 4BWFB 4Q7QA 4M1QA 3KR0A 3DBRB 5BN4B 2CNDA 7ADHA 3FIUA 2AOWA 4R05A 5LKAA 1RCUA 1GLGA 3CQ9A 1JDNA 3ZD8A 2NTYC 3E2IA 3PQ3A 5J5CA 2WM9B 5LQKA 5LYYA 4BO6A 4CFSA 3EYAA 5B1YA 2XYPA 2WU4A 5J58A 3VR5A 1J8VA 2QZSA 1BRMA 2F48A 3VUEA 1JHXA 4XIFA 1L9XA 3UWMA 3D3WA 3WGMA 4DR7B 2H51A 4URZR 3OSUA 3ABRB 3RHTA 5AXAA 2CXOA 3CZ5A 1HURA 3RJZA 3KUCA 4ZFNA 4GBGA 1OREA 4K9QA 1P7ZA 2OCXA 3I6YA 2E4UA 1MJGA 2OM6A 2PS3A 3AETB 4TS3A 1TC1A 5A7FA 3QUSA 3TLKA 3DLCA 4E5UA 2FQ1A 4WFKA 2HSZA 4QREA 2PMDA 1RM3A 5A06A 4W1RA 2VP2A 3O1HB 5E4FA 5J2UB 6PFKA 1ZCJA 1JG3A 1W7AA 1U0BB 1SWVA 1VFPA 5I9BA 4BMVA 3LDUA 1C0IA 1HLFA 1R37A 2HDWA 3AKZA 1J0AA 5A4IS 2ZWVA 4LBZA 1KU6A 3GLIE 2NU6B 4X6LA 3C70A 4Y2QA 1NMXA 1FK8A 4YA6A 3RARA 4DMUB 3RADC 4TL9A 1T5BA 3WNBA 1GOTA 3M6XA 2XTAA 3ZLJA 1AGPA 4OFBA 2HEGA 3JYQA 3K2BA 3QEAZ 2HWWA 2O0JA 3UAYA 1AXGA 4BVAA 5KNLA 3HEMA 5MFPA 3R0VA 4FFBB 1ILEA 4ZMRA 2LR0A 3LCMA 3ULKA 4ZVRA 1S0UA 3G7UA 3M1YA 5M29A 3G5LA 1X9IA 5L7WA 2RG1A 3ZQ6A 2DHCA 2B5VA 2XA2A 4TTJA 4V24A 4DUGA 2XCUA 3RBVA 5ITSA 3OY2A 4QYIA 4FIZA 2W4IA 1UOOA 4ZC1A 1ESDA 3CSUA 4BNFA 4BPRA 4NBWA 3BMNA 2J0UB 1TTPB 3WIDA 4YV1A 2VEDA 3H16A 5CLHA 3EFEA 2C31A 3V97A 1JWLA 2BSXA 1T8PA 2PUGA 1A2KC 2N3ZA 3NORA 3CMCO 4XWYA 3GLFB 3TKLA 1V9SA 2ZBDA 4GLLA 4ARCA 3HDYA 2C97A 1N9GA 2JATA 3B38A 3EUWA 3JD4A 3DMRA 4M83A 4EMSA 1FJXA 2VXCA 1GY8A 1K5GA 2RGBA 2GLUA 2GEFA 16PKA 2JAUA 3SZ3A 1G5HA 3T6KA 4X1IA 4UZSA 3ER8A 2C2OA 4RTJA 2WIJA 4GGPA 1NONA 1XLUA 2HPVA 3WLKX 4LJ5A 3TZCA 3C3MA 5AW7A 1U8YA 1I3NA 2VCYA 5G4LA 3M4XA 5E95A 1YL7A 1JG4A 4DV2B 3JQDA 4KI7A 1FTWA 3UT5A 3VI4B 1OYVA 1ESZA 5B4UA 2BGRA 2VKQA 3P9SA 5JCOC 4RETA 1JQJC 2HADA 3IXLA 1MV8A 3F8TA 4AF8A 2HNAA 1JB1A 2JZNA 2OTCA 1DXYA 1ESEA 3EZNA 3WHPA 3DEIA 2AKYA 3KJQA 4K40A 4CLHA 2ZTLA 5KU7A 3KCQA 1V3QE 1P77A 3AUXA 3NC0C 3QEMA 3U7EB 3CEHA 1V0JA 3PQ8A 5AVWA 3FE2A 4RZSA 3LPAA 3LVQE 2LZ0A 4J2OA 4V39A 2UZ3A 2Z9BA 4Z49A 1NBIA 4HV4A 4D98A 4G23A 3E9DA 3IP8A 1SQGA 2VAMA 1U0JA 5T4BA 2JCSA 1UDBA 2FKNA 3B7WA 5FP0A 4RHTA 4BZWA 1DAEA 4FSDA 4F3NA 1B0AA 5ERXA 2HRQA 1RLOA 1ORRA 2SHKA 4GNKA 5AK4A 4AQ7A 2R1VA 3H04A 4F2GA 2C5LA 4IO0A 4R9UC 4I6JA 1VE7A 2YBEA 3EC1A 5FEUA 4KX3A 3IMEA 3IEXA 3KUKA 4ZXFA 3IMGA 2J9ZB 1BMDA 4KSBA 3JZDA 3L1IA 1Y34E 4MQ5A 1QIDA 4J49A 2DZDA 2RC5A 5CNKA 4CTMA 1FMJA 1PYOA 4LFAB 1NNUA 4TXNA 4RH3A 3TNYA 3W3AD 1M5UA 1SXQA 5BT9A 5K45A 3HU5A 5THQA 6GPBA 4OV6B 4R2WA 1N2SA 4Z4HA 4YMLA 3JR3A 3NCTA 3V7NA 2PRKA 2QJTA 1IZ8A 1UANA 2D1SA 5P8WA 3ILXA 4B73A 4C1BA 1DPGA 4QUKA 2I2CA 2RGYA 1CUIA 4UW9A 3OM0A 3R6LA 4MS3B 1FNCA 2RGCA 5EXTA 1CE8B 1CUSA 1F0PA 1AZLA 3CRZA 3AEQA 2X13A 3HTXA 2O8DB 1FDVA 5HIAA 2B6HA 2JI6A 4AT1A 1EQAA 5KYWB 4ALMA 1U90A 1V2GA 4N3NA 4EOGA 2XF8A 2X0IA 4L3VA 1MOSA 2BT4A 3I76A 2GZ3A 3MWYW 4ZODA 3WLSA 4OQEA 3EXEB 4L78A 1D7OA 5IJ0B 1EU1A 3NBXX 5JBQA 1YDFA 3RJ5A 1TEHA 1TM4E 3BXFA 4GMDA 3QMMA 5K0JA 1TTQB 4IHQA 2VRBA 3PD1A 4HQOA 3SYRA 5ISMA 5HNKA 1N4DA 3AEKB 4NMWA 1E1CB 1F2TA 1NXXA 2OUKA 5F1YA 3WYEA 1AUVA 4CMJA 2IZOA 2C83A 3CKLA 1GRVA 1KAGA 4XUEA 5KQPA 3HI4A 3K9GA 1R4ZA 3OZ7A 4IWYA 3A7EA 4HTFB 1EP1B 1KZ6A 4PGFA 3DE2X 2E4XA 1DQYA 4L76A 4J90A 1UPXA 4EFMA 3NDPA 4PWZA 1A8PA 1RU3A 4RD6A 1MAUA 4F3RA 2AK3A 3A2LA 3FOBA 4QVIA 2AG5A 4A4DA 4F4CA 2H0RA 2JCVA 4OQPA 1OY1A 2EQAA 3WC4A 1DARA 1KBQA 5BRJA 5CW2A 3SQDA 2X4LA 3L4BA 4ZI7F 2C1EA 4G4IA 4EPTA 5BN3A 4QUBA 4OEHA 1QCZA 2I2DA 3H86A 5TPZD 2IW3A 4R16A 3R8CA 1W29A 2PS1A 4HX2A 2JFBA 5C8DA 2FDCA 1WCXA 3KQOA 1Y7TA 1IAQA 1OX5A 3K9BA 5HXAA 1DWPA 3HLTA 1RVDA 1F38A 1P5RA 1D1PA 1TKRA 4IIDA 3N2IA 4R8SA 1XDGA 2JLAA 2YUIA 3L0IB 1TNDA 2YOHA 4G4JA 3VQTA 3E3OA 4UTZA 1R0RE 1P6QA 1U0OC 4DLWA 5KQSA 2VJDA 2GAIA 3PHIA 2Q0QA 2A7XA 4GUDA 5FBZA 4B17A 5K0SA 2PLWA 3UWPA 4D74A 1Y6JA 4NRDA 5JD4A 5DV9A 3H1EA 3UMGA 5JNVA 4BWYA 1BS2A 5BXQC 3H8VA 1JVBA 4NHEA 2BMJA 1M1XB 3WGNA 4RFSA 3QOWA 3V6LA 4OGWA 3AFHA 1G5RA 3JWHA 4JVSB 4RA6B 4Z2AA 3OWXA 4TLLB 4PNZA 3UF0A 2KJQA 4P2BA 2I2WA 4IJKA 4A26A 4HQLA 2WYHA 4BYMA 1G8JA 3W5SA 3B8HA 2XYVA 5TQ2B 4HO1X 4H59A 2CXNA 1L8OA 4HJXA 3VDQA 1XTQA 2B82A 3DMYA 3ESQA 3MAGA 4F5YA 3L4SO 5KPJA 5DU2A 1I7NA 2RGNC 1REQB 5ALZA 2NMVA 4G8JA 1FA9A 1PV2A 2OGUA 1Z34A 1GXSB 5CM2Z 1RHMA 3UATA 2FP3A 3AJ9A 3N2EA 5FFNA 3ESYA 4CQMB 4E4RA 1ZO8A 4QJBA 1SEVA 3AR8A 1R5NA 2YXBA 4X7MA 4JU9A 4XX0A 3QKRB 2QNBA 1KPHA 4ND8B 5J43A 2KB0A 2NUPA 5JAZA 2VSQA 2AOTA 1Z6QA 121PA 3QXCA 4WOPA 3I1YA 3R6WA 2IYZA 5EFZA 1CX9B 1U7WA 1PVOA 4DB2A 4B6FA 3CGGA 3RK1A 2CDCA 2ZRGA 2BI8A 3PKIA 1C7RA 1SC4A 2B25A 2JI7A 1Y1TA 2AOUA 1CZHA 2CNOA 3ZHTA 1W73A 4A8JB 5KOIA 3TD2A 1A27A 3C3AA 4CKCA 2H2DA 3OX2A 3CB4A 1P9NA 3BGWA 1Q91A 1T4BA 4KIGA 4PZLA 2V59A 2V1UA 3RJ9A 1CRZA 3TECE 5MN5A 5H5JA 1GCIA 1Z0UA 4DYVA 2ATEA 3N2NA 3ZKWA 2A30A 4MS4B 2V96A 2VP3A 4ZOCA 3ADCA 1OB2A 1EK5A 3TN7A 2IUSA 1XX6A 3GT0A 1E7SA 2D8MA 3O7MA 3KLPX 1O03A 4M89A 5B1HA 3N2KA 2Q45A 3WNVA 4FONA 3DT8A 1EB8A 1JHRA 1VPDA 2NU7A 2RK6A 1GRNA 2VTBB 2FI1A 3EY4A 4MUHA 3ZCXA 2NIPA 1NI4A 1CUFA 5F5XA 3WYAA 1U31A 1UAYA 4NPCA 3VR6D 4CXMA 3AYZB 5IKMA 3I6MA 3R20A 4BB9A 4F12A 1UUFA 2P69A 2QE7A 5GGXA 2XJ9A 2AW3A 3H5LA 4BV3A 4CW7A 2ICAA 4MQFA 4WZZA 3KB8A 3A1WA 1RBQA 4B5LA 2J3LA 1U3VA 3GMDA 2GASA 3TQSA 5K5EA 1LKZA 3MLEA 4TWIA 2O6LA 4IIVA 4U00A 4LECA 2BISA 3O8DA 4AJEA 2CKDA 4JXKA 1D6MA 5HK8A 1IUOA 1KBZA 3BFVA 4WCFB 1JXAA 2JG3A 4UCXA 2PX0A 2GWHA 2VN8A 3QUCA 2KW5A 3GJ3A 3ICOA 5JNRA 1IOWA 4LJLA 2FWRA 3MCVA 3BBPA 2FGKA 2X76A 2HWXA 2PKWA 2ZRLA 3OAAA 4PM4A 2REOA 3VGJA 2O59A 3EXFB 2I3GA 4UMVA 4TLAA 4HPXB 1K4KA 3LYHA 2F8LA 4WDRA 4G25A 3HCFA 3KG2A 4FNMA 2QE6A 2VNSA 3CIOA 3NOQA 4RE6A 4RQUA 2C5FA 3A3NA 4U6NA 4KQFA 4YP6A 2NSYA 4DMRA 2BFPA 5H3HA 2GCNA 4LRUA 2ZAIA 1QAMA 2XVZA 4QFBA 3VTFA 3QBTA 3AIOA 1QVWA 3LT0A 5HKKA 2J3QA 1WDKA 5G3ZA 3JXEA 4JA0A 1AH2A 1N6PA 1U1DA 1PJCA 4A2WA 3CUUA 2FB9A 3E9QA 3GRCA 4ETWA 1E18A 2CF5A 1J07A 1QFMA 1A82A 3FAZA 2P65A 1BDBA 1DTEA 2XGMA 2J3IA 3FM9A 2HRCA 5EINA 4B7XA 2P9BA 4XQ9A 1PJRA 1DKQA 5K0TA 1R0CA 3MRTA 2EARA 1E0DA 3MT8A 4XWAA 5U4XA 4MV4A 1GYRA 2OCYC 1OWPA 2IXGA 5FA8A 4PNEA 2ORIA 1RP7A 1S96A 5IARA 4MB6A 3OTIA 4S1WA 1EVQA 1EWTA 1YHZA 3BCUA 3QQPA 1PFWA 2D13A 2HEIA 1ZD8A 3AR3A 3O2SB 2QF7A 4FN5A 1LQTA 1U28A 2XZPA 3BMOB 4FEGA 4XB1A 3TTUA 3NEPX 5LU9A 4D9NA 2QL7A 4JXJA 3AIIA 2HK7A 4DARA 1D2EA 2BCJQ 4LXUA 5DYNA 4DDUA 5IH7A 2J0SA 4FB5A 4JQZA 5GMOA 4JI8B 1F20A 1H8HD 1J2YA 3H5NA 4TKZA 3WLIA 2DFLA 1W87A 1C81A 2FX2A 1VMEA 3CN7A 1ACMA 1GGNA 2I4TA 1YQQA 2OB1A 2PBZA 2Q1SA 5FWYA 3GJ8A 1GGEA 1YR1A 2XZDA 1BH2A 1LI4A 3LI2A 4KB5A 5FULA 5I4BA 4M8IA 1CEEA 3JALA 1NL3A 4HWSA 4RF2A 1RI5A 4YAIA 3TZLA 5EIBC 2QRZA 2WHPB 4GF5A 1IWPB 4H6WA 4H6PA 5LP6C 3RIEA 1DNPA 1NBWB 2F1RA 3A14A 2VBGA 3FZQA 4N65A 4X5OA 3E81A 3HBFA 3WGOA 4D46A 2QYTA 2ZT6A 3U4MA 1NN1A 2Z5VA 4H7DA 1D2MA 2RHLA 4KFUA 4KJZA 4Z1MD 1CR1A 1OHHA 1U8ZA 2ZYRA 4NFSA 1GNSA 5CEEA 5EMHA 3RGWS 5G0WA 4HOYA 4C4ZA 2OOSA 3PTZA 4QU5A 2HMSA 3SF8A 1O0BA 4HRVA 3F2IA 2OUIA 1A5AB 1KZGB 2NTEA 3V4SA 4CUZA 4AKGA 1CVRA 1DWUA 3C16C 3HVUA 4KQHA 3RNLA 3RROA 4GXTA 1JHPA 5FV4A 4XYMA 2ZU6A 5E1BA 2E1PA 4EHFA 3SZMA 1VHQA 1NVMB 5T67A 3WIVA 1DFIA 1TMGE 3DBVO 3KOMA 2OXIA 1JIUA 2B30A 3D6NB 2B21A 1C9JA 5FI3A 4L95C 3U19A 1XRSB 2VKTA 3HZOA 2EYQA 1CUGA 3JQGA 1JPUA 2CXPA 4B6PA 1MXHA 5LZ2A 3UV3A 5KC8A 4C0KA 4YRZA 1IEVA 1U80A 4GOJA 2HCJB 4MB2A 4N8DA 621PA 3QEBZ 2CHVA 5E8RA 4FMCB 5IFKA 4B45A 1EFPA 3KJNA 5B57C 4S0ZA 4CLXA 2FXIA 2FZEA 2PJRA 1TM5E 3I0NA 4N48A 3OUZA 3OZRA 1DAFA 4MUKA 4TVOA 4C0HA 4IIHA 4E03A 2WYVA 3DMFA 3QTBA 3G5AA 2QVBA 3AUFA 1MEEA 3NPMA 3OJXA 4AZVA 1A4XA 4RESA 2LWIA 3HO8A 1XVUA 4OJTA 4BBJA 3QE9Y 3C7TA 5FWAA 1E9CA 1YB5A 4L0DA 1DHRA 2JIQA 5AVQA 2R85A 1K8ZB 1Q20A 1TYBE 2P41A 4W1PA 5DYWA 2FEWB 3DQZA 5JD5A 4GPEA 1Q6ZA 1EQUA 4QATA 1ZOOA 4G5YA 1NN3A 4G24A 4GX0A 1I4OA 5ANRB 5GVRA 1KQPA 2GK4A 3AUTA 4UPEA 2IS4A 3VNBA 1IHDA 4IDAA 1GGMA 1IPEA 4NBUA 2DG2A 4NV1A 1ZOSA 1QKJA 2IITA 3GLQA 4DC9A 2A94A 5HQ3B 2HIHA 4KXWA 1N57A 3HB5X 3PL5A 4UNPA 5J4HA 3IRUA 3PFKA 3U9TA 4X7PA 3U48A 2I76A 2WFLA 4HDSA 4GC9A 3NGMA 4OGKA 4ZWNA 4DEVA 4EVIA 4L74A 3HJHA 5B58C 1CUYA 1KRXA 5YASA 1T9BA 2CUKA 4H7FA 4GOLD 4US2R 2E5LB 3PR3A 4JY7A 1TE2A 5BOSA 3U5ZB 1T3TA 1O6GA 4L5YA 3T7KA 3DEZA 1GN9A 3DDUA 2H4XA 3WRWA 4DYDA 2V7QA 2IEZA 4GMFA 3H9BA 2JLYA 4OFWA 2YZKA 5NLLA 3WL6A 1PNRA 4IH1A 4ME6A 2PXHA 4UBOA 1DG1G 2IHZA 2YW9A 1C50A 1YBVA 2MYNA 4C7XA 1NW5A 1IY0A 1XD2A 2HF9A 2HU8A 1AKYA 1CHDA 2GN9A 3KYCB 3ZBQA 5HVNA 3U4AA 2HYIC 1RQXA 221PA 1K3UB 1L7MA 3IA7A 3K09A 2VNHA 1ZWKA 4I4TB 4MGEA 1BQEA 1K88A 1DJPA 1N2ZA 2A92A 2Z2KA 1OF1A 3ELUA 4QGGA 2FK7A 2OYCA 7ABPA 1VCIA 1Y5NA 2X4GA 2Y05A 3A6ZA 1L5FA 2J5BA 3E3LA 3PB3A 4HGQA 5EJEA 4DJ5X 4QOIA 3TMAA 3HCOA 5ADUS 3EAGA 1NFFA 2Y1CA 4CF3A 2PD3A 2FSVC 4JGIA 2HC9A 2QN7A 2EP5A 2YWBA 4OKNA 3OTOB 1L4UA 1EVYA 2FMXA 2YOGA 3LGXA 3K20A 2QRVA 3N8HA 5B2ZA 2PWZA 4UM8B 5T5QA 3AHCA 2QVCA 1AA6A 1F5SA 3RC9A 4DA9A 3OD5A 3U40A 3A6LA 1SXIA 5SYMA 3I12A 4U7JA 3RSGA 3TSYA 4NXNB 3K5PA 4A0GA 1QBGA 2LP4Y 3W2TA 3TUIC 2IT1A 2SICE 1GQFA 3ELBA 1KY2A 4I9UA 1TGYA 1B43A 4UCQA 3J80A 1N36B 3OO1A 3U3OA 1N33B 5IKPA 4M99A 2QYHA 4TQUS 1LLQA 2YV3A 3QM1A 2AEJA 5DXJA 1KSGA 1V96A 4Y9UA 4FGSA 3U44B 4GOKA 1M2WA 1MC5A 3IDQA 4YQEA 2H4YA 4LAFA 5LIPA 2V5VA 2DM6A 3LHIA 4D9JA 1Q16A 1ZD5A 1H05A 2XNDA 1FS5A 4YP5A 3GCZA 4LY3A 4NSNA 3KYDA 2Y1LA 1Q7CA 4KO1S 5IYZB 2XZTA 3E61A 1YONA 1W76A 1UZAA 2OBXA 3KWMA 6LDHA 2ENUA 2FZLA 5CA0A 5FORA 3RBAA 4PF1A 4D8YA 4L0QA 1YK1A 3ZXXA 1WA5A 1R00A 4K2HA 4DLXA 4KWTA 5CYOA 1Q0UA 4C76A 4LJ9A 1IZ9A 1YKGA 4BTLA 1NQXA 2D8AA 4WK6A 4B34A 4DLUA 3HA2A 5B36A 1GDDA 2P9JA 5REQA 4L72A 2J3KA 2ATCA 2LIVA 2WSMA 5E0OA 2F8SA 1SXJE 3VA7A 3HUFA 4F3TA 4J0DA 4R5HA 1K7EB 2LD4A 2C4HA 2WJPA 3ZW9A 1ZJ5A 1AKEA 4RVHA 2VJLA 3VSEA 1RCFA 4PBSA 5IDYA 1MGOA 3DPIA 1ZNQO 3FOCA 3PQ7A 4YRDA 3GZ4A 5AKZA 4IXTA 1V43A 3V4VB 4JJZA 6CHYA 4DC0A 2B4AA 3LQ4A 1NNEA 2FP4A 3GEMA 3MJVA 3TLEA 3ZDRA 1PWXA 2ZE6A 1QOZA 4JYCA 1G18A 2H65A 5ARCA 4AY6A 3NDJA 5CFRA 1B76A 1JH9A 2ORED 2NN3C 2YHIB 3EVBA 4O2LA 3UJAA 2AC4A 1NW8A 1WXHA 1E6MA 2DUMA 2OG2A 2YV5A 1UBFA 3IBYA 3Q1LA 2R60A 1U1FA 3N1UA 2HA0A 1Y6RA 4KPEC 4EAQA 3SYKA 2FZ4A 2ODPA 5EP4A 4DG5A 3UUFA 1SKBA 1XTTA 1X0XA 1P2FA 1FYXA 3KM0A 1IUKA 1YQ9A 1OBFO 3TLBA 4ALNA 1WPQA 3E9ZA 1E2FA 2GSDA 5C52B 4LWZA 3AUYA 4RGBA 3FCOA 5DN6A 2BGLA 3ITKA 1CY4A 3K1AA 1PCXA 4G0ZA 2W8BB 5KAPA 1YQEA 2CHGA 5DMHA 3SS9X 4GEKA 4C30A 5CA1B 4DR6B 2O07A 2P30A 3P9ZA 1Z4PX 3BHJA 4KO2S 4LSGA 3W8FA 1H2HA 5GVSA 3RQIA 4AXXA 1A9XA 2CB9A 2NTVA 4XM2A 3SR3A 1U3DA 2BFDA 2CLKB 3PNSA 3L8MA 5FO0A 3TR0A 1IPHA 5HUJA 1T2DA 3NEAA 1M8JA 3M4YA 2CZGA 2L69A 1DRWA 4L57A 1BHSA 2EYUA 1EG2A 3MMNA 3T5MA 1KRWA 3D3JA 4DDTA 5B3JA 5AH0A 4E88A 2Q2NA 5F3RA 1GPH1 3DW1X 3JY6A 2FW1A 1EWKA 3DVAA 3A1DA 3R9WA 2AG8A 1YA6A 1BJRE 1VE9A 1DG9A 5I4KA 1BS9A 2LV8A 2ZYTX 3AUSA 5F9MA 3ROQA 1XZBA 2P6MA 3RANA 2CL5A 3RB8A 2R84A 1KIFA 2JZOA 2Y27A 3T3IA 2VF2A 1ZUNA 4NAUA 2H63A 1A0OA 3TQCA 3QVUA 4R2HA 1ZAKA 3ZY3A 3TRKA 2P5UA 2IX9A 1KTIA 2IYTA 4JZKA 4KKVA 5HZMA 3EMBA 5JDCC 3PCRB 4INOA 5I4IA 1BN6A 1W581 4Y2JA 2VPPA 3IVAA 2OHXA 3RRXA 2XZOA 4Z4EA 2I7DA 1WQ1R 3DOIA 3VBCA 4CT5A 4TYMA 1S89A 2VDPB 4B5KA 2QVGA 4PX9A 1F9EA 2VJMB 3R5SA 4RIIA 4DXDA 2BE7A 1L5KA 4CQJA 1KAMA 4EB6B 1FUIA 1HL3A 3PFWO 2PZLA 3SYLA 2JKZA 3X1ZA 4JX8A 2R8XA 3SXUB 4ZAXA 1CETA 1Z0FA 1VJGA 2PSDA 2UUOA 2YFHA 4G4GA 1U1EA 5ADVA 1U5BA 1CY2A 1U6IA 4REQA 3BRWD 4QHTA 1T1JA 5FFFA 2XMSA 4BX0A 4PV7A 3TD6A 4NU0A 3U4QB 3L8CA 1ZCBA 1B14A 1GG8A 1AF4A 1ODSA 1UBGA 4JMPA 4BNWA 3N3BC 5CB6A 4W7IA 5LL6P 1CNFA 4H4EA 5E7QA 3FWKA 5EXDA 5FHQA 2VQDA 5IXJA 3V2UA 1OFUA 2GN2A 4GH5A 4MVJA 1Z7WA 4DIBA 5FOQA 1I30A 2Y93A 1XQ1A 3CWZA 4IRMA 4ZK2A 5ILGA 2GNAA 3RU7A 2RKOA 1QCCA 1GTMA 1II8B 3N74A 3CNHA 3GAFA 4DLRA 2RIPA 4FKBA 4PPFA 2VPWA 1G55A 3KD3A 1BIFA 4KO3S 1PZGA 4LYAA 2PAFA 1J8FA 2WWXA 1JSRA 4UBJA 4NH4A 2J41A 1QLJA 4MQBA 4YUYA 1QRAA 5EQDA 4HKTA 2AFIA 1XZJA 1Z9BA 2IFTA 2ZSHA 4M9UA 1YJ8A 1CS0B 3RT9A 4D44A 2B98A 5J47A 2YVLA 1ULHA 3C4VA 3ROKA 1ZI9A 3BWEA 2GCOB 4YJFB 2PNFA 7REQA 3ETJA 1JJIA 1FS6A 3RVLA 4Q9KA 3G82C 4RSMA 3MAJA 3UENA 3KHUA 3H1PA 3HYCA 3L1KA 4UDNA 3NT2A 1SVLA 3JARA 1TUGA 3D7LA 4HH4A 3INYA 1HSZA 1E1LA 3OZBA 2M6KA 4BBZA 5KOHB 3CO0S 3KLNA 1EFVA 5KYGA 1NC3A 2ZRDA 2N1BA 1KDOA 2YR0A 3SDBA 3WFZA 2ZUFA 1F12A 1QGDA 4R8LA 2JCYA 4F85A 4H60A 1B8PA 5SV2A 4WACA 3SKXA 5TX7A 2D7DA 1DC7A 3ZX5A 2CV0A 1P3DA 5CK5A 1XQYA 4YCJA 3WNCA 5H8WA 1T3ZA 2CUNA 3KFVA 4YXFA 4E14A 1TJ3A 5DDIP 4OCZA 5LCXA 3EEQA 1DEAA 4FNOA 2JAHA 5T64A 1LPAB 5DX8A 2FUNB 1KMIY 3T7JA 1BW9A 4RHYA 1D1SA 1R7RA 1MZVA 3JQAA 1MX3A 2CC2A 1VDZA 1I2ZA 3VDNB 4WFJA 4EG0A 2C7GA 2WUVA 3C6ZA 4AMBA 1QXSA 4I55B 4EYQA 4PYJA 3R6DA 1E3DA 3A36A 4B47A 1P1KA 1U7ZA 1DAOA 1ZA1A 4B7CA 3O4FA 2WD9A 4G89A 5SY4A 3GLIB 4E7PA 2G8NA 5CA0F 5JQGB 2VAWA 4BX2A 1PYDA 1F8GA 3MTQA 2GS9A 2PJZA 4TMVA 7AT1A 1LH0A 5DSZA 1URPA 4N5MA 2PV7A 1OX6A 5LQJA 3MINA 4KBGA 3RC3A 3L92A 4QECA 3TJMA 4RXUA 5ICCA 4W82A 2CXUA 5C3UA 4MW0A 2FPIA 1LZLA 3GLRA 3WLFA 1FDSA 3HDQA 4IS2A 4K26A 1DAGA 3NR2A 5KEIA 2ZWPA 4NCBA 1Y48E 2DUNA 3K9LA 2J48A 1XPRA 1RXWA 5C7OO 1ZMRA 3NTVA 4FE7A 4BIMA 4KYIB 3OM1A 3A37A 4HCJA 5F1PA 4AICA 4C6TB 5EJ5A 4DR2B 4YCLA 3AFGA 1Z4QA 1ZOPA 5IP5A 4RTMA 1CJKC 1Z5UA 1TK2A 1EHCA 1YV9A 3CF4G 4X20A 1EMDA 2C4UA 5FL3A 5G53C 4CQMD 1GV1A 5IZ4A 4E51A 4NYIQ 1SUEA 4RLQA 2PX4A 3KOUA 4UBNA 4B7UA 3L3BA 1XCPA 5GJBA 1FLAA 3ZY4A 4LNHA 4LGVA 1JEEA 1HQYE 3DFZA 2O1XA 3NATA 4ZIRA 1P80A 2Q6KA 2AZMA 5CLLA 1S1MA 1CB7A 1K75A 1Q15A 2YXPX 3F6BX 2YYYA 3KJGA 2AJ8A 4OQDA 3THWB 3L18A 4PC1A 1L9KA 3P9QA 4C6HA 3OF5A 5HJ2A 4MAFA 1A2OA 4YR9A 3LE8A 2HMYB 4H7IA 4KQIA 4MR7B 3LYUA 1WE2A 4WLOA 4R54A 3Q6NA 3O4HA 4IF6A 2WD7B 2ZW9A 1A50B 3R4CA 2QTWB 2G76A 2Y6UA 3IEPA 3N0WA 5CGZA 1QB7A 2WKSA 1ICIA 4Q05A 4EUFA 1YXMA 3G5MA 2GLTA 5E6SB 1J90A 2SKDA 3ZKAA 4XVCA 2RBEA 2QPAA 2ZTVA 3SHOA 4F06A 1ZLYA 4GSKA 1NE7A 1DEHA 3K96A 2J7PA 3AZOA 4CN9A 1GARA 3H11A 3LUGA 4KLZA 3V3TA 1H2XA 4OA8A 2A7QA 4MS1B 1TAQA 5AK6A 3SYNA 3BA1A 2VFAA 2X3UA 2ZITA 2D0PB 2O3QA 2BVNA 2VPXA 2ZYUX 3FRJA 4LBYA 4LXTA 5DNDA 4DC1A 2EHDA 2WM3A 3B1JA 2F00A 1ZUWA 2CD7A 2VNKA 1GL7A 5H3LA 2A1TR 5K6AA 4CPDA 2PT9A 3P2IA 1O9HA 1Z16A 3SHWA 4Q1AA 1DC3A 2FZ5A 5JDIC 5KBYA 2UDPA 3EWAA 3OCVA 3ZI4A 5A3JA 3RK4A 3UJNA 2ZM5A 1J1UA 4JQOA 3A6DA 2OB2A 3PGMA 4BASA 2Q0HA 5A6VA 3H2SA 1AKVA 1KKUA 4I5EA 3IELA 2UYYA 4IGEA 4G0WA 4O8CA 3B1KA 2ZYAA 1N8KA 3O73A 3QFHA 3RKUA 5CCDA 3DOJA 1FPQA 4L4XA 3S2YA 3UV6A 4TQGA 3LYLA 1HG1A 1L7NA 1YJCA 2H31A 1Q7RA 2AVDA 2NO9A 3ZWOA 3RSQA 1M2OA 4CKEA 2Q0XA 3DKRA 5EUCA 5DLPA 3RU9A 3U80A 3SE0A 4Q4CA 1DELA 2ZTUA 2V4MA 4ALIA 1J2UA 1SUDA 3UA4A 1IY9A 3GLVA 5CXXA 4CTOA 1EJBA 1F5NA 1KGDA 1EXDA 2GXSA 1R74A 4YHBA 3CZ9A 3P9XA 1BJTA 2GEUA 1NBMD 3LXXA 3QNWA 3THOA 4ZYZA 1AO0A 1HMYA 4WNYA 2X8JA 3QX3A 1C41A 1J0XO 5H7XA 2PGDA 4LHEA 2J6IA 1A5SB 4JT4A 4LIPD 5GZ6A 2Q6VA 1NQTA 1O08A 4BAZA 5MFZA 1E5QA 1QF9A 2IEAA 3Q3VA 5AW3A 3A6JA 2UZ1A 6NULA 1XQ9A 3RFXA 1T2EA 2HN9A 2YMQA 3I2KA 3SJAA 4MVJF 1O57A 3S2FA 1XA0A 1M0WA 5TE9A 3R44A 1YCGA 4AKHA 3PGVA 1T36A 4HXEB 4UM5A 4AP9A 3G1WA 1OA1A 1B41A 1DP4A 1NY5A 1E5DA 4ND3A 1TKAA 4TV9B 3ENKA 4LZNA 1XQXA 2B69A 5I9SA 2ZIUB 3RVSA 5B5SA 4HYQA 1EINA 1FJGB 2RIRA 5DCYA 2NNLD 3B7GA 1I1QB 1XFAA 1NOJA 4KFSA 4IL5A 4JP2A 5D84A 1HDOA 2DOKA 2OQIA 1B42A 1BSVA 1IJBA 2PZBA 3PHCA 3T3PB 2DFDA 1M2VA 3E4DA 3GRYA 3OPVA 4UJ3A 1PFUA 2DRIA 3GRKA 2P9CA 2C7QA 5JV5A 1PFQA 4JWKA 2PHZA 4PLZA 5GONA 5JAQA 1P4JA 1PT9A 4ZAWA 1TRKA 2M6RA 1Z6XA 2C07A 3F7MA 1ESCA 1TUBA 5C2JB 3AHJA 1PX2A 4I1UA 2C7BA 1PL7A 2ZJ7A 4RQBA 3WGGA 4CDMA 2OXTA 1A7JA 1GEGA 1JALA 1HI9A 3AHGA 3CE6A 3CW9A 3H83A 4LDNA 4RZ2A 1DU4A 1TCAA 2BFEA 2QTNA 3AF3A 3UOAB 1XDZA 4UHJA 2I4OA 1P75A 5HDQA 4A5SA 3WI7A 1NUPA 1FFBA 4IICA 3DTVA 2GBPA 4GX1A 4I3FA 1UMCB 3V80A 2D62A 1E4OA 1HETA 3RWBA 2BGKA 1C14A 3PX3A 4PXSA 2EJCA 3SQLA 4FFOA 2NU9B 4Q12A 2VG8A 3QVSA 1U04A 4ZAZA 5FADA 5DEIA 5KNDD 2XBMA 3VR4A 1V26A 2R48A 1GTVA 2C3MA 5K8JB 4DA6A 2BSAA 1RWNA 3WYGA 2RHBA 5KTTA 1JHMA 3T5PA 3UFBA 2JL1A 1QFSA 4J9VA 1WSAA 3K0SA 4UMDA 1U4NA 1P91A 1IHYA 4ZRNA 3WBBA 5AHKA 1TTTA 4KFTA 3VR1A 5B6PA 2YNMC 2Z43A 3JWPA 1D7AA 4DCPA 1CFJA 2JAXA 1XK6A 3LWBA 4NV0A 4RHCA 5GQSA 3MHTA 2M32A 4GZLA 2BBOA 4LXHA 4CHGA 3CLUD 1R12A 3HEBA 2HL6A 1P7WA 3NBAA 5TC4A 5T41A 2ID7A 1TQ2A 1XFDA 4B84A 1L2TA 3B6EA 3KQUA 4RV5A 3RUCA 1FVHA 5HS4A 4PZPA 5F7ZA 1MO2A 3R9XB 3WFIA 3U3XA 3L2OB 1QV7A 1Z73A 4G1CA 3M4NA 2ZRJA 1OZHA 2A3NA 3BXEA 3OFVA 1X2BA 4BO1A 4YAOA 2Y99A 4FD2A 4B2YA 3K8QA 4PPQA 3UMRA 4J7AA 3K9FC 3IVGA 3L8FA 4PQFA 4NCIA 4RS3A 1KYWA 3AJ8A 4NI5A 2XUJA 3OPYI 2WAYA 4L75A 5FPYA 1WHSB 1H2EA 3KQKA 3M2TA 1KJYA 1Y3IA 2EJUA 1T4MA 2J46A 4KQ6A 1V1MA 2ATVA 3VGPA 4HRXA 2IHVA 5AJVB 5IC5A 1VRVA 2QTTA 4E2ZA 1JZTA 3LM8A 1IQUA 3Q2OA 5BORA 4YGXB 4KBYA 1JG7A 4MYSA 4XD7D 1TJ4A 1M0TA 3HJUA 5HCIA 4DLSA 3FR8A 2BCGY 4HPWA 1NATA 1YRLA 2G28A 3D3KA 3AI3A 4WZBE 3F6SA 5EVJA 1SPBS 3RPEA 5AUPB 5HM6A 5ICGA 3GGOA 1OH5A 1UC9A 2PLFA 2VCEA 3R3JA 2QMEA 4Q4LA 5AJXA 3GC6A 4YJ2B 4PSVA 3OP4A 2X0DA 3TOCA 3ZVRA 2HYDA 2QAIA 4I8DA 3A10A 3I83A 5M7EA 2CXQA 3LIPA 4PQGA 5LMZA 2CLEB 4LRSB 2EJBA 2AFHA 1TM2A 3CZQA 4JX9A 4BZPA 3FMPB 5LC1A 4ZU6X 2DETA 1MA0A 5AHRA 1NMSA 1CR4A 4XM1A 3EFOB 2FSIA 2Z2YA 3NRBA 4JA2A 4DREA 3HXTA 4IIGA 3GCXA 3KJZA 4MRPA 4GG1A 4PLTA 3T0GA 4EL5A 2R25B 2XKAA 2H9IA 1ZN9A 2YC4C 3FVRA 5KWVA 2XYQA 1J5XA 4M49A 4FGJA 3N05A 2BGMA 4DHEA 3ON5A 4H1HA 2UYGA 4EPXA 4QDUA 2PTHA 1JLLA 3CFYA 1UWVA 5ALGA 1RLUA 2ZRFA 2CT8A 2XUPA 3DMNA 2ZDQA 3IP7A 4TSFA 5LDDC 4G41A 5SZJA 1YBHA 1W52X 1UFKA 1RW4A 3VAAA 3VVMA 1H4TA 2G9RA 1Z0IA 2GJSA 3AKDA 3D6FA 4TTVA 1T25A 1UQTA 4U3JA 1KZHA 1BA3A 4IJWA 3TBKA 2YC2C 4J43A 4A8JC 4RADA 5DJ5A 5CITA 1EM8A 4M37A 4DR5B 1EPUA 4EARA 5EMJA 1NPYA 3FGPA 1XWIA 1ITZA 2FZKA 3GROA 3KR2A 3QOXA 4UBIA 2OVBA 1XRNA 5CPFA 1HF3A 3B3FA 1RLMA 2LRHA 2TSYB 4CETA 2VZ0A 3JD2A 3CINA 2ZGVA 3HCCA 2OCAA 5KMGB 1KYQA 4PZ0A 5KSPA 2FPUA 3ZZ1A 1T6ZA 4DIDA 4DR1B 1CZOA 1RKXA 4C0SA 3ZZNA 4HNUA 1HTTA 3LPMA 4YJGA 3RUDA 5CM8B 3ZXSA 5F78A 4QD3A 5F7JA 2VWQA 3L7NA 3IBCA 5CFMA 4DV4B 2BRUA 2FFQA 1P73A 2W2QA 4MCHA 4D9FA 4MX8A 2XEDA 4N6OA 4D3DA 1EGVB 3TLJA 3TOXA 4RDXA 3OQMA 5TB5A 3D64A 1R66A 1ZISA 3E9CA 5ALQA 1CQXA 4OD0A 3ZVKA 3IX7A 2CL0X 3RC7A 4YRNA 2DBYA 3H7AA 3FTNA 4CGYA 3MIZA 2YW2A 1W4BA 3MBOA 4WCFC 3FOFC 4AJ1A 2GUGA 3FCCA 4CM1A 4O3FA 2EDCA 4ZDJA 4W5WA 4CMEA 3IODA 1MKYA 1O5TA 2BFFB 4EENA 1UPUA 4EJ2A 2P9TA 3OIUA 4Q34A 2H57A 2EW8A 1KJJA 2JFHA 2X5KO 1R0SA 3KPYA 4RKEA 1KDYA 1Y9JA 4O1HA 3LUKA 3BE4A 5CIYA 3C97A 1FYWA 3FGNA 4GHWA 4O2BB 5DLQC 1CTQA 1WHTB 4RJIA 4BEJA 4K9SA 1AQYA 2JVIA 2WU1A 1MDBA 5B7NA 1YJ5A 3OZFA 3TM5A 1M7HA 4RJ2A 1C7FA 4GGMX 3CEPB 3EISA 1KEUA 3W8RA 2OSVA 3RRMA 4YACA 1Y4ZA 1D6SA 5A0FA 3M6LA 4EBBA 1ZK4A 3E9YA 4FFNA 2ZG6A 3ZVMA 1DIHA 1WP4A 2XMGA 3DBLB 2AI2A 1SU8A 1Y3HA 5DHSA 3OMWA 2YWGA 1IVSA 3FPKA 2Z3VA 1TEXA 2JCXA 1Z2OX 2DSNA 4FCVA 2CSXA 5G0TA 2I6QA 2XDQA 3K53A 2I34A 3KUUA 2EGUA 4LXQA 4NYMQ 4OF4A 4TZKA 5EYPB 3SE7A 5A3QA 4TWBA 5IASA 1QC5B 1KQFA 1GHTA 4Z3DA 5CXQA 3RWOA 4ZZIA 2XAUA 2IGTA 2N75A 4OXRA 1LWNA 3AERA 3ICVA 4QFCA 3JQ6A 1H85A 1G66A 5GONF 2QRKA 1UKAA 3ZH2A 4KRGA 2YX1A 3GUHA 1NVFA 4M76B 3OHPA 4YC7A 3GP5A 4OPMA 4CL3A 1E69A 2MU1A 4NE7A 3UK7A 1J6UA 2Z8YA 1Z5GA 2NNWB 4CHTA 3NHWA 1YUMA 2JGDA 3A9WA 4HAIA 1JILA 4TUYB 5E8JA 1OYOA 5LZ8A 4DDMA 1R10A 2VLBA 2JDIA 1Y4AE 4ZOQI 2B9EA 2KLHA 3DDZX 5DBEX 1UEXC 4FD3A 4OMDA 5FJIA 5K1ZA 2YJ3A 1WBDA 1N34B 5JPIA 4TKVA 3AZQA 1P3Y1 4NG5A 5BQPA 1KYZA 1AD2A 1Z0AA 3EH1A 5LD2B 1RYMA 4KQJA 2Q5EA 2HU7A 3QVWA 5DGTA 5KJEA 3V8VA 2GAFA 2HMWA 2KYRA 4GR9A 5BY2A 4IDDA 4LZZA 2G04A 4I3GA 4XVHA 4D9IA 3OCWA 5J2TB 5KO2A 1S02A 3Q12A 5EPUA 1PVDA 4QPDA 2WMNB 2XZLA 2LCIA 1JKJA 4UHDA 3IIEA 2C20A 1JDJA 1RNLA 1ULSA 1ML3A 2ZS7A 4KFCA 1F7UA 4M8NE 3B48A 1VJ0A 3C3EA 1OT5A 2QUZA 1N9ZA 1ESMA 5FV7A 2ARKA 4LVNA 3A4YA 4MUXA 5EWJB 1E9RA 1LBHA 2I67A 3AUKA 5IJAA 3T9CA 5K0ZA 3JRXA 4DQKA 5EUMA 3M7IA 1L5QA 1VHDA 1IHUA 4B8WA 2B4YA 2O48X 1AT1A 3M49A 1JFRA 3EZYA 4PVCA 1EUDA 3NAQA 3V00A 4PFQA 3NZEA 4DCJA 3UEOA 2C00A 2Q1TA 4QPZA 4DLYA 1EZ1A 4JJKA 3FCYA 5DYGA 1C3OA 3COWA 3H3JA 3MUEA 3Q3CA 5JCJA 2OQ2A 2WIKA 3LHFA 2AC2A 5B55A 1O94C 2PPLA 3BKXA 1LBTA 2R7AA 3KSZO 4OOEA 1D07A 1EYZA 2VYQA 3HDVA 4L0MA 3V8BA 4G1UC 2QD2A 1MD9A 2ZI6A 2GH1A 4MV0A 2W71A 2PUWA 4Y6PA 2DPMA 4ZT2A 3ZK7A 4CL8A 1DIOB 1SCIA 3FHTA 5F3DA 2Q8QA 2FZGA 2RGAA 2UVPA 3FBTA 1WCWA 2C3YA 4MVJE 4EQ6A 1IZ7A 3OLQA 4DCMA 2JLZA 3Q8LA 1K27A 1H94A 3NHZA 5BRAA 3R0IA 1PK7A 4HRAA 1M5RA 2GWRA 1BNCA 4R2JA 4V1CI 1IXYA 4ZHQA 4AP6A 2Q7XA 4MA0A 1BHQ1 2P78A 2NXEA 2LIPA 2XCQA 1KDZA 3OQOA 3WAJA 1IH8A 1JKXA 1OKKD 2VSNA 1FBNA 4M7RA 4OJMX 5I7OA 4I4LA 1JJAA 1H1LB 1YQWA 1GLNA 1ZESA 3AMVA 3U31A 4AZWA 5JXIA 4EPRA 3A1SA 4CV3A 3VO2A 3HBMA 3EBPA 3OPQA 4S1VA 4BE7B 1B3BA 1P7VA 2ECOA 2I6TA 3RTEA 2DAPA 4OJQA 4U9UA 4OK5A 5A3SA 1FFGA 3EZFA 4B33A 1TM3E 4MQMA 5AD1A 2OZLB 1DC4A 4MVCA 1JHOA 3GAZA 3ADKA 3BA6A 3PE3A 4IOLA 4BL5A 1ZXXA 4NFHA 2F1JA 1ORTA 5MHTA 1WXXA 2FLWA 1TU4A 2Q8PA 5I7EA 3GIDA 1D9XA 3EF1A 3KTAA 4BHTA 3K72B 3D7KA 3P19A 1A9PA 1K6XA 2D2VA 3EIHA 5IBRA 3SIXA 2IOYA 3QLUC 4XEUA 3E5HA 2PY6A 4MB0A 3S7ZA 3N2GB 1GPDG 1C4OA 2PKXA 3QJYA 3SYMA 5I7HA 3WRYC 4E3WA 4U7GA 1LUAA 2ECKA 3O1IC 3QBVA 4GUAA 4DRXB 1G4UR 1LA2A 3LC7O 4IIJA 4DTIA 3DCYA 3O0DA 3QLVC 4Y1RB 5IT0A 3P4UA 1T34A 4PRZA 2CZCA 4LMRA 4CTJA 3ZS9A 2R6DA 3FPAA 1SAYA 4UPDA 3BE5A 2ZE5A 3RHFA 1NT2A 2WU0A 4X94A 3EW9A 1CS4C 1D2GA 2QTMA 3AR5A 3EULA 3OC0A 1S2MA 1UIRA 2HF7A 2WIAA 3MFQA 4FFDA 2Q6LA 2QMQA 4Q4JA 3R7WA 3I30X 1MT3A 3JAKA 2CFOA 4AC9A 3SZLA 3FLAA 4DA0A 1KPGA 4E31A 1R1DA 1ORIA 4LVUA 1FX1A 2OORC 4BBPA 1Q22A 3E1SA 4C1NA 3OFND 4ARSA 1F8UA 3G6KA 3IJEB 3L4EA 4GSYA 3C85A 2QSUA 3DLAA 2EKLA 3E22B 3L8EA 5HKBA 1COWA 3KYBA 3VKHA 2VK2A 3FDJA 5E7JA 3DAHA 4UVHA 2ZYGA 2A5LA 1J2RA 4ARVA 2Z4SA 1KEZA 4HVAA 5AM1A 2P2YA 2VXOA 3FYDA 4G09A 4OFZA 1TADA 2WNSA 1YCHA 3W3ZB 3GRRA 3X1WA 5T8KC 4HRYA 2JF0A 4J75A 4D4MA 2AIRA 3O90A 3ORYA 5K8IA 4QXRA 3AUAA 3RUHA 2ZCUA 5HIIA 2FQYA 3PWSA 3G17A 3QENA 3TZQA 3DEJA 4OTZA 1CDZA 3I4LA 4FUTA 1IQPA 1HDIA 3JX9A 4QFMA 4DM4A 1S2NA 1K89A 4UUBA 1LZKA 2VVTA 5TEVA 3V1MA 3IUYA 5LYJA 3BB3A 10MHA 4IJQA 5KNCA 3GAMA 1FVXA 1NT4A 2RCNA 1H22A 3B1VA 1Y8QA 3NVDA 2FSHA 2P8SA 4RKYA 2DBZA 3TEJA 3EIXA 4IF4A 1IJKA 3RODA 1PJ3A 4NAHA 4RQTA 3ZY2A 2QY9A 1HFKA 2Z56A 4WEQA 1PVVA 2PNJA 4U1RA 2N0SA 2A88A 3P2KA 3AESA 4GYWA 1EHIA 3R9IA 3U3MA 5JR3A 3SJBA 3CZMA 4RAOA 4X24A 3SX0A 2GRAA 3HWX1 1JKMA 3E5NA 4QDOA 4TRRA 4H18A 4BVGA 1ZM4A 4LOAA 4HJRA 4QYSA 3JZAA 4JB2A 3TR5A 1CY6A 1D5CA 2K7ZA 2PO7A 4N82A 4PC2A 4DSAA 1RAAA 1R9MA 3E5MA 1MPXA 1XJ0A 4F8YA 1EVEA 2O8BA 5ER9A 3WNDA 3MJDA 2YFYA 3HXLA 3L0CA 1GAQA 3S27A 1UFVA 1EG7A 2C95A 4EF5A 2O14A 2UVDA 4IMIB 3U3KA 3ZIUA 5BVHB 3B78A 3NVKI 4CM4A 4ZT3A 1KI2A 1SWWA 1TC2A 3ANLA 3T34A 3SQXA 5DYYA 2H8GA 4D9KA 2IIQA 2QX4A 4C06A 3PGKA 2AJLI 3H2KA 4LK3A 3IQDB 1FNDA 1ZGZA 2WWIA 1KR5A 5A9TA 4CMHA 1NVTA 3MJSA 1RRFA 4HH3C 3R7SA 1JRLA 1V6SA 1ZEMA 5P21A 4C4TA 3K70C 3M6UA 1TUIA 4G67A 4H08A 4RIFA 1NC1A 5DCUA 1GRQA 3AOGA 3KEMA 5LPNA 3QVKA 4JB3A 5BSTA 2ECPA 1BOFA 2Y68A 3NEYA 3RD5A 3TTVA 3NHFA 4EG1A 1L4NA 1ZQ1A 3DE1X 3WGJA 5L3QB 3H9QA 2FPWA 3IS3A 3TM4A 1UEJA 3QUQA 2VYVD 3KNZA 1DEXA 1TJ5A 5E0KB 1T6BY 2HNKA 3CURA 3ILSA 5SZIA 1M3SA 5ALLA 2H7CA 1UADA 5IX8A 3QOYA 2QVLA 3BCHA 3N58A 2ZTHA 4MJ3A 1K6IA 5BWLA 4B48A 3N0TA 3OT5A 1EH5A 1DUIA 3CKKA 3OZIA 2NO4A 4JP5A 4X84A 2WT4A 1FUKA 1WD5A 3OEED 3NOXA 4X6XA 3S2IA 1E3WA 1T26A 2C4KA 2UUPA 2W6CX 3EBLA 3FZNA 3L93A 3OTQA 2NXJA 3VTZA 3RG2A 2QRNA 1PD0A 4H0NA 1SXPA 1T4DA 3L77A 1U3FA 4HWOA 1VL2A 1WVGA 3D4PA 1WXFA 3LWNA 4TLDA 3HJAA 4OHFA 2DUUA 4CUKA 4ZI5A 1OIVA 1LS6A 3SZUA 1JIXA 2BELA 2QGFA 3F5MA 5JBIA 2XB4A 4RCZA 1Q0RA 5DGHA 5IM5A 4H7EA 5AKLA 1PNTA 4EO4A 3NUQA 4LE1A 4MPTA 1X1BA 1GFWA 3DHNA 3MM4A 2DPXA 4DA7A 3NRJA 4MIOA 2A0XA 4D99A 4WFQA 1WULS 4KFRA 2BEVB 2IBMA 1GWNA 3ISJA 5DBGA 2R6AA 1Q1GA 1RLTA 1SD1A 1WB6A 1N1EA 1XTIA 2F6RA 1AK1A 4BAUA 4TTTS 1WB9A 1MEJA 4AULA 3G79A 2KI5A 2V03A 5ENZA 4G1VA 5EJ9A 1R4MB 3IOBA 3QFCA 4N3BA 2ZOSA 3N70A 2X8LA 5I6DA 4L2IB 4DLPA 3CKYA 3OZVA 4G6ZA 4RORA 5H80A 1MRZA 4ZHQF 4LBWA 1ADYA 1CU1A 2FPOA 3KVVA 3ROEA 1P6XA 3UOWA 1U2RA 2E5FA 2P91A 2GCPA 3AC0A 3FMIA 1Q12A 2Z5LA 2XMZA 4G2TA 5BOVA 5HKOA 2JFZA 3ANYB 1P5JA 1YIOA 2ONKA 4MVXA 4FILA 1LXCA 2G0NA 3DUFB 2DQZA 2QLLA 1P2VA 3AILA 1B1AA 3EQ2A 3I92A 4XJXA 5AM5A 4JI3B 1Y9EA 3AI1A 3PVZA 4W7HA 2JHAA 3OOJA 2RAVA 3RYIB 3DS8A 2XUKA 2X8BA 3FJYA 4QL3A 2Q5JA 5EP3A 5CD9A 3Q87B 1E3MA 4JI6B 1ZK1A 4K86A 1B8NA 2YFQA 3DZKA 2REQB 2PGXA 3A7DA 4BTEA 3MRSA 1ZRHA 1HLGA 2VA9A 4F6LA 1BGVA 2P4HX 2NUAA 4RH0A 5ITVA 3VHLB 2G09A 2IPXA 2ERCA 1LPOA 2B2NA 3ESBA 3LOQA 1HEIA 2PXCA 4GC5A 3MMXA 4X41A 4DZZA 1Z6PA 4OL9A 3DH0A 1G9XA 2P2GA 5TQ0B 4YMSA 1SHLA 1VSUA 3C6XA 2YWXA 4NYJR 1E3JA 4BNMA 5B30A 4IIJF 4IR7A 3VJKA 1WLSA 5AUQA 5CURA 3PQDA 2ODNA 1U2ZA 5E2AA 4A0RA 5JADA 3QKTA 3RC1A 4JUCA 3B2QA 4G5FA 4JJGA 1HA3A 2VUIB 4QO7A 1KARA 2BTQB 3TL6A 4UZFA 1JP7A 1AA9A 2DT8A 3OEWA 3V4ZA 3I23A 2BOVA 1Z0ZA 3B1WA 3FPEA 5AJWA 3HO6A 5EJ4A 3UXEA 5IWAB 2C2MA 1C8VB 1VIVA 4JKOA 5I4CA 5KI6A 4CKBB 1RYFA 5AOVA 1BEUB 1KMCA 1UH5A 4AWBA 1KK2A 3O3CA 4AYXA 3VOBA 3LC2O 3EVCA 1GUFA 2B3DA 4F46A 4MI1A 1F2VA 1AGNA 1U0RA 3HU2A 1JEJA 2I1LA 2FY8A 5D1NA 4IDPA 5K0BA 1N3LA 2CLIB 3MYRA 3C5CA 1ONNA 1BE0A 4P83A 3NYQA 2HFJA 3JZFA 1QZZA 4GP7A 4LTMA 4AYWA 2AD5A 4WL0A 2OYSA 3LC0A 3AHEA 4RM3A 5JIBA 5IN4A 1SCKA 4ESVA 1KYXA 3A2NA 1HTBA 1ZZEA 4QUGA 5AKYA 4MR8A 3DYIA