3PE6A

Crystal structure of a soluble form of human mgll in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
289
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWAPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal structure of a soluble form of human monoglyceride lipase in complex with an inhibitor at 1.35 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 107
structure length 289
sequence length 289
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe6A00
1A7UA 4Y2RA 1YCDA 1OCEA 2JGLA 5AK4A 2QS9A 5HFNA 3WZMA 3DYVA 1CUAA 1ZD2P 1XZJA 1AQLA 5FP0A 4BTVA 3WLAA 1AURA 4LXIA 2AJCA 4HS9A 1EB9A 2XDWA 4IO0A 3CCBA 2HU5A 5FPPA 3I6YA 5KREA 1AX9A 5CMLA 4ZI5A 3TGLA 3QMWA 2VQ6A 2GBCA 4PW0A 3A2LA 2RHWA 4FWBA 5EIEA 2W6CX 1VKHA 4KRXA 4LIPD 1DWOA 2WG1A 4GHWA 5I9IA 2HDWA 3IUJA 2ZJ7A 4X85A 1BN6A 2FJ0A 3F67A 3KWFA 1UK7A 2R8BA 1K5PA 2ZJ6A 4ZWNA 2XI4A 4BCBA 2XQJA 4A23A 4DNFA 2XE4A 3O4HA 3WJ2A 4G4JA 3KWJA 4X94A 1PV1A 4HXEB 4B82A 2DQZA 2WIJA 2XB6A 1UKBA 3CXUA 3I2FA 2VAVA 3C6XA 4DNPA 2ACEA 1J2EA 2PSDA 4OCZA 4F21A 4U2DA 2EDAA 2G4LA 1K4YA 3IDAA 4UFNA 1FJ2A 2WG2A 3EQ8A 3QPAA 5AIBA 5AKZA 3GELA 4W9RA 4J0HA 4CG2A 3JWEA 1M33A 4FFWA 3HXKA 4GW3A 3M3DA 3ZLUA 1CFJA 4LXGA 3YASA 4W1RA 4UFOA 4JUIA 3WK8A 4MEBA 3NWOA 5AICA 2XMCA 4LHEA 3WJ1A 2YXPX 4E11A 3MUOA 1ZI6A 2IIVA 2K2QB 3VJMA 1H2YA 5I7UA 4Y9SA 1QE3A 1Y7HA 2ZSIA 1QIKA 1BS9A 4RPCA 3H19A 1EX9A 1CUXA 1WB4A 3IA2A 1CEXA 3I28A 3UUEA 3FVTA 1ACJA 1XQYA 1Z68A 4RNCA 3ZI7A 3I1YA 4ROTA 2H7CA 4N8DA 2JEZA 4Q3LA 5AOAA 4S0XA 5DLPA 3G9UA 4BZWA 2GBIA 3K2IA 1W75A 2I3DA 5ALHA 4ZGBA 4H7DA 5DNWA 3WK9A 3B3QA 3OC0A 1PJAA 1CLEA 5AO9A 5CT4A 1VE7A 5ALDA 3R3YA 1U2EA 5HKAA 4H18A 4KE6A 1FSSA 2PL5A 1H22A 2QJWA 5JD6A 3WWPA 5AIAA 2NW6A 2CBGA 2HU7A 3Q8WA 4AX4A 2GBFA 4KJXA 1LBSA 4Y7DA 2YH2A 3DL7A 4EUSA 1QONA 4X6XA 5LZ5A 5DNVA 2XUKA 3C5VA 3DOHA 3NGMA 4CFSA 3GFFA 5FKJA 3I2KA 3V1LA 1QFMA 1NU8A 3KSRA 4OB7A 1XZLA 1CUSA 5LLSA 3TJMA 4X3CA 3VJLA 5FV4A 1UOPA 5CH5A 1XRRA 2CEKA 3O9VA 3AILA 1ZOIA 5AM5A 2JIDA 2C58A 1L7AA 2X76A 1F6WA 4G8BA 4QZVA 4DNOA 3BXPA 4DGQA 4QDZA 2XUQA 4EHBA 4KAAA 4WY8A 3OPMA 4B85A 1MNQA 4KE9A 1H2ZA 4ETWA 4B0OA 2Y2UA 2VT6A 1PFQA 3A2NA 1J06A 2WIFA 1TIBA 3H0CA 3PF8A 4J3JA 4BRSA 5ALWA 1LBTA 1FFDA 4G9EA 4C87A 2J4FA 4K5QA 2RAUA 2GYVA 4ZV7A 1UT6A 4NZZA 1N1MA 2OAGA 3E3AA 1I6WA 3AZQA 1CQZA 1AMNA 2BAGA 3HI4A 4FBLA 3F9CA 4PNZA 5AM2A 3DD5A 1CUHA 4BC1A 3O4JA 3V1NA 4D9JA 2X5XA 1C7IA 1ORVA 4J0IA 3VVMA 2VATA 2YYSA 1WM1A 2XUIA 1Q84A 2C0QA 2QZPA 3ZWQA 3U0VA 2VJCA 3W9UA 3R0VA 4KACA 3FYTA 3C8DA 1CPYA 3L1IA 5HZGA 2VT7A 5ALNA 2GYWA 2PUJA 1BN7A 3WWEA 2CMFA 3C45A 4H7KA 4FLFA 4BAZA 1LPOA 5FDFA 1W1IA 2XUAA 5CT8A 4QEKA 3WK6A 2C5GA 1EK1A 4ZV9A 5K3FB 3SK0A 3DNMA 1B41A 5AKYA 4W1SA 5HKBA 2ONCA 4JYPA 4UFPA 2O7VA 4J0JA 1KEZA 3G02A 2CUTA 1R9NA 2OGTA 4HVTA 5JAHA 4L9AA 2IITA 3OM8A 4U2BA 1DT5A 1THTA 2HA6A 1XQWA 5E2IA 3HZOA 2JGIA 4HZGA 2PSEA 3AIMA 5JARA 4HXFB 3ZLTA 3LS2A 1BE0A 4GWLA 4M0EA 1NX9A 1YASA 3C6ZA 5JYCA 1KU6A 1QOZA 5IH7A 3VXKA 1JJIA 1QJ4A 1E89A 4P08A 4LYDA 2C0PA 4LKOA 1TCAA 1P0PA 1YR2A 3Q0TA 4BVKA 2Z3WA 1XLVA 4BDSA 2WIDA 2WG0A 3E1GA 3WWCA 5AKKA 5BWBA 2W22A 4B6GA 1XFDA 1EDEA 3FYUC 4Y2YA 3QH4A 1HL7A 2AJLI 4ARBA 1QIJA 4FDMA 5C8XA 1XRLA 4BB0A 5JANA 4PSUA 1HQDA 1TK3A 2XMGA 5CT6A 1EVEA 4HTAA 5D3KA 4X92A 2G5PA 3WMRA 5C8VA 3AIOA 5HK8A 1DINA 2GBGA 1JMKC 3WKDA 2J4CA 2PM8A 2EEPA 1ISPA 4KR0A 3RK4A 3UMJA 2DQYA 2QR5A 1U4NA 2WUFA 3I1IA 1GPNA 4K6KA 4B7ZA 1A8SA 4JH0A 2AJDA 5HCUA 1A8UA 3C43A 2H1IA 4L72A 3KDAA 1CUDA 1QIDA 2ZVDA 3QPDA 4F60A 3LCRA 4I19A 4Q05A 2OCLA 5AOCA 1UXOA 1LPSA 3W04A 3A6ZA 4A5SA 1YAHA 4U2CA 1UK9A 2JBWA 4Y2TA 4GLBA 4MQLA 2HA7A 3VDXA 2OLEA 5AP9A 3WKEA 3WK5A 5AOBA 5FPQA 1QTIA 4H7FA 4BRZA 3DL4A 1GPLA 3D0KA 3ZPXA 2WFLA 3C70A 3PF9A 4BE9A 2HFJA 3IULA 5D6OA 4AQDA 4MWTA 3SWWA 1HKHA 4DLNA 1IZ7A 3FWHA 3QITA 1CV2A 3D5EA 4IQ4A 1FFCA 1YA8A 3WYDA 4I3FA 1BRTA 3M83A 3DYIA 4ARAA 1WB6A 4DTCA 1IUNA 1DX4A 5JAUA 5EI5A 3G0CA 5DYTA 3W9BA 4DM7A 3O95A 1X2EA 2ZYSA 2XQKA 5BWCA 2PVSA 3QPCA 1R9MA 1O6FA 4MXDA 3CN9A 3STTA 3V48A 2QUAA 4QWWA 4X6UA 1GKKA 3STVA 4XVCA 3WKCA 2PPLA 2XQIA 4X00A 3WKAA 2GZRA 5AK5A 2X8BA 1EA5A 5T4HA 3LIIA 1C7JA 4X95A 1E66A 1XZDA 4HRXA 4GBGA 5DJ5A 3QMMA 1E5TA 3IVMA 4Y2VA 1JFRA 4XWGA 2HA4A 2WHPA 5T4EA 1GT6A 1LLFA 2RONA 5ALLA 4N5IX 1VXRA 1MPXA 5DWDA 4TPKA 5HF9A 3DEAA 5AI6A 1MJ5A 2QOEA 1CQWA 3DCNA 4H0CA 1DQZA 4WFIA 3G9ZA 5CBKA 1QO9A 3DQZA 5A6VA 3CN7A 3F98A 4AB1A 4C88A 3OURA 5JZSA 4QDXA 2OCGA 3VKFA 3F97A 5FOQA 1E8DA 3I2GA 1UOQA 4Y2XA 2WJ3A 2RHTA 2IX9A 1JT2A 1XLUA 1XZCA 1DT3A 2GYUA 4G4GA 3JYHA 4BP9A 3PUHA 1LPPA 1TCBA 3W2TA 1CUGA 4MYDA 4CCYB 1R4ZA 2QKYA 1H2XA 1FFEA 4WDQA 1EK2A 2GZSA 1A88A 4QLAA 5LZ9A 1P0IA 5CXXA 1VA4A 2V96A 4UHFA 4C4XA 4UBIA 5CT9A 3FLAA 4J0CA 2WIGA 4K6GA 1BROA 3LP5A 3D2AA 1EXWA 2XLBA 1DX6A 3M82A 2QUBA 3O0DA 1UKAA 4FNGA 4JYMA 5ALOA 2JGFA 2E3JA 1B6GA 3DJYA 4RE6A 1MX5A 1DWPA 5D3ZA 3WI7A 3TRDA 2VJDA 1HLGA 2WUGA 5EFZA 4DMFA 4PSDA 1ETHA 1XRNA 2DFPA 2G63A 2AJ8A 1Q0RA 1USWA 4CIBA 4QNNA 4H7EA 1IZ8A 1CUBA 1L7QA 1OILA 2DHDA 1G4HA 3FYUB 3ZLVA 2BUBA 2WSLA 2DCMA 1XQXA 4MQMA 5EIAA 3JW8A 2WILA 4UHBA 5JASA 4GI1A 4V2IA 4DMKA 4M0MA 1QIEA 2QTBA 4Q82A 5LZ4A 3D2BA 2HRRA 1TAHA 3R40A 2EDCA 3WA6A 3H2HA 4FLMA 3IUMA 2BJHA 1YS2X 2D0DA 2H7YA 4F0JA 2HRQA 5JD4A 2JF0A 2V97A 3KOOA 1QIMA 4XX1A 3KXPA 3G0DA 3C5WP 3PUIA 4B84A 1R1DA 3WYNA 1XZFA 4FBMA 3G8YA 2CJPA 3FCYA 1GGVA 3L1HA 1VXOA 3HC7A 4BTLA 5LIPA 3C87A 4MYSA 1L7RA 4M0FA 2ACKA 1UOOA 3PFCA 1WPRA 5LZ7A 2HIHA 1SCQA 1ZIXA 3ESBA 3HACA 4TVKA 1CUUA 2OGSA 3F8SA 1IVYA 4P9NA 3E4DA 5EHNA 1QIHA 4WCVA 3CCCA 2ZYHA 5ALPA 4C4ZA 1SOMA 5K3BA 4OB8A 1O6GA 3WK4A 5ALQA 5LKRA 4INZA 3I2HA 3R3ZA 4OB6A 3GBSA 5SYNA 4Q3OA 3ILSA 3VISA 4E46A 2HM7A 4QE3A 5BOVA 3RLIA 1JJBA 5E4JA 2JGEA 4N8SA 2Q0XA 5SYMA 4J0DA 4BAGA 3FNBA 4QA9A 4AO7A 5ALRA 4OU5A 5IVIA 1YSCA 1XZKA 4NVRA 2PUHA 1K63A 3NOXA 5A71A 4UBNA 2XMBA 2VJBA 1LNSA 2AJBA 2XUHA 5CTAA 2CKMA 1VZ3A 4P92A 1WOMA 2XT0A 2OCKA 1XRQA 5AM0A 2ORYA 3R3WA 4EY7A 4EZIA 1QTRA 1LPBB 3D3NA 3WIOA 3HABA 2BUAA 2XUJA 1LGYA 4OYLA 2ZSHA 5ALGA 5HF5A 1UK6A 2QXTA 1VE6A 4BBZA 4CIAA 2OPHA 1IUOA 3EIOA 4PF1A 4IH9A 5AM4A 1UZAA 4H7JA 1GXSA 3FVRA 3BF7A 2RIPA 2FUKA 4QDUA 3VVLA 2I3ZA 4YASA 1QZ3A 3IURA 2Y6UA 4C4YA 3AJAA 5E4YA 7YASA 4X7BA 2DHCA 2VSQA 4J0GA 1YB7A 3HLKA 3WWOA 4UUQA 5ALJA 5LP1A 1TKRA 5CURA 4OUKX 3DKKA 1VLQA 2XMRA 4CI9A 4FOLA 1LPNA 5LZ8A 3K6KA 2WM2A 3BE8A 2QXUA 2Y6VA 4BVLA 2XMDA 1CUFA 2WFMA 1F0NA 3M81A 2OGZA 1EB8A 5FLKA 1SCKA 4BATA 5AI5A 2J3DA 1WHTA 1LZKA 4RE5A 4Z49A 5AI9A 3DS8A 5T4FA 4EA6A 3BDVA 5ALEA 1ZIYA 1EH5A 1XQVA 3QMVA 4JEIA 4X71A 1VZ2A 4J03A 2JGJA 2Y2VA 4N5HX 3AZOA 5AKXA 4PSCA 5D7BA 3STYA 4B83A 3G7NA 3UUFA 4B81A 3N0TA 5HK9A 4F5ZA 3KD2A 1BU8A 1HBJA 3F96A 3S8YA 3AIKA 4Y2QA 3FLBA 3GA7A 3GUUA 1JU3A 3MGAA 5AKHA 3D59A 5LZ2A 4BP8A 3O4IA 5C7YA 3T52A 1X70A 2PSHA 5IVHA 4ZRDA 5KBYA 2DR0A 2HHAA 2PU5A 2QRUA 2WUDA 3WL5A 1UK8A 3G0BA 4TGLA 4P93A 3AUKA 1E3QA 4WJLA 2WU3A 2UZ0A 5HFAA 4G9GA 1UWCA 5AM3A 2C5FA 4C01A 2OQIA 5JZ9A 3RARA 3LLCA 1BCSA 1VA5A 3P2MA 5LKAA 2VA9A 3V9AA 2WFZA 3PDCA 4H7HA 2WUEA 2ECFA 3WQHA 4BDTA 4L0CA 1MX9A 1OXMA 5AHXA 4GEGA 5E4TA 4Q34A 3QYJA 3R3UA 1ODCA 4N8EA 1BCRA 1DWQA 4BVJA 2B61A 1BEZA 3WWDA 2VJAA 5ALMA 3B5EA 2VF2A 4W1PA 4X91A 2VAXA 4G4IA 5YASA 2OG1A 1MAAA 5AH0A 2DHEA 2P8SA 4Q1VA 4X97A 2HL6A 1XKTA 4G8DA 1DQYA 1YS1X 1Q83A 1E8NA 4OSEA 1XRPA 5ALIA 3EQ7A 2OAEA 5C8ZA 4FFVA 4XJVA 2WIKA 4PQEA 1VJ5A 4FTWA 4UBJA 4FMPA 2B4KA 2AXEA 4KAJA 5BV7A 3IIIA 1EVQA 1JU4A 4B9EA 4BCDA 4U2GA 3ZV7A 4UBMA 4GXNA 3N2ZB 4LXHA 4CG3A 1JI3A 1E8MA 3G9TA 4OPMA 3AZPA 1EHYA 1WPXA 1GQSA 5KWJA 3QZUA 2WQZA 2XUOA 1GQRA 5I8PA 1ZJ5A 4B0PA 2BUCA 2QJRA 2J3QA 4QDOA 4UPDA 3BJRA 4QDTA 2WTNA 3WL8A 5AKLA 3BIXA 3ED1A 5AJHA 1N5RA 3E0XA 3PFBA 3A2MA 1BEEA 1ZI8A 3QM1A 3V1KA 2XUGA 3H2JA 2HFKA 4FNMA 4KYVA 3LIPA 2D5LA 3HSSA 1T2NA 4J0KA 3H1BA 1QO7A 5ALUA 2VEOA 2O2HA 3T4UA 1CUZA 5HF8A 1SC9A 5ALXA 3VJKA 5ALFA 5JATA 1Y7IA 4DMCA 4NMWA 4X93A 5FXMA 3BIWA 2ZYRA 3I2IA 5AKGA 4AN0A 4B80A 5LYYA 4AO6A 3FLEA 3S2ZA 3IB3A 1CUJA 1KU0A 5DYWA 3MVEA 4HXGA 4C89A 3BJMA 4QLOA 5K3FA 3WKBA 1X2BA 3ANSA 5K3CA 2XQGA 2WLSA 1XZHA 1AUOA 3OOSA 4YK7A 5A2GA 2QT9A 3H2KA 1MT3A 4XIIA 4FKBA 3FBWA 1Y37A 2BCEA 5AI8A 2HADA 1XRMA 1CUIA 4Y2UA 5ALYA 4Y2PA 2WHRA 5ALKA 1LPMA 3I6ZA 5CW2A 1MTZA 4PO3X 5AK6A 3NUZA 3H18A 1CIJA 1G42A 1CR6A 1JJFA 2CB9A 1ZD3A 1MX1A 3ICWA 4L3WA 1U8EA 1XZGA 3SX4A 5JZBA 3V1MA 2BGNA 1XZEA 5AKEA 2OXEA 1N8SA 4A16A 2XUDA 4AZ3A 4GECA 1XZAA 4BE4A 2ZJFA 3EF3A 2PBLA 1W76A 1S8OA 1QLWA 1SFRA 4G8CA 5ESRA 4LYEA 1C4XA 5ALVA 2LIPA 5JAOA 4G1FA 4KRYA 1G66A 1DTEA 1MO2A 4BAUA 5IVDA 4OU4A 3WK7A 1U65A 5HQ3A 1RWQA 2H9YA 1GKLA 2XMSA 5JADA 5AKIA 4WY5A 4ZREA 3W06A 1W6RA 2PKYX 1W52X 1NU6A 1QIFA 5JAPA 4BZZA 3PE6A 5K5EA 1CUYA 1TRHA 1HDEA 4GDMA 2O2IA 1TCCA 4IH1A 3ESAA 2XMQA 1EDDA 2WTMA 4AMYA 3RKSA 2ROQA 3STUA 4BYMA 1THGA 1GPKA 5ISMA 2HA2A 1FFBA 4J7AA 2WHQA 4EY6A 1J1IA 2WKWA 1ODTC 4DSAA 1CUWA 2QMQA 4DNQA 1R88A 1QIGA 2WFLB 3X3HA 3R41A 4CCWA 3ESCA 4W63A 1R50A 4G5XA 4C6HA 4AO8A 2O7RA 2QVBA 5A7FA 3WL7A 3WL6A 5F4ZA 4UHHA 1UFOA 5FUMA 5EIHA 1EI9A 1XZMA 1ZJ4A 5ALSA 2BGRA 3O4GA 4UBOA 1MU0A 5IVKA 1W4LA 1AGYA 4KE7A 4KEAA 1IMJA 3H1AA 1XKLA 2JEYA 3WIBA 5H3HA 1P0QA 1RYYA 5AM1A 5CRIA 2O2GA 5CH8A 1G5FA 4U2EA 3GROA 1MNAA 2PX6A 3ANTA 5CXUA 2BKLA 2OQVA 4EY5A 1YA4A 4W1QA 5T4BA 3O9MA 3I6MA 3L1JA 2BFNA 4UHCA 3OTQA 1ZD4A 1XLWA 1RP1A 1XZBA 1XZIA 1MN6A 5FRDA 1QIIA 2YASA 2Z5GA 2H7XA 4WDRA 1ZD5A 2WHPB 5K3AA 2WU4A 3QBJA 3STWA 3TEJA 4EB0A 3DKRA 4U2FA 1A8QA 4WFJA 2PU7A 1WHSA 4EY8A 1ORWA 3B12A 4X90A 3HYSA 1SCIA 4UBLA 4AZ0A 1H23A 2DSNA 3PICA 5AI4A 1EINA 3FCXA 2PSFA 3IBTA 2RGUA 5AI0A 5CH3A 3C8HA 3OG9A 3H2IA 4WFKA 3FOBA 5DYYA 4EBBA 4FLEA 1LPAB 3HJUA 1TQHA 2XQFA 3FSGD 2PSJA 2OCIA 3D2CA 3FSGA 5C81A 1K8QA 4DYHA 3RM3A 5AKJA 3G0IA 6YASA 2Z3ZA 2ZYIA 3DDUA 4B9AA 5K3DA 1QGED 4AXBA 4CCYA 4O08A 2V98A 5K3EA 4NS4A 3BWXA 3H17A 1ACLA 4FHZA 3EBLA 4Y2JA 1P0MA 4PV7A 5JALA 4UHEA 4Y2SA 5CT5A 1UKCA 5IKXA 3D4LA 1JKMA 1ZGCA 3R3VA 3R3XA 3AINA 3ICVA 1F8UA 1K6EA 5EHZA 4UHDA 4E15A 2CZQA 1CRLA 5ALTA 1MAHA 2G5TA 4RGYA 5EHQA 4BC0A 3STXA 2QM0A 5DNUA 2HA0A 1AC5A 1LZLA 3K9BA 2I78A 3BL8A 2Z8XA 4BCCA 3PI6A 1ODSA 4MEAA 2WJ4A 4ITVA 3G9XA 4DMHA 4IHAA 1IUPA 3FYUA 3HEAA 4IH4A 1DU4A 2Z8ZA 2HA5A 5ALZA 4H77A 3GZJA 3EQ9A 3SC2A 1FFAA 4MJ3A 5JD5A 1Q0ZA 4KAFA 1D07A 4I4CA 1WB5A 4QWMA 5DTJA 3HRHA 1JMYA 1N5MA 3WA7A 5HQ3B 5A7GA 1VOTA 3H04A 2I03A 4HAIA 3A70A 2V9ZA 2HA3A 5J3JA 4E14A 2ES4A 5AK3A 5JIBA 1EDBA 5A62A 3WZLA 1AZWA 4H7IA 3QVMA 5A7HA 4YPVA 5HF6A 5EHXA 4K6HA 1GZ7A 3G0GA 2Y1KA 3C6YA 4YX9A 3ESDA 1HPLA 1ZICA 1QFSA 1CVLA 3IUQA 3C6BA 2JGKA 2R11A 4CG1A 1CUCA 3BDIA 2VTVA 4Q3KA 1AKNA 4UBKA 4AN1A 3DLTA 4KE8A 1ZI9A 2C4HA 3D7RA 1YB6A 2B9VA 4H35A 3FAKA 2FJPA 4OYYA 3DOIA 1H2WA 1J07A 2WJ6A 2B20A 4AMZA 5EGNA 1ZGBA 2XUFA 3U1TA 4X6YA 4MWSA 3AFIA 2JGMA 4DSZA 4HRYA 4K2AA 3IUNA 1XROA 1CUEA 1YAJA 1F0PA 2XUPA 2C7BA 3I2JA 3H2GA 1CUVA 4EY4A 1R3DA 3MUNA 3BF8A 1WCYA 2XMZA 2RI6A 4DIUA 5KWIA 4JNCA 2FX5A 2XLCA 2HU8A 3W05A 1T4MA 4ZXFA 5DTIA 4OD0A
chains in the Genus database with same CATH superfamily
4L2IB 3ZLBA 3SR3A 1ZS9A 5LQSA 1WBBA 1KJZA 1N32B 1YCDA 4NMXB 5G3YA 3FFTA 2XCTB 1ZR2A 3RTEA 4N5DA 2GWHA 1XZNA 2XNKA 3ZEIA 1I3NA 1OCEA 2JGLA 3JQCA 3QE3A 5AK4A 4QOHA 1YR1A 5HFNA 3WZMA 3L8ZA 5BUZA 1JIQA 4CETA 3L4BA 3K0FB 3NJRA 2C94A 4M55A 1CUAA 2CXSA 3MERA 4IICA 4C7KA 4DLWA 2KX7A 1ZD2P 2JAHA 5IBPA 4D3XA 1AQLA 4BFSA 4BTVA 1F2VA 3WLAA 2OP1A 3HWSA 2D2XA 1JDPA 2NQTA 4JR0A 1YULA 4EATA 1N0WA 3ESXA 3MRSA 3VZPA 1AQNA 2POCA 1OLSA 1W5FA 3MFQA 3BMQA 3RC2A 3AEXA 4EFMA 1U0BB 2LNDA 4GRAA 4TROA 3P96A 3ZX5A 4IO0A 1AHNA 3RHFA 3L6OO 1M8KA 5FOSA 1F9EA 1H85A 3WLSA 3A9VA 1GXSB 2K5UA 3OU6A 3M8KA 4KZPA 1S01A 4B32A 3TAHA 2A2ZA 4RF2A 5FPPA 5KREA 3JQQA 2QNBA 2JPDA 4YP0A 2J5XA 1EESA 2FN9A 5LUAA 3S5UA 4UVIA 2PDAA 3K1TA 2R4TA 2Q27A 4N65A 4V3BA 5HXAA 4CMAA 2RG1A 4L22A 3UAWA 4XM1A 3VAAA 2Q6KA 1OI3A 2H1CA 4N0DA 3CF4G 1ADBA 3E4CA 1CBUA 4B6JA 2H54A 5BN3B 4DWJA 1DO8A 4TVBA 1E61A 1RM3A 4I7EA 4ZRNA 3QKTA 5AW3A 4LIPD 4KNYA 1MAWA 1DWOA 4PPQA 2HV8A 3CG0A 4GX2A 1GL9B 1PFKA 1BJRE 4GHWA 4YS6A 4N48A 2VZ9A 4B31A 2COUA 1PIWA 2HDWA 2A1TS 2FJ0A 3AOEC 3F67A 2LDBA 5LQRA 2HQRA 4R0VA 1K5PA 4QTZA 4UJ5A 4MI3A 2FKNA 4UAVA 4WY2A 4XPIB 2WJGA 4YREA 4DG9A 1DFIA 2CYAA 1FUKA 2RBKA 3JQGA 4H1VA 3OJWA 5CM8B 2PBZA 3WJ2A 5JPCA 1VKJA 3SLRA 2ZJBA 5KNDH 1VYTA 3A6PC 1JG1A 2JZCA 3AW8A 4HXEB 4JP8A 4B82A 5JRDS 4IIEA 3RVRA 3MBOA 4J8PA 2VTBA 1UKBA 4M9ZA 1NBMA 1JR4A 2IJGX 2PRJA 1P1RA 3DXXA 3QLVA 2BMWA 2RGDA 4GPTA 4G0UA 1E59A 2DWPA 1WHTB 1J9EA 1RWBA 5TX7A 1V7PC 1P18A 1CY1A 2Q3HA 4U2DA 2PEZA 4CHTA 3TZ6A 5KTRA 3PXXA 2OO5A 3IDAA 1OH8A 1CQPA 3RK0A 3H6HA 1TRKA 2LZ0A 1FSFA 3TTSA 1T6ZA 3WAKA 2OGWA 3W6OA 5CLHA 1YOBA 2GKGA 2WG2A 1LI5A 5J63A 1VB5A 5FBRB 3AVPA 5IC4A 2ZJ1A 3MCAA 1S8AA 4N54A 3USZA 4CE6A 4RKWA 3RVPA 3MF4A 1SUEA 1VHTA 4W9RA 2QG4A 4LNUA 2I67A 1OA0A 3D8NA 1HNNA 4IQFA 3W5IA 1VPTA 2Q3FA 3CUKA 4DXAA 3OP1A 3HJBA 1PR2A 2PR7A 3CPSA 3LU1A 5FOTA 2ORVA 3HXKA 3O0TA 4A8PA 3WR5A 4DM4A 5C8DA 3ZGNA 1U7PA 3RUCA 1MG0A 1WTAA 2C4WA 2PH5A 2PKQP 2M6KA 1RQ7A 2R1TA 1U99A 2PMDA 3QX8A 4W1RA 3W5HA 1ZN8A 2V7XA 3WK8A 1GRNA 3NPAA 4MEBA 2EKLA 2RK6A 5JAMA 1TXGA 2YXPX 3UXMA 3OFJA 4E11A 1LBQA 4I6JA 3H5NA 4FN5A 1GLVA 1GRCA 1SUAA 1RXIA 2IIVA 2ZE5A 5C8YB 1K7YA 1GTRA 1NMZA 1ZJJA 4M4SA 2B98A 3MCVA 4C4TA 1DNPA 3VJRA 5EIXA 1FDOA 3MLBA 1O87A 2G9QA 1MC4A 1JWLA 1TT7A 4FU0A 3D3KA 1D7OA 1Y7HA 4DR7B 5C4IA 2FMKA 1QGYA 1QIKA 5F3RA 5SZHB 4KIFA 1YR9A 1UH5A 2FSVC 2FRDC 3PDJA 4NYJQ 4O4JB 1EX9A 4OQZA 3O2JA 3UICA 3QXCA 4LJAA 1CIVA 2AFIA 1P17A 3V7WA 3UA4A 1XTRA 2KLBA 1QVAA 1J20A 1RP7A 2WU1A 3GLGB 3RSHA 1PSWA 2R1ZA 1N8KA 4FEYA 3GLFB 1KP3A 1V9CA 1K06A 2KYRA 5HJEA 4BX9A 4NIMA 2H7CA 4N8DA 4DLUA 4Z6KA 6Q21A 3UBMA 4QECA 3WGNA 1X8KA 2Q4DA 4WKBA 3GNQA 4OYHA 4F11A 1WMDA 3GLKA 5CA1B 4D44A 5C8YF 2GM4A 4S0XA 3ZGVA 2WWHA 2J07A 3C3BA 4B73A 4A8JB 1BFDA 1MVLA 2WSMA 3F6BX 2ESRA 5ANRB 1NG1A 3RIGA 2VAPA 3G9UA 3CLRD 4YT8A 3UKJA 1JZTA 3AUTA 3ZE8A 5A5DA 2JD0A 4FFBA 4PFKA 1RYFA 5F2KA 3SHOA 7GPBA 1RCUA 1OX4A 1W75A 2I3DA 2Q50A 1WP4A 1M2VA 1P4RA 2J3HA 4FHCA 4O4JF 4G09A 4RYDA 2HLHA 2GNOA 4XGRA 3PNOA 3PDUA 1DOHA 1SK8A 4TRJA 2E48A 2PS1A 4AL4A 3TL3A 3MIIA 4I5GA 2WUVA 5C35A 5JBQA 1Z6AA 1VE7A 1D4OA 2O54A 1V1JA 4YRFA 2G7ZA 4P54A 1LJUA 2P3SA 3DCYA 3R3YA 3E5NA 1PR1A 1ZH4A 4NX2A 5AUQA 3V8MA 5HKAA 3NJ8A 2I7TA 2G5GX 1CK4A 1FSSA 1M8GA 2IUSA 5KYUA 5DBGA 4XM0A 3UHFA 4DR1B 1QVZA 3OT1A 1K4MA 5CA1F 1Y6JA 5AIAA 2ZR8A 4JCCA 1U63A 2H9AA 4Q9LA 3AR6A 4HGQA 4A7PA 1RC0A 1IOVA 4YJHA 3MIZA 1IRXA 2QSZA 2ZYGA 1F4PA 2XKBA 3EFEA 1DAGA 3DVRX 3GY0A 4HBGA 4URYR 1DEXA 8OHMA 1N0VC 1TW3A 2YH2A 4OGKA 4TV8B 2CKDA 4Y7DA 2Q1UA 3T7SA 4X6XA 2ZUDA 4BMZA 2HCJB 5JROA 3O8NA 5DNVA 2QRGA 3V2GA 2VCEA 3C5VA 1JA0A 1W4RA 3RV4A 2XCSB 4CFSA 3GFFA 4IRUB 1KHHA 1U2GC 5CA0A 5FKJA 2GJ8A 3I2KA 1SXGA 2LPMA 1BSVA 4UOQA 4MUMA 4B3HA 1UJ6A 1QFMA 5FYQA 4E03A 5IJZA 4M9RA 4GXQA 1HFJA 3PDIA 3QKSA 5C7LO 1BG6A 1P0FA 4D98A 1EXMA 5EP1A 3DHNA 4D8VA 3QVLA 2HJSA 2VHXA 3E5HA 1ULUA 2F9FA 4JT8A 3KU1A 3HJNA 4G84A 4YMHA 4WZAA 2G5CA 3TJMA 4X3CA 3D6JA 1FP1D 2ZLBA 3SEAA 1B43A 2AQHA 2MU1A 3CSDA 3OJXA 2IW3A 4ZYZA 3DLAA 2XUZA 5JE8A 4I1YA 3AHCA 1EPUA 3D2LA 4YT2A 3KVRA 1EUDA 4TV8F 2OZVA 5AM5A 3ZJ5A 5IDQA 1SB8A 2JIDA 3FRHA 3SNKA 3K6SA 4C3UA 1YRWA 3ZXSA 1Y81A 3TW0A 1JILA 3A6LA 1RBZA 3GFOA 2BFAA 4G8BA 4MKXA 1N7GA 2WQ7A 3BG5A 2W4QA 2D5CA 2IDJA 3PXDA 4XW2A 3WBFA 1YGPA 4LC9A 4CEHB 1JEQB 2OFXA 3OPVA 3AWDA 1UJ4A 3WB0A 5EJ6A 5A4KA 4X54A 2HX1A 1K08A 1IJBA 4WY8A 1MNQA 3L0PA 4OHBA 1TCUA 3PPWA 4HWSA 1A2QA 3LDFA 4DG8A 2XZTA 2XAUA 5A4AA 2VUTA 5BUCA 1TVEA 1Z5PA 2X1LA 2ERCA 3R5KA 1N0IA 3T3EA 4FHFA 4NH0A 1KFJB 4YHHB 2GCEA 2X22A 4RFLA 2QD5A 2FEAA 2PUCA 1CXZA 2DPLA 3KWMA 2ZB7A 4FFOA 1ECFA 3AFMA 4PPYA 1RHUA 4OHXA 4YT5A 3T6KA 1XU7A 2IUEA 3IMFA 5ALWA 3T7JA 4B4KA 1YL5A 1V6AA 4OUDA 2I2DA 1RJGA 2JVIA 4F71A 2WLTA 3TUZC 1HZZA 4DN6A 3HB7A 2J4FA 3QXGA 1TM1E 4LF5B 2G72A 3KEQA 4NLLA 2VOJA 4AJIA 4EBFA 1FL9A 4MQFB 3TSAA 4MAAA 1VHJA 4BVGA 4ZV7A 3O8CA 3AUXA 1U7XA 4NZZA 1SOUA 2Q3JA 2I8AA 2OAGA 2Q41A 2IYAA 3E3AA 3H9QA 2DY0A 3A14A 3N2KA 3SLKA 5JCXA 4NBRA 1I6WA 1R5BA 5THXA 2XEXA 3IUPA 4C0BA 3WV4A 2C7OA 3V4OA 3F9CA 5EJ8A 4YJDA 2GCGA 3MJFA 5JZOA 3OIGA 4I46A 1W1WA 4LOAA 3V1NA 1SVLA 2O9JA 4F4IA 5AVSA 3BT7A 2HC9A 4V0RA 2A5FA 2ZKIA 3GYBA 4XB1A 1ORVA 4J0IA 3DBOB 4JQZA 5JC8A 1BKYA 3DL2A 3S2UA 2YYSA 4DR5B 2LDXA 3NXSA 2BGWA 1Q14A 3G88A 1OI7A 3WZ2A 1WM1A 3KQKA 2RIRA 2QZPA 4NXNB 3IDOA 1HDCA 3DVAA 1FDWA 1KK0A 1SQSA 2C5BA 2BT4A 3PC7A 4I14A 4M1SA 3U0VA 1R74A 5BURA 2BCGY 3WGMA 1TK2A 1QMPA 5JAZA 2W8BB 2VJCA 1R8JA 1XA3A 1TZJA 3W9UA 1RRGA 1U9CA 2PQ0A 1JXQA 2JGDB 2M6RA 4S2UA 4ZCQA 4PU0A 3FYTA 3IQGX 4S1PA 3BJEA 1WXXA 1CPYA 3O2NA 4FC7A 4GG1A 4JR1A 4UU8A 4WERA 3RC1A 1X15A 3BUSA 5FO1A 3L1IA 2G8LA 1EIWA 4LHVA 2XHEA 4RZIA 3FCAA 4D25A 5HZHA 4ITRC 5LB4A 4C08A 1X1DA 2YXBA 1K4KA 3HR4A 4RA9B 3TDNA 3C45A 3TKLA 3WDSA 3ZIAA 4EUEA 5EVCA 2H4WA 4YV7A 4UCWA 3NV7A 4G1MB 2O2SA 3RSGA 4E31A 4HG2A 4I50A 4KMOA 4FD3A 4YRMA 3GRRA 5CFMA 2W2MA 1JPNA 3HN2A 2O3TA 4HEHA 2A1UB 2BTOA 2VWPA 4JQYA 1G1MA 4RS3A 4U7WA 1OFHA 2X23A 3E9MA 3Q2OA 4GUAA 2C5GA 1EK1A 2NM0A 5K3FB 3OQMA 1ULZA 4D9NA 2P77A 3E2MA 4X1IA 4MV7A 3GC6A 5F77A 5AKYA 4W1SA 1P77A 3DD1A 3KVYA 5TGDA 3A28A 5KVCA 2JCVA 5LJIA 2CMKA 3L8CA 3QKRB 4LI3X 2WIBA 1FY2A 3KVOA 4IIVA 4JYPA 2BBOA 4L0DA 1M1NB 1NRWA 1L7DA 2YZ7A 5K7SA 5HUHA 3U31A 1AK9A 5KPJA 1N9ZA 3VYUB 2QHXA 3N8KA 2HSEA 2QLLA 5DBEX 2HTFA 1P5JA 4XWKA 2CUTA 5AVKA 3NDBB 1EFVB 1MW8X 1GGHA 1G4AE 2UUCB 1GZHB 4AY5A 1F17A 2OHOA 2OCYC 4EAQA 1IAVA 3WWZA 4TS3A 4LJ8A 5EIFA 4M8KA 3LUJA 1MT0A 1T9ZA 1THTA 3B48A 4YDRA 2PJDA 1EYZA 1FLAA 2HA6A 2GO7A 3JYLA 1I80A 5LQJA 1E9CA 1RYEA 5ULLA 4AY6A 2FDCA 2YWHA 1E99A 2IYVA 1XDGA 3E1SA 4HZGA 3GAAA 3HA2A 4TT8A 3VOTA 1M6WA 3I12A 2NACA 3U44B 2YXEA 3JYOA 4JBIA 3ZLTA 4ESHA 2JIPA 2EJWA 4M0EA 1YK1A 3HBNA 3WQBA 4CQJA 2JS7A 3GVXA 4K88A 4PZDA 2H57A 3TBFA 1D2GA 3TJZA 1TTPB 1G8GA 1Z18A 1KOJA 4MTLA 1XQ1A 4C5BA 3EGCA 3I9MA 2PWYA 3PUKA 3RUIA 1YMUA 5KYWA 4DV5B 1MA3A 2AG6A 2AGVA 2ZULA 3VNVA 2BR3A 1JJIA 4HB0A 2PKRA 5FWAA 1G8HA 1QJ4A 2G7MC 3I30X 1XOIA 4CR6A 2I3GA 4ND4A 1YRLA 1EMDA 1Y5IA 1E1RD 4RETA 2I34A 3H5RA 4KXNA 4TM7A 1P0PA 2WBLC 4R31A 1AV7A 1FVHA 2FY8A 3DE3X 3PUJA 5EZSA 1RIIA 4BVKA 3UQYS 1UBSB 1NW7A 1N6RA 3DKPA 3IQFA 4C03A 5ADUS 3J80A 3W8FA 1XLVA 2I6QA 4CHGA 3ZNNA 1A7JA 2EWMA 2LTAA 2WIDA 3A4IA 3ITDA 5FUXA 1NSYA 2D1TA 3WWCA 1HOTA 2R85A 3GNTA 2C20A 3E9EA 4Q93A 3L0OA 3ZV4A 4ECAA 4QG3A 4CLRA 1SHUX 1C1DB 2HDOA 1NWCA 2PT9A 4B6GA 1XFDA 5F9HA 2V7QA 4Y2YA 1G1AA 1YR6A 3QH4A 2NUTA 5I7SA 2QYOA 3V5NA 4X3OA 3IVGA 3N5KA 5DLYA 3BHNA 4LTNA 4JP3A 1DFHA 4M3NA 4ZVNA 2O0MA 3ESQA 3KPUA 4GZ3A 3FM9A 4HR7A 1QIJA 1I10A 2QN3A 3VHQA 1NF9A 1QHNA 4P80A 3T7RA 1U28C 1NPYA 2YFHA 5LL6P 3MD9A 2PT5A 2IOYA 1QHSA 1TK3A 4J16A 5FOVA 1F2UA 3E3LA 5EWJA 1SXJB 5CT6A 5F7XA 1P7ZA 3TKYA 3ZXUB 1WCV1 4HTAA 5JXIA 3ZKAA 4B3XA 2VRWA 1E3DA 4MMYB 4XDYA 2BP7A 4X92A 2G5PA 2GILA 5DNEA 4C89A 2IUTA 3HKDA 3R6WA 1FTSA 3UKOA 2XA2A 1XE3A 3NHBA 3DBVO 3MWKA 3EIFA 4IQ8A 5EN4A 5H70A 1FTYA 5J5VA 2WI8A 1IZ9A 1U5CA 2WVGA 3MS4A 4YCSA 1XHLA 3F4KA 2QP4A 2JAOA 3DDSA 5CYOA 3RF6A 3T12A 3AIOA 1JFVA 2WYHA 1NXOA 4MVJE 4RM3A 4TSRA 1DINA 3TRFA 4EECA 1GEGA 1KFBB 3DC2A 3LPAA 4P32A 4ASUA 4YMUA 3JQAA 5G3ZA 4JC0A 2I54A 4HDRA 3BGDA 3OTHA 1JMKC 4ZZ2A 3C3PA 3UK0A 4FFMA 3SKXA 1F14A 2C83A 4Y9TA 5CM9C 3RODA 1U0FA 2DC1A 3HLTA 4EHHA 2XBLA 1NI5A 2EEPA 5AVRA 1ISPA 1RVDA 4P33A 4XVUA 3RK4A 3UMJA 1YTUA 2QR5A 3I1IA 4E15A 2BSXA 5G0VA 5JHGB 4O4LB 1B15A 1SPBS 5TF0A 1Q1ZA 4DGSA 4ZJPA 1B0AA 1P39A 1RU3A 1PTKA 2IL1A 3C43A 4LPSA 4XSHA 2ZRFA 4BO3A 1PW7A 4MNTA 2OKCA 5EZYA 2H1IA 4UD6A 1VE3A 3I73A 3PEYA 5AESA 2D06A 2EATA 3EIHA 3H7IA 1E7RA 5B1DA 3W4JA 1ORRA 5HUQA 4F60A 3PQ2A 7ABPA 2X40A 1ZUIA 3P19A 4Q05A 5KTNA 5MN6A 3FOZA 3ZBTA 3G0OA 1J8QA 1QORA 1UXOA 4KHZA 4X62B 1FPQA 4KWCA 1B1CA 1LPSA 2JKYA 3T3PB 3A6ZA 3CBQA 4Z1MD 1OSNA 1YC2A 4DJJA 2P9GA 3I1JA 2PTHA 2Q8NA 1N2ZA 2FPRA 3WFZA 3VDXA 4YACA 3RYIA 5AP9A 2PYZA 1LF5A 2YMQA 2ZEJA 4NULA 4RLSA 3T99A 4UEKA 3MYYA 4M1YA 3VRHA 3MTQA 3V8RA 5F2EA 2VLBA 5K3SA 4MDYA 1JWBB 1G3RA 1QTIA 1YE5A 3C3MA 5IKEA 1Z2PX 4FGSA 1T9GR 2ILVA 4O4LF 1GPLA 1MOQA 3DSRA 4YCCA 1U0EA 3UTDA 1MJGM 3ZPXA 2YXLA 1WABA 2E7ZA 2WFLA 3JATB 4HMQA 2QVLA 2Z6VA 1DL5A 4I8XA 1CY2A 3WSTA 3VPCA 4EFLA 4EUHA 4G86A 5JYDA 5HG0A 3PF9A 4OREX 1PVDA 4DL9A 2VF8A 5JDCC 4U7TB 5FFNA 4R68A 3JR7A 2AUMA 2GEUA 2HPVA 1G20A 2YY5A 1K0UA 3K5IA 3NOOA 1JAZA 4HPWA 4IV0A 1KSGA 3RVLA 3JCZA 3LLSA 5D6OA 4BMPB 4AQDA 4C29A 1QHYA 4DLNA 2A9OA 4JBYA 2PMWB 5AXBA 3WXMA 1IZ7A 2R7AA 4D0SA 2V0NA 2IKQA 3ENWA 3FWHA 3LK6A 4NMLA 1CV2A 1E5DA 1U90A 1MDBA 2JFNA 6PFKA 1EGAA 1RXYA 3C24A 3O3CA 1DQSA 3R5FA 8ABPA 1APBA 3BREA 4ZI7A 4XR4A 1OA1A 1FFCA 1VHWA 4JGIA 3GNLA 3J81A 1J9GA 2NOAA 6LDHA 1DKQA 2MDTA 4HNHA 1E2IA 3WYDA 1EP1B 1J09A 2V8OA 1ZVJA 3M83A 1JAYA 1T0HB 2ZI6A 3DYIA 4HI0E 1WB6A 1H0HA 4IEFB 4N0PA 4NV0A 3UH0A 3WNBA 3I6IA 3OFKA 5JAUA 4AKIA 4L08A 2DKNA 3MN1A 3K30A 1YVUA 3FGOA 4IVPA 2VXYA 4RADA 2PMBA 2O6LA 4QEDA 1Q1EA 1WWKA 3O95A 4IDAA 4QXRA 1MIOB 1P0CA 3C3WA 4P4UA 3AETB 4ZTBA 2I29A 1T5LA 3IALA 2WAAA 1L0BA 1MB0A 5JPDA 5FBQB 1XEWY 2LBPA 3WRVA 5BWCA 2VNHA 3QFCA 1HURA 2PVSA 2WWXA 1CZHA 3ZXIA 3QPCA 2BTQB 1O95A 4Z9XA 4N76A 2BEVA 2FR8A 3JZAA 2F55A 1X1CA 3FA2A 3LC1O 5DBHX 5K09A 3WMEA 4NFLA 5IPFA 3STVA 4R8MA 5HJ7A 3WKCA 4WSOA 2PEYA 3SQLA 5C1DA 1DDIA 2WOOA 3DCIA 4J7XA 4WCFB 5B1SA 1JHPA 5TEWA 4X00A 5HOEA 4D8TA 1T0BA 1Y3HA 2GERA 2PLFA 1IQ0A 4MVJI 1QPZA 3ZC3A 2PUDA 3LNCA 1KARA 4FD2A 4N3CA 4PYLA 2RH9B 3GGOA 4XYMA 3SXJA 1C7JA 3RFCA 3ZU3A 1NKSA 3OAAD 1E66A 1VMEA 2CZCA 2IS6A 1CZOA 4IMJB 1PJ4A 2WE7A 1M2OA 4HRXA 2P9FA 1U81A 4LSZA 3D7LA 4O29A 3FWKA 5FFMA 2R1VB 1KC3A 3QMMA 3IVMA 5DRTA 3VDQA 1VP9A 4IIJB 4EUNA 3KJZA 5IU6A 5K3OA 5L6MB 4U00A 4PYIA 3I53A 5H1YA 1M83A 5T4EA 3W4IA 3C41J 4QOIA 1SBYA 2IXAA 2RONA 2WSBA 3GD7A 4L8VA 4RZ2A 2C4UA 1VKNA 4BO8A 4BNMA 4BO0A 1XVVA 1D6NA 4FS8A 1LLCA 2YUIA 2FSIA 5IUNC 4AJ2A 3QE9Y 1MVOA 3HCEA 1FTGA 1Z8NA 3S44A 4PM4A 1PGNA 4TPKA 3W8EA 1BD4A 4B6PA 3CZ5A 3DEAA 5FB3A 2XVZA 4CM3A 1MC8A 3LBYA 2BZ1A 1RJ9A 4LJ4A 4F56A 1CQWA 3DPIA 3U81A 4B3SB 3FTPA 5IKPA 2HWXA 1K9SA 1XAGA 4R7TA 1X7XA 4KN8A 4WKOA 1T35A 4PAMA 1SHLA 3BVPA 3DAFA 3GPDG 2WWVD 2F9LA 1YRAA 1EZ4A 3H1TA 3DQZA 1VL6A 3EUWA 3L7JA 4IIJF 5A6VA 4X6LA 3F98A 4ZMRA 1BWPA 2EGUA 3D1LA 1CJVC 3TEFA 1P91A 521PA 4UW9A 2ZZKA 5DI3A 4F38A 2CC2A 4WV3A 4M1EA 4AECA 3A1SA 3GZNB 2VK8A 4QDXA 1AV6A 2QNIA 3IBSA 1B2RA 1TM5E 1PZFA 5H4GA 1ZH8A 3DTVD 1T5IA 5AMXA 4BYGA 3T41A 5CB8A 2ZT8A 5BMVA 2YFQA 3P9RA 1Z6XA 4II2A 3FXAA 2ZE7A 4RF5A 4UAJA 4BNLA 1L5FA 1W96A 2WJ3A 2ZK7A 2RHTA 3RBAA 2BM1A 4KVZA 1X1SA 2Y1WA 3KHUA 4L4ZA 4IIDA 2YBDA 5G4KB 1MG5A 3CF4A 3VH4A 5DHPA 2WWIA 2IC5A 4NE7A 4B71A 1GLNA 2FOLA 2ID4A 1R0SA 2OP0A 3VYSB 1Z2OX 5J2UB 2CL5A 2FPGB 2IYXA 1N6OA 2YN4A 4XTRA 5H68A 3IDZA 4Z4EA 1KKLA 1UMBB 4M76B 5IJ9B 2FE1A 3PUHA 1LPPA 3P9YA 3HRKA 3QLUA 3TQOA 1TCBA 3HJRA 4G0WA 3EVEA 1STOA 4KODA 3W2TA 4FGUA 4HDNB 1U3GA 3B5JA 4H1HA 4XQGA 2OFOA 2ZJ3A 3EDMA 3MLAA 4G0YA 1U0SY 3FGPA 2BV3A 2GEFA 1KP2A 1SG0A 3QELA 3GAMA 4L51A 4DBVO 1G3UA 1IN4A 2F43A 4O4IF 4URVR 5IJWA 5LZ9A 4S05A 1H8EA 2DUJA 3C3KA 4J7UA 1GPH1 1K7CA 3VC1A 2BL4A 2XIJA 2XB2A 1V6SA 3D6NB 4JBNA 3EEOA 2IUFA 4LYAA 4UBIA 1O97C 5CT9A 1C30A 2ZU6A 3FLAA 2J3MA 3A2KA 4K9SA 4DV6B 2V7GA 4D6PA 1FJXA 3RU9A 2HHCA 4J1NA 5JCOA 3A4NA 3A04A 4ZD6A 1BROA 1KZ7B 3ZVKA 1ZHOA 4HVCA 5ES4B 5KQRA 4Q5IA 3WIUA 4BLSA 1PX2A 3U6BA 5J2UF 3OJ0A 4WBSA 4KIJA 2R8ZA 2PAAA 1NOJA 2WQ6A 2C5LA 3Q8XB 1ILEA 4GGMX 2A5GA 2VRBA 3ADDA 5IAJA 1OAAA 3N3AC 2LRHA 3O0DA 1G8AA 3OLZA 2J33A 1UKAA 1CQIB 4FNGA 5L95A 2A92A 1Q11A 1O96B 3L41A 5ALOA 2W83A 1UBNA 2CVFA 4EG4A 1UPFA 2GVZC 5C3MA 2E3JA 5ERYA 5CCEA 4MUEA 3LQ4A 1T5SA 4CKXA 1JYEA 2XWJI 1B6GA 3CR3C 3K09C 3MQ2A 3LOUA 4OJNA 4UUNA 4YUWA 1UFRA 5CVTA 3E3NA 4MWZA 2GLTA 1DWPA 2P4EA 3DZGA 2R84A 2JJ1D 3CVVA 4FFNA 1V8PA 3HADA 4FJ1A 4S0ZA 3T61A 3TE6A 3WI7A 3OKFA 3B6ZA 2E18A 1HLGA 2YNMD 1JP7A 1T0JB 1JE1A 2B9EA 2IH4A 1X3SA 4CQLB 1XRNA 1IVNA 1Q5PA 2DFPA 2G63A 5KI6A 1Y5LA 4D9CA 3TM5A 3LQRA 5IW8A 4TLLB 1PS9A 5JY6A 4IOJA 4CW7A 2RHJA 1CVRA 5KOHA 4KR9A 4RWEA 2O8EA 5E6UA 2WEKA 2PO7A 3GN1A 4K3UA 1OH6A 4TYQA 4I99A 4TRRA 1TE2A 1QH0A 4R3UC 1PQPA 2C03A 3S2GA 4JLWA 3T8YA 4RFSB 1IZ8A 2AOUA 2DHDA 2GVDC 2YHUA 3UJAA 1CNFA 5REQA 1II0A 4CM9D 4MUNA 4PY2A 1O94C 2UVPA 4OHFA 1A27A 4X1YB 4ERXA 4NBSA 5JH7A 4TMXA 3RBVA 1YZGA 3W2FA 3GZ4A 4EQ6B 3EGDA 2NXWA 1UIRA 1IM2A 1XQXA 1G21E 1GTJ1 3E2PA 3GEIA 3LUKA 3UN1A 3NHMA 5C5IA 1KEEA 5TARA 1UWLA 3I9V1 2QLMA 4KTVE 3TBHA 4AJ4A 4IAOA 2OQ2A 1LI7A 3F5DA 3FB1A 3PP8A 4PGGA 2PLNA 5I8ZA 3V1YA 4V02A 3OQOA 4WWHA 3OLYA 5BT9A 1W0KD 4XA8A 3D1JA 5BWNA 5AVZA 3KZXA 2WAOA 1NURA 2Q4RA 2Q6VA 4F7WA 2SECE 1VKRA 5G53C 4GXTA 3SIPA 3WA6A 2FPMA 2W6QA 3H2HA 3I52A 2GI4A 4TYWA 1LBHA 1YS2X 2XNDD 1E6EA 1Z6TA 4MWCA 1Y6RA 4N4AA 5JD4A 4R1LA 3KOOA 2QU7A 4Y1RA 2B6NA 3KXPA 4D42A 5KTKA 3G0DA 4JR2A 3U3JA 3V7UA 3VUEA 2DPXA 4C7BA 4HNVA 1YCFA 3C5WP 2IU0A 1GN9A 1YS9A 4P3KA 4TUYB 4EA8A 5F23A 3HL0A 3TZBA 5EIWA 4BQEA 2JCYA 1NJ5A 1N3BA 1PAUA 1JECA 1MV8A 4B84A 1R1DA 2I5PO 2VPTA 2XSZD 1G38A 3FCUB 1YIDA 2YHIA 3HCNA 3RUEA 5E1BA 2PE5A 1H94A 3FPKA 2JZOA 2IEAA 2EL7A 3IXQA 3MS7A 4WE3A 1L6RA 5TGZA 5KMGB 2FPOA 2Z0MA 1A8IA 1V16B 2VYND 3L9WA 4CVNA 4DUPA 4ZQFA 1GGVA 5I4KA 1KWKA 3T1TA 4QL3A 3UGJA 4XX0A 3L1HA 4Q4HB 4ESEA 4P7GA 1Z7YA 1U1IA 2YX1A 5FPTA 1OIVA 1EX1A 4EGJA 4MW5A 1XWWA 2O2XA 3DV2A 5KQSA 1BHSA 2E1PA 4YMVA 1VYHA 4EG5A 2ACKA 4W5TA 1MO5A 1R0RE 2FN4A 3PFCA 1KS2A 1ORIA 4NFYA 1KK1A 1NATA 3UZUA 3G3EA 3WRYC 1WPRA 5B3LA 3MLEA 1R6XA 2HIHA 2H63A 3ESBA 3HACA 4TV9A 3S2IA 1Z75A 4TUYF 2Q8QA 4LQCA 3EVBA 1L8QA 2C2KA 5HS6A 3SZ3A 4GBMA 3UTCA 2WE8A 1SXPA 1V43A 2RB5A 1CQJA 4CV2A 3CZ4A 3F8SA 1ISRA 5JBNA 1IVYA 1JEDA 1BE8A 1BX3A 1GPAA 3ILHA 4JGBA 3QVKA 4Q4DA 4Y6QA 1HRKA 3BMOB 4RIIA 1JJ7A 5SY6A 4ATNA 5IHXA 1ML4A 3EG9B 4UTOA 4WCVA 3D4PA 3L7OA 1Y80A 2ZYHA 1I01A 3FYSA 5K3BA 3KR9A 4REOA 4C4ZA 1SHZA 1MO6A 2BFPA 3NIDB 4MKRA 3WBBA 4DDUA 1YZTA 4MHSA 5ALQA 5K0TA 3NFYA 1F7UA 1C7QA 4FINA 1SQ5A 3RRMA 2O2ZA 3GBSA 4GRDA 3K71B 3L6UA 2GPNA 1R4MA 2XGMA 1CY6A 1V8DA 4EG8A 2F3PA 3OQHA 3QFSA 4E46A 1DG3A 2HM7A 5I7RA 5KU7A 3G68A 4QE3A 2R5NA 4KN9S 3NV9A 4L5BA 2AFHA 1O0CA 1KZ4A 1L1FA 2H0RA 3RS0A 3CB2A 3C3DA 4N8SA 3OO0A 4Q3CA 1OVMA 2Q0XA 1QKKA 3W6NA 4B3IA 4B3JA 3NNDA 1ZC3A 1TOAA 1NBME 1ZIPA 3M4YA 3MRXA 3BB4A 1RQGA 3LX6A 2BKEA 4RA6A 4MW0A 4EITA 1I2DA 4ZO8A 3AK4A 4CMEC 2GA8A 1KFCB 3CUTA 3LT1A 4LC0A 1NIJA 3UCFA 3UMYA 3ZKWB 5TPWA 5KHLB 3CNQS 2ETVA 4K87A 5ITWA 5IT9A 5UKDA 1O8CA 1VZ3A 2YQZA 3VR5D 1ZRSA 1I9GA 3JAKB 3W1VA 2C8JA 3BXZA 3HJCA 1KH1A 1AUXA 1RRMA 4L2IA 3W9SA 1XRQA 2F1JA 5A6SB 2GBLA 2TMDA 3C97A 5DTRA 4PR0A 1KKMA 4C4SA 2QGFA 3B6MA 2WMNB 1Z0UA 1DBRA 5TT0A 1VL1A 3PHLA 1QTRA 1UZMA 1MMFB 3T1YB 1LPBB 2AQIA 3K0FA 5DHRA 4XCXA 3RS2A 1GOTA 3F0TA 2NZUG 2O7QA 3G9QA 4H2DA 3C3YA 2DR3A 2HCRA 4FMDB 5ICMA 4MO9A 1F7VA 1KPHA 3UC5A 4YO8A 4RANA 3II6X 4OLBA 2JK0A 3IERA 1A3CA 5ALGA 5HF5A 1UK6A 1WD7A 3WNCA 2XB4A 1PYDA 2MYPA 2OUKA 4FQ8A 2DGDA 4R05A 4LFAB 1IUOA 1GSOA 2GZ3A 2PWBA 1H6CA 5HKLA 2X3UA 3HDQA 4PF1A 1ECPA 4F2WA 5M29A 1EFDN 3P0IA 3UXYA 1JMVA 1QQTA 1UZAA 2QZ9A 3K53A 4HB4A 5IC6A 3ZS8A 1GXSA 1YL7A 4B8WA 3N07A 2JLYA 3RS4A 2D7DA 3Q12A 3QP9A 4UTVA 3BF7A 5JMWA 1F0YA 4LCBA 4RH3A 5E3IA 4B4WA 3VVLA 2M6SA 3JPYA 1JIJA 3EZ9A 4RZHA 4PLGA 4B79A 2OPBA 3BSFA 4QPCA 4D4KA 1X77A 2AEJA 3KJFA 2SKCA 2Y6UA 3BXXA 1Z2EA 1NUUA 3ZW8A 1BWRA 3HDJA 4C4YA 1TADA 3S40A 3M34A 3AJAA 4FMDF 5P8WA 2AFIE 2P2NA 4QBGB 1XCMA 1HM5A 3GJSA 4YCJA 2OHJA 4FQ7A 5L9AA 4QHSA 4ZQIA 3KZVA 1XTTA 3N6VA 3RAPR 3ZBPA 2DHCA 4WW0A 2HDHA 2VHWA 3NCTA 1PR0A 3KKOA 1DE0A 4ZQGA 3DBHB 4DLYA 5EFOA 1RBQA 2UYCA 5GV8A 1JVSA 3ANLA 3BA1A 4EHLA 5ALJA 3SJZA 3TM4A 1CDDA 2PS9A 1TKRA 1OGJA 3WLRA 3TECE 1LLDA 4OUKX 4RU1A 1L8XA 3UO8B 3F9RA 3HK2A 1H2RS 3RWOA 4CI9A 3EY9A 3PC8A 4OSPA 1LPNA 3K6KA 4QOJA 5BV0A 4EH1A 4XPIA 3L0ZA 2PGLA 4OVKA 3RADC 8GPBA 5K0NA 2P9ZA 2JJ8A 4JQCA 1ZAKA 4IJUA 5DGTA 2CLFB 2WFMA 1JG7A 4PG5A 3RIMA 3BK2A 1QCYA 2Z4RA 3KXKA 1VJ0A 5CVJA 5D3QA 3UJCA 3RVJA 5DZSA 4RSRA 1RQ2A 3GWGA 5FLKA 1SCKA 2RHLA 1Q7CA 1JYFA 1S5PA 5AI5A 4C14A 3OU2A 1WHTA 2XTAA 4RVOA 1JHMA 2BE7A 3GCXA 5LYJB 5EKXA 2YQ4A 3ZCPA 3WB1A 3VZDA 4OOFA 4D3ZA 1KFKB 5IT4A 3X0DA 1DRJA 3JD3A 3ECSA 1CY7A 3BDVA 5GTDA 4LQDA 5KINB 4ZCPA 1MJFA 3EAFA 1GAWA 5ALEA 1DQPA 3G5UA 5HX7A 5WRFA 2CD7A 2RHCA 2J0SA 1DBSA 1YZUA 1CG6A 3I1FA 3NCHA 3COSA 4OQFA 1YS4A 2W42A 4MLPA 5IP5A 1NVMB 2B5OA 2FPPA 2R6AA 4YAJA 1NC3A 4X71A 3Q9UA 3F3YA 2PBFA 4XB6B 4NESA 1JDBC 4M9SA 1C41A 2Y2VA 4GAEA 1MUUA 4K6FA 1BE6A 4LRYA 4NU5A 1JH8A 2NNLD 1T5BA 3RHSA 2JGRA 1U1FA 1FTWA 2JCSA 1R0XA 4LGVA 3UUFA 4B83A 4B81A 1PJRA 5T3YA 5LYJF 1CKEA 4AMUA 3KD2A 3PUVA 4WZAE 1NW5A 2NZXA 3U7FB 3COJA 1R5JA 1M8PA 2KBFA 1GCIA 3QK7A 1MB3A 4PPNA 3VAYA 1FZTA 2IIPA 1J8DA 1KEKA 4IZ6A 1PN3A 1R5NA 4RVCA 5C8YA 1JU3A 3GUZA 5AKHA 5A03A 1QQ5A 4MB2A 1Z34A 4IDOA 3AY7A 1PR5A 3D59A 1LVUA 3FI0A 1IK6A 4FQ5A 3O4IA 4RD6A 4QGAA 4DPMA 3HQ4O 3C2QA 5CBPA 4YIHA 4LE1A 4OP1A 3R5SA 4D3YA 2KM1A 4MDEA 3PGLA 4BU1A 2PSHA 2DRIA 4WXRA 4QO8A 3WLFA 1ENZA 5GZ3A 1T25A 4OATA 4O4JA 5JS1A 5DTQA 1L5OA 2B99A 2JLAA 4C6SA 2HHAA 2YHAA 2B92A 3GLGA 1INLA 1E9SA 5EVJA 3VGPA 2JATA 2WUDA 3VHRA 3GLFA 4EUKA 3DXYA 4TGLA 3I32A 3NHUA 3NPMA 4P93A 4OHZA 1DDOA 3CTPA 1ONNA 3DMPA 1E3QA 3Q9SA 3ZD7A 4MYRA 1RM5A 1UWCA 5AM3A 2O2YA 3GT3A 5CA1A 5AW2A 1SVIA 1XNGA 1GPDG 1P72A 3NORA 5C7OO 4A8JA 1UP6A 4CMGA 1DAKA 3EWAA 1AHIA 1T2FA 2JASA 4DCGA 3CONA 5LMNB 4AN4A 3MTGA 5IHPA 4CGZA 2G6BA 2O0JA 2YJTD 5FHRA 1DJQA 1YDMA 3V9AA 5I45A 3NP7A 1J2UA 5IJ0A 4C7OB 4HAXA 3LQ1A 4H7HA 3BC1A 3LGSA 4OV6B 3VU1A 2Z1NA 5DN6D 1AK1A 2HF7A 4Q03A 4ND8B 4YAIA 3Q4GA 1BAPA 1ZUHA 3H87A 1WETA 1MX9A 1OXMA 1F38A 1AKUA 3HUDA 4CQMD 3FUUA 4MKHA 5AHXA 2HF2A 1D1QA 3W3AA 2J45A 3ZDXB 2ET6A 1NDHA 2P9HA 2H5JA 1HE4A 2P91A 2OHFA 4GZMA 4IV5A 3IKLA 1U0JA 4FZJA 4JENA 3AF6A 5CVDA 2FG7C 1V5GA 1X9HA 4YEDA 4X8MA 4AJLA 3AVQA 2CDAA 2B61A 1ARZA 4GX5A 3CSSA 4D4IA 2OXCA 1XJCA 4AQYB 2CLKB 2P7HA 3AL2A 3DMTC 2QZSA 1RVV1 4GI2A 1RSZA 4P58A 5BMOA 5JMTA 1E6MA 1B7GO 4BECA 4TV8A 4WOBA 1D6JA 1OFGA 3PGMA 4W1PA 4B47A 1OROA 1VIAA 5DM1A 3OLVA 2H5LA 3WLOA 1PQUA 4PRYA 4EVQA 3T9DA 4JAVC 2J85A 1NV9A 3Q8MA 4Q1VA 2AFRA 4QYTA 2PPVA 3FHCB 3AWIA 4WADA 4EARA 1T8TA 1Z4NA 3E82A 5JSQA 3LUFA 3ZTWA 4JASB 3IAS6 5IARA 1QO0A 3H13A 3EQ7A 1C3VA 2P9BA 3MWDB 3MQFA 4FC6A 4F9TA 2CDNA 2ZI9A 3WYFA 2VPIA 3GJYA 4PLFA 3OOJA 1WXWA 4I0WB 1D7AA 4LCEA 4QFCA 2FWAA 1KVTA 1XK7A 3K0HA 1UXKA 4P35A 1WRBA 1UM9A 2E4AA 821PA 2ZS9A 3A1UA 2G3YA 5TEVA 2B7CA 3AM3A 2QUHA 3MGBA 2CLLB 4RD4A 3T7KA 1TQ2A 2I2AA 3AHJA 3BWBA 2B0CA 3K9CA 4FTWA 4NENB 4IO1A 4QATA 2BM9A 2VYQA 5T3UA 1OYYA 1U98A 3W79A 1HUQA 3H11B 1HQKA 2QM3A 4BO6A 2NTEA 1HH4A 1QLJA 1RI4A 4LSMA 4B9EA 4BB5A 2EIXA 3ZV7A 1B4DA 2LKCA 4UBMA 1PFVA 4QOGA 4CEHA 4OHOA 1JEQA 1GCGA 4FJ2A 3UJ9A 5C9ZA 5ITZA 5IWCA 3EJ6A 2FW1A 4CIXA 4MRAA 3TD9A 4CG3A 3PL1A 1DG1G 4YRJA 2CHVA 3MJCA 1C14A 2D8AA 5ER6A 2VDOB 5KHOC 1JPJA 3K35A 2A9PA 3EGVA 3Q3GE 4F5WA 1EHYA 2AXQA 4UU1A 1J99A 3VPAA 1GQSA 3EHDA 4F85A 3TIVA 5JNWA 1GQRA 2QT0A 1JR3A 1ZUWA 3N53A 4KKXB 1I1NA 1FDVA 2BUCA 2IT1A 4C06A 4NPAA 4UPDA 1V3QE 1XVUA 1Z17A 2V7VA 1JHAA 1Z5OA 3NJ4A 4MVWA 5DLEA 3SC3A 2PKXA 3G1WA 1Z4LA 4KTTE 4PO8A 5B57C 3LD9A 5AKLA 3MJDA 3ED1A 4A1OA 4BNUA 4BGDA 5AJHA 1N5RA 3S29A 5EWLB 5ICCA 4JI2B 3G5LA 4YRBA 4NYMQ 4EHKA 1DTWB 3PFBA 4MQFA 2ORIA 3LBFA 1M7HA 2HEGA 1RQLA 2Y67A 2FV8A 1Q1QA 3CLTD 3FX2A 3NKLA 1LBIA 2IHJA 4MV9A 4F12A 3HCBA 4UQLA 4AMBA 3W5AA 2F8TA 3V1KA 1LB1B 1S9DA 2V5AA 2VKTA 4FNMA 1RLJA 4IOKA 4RD2A 2QTMA 3ENNA 3LIPA 2D5LA 1GYPA 3HJTA 3L6DA 1UPUA 4DCPA 2W6IA 4CTKA 5D2CA 1SBCA 1O77A 2VUSA 3UW3A 3T3IA 5JDIC 1V48A 1W85B 2AG1A 1FUIA 3WRXC 4NE9A 1OKKA 2WK1A 4AJPA 3H1BA 4DG5A 5I3ZA 2FMXA 3GJ3A 1OE0A 1UODA 1EEXB 2O4CA 4RIFA 4I1PA 3EYWA 4FONA 2IXFA 4YI5A 1FW6A 2CLEB 4C7VA 3CU5A 1JQ5A 2ZI4A 5JDIA 1U9ZA 2XCRB 4M9UA 3BZWA 2W8BA 4LV5B 2ANCA 1VG0B 4XTCS 3SQXA 5DHAA 2OLJA 3AHIA 3ZVRA 4ZK2A 2JGDA 4NL4H 2P5SA 1RJWA 2JJMA 4UASA 2I71A 1E6LA 3MRTA 2CCKA 1FFSA 1Y7IA 3TDKA 4JYBA 5JU6A 3MQ4A 4NMWA 1H9BA 4X93A 2Y1XA 1OUMA 4C6RA 2WF9A 2WYVA 3NWPA 3D64A 1FFHA 3BIWA 3O5AA 3Q5DA 3ZWBA 3DUFB 1EFHA 2ZYRA 1Z4MA 1ZIDA 5AKGA 3C8MA 2H92A 2FHPA 3S2ZA 1RKVA 4RCYA 1PS8A 2B8TA 4TRMA 1EBUA 3GFBA 5BW5A 1M2WA 2ZPTX 3H3XA 3BTOA 4QLBA 2A1UA 2G67A 2NO0A 1P9RA 4NBUA 4RSMA 1T9KA 1Z13A 2EX4A 2DE0X 3B1VA 4QLOA 5D00A 1DC7A 1R12A 2FWRA 2X9LA 2WR8A 5BSGA 5K3FA 3L7KA 3SVZA 2E2WA 2ABWA 4KFSA 2GM9A 2YWCA 2P6PA 3RTBA 4BEWA 4CEJA 1GNQA 3EVDA 3U9LA 1GPWB 1K8ZB 1N5LA 3I3SR 4X8OA 3SJBA 1J2JA 5K3CA 5IK2D 3ZHRA 3QKRA 3Q7SA 2G1PA 1VSTA 1KXJA 1M1NA 3QA9A 3MUFA 4BP3A 1XTVA 2X9NA 2XDYA 3RRNA 5LLDA 2UZ1B 3OHSX 4TMKA 4UMDA 4J4BA 4OHCA 2ZYDA 1WULS 1HT0A 2Q5IA 1EFVA 3VU9B 1Y37A 1WDMA 2XCUA 3RT1A 4PFQA 3ACBA 4Q9DA 5AI8A 5TPZA 3F6SA 1TL7C 1J6UA 2Y66A 2DJ5A 4F3YA 1UCFA 1Y4SA 4B7AA 3GH1A 4TQUS 4Y2PA 1AGNA 4DW8A 3D5TA 3MGCA 2AZMA 5E6RB 5LVAA 2XZLA 1RXCA 1RKUA 4IWYA 5SYAA 5GPBA 1VIDA 4GPBA 3U4GA 5HIAA 1Y8QB 1MTZA 3PHHA 4MIOA 4PO3X 4Q1EA 3U44A 3OQ6A 4QGHA 5BSVA 1Y6FA 1QG6A 3G6WA 3I2YX 1P5HA 2LV8A 3TNJA 3OM0A 3HKCB 3PEVA 2JIBA 4DDHA 4HSEA 4DCTA 1W8DA 2QY6A 2NZWA 1P3DA 2W6ZA 1Y34E 3ELDA 4TMTA 1F60A 1QVRA 4OP3A 1I5EA 3V1MA 4NECA 3Q3VA 2Q07A 2EHDA 1VTKA 5A4IS 2BGNA 2Z3VA 1VP3A 5AKEA 3TTUA 3LC7O 2OXEA 5G2OA 1LTQA 3CX3A 2Z83A 2ZXEA 4D46A 1N8SA 1DADA 1P9NA 2WNIA 2FGJA 3GJ6A 4PSVA 2PRYA 5CDFA 4ETNA 1G20E 1LWOA 3V55A 3FIUA 1E2PA 3V8EA 4Q4LA 3NBYC 3LF1A 5BV8A 1E3EA 2IXEA 5G0UA 2JAPA 1BDBA 2DWCA 5G0SA 3RH0A 3ZD8A 3KZNA 1C1DA 2X4DA 2JD1A 1QLWA 1SWWA 5BSTA 3VOAA 3Q41A 2YDYA 4G5QA 4XFKA 4BEVA 1M66A 1HRDA 2FU5C 2J08A 5G41A 4ECEA 1ULSA 4HVLA 2VK1A 2Z2XA 4G8CA 3O92A 4MV4A 1URPA 4TWRA 4C22A 3ASZA 1JWAB 1C4XA 1YZHA 2RI0A 1I3CA 4PQRA 1DJLA 1G66A 1HE3A 2FZGA 1ZA1A 2X13A 5EEHA 2VNIA 2ZJAA 4HDSB 4UPVA 3T34A 3DP7A 5M3BA 4KIGA 2G25A 4RMJA 3IEPA 2V7EA 3F7OA 3K8ZA 2HRBA 1SXJA 2V6FA 1V0JA 5FR1A 2P4HX 2PXAA 4POOA 5K4HA 4OX9Y 2ZIWB 1MO2A 3IR5A 5CNJA 1C9YA 5GWXA 1IQUA 5FI1B 3LWBA 4WN9B 2C95A 4DDVA 3NEJA 4DLPA 3G2HA 1RHMA 5COBA 2DP4E 1ZGHA 4R3WA 3PPIA 4BLPA 2MINB 4LE2A 1VQ1A 4OU4A 1A1VA 4MPJA 1U65A 4BJ5A 3UXEA 1GLGA 5FLEX 5BV2P 1E3JA 1JTVA 1E2HA 2WV7A 3W7VA 2WA1A 4CM6A 1AN0A 1SVMA 3QXSA 2GK6A 1FMJA 2XMSA 3D7KA 3RVBA 5I48A 4W5HA 1RWNA 2RAFA 1MRZA 5CLGA 3KETA 4NAVA 4QUBA 4ZREA 3TW8B 3TSOA 1W6RA 2CNBA 1UXGA 1F8XA 3AR2A 1NU6A 4RJTA 2JA1A 4ZODA 4AC9A 1DLIA 1R6UA 4M83A 2NYRA 4WHMA 1VGRA 5K45A 1EK6A 1MC5A 3ONNA 3PPVA 1ZSNA 1CUYA 1TRHA 3N6RA 4O4LA 1HDEA 2FUG6 4B6QA 1NE7A 4LYHA 1Y4AE 4QJIA 2VNKA 1FQKA 1K68A 2X9VA 4L16A 2EBHX 3ZCTA 1TCCA 2KLHA 3QJ5A 5DU2A 2AA3A 3V8NA 1PTJC 4J4HA 3FVVA 3G2JA 4RS4A 3ESAA 2XMQA 4NCNA 1EDDA 4NG5A 1PGQA 1AUVA 1WUJS 4B8YA 3HRIA 4BZXA 1FE8A 3TEMA 2G0TA 2R00C 4DA0A 4CI0B 1LRKA 1VMKA 3DM9B 1A96A 2E82A 4LXQA 3RKSA 2WA2A 4L8FA 1IXRC 5C1OA 4CV1A 4MP6A 2VPYA 2O48X 2G9RA 3GRCA 2Z8YA 3EPPA 4LK2A 5HIIA 3KLBA 1GPKA 2G1JA 2HA2A 4DV3B 2XBMA 3IKJA 4PONA 1ADGA 2XCIA 4MGZR 2QAGC 3EE6A 4EY6A 4F2PA 2E55A 1IY8A 5GOZA 1FP6A 1POXA 1NNLA 2GSWA 2WKWA 1ODTC 3BD9A 3AUFA 4HLUC 1EJBA 4RGBA 3B1XA 3BULA 3GNSA 3JATA 2QMQA 3RREA 5C1PA 4U8GA 1LJLA 1T43A 1EP3B 3X3HA 1JB9A 2HLNA 3EDCA 4QRDA 2QAGA 1WL8A 4RUKA 3I23A 5IXJA 2X86A 3JVVA 3Q6IA 1R50A 1X14A 2IY8A 4G5XA 2AYZA 3KOMA 4C6HA 2ST1A 3LG2A 1SKBA 2WPDA 3E7WA 4XQ9A 3DMRA 5HGXA 1E2GA 4DNXA 2MYNA 2ZZNA 4LUCA 4U7FA 4JVNA 3S7TA 1OZHA 3AEZA 4DABA 3M2TA 5A7FA 2XTZA 1YKSA 4YAUA 1JAHA 4DUGD 3COWA 3W5UA 1KSFX 3BCRA 3ME5A 1OTYA 4IBOA 5FI0B 1ZINA 4HH4A 5K8LA 4D9GA 2D00A 3CISA 4R40A 4EG0A 3M5CA 5FUMA 2H08A 2D3WA 4LHSA 3U3KA 4B2LA 2HCTA 1ADCA 1JHYA 4TTVA 1Z4QA 3DDHA 4ZDIA 2IHYA 1K27A 3A37A 3KQYA 1ISHA 3ZQ6A 3TIXB 1TKBA 2PSSA 3GEMA 4LGYA 3ISJA 5EIHA 5DX0A 5A3QA 1Y7PA 3A1DA 3NBZC 3ZS9A 2F9MA 3LCUA 3R7DA 1QH9A 4W9NA 2FSPA 5IM5A 4DQUA 2QQGA 2Y9PB 3JQ9A 2AEMA 2B8WA 4UBOA 1W5AA 2PL3A 1L4GA 1W4LA 2JFVA 1QDLB 1MIOA 1H42A 5A05A 3DEFA 3Q0IA 1ESNA 1WUTA 1L6IA 3GFRA 4PHCA 3VYTB 4A2PA 5K0SA 2OOSA 4L75A 1JQDA 1SELA 3I0MA 3CINA 1HXHA 1QK4A 2E5WA 2GEVA 2BTQA 3JRWA 3M4ZA 4L1KA 4QASA 1D1SA 3HDGA 2C4KA 4QQNA 4ND5A 3V1UA 1G5HA 2P62A 4HAOA 4M1OA 4P81A 2ZRPA 1RYYA 5E7IA 2G36A 1XMOB 4JCOA 1YH3A 2FFJA 3OCWA 5CEFA 1OMOA 1J56A 2C9DA 2C29D 1G5FA 1HNZB 4Y6PA 2ZRQA 4N5NA 1MNAA 1Z2NX 2C98A 4WCFA 4JN6B 1XMSA 4WESB 4LBVA 4KOAA 2NUPB 4R2XA 3EPLA 4HFRA 5H9VA 4UNIA 3ANTA 1Z0SA 2B4RO 3C4QA 3NI2A 2OQVA 4Z4IA 3FOAA 1WTCA 2D13A 2VS1A 3LXMA 4W1QA 2VHQA 5T4BA 3I6MA 1U2DA 3L1JA 3B70A 3LM8A 2P9TA 5NULA 4EO9A 4QXOA 1IY0A 1KC1A 4QREA 1GPYA 3B5IA 3KB1A 4UHCA 4A0FA 3UT5B 4JI4B 3D02A 3RW9A 2C7VA 1ZD4A 3ENVA 2ANBA 2DQ4A 1KI8A 1XLWA 3EFOB 5GVSA 2XJ9A 3QBEA 1JIIA 4IIJA 4D9IA 1XZBA 4CKZA 4TWJA 2HWKA 1MRSA 3AI2A 3JSXA 3LW7A 5IZCC 4NCKA 1X80B 5H82A 2NLOA 2O5RA 3G2KA 4OEHA 5FWXB 4MZDA 1LC3A 3UMGA 3BKWA 3BWDD 2C4VA 3FSJX 2WYOA 3OY7A 4JDUA 1ZD5A 2WHPB 4MW6A 4NTZA 5EUCA 5TVGA 3ZYZA 3R8FA 4EW3A 4KX3A 4FHEA 3QBJA 3KUXA 3NRBA 4TWIA 1PWXA 4GMGA 3V8QA 4R1SA 4TLDA 4EB0A 1LFDB 3HJFA 1O89A 2QRLA 2BFBB 5IKOA 3WMXA 2P6OA 4R84A 3OCVA 3AY6A 2GN2A 1V3TA 2VJQA 3ETDA 1ORWA 5AXAA 5L7YA 3V4ZA 4UBLA 1P9LA 4UM7A 6REQB 1OAKA 2JHAA 1H23A 1H9CA 1G3MA 5A0VA 1KKUA 3WDMA 4CM8B 4QPZA 1AHPA 1ZX1A 3DYBA 5EMNA 1NVDA 2P3QA 3R0XA 4FB5A 1XVAA 1IN5A 1U0RA 2OV3A 1A82A 1E69A 3DPSA 2FFRA 3DEKA 3CNHA 1OX5A 1IOZA 2X2FA 2QRQA 3A9TA 4BMOB 5JHHB 1AXGA 1R64A 1UKVY 3GZNA 3OG9A 3PFKA 3H2IA 3FOBA 1Q44A 2M1XA 1USVA 5B58T 5AQ1A 3IMGA 2MIIA 3DOFA 1E9AA 4IOMA 1KAQA 4LBWA 2IYQA 1H69A 2AVDA 3HJUA 3DTVB 1N4AA 4RTNA 3K0SA 2IIQA 2IQ5A 3E15A 3VV3A 2BR5A 1TD9A 5IULC 3F46A 3UK1A 1FFGA 5JYEA 2PSJA 4MUXA 5G4KA 4KH1A 4BY9E 3ICEA 4RIEA 4DMRA 2I2XB 1P1HA 3NM6B 4RLFA 1X0VA 3G0IA 1ZCJA 6YASA 5J2UA 1PR3A 2FPGA 3M6VA 1Z0JA 2B30A 2ODBA 1XRSB 3G8AA 4OI1A 1QGZA 1BS2A 5ABPA 1UMBA 2R9VA 5IJ9A 5KTSA 1U9IA 5B58C 5CXQA 2XVAA 4IHKA 3IRUA 2PS0A 4HDNA 2RGXA 3I64A 1CRWG 2M32A 2V98A 4HHEA 4BRUA 3PNYA 1FS5A 4B45A 1SVSA 3EASA 2O1XA 3L7CA 4HZUB 1HETA 2CNKA 4PV7A 5C5CA 2R8YA 1ZEMA 3IAFA 3LRTA 3ND7A 1NLYA 3K2EA 3WICA 4AF7A 4AMVA 3EZLA 1FF9A 3U3DA 1W6UA 4B2IA 4YRZA 5BVHB 2GGSA 4Y2SA 5F52A 3R7WB 3EVZA 2YMPA 4TQGA 4C0WA 5TY0A 1SM4A 4D6XA 1DZ3A 4IX9A 1YQWA 3HP1A 6ADHA 3EQ6A 2POQX 4R41A 1QQ6A 1WVIA 3EXEB 2WYUA 1C8BA 2Q21A 1JKMA 4DRYA 4JS0A 4WACA 4EI7A 4KQ1A 3EVFA 2O8FB 1QCDA 3AP2A 3FWPA 4ZQEA 1JKIA 4N82A 4DWVA 1KZHA 3G2IA 3I01A 1WPQA 3TXXA 4YR7A 2OQRA 4RHCA 4E51A 1E0SA 1CQIA 2ONKA 2VF4X 1UBHS 2IE8A 3HO6A 1EK0A 1IJEA 1KY3A 1DO0A 1O96A 1HT3A 1H2EA 2DM6A 4WXYB 4RD3A 5EHZA 2QX7A 2YIDA 1XTBA 4WUTA 2PN1A 5I9SA 4D6YA 2JI4A 2F8MA 2PLAA 2QN8A 5ECWA 3ONFA 3LT0A 4OH1A 2ZU0C 1QPGA 1WA5A 5ITSA 4QPJC 3PC6A 3ORFA 4NJMB 1V2HE 4NCIA 3O93A 3TNDA 4CTNA 3BK7A 1LVHA 2YMMA 2BFMA 1NFQA 3DOEA 5LUBA 1P1JA 4EA7A 1BDHA 5AW1A 4EDFA 2HA0A 3R9XA 4OOEA 1LZLA 3LRPA 1G2PA 3BL8A 5LQNA 5AT1A 4CQLA 1I51A 4HWGA 1XALA 1UBKS 4IW3B 1ZZEA 2A59A 2XGOA 3JQRA 1XAHA 3TQQA 3U0BA 2G88A 3NHLA 4BCCA 2W2OA 4MEAA 5L45A 4ITVA 3QBVA 2RGCA 1DCKA 3NWEA 5LD2B 1XL0A 4R1OA 4RFSA 4C4OA 4A15A 3BTVA 1Y89A 1NI3A 2JIZA 2W8ZA 16PKA 1ZG3A 2VAWA 1W87A 4C3ZA 4EFDA 1GTMA 1IE3A 2HA5A 4X1YA 1UMDB 1YRBA 5FD8A 2NVUB 2HD4A 2WD7B 2C2ZA 3EZXA 5EMKA 3IVAA 5LDHA 1W4BA 4XIGS 2XVYA 4N18A 1PWHA 4EQ6A 2C7PA 1QOQB 2VXOA 4BJ1A 5JXJA 1V39A 2Y1LA 3ENQA 4PFSA 5T41A 1I32A 2WB2A 3WP1B 5TVKA 3A7DA 3ROPA 4UOEA 3CWQA 3E61A 1WB5A 5DTJA 3I58A 1RXUA 1XCGB 4BLQA 1OGYA 1HZJA 2RH5A 3O8DA 2A94A 2IHVA 4CV0A 4NV3A 4TLCA 1RNLA 1PJ3A 1WZ2A 3H04A 4CTOA 3NG1A 3KLOA 3KO8A 3BL5A 4FYJA 3Q7EA 1JDZA 3AU9A 3LP8A 3TVTA 1R3UA 1NWHA 3LDHA 4RKFA 1A9ZA 2HA3A 1XCOA 3AQIA 3P2OA 4QU9A 1SZDA 3HDVA 3ZHTA 5I6DA 2VOEA 3M1LA 1HYQA 2RH4A 2Z1DA 3QNUA 3G49A 1YQUA 3WZLA 5HKOA 3UPDA 3UK7A 1AZWA 4UOZA 1WVGA 4TUYA 3LX8A 2D6FA 2HPHA 3GCGA 4I08A 3GEDA 3VQTA 3FGNA 5EHXA 2J1LA 3QU5A 2IIBA 4KI7A 4FNAA 5BRNA 3G0GA 1HDYA 2O8BB 1Z4PX 4C2TA 5H0IA 1N6LA 2GCIA 5BN4B 2C42A 2Q5EA 1EFTA 1Z16A 3BJZA 3QUAA 4JX9A 5KMGA 2H1OA 2D74A 4EI2A 4ENUA 4DLKA 1OTHA 2A4MA 4YX9A 1V16A 5KKNB 1E2UA 1LW7A 1GGMA 4UC0A 1VPDA 5I7AA 1K7EB 4GPAA 1PZXA 3RT7A 1C0LA 4Q4HA 2OFWA 5D3MB 1HPLA 5L53A 3KK0A 5EJAA 2AW3A 1EFPB 3SOZA 1T1GA 5THQA 4JL6A 4GKVA 5E3HA 1J7JA 4B5KA 3IUQA 3C6BA 1D2RA 2JGKA 5LWHA 3CRNA 1A9TA 1AU9A 2R11A 2JAXA 1DKLA 3EDYA 3GO4A 1OLUB 1G4UR 2XOEA 2UAGA 3KE9A 1GA1A 3T9BA 1Y1SA 3GDWA 2F00A 5K51A 2VNJA 4KE8A 4GLOA 4WRRA 2BN4A 5FT9A 4F04A 1U7UA 3D7RA 4L6CA 5HHTA 1NW6A 1E5LA 2BFFB 3F78A 2B9VA 2A1IA 4H35A 4X8LA 3BMOA 2Y77A 1FDRA 4HJXA 3EG9A 2CUZA 5JOQA 2E87A 1N1GA 1YACA 4LZAA 1DKMA 5DYNA 2JBAB 4TSFA 2E85A 3FKQA 4LRWA 3R9IA 1BWSA 2OLKA 2VJMA 3IILA 3O74A 4FXPA 1PFGA 1EHCA 2Y1DA 2J0UB 4Q00A 5FPYA 1VJGA 2QROA 4I5FA 4S2EA 3M49A 4JXKA 4MYTA 4KGZA