3PE6A

Crystal structure of a soluble form of human mgll in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
289
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWAPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal structure of a soluble form of human monoglyceride lipase in complex with an inhibitor at 1.35 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 107
structure length 289
sequence length 289
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe6A00
4K6GA 4ZXFA 1IUNA 3IVMA 1YASA 2OQIA 4RGYA 1C4XA 1UK7A 2WIFA 3FAKA 5JARA 3FNBA 1XRNA 2ZYSA 2WKWA 3FOBA 5T4HA 1XRRA 3I2IA 5AKGA 1MAAA 3WKBA 2DQYA 1LGYA 5C7YA 5ALMA 1QTRA 3M82A 1LPMA 1JU4A 5D7BA 1QTIA 5HFNA 1E3QA 3AZPA 2VJBA 1CUDA 4JH0A 5CH5A 3C6XA 1EI9A 4PW0A 2I78A 2JGEA 2GZRA 3S2ZA 3WKCA 4B83A 1JMKC 3WLAA 2ES4A 2XMBA 4N8DA 3ZWQA 1CRLA 1WPXA 4J0KA 4GECA 2O2GA 1QIMA 4PF1A 1QGED 1USWA 4F21A 2C7BA 1WCYA 3KOOA 1BN7A 1ZGBA 3VVLA 1BCSA 5EHXA 1G66A 2DCMA 3QMVA 5HF6A 1RWQA 2XLCA 4LYDA 5JATA 2VF2A 5EHZA 3TEJA 1UK6A 3W9UA 4X3CA 2WUFA 5DNUA 1ZGCA 3B12A 2Y2VA 2PPLA 4AMZA 2WUDA 1FFEA 2HFJA 3A2MA 4EY6A 4WFIA 4EUSA 5EHNA 3O9MA 3R41A 5AI6A 3O4GA 5LKRA 3C5WP 2WFMA 1N8SA 3R0VA 3O0DA 1IZ7A 4N8EA 4QE3A 2XMRA 1GQSA 2BGNA 3ZV7A 1E8MA 5BV7A 2WUGA 3SK0A 5FPPA 1GPNA 3HI4A 4OD0A 1CUXA 1HKHA 2XUJA 1QFMA 1UWCA 3DKKA 5A2GA 1QIIA 1ODCA 2V9ZA 2B61A 5E4TA 2UZ0A 4HS9A 3EQ9A 3B5EA 1ZD3A 2B20A 1HLGA 1A8SA 4GLBA 4QA9A 2PM8A 5K5EA 2JGLA 5ALTA 5EIHA 4G4GA 1ORWA 1LPAB 2ZSHA 2ZYHA 3U0VA 1QIGA 1W6RA 4IO0A 1AUOA 4CCWA 2I3ZA 5CMLA 4KAAA 1LZLA 4UHHA 4ZGBA 3LIIA 1MX9A 1IVYA 1RYYA 1EX9A 3W04A 1H23A 1YAHA 2GYUA 3UUFA 5ALZA 2BUCA 4YX9A 3PFCA 2HIHA 5K3CA 1YA4A 3R40A 2PUHA 1YB7A 3RM3A 2WJ3A 1H2XA 5JD6A 1L7AA 2Q0XA 4BRSA 4I3FA 3WWEA 5JZ9A 3H19A 4OB8A 3PFBA 3DOHA 3ESCA 1N1MA 2QXTA 5AOCA 3C5VA 4Y2SA 4W1SA 5LLSA 2FJPA 1P0PA 4U2DA 2ZVDA 1XLWA 3WL5A 4M0EA 1XZAA 4X6UA 4Y2PA 2WHQA 4RE5A 1EDEA 3NWOA 2HA4A 1DQYA 3ILSA 3CCBA 2HDWA 1AMNA 4X94A 1Q83A 2XUDA 2PSJA 3IBTA 1LPSA 4MJ3A 2VAVA 5IVKA 3DQZA 4U2FA 5ISMA 4Y2UA 4HXEB 1UXOA 3V1KA 5LP1A 4GEGA 2ACEA 2HA6A 3WI7A 3HACA 4G5XA 2H9YA 5LYYA 1EK2A 5CH8A 1XQVA 3NGMA 2OPHA 3IUNA 4KE8A 1DQZA 4F60A 2QUBA 1JJBA 3PICA 2WG1A 5AIBA 1LBTA 2Z8XA 2VT6A 3IA2A 4X90A 5F4ZA 3ICVA 1TKRA 4KR0A 3QMWA 5FP0A 4DNQA 4CCYB 5FUMA 4B82A 5AI9A 4UFOA 2H7XA 1TRHA 1EB8A 5AI4A 2DHCA 1XKLA 5DYYA 4H18A 1FFAA 3HC7A 3TGLA 4U2EA 3UUEA 4J3JA 3D0KA 4U2BA 4HVTA 2WJ6A 2HRQA 3G0IA 5K3EA 3LIPA 1H2ZA 1JJFA 1QO7A 3T4UA 4C01A 3OC0A 4AN0A 1E5TA 1Q84A 1GXSA 1H2WA 4Y2YA 5LZ5A 3DD5A 5CXUA 4PQEA 3PI6A 4BTLA 3QYJA 3BF8A 1Y7HA 3BIWA 4BP9A 4AO8A 3HYSA 4BDSA 2WFLA 5JAPA 4LXGA 2Z3ZA 1R4ZA 2XMQA 3HEAA 1J2EA 1AX9A 1DT3A 1UKBA 4ZWNA 4W9RA 4UHDA 5E4JA 5D3KA 4PNZA 2C4HA 2HFKA 1CUWA 4UFNA 2OGZA 5HZGA 3V48A 3TRDA 4CIBA 2ZJ6A 2HL6A 3ZPXA 3OPMA 3H2HA 2C58A 1XZEA 2W6CX 2ZYRA 1LPOA 4PV7A 2PU7A 1QIEA 2WHPA 1U2EA 3O4HA 1U65A 1K5PA 5KWIA 3FYUB 1CUGA 4BVKA 1R88A 3DCNA 3G8YA 4MYSA 1A7UA 2VJAA 1XQYA 4N8SA 3STYA 1ZOIA 3WJ2A 1C7JA 1ZI6A 3I2HA 6YASA 4ETWA 2Z8ZA 3K9BA 1XQXA 1FFDA 2IX9A 5ALFA 5ALSA 4B80A 2XLBA 4CG3A 3VJLA 5EFZA 5KBYA 3V1MA 3BXPA 5HQ3A 1XLVA 4N5HX 3AUKA 3PUHA 4EZIA 1VZ3A 3WMRA 1CUJA 2WTNA 3ESBA 1CQZA 4RPCA 1ZJ5A 1PV1A 3FSGD 3EF3A 1CUUA 1VA4A 5FKJA 1G5FA 3DYIA 2C5FA 2CEKA 4QDOA 2XT0A 1BCRA 5ALPA 4AN1A 1K8QA 4KE7A 2QMQA 1XZIA 1QONA 5ALIA 3W05A 2HRRA 4G8DA 5AM1A 3WYDA 5HK9A 4FBMA 4Y2QA 3DNMA 1YS2X 4PO3X 1GGVA 3CN9A 1XROA 2P8SA 2XQJA 2VATA 1WOMA 4IHAA 3BWXA 4U2GA 1UKCA 3MUOA 1K6EA 3BF7A 3STWA 1F0NA 2B9VA 4F0JA 1TAHA 3S8YA 3WA7A 2BCEA 4QWMA 2XQGA 4DMHA 2XQKA 3TJMA 4J0JA 3IUMA 2XI4A 3KWFA 3I2FA 4LXHA 3BE8A 4NZZA 4I19A 2OCIA 1WB4A 1EHYA 4L72A 1GZ7A 4A16A 1X2BA 4RE6A 1BEZA 5CTAA 1ISPA 1PJAA 1ZICA 2XE4A 1IUPA 4Q3KA 1ZIXA 5I7UA 2ECFA 4YK7A 2RONA 1ZD4A 3PF8A 1AZWA 1XZLA 3N2ZB 3HJUA 4XX1A 4MWSA 2HA2A 2WU4A 2QT9A 1XRPA 1SCQA 1C7IA 2XQIA 5T4FA 5ALVA 1YR2A 2X76A 4MXDA 4CFSA 2AJBA 3A6ZA 1SOMA 4MEBA 4P92A 3F97A 4X6YA 4W63A 1NU6A 5CT4A 5HF8A 3G02A 2OCKA 4J0DA 2WJ4A 5HKAA 4BRZA 3A70A 3EIOA 2K2QB 4QDXA 4BCBA 4UHCA 3I6YA 5T4EA 5CT9A 1HDEA 4X6XA 5AM3A 3C6YA 4AQDA 3H2IA 2CMFA 2AJ8A 3ESAA 5HF5A 3V1NA 5I8PA 3G9ZA 1YSCA 2BFNA 3WL6A 2O7VA 1Q0RA 2QVBA 2YASA 2WIDA 3G0GA 1XZMA 4H7FA 4J0CA 4E11A 4GWLA 5CRIA 1XFDA 5K3FA 1UFOA 5SYNA 5ESRA 2XUQA 2WILA 1T2NA 5C8ZA 3QMMA 5IKXA 3H17A 4EBBA 4TPKA 3G9UA 1MX5A 4UBJA 2YH2A 3VDXA 3GUUA 4WY8A 5C81A 5AIAA 2GBGA 4UPDA 3HZOA 4OU4A 2H7YA 4HRYA 3VISA 1ZD2P 2QS9A 3OG9A 1YAJA 1T4MA 4M0FA 2J4CA 2QKYA 1THTA 1QLWA 4H7EA 4MQLA 5ALDA 2GYWA 1XRLA 2WIKA 5FPQA 3SC2A 5KREA 3W2TA 1DX6A 2OCGA 3H2JA 3I6MA 4H7KA 4WFJA 3ZLUA 3IDAA 2BAGA 2QJRA 1VA5A 4FFWA 2QTBA 3I2KA 2CJPA 4J0GA 1OILA 3ED1A 1BS9A 1QE3A 5AO9A 4UHFA 1QIHA 5DYWA 3P2MA 1LZKA 4FLFA 3C6BA 1CV2A 2BUAA 3WK7A 1CUSA 1MU0A 3L1IA 2CB9A 4G8CA 4C4YA 5AKYA 1CIJA 3H2GA 3QPCA 4J7AA 4TGLA 3YASA 5ALJA 5CT8A 5ALUA 3AZQA 1UK9A 1VLQA 3OOSA 4QDUA 4MQMA 4Y2TA 1EB9A 4DTCA 4WDRA 1IZ8A 1DT5A 2EDAA 2WTMA 4IH9A 1J06A 4ARAA 1LLFA 2WU3A 3D5EA 3WKDA 4B6GA 2FUKA 2OLEA 4HRXA 1WB6A 2JGKA 1TCCA 3DEAA 2CZQA 5AKXA 1KU0A 2GBIA 4BYMA 1EXWA 3ICWA 5A7GA 4O08A 4EY5A 2XB6A 1JT2A 2QOEA 2QJWA 1UOOA 1W75A 4AZ3A 3NOXA 4UHBA 4OUKX 5ALXA 3KDAA 3G0BA 2HU7A 3FLAA 2ZJ7A 2O7RA 2XQFA 4XWGA 3C8DA 3CCCA 3PUIA 5CXXA 3IUQA 5K3AA 2HU8A 2HA5A 4H7HA 4S0XA 1J07A 4WCVA 4CG2A 2GBCA 4P93A 4Y7DA 5CBKA 2EDCA 4KEAA 4CIAA 1OXMA 2PVSA 3VJMA 4E15A 1AGYA 4ZRDA 4A23A 3F96A 4X95A 4H0CA 5IVDA 2HA7A 1K4YA 3FSGA 5JD4A 3FWHA 1MX1A 1L7QA 5A7HA 1L7RA 3DS8A 4F5ZA 4Q3LA 1JU3A 3MUNA 4OSEA 2RHWA 1GKLA 1CQWA 1DX4A 5AK3A 1SFRA 3G7NA 5CURA 3G0CA 2XDWA 4DNPA 1R9NA 4WY5A 3H0CA 3A2LA 4BB0A 1YS1X 1MPXA 4LHEA 2Z5GA 4EY8A 3C45A 1FJ2A 1BRTA 3HXKA 4OYYA 2WSLA 1G42A 1UK8A 5LKAA 3QVMA 4X00A 3D3NA 1M33A 3STXA 3OURA 5BWCA 1ACJA 3FBWA 3DDUA 2VAXA 2XMGA 2V98A 5DTJA 2WFZA 3WKAA 4AB1A 5JADA 2R11A 1MJ5A 3Q0TA 3GA7A 5JYCA 4BC1A 4AMYA 4N5IX 5ALEA 2I03A 3ANTA 1W1IA 2FJ0A 1CUCA 2D5LA 4EHBA 3QITA 5AOBA 3WZLA 1GQRA 4QZVA 4ROTA 3AINA 3RKSA 2XUIA 2WHRA 3V1LA 1B41A 1QIJA 1XQWA 4W1PA 3N0TA 3WQHA 2PUJA 2YXPX 1DU4A 1JMYA 3MGAA 4L0CA 1BROA 4U2CA 5T4BA 2QXUA 5ALWA 1AKNA 2JGIA 2XUKA 4KYVA 1SCKA 4CI9A 5A7FA 2CUTA 1XZHA 2H7CA 3IURA 3FYTA 3AIOA 4EY7A 4DNOA 4UHEA 3WWOA 1XZDA 4QDZA 5IVIA 1VE7A 5ALHA 5LZ4A 3W9BA 4PSDA 4OB6A 3WA6A 2RI6A 5KWJA 2G5PA 4L9AA 1TCAA 4BE9A 4J0HA 1A8UA 1LPBB 2ZJFA 4D9JA 1YCDA 3I2JA 3WL7A 2DSNA 4MEAA 3EBLA 2Y6VA 1G4HA 1HPLA 1XZFA 3F9CA 1W76A 4BAGA 3EQ7A 1XRQA 3CXUA 3I1IA 2WIGA 3BL8A 1YB6A 3NUZA 5HKBA 5AOAA 3G0DA 1H22A 4BVJA 2XUOA 2ONCA 2G63A 5SYMA 4BZWA 4BTVA 1QIFA 1AURA 4H7DA 1QZ3A 5A6VA 2ACKA 4AO7A 4LIPD 1TIBA 3EQ8A 1AQLA 3H1BA 2DHEA 3R3UA 4BE4A 1N5MA 3LS2A 3VVMA 1VZ2A 5C8XA 4Q82A 5A71A 2HM7A 2ROQA 1P0IA 5HK8A 5LZ9A 5FLKA 4KE9A 3D7RA 1MNAA 2BKLA 5CT5A 1HL7A 3GZJA 5ALYA 3SX4A 5FXMA 1CLEA 3C8HA 3BDIA 2QZPA 4MYDA 1SCIA 1TK3A 4G4JA 4E46A 2OAGA 3M81A 4DYHA 2HA3A 1CFJA 1GKKA 1B6GA 2WLSA 4UBIA 4AZ0A 1N5RA 4C87A 1VXRA 2XUAA 4YASA 5AICA 4CCYA 1XZBA 5K3BA 1VOTA 4H7IA 1W4LA 2QUAA 2PX6A 1EINA 1KU6A 2H1IA 4UBNA 3R3VA 5HCUA 1DWPA 3JWEA 2WM2A 1JI3A 1BU8A 3ZLVA 5ALOA 1ZJ4A 2X5XA 3FVTA 1W52X 3FCYA 1E8NA 4X92A 5K3DA 1AC5A 4RNCA 2RIPA 4Q05A 4IQ4A 2V96A 5DNWA 5ALKA 4M0MA 5J3JA 4DMKA 2Z3WA 2IITA 5AK6A 1WHSA 2PSHA 3ZI7A 3DL7A 2XUHA 4GW3A 4UFPA 3GROA 3OM8A 4FFVA 1ETHA 1QOZA 2PSFA 4UBLA 2JGMA 4BCCA 3WIBA 3PF9A 3RK4A 5AM4A 1QFSA 3BDVA 3ZLTA 4J03A 4ZV9A 4JUIA 4DGQA 4FNMA 3KXPA 3DOIA 4K2AA 3D4LA 3QBJA 2PSEA 3CN7A 3E4DA 4DMCA 1CUZA 3FLEA 4GBGA 4BATA 3E0XA 1SC9A 4B84A 3OTQA 1ZI9A 3L1JA 4QWWA 4GDMA 3IIIA 3BIXA 5EIAA 3IULA 3FYUA 4Q1VA 2JGJA 2O2HA 4KE6A 4CG1A 4JYMA 3I2GA 5LIPA 4B85A 5JANA 2W22A 2RAUA 5DYTA 1TCBA 1GT6A 3RLIA 3E3AA 3O4IA 5CW2A 2ZSIA 3D2BA 1LPPA 2AXEA 3U1TA 2NW6A 4WFKA 5C8VA 3HABA 2VA9A 4BAUA 1QIDA 4B9AA 4LKOA 3AILA 1K63A 2WG0A 2O2IA 2Y2UA 1ZD5A 1E89A 3VKFA 1GPLA 3JYHA 5AKKA 5AKJA 1E8DA 5JAUA 1JFRA 2AJLI 2OG1A 3HSSA 4DM7A 1WPRA 2VEOA 4OCZA 1DTEA 1TQHA 4AO6A 4FMPA 1IMJA 4ARBA 3G9XA 4P08A 1O6GA 2PSDA 4QLAA 1VE6A 4FKBA 2VT7A 4QEKA 7YASA 1Q0ZA 4WDQA 3DJYA 5EIEA 1EVQA 4DMFA 5BOVA 5JASA 1DINA 3X3HA 4EY4A 4B9EA 4Y2JA 2J3QA 3F8SA 3O95A 4W1RA 4X85A 5D6OA 1R9MA 1R50A 3FCXA 1HQDA 5I9IA 5ALRA 1FSSA 2HA0A 5LZ8A 5DTIA 1OCEA 4Q34A 2BGRA 2XUPA 1ACLA 3C87A 4HXFB 3WIOA 4NVRA 2XUGA 4BVLA 4LYEA 4EA6A 3WWCA 3DLTA 1F8UA 4G4IA 2QR5A 3WL8A 1PFQA 4FBLA 4KRYA 4PSUA 4V2IA 4BC0A 4DNFA 3V9AA 5JZSA 1UKAA 3WWDA 3H2KA 1CUEA 4FWBA 3WZMA 2PU5A 5AI0A 4KRXA 1Y7IA 2IIVA 4GXNA 1XLUA 3W06A 4J0IA 5FDFA 1NU8A 4HZGA 3H1AA 2J3DA 3K2IA 1CUAA 3AIMA 4QDTA 1ORVA 4KACA 4B0OA 5CH3A 3WJ1A 1EDBA 2QRUA 3WK4A 3IB3A 2PKYX 2WIJA 2JEYA 4HXGA 2HADA 5AKEA 2FX5A 4XJVA 4AX4A 2WUEA 4GHWA 5AI5A 5AM5A 4ZI5A 4H77A 3PE6A 4GI1A 5JALA 3G9TA 1BE0A 4PSCA 1MTZA 2GZSA 4OU5A 5DJ5A 3A2NA 1VXOA 1X2EA 5AM2A 1FFBA 2GBFA 1ODTC 3WKEA 4FNGA 3UMJA 2G5TA 3KSRA 1D07A 2WFLB 4Y2RA 4JEIA 4IH1A 1X70A 1MN6A 2E3JA 3WK5A 5AK5A 3HLKA 5ALGA 4FDMA 3I6ZA 2X8BA 5LZ7A 4JYPA 4AXBA 1ODSA 2QM0A 5EGNA 1RP1A 1H2YA 1EH5A 1HBJA 2D0DA 4X7BA 4FTWA 2V97A 2I3DA 5JZBA 4X71A 3K6KA 4B7ZA 2OGSA 3AZOA 2WHPB 3PDCA 5AKZA 5DNVA 4QNNA 4DSZA 2OXEA 3O9VA 4NMWA 5DWDA 4Y2XA 1S8OA 1P0MA 2JIDA 5LZ2A 3F98A 4H35A 4UBMA 3R3YA 1WHTA 4A5SA 1CUHA 3FYUC 2PL5A 1NX9A 3VXKA 3RARA 4K6KA 4ZREA 5JD5A 5AHXA 2VJCA 2YYSA 3I1YA 1XZJA 5HQ3B 2PBLA 2VTVA 5AKHA 1THGA 1EK1A 5AH0A 5YASA 1QO9A 1KEZA 1O6FA 3QM1A 4Y9SA 4DIUA 3R3XA 4BAZA 2HHAA 2OGTA 2WG2A 1CPYA 4I4CA 3FLBA 3GFFA 5DLPA 5AI8A 3BJRA 3I28A 1VKHA 2G4LA 1EVEA 2EEPA 2CKMA 3F67A 4K6HA 4ITVA 5AK4A 1Z68A 1DWQA 4HAIA 4IH4A 3ANSA 5BWBA 3H18A 5E4YA 1XKTA 4Y2VA 1YA8A 4L3WA 5CT6A 1XZKA 5AM0A 2LIPA 1CUBA 3WK9A 4ZV7A 2VJDA 1EA5A 1I6WA 2DQZA 4INZA 2CBGA 3E1GA 4BZZA 5A62A 1MO2A 1CUIA 1F0PA 1CVLA 1CEXA 2VSQA 4X97A 2C5GA 4UBOA 3WWPA 4FLMA 4HTAA 4G9EA 3C6ZA 3VJKA 4E14A 3QPDA 4Q3OA 1XZGA 1UT6A 1F6WA 5EHQA 3O4JA 3QZUA 3DKRA 3WYNA 4DSAA 1XRMA 2JGFA 4DLNA 3QH4A 4BDTA 3JW8A 2Y1KA 1GPKA 2JEZA 2XMZA 1UZAA 1Y37A 3QPAA 1QJ4A 4OPMA 2J4FA 2OAEA 1QIKA 2RGUA 4OYLA 2JBWA 2OQVA 5HFAA 4C89A 3M3DA 4KAJA 4C4XA 1CUFA 1LBSA 3STUA 2HU5A 1U8EA 3D2AA 2XMCA 4EB0A 1IUOA 4X93A 5HF9A 4FOLA 4KAFA 3D59A 1E66A 5IH7A 2ORYA 1R3DA 5FV4A 1ZI8A 2AJDA 2AJCA 2BUBA 3D2CA 5AKIA 4YPVA 3STVA 3DYVA 4WJLA 3WK6A 3H04A 1J1IA 1DWOA 3WK8A 1WM1A 2VQ6A 4NS4A 1U4NA 5ALLA 2XUFA 3STTA 4B81A 3L1HA 5H3HA 2Y6UA 3B3QA 2RHTA 1ZIYA 4QLOA 3KWJA 4G9GA 1CUYA 5K3FB 2B4KA 4P9NA 2C0PA 2OCLA 3LCRA 4K5QA 4XIIA 1JKMA 2GYVA 5AJHA 2BJHA 1A8QA 3HRHA 3BJMA 4G8BA 3KD2A 4C88A 3C70A 4BBZA 3AFIA 1LNSA 2XMDA 5ALNA 3AIKA 1JJIA 3SWWA 1EDDA 5IVHA 2JF0A 5E2IA 1MNQA 2C0QA 4FHZA 4OB7A 2R8BA 3R3ZA 5JAHA 5ALQA 4B0PA 2DHDA 5EI5A 3Q8WA 2DR0A 4LXIA 4XVCA 3GELA 1A88A 3IUJA 4W1QA 5AKLA 4UUQA 1UOQA 1LPNA 2XMSA 4KJXA 1R1DA 3DL4A 4G1FA 1CR6A 3MVEA 4TVKA 1XZCA 4FLEA 3C43A 3AJAA 3GBSA 2DFPA 1CUVA 2WQZA 1P0QA 5D3ZA 5JIBA 5AP9A 4C6HA 4Z49A 2ZYIA 4JNCA 3R3WA 4MWTA 3LP5A 4UBKA 4C4ZA 3LLCA 1VJ5A 5FOQA 3M83A 4BP8A 5FRDA 3FVRA 1BN6A 1BEEA 1FFCA 3ESDA 1WB5A 1UOPA 5JAOA 4H7JA 1MT3A 1MAHA 3T52A 4X91A 4BCDA
chains in the Genus database with same CATH superfamily
4I1IA 1A98A 4ZXFA 1QPBA 4CTOA 3IVMA 1M8PA 3PTAA 2UAGA 2OQIA 3IAEA 1YR8A 1SQ5A 1NVUQ 5DWVA 3A04A 4RHXA 2BTQB 2C2MA 1UK7A 2CBXA 3BWMA 1VLZA 1HEUA 1U1IA 1LBEA 2IHUA 1EX7A 1Z39A 1L9XA 1P6QA 3LKZA 3TOZA 4Y0VA 1XDZA 1KY2A 1W29A 1Z5GA 3F78A 3O38A 1DJLA 3QU4A 2ZYSA 3HNOA 4DR4B 2R7KA 4J16A 1RC8A 2E4VA 4C4AA 2WT8A 3SMVA 3FKSD 1TU3A 1ULUA 2AN3A 1K86A 1I2ZA 4KFSA 4KCGA 1Z7EA 2IYRA 3G1TA 3ZK9A 1WF3A 3LQ1A 1I01A 1FDVA 1RYEA 4RPKA 2FZEA 1XWIA 2CHGA 4FMDF 4LBZA 3IPYA 4BY9E 1YGPA 1L3CA 1C9EA 1NMZA 5CDTA 4RETA 5B12A 1H5NA 4PM4A 3M82A 1LPMA 3IILA 3C1AA 2P2GA 4WD3A 1EE1A 1PUJA 1GNRA 2J7PD 4K05A 1QTIA 1UBRS 4FN5A 2V45A 5H81A 1LFAA 3B20A 3F2VA 5HFNA 1NP6A 3OE1A 2B94A 1CUDA 4C2AA 1O5TA 2QLBA 3B3GA 4Q21A 5B5SA 3Q6IA 4HAUA 2CHFA 2PZBA 3DGFC 1U7UA 4M1YA 4P2BA 3UHFA 4ZAWA 4IJQA 3ROTA 3LBHA 2MMGA 5COAA 6AT1A 4CIYA 1HL3A 4CV2A 2WD9A 1CQJB 4GX0A 2AUMA 3U48A 4A6PA 1E2PA 4N8DA 3O93A 1SC6A 3OUUA 5HA5A 4UHKA 2JH3A 2Q2VA 5BNFA 4DQKA 4ROSA 4FWTA 3C3YA 1E6EA 4J0KA 5CDFA 2GVZC 3WSVA 5CDGA 4GECA 3HY4A 4N3NA 3DEKA 1QIMA 2QQEA 1W7AA 5ICEA 2IE0A 2Q27A 1TMYA 4PF1A 4E5KA 1BKYA 1E6LA 3TIXB 4L9WA 3R9XA 2G28A 3IXQA 1XQ6A 1P33A 2YFHA 3KQPA 4YRDA 2ZIAA 3NHWA 4KPEC 3KYBA 2C7BA 3RF6A 4YLGA 4V0NA 3G8BA 3OPYA 3TLCA 4EKEA 3HCDA 3KOOA 5CFQA 3HV2A 4GQIA 4YCBA 3S5JA 2IEZA 3I1JA 1PGNA 3RBZA 5FEMA 5CPBA 1WXIA 2ARKA 5DLQC 3KXIA 3VDNB 1ECCA 5KNDA 3H9UA 2DCMA 3A6DA 2F62A 4OAOA 2NZ8A 2NYAA 8AT1A 4LCBA 1FX0A 1T10A 3MUFA 3QV2A 1YKSA 1XTRA 3ESZA 3P0HA 1NJFA 1OH8A 1CETA 2YVQA 2GXSA 1Y80A 3B12A 3TM5A 2GEKA 4WACA 2VZ9A 1LTKA 2WUDA 1SUWA 1LLCA 5KS2A 3A2MA 2WJJA 4B74A 5F1KA 4DC1A 4ML3A 1WMSA 3IPRA 4WOPA 2O2EA 3L0ZA 4GXRA 3IOCA 2K7FA 4XGRA 1RQ7A 1SVUA 3AF0A 3I5AA 3UFXB 4P3PA 3TD6A 4JWKA 3IP9A 1IJEA 3C5WP 4JLUA 4FJ0A 1OGYA 1L5GB 2GXAA 4HEHA 4RZIA 1D3AA 2GDZA 4LC0A 5IT0A 1RYDA 3CYFA 2IHVA 1FTQA 4RDXA 2BM8A 3U7HB 5LVAA 1DKPA 2BSQA 3EMBA 4DZZA 4QE3A 4A8JA 4L7QA 3JATA 1GAXA 3T7AA 3PYLA 1GQSA 2VYVA 1IZ9A 4HATA 5K1ZA 2A7XA 1O94A 1T0UA 5LWHA 3EASA 2J5XA 1I6MA 3E7WA 3R8XA 4HQ0A 3BZUA 3WV5A 4C3VA 2OVFA 4OHYA 3UAGA 4A26A 1XJQA 4HPXB 4HRVA 1P7WA 3SK0A 1QRAA 1B8OA 2GSDA 2YJGA 2WYOA 3CRZA 3D7MA 3NTVA 5SZIA 4L8VA 1EVJA 4N0QA 1YDFA 3IP5A 2I2CA 2V5UA 3T0FA 4Z7OB 2QUZA 3U5TA 3W34A 3OCUA 4M1ZA 2FMTA 2QN3A 3IEKA 4OD0A 3UK1A 3A1FA 5HJ5A 1ULAA 2XUJA 4NENA 5E7MA 4Z3OA 4ZPXA 2NUAA 4BMXA 3OAAA 1OX6A 1FRZA 4UE6A 5HE8A 1KE2A 4B47A 5AUNB 1D2MA 2VXCA 3M5CA 1YBMA 3LW7A 1KETA 3ONWA 4GGPA 4JOSA 4MWBA 3BAFA 5JSFA 2P4EA 1HMPA 2V9ZA 3KDPA 3RROA 1IN6A 4EMTA 4ZI2A 1Q20A 2K4MA 4CHGA 3FDZB 1NQTA 2C4KA 3BCRA 3KQQA 3O4VA 1H9AA 2VDMB 2XSZD 4HWKA 4KNVA 5DHAA 5J2UF 3ZS9A 2WV9A 4MLCA 4G36A 2HT1A 4QA9A 2FP3A 1EEXB 2PM8A 2YJ3A 3PZBA 4QPZA 3VPXA 5DCUA 1Q0QA 4RIFA 4L8FA 1LFDB 2EXXA 3A28A 1QU2A 3LKVA 3QOWA 3FYCA 2C99A 2JJQA 2CXHA 2TMYA 4HDCA 4OFZA 1Z6XA 4E94A 2O8VA 3DOCA 4A0RA 3IQFA 4PBTA 4YLEA 4L0MA 4EHFA 4US1R 4P32A 1IXKA 2ZSHA 1SELA 4BNDA 2H18A 1DIBA 3WLNA 3JQDA 4QFMA 5EUMA 5FO1A 1WW2A 4OLFA 1UAAA 5T64A 1Y89A 3G2LA 1W6RA 4GOKA 5EWLA 5EMNA 1JS1X 3RUAA 1AUOA 3KHKA 1XELA 3OCVA 1IOLA 2I3ZA 4QJ3A 3KUUA 1Z5UA 2Q1TA 5GY7A 5A9TA 1CJMA 3RBXA 1D2HA 1E1QD 4XWOA 3VU9A 3TE6A 1Q19A 2RH4A 2VRWA 1IBCA 3EUAA 2DWPA 4REMA 3EN0A 4UHHA 3QEAZ 1NR1A 2PIDA 3DZ8A 5KNCH 3KQHA 2VCEA 3CEJA 4TKUA 1MX9A 1PGJA 1RYYA 1CY7A 2VOJA 2W7TA 1H23A 3RS7A 2LBPA 4YMLA 4PNEA 1GYRA 4BMYA 4EG7A 5IM4F 2NZYA 3CM0A 4LS3A 1J49A 1RZRD 1GG5A 1P77A 4DE5A 2Q2OA 1OHHA 1USGA 2H63A 4OHCA 4DW8A 3M6LA 2P5TB 2BW0A 4NEGA 3SC6A 2BUCA 2CDBA 2P1DA 4MAFA 4YX9A 1FIUA 4ZODA 1YA4A 5ELLA 3RSHA 4YJ2A 3PD1A 3PZRA 4CCSA 2ZWAA 1BFKA 1FLDA 5JRZA 1L7AA 2Q0XA 5A4DA 5K05A 5IT9A 1VJGA 4D3SA 3AXTA 4I3FA 2QZJA 1F48A 1IY0A 3EFEA 1E1LA 4D4MA 3UNXA 3ZXIA 3ZCSA 3NDBB 3PWSA 3AUAA 1J2JA 4OB8A 3ESCA 4IZHA 1H93A 3PL1A 4B6QA 4YR7A 3I9JA 3D4PA 5LLSA 3UVEA 2BGLA 1GARA 3CKYA 5DM60 1P0PA 4BU1A 3B53X 4W8OA 1PSZA 4BVHA 1YGYA 5AVUA 4WOCA 1DTWB 4F4FA 1MVLA 3DEHA 3DLHA 1NIJA 1A4IA 2EL7A 4F84A 1U2DC 4QYIA 4Y2PA 3SEQA 1R6BX 1MR3F 3OM0A 4XEUA 1U3CA 2ANBA 3ETDA 3FDXA 2ZATA 5DGHA 5EZ6B 2JFVA 3OMLA 1ADFA 2RHJA 2E1RA 2XWQA 1M6VA 1TCUA 1P0CA 3R6DA 1AMNA 4BVFA 1UH5A 4AXXA 2AEMA 1G8KA 3H11B 4ALIA 1CY4A 3QVJA 1QE0A 3OT1B 4TTVA 2EF1A 3SGLA 3HYNA 3ZBPA 2I62A 4YV2A 4PPNA 4FYKA 2QRZA 4ZA2A 1A71A 2JFFA 3MBOA 4AMUA 5LYJB 2Q6VA 1YKGA 4TMWA 1K3TA 3LCMA 4FZJA 2R0QC 1B0AA 1L7NA 3CWCA 2V65A 4HXEB 4LQLA 1X74A 1YDEA 4RC9A 3TI7A 5E6SA 5I7AA 5LP1A 1LQTA 2XA1A 2HGSA 4EGFA 1TAUA 1KZGB 1QV9A 3JQCA 4NYIR 4HWTA 2ZR8A 2Y9MB 1FC0A 2X7JA 3KDSE 4RSMA 4EFLA 4F5YA 1AHPA 3QFSA 4I8IA 3RVSA 4CIDA 2A1TS 3JRNA 3EWIA 3HWWA 4DPLA 2X6TA 4LXQA 1JSLA 3CR7A 5LYYA 3A9WA 3DP9A 4KIGA 4CTKA 3CZ9A 4J1NA 2ZBEA 1XQVA 2G6TA 3DBIA 1JXMA 2CY0A 3NGMA 3UHJA 3W0LB 1LA2A 2DBVO 4F60A 1KI7A 2QUBA 5CM2Z 5EA2A 2IPOA 3PICA 3W5JA 1ZVJA 2W98A 2BFEB 2ZYVX 5FFNA 2BI4A 5AIBA 3RG2A 2VP9A 1K68A 4WLFA 6PFKA 1XMSA 2O52A 1MGOA 3NPAA 4E12A 3CNBA 5ICGA 5AJXA 3IIMA 4AJ2A 4RYDA 1P2FA 4PAWA 3BA1A 2C2XA 4KR0A 1MXFA 1GPH1 4YO7A 3ENNA 3VV3A 2HKIA 5KJEA 1EFKA 4TUYA 3QPVA 4PSVA 3I39X 5AI9A 2EW1A 5AVJA 3ZDYB 4PPFA 4BKPA 1T0IA 1MD9A 2CHVA 2I2XB 3JWIA 3MBIA 3VR5H 4JU8A 4IKEA 2Z1DA 4YRAA 5JJCA 4V39A 4OG2A 1ZJ6A 3RRZA 3FX2A 1EB8A 2W2KB 5JEDA 2IIBA 1R5JA 2WJZB 4D6PA 1TT5B 2QAIA 5JXWA 3K30A 2QQGA 4FSHA 5I9NA 2OGWA 2AR7A 1UIRA 1ZQ9A 1QHEA 4GP7A 3LUKA 3QA3E 5BNTA 4H27A 1Z4KA 1RYHA 4U2EA 4J3JA 3AJDA 3UOWA 3PIIA 4W7HA 2WJ6A 2HRQA 3IOBA 3DL0A 3G0IA 3QELA 2ZIEA 3AW8A 2NQTA 2IBMA 1A4UA 2F1RA 2VK8A 3W6OA 5B3LA 3BWBA 3O8QA 4EA8A 1A5ZA 2R7NA 3WP1B 2G9ZA 1TYCA 1FNCA 1IM5A 3TR0A 3OOJA 1VMKA 5KB3A 1U0GA 3QE0A 1W36B 1HDGO 3OC0A 4AN0A 1KEWA 1W5AA 1QVWA 1SZJG 2A9JA 2OYSA 3JAWA 4L6IA 1JHYA 4ND2A 1E5TA 5LQAA 3CJQA 5BN5B 4DLSA 2GM3A 2P2SA 4UEOA 4Y98A 1KR5A 1O3YA 2PUDA 3SVLA 4Y2YA 5LZ5A 3U13A 3WO1A 3AOGA 2HJSA 2PH7A 2SKDA 3QLUA 3V4ZA 4PQEA 5AFSA 2QAGC 3RV3A 3DO5A 4L3OA 4BTLA 3TMYA 3FTFA 1YK0A 2PMBA 4DHWA 1Y7HA 2V7TA 3OOYA 2CHQA 3BIWA 4R8VA 1FLAA 4BP9A 5KVAA 4ARZB 1B1AA 2Q1YA 4DIBA 5KTSA 2ZQ5A 1YZLA 1QH9A 4LXGA 1P1JA 2ECKA 2QN1A 3U0BA 1JU9A 1ZWKA 1J2EA 2CGEA 3TB6A 4RXUA 1Z3IX 1AX9A 5EWMA 4CQMD 1VSUA 4YAEA 3W2FA 5C80A 4FMBB 2BYTA 1DT3A 1ENYA 3K1JA 4JP5A 1EEHA 1Q0SA 2O2CA 1CY6A 2WJYA 2RHCA 1E92A 3GOHA 1G0NA 1PEYA 3RAFC 2ZBUA 3B6IA 3LYAA 3Q40A 4W9RA 3N9IA 3NVDA 3OEWA 1YRWA 4JMPA 4X9XA 4DIEA 5D3KA 4PNZA 4M1EA 1WV0A 3WS7A 1V8BA 3WICA 4X8HA 1CUWA 2OCBA 3OOEA 5JWOA 4YXFA 1YL5A 4KBGA 4LE0A 3AT1A 4MV0A 4MV6A 2C0CA 2IRWA 3OUTA 3JWPA 1PFWA 3SDBA 1Z7YA 3KQVA 3N3BC 3PXUA 2IVZA 4Q9DA 1OWOA 4G5RA 4Z4IA 3ZPXA 1KJYA 2Q2WA 4WESB 4A2QA 5K2OA 4IGAA 2YCLA 1EAMA 2C58A 1BJTA 2HLDA 3P9KA 2A5FA 2XKKA 3KE8A 3KUXA 4FS3A 4KDRA 4Q5IA 4FINA 4DARA 1I3LA 5KYVA 5CUQA 4DSTA 5BRAA 3OFVA 1Z13A 3K70C 1Q0UA 3L6RA 2II6A 4RMNA 1Y8QB 4WGGA 1N7JA 1SBIA 2EYUA 3UHAA 1U2EA 2ZUWA 4ZZ2A 1U65A 2QUJA 4UULA 1RHRA 1K5PA 3RREA 4MI3A 2B3DA 2ERYA 2GRJA 3FYUB 4L78A 4YQYA 3P9YA 5G0UA 4BN5A 1T26A 2ORWA 2B98A 1ZH6A 4XFKA 2EQBA 2O1SA 1YS6A 1R88A 2NM0A 2DC1A 4M22A 1RI4A 2ZGVA 3WGTA 4DDMA 3E05A 1UPAA 3PUZA 3TEFA 1A7UA 1KDVA 1J0DA 1YFKA 4RSRA 1Y4UA 3C3EA 1FEZA 3ASUA 1RPAA 3LXRA 4OXXA 1HMYA 1C7QA 5G1NA 4FEYA 3O6VA 3BRSA 2C57A 5B1IA 1DXHA 3QTBA 1C9YA 3Q98A 3MJVA 3ZJTA 3ZKAA 2PY6A 4HX5A 1ZOIA 1S3GA 5EP3A 1C7JA 5CB8A 1ZI6A 3NM5A 4XVUA 3I2HA 3IKJA 2HBQA 3UQYS 3DR3A 2VA8A 4N9QA 1TW2A 2GTPA 1XG5A 2OENG 4CMBA 1AKQA 4HGRA 5MN4A 2O5EA 1KEEB 4Q66C 4WZAB 4CG3A 2W90A 5MHTA 3UV7A 4GLFA 1JX6A 1ZUNB 2WICA 4XR4A 4J91A 3D6AA 3V1MA 5KBYA 2QROA 3BXPA 4HF7A 1UUFA 4Q1AA 3D4NA 3EXFA 4HD8A 3DAFA 1C1DA 5DYNA 4YN3A 5AD1A 1LUAA 3GUVA 4K86A 4B3RB 2GN4A 3U1VA 2WSSD 2I8AA 1CF2O 4EZIA 1KWKA 4AJNA 4DLXA 2QMUA 1RRCA 5KPJA 1P1FA 2BEUB 1W2HA 4M8KA 4O4HF 3RSLA 1QPGA 1I33A 3MWLA 1OV4A 2CVOA 3VHXB 3WMRA 4QYXA 1P18A 3TLBA 3HUFA 3QX7A 4BNKA 4RY8A 3DTVD 4RPCA 4HL6A 2Q7OE 3GNTA 3K72B 3VR4H 2NO5A 1T34A 3WTBA 3KT6A 1T0BA 1HA3A 5HIKA 1PV1A 2NXJA 4JELA 5KYXA 1T6ZA 2AYZA 2CUNA 2F67A 1E1MA 2VUIB 4HQLA 4MLZA 3KPJA 4OAQA 2BZ1A 1DCTA 2YMPA 1EXNA 1SB8A 1VE1A 4QDOA 1LXCA 3KV1A 1AKTA 4QO7A 5ALPA 1GCIA 5F33A 4UE2A 2PLAA 5I7WA 5JR3A 1SKBA 2Q0HA 2WW8A 1IH8A 1J00A 1FTYA 1XCJA 1D6JA 2QMQA 2Y1FA 3KL2A 3LUFA 3R5FA 2WRZA 3WFJA 4CR6A 3W05A 3O8RA 1EP1B 2VPYA 1D1QA 2NXEA 1M5UA 3EVZA 2D59A 2ZJ2A 3QVWA 4KWCA 4H9GA 3HYLA 1LI5A 4L9SA 2AMYA 5JS1A 2QLJA 3DNMA 1BA2A 5FA8A 3GDFA 3RJZA 3NEYA 5CB4B 3AU8A 1YS2X 2VNKA 3RC7A 1ILEA 1YBHA 2CD9A 3CFYA 3DE6X 4W5WA 1R0LA 2YXEA 5LNK6 1NV8A 1GIAA 4N39A 1OU0A 2GKSA 2P8SA 1VPTA 2EX4A 4Z1MD 3LPNA 3C7TA 5DGXA 3ENWA 4AY4A 4F06A 2FSFA 1KJIA 2IU3A 3KG2A 4G97A 1PEKE 3D2LA 1QNLA 2LDBA 1TUEA 2ZM5A 1C0PA 1L5NA 3EIHA 4NV3A 3U4HA 1N7HA 2YZNA 1CX9B 1GU1A 5EZQA 3S8YA 1C5KA 4QXOA 1O89A 1DBRA 1RWKA 3EXHB 4I50F 2XQGA 3T34A 3UJ9A 2H29A 4EL0A 3ZE9A 4U00A 4DA9A 4J0JA 3LHKA 4M0UA 1E4YA 3B5JA 2XA2A 2CLCX 1BRMA 4NZNA 2ZT7A 4RESA 5G41A 3TLXA 4IS3A 3ZQUA 2F17A 2JEOA 3ZZMA 2A0WA 1MFPA 1UBOS 2GHTA 3J80A 5I9MA 1X1RA 1G291 3FJOA 4NU5A 4EAAA 4FGUA 1KF0A 1WB4A 4JLPA 4XYBA 3UEOA 3L8MA 1WZNA 4YH1A 2FI1A 4RPIA 1N2ZA 3S2GA 4RE6A 1PU2A 5H8WA 2RKBA 1T3TA 1NUHA 4PBRA 5GOTA 1IUPA 1XNQB 1M1XB 4JT9A 2NG1A 2GEJA 3OQ6A 4QU9A 2FKAA 4IJWA 5EYPA 1TL7C 3UWKA 4D25A 5I7UA 1NXPA 3VAYA 4AMVA 3D81A 4L75A 1IXRC 1GAWA 2ECFA 3L1VA 3RAPR 5JQGB 1V7ZA 4QDJA 3EMDA 5JWHA 3TB4A 2GRAA 4BPRA 2C1ZA 2Q1SA 2HA2A 4MPJA 3W3ZB 5AW3A 2R1VA 4YTEA 4YUXA 3ZV6A 3ND6A 1SCQA 1IN7A 4TTPA 4QYWA 1WNFA 1QQAA 1W4ZA 1C3XA 3MQFA 5LB2A 1G8SA 3IAFA 1JALA 1N2HA 1QANA 2QM8A 2H4WA 2SECE 3M3HA 3L79A 3QY9A 4M7PA 3MSXA 2P7IA 3W5UA 4KI7A 3NP7A 5DCWA 3EGDB 2HQ1A 2W5UA 3T5AA 3S1LA 3L93A 2VHVA 5HJ2A 3WFZA 1EXVA 4C0WA 5A4MS 2AJBA 4OX9B 1SOMA 4XQ9A 1EWYA 3VM6A 4C7BA 4ENSA 4GD3Q 2Q6KA 3MS4A 1FUIA 4HN4B 5IEBA 3H1GA 4GBMA 3PQCA 2BHLA 2UVDA 4UU0A 2VK4A 1ABBA 1G21A 2QLFA 2O8DA 4BEWA 2EZ8A 4TZ6A 4HMPA 3RODA 4MCIA 3V8RA 2A5DA 5AUQA 1XXHE 4XXHA 3M7IA 2WJ4A 2M6KA 1P4AA 3M70A 1XO1A 2G67A 2DJIA 3QKRB 5CTJA 5HMLA 4D3ZA 3IEMA 4R8MA 5CA1B 2QG9A 3W1VA 3GGPA 3QFFA 4CU5A 2K2QB 4QDXA 1X94A 5IT5A 3VZCA 3GIWA 1B00A 4LQCA 1X3LA 1Y3IA 1B4DA 2A3NA 1TJNA 3KV3O 1YFLA 2RAPA 3AESA 3MT7A 4H0NA 5T4EA 3RFXA 2QE7D 3VZSA 4Z6KA 3RVJA 3C6MA 1E69A 2ZE6A 1OLUB 4BPBA 3AR2A 5CT9A 2AEJA 1HDEA 3GUZA 3IJPA 5FHQA 1DNPA 2L42A 4PLGA 1NT2A 1NVTA 5B1EA 4NZYA 1CRPA 2D0IA 4EKDA 2OK7A 4AQDA 1YVPA 3BWCA 2V3CC 2CMFA 2IZ0A 1I14A 1Q21A 4ZI3A 5HF5A 2X14A 3F8TA 3NBAA 3ZI4A 3ZYZA 4F2HA 2O3RA 2VP0A 4MV7A 4NCHA 5EY5B 5K6RA 2BM9A 3G9ZA 1YSCA 3DV0B 5K0EA 3NHBA 2XVZA 4JU9A 2X2PA 6LDHA 1HLDA 1ZA2A 3BGVA 1GTSA 2QVBA 2G06A 1OI4A 3EAGA 4L22A 2JHCA 4LTDA 2UXDB 2ZIFA 1EWRA 1PZHA 5LBIA 4HWRA 4OYRA 2JLBA 1L4HA 2Q1XA 2W8BA 3VTAA 1SCBA 4NYIQ 4XDYA 1CD5A 1UAYA 5K3FA 5SYNA 2XNSA 4IINA 3GCWA 3D7KA 5H83A 2ZBQA 2PV7A 3EVFA 2K87A 4XIJA 4ZCPA 1UJ4A 4B87A 4LDRA 3ZE2B 3QMMA 4DLBA 4IOLA 3MGBA 1HYQA 1P4GA 4PO8A 4RV4A 2CWWA 1SHTX 5FOWA 1U9YA 1MJGM 2NN3C 4LSWA 2W2MA 5KNLA 2DGDA 3ZU4A 4M54A 3RSSA 1E7QA 3O73A 1U3GA 1XA0A 2G9UA 2YH2A 1Y8AA 2EFHB 3OCCA 4QULA 5LP6A 3O3MB 4WY8A 4ZT6A 3W2GA 5CIYA 5AIAA 4NBWA 1XQ1A 2HNAA 4QBHA 2V7WA 4MINA 1BHQ1 3LZCA 4KDCA 1FLVA 3QXGA 5GV7A 2H7YA 4HRYA 1JIVA 3RRBA 1WB9A 2GDJA 3AVOA 1ZD2P 2QS9A 3QXJA 4ZYTA 1N9GA 2PD3A 2L18A 1ZZEA 2G9VA 3NNDA 4UNRA 1IHOA 2FWPA 5BWLA 3QFCA 1T4MA 1J8DA 3GRYA 1UT5A 3ISTA 2A78A 4EFNA 5J4HA 4WBXC 4CKCB 2A30A 3CPSA 4G63A 3SHFA 4EYQA 4CM8A 1R4NA 3PQEA 3QNMA 5HSGA 4NZOA 1QLWA 4H7EA 3BMQA 3DAGA 2IFTA 1A9XA 4O4LB 4LE1A 1T1JA 5DLEA 2Z08A 4NYMR 4KR3A 5FPQA 3N2GB 2GI4A 1MF7A 1W34A 4YEDA 4TV9F 2Y99A 3VHLB 4RQUA 4YRNA 5E7IA 1H4VB 4E70A 3VX4A 2JZCA 3GLFA 1E4EB 2Q50A 4H7KA 3EPLA 1WDLA 3RYIB 3ZY6A 2FMIA 4MW0A 3IDAA 5E3JA 2ZUCA 4ZVSA 4CR7A 4RKRA 6Q21A 3NOOA 2QIOA 1JF8A 3A4VA 1WULS 3V00A 2NU7B 2VUHB 4QRIA 1WHTB 3G0HA 4K9DA 2F43A 4P58A 1IZYA 2QMOA 3ZQ4A 1P80A 4RD3A 4BP3A 4YV0A 5J59A 2UXBB 2BMAA 3V34A 4XPIB 1YULA 2QW8A 4D1YA 2IHTA 4OOEA 1BS9A 2AQHA 3CSDA 3D5TA 1JR6A 1TU4A 3AKYA 3K0HA 4GKJB 1L9KA 1KMQA 1YOVB 1XYYA 1Z12A 2IA5A 2P6NA 3PIRA 3C3KA 2CFOA 4MA4A 3FFTA 3THXA 1IQUA 3J7AC 3RG8A 3K94A 3IEXA 3MK31 4KKVA 2D0PB 3C6BA 3DJFA 3NHSA 4MV3A 1CUSA 1HTWA 3WK7A 1Q3HA 1RXSA 1VQ1A 2CB9A 3D31A 4YAWA 4EI2A 3LUPA 2C7OA 2VRCD 1CIJA 3KTAB 2MSDB 1WU7A 4J7AA 2R4QA 4TGLA 3YASA 4RCVA 5L3SB 2XCOA 3OLCX 5H02A 3EDMA 1BOFA 2G3YA 6CHYA 3QQPA 4L2IA 1TO1E 5IDYA 1U0SY 4IEFB 1PK7A 4RVHA 3RFFA 3SZ3A 1KRXA 4ZCTA 4ZVLA 1CE8A 1ZM9A 1UK9A 1ZN8A 4PC6A 4FYYA 1NYTA 4U6QA 4YJHB 3FNFA 4MQMA 3V8NA 5LU8A 4DF3A 3ZDQA 1S8FA 3WGIA 4DTCA 4J6EA 2H2IA 1XYVA 4IOJA 4ZFNA 1DT5A 2AL7A 2ZU6A 1XU4A 1NI4A 3AERB 4M1OA 2JB9A 3GN2A 4LFAB 2YIDA 1UMDA 3BH6A 3E5RA 4R69A 1J06A 1QB8A 2F3QA 5IJAA 2ZT5A 3SSNA 2P4QA 4M1WA 3LBNA 2QD5A 2FWAA 4MB6A 3JALA 2Q9BA 4OLJA 1UPXA 2V9PA 2JJ2D 3IYLW 5CR9A 1G21E 2QSZA 4MQ4A 3LV8A 3CWZA 2VG8A 4E2ZA 4JUFA 3TZBA 3ZZ0A 2JLRA 1I2BA 3DEAA 3FH0A 3SBXA 1Y48E 1KU0A 2GBIA 5C35A 3MWEB 2XCQA 4BYMA 5TSDA 5K3OA 2JI8A 1T9AA 1TKAA 2PYZA 3KZXA 5IJ0A 3OQNA 4JUCA 3WBBA 2JBAB 3DZFA 3WLLA 3O7MA 4W82A 1UOOA 3BMXA 1W75A 2XKBA 4DCUA 1SHUX 4ZHQB 2HO5A 4Q9LA 3FNQA 3KWLA 4HGZA 1D09A 4J2OA 5JSQA 3KDAA 3OBIA 4AMGA 3K9FC 3HXMA 1TT7A 3G0BA 4C07A 3RYFB 1HYBA 4K87A 3HXTA 1YD7A 4ARCA 3TX6A 1WW8A 4JLAA 3BGSA 3MJCA 2FFAA 3MIIA 1L5KA 3QVUA 4FFRA 4MVJD 3L05A 3MMSA 3OQJA 4TQGA 5JVDB 1Y1LA 1UBLS 2H11A 2WM9B 3FCEA 3OEEA 3PUIA 3WY9A 3BE5A 3IDFA 3IUQA 4Q18A 1VE9A 2HU8A 2W93A 1A5BB 2FZKA 2HA5A 1V1RA 3VH4A 1JQAA 3C5CA 4F85A 1J07A 4BB6A 2V6JA 4CG2A 1U0JA 2GBCA 2W43A 3ETHA 3LVQE 3KJXA 1H6CA 2EDCA 5CBKA 1CKEA 1PCXA 3DVAA 3HCOA 1AUQA 5H1YA 4N49A 1V71A 3VJMA 4JLDA 4PG6A 4IDFA 2C29D 4ND6A 4D41A 3ICPA 5E7QA 1V39A 2IXDA 5FX2A 2X86A 2QRLA 4F45A 5LPNA 1K6IA 3K96A 1MZPA 4FHFA 2Q0QA 2HA7A 2ZBPA 3FSGA 3L7YA 2X9LA 1UBCA 3K71B 4KWTA 1NG9A 1T3ZA 4KW7A 5JD4A 3FWHA 1IRXA 1KVUA 1MX1A 2UUPA 2Q4EA 2V6BA 5C7LO 3B2NA 3L6BA 4F5ZA 5ELXA 2I4IA 3D4OA 4YRSA 5JZOA 4F93B 4Y67A 3F0TA 2R8OA 4NKRA 3IX7A 1BDHA 3BSSA 3E27A 2ZULA 1X80A 4YRKA 5DHUA 1SZPA 4ZZ1A 2WHEA 3CJTA 3HR7A 4WADA 5AK3A 5CD9A 4U7TB 1KVSA 4I1UA 4RCZA 2FFHA 4EFDA 3BXFA 2AZXA 1H8ED 5CVDA 4EOGA 3GRFA 4PX3A 2ZJZA 5FBQB 4QGGA 5ITVA 1ESNA 1XE3A 3HDVA 5G3ZA 1DAPA 2H4ZA 5G53C 4Q1DA 3WLJA 4CF5A 4DNPA 1JTFA 1KYVA 1N0UA 4O2BB 4TVBA 4AUKA 3IAM1 4DA4A 4XD7D 3VO8A 4A8TA 3RHSA 1VCNA 2XWBF 2W0MA 4KXQA 4BB0A 3DW3X 4X1IB 1B93A 2NU9B 1REQB 2ZQZA 3H97A 1YS9A 3Q12A 3FBTA 3RKUA 2BM1A 3RVNA 5COQA 3VVCA 3WJAA 2Z5GA 3KZMA 2VJOA 2P62A 2J45A 2ZR9A 5JMOA 1C9DB 1PJCA 2YJ4A 3FTQA 4FWIB 4K9QA 2PKEA 3R5XA 4MDYA 5I5EA 3L0YA 4AJ4A 4Z0PA 2B6NA 3SHWA 4DR6B 1U2SA 4GSLA 2YXBA 3BFPA 3GLFE 3ZY4A 1XEXA 2O5VA 2Q1WA 2AVNA 4CM6A 2JGNA 4E1AA 1T5OA 4IEIA 4OHPA 4US0R 2B8EA 3G88A 3JYQA 4P84A 2JFHA 1V48A 1Z75A 1IBSA 4MI9A 1ELOA 3TFWA 1WA5A 2VT2A 1ZDMA 2I7DA 1HOTA 5G4LA 3STXA 1SQSA 3T7EA 1ACJA 1OLSA 3FTDA 3IJEB 2BTOA 3IVRA 2B8TA 3C7KA 4L4UA 2VAXA 2XMGA 3GRZA 4MB0A 4YBZA 4W5HA 2B1RA 4ZICA 2E4ZA 4LXUA 3D1JA 2YV5A 2JZNA 3N2EA 5DI9A 3EMVA 2LCIA 2O2YA 4ZTUB 2R11A 1MJ5A 1F6BA 4WK4B 4UVEA 3WYFA 2JAWA 2OBNA 3SQMA 3NBQA 1E1CB 3AEYA 3SAJA 2FSVA 2BRUA 4NWIA 4F2DA 5LLTA 3ANTA 1M72A 2H1VA 3WO0A 1SIWA 2FJ0A 1CUCA 4HYEA 3SS7X 4ESVA 5AOBA 1HDOA 2PA0A 4XX0B 5C1OA 5JNUA 2A14A 1TYBE 2HBYA 4M99A 3ZD9A 3AINA 1C7RA 2ECOA 1J24A 2QRKA 1NUSA 1ZSYA 2JLAA 1GRNA 5JZMA 3RNOA 3R1IA 1FVOA 1KQ3A 3OZIA 3DAYA 3NBUA 1KJZA 1T24A 5A1TA 4PPQA 4M8LA 2FZWA 2GN8A 4EF4A 1XQWA 1E2UA 2IDJA 1W5FA 2C3OA 3QMPA 4Q7KA 4HVCA 3GH3A 1Z08A 1J4AA 3E1KA 1M8FA 2IZ5A 2PLRA 2J09A 3W5AA 4UHJA 3GFSA 3IMKA 2JGAA 1U8TA 2WP8J 4L0CA 3PV0A 4RL6A 4L8GA 5CLIA 1KKMA 3RSFA 3LH5A 4E22A 5LQKA 3PL5A 3QIVA 1QFXA 1OGJA 2C2HA 4RTRA 4TVSA 3TLMA 4DY6A 4WCFA 4J4BA 4Q4DA 4U2CA 3HN2A 4PTYA 1I32A 2AWNA 4Y9RA 4KFUA 3OJOA 5AVKA 1U6KA 3CEHA 4DAEA 3S8MA 2JGIA 4D4LA 4OXYA 2OD9A 2XUKA 4HDKB 5CDUA 3JARA 4KYVA 5BXQC 5KNBH 2P9YA 5A7FA 1C30A 1GCAA 3I9KA 3PUYA 1XZHA 1WX1A 2D5CA 2SCUB 3K9QO 1A5SB 1DPFA 3KZKA 1CRWG 3ODPA 3G6WA 1AA6A 1I10A 4ECEA 3K6RA 4TT3D 4C0AC 2POCA 1BJKA 4AS2A 2B36A 4HFNA 5F1PA 1F38A 1XZDA 5C5EA 1OF1A 4QDZA 3F46A 3S2IA 5LZ4A 1VE7A 1XNJA 5F2KA 1I4DD 3ZK7A 3W9BA 1TLTA 1ZAKA 1OFUA 1QBGA 4JENA 2I2AA 2NXNA 1XDDA 2QF7A 2PLFA 3MCVA 4M1KA 4J4HA 3BSYA 3PC3A 1PGPA 2FWRA 2V4MA 4TXLA 4URZR 3MWJA 2QJFA 2GX6A 2O57A 2WD8A 3I3SR 1GFWA 2ISQA 3L0DA 4O8ZA 5H4HA 3WWZA 4MWOA 1ZGHA 2A7QA 3WIDA 2HQBA 5CEFA 1Q1AA 1NBOA 5CBPA 2X15A 3KEOA 5HZHA 2AMJA 4Y6RA 3GVIA 4MSUA 4RY2A 3ELDA 1ZGZA 1HETA 1LPBB 3MINB 4YRTA 3NC1C 4RMJA 2EKPA 5JDIC 2W6OA 2GPAA 2DSNA 1XJ0A 2NU6A 1JQLB 2AXQA 3E35A 2Y6VA 1G4HA 3N7AA 4WNCA 1HPLA 5JEEA 1L5QA 2AK3A 3U5ZB 3FWKA 1W76A 4IIDA 4N65A 4E4YA 3MGGA 2UXCB 4BAGA 2YIVX 2J6CA 2PANA 4QOHA 2H07A 1ML4A 1PJRA 3HA2A 1V5WA 3KOUA 5J2TF 1IONA 1RYMA 5FHRA 3MMPA 1P1CA 5DOZA 2XB4A 3UHPA 3V80A 2REXB 3Q7TA 1NULA 4WLNA 3V8PA 3AO0B 4PVCA 2QUIA 2TS1A 2EIXA 4UAVA 4LPSA 2ZUDA 1L5ZA 3PXXA 1FDIA 4YDQA 1XL1A 1IBKB 4KLZA 4LNUA 2WKPA 3TIIA 5JS6A 2PUTA 5JAMA 4IGEA 5IF3A 4LRUA 3WL4A 4BVJA 2IWRA 2D6FA 1UMCB 3OU6A 1CJCA 1Q3KA 3KR1A 3R9KA 5TY0A 2YVLA 2PMFA 4UZSA 3DVSX 1PKEA 4YCJA 5ILQA 4A3SA 2BFBB 3HCEA 2NPIA 1LBIA 4BRWA 1ZPDA 5C1IA 2DPXA 1RKVA 4NYMQ 1ODKA 2JCYA 4LIPD 3WLKX 4MUGA 2B1GA 1FXWA 3JWJA 3P96A 1VG9B 1AQLA 1OKKD 3OEHA 4YRRA 4BJHB 3R3UA 2C31A 2J33A 2PQMA 3A1UA 5KDLA 3QHQA 4M86A 4GG1A 2C00A 1JHDA 1WZCA 4RTQA 4LV5B 1SXJC 2QJOA 3ZNNA 3QKWA 4QU0A 1SMKA 2R5NA 1P0IA 4XRRA 5G1OA 3DXFA 3V9PA 3DDCA 4I99A 1TADA 1U0HC 2FN4A 3CNEA 4JP8A 5EL0A 5FLKA 2AUTA 2JFXA 3G2IA 4YS6A 4HEA1 1WSDA 3FPAA 5CK4A 5CT5A 3X1YA 3A05A 2YHIA 4GRIA 1P5HA 1BE6A 2A1IA 3CLTD 3ZE6A 4KV7A 5JDCA 2HTEA 4WMLA 4BEVA 5DP1A 4C06A 4UCFA 4BOYA 2D74A 2EKZA 3DFKA 3JWHA 2UZ4A 4MYDA 3FRJA 3VSDA 1MLDA 4D46A 2V74B 2A1UA 4G4JA 4ZANA 4ZYWA 2OAGA 3JYPA 3PGMA 4PICA 1ETUA 1KQGA 2FP4A 1Y3CE 3M81A 3IBYA 2OUKA 2QTAA 1JAIA 4X7RA 1HE1C 2LWIA 2HA3A 4RBNA 1W96A 2PYDA 4LSMA 2AX4A 2AXPA 5ESWA 2D3TA 1KJ9A 3C4VA 2VRNA 1JBKA 1OUMA 1YR7A 1N5RA 1LVHA 5KYNA 1K5DA 1YE8A 1OW3B 1BWQA 3CIFA 3OTGA 1DRVA 4GFDA 1VXRA 2PL9A 4TLMB 3EVBA 1UQRA 1A9QA 4CCYA 1COWD 4CEJA 1GG2A 1W5EA 2I6GA 1VOTA 1PZGA 3HR4A 1ND6A 4MW9A 4L8LA 3OM9A 2QUAA 2YVUA 3EW7A 1XD2A 3UMGA 4E5DA 3V4PB 3QUCA 1QZZA 3C3BA 1E64A 4UBNA 1JR3A 1RKBA 3D8UA 3JQAD 1SKQA 3R3VA 4OOFA 1W6UA 3A9RA 2CT8A 1UXHA 1HX7A 2N47A 3ELWA 4F71A 2PT6A 1YU9A 5EZYA 2AC2A 5AVVA 4EL5A 3JWEA 3KKZA 3V1UA 4BBJA 4AQYB 5IAEA 1BU8A 3M0EA 5ALOA 3L04A 1ZAYA 1K88A 3D9QX 2J32A 2C04A 4FYHA 1YVEI 1Z6AA 3K5PA 1ZM2A 4EUHA 4F3CA 3CVVA 2I2WA 4YQZA 3EZLA 5ER6A 2C4NA 4LJSA 5TF0A 1E8NA 3TKYA 3R9XB 4X92A 2ZRLA 1AC5A 5EPUA 3GL9A 3D0QA 3FNIA 2RIPA 1V41E 2RARA 3I9NA 4IQ4A 4MQUA 4Q05A 2OZLA 3FYDA 5ALKA 3RCBA 3ZOZA 4ZK6A 2WA2A 2X3YA 1IU9A 2HCJB 4WW0A 3IQEA 2JIBA 4ZOAA 4N40A 2AZ4A 4FX5A 4G86A 1V26A 4XM2A 1QAQA 2JHAA 2VH5R 4JVOA 5AK6A 2X23A 1V6CA 4BO3A 2VHUA 1T8SA 3ZHRA 1OB5A 1F0KA 4M3NA 3GROA 5DX1A 4FFVA 1UM8A 5DNAA 1FX0B 1QYWA 3ZV5A 4ZYYA 3DF7A 3HB9A 2PSFA 1E1RA 4A82A 5CB4F 2ZRHA 7AT1A 2ONKA 4BCCA 3A6GA 1FRNA 2GPYA 4BV3A 1VBNA 3SYMA 1GU0A 1NSYA 4RW0A 1EFUA 1NMEA 1OZFA 3DUFA 4J0QA 4ZMSA 1KVTA 3L4BC 1U0EA 3LBFA 3ROMA 4REOA 1RSZA 4J03A 1TW3A 4JUIA 2HAEA 3ZHOA 3OFKA 1NN1A 3FUVA 5EKXA 3SJAA 4IDDA 4RS4A 2XNDA 2Q3JA 4LMBA 3R5HA 4DUGD 5HRUA 2P1RA 4ZQFA 1PJBA 3OQIA 1UF9A 3GRCA 3NNSA 1CTQA 3IVGA 3KOWA 3DC2A 2Q3HA 4NOKA 4YDHB 2B92A 1GQYA 2GVDC 2Y1WA 1XNRB 2P9CA 4X20A 3IT3A 1R9JA 1RIIA 4BATA 4MIYA 4A8JB 1VE5A 2IEBA 1F8GA 1PKXA 3PNYA 4CTMA 2W2LA 3ZWAA 3O2JA 2B7CA 3WVNA 2J0SA 4C4SA 3VHQA 4G5FA 4X0EA 3EQZA 3UWOA 2YJZA 4RCYA 2A88A 4FGJA 2XODA 1WKVA 2BFPA 3IIIA 3B51X 1E4OA 4PGMA 1V35A 4W5QA 2NTEA 2GERA 3J81A 2RMKA 4LZZA 1Z4JA 3UAXA 6REQA 4DPKA 4UU1A 1OLXA 4YMSA 2JGJA 1RQ2A 4N03A 3ADPA 3KU4A 4CG1A 5B4UA 5JQGF 1IPEA 1POXA 4JYMA 4NENB 4R71A 4IMIB 4U1RA 2NUAB 3FDFA 3K6SA 1FP7A 1JQ3A 1G1MA 3TLGA 4UW9A 5FUYA 5K2MA 3PHJA 5DYTA 2BM0A 1N1GA 1QCDA 1TCBA 2JFPA 4KGVA 5FUWA 3TZLA 4C0KA 5HKOA 4GVXA 2A4KA 1KARA 4FOPA 4ETNA 2HV8A 4F3KA 2PBFA 5JZVA 5HZMA 4EEKA 3ESYA 4M2LA 3VSBA 1U7ZA 2GKOA 3M6MD 2RI0A 4TL8A 1FTSA 2EU8A 2WABA 1E3WA 3PSAA 4FZVA 3VR6A 3WBKA 3DFMA 4P5PA 3WNVA 3WSWA 1AQNA 1SHKA 5ERYA 5C5DA 2RC5A 4G5QA 1FXUA 2VHXA 3S70A 3U1TA 4MKRA 2R6JA 1UJ2A 3G23A 2XYGA 1OBOA 3EF0A 2H92A 3RHTA 1M6EX 3NXKA 1QIDA 2CNDA 4QOJA 4R2HA 1ZM4A 4MUHA 3F8WA 4EABA 4F8EA 4AJ1A 2LP4Y 4XVQA 3RIYA 3PXGA 3DEFA 2DFVA 4Z9BA 4BNDB 2XCRB 2A94A 3UYLA 1RC1A 2LTAA 3WGHA 5EWLB 3CF0A 3UG7A 1Z8FA 2VPPA 2PZJA 2IH4A 1GM5A 1IN5A 3N05A 5AXDA 3HP4A 2G1PA 3G49A 1RAHA 4CMEC 2FSGA 3VU9B 1OA0A 1UBTS 5AKJA 1PT6A 2AFIE 5I6DA 1R6XA 4NARA 4ZO6A 5K0TA 3C15C 5J23A 1JNXX 4TKUB 5JCOC 5IAKA 3BRWA 4PYNA 1PWXA 1T9HA 2XE7A 2O2XA 3F4LA 3HSSA 4DM7A 3TJRA 1Z2OX 2O8NA 1WEHA 4A1OA 2WPNA 2Z83A 3E2MA 2FOIA 4GR4A 4ZU3A 1GY8A 3DT6A 2VEOA 2ZSEA 1JNYA 1U2GA 1P4RA 2I6XA 2AGVA 2VO1A 4PR0A 3KJHA 4JASB 4QRDA 2P4SA 3AFGA 3IMFA 2ATVA 2YZKA 4KUGA 4FMPA 1O6ZA 4NJOA 3EULA 4AJKA 3HKBA 4IAOA 1Y8ZA 2JNWA 1IMJA 2OO3A 4I9HA 1P75A 1ZH0A 2GM9A 3TDMA 4UTPA 4FXPA 3CCFA 1NQOA 3G9XA 1U99A 2AD1A 1LTQA 1WCV1 1Z07A 3M1YA 4IIJF 5FTWA 5ADWA 2D3WA 4ND4A 5TQ2A 3CRRA 1BAPA 3EY9A 2CZGA 5CXQA 2PSDA 2H5EA 2BEKA 1C80A 2VT7A 1JHRA 1VKOA 2RJ3A 1Z63A 1KAQA 1EVQA 1RWWA 2FB9A 4FPXA 1Z8HA 3D02A 1UADA 5IUJC 5CM9C 4CL2A 5JD3A 5JASA 1DINA 2QDXA 4EI8A 3UXEA 3X3HA 1ZJZA 1DHRA 4B5KA 3ROZA 2J9XB 3NRCA 4ARVA 5BSVA 4YRZA 4MV4A 2DPMA 5TRTA 4QYIB 2O2ZA 1RCUA 2XECA 4ODIA 4X85A 1ISSA 4YPFA 3GJZA 4NPHA 2O2JA 5D6OA 2NX2A 3QVXA 1CHNA 2YNMD 5ANRB 4KHZA 4AP9A 1XPOA 3FCXA 3LLSA 5I9IA 1U7TA 1RT9A 2BE9A 1ODLA 3Q3HA 1M6VB 2XZOA 3VOTA 4JDPA 1WL8A 1AB6A 4IVNA 2Z43A 3AUTA 3FGOA 4KWHA 5DTIA 5IDWA 3L4SO 1WWKA 2NO1A 4FFDA 4NU6A 3PHLA 4M7WA 4Q34A 4YAOA 5F5XA 4UQOA 1AQYA 2XUPA 1JDBB 4HLCA 4U0JA 2HDOA 4GIBA 3ZU5A 1NLYA 3VX3A 2FU5C 1QB7A 1WZIA 4HXFB 2CHEA 4O4LF 3WIOA 2CVFA 4NVRA 1STOA 2NT4A 1IATA 1YK1A 2D2FA 4RLQA 5DMXA 1XMVA 4LPKA 3ND7A 4EQ6A 1ZXBA 2XXAA 3GJRA 4LYEA 1DPGA 1KYTA 2Y1XA 5E6SB 2QN2A 3GZ4A 4FDLA 4Z4HA 4Y2HA 3PKIA 1U80A 4IFTA 3D8HA 4G4IA 4I9NA 2R8EA 3HDYA 5C18A 3KUDA 2NWQA 3PDWA 4HB4A 4KRYA 2I1LA 4BRZA 1A8PA 3RTDA 4DNFA 4ZDIA 1U1CA 3NIDB 3TZ6A 2QRNA 3PC2A 2I8LA 5TMDA 5BMVB 2Z56A 2ZJ5A 3JAKA 1M2EA 4G1CA 5F7JA 3HXLA 2ACVA 1SBYA 1XVUA 2DKFA 2PMWB 3H2KA 1O95A 3GVHA 3C3PA 4NBTA 1GZ4A 4O0LA 1T1IA 3X1JA 2IWHA 2RGYA 4HG2A 5AW6A 5DTEA 1FFHA 4XUGB 2F7SA 3EGWA 4CRWB 5K4GA 1Y7IA 1GR0A 1HZZC 1VHLA 2VP4A 3AC0A 3NETA 3GHHA 1XLUA 4HR7A 2PFGA 3A1TA 4DBLE 3OECA 1J39A 3IP1A 3L8DA 4F2WA 3EGEA 4TM7A 4WNYA 5FQNA 1W36D 2PN1A 3H1AA 3O9ZA 1FP1D 4P3OA 4TSRA 4TUYB 2A0UA 3PEVA 2PHZA 4GPEA 4CR8A 4U0KA 1QU3A 1FMFA 3RC1A 2D4HA 3HU1A 1RI5A 4Q19A 1T15A 5D1HA 1CDZA 2DECA 1E7YA 5LQCA 5HCNA 5IWCA 5C1DA 4LF7B 2WAMA 4QDTA 2WFAA 2G09A 4KACA 2FWJA 4J1TA 2IH5A 1RLOA 3T9FA 3ZW7A 1M6HA 3WK4A 2W0SA 1IHXA 4HNHA 1VKJA 3DPUA 1KIAA 2YJTD 3IB3A 5IEJA 2JIOA 2PKYX 2GFQA 4EIWA 1I24A 4FKMA 3QELB 1G19A 2AZMA 2QTVB 4HXGA 4Z99A 2FX5A 2WUEA 3O8QB 4M38A 5AI5A 5EESA 3U4QA 3I5YA 1CP2A 1H1TA 3IAM6 4MKZA 4L16A 3QENA 1OAAA 3PE6A 4EVIA 1K7XB 3DE3X 2CUKA 1ILWA 2HDHA 3EIQA 4B7CA 2X5OA 5FR1A 4O02B 4BFVA 3AEKA 4JEHA 4YV1A 1ZK0A 3D8BA 4M8NE 4PSCA 2WJGA 1MTZA 2GZSA 4GBJA 4A8PA 3JAWB 3ZWCA 1ZESA 5CFOA 1EAYA 1RWPA 3CWQA 4PRLA 4PZLA 5AM2A 5LDDC 3O8DA 3OX1A 1ZCBA 3PJEA 3OQBA 2GBFA 1SIBE 1SVMA 2J6HA 2WWHA 3MCUA 3QKSB 2FUG1 1ZNWA 2X0RA 1PJ8A 3Q7EA 4HFMA 4B3CA 2QPLA 2XIQA 3WKEA 4MS1A 3WQSB 3JWGA 3FPSA 4HWGA 5FPKA 4F6RB 2OV8A 1QX4A 1YQDA 2W8ZA 1EFCA 3DFIA 1YCGA 2OHJA 3CGWA 4Q3NA 2HD4A 1AMUA 4CM3A 3KSRA 4DIKA 1D07A 4FFOA 4R0NA 2HEGA 3G79A 3S27A 4EUNA 5L40A 3DAOA 4P8RA 4Y2RA 4RK0A 1KJJA 5KKNB 3IT0A 5F9MA 4ZHQF 1N8KA 1OU4A 2E3JA 1GGJA 2HWKA 5EXTA 2WAAA 3WQQA 3WK5A 1T4GA 1Z6GA 3I6ZA 4EB6B 5KVCA 5LZ7A 1O5OA 4JYPA 2COUA 1DEOA 2JLYA 3EVGA 2ZCVA 1O6CA 2CUZA 2CV0A 2I4TA 2Y76A 1MH1A 1NR5A 2QM0A 2PUEA 3PUJA 3LUCA 1OR8A 3ACCA 3LPMA 1RP1A 3PE4A 3LFUA 5SZJA 4QVIA 1EH5A 2NUPA 3HVKA 1PEDA 5BNWA 1YB1A 2D0DA 3NAQA 3ITEA 1DAHA 2B1QA 4TLDA 1ADJA 3SSMA 1PSDA 4BIIA 1XLTC 4GVPA 4N6OA 3GRRA 4DV3B 4FTWA 5CLJA 5LOVA 2BGGA 1F0YA 1Z22A 4RVOA 4X71A 3CNLA 5JZBA 1DCFA 1OIXA 5BQOA 3CT4A 3T3GA 4WBNA 3GLGA 1PSWA 2OGSA 2HIMA 4JC0A 1RZUA 4MUFA 4DDUA 4H6PA 3WFIA 3PLAE 1E0KA 4ZT3A 1G5IA 2JLZA 3HXQA 1M7BA 1NRWA 1QHYA 2OXEA 3GG9A 3VNUA 4YQEA 4NMWA 1WDKA 3LK6A 4XAQA 4BECA 1V2GA 4L74A 4Y2XA 4JI0B 2Y0CA 1V5EA 4C14A 1PT8A 4BYGA 2B5VA 3KCNA 5C4IA 4DM4A 2JIDA 1I51A 4XVRA 4B4WA 2CNWA 4UATA 4FNOA 3GLQA 3H99A 3O4FA 3OY2A 3WGJA 5DBGA 3FPLA 5CJJA 1P29A 4ZKDA 1ZCAA 5CIQA 5DLYA 3CVUA 1YZNA 3F6SA 1T0HB 2PL5A 1OI7A 1II9A 1NX9A 3BJEA 1NVKA 1GHTA 5HE9A 4ZZ3A 3UMMA 4ZREA 3CX6A 1A97A 4FDUA 5A3QA 5FTLA 5FLXA 1DJQA 5JD5A 3R7NA 3T3DA 4R1LA 3O3NB 3QTTA 4KMOA 2JI7A 1PJ2A 2YYSA 4O2BF 3M6VA 3TNFA 1BO6A 2Q07A 4XUCA 5JY6A 2I34A 4M89A 1W73A 2FE4A 1XTQA 2AXNA 3N0WA 3CX4A 4M88A 3EXFB 4IILA 2VTVA 1C1DB 4PG4A 4DR1B 1THGA 4P7FA 1H8HA 4OL0A 1Y1SA 5TNXA 4D0SA 1I2AA 1WBBA 2IUTA 5JSZA 3BTOA 2P4HX 1PL7A 1TAGA 2VAPA 4CFZA 4DIUA 2V8BA 2PGLA 4UNNA 1GYPA 2DQ4A 1DKUA 1A96A 1M1YA 3L7KA 2RKWA 3ZDXB 2FWBA 2WJAA 4B71A 5K03A 4N5MA 1UBHS 3FNRA 2OGTA 4JC4A 4MV5A 4NAHA 5FD8A 4K3UA 4JI5B 1GR1A 4XD2A 2WG2A 2PQ2A 1CPYA 3B2QA 1Q2UA 3LFHA 4KX5A 2ODTX 2FW8A 4LW8A 1JB1A 1RM4A 3VTZA 5BSEA 1JLHA 2BD0A 4I4CA 5KYXB 1TVEA 2G71A 3H5TA 4OBWA 4KQ9A 4OFWA 4U7GA 4XOIA 2R60A 4YWHA 2R8RA 3GFFA 4MRNA 1TYAE 4QU8A 3WGMA 5C5CA 3I28A 1VKHA 2IXFA 2FEXA 2XE8A 1EVEA 4PSAA 5J1SB 3EW9A 1EE9A 3BT7A 3PUWA 4K6HA 2P3QA 5KYYA 4OKSA 3R5TA 1Z68A 1SOWA 3AY0A 2ONYA 4D4JA 5HJ7A 1SBTA 2ZRIA 1RAEA 3OF3A 2DBYA 2DUJA 4IH4A 4PHTA 4LXXA 2GD2A 4PTZA 4V3CA 1E2HA 2GR9A 4JQSA 4YB8A 1MO5A 4YRLA 5DKFA 2MT9A 4X1YA 2XBLA 5HJEA 3DLAA 3F90A 3MD9A 4Y2VA 1TTPB 1YA8A 2PVCA 2YIMA 3AIIA 1ICIA 3S28A 2JGDA 1A0OA 4EG1A 3N75A 4KLAA 4LTNA 3KKNA 4GZ3A 2P9QA 1GQFA 4LOLA 4R2IA 2LIPA 2PR7A 3WK9A 1Z2NX 4C7XA 2HJHA 1GTVA 5CGQB 4QG3A 3SXPA 1JVNA 4ZPJA 2HHHB 1P4JA 3VYVA 1EA5A 1MUUA 1C3JA 2YOGA 3EHDA 2IF0A 2CBGA 4PS1A 1WPGA 5DGIA 3CY6A 4BZZA 5A62A 3B82A 1GDTA 2BN4A 4YP9A 4GM1A 2VSQA 1CVLA 3ZHVA 4X97A 4UPVA 1DXQA 4ZCRA 2Q3FA 4J7CA 3KZNA 1D9XA 4IY1A 4R3UC 1Z3CA 5BSUA 2HMUA 4UM9B 4GNKA 3K9NA 2OCXA 2V6MA 1PD1A 2PAFA 4KIWA 3FNHA 4RYLA 2KQUA 3SCZA 2OZKA 2X9GA 2Z9BA 3HVJA 3QFTA 1JSRA 3SXJA 3UMRA 1Z5ZA 4YI3A 1E6CA 3LVBA 4ZI7A 1XK7A 4Q3OA 4F1WA 1KI6A 4G25A 5EQDA 4LAFA 2CXQA 1XHEA 2QTRA 3K7EA 1F6WA 4FW9A 1DELA 4AD8A 1SCJA 3TW8A 1XPRA 3DDHA 4L5JA 2HPHA 1FU7A 2Y93A 1BDIA 3Q10A 1W35A 3ZR4B 4CLOA 2YFQA 2I8CA 2GNAA 3IOYA 2IEYA 3QH4A 3NOQA 4DDTA 3G3EA 3FAZA 3JW8A 2CCGA 2ORIA 4CEIA 4KUHA 5EYPB 2VDWA 3KIPA 2IHKA 1GPKA 2JEZA 3AG6A 1HTTA 1QGAA 2G80A 2XMZA 4F2PA 1MQAA 5CB0A 4QM6A 1Y37A 2ZJ8A 3KQMA 4L8WB 4XVHA 5T7BA 1NUTA 3QPAA 5A2QA 2IP1A 4IYJA 4OI1A 5T3YA 1NBME 2JD0A 2F8MA 4UQPA 2H5LA 3VSEA 2RGAA 3THSA 1E2MA 2WV7A 4M87A 3MTJA 3VI3B 4CMKA 5ARBA 4DA0A 1CS0A 3BHNA 2J4FA 2OAEA 2P5UA 1GPAA 3GGCA 1XWFA 2ZS7A 3GEGA 2XT6A 4Y6SA 5DW0A 2QQFA 2QU7A 4B4DA 5HFAA 3BGOS 4KSYA 2ZS9A 1Y82A 2Q5EA 2RGNC 1T9GS 2ECQA 2Z30A 3HLYA 3R74A 3TIFA 2R7AA 3EZXA 1VGRA 2VJLA 1A7KA 5H4GA 3GLHA 2HC9A 4LRXA 1FUKA 1QG6A 1CUFA 3CHYA 3KJEA 4MKHA 5EOVA 2IEAA 3U3DA 5EJEA 3ZUPA 1E79A 2P35A 3STUA 4LQ4A 2C20A 1WR8A 3ABRB 3ZKWA 3OZTA 3IBGA 2XMCA 1JG1A 5HF9A 1MIHA 2PGOA 2QMZA 2FFRA 2XDYA 3DM5A 3N6XA 4FGKA 4MCAA 2CXNA 4CZ2A 2P5SA 1GTRA 1G21B 4FOLA 3Q2IA 2VYNA 2IGTA 3PNSA 3VKHA 2D62A 3DMYA 4L5CA 3D59A 3ZQJA 2FX2A 4EBFA 2VYFA 2WBLC 1E5DA 2ORYA 3H5LA 1R3DA 4V1CI 1G59A 3AHHA 3NWPA 2EJVA 3TEMA 4RTPA 4N6GA 1XK6A 3L4KA 4YROA 1H2BA 1JZQA 2A33A 2GBPA 1ZI8A 3N70A 4AFNA 2BHNA 3LOQA 2PWBA 2KW5A 1KERA 3AESB 4R40A 4ABTA 4WJLA 2BMJA 1U9IA 3N8DA 3H04A 2CLMB 4AP6A 3NGLA 1KJNA 2VH2A 4KO3S 4NBKA 4NHEA 3SICE 4CUJA 1DWOA 5B6IA 3ZY2A 2VXYA 3V97A 1WM1A 3ZDBA 2VZ8A 1NVBA 4FZRA 4YJKA 1SBQA 4C2UA 2CVHA 1E63A 1U4NA 5ALLA 2D2VA 3E03A 3STTA 4CETA 1J8QA 2YXDA 3DB2A 3DL2A 2ZDGA 5H3HA 2LCQA 1ZHFA 3RVLA 4GWKA 2E7ZA 4JOQA 3DBHA 2K5UA 4NAVA 3ZZTA 4RIEA 3ZIAA 2RHTA 2AHOA 2JIPA 4A92A 4X45A 1YR9A 2CF6A 1N2CA 4LKRA 2OQ2A 3TRFA 4HDSA 3I64A 3KWJA 2FPLA 2CVQA 2W8BB 1X7HA 3PITA 2AQIA 4LXTA 5K3FB 3OFJA 2QTZA 4P9NA 3V4SA 2H2DA 1JG2A 3EC2A 3M9LA 3KQKA 3KKMA 3CH5A 1IK6A 3DOOA 2ZSAA 3V32A 3IE1A 2OB2A 1OFHA 2ADMA 2G4VA 3EZNA 4DA8A 2PO5A 4XIIA 3A7EA 2GYVA 3ROXA 4DOMA 4FT4A 3AVWA 1FX1A 4TTRA 2BJHA 3PQ5A 4MV8A 4GOJA 4C6TB 3HRHA 3BJMA 4C0QC 1RLIA 4C5CA 1JQ5A 3DR5A 5KWSA 4H4DA 5LP6B 3MGCA 2VPQA 4PLZA 2XGMA 3C70A 4Q9NA 1SCNE 3CLTC 2WWRA 2X58A 2ZTHA 3G82C 2IGBA 3P4UA 1SXQA 1N2GA 1E4VA 2FPPB 4CPDA 3KE9A 1T5SA 4QPJC 3WNDA 5CNJA 2WMYA 1GKUB 1JSCA 2OCYC 4MKGA 4OH7A 4D9CA 2H1OA 2XJ9A 1EK6A 1JG6A 2QW0X 2ZITA 1VRCA 3GVXA 1P31A 3HGMA 5CFRA 4TVOA 2W2QA 4B45A 4DR5B 3U40A 3RS3A 2A5YB 4POOA 3V42A 4LGYA 4CM8B 4D98A 3HG7A 1XN1A 1R4NB 3F71A 4O8CA 4DSUA 3GJ8A 5JI3E 3BMQB 1A9XB 1DXYA 2H2HA 2VNIA 2V0CA 1LRLA 4RDCA 3VH1A 3WGKA 5LDGA 5JROA 4A6DA 5G4KB 5JAHA 3OWXA 5ALQA 2RC6A 5KCMA 4B0PA 1I80A 4E0BA 3X1KA 2PFSA 7MHTA 5DDIP 5AW4A 1QVVA 3QWFA 1BD3A 3ME5A 4TRRA 3QLEA 1W9MA 4XVCA 3NXSA 3F1KA 2Z2JA 3AXSA 3UZUA 4WA7A 2RH8A 1A88A 2HPVA 3IUJA 3VVBA 4P3XA 4O4IA 4EECA 2KLHA 3D3JA 3J7TA 1LDMA 3U7RA 4KFCA 1J6UA 4QYTA 4HSGA 2M32A 2B82A 4F9GA 4R3NA 3KQNA 1WBJB 2YHAA 3QPWA 1U7HA 3ZGLA 1G6Q1 3QBEA 5IUNC 4MUJA 4UVDA 4WCDA 3K1AA 4PYKA 4I9UA 5KTNA 2XYQA 3JD4A 2YC4C 3IQZA 3NDIA 2F43B 1PS8A 4KR9A 2X42A 3ZJVA 2GEDA 1NONA 1QYIA 1EUCB 2QIPA 2ZB8A 3EXG2 1DAOA 3AUUA 3EZ6A 5BV8A 4KBFA 5D85A 2NUTA 2A9QA 4PC2A 3C43A 4RHTA 2IUSA 1E3MA 2PZMA 2ZUUA 3GBSA 4KITB 4G5OA 4GL2A 2WB4A 2DFPA 4QHTA 3UWPA 5ICMA 3THXB 2ILVA 1U2DA 2AK2A 1Q6YA 3W8DA 2GD1O 5IZCA 3GJ3A 1ZLXA 4CMIA 5EXXA 2ADFA 4RLSA 5FUXA 4BKUA 2IVFA 4GPBA 4Y18A 5AP9A 3OLZA 2XCTB 2IJGX 4TXMA 2HYDA 2GSWA 4GR5A 4OQQA 1OXVA 4Q47A 5HTOA 3MAJA 3DE2X 1DQNA 3SM9A 1H3EA 2W2OA 4UBKA 1ZSVA