3PE6A

Crystal structure of a soluble form of human mgll in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
289
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWAPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Monoglyceride lipase
publication title Crystal structure of a soluble form of human monoglyceride lipase in complex with an inhibitor at 1.35 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 289
sequence length 289
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe6A00
1LPPA 4E14A 1YCDA 3JYHA 1MAHA 5CH8A 3D0KA 1ZIYA 2QT9A 5AJHA 3ZLUA 4ZV7A 1KU6A 4RNCA 2DCMA 4DNPA 3G9XA 4RE6A 4KYVA 2ZYSA 4UBJA 2Y2UA 4KRYA 4G4JA 3MGAA 2DHEA 1R1DA 2JGKA 3BIWA 4CFSA 2H1IA 4IO0A 4X90A 3LIIA 1UKBA 2BAGA 1VZ2A 3WYDA 4YK7A 5JANA 4DM7A 1N8SA 3STVA 1YASA 1DTEA 4H7FA 2XMBA 2WU3A 3T52A 1EH5A 3F9CA 3FYUC 2IIVA 5HFNA 3S2ZA 1DWQA 2XUHA 2XUGA 4CIAA 1UOQA 4ZGBA 1DWOA 3BXPA 1ZJ5A 2BUAA 5AOCA 3JWEA 1XFDA 4UHCA 3FYTA 1CUEA 4HAIA 2XT0A 4EBBA 4DNOA 1QIMA 4BE4A 1QLWA 1CUZA 2WHPA 3C8HA 1K6EA 5ALNA 4G5XA 4KRXA 4G4IA 1E5TA 1EINA 1TIBA 4WDQA 1MU0A 2B9VA 4BAUA 1GQSA 1LBSA 1MT3A 2GZSA 4UFNA 5H3HA 3RK4A 1XQWA 1E66A 4TPKA 5T4HA 2HA4A 5FOQA 4IH1A 2OLEA 5A2GA 3RKSA 3ANSA 3B5EA 4ZREA 2EDAA 4BVKA 5AKYA 4Y2PA 5AKXA 3QMVA 1X70A 1EDBA 4BC1A 4YX9A 3VJKA 2XUIA 5AOAA 1UOPA 5EGNA 4UHDA 3FLEA 1ZD3A 1VKHA 1XRMA 3VISA 1E8MA 4LXGA 1QIFA 2RONA 1L7AA 3NUZA 3ZWQA 2WUEA 5CT6A 3ZLVA 4KAFA 5HF9A 2ZSHA 2VA9A 4FKBA 2V97A 2GYVA 1HQDA 4Q3OA 3G9ZA 4QLOA 3ED1A 1FFEA 3C70A 3KOOA 2OG1A 3BDIA 1XZJA 4MEAA 1FJ2A 4C87A 4W1QA 4QLAA 4HXEB 2WHRA 4AQDA 1Y7IA 2C5GA 1W4LA 2P8SA 5I7UA 4B84A 4CCYA 3A2LA 3F8SA 5AM4A 4OSEA 2OAGA 5AP9A 2JGJA 2QJWA 3AILA 4MEBA 5A6VA 2VQ6A 4J0IA 5A7HA 4G9GA 5AM1A 5K3AA 5CH5A 4K6GA 4C4ZA 1DX4A 2WUDA 4UBMA 1P0PA 3A6ZA 4GW3A 5JZBA 3SWWA 3AIOA 4MJ3A 4HVTA 5LZ4A 3KD2A 1QIDA 4EY7A 1AZWA 1MPXA 4P93A 3G9UA 1F0NA 4AO8A 1E89A 5CW2A 4BCCA 1BROA 5DNVA 4BP9A 2EDCA 1USWA 4UHBA 1PFQA 5AKJA 1XLUA 3L1IA 1CQZA 2QXTA 4FMPA 1ACJA 2VTVA 2X8BA 1LLFA 1ZJ4A 4P92A 4UBLA 2WTNA 4FLFA 1AKNA 3NOXA 1BCSA 2WJ6A 2GBCA 1O6GA 3FVRA 2HU8A 3R0VA 4X91A 4GECA 3WI7A 4UUQA 4TVKA 4H0CA 5AI5A 5HZGA 2XI4A 4L9AA 4H7EA 5A62A 4AB1A 2WIFA 1EB8A 4K5QA 4HZGA 2PPLA 3V1MA 1YAJA 5ALLA 2PUHA 4KE6A 4ARAA 1U8EA 2WHPB 4RPCA 3VXKA 5JALA 5FPQA 1LNSA 1XRLA 3WKEA 4EY5A 2GYWA 4X93A 4DSAA 4WFKA 2CEKA 1LPAB 3IULA 1H2YA 1GPLA 2VSQA 3HEAA 4H77A 5LKAA 3R3XA 4Y2TA 1JU4A 5K5EA 3CXUA 1ACLA 1U65A 5D3ZA 5LZ2A 1X2BA 2AJBA 3NWOA 1Q84A 5AH0A 1ZOIA 4IH4A 3HABA 2OAEA 4K6KA 4OCZA 3YASA 2G4LA 3WL8A 4FTWA 1QIIA 3ZI7A 4J0DA 4OU5A 4KEAA 3M3DA 3I2KA 3ESAA 1AUOA 2WKWA 4J0CA 5C8VA 1EXWA 2HA5A 3R3WA 3OC0A 4U2GA 4OB7A 5F4ZA 4KJXA 5DTIA 3G0IA 1UZAA 2OGZA 3O9MA 1AURA 4QDTA 5AK4A 1LZKA 4S0XA 5JD4A 1CR6A 1WPXA 2ACKA 4WFIA 2HADA 1NU6A 4X6XA 1EDDA 4Y2JA 1MO2A 2QMQA 2Y2VA 2CKMA 4YPVA 1CUSA 1AGYA 3STUA 4CCYB 5JAPA 2WG1A 3QM1A 1OCEA 4C89A 5ALYA 1ETHA 5CXUA 4WY5A 1W1IA 5I9IA 4H35A 1ODTC 1CQWA 3WK4A 5AICA 5E4JA 5FPPA 1XZIA 3DOIA 5CT9A 5AKLA 2IX9A 4MWSA 2I3DA 1BE0A 4UBOA 1XROA 1OXMA 3ESDA 3H2JA 4Y2QA 1Y37A 2XE4A 2XUDA 1QJ4A 1BEEA 3UMJA 2HFKA 3MUNA 1CUHA 2JGLA 4ITVA 2PSEA 4TGLA 1E8NA 2WIJA 4N5HX 1Q0RA 1ORWA 3DLTA 2GYUA 5JZSA 2FUKA 2ZSIA 2XQIA 4OUKX 3HRHA 3PF9A 1QTIA 3CN9A 3WWEA 1IUOA 2Q0XA 4Y2VA 4CG2A 5DYTA 3WQHA 2ZVDA 1ZGBA 2BUBA 5AKZA 5FLKA 2FJ0A 2DSNA 3HSSA 1EX9A 1MX5A 4UPDA 4BCBA 3AZPA 1MX9A 4U2FA 4BRZA 1XRNA 1THTA 3WKBA 4CI9A 2HU5A 5EFZA 3OG9A 3TGLA 4UBNA 3F98A 1WB6A 3IBTA 1CVLA 4Q34A 3R40A 4O08A 4UHFA 1JT2A 4JYPA 4BB0A 1EDEA 1JJBA 5LZ7A 4KAAA 4M0FA 2WILA 5HF5A 3H17A 4B80A 1I6WA 2GZRA 3ZPXA 1DU4A 2XUPA 3D4LA 3DDUA 1QIEA 5ALDA 4AO7A 5ALUA 1LPBB 1JJIA 3QBJA 4INZA 5AI0A 5JD5A 1JMKC 1GZ7A 3IVMA 1DQYA 4BTLA 1CUFA 1QFSA 2VAVA 1N5MA 5AI9A 4XIIA 1TRHA 3G0DA 5LLSA 5CURA 4CG1A 5A71A 1XZDA 5ALHA 1DWPA 2R8BA 3D3NA 3MVEA 5EI5A 1LGYA 4BRSA 4CCWA 1BU8A 3CN7A 3O9VA 4FLMA 3DCNA 3ESBA 4AX4A 4B0PA 4P08A 1VZ3A 2ZJ6A 4ROTA 3OTQA 4FFVA 4Y7DA 1A8UA 3HC7A 4FDMA 4W1PA 4X6YA 1SCIA 2XDWA 3AFIA 3AUKA 4HTAA 4AXBA 5CT8A 2XQGA 5C81A 1CUBA 4PW0A 3BIXA 3I2FA 2Z5GA 2R11A 3WJ1A 2WSLA 4ETWA 4X94A 4JNCA 5JYCA 3OURA 2ZYHA 2WG2A 4I4CA 4KE8A 5BOVA 2AJ8A 3IUNA 3G0BA 1O6FA 4ARBA 5LIPA 1SC9A 1CUJA 4F21A 1SFRA 5EIEA 1JU3A 2IITA 4B9AA 3C6ZA 3S8YA 1JJFA 5A7GA 2Z8XA 1TCCA 4H7HA 1QO7A 5EIAA 4HXFB 4OYYA 1UWCA 2JGIA 1BN7A 3HI4A 2XLBA 4I19A 1UXOA 5BV7A 1AC5A 3G9TA 1CV2A 2GBFA 3BWXA 1BRTA 2JF0A 4LXIA 4C4YA 2HFJA 2ORYA 3HACA 3W2TA 1H2WA 3HXKA 1EA5A 5HCUA 2PSJA 3D5EA 1JMYA 4EHBA 2PUJA 5E4TA 4MQMA 3DL4A 5JAOA 3WKAA 4GEGA 1WCYA 1K5PA 1R9NA 3BJMA 2OCGA 4JYMA 4M0EA 2I3ZA 2Z3WA 4A16A 3BF8A 5FV4A 3O4HA 3WK7A 1SCQA 2WHQA 2GBGA 5CBKA 2XUQA 3PI6A 4BTVA 2HDWA 3MUOA 3N2ZB 1T4MA 3DEAA 3ANTA 2EEPA 3GFFA 2VF2A 4NS4A 2DQYA 1LPNA 2WLSA 3AJAA 3Q8WA 2RAUA 4U2EA 5AM2A 2XMRA 3FSGA 3AINA 5C7YA 1UT6A 5J3JA 5HF6A 2B61A 2WUGA 3OOSA 5AKKA 7YASA 3GBSA 5ALPA 3DKKA 2WIKA 4X6UA 3QMWA 1QIHA 2V9ZA 2AJLI 2O7RA 3BDVA 3DNMA 2RI6A 1A88A 3UUFA 4F0JA 3STYA 1PV1A 4QA9A 3I6YA 2DR0A 3I2IA 2K2QB 3WWPA 5AI4A 1G66A 2YH2A 4PSUA 3PFBA 3I1IA 3PE6A 4H18A 1UK9A 3PF8A 3H04A 3FCXA 4F5ZA 4X3CA 4Q3LA 4FFWA 4YASA 3DOHA 1HKHA 3WL5A 1KU0A 1XLWA 4PO3X 1MNAA 3BJRA 3T4UA 3R3VA 3E4DA 2ES4A 4U2DA 3W9UA 1W75A 3FAKA 4C4XA 3TRDA 5K3DA 4BC0A 1OILA 1FFDA 1ZD2P 1XZHA 1U4NA 2XMQA 4XVCA 3WWDA 5AO9A 2QS9A 1FFCA 3R41A 4JEIA 4AMZA 2ECFA 5ALRA 5FRDA 5CXXA 5C8XA 2QZPA 5IVHA 2CUTA 4BVJA 2WTMA 4Q1VA 2C58A 4ZRDA 1CUIA 1VE6A 3OPMA 5ALWA 5IVIA 1QOZA 2PVSA 1TKRA 3K9BA 1YB6A 2V96A 5I8PA 4X95A 2C4HA 2Y1KA 3VDXA 1LPSA 1YS2X 2DHCA 3AZOA 1L7QA 2HA7A 4D9JA 3A2NA 2PX6A 4WDRA 3EBLA 2DFPA 4I3FA 5AIAA 4QDUA 1ORVA 3BL8A 5ALKA 1Q83A 3TJMA 4J0HA 2HL6A 1QIJA 1IZ7A 3F97A 5KBYA 5HK9A 5K3FA 5JIBA 4J0GA 1E8DA 4EY4A 3DQZA 4BZZA 2WQZA 4W1RA 1GKKA 1WB4A 4QEKA 5FXMA 4HRYA 2H7XA 4CIBA 2PBLA 3W04A 2ZJFA 4W63A 3B12A 4M0MA 1HPLA 4L0CA 1G4HA 1IZ8A 2OCIA 4P9NA 2FJPA 1RWQA 5ALEA 1F6WA 4JH0A 5AOBA 3STTA 3K6KA 4G1FA 5HQ3A 5SYNA 2V98A 1GGVA 1RYYA 3KXPA 4OU4A 3C5VA 1BCRA 6YASA 3M82A 4WJLA 5AHXA 2AJCA 4DMFA 2XUFA 4PQEA 5JARA 1QTRA 2AJDA 4BZWA 1AX9A 2AXEA 5JZ9A 4OB8A 1XRQA 5HKBA 1K8QA 3G0GA 3IURA 4C88A 4GXNA 4G4GA 3R3ZA 4G8DA 3QPDA 3EIOA 2B4KA 1HBJA 5AM0A 3C5WP 4Y2XA 5AK3A 4B9EA 1HLGA 3LLCA 1BEZA 4XJVA 5CH3A 2CMFA 2BKLA 2OCLA 4G9EA 3STWA 1GPNA 4AN0A 1H22A 1SOMA 5K3CA 3SK0A 5EHXA 5ALJA 2C7BA 3C43A 1UK7A 4OD0A 3D7RA 2QOEA 1DT5A 1TCBA 4UHEA 1XKTA 2WG0A 3F96A 1P0IA 1YB7A 1QIGA 2VATA 1MJ5A 2PL5A 4UFOA 3AIMA 4L3WA 4QDOA 3H18A 3I6MA 4KE9A 5LZ9A 4CG3A 3QMMA 5BWCA 3RLIA 1DX6A 3IIIA 3DD5A 1XZGA 3ILSA 2XMCA 3B3QA 4FOLA 3PUHA 3QPAA 3M83A 4V2IA 4BVLA 5ALIA 3ESCA 5K3EA 2HA3A 4QE3A 5ALZA 1G42A 3KWFA 2NW6A 4DMHA 4JUIA 3EF3A 4X71A 3WMRA 5AKGA 5AIBA 1ISPA 3WKDA 1T2NA 1R3DA 5HFAA 5T4EA 3H1AA 4FBLA 1CEXA 4KACA 2WUFA 4H7DA 3EQ9A 4PNZA 5LYYA 1J2EA 2BUCA 5D6OA 3C6XA 2CBGA 2PM8A 3PICA 4DYHA 1YSCA 3C45A 3VJLA 1CUGA 4BAZA 4J03A 5KREA 3ICWA 3DYVA 1BN6A 2H7CA 2QR5A 3H2KA 1FFBA 2WIDA 4W1SA 2XQFA 2D5LA 3U0VA 2OCKA 4QNNA 4GI1A 3FVTA 4HRXA 2XQKA 1R4ZA 4RE5A 1EVQA 3I6ZA 2XB6A 1EB9A 2WJ3A 1N1MA 2J3QA 4ZXFA 2RIPA 3LCRA 5IVKA 5SYMA 2QXUA 2BGNA 1IVYA 5K3FB 3VVLA 3WK9A 2O2GA 4Y9SA 3PDCA 1QO9A 3JW8A 1W6RA 2VJCA 1UKAA 5AK6A 2HU7A 4X97A 2DQZA 4MWTA 3PUIA 4QWMA 5ALSA 3HLKA 1MAAA 5AK5A 1EK1A 3TEJA 3FLBA 5ALOA 5HQ3B 3DJYA 4NVRA 2DHDA 4B83A 4K2AA 2G5PA 3W9BA 4ZV9A 1M33A 3FCYA 5ALXA 4Q05A 2YASA 3SX4A 2XUJA 4NMWA 2JEZA 3V1NA 4GDMA 5ALTA 3V1KA 1WOMA 2QUBA 4BCDA 2VT7A 1XQYA 2BJHA 3I28A 4FWBA 4LHEA 1UOOA 1EI9A 3BE8A 5FDFA 2QJRA 2X76A 5ESRA 2OXEA 4MQLA 1DT3A 3IUJA 4WFJA 1CUDA 3G02A 1VJ5A 3C87A 4B85A 4PSCA 4KE7A 2CJPA 3WK5A 1J06A 2JGMA 4U2BA 5DWDA 4GLBA 3H1BA 4QDZA 3DYIA 1QFMA 1IUPA 2HRRA 3GROA 5JASA 2OPHA 2VJBA 1CUXA 4RGYA 3LIPA 3WYNA 1GKLA 5IVDA 1XZCA 1ZGCA 1XZMA 5IH7A 2W6CX 3IA2A 5LZ5A 4ZWNA 5ALFA 2O2IA 3M81A 3U1TA 4QWWA 1XZEA 2PSFA 1WHSA 2W22A 2YYSA 3QZUA 4AZ0A 5K3BA 2CB9A 4DNQA 3DKRA 5AKIA 2OQIA 1GXSA 3V48A 2ZJ7A 2Y6UA 1AMNA 3QYJA 3R3UA 2BCEA 5ALVA 1C7IA 2O7VA 4QDXA 5KWJA 1YA4A 1XQVA 1VA4A 3I1YA 1Z68A 2OGSA 4F60A 4AZ3A 5AM3A 3WZLA 2PKYX 1SCKA 3FSGD 1YS1X 1LBTA 2OQVA 1R50A 2XUKA 3KDAA 4J0JA 2YXPX 2HA0A 3D2BA 4HS9A 4DSZA 1CFJA 3H2HA 1YA8A 1UK6A 4FBMA 1NX9A 3V1LA 1QZ3A 1CUVA 4BYMA 1IUNA 5EHNA 1GT6A 1K4YA 3G0CA 1TQHA 5BWBA 1K63A 4BATA 4NZZA 2Z3ZA 1QIKA 1VE7A 4UHHA 4GHWA 4FNGA 4PV7A 2ACEA 4H7KA 3H2IA 3FYUB 3IDAA 2BGRA 4PF1A 1B41A 1BS9A 1CLEA 3C6YA 1DINA 1TK3A 5D7BA 1EHYA 3HZOA 4BP8A 1THGA 1UK8A 2E3JA 5DYWA 3PFCA 1C7JA 2B20A 4J0KA 3WWOA 1RP1A 1UFOA 2WFLA 1LPMA 2G5TA 3WLAA 2XMGA 3RARA 4AN1A 1XRPA 5LKRA 4X85A 1CUYA 2D0DA 4AO6A 5AKEA 4DTCA 1XRRA 1EVEA 3VVMA 5EHZA 3EQ7A 5JAUA 1R88A 1VXRA 4X92A 3QPCA 4BAGA 3WWCA 3WIOA 4EUSA 4BBZA 5DTJA 2O2HA 4A5SA 2WFZA 3C8DA 3GELA 1S8OA 1TCAA 2XMSA 5DJ5A 3WA7A 5YASA 3VKFA 1A7UA 3E0XA 5DYYA 1P0MA 2J3DA 1ZI8A 5KWIA 2OGTA 3WA6A 3K2IA 4J7AA 5E4YA 5CTAA 2XUOA 5FUMA 1G5FA 2VAXA 3WK8A 1FFAA 4OYLA 4GWLA 3SC2A 4UBKA 1GPKA 1XZBA 2HHAA 3DL7A 2C0QA 3E3AA 1YR2A 5LZ8A 3WL7A 1W52X 1WM1A 4Q82A 5T4BA 1ZD4A 5ALQA 4EB0A 3WL6A 2FX5A 1E3QA 4J3JA 4B0OA 2WFMA 2HM7A 1NU8A 2JEYA 1MNQA 3KSRA 4C6HA 2JGFA 3G7NA 1JKMA 2Y6VA 4N8SA 4Q3KA 1HDEA 2PSDA 2J4CA 5EIHA 2I03A 1ZD5A 2VEOA 4Z49A 1IMJA 1JFRA 4Y2RA 5EHQA 4N5IX 5JADA 3WJ2A 4IHAA 4LYDA 1PJAA 2RHTA 3FOBA 4DIUA 4E46A 3DS8A 4EA6A 3W05A 1CIJA 1CPYA 2HA2A 4Y2YA 1J1IA 4LKOA 5HK8A 2JBWA 3L1HA 2PU7A 3QITA 4FLEA 1WPRA 2VJAA 1XQXA 1YAHA 3CCCA 2H9YA 4IQ4A 4WCVA 2HIHA 4G8BA 3D2AA 2PSHA 3GA7A 3QH4A 3R3YA 1KEZA 1XKLA 1N5RA 3D2CA 2XQJA 3KWJA 2QUAA 2LIPA 2WU4A 5CMLA 2Z8ZA 5ISMA 2C0PA 1XZLA 1JI3A 3G8YA 2X5XA 2QM0A 1QGED 4EZIA 2G63A 4IH9A 4XX1A 2H7YA 4UBIA 1VOTA 1U2EA 3I2GA 3AIKA 4DNFA 4DMCA 5JATA 1Y7HA 1WHTA 2QVBA 4MYSA 5JD6A 4BDTA 2ZYRA 4H7JA 4N8DA 1LZLA 3F67A 4B7ZA 1D07A 3BF7A 5AM5A 2ZYIA 4MXDA 4H7IA 5LP1A 3X3HA 2WFLB 3WIBA 3LS2A 4X7BA 1ZI9A 1XZAA 4OB6A 3RM3A 5AI8A 3O95A 5AI6A 1MTZA 3I2JA 3A2MA 1CUAA 3ICVA 1ZI6A 2HA6A 4DMKA 4LYEA 5DNUA 4UFPA 1H2ZA 4Y2UA 5AKHA 4FHZA 5FP0A 4DLNA 5CT4A 2C5FA 1MX1A 5IKXA 4MYDA 5CT5A 3WKCA 4EY8A 1B6GA 1J07A 4B81A 1ODSA 3A70A 4EY6A 2VT6A 3VJMA 5DNWA 5C8ZA 1LPOA 3W06A 4L72A 3AZQA 1UKCA 4QZVA 4LIPD 4BE9A 3WK6A 3HYSA 4FNMA 4K6HA 1XZKA 4E15A 5HKAA 5HF8A 5FKJA 3E1GA 5ALMA 2XLCA 3QVMA 4Y2SA 2WJ4A 4A23A 5DLPA 4AMYA 5T4FA 3FNBA 3FLAA 1CUCA 1QONA 5D3KA 1P0QA 3V9AA 1HL7A 3H2GA 4ZI5A 2PU5A 2I78A 1AQLA 3FWHA 1TAHA 3L1JA 5ALGA 2QKYA 1X2EA 4B82A 2JIDA 3FBWA 1FSSA 4WY8A 1ZIXA 2UZ0A 2ROQA 3FYUA 4KR0A 1W76A 3OM8A 3N0TA 3IB3A 4U2CA 2RGUA 3Q0TA 1F8UA 3ZLTA 3ZV7A 1GQRA 2CZQA 2BFNA 4W9RA 3P2MA 4N8EA 5A7FA 1VLQA 2ONCA 3WZMA 5E2IA 1CRLA 3STXA 4E11A 3I2HA 1C4XA 3IUQA 4OPMA 4GBGA 4KAJA 1H23A 2QRUA 1A8SA 4BDSA 4LXHA 3O0DA 3NGMA 1DQZA 4B6GA 1CUUA 2XMDA 1F0PA 2HRQA 3GUUA 1WB5A 3C6BA 1H2XA 1ODCA 2WIGA 3LP5A 1L7RA 4HXGA 2GBIA 1XZFA 3UUEA 3H0CA 1EK2A 4X00A 3IUMA 2JGEA 1VXOA 4PSDA 5CRIA 3H19A 2RHWA 1XLVA 1Q0ZA 4XWGA 3O4JA 4C01A 5JAHA 2QTBA 2WM2A 3EQ8A 3D59A 1R9MA 4DGQA 2VJDA 2XMZA 1CUWA 3O4IA 3CCBA 2J4FA 2XUAA 4G8CA 3GZJA 1MN6A 1A8QA 1ZICA 1VA5A 3O4GA 3HJUA 1QE3A
chains in the Genus database with same CATH superfamily
1LPPA 2H5JA 2FSVA 3KBBA 4E14A 3JSXA 4YJFA 2LKDA 1YCDA 2IXAA 4M0UA 3SF8A 1BH2A 3JYHA 2BMEA 4IOKA 3ISJA 4L7QA 4LC0A 4LDPA 3RRFA 4E31A 4FZ5A 2W93A 1WW3A 3MMSA 5F7ZA 5DH9A 5C3MA 2H4FA 2EGUA 1H9CA 4GU5A 1GPMA 4IDNA 4B6FA 4KHPB 3VZRA 2CYBA 3ZLUA 1TQDA 1XI2A 1XAJA 2H1FA 2OYRA 2IHYA 4DV2B 4L75A 1YQGA 2NQ8A 3A3YA 3NBQA 3OX3A 5DRYA 4DNPA 3NBXX 3LF2A 1R2QA 1S2LA 3TOSA 1V8PA 2C4MA 2VHVA 3FHJA 3L9WA 3HB7A 2Y2UA 4C3OB 1NOIA 4YN3A 3DVLA 3MTDA 2CCKA 2MSNA 2ZVQX 3RHFA 1ISFA 3SDSA 3LXMA 1ZXXA 1FMFA 3MGAA 3ZWNA 5FR2A 1HYBA 5JS6A 3BYZA 2VR1A 1T2CA 4NK5A 1XMSA 2DHEA 1FRFS 3EIHA 2N3ZA 3PC6A 1R1DA 1U9IC 1UPBA 3HGMA 4FZJA 1UH5A 1YUMA 4CTNA 4DR2B 3UFBA 1DAHA 1IC6A 1ZL0A 4IQ0A 4MGEA 1HY3A 1C30A 5IT9A 4TKMA 1JIXA 2QRQA 3NC4A 4IO0A 5D3MA 4PG8A 1YB4A 3UWMA 2EEZA 1FXWA 3O2NA 2RSLA 5K01A 4JD5A 3SC3A 3H4TA 1S7GA 4NBSA 1UKBA 2BAGA 3FX2A 3A1EA 4MICA 4BNDA 5J43A 2P2NA 2ILVA 3WYDA 4YK7A 1TK9A 3I8XA 5LQDA 5FUVA 3EARA 4WVLA 4E5DA 3CQ9A 4G0PA 3K05A 2NZVG 4MAMA 1G2IA 1JS1X 4TT3D 1H1DA 2O5CA 3A1WA 3RTBA 3LUAA 4X45A 4WNAB 1TZ2A 1ZLYA 1XCJA 1NWHA 5H3LA 3DAYA 3S2ZA 3WR5A 1MA3A 2YNMA 4TV8A 3ROGA 4DDKA 3W4JA 3WQSB 4JEHA 2HJRA 1XYVA 3SDBA 1YFLA 1NMEA 4IIHA 521PA 4WNCA 3WBKA 1NQTA 2XF8A 4AT1A 4AURA 4HI0E 4DUGA 5C1BA 4CIAA 4IAOA 3BXPA 1LK7A 3LQKA 3PYMA 1NG1A 5FI5A 3GLIE 1SWVA 4L2IB 1X38A 1QCDA 2DMRA 1TE2A 3FNIA 3JWEA 4Z0NA 4FD2A 2YFKA 1NASA 1JRLA 3I9JA 3JQ9A 4LBZA 4AWAA 5KVCA 2ZXUA 5AVTA 2E5LB 2QLFA 3LNTA 3M6UA 1CUEA 4O2LA 1I13A 4UHCA 3ZGXA 3U39A 1ADGA 3Q7RA 4U8HA 5LP6A 5LXTA 4OP1A 4DNOA 2CNOA 1C4WA 3AUUA 5D7NA 1Z74A 2OSVA 1X7HA 1M1YE 4KVZA 4MQ5A 4C4OA 5B4VA 5CHYA 3HBJA 3VUEA 2ZJBA 2WHPA 2GPSA 5DE3A 1NVTA 5EQFA 3WLOA 5IJ0A 3C8HA 4LOAA 3FTPA 4PBRA 4NFYA 3D4PA 1AK1A 3L7YA 4G5XA 3TZEA 5J4HA 3RYFA 1Q95A 2V9CA 3HEMA 3SLGA 3WNQA 3AR7A 1R6XA 3MJVA 1TIBA 5DX8A 4IV8A 2ZJ5A 2Y66A 2VI5A 2B9VA 3ND5A 1GQSA 2ONZA 3PV0A 3T94A 1SK9A 5H3HA 3RUDA 3LBIA 5T4HA 2CLKB 3PJDA 2ORED 4EGJA 2UZ1A 5DULA 1SKAA 3TKAA 1MEOA 2A30A 2AOUB 2OLEA 3NT2A 2E1PA 3MMNA 4WKCA 5A2GA 3B5EA 4ARIA 4JJ8A 4FW8A 2EDAA 4V03A 4CXMA 3NKVA 5HTKA 4U02A 2AS0A 5KOYA 3LPAA 3WICA 2H1SA 2VLIA 4HAUA 1OI4A 5AKYA 5L3RA 2AD1A 4WE3A 3UAYA 4Y2PA 5HG0A 2V6IA 4Q00A 5T8KC 2XWSA 2X4GA 3KZXA 1EDBA 4BNZA 5BP7A 1SQ6A 4U7WA 2HZBA 3OU7A 1BRMA 1M74A 1H93A 2O2YA 4TLDA 5FTWA 2FEOA 3VJKA 4C7KA 2XUIA 2JHPA 5JCOC 1X3SA 5AOAA 5HX7A 3TTSA 3RJZA 2HW8A 5FIUA 3U9SA 1IEVA 3PC8C 3G2PA 3LMKA 1ZD3A 3OF5A 5BSKA 3TLAA 1VKHA 5SZHB 5CFOA 4NESA 4IW3B 2OD2A 4FYVA 2JVIA 3TW4A 3SYNA 3TWOA 3H1EA 2RGWA 2ZTLA 2P6RA 5CLJA 5EKUA 3KQLA 2IYLD 3CLSD 3OZDA 2WJYA 1QIFA 4CF5A 1F3OA 1PCXA 3GDGA 1VSVA 4K88A 2D1YA 4C03A 1E69A 1MRNA 2GRUA 3EFBA 1CW2B 5JO0A 5C52B 3NUZA 5ICCA 3OPNA 1S7CA 1YMVA 5K4GA 3DV2A 3CLTD 4KO3S 4DR1B 2PXHA 2HIAA 4IZHA 4WKBA 3SJBA 4BJHB 1RYEA 3VSCA 4JVMA 1ZOSA 3PCTA 4FYPA 5HF9A 1EUCA 1KRXA 1I33A 4DLVA 1EG2A 2QX7A 3DV9A 1D2CA 5IAJA 1B43A 2FSHA 3MMPA 1BOFA 4FKBA 2HRCA 1LVHA 2JCBA 2MOKA 3HN2A 4QRIA 1M76A 2VNHA 5IDVA 5J2UF 1T9AA 2DPLA 3BXGA 3NCTA 5E8RA 4EG5A 4LNAA 2X0JA 3G9ZA 2ATVA 2QMEA 3ED1A 5KNDA 1VPEA 1YB2A 1UXIA 3KT3A 5KWEA 3SS7X 1DE0A 3FUVA 2OG1A 2AMJA 2PBRA 3OJFA 2XWQA 4FYIA 4HB2A 5ER9A 4ALNA 2BLNA 3BGDA 2WD8A 3BDIA 4CV0A 1FFHA 5IM4F 4JKYA 4BLVA 2PKEA 4AULA 4MEAA 3N2GB 5FJIA 3LK7A 2WJPA 1WCIA 2VLBA 3CKMA 3QVOA 2ZZKA 4FU0A 4J7XA 4HXEB 4QLAA 3PQFA 4RAQA 1EFCA 5DF1A 4UQLA 1TU4A 3O90A 1Y7IA 2BW0A 2HB6A 1RU3A 3KEGA 1W4LA 3VMMA 2ID7A 5E1BA 1GRRA 3A6JA 3OOWA 4KPYA 4OVKA 2X0EA 4G65A 3Q40A 1RI2A 1F3LA 1JYFA 1QKKA 5AM4A 4G5QA 4I6EA 4BGVA 2A9JA 2PD6A 2QDKA 1T0JB 4IJ5A 4JODA 4MHTA 1ZEJA 1ZONA 3AOEC 2OAGA 2WP0A 5BNTA 2NIPA 3R8XA 1CETA 1OU4A 2IF0A 4BUCA 5D5HA 2IYZA 4LPSA 2XTJA 3MC1A 5A6VA 2X4LA 621PA 4P2GA 4CIYA 3OQHA 1CRQA 3E1KA 5KYGA 1OFTA 1HT2E 3H11B 1BMTA 1XNQB 4LZNA 4X41A 1FYWA 5K3AA 2A5GA 2B0CA 5I6DA 1HRKA 2BMWA 4QARA 5A9TA 2RGEA 3DEYX 1W0KA 1L5HA 2CYCA 2EX0A 2HHLA 4M9SA 3OOJA 4PQYA 2XB4A 1UINA 4E1VA 3A4IA 3OZBA 3RIXA 1C4OA 3ZEAA 5C32A 3A6DA 4DLAA 3CYFA 2H8GA 1PJ8A 1SUWA 2Y0DA 1X7WB 3F49S 3O8NA 5IBQA 3A6ZA 3N0VA 5J2UB 2CWDA 5BN1A 3PGVA 3QEJA 5ECWA 3CVOA 3PC7A 4YIHA 1MA0A 1RQXA 4M38A 1TJ3A 2FRDA 2CD7A 4LQ4A 5F78A 1T8SA 4BO8A 4F38A 5LDHA 1Z5GA 3WYBA 3SWWA 4B76A 4MJ3A 4BB6A 4DMRA 1LSUA 5KQMA 2C31A 4IEEA 1KFKB 1PTJA 2J3IA 3D4NA 3WB2A 4C4TA 4FN5A 2VJOA 1QYXA 1RLIA 2PL1A 2D3TA 4EKEA 2Z08A 3P1JA 3W7AA 3NASA 2REQA 5DM4A 3WGVA 2GUGA 5CR9A 4X1IB 1M2WA 3H6KA 3TJZA 3T41A 1K8RA 1F0NA 2C2OA 2OILA 1V3TA 4AO8A 4F2PA 1GUYA 5H9VA 1D2HA 2O7QA 3DUFB 1R6DA 3MRVA 4YGYA 4IF6A 5CW2A 1VL5A 3WFZA 2XNDD 1OXTA 4DJ5X 2BJWA 1Q0PA 3K0HA 4OYRA 5IZ4A 2R7LA 3H84A 2IH2A 2BBOA 3PRJA 1RFLA 4FD3A 4TLEA 2WB2A 2A0WA 3GW8A 3JR3A 1F9EA 1DADA 1PR4A 1K75A 1DC8A 1QDLB 2EERA 2IPNA 5EP3A 3SSAA 4LNUA 3AG6A 3KZVA 4IJKA 5HJEA 1YRLA 4RTMA 1EP9A 2A9PA 3L1IA 3KHKA 2OK7A 2SCUA 1QR2A 3NPMA 5GGYA 3SVZA 2QXTA 4OJYA 5DBGA 3L6OO 1GA6A 1AKWA 1Z0ZA 3U3JA 3ZWKA 1NMXA 2X8BA 3G5MA 2KI5A 2W83A 3DC2A 3MA0A 2BDUA 3RVOA 4M8LA 2Z4SA 1RAFA 4YDHB 3COSA 4E6EA 3E53A 1RWMA 3QLVA 1ODJA 2QAGA 4TMYA 3UHOA 4D43A 3P9KA 2RGGA 4PPNA 2A0UA 3HZZA 3CUYA 4URWR 1MR3F 5LYJF 4YI3A 1XLTA 3EZLA 1J33A 5CCEA 3ZBTA 3OZXA 1L5ZA 3UAVA 1VGVA 3A28A 1U0LA 3CWZA 1M67A 3B36A 1NUTA 4JOQA 3UPUA 4NS1A 4HWSA 3WRWA 4RKWA 3FUWA 4REQA 3BN3A 2FCRA 3KIPA 2Z8YA 3ITNA 3Q5DA 4TVKA 3RBAA 2JK0A 4E33A 3H1FA 3EGIA 4WLEA 4DLTA 4DANA 3L92A 4L9AA 1ULAA 2PGOA 5L9AA 2FPLA 2PTHA 4FS8A 1Q74A 4TZTA 3JCZA 1VSTA 1ZG3A 1QHXA 2RDMA 3HCFA 1FYVA 1I0IA 3TSYA 1ZGHA 1M8JA 2XVMA 3FBGA 4KE6A 4U0KA 2CZCA 4X7MA 1G60A 2QK4A 2VHWA 3AP2A 2R7KA 3EZ9A 3ZNOA 4ARAA 1UJ4A 3PFHA 2RGCA 3BHMA 2PWYA 3G6WA 2DP4E 1Z18A 2F00A 2GJAA 3OO0A 5JALA 1I24A 3SNKA 4QYXA 4ZVPA 4WWHA 2AG0A 2HWXA 3B9PA 3ZDYB 3IP3A 2JFXA 5JCXA 2VF4X 2DULA 5I9SA 2AZXA 3I9FA 4ERXA 2MWMA 2IBTA 5ITVA 1W5AA 3IO5A 3LFHA 2PX8A 5TGZA 1CRZA 2A35A 2J6BA 3KKQA 5LMNB 1V1RA 1B6TA 2X6QA 4B8WA 2C2ZA 2O59A 4CM9D 3RRYA 3IULA 3HKDA 3N07A 3KJIA 4RAOA 1MZPA 1GPLA 1RAGA 5KYYB 1Y3IA 3HEAA 3CU5A 1RQ7A 3DPUA 4TVOA 5LYJB 4GMFA 3U3OA 1EZ1A 3BMCB 4N0MA 3R0XA 1NVFA 5K0NA 1Q1EA 4YJHB 5EZYA 4EHLA 4DDUA 1A9QA 1QS0A 4BWYA 1QRDA 3OF2A 3KTFA 5KSZA 3WSVA 3CXUA 1R0LA 3T1OA 3TNDA 3WOHA 1U65A 4JBIA 2VPPA 3KPVA 4R2HA 2ZYAA 5FH9A 5HM8A 5EE3A 5TGDA 4AQYB 3L41A 4WLVA 1DEOA 3VZSA 1A5ZA 2AJBA 5EHGA 2QSUA 3CRW1 3Q85A 4RKEA 3OIVA 4QHYA 2HMTA 2G72A 1LDNA 2VYFA 4WEOA 4BB9A 1ZAYA 3L0BA 2H08A 2OAEA 3O5AA 4YFVA 4K6KA 3S29A 1T15A 4IZOA 1Q3HA 3FUCA 3BK1A 1KMMA 1TYAE 2J67A 1L5SA 5IXSA 1FJGB 4QXPA 1WUJS 2YZMA 2FWIA 1SC1A 1DAGA 1E9AA 1M34A 1OWLA 2QLNA 4FTWA 1GGMA 1QIIA 3Q9LA 4J0DA 5FYQA 2C1XA 2CXOA 3WL4A 4HRAA 1X7DA 2EF0A 1OQAA 4MS4B 3QX3A 1D6NA 1V1MB 1UXHA 3RIGA 1H8HD 1OVGA 2DWUA 2OB2A 2RH9B 3M3DA 3HKEA 4YJGB 1S9HA 2VEDA 3CVXA 3QGMA 2DRIA 5ETJA 1WW2A 1OH8A 2J0VA 3NT5A 2WTAA 1QLHA 3ISTA 3MQ4A 3Q2KA 4UPVA 1S1MA 4LCBA 1C4KA 3PG5A 4NJMB 2HA5A 3MGKA 2UYCA 4BXOA 3DXFA 1H4QA 1TU0A 3OIYA 3EY9A 4ZO4A 2PQ2A 3D6JA 2QA5A 2VDQB 1JAZA 3INNA 1CSEE 1QKIA 4TZ6A 1J21A 4ZQEA 4JI8B 2EWMA 2YHSA 2DEUA 4ABTA 4GWGA 1P5JA 5F2EA 3CG0A 4FYWA 3M6LA 3W3AD 4QBHA 3N6XA 3MFQA 3LP6A 3PXGA 1DZIA 5AK4A 2V7QA 3MGGA 4QO7A 1WPXA 1ZH8A 1F12A 4WFIA 4Q24A 4CFYA 3EZNA 5HKKD 3OZCA 3E27A 4YJ2A 5LUAA 4Y2JA 1DAKA 3UG7A 1QQBA 4TLMB 1UBTS 1MO2A 5BN5A 2GRAA 1KK3A 2DZDA 2QMQA 4LVNA 4DQ0A 2YYYA 1Q1ZA 4A91A 1ZC3A 2Y2VA 2E6UX 3QY0A 3ZTTA 2P9JA 1A0OA 4WY2A 1TW2A 1HGXA 4YPVA 2W58A 3TQCA 4TS3A 2HLHA 2Y71A 5TLSA 4XR4A 1OHHA 4IG4A 1CU1A 3QM1A 1REQB 1E4EA 1GR0A 2WHEA 4A2QA 3RVJA 4ENRA 1ILWA 4M55A 4V0RA 3ICPA 5ALYA 1ETHA 4M60A 3KWMA 4D8WA 1GQFA 1XDGA 1YL7A 2Q1WA 4S05A 4WY5A 2FSUA 4JJZA 5I9IA 2ZEJA 3MIIA 4PO8A 4M3NA 3GMDA 5DSZA 2YX1A 4H35A 4FBGA 3DMNA 4HNHA 4J90A 2LCFA 1CQWA 3TQRA 3VR5H 2PDAA 4PYMA 4Y7CA 3PSAA 2RH4A 221PA 4P5PA 2R8YA 5FPTA 4BNGA 1NXWA 3F6EX 4KQIA 4M87A 1UBUS 2XVAA 5E4JA 3UJPA 4CKBA 4AP5A 2B34A 2ZUTA 1BA2A 2FEKA 1FNBA 2WAOA 2PX5A 4JL6A 5AKLA 4N5DA 3B6ZA 1U98A 4J49A 4MWSA 4OXYA 4DQXA 1D9ZA 3IBYA 4EQ6B 2R8RA 2ZRAA 1EEXB 4FINA 1J20A 5DOZA 3D64A 3TIGA 1QYCA 4HDQB 4QELA 4DA8A 3EGOA 2P7IA 1J6UA 3DNPA 1GKYA 3H2JA 1T0BA 4XIFA 3ROZA 1H8ED 1S8NA 1P1IA 1QH1A 3DOFA 1K5HA 3LFUA 4GQBA 1Y37A 2L69A 1NM5A 4JLNA 4URHA 5CM2Z 3I9OA 4QQRA 5CPFA 2XUDA 4FOSA 4JI3B 3VHLB 1NHGA 3AXSA 4HLUC 2CXRA 3ZG6A 2I2AA 4L3OA 2PD4A 1ZN9A 3GUCA 2XBUA 1SC6A 4DRXA 4Y18A 1SY7A 4XGRA 1H65A 1SBQA 5AUPB 1DKUA 2HRZA 3F1LA 1YQXA 1QVZA 1E96A 3B6IA 1JEDA 5DM0A 4I55F 3RS0A 1GADO 1LEHA 2ZRQA 1XTJA 3FOWA 4JL8A 5CGQB 5IMBA 2IU6A 4US2R 4DBVO 3MSXA 4FFOA 1ZCJA 3JS5A 4A0RA 4JV5B 1WEHA 4N5HX 3K70B 3BVPA 1Q0RA 1WB9A 2FMUA 2GYUA 3LUCA 3GLVA 1O6CA 2FUKA 1ZZGA 2ZSIA 3P2JA 4MRRA 3PF9A 1SR8A 1U0SY 3HCEA 4HDRB 1U63A 2JHGA 3V7NA 4RTRA 3KVRA 4UU8A 3NLLA 3QWFA 4Q7JB 3WWEA 4F56A 1IL0A 4QGGA 4B2YA 2REXB 1QHEA 1ISJA 4ZTZB 4C6SA 2BUBA 4NCHA 1U1IA 4ZU3A 3ZUPA 3SR3A 3FKJA 1QK5A 4U9UA 2NV2B 3HGTA 1LBIA 3LA8A 5FLKA 1ILEA 1Y7TA 3IP7A 3AM1A 2DSNA 4P6VF 5DM2A 4HH3C 3U31A 1MX5A 3CZRA 3H1GA 2ZBVA 1JSRA 4UPDA 1GTRA 1V8FA 2C3MA 3ZZNA 2F64A 3KSDO 4BRZA 1E3WA 3GJSA 1M54A 1THTA 1UC5B 4UAGA 2FSPA 3L01A 1A5SB 4HEA6 4AMVA 4H6XA 5EXDA 3U09A 2AFIE 3KUDA 1ITZA 1WB6A 3M1LA 4UJ5A 4Q34A 1EUDA 2JIOA 2Y05A 1KXJA 4G23A 3Q3GE 4XWAA 1DEKA 3R40A 1QFXA 4EGQA 3GGCA 4X3PA 5AYVA 1WS6A 3O47A 4WASA 4AY2A 1B3BA 1DC3A 2CCJA 2P2ZA 3M5PA 3OCUA 3QU5A 1EDEA 4LGCA 4Y6QA 1E99A 3CZAA 4DNXA 2XADA 1U2DC 4I55B 5U9CA 4Q3NA 4JI4B 4H31A 4S04A 3B9BA 1U2QA 2C2YA 2AI1A 3DLHA 4M0FA 1RJDA 2V54A 1U8AA 5HF5A 1X86B 5EZQA 1VLZA 4DDWA 4F4CA 5KSPA 3AL3A 3UCFA 1AV6A 3FVWA 3VPSA 2YJ3A 3C3MA 4NFHA 3U62A 2PLFA 4EDFA 7ABPA 2XUPA 3II6X 1HEYA 1ECBA 2BTOA 1DEXA 2OGWA 2F1RA 4N5NA 4CF4A 4XTCS 1RNLA 4CMHA 1BDBA 1R3UA 2GEBA 2QQEA 3DOCA 3PXBA 1C0EA 2ALJA 3MCWA 2I4TA 2PQMA 2XDQB 2Z2XA 3TDKA 2YHBA 1DCKA 2ARKA 5B55A 4INZA 3RTAA 1XMQB 4AKIA 5AI0A 2QRNA 3O92A 1KMCA 1G9XA 5JD5A 2C3OA 2HF7A 5CBPA 1O54A 1JEYB 3IVMA 1DQYA 3ILXA 4G5HA 4C2UA 4HDNA 1QHHA 2O8DA 4XVHA 1BWSA 2PLWA 3L8ZA 3DCJA 4XIIA 3ZU2A 1E2MA 2I1LA 2X4DA 3CKKA 5ILOA 4TMWA 4E22A 5EPOA 3L2OB 5GV7A 3VU9B 3RTEA 1PN3A 4C6RA 2QVXX 3OOEA 3IALA 1EEHA 2QI9C 4CG1A 4R51A 4B71A 2HEIA 3I73A 4OHRA 2JAOA 2NZ2A 1QMGA 2AI3A 2QI9F 1ISSA 1XXLA 2G17A 3CBQA 3D02A 3FRHA 4NH0A 1ECFA 1QK4A 1DPGA 2Y0BA 3KZCA 3PGA1 3E7XA 4Z9FA 1LGYA 5EI5A 3ZDBA 4GKJB 1H2HA 3VZDA 3ZXUB 4DEXA 1NIJA 4CCWA 5MGBA 3AX6A 2FZWA 2HPHA 1SPBS 5DOVA 2WWGA 4WZBB 3RVMA 1MQSA 4CT0A 4MI6A 3WAJA 5DX1A 3LY9A 1GVNB 5DGTA 1TCUA 3DCNA 3QVSA 1L3CA 3ESBA 5D3QA 3ZBQA 4B0PA 1MZVA 4Y2HA 2ZJ6A 4C3VA 3H05A 4G1EB 1JN0A 3IQGX 1M2GA 4PZPA 2Q4OA 4QVIA 1B15A 1A8UA 1XWWA 1YBFA 2F62A 2ZDHA 1K89A 2IT1A 4OP3A 3JWJA 5CFQA 3ZVNA 4W1PA 2XR1A 1OXVA 2ZAYA 5FOXA 4Z8YA 1JIQA 3IFSA 4BVFA 4C0BA 1A5TA 2ZYGA 3AUKA 3E2IA 3KT0A 4OH7A 2FP3A 1N0WA 1RI1A 2YNMD 3HO8A 4AXBA 2J3EA 5C4IA 4O63O 1P9OA 2XQGA 4DQKA 1YULA 1TT7A 4DUGD 2XKKA 2FLKA 1ZX1A 5LOVA 2HO4A 1ZW6A 2ZRKA 3GP8A 3UBMA 1NRJB 5C81A 1E6UA 3GR6A 3PB3A 2PX4A 4PW0A 1XNRB 5JQGF 2J08A 2N0SA 3WZ2A 1KIFA 4CM8A 3EASA 3NHRA 4D8YA 5ES4B 2Z5GA 4AC9A 5T7BA 2JCGA 2OENG 2CLIB 1RM3A 2PYDA 2YUTA 3JZMA 4ISCA 1LDEA 1ZKMA 4QM7A 4A8PA 1JKJA 3HY3A 3LWDA 3UCXA 1KC1A 1TZBA 5JSQA 1J49A 3H2BA 3L02A 2JLAA 1ZJJA 4X1YB 4EA7A 1R8QA 1OV6A 3K9CA 3KU4A 1P7WA 4KE8A 3CRQA 4ZVUA 3L1KA 3A1UA 5BOVA 5H0IA 2JLUA 3C2QA 1FS5A 2P9EA 4IJQA 1P39A 1OI7A 3M5WA 1YZHA 2P0EA 4CM4B 2A2ZA 1O6FA 4ARBA 5LIPA 1AKEA 2Q29A 3FIJA 3NIWA 3CNLA 4V0QA 1CUJA 4R6WA 1ZUNA 1NKVA 2ET6A 2CVHA 1SFRA 1B3RA 4O6VA 4CKEB 3I01A 1O08A 4LJ8A 3HO1A 1EWKA 2IYWA 4DLYA 3K9GA 3ECCA 4B9AA 3ICEA 2H5EA 1P31A 4TMVA 4KOEC 4GYKA 1U1DA 1WUYA 1I9CA 2P5SA 3C6ZA 4Q9LA 2B7LA 1NLYA 1T6YA 2ZVJA 5KIAA 1B8UA 4NZOA 3S8YA 2VNKA 5A7GA 3AU8A 2YS6A 2NSJA 3BWVA 4IGFA 4D2IA 4F45A 3V8VA 2IY7A 3FB1A 5FPKA 1XTIA 1QO7A 2CJYA 2FW6A 4YBRA 4HXFB 1W5EA 3M1IA 3TNYA 2FKAA 4CKWB 3G0HA 2JGIA 3QXCA 3IUPA 1EG7A 3NKLA 3UN1A 3VR6H 4PCUA 1G8KA 3CKLA 5E9QA 2VCEA 1BN7A 1E9VA 2YY6A 3HI4A 4X8LA 1FSPA 2DFLA 3R74A 5JQGB 3FNQA 4CN9A 1TK2A 1AC5A 3MZ0A 3B1XA 4KKVA 1BD4A 2G76A 1I1NA 1NZDA 3Q3EA 4R7GA 3V5NA 2ZUEA 4QGHA 4UD2A 4BKOA 1Z17A 1Z25A 2B98A 2R6HA 2GAJA 1JEQA 1XB2A 4AG6A 2CMGA 1GRCA 1UQUA 3BD8A 3LPNA 3ZWYA 2GA8A 4ESEA 1NW5A 4RY0A 4B3CA 4AUNA 4RVHA 1K7CA 1GPAA 3A32A 1DKPA 5CA1F 1FVFA 1H2WA 1RQPA 4N3GA 3R7SA 3TAHA 1YD7A 3R8CA 3D6AA 2PSJA 4QKQA 1ZOLA 4RY2A 3EXHA 3MPOA 3ELUA 2MSLA 1U0NA 2ABWA 3LUFA 2HSGA 1FS4A 3CE6A 4Q9NA 5KHAA 5AVJA 3EBPA 4EHBA 2XT6A 1IBRA 4QBIA 5FAKA 3IILA 3TG8A 2BYTA 5A2QA 3ZZUA 5I7RA 4MO2A 4MQMA 2FMFA 2SBTA 2BTQA 2QAIA 3DL4A 3NI2A 5E0OA 5AXBA 2G5CA 3TTVA 4WZBE 4EJ0A 5LMUB 4GEGA 1U2GA 2YHAA 2C07A 1FRZA 5EYPB 2XB2A 4LSWA 1FUUA 2SHKA 4KR6A 4JR1A 1YL6A 2IY9A 1PVVA 3D8UA 4M0EA 4QQFA 4BFCA 4DKXA 1JFTA 4OHYA 1C0PA 5BORA 5KNDD 1HQKA 2O3QA 2O8BA 3G0OA 5C31A 1NF2A 1CE8A 1BOOA 2YRXA 1XKQA 4XQ0A 4Y30A 5JCJD 3DE0X 1GY8A 3WK7A 3OM0A 2Y1FA 3CR7A 2CHFA 4XLZA 2XZOA 2QX6A 4YAJA 4AI6A 4KQKA 4EG0A 1MAWA 2FF5A 4KTTE 5HS6A 1E2BA 3BBPA 1WXIA 1NQUA 2I2DA 2NAFA 3BXHA 5T5QA 3UK1A 2WJWA 4G4SP 4K40A 1G8FA 1MD9A 2DM6A 3HMQA 1UZUA 4ZRNA 2OC9A 5A04A 3QTBA 3ZCPA 5JPCA 5CLLA 2GXSA 1DC4A 1S0UA 2HDWA 1XRSB 4BTVA 2R44A 1IN1A 3N2ZB 4D25A 1U7OA 3DEAA 3K0BA 4BLPA 2V7PA 1OLXB 3I3SR 3MXOA 3D7LA 1E59A 2CLOB 1IIBA 2G3YA 1E0KA 2JANA 2QMHA 2Y1CA 3ANTA 3AVPA 4HCJA 5DX0A 3S55A 1FU4A 3Q3IA 3GFFA 2VF2A 5CA1B 1N7GA 1WXQA 2FFHA 3LG2A 4RV9A 3LRPA 2OP0A 3EWAA 1ARZA 2I7CA 1EVLA 4CLEA 1E7QA 1V7PC 1DBVO 1RAEA 3AVOA 5AM2A 1ZM9A 1MO6A 4HT3B 3RIEA 2FOIA 2P6PA 2PZMA 5C7YA 4JJEA 4N5LA 1XPJA 2WTEA 4B4KA 2VJQA 1SVSA 3ZD7A 3EISA 3MTBA 1W0KD 4NCNA 4QPJC 2PYZA 4FGZA 5EA2A 4G0NA 3RJTA 3UKDA 4CKZA 5KVAA 3PXUA 2R4QA 1BXGA 1CZRA 3KVOA 3KZNA 4D6PA 3N7AA 2W4IA 3OA0A 3NTOA 1CZUA 1IHDA 1T8PA 1TEHA 1T4GA 5BN5B 2FP4A 2J9ZB 2O7RA 4BVAA 3S1AA 1FSGA 3F9RA 2UVPB 3EB9A 3RJ9A 1A88A 1S6YA 2CFSA 2XNSA 3K0AB 3STYA 3P2KA 4BUJA 2Q2QA 2VSXA 5H16A 1SIUA 2HX1A 3QG5A 5EJMA 1OZHA 3L8DA 5JXIA 1ADYA 4LS3A 4S24A 1H2AS 4RM2A 2PT9A 3U5TA 2D2EA 3BRCA 4PHFA 4YECA 2H4XA 3WRVA 2RBGA 4ND3A 4DCPA 4IYRA 4ZZ0A 3I2IA 3REOA 3GDFA 3FFWA 1IZYA 3DG9A 2RJ3A 3WWPA 1KSJA 2RMKA 5M7EA 5AI4A 4BN4A 2F3SA 2O2SA 4ZAWA 4PSUA 5FO1A 1PFUA 1XEXA 3EZYA 3VGPA 4J75A 4LMRA 4BEJA 1I3KA 1OZAA 3I1IA 1EZ4A 1HETA 3MSCA 1H5NA 4MUKA 3QEAZ 4H18A 3UTDA 3FJOA 1D6MA 1JFFB 2JLRA 4RGBA 1GZ6A 4NL4H 1NN3A 3FCXA 3T54A 1M2NA 1KY5A 3I45A 1NMYA 3ZDFA 2HWUA 2IIQA 4LDZA 4BKMA 1TM7E 4G0QA 4JGIA 3ZGOA 4ZTUB 2FK8A 2BGWA 4X7PA 3THYA 1HKHA 3DOEA 3OP1A 4ENUA 3CRMA 1XLWA 1S5PA 2DSTA 2NUTA 2ZRJA 3PEYA 1CQIB 1TM2A 1I7DA 2IOFA 4COOA 2G7ZA 3T4UA 3R3VA 4BIMA 1DRKA 1VIYA 3ULKA 5I4IA 2FDRA 1SUAA 4FSHA 3FTCA 5KAMA 2HQSA 5FOUA 4L51A 4C4XA 1H85A 4HKTA 3TRDA 3UXYA 3U4QA 3MTQA 1OILA 4HX2A 1Z2EA 4IBOA 4EYGA 2EQAA 2WSMA 4YRZA 4JLPA 3HMKA 1G5HA 4M4SA 4JNKA 4OFWA 3U9TA 3UMSA 3NIDB 3HP1A 2YJNA 3UXHA 2QS9A 1FFCA 1P72A 1PT5A 1FW8A 4XRRA 3UF0A 2XYPA 4D81A 2JRLA 5A02A 2KB0A 4KG7A 1LS1A 2A8YA 1NURA 1VG9B 1O97C 1L0BA 2A1IA 2IEYA 1HE3A 3M6FA 4RCYA 3ZCTA 5IVHA 4NU8X 2O54A 4NXNB 2G82A 4Q1VA 4ZRDA 5C51B 1CUIA 3GJRA 5E1OA 1N2CE 1SULA 4PHGA 1P29A 5KQLA 2C4NA 4Q16A 3WMXA 3FZGA 5IVIA 3TOZA 4XOUA 4CTMA 2PVSA 2BLLA 2J0UA 3KVYA 3DF9A 1U0HC 7MDHA 1J4AA 1GLGA 1E2QA 3K9BA 2CSUA 1C3VA 2R97A 2ZI3A 1HUQA 1XK6A 3GHYA 4OLJA 1Z7BA 3VVCA 5KTMA 4UDXX 1E64A 2XCRB 3R9XB 2OD7A 4M1KA 3BMQB 1NVWQ 2Q1YA 3QSYA 2PE5A 5AT1A 4P0QB 5IABA 3IP5A 2BCGY 4I9NA 3F6CA 1IUKA 1SUFA 1TTPB 4PGFA 3PXXA 3JX9A 4KI0A 1FMLA 3HCAA 2ZXEA 3WGMA 2P8JA 5IX8A 1KIMA 1L7QA 3RFFA 1GAJA 5LBTA 4CE6A 1J8FA 3GEMA 2FY8A 4LI0A 3RFUA 4FHDA 5IZCC 3WGIA 1C8BA 1P7CA 1W9HA 5DPMA 3WGOA 1H2BA 1E79A 3HUDA 1HMPA 4Q9JA 3D7KA 2NZYA 2X14A 5AIAA 2NO5A 1ORVA 3BWDD 3EZXA 3MGCA 3D2LA 4L07A 5MFPA 2Y1WA 3PE4A 3HDGA 5ALKA 3SR4A 4U7DA 1NVBA 1Q22A 3CPJB 3U7EB 2IXFA 3WS7A 1IZ7A 3NHWA 4V0KA 4BQNA 3URKA 5L6LB 2PIDA 2ZULA 4KXQA 2CZGA 4ZCTA 1FTNA 4J0GA 4YRAA 4RMJA 3UK2A 4CLRA 3WDKA 1WU8A 1W85B 5A4FS 2IXDA 2JJ2A 2B8WA 3MINB 1L5NA 3ZE7A 1N25A 1EFPA 5L4NA 3MRSA 1RZVA 2ISQA 4PQGA 4U7GA 2CUNA 4HTFB 2H6EA 2OWEA 2XIJA 1BHO1 3REFA 1VBMA 3FWZA 2IY8A 4KQGA 4R69A 3QBVA 4W1RA 1WB4A 5EE9A 1ZR4A 2COEA 4QEKA 3LT1A 2H7XA 5KYXB 4XM1A 5AVWA 3PLAE 1HNWB 3ZHXA 3LDFA 3VR1A 2ZJFA 2B94A 2R48A 1IOVA 2DAPA 4K9SA 1N33B 4IGAA 3HP4A 4W63A 3EGXA 2DUJA 1Q3TA 4L0CA 3V32A 1PK8A 4O4JA 1OX6A 2WVJA 2I8CA 5DKFA 2UYOA 1ZIPA 4OOEA 4QXRA 4ZC8A 4PLGA 1HG1A 5GP1A 1VSBA 1XDBA 4BMOB 1F6WA 3KYIB 2Z2JA 3Q2OA 5GOTA 4XCQA 2OKGA 3P19A 4CMGA 2Z3VA 2V7QD 3E82A 3TRIA 1J2TA 4Q1EA 3K0CA 4G1FA 1RKQA 4F84A 3CJRA 3QBEA 3VHRA 2PVCA 3WRXA 3KXPA 1COZA 4C7OA 1JE0A 1BJTA 3H87A 4J6FA 2BZ0A 3M82A 5DRTA 5AHXA 4NLLA 3P5SA 4XDZA 3T7RA 3R5XA 2VKQA 1G8GA 2EZ8A 2W2QA 2NQ2C 3F6PA 4NPHA 4PQEA 2VYCA 5FA8A 1NQ5A 4BZWA 1H69A 1VGRA 5C9ZA 1AQNA 2FW9A 2VDLB 1OE0A 1XL0A 4PU0A 2VH1A 3VVBA 1BX3A 1NGSA 4JCOA 1QU2A 3CHYA 1A4RA 3LYUA 2GZ1A 1XRQA 2VPYA 5HFJA 4PE5B 5HKBA 4JCCA 1TCVA 3KTDA 1XCGB 4MMXB 1KE2A 4UM9B 1C0IA 4XWKA 2XRFA 1D5WA 2ZQYA 2B4QA 1F48A 1N2OA 3KHUA 4FQ5A 4ZKDA 2B4KA 1HBJA 1Y1LA 2YFYA 3GAMA 4MS3B 4P8RA 3TRJA 4W8GA 3TSCA 1AQJA 3E3MA 3OQVA 4Y2XA 4KYUA 4HWRA 3PFGA 9ABPA 1T25A 3PUZA 4N6GA 1QUFA 3G3EA 1DAIA 2NG1A 3Q7EA 4HZUA 4ZDIA 5ADVA 5JAMA 3TW0A 1BEZA 3O8QB 4AS1A 2J9YB 4PYKA 5F1KA 2J32A 5FF9A 2WF7A 2JK1A 3AP3A 3STWA 3CZ9A 1GPNA 5FTMA 1WDWB 1KJ9A 2F43A 4WIAA 5K3CA 4N3BA 5EJ4A 2Q5HA 5C5EA 2O06A 2XTMA 3C48A 3GN1A 4X3OA 1ZMXA 4IP0A 3PVCA 5C5CA 2D3WA 2D1SA 2WW8A 3JALA 2C7BA 3KUXA 3OVMA 3P9NA 1ECCA 5LSAA 5G0WA 3UMRA 3IUSA 1UMKA 5LQCA 4ARUA 4M7OA 5JJBA 5J40A 3UM9A 1C3OA 3NV7A 4UHEA 1P62B 4P7KA 5HQTA 5JAZA 1W93A 2GEJA 2G9UA 5TJHA 2CLLB 2QU7A 2A58A 4GSYA 3W2FA 1N6HA 2ZUVA 3KQKA 3UENA 2VATA 1YA6A 3KAPA 3BFJA 4HH1A 2W2NA 4J4TA 4C43A 1KNQA 1T36A 2WF8A 1P91A 4IS2A 4I81A 4I99A 4V0NA 5SV2A 1V11A 3KKNA 9ATCA 5DGXA 4ZQCB 1PL6A 2FXVA 2PJZA 4P22A 1JKIA 2EFYA 3CPHA 4P3XA 4PRZA 2FW8A 2QTVB 5HCIA 4CM1A 1CJMA 3HGQA 2HC9A 1IZZA 1E1LA 2GFHA 2YZKA 3LVRE 3QMMA 3T06B 5M3BA 3M6AA 5BWCA 3RLIA 5A9SB 1WCWA 1R6AA 5LD2C 1YHNA 3H9EO 1A98A 1DXQA 4HWGA 3DD5A 5ESWA 4MI1A 4NULA 3GRUA 3NTVA 2FZ5A 1SHUX 3ILSA 1V6AA 1JQJC 3B3QA 4O1MA 4LJ9A 4MIOA 3T5TA 3T1TA 2PHZA 4FOLA 2GK4A 5BW8A 4BPRA 4DCGA 1JEOA 1J7KA 5GWXA 4FGKA 3EXFA 4V2IA 2R6JA 4QOIA 2ECOA 5ALIA 4ZYVA 5INTA 5KQGA 1KBQA 4XA8A 4B3XA 1KVRA 4BZQA 4QE3A 3DE1X 3NAZA 2C61A 1E7SA 3CNBA 1QRSA 3ESXA 3KWFA 3WGLA 4AXXA 2V7EA 4YMTA 4F3CA 5B5SA 1CKEA 5DISB 2FK7A 5HIJA 4M1SA 3OU2A 4Z2AA 3AKYA 3IL2A 1BDMA 4OMUA 5G4LA 5GZ3A 5AIBA 3EG5A 3KPUA 5IN4A 2P0AA 4OBWA 1L7DA 3JWHA 5HFAA 3THWB 4NZPA 4MUGA 1PNOA 1UZLA 4E11A 3QUQA 2C7QA 2I5PO 4JJAA 4CR8A 4XKJA 1E2NA 4KACA 3TLYA 2A88A 1DEAA 4H7DA 4RXTA 2R1TA 1Y1RA 4HNAB 3QK7A 5LQUA 3PFKA 1LLUA 2JFVA 3F4BA 4TTQA 2P3QA 1EGAA 4E03A 1TMGE 4PXYA 1RACA 2O3TA 5J58A 1KK0A 1FDOA 3W5IA 4ZT3A 4P98A 4DYHA 5A9RA 3UMYA 5JS8A 1U3TA 1KEEB 2FUNB 3IHTA 3RUAA 3BL5A 4S1TA 2HHHB 3OTOB 1OI2A 1N4DA 4YY3B 4BAZA 3RRNA 3OEWA 4LWOA 3S68A 5B12A 1TB4A 5LD2B 1I1HA 4M0DA 3RSOA 1CJBA 3D6FA 4NDZA 3K4QA 4A6DA 4F8YA 3ORHA 5KREA 3IKTA 1E9EA 3SXUB 2WZQA 3S1SA 1DBRA 4E7PA 1GWNA 1KVTA 2PKQP 2VK2A 1Q17A 4ZYUA 4IV0A 2HU2A 4D4MA 3BGWA 4PPGA 4S1WA 2WA1A 3QELB 4CEJA 3GT0A 4C4RA 2FWJA 2RHOA 3IQIX 1EK5A 4YIKA 1OXBB 4EYOA 2Z58A 4QNNA 5B4TA 3EH1A 1LSOA 3Q7SA 4G1MB 1K08A 4H08A 2WPDA 1ML3A 3FVTA 4HRXA 2XQKA 8LDHA 3MM4A 5L53A 2HD4A 4EO9A 5CB4F 4HSGA 3F3KA 4BJ3A 2WLTA 2IUTA 5CFLA 4FEAA 1W5FA 2EXXA 2NSHA 3GAAA 4N01A 2WM9B 2QMOA 1IM8A 3EZ2A 3FDXA 3SIWA 1XL1A 2IYPA 2FUCA 3NYRA 1Y1QA 3C3AA 3RBXA 1MMFB 3EWSA 1Z5UA 2BONA 2J3KA 1VLHA 5IYZB 1ENYA 3VTFA 3TPFA 2V7BA 3LCRA 1OWMA 1NVEA 2BFAA 3D7NA 1ZVMA 3AUFA 1NMQA 4A3SA 5K45A 2ZJ0A 2P1ZA 1IVYA 1VYTA 1QB7A 3DZBA 4MUJA 4NK4A 4J1SA 4W82A 4BYGA 1XU4A 3LO8A 1QOPB 4IV5A 2PIAA 3A58B 3B1ZA 3VVLA 2R2AA 1P7ZA 1X0XA 1FL9A 2IOYA 4E2ZA 3DPSA 3TG2A 2E82A 2PH7A 3I9NA 4NENB 5FADA 5KQPA 3LSYA 2IV7A 1N2XA 2B4AA 3FNRA 3LFTA 3MNFA 4P5DA 1WAMA 9LDBA 5JVDF 4WLNA 3PD7A 1FFSA 4PSAA 4R05A 1A4XA 1W6RA 3IESA 4KO8A 1KNXA 3AHCA 1AGPA 5CDUA 4IWNA 3EXG1 3JU3A 4N0DA 1UKAA 5AK6A 1KEVA 4RTQA 5FX2A 1XZPA 2DQZA 4RVNA 4HDKB 1ZL2A 4LZLA 4BV9A 1CNEA 3JQBA 4XGIA 1SCUB 1P5HA 2H92A 3O4VA 4GO1A 4C2BA 5CB8A 3OCYA 3GJ6A 2HMVA 5ALSA 1H9BA 3HLKA 5GZ1A 3K5WA 1XCPA 2EBFX 4TXJA 3ONFA 1MAAA 1WDMA 1WJGA 3ZV3A 3BFPA 5CB4B 3I5YA 3PDJA 4CLHA 2X86A 2XE6A 5CM8B 4PXSA 1EK1A 5J4LA 2QBYA 2GN4A 2XXJA 2VWQA 4A36A 1L8XA 1TJ4A 2QROA 2QTNA 2DHDA 5ALOA 3TN7A 4B83A 3OCJA 3R7AA 2PO7A 4FCTA 3TZCA 2Z9CA 3FCYA 4MGKR 4INAA 4CQLA 3N58A 1G20B 1GN8A 3GZNA 2UXBB 3M33A 2D2IA 4HH4A 3CUVA 4F1KA 3BEDA 1IJBA 2WNSA 5EKDA 3T3OA 1MRSA 4IIJA 1XVAA 3KSUA 3FAZA 1U6JA 3VSDA 1P6QA 4BV8A 5DN9A 2R86A 4O4LA 1LDMA 4IDEA 2A9VA 4LGVA 4P3KA 5TNXA 1LU9A 1ULSA 2QUBA 4Z4CA 4P34A 4BKQA 1ZK3A 4JLVA 1G3MA 1Z36A 4BTEA 3SQWA 2GLUA 1U0FA 5JVDB 1XQYA 2WYIA 2IPMA 1MENA 4RSMA 4C0WA 1KEUA 4FWBA 3F0TA 4LHEA 1RRKA 5D00A 3RC1A 4CV1A 2OHVA 4OF4A 5K0CA 1FX0B 1GAQA 1U81A 2HYDA 3LPDA 3D6NB 1UR5A 3HB5X 5FDFA 5CEJA 1SIBE 3LOUA 4PZCA 2CYAA 5ESRA 1DRVA 1ZA2A 2C99A 2EG9A 4Z3KA 4EITA 1P1FA 2HCTA 3HV2A 1T2UA 5A5DA 3SBEA 1YKFA 1MIHA 2QLTA 3B60A 2CLFB 4BNUA 1RI3A 2EQ5A 2OZVA 4HMQA 4KE7A 4PSCA 3UT5B 1KJIA 3TR6A 1N0HA 2JFPA 3QA9A 2JIPA 3KQOA 3BD6A 3QMPA 4K8OA 1YJXA 3DM5A 4NE2A 1TQ6A 1V4BA 3TBKA 3IE1A 3JZAA 4E7OA 3I9LA 4QDZA 1XF9A 1T1RA 2E49A 2IEDA 5JT1A 2QEQA 2EZUA 1QFMA 1SOWA 1NKTA 2PANA 1IUPA 3N59A 4IYJA 1KDYA 2ZS7A 5JASA 5JSUA 1CF4A 2AOXA 1J9GA 2GDZA 4LK2A 1M1UA 1JAHA 4HXYA 2CFOA 2VP9A 4R98A 2OBNA 5IVDA 2ZJAA 2O5VA 1GNRA 1HDGO 4F3RA 5BOSB 1XRJA 1YDWA 4JJFA 4OQFA 1E2PA 4DRZA 1T8UA 1V6SA 1XZMA 2PGJA 4IWYA 4DC0A 5IH7A 1UP6A 4TKZA 3L6CA 4L4RA 3CLVA 4WZZA 1ZVVA 2FRVA 2W6CX 3HUFA 4DN6A 1DB3A 1GDHA 1CJKC 1W5BA 1YOBA 3R7NA 1QFJA 4X44A 3SYMA 3M81A 2DWOA 4KJZA 3WRYC 1MF7A 3CX7A 5CG1A 1GZ4A 3TL6A 3OIWA 4QWWA 1VJRA 3I9MA 4V1CA 1M7HA 1QKJA 2EW2A 2W22A 1PV4A 1CWUA 2CLDX 1M66A 5AQ1A 2FEWB 2GXUA 2PGXA 4L85A 5E9AA 4AZ0A 4K9KA 5CNJA 4HQNA 2A6PA 1K2VN 3BB4A 1QV6A 3BH7A 4YLEA 1B23P 2IKSA 4EA9A 1NPYA 2R1UA 3EPJA 3IKMB 4DMUB 1G7TA 2LUOA 3NTRA 1AHIA 4MQFA 3TPZA 4AJIA 4F5EA 1KZ7B 1F5NA 1N0IA 4G07A 3DM9B 1M5RA 5ALVA 4IDFA 1J8QA 5GJBA 1OYOA 5SICE 4DWOA 2SKCA 2RHRA 3RRBA 2PUDA 5MDHA 3VX3A 1NLMA 1GD1O 4IFIA 2IYOA 3GEIA 4K1LA 4UVHA 2A3NA 3M4ZA 3C3JA 4BMZA 2F1IA 3WZLA 4F2GA 4CTKA 2VQEB 2BEUB 3SSMA 3UAGA 4MLDA 1R50A 3TAXA 3HADA 2LKCA 1YJBA 4Q5IA 1NY5A 3C3BA 2FGJA 3NDRA 1CZKA 1B0PA 4R84A 2HTEA 2ONJA 2QUIA 4O3MA 3PNQA 3L1UA 4HDSA 4UEQA 5JDIA 3G23A 2DPYA 4HS9A 1Y63A 1E2KA 5GOZA 5P21A 3U19A 1E63A 1SXJC 4M7PA 4EY3A 5G40A 3X2FA 3V8QA 2I8LA 4FYYA 3MG9A 3OBBA 4ZCRA 1ZC4A 2QM8A 1EQUA 4L8FA 3DP7A 4HWKA 3RHSA 2GZAA 3QJYA 5BWBA 1PJLA 1I4EB 3FW1A 4PXAA 2X0KA 2Z3ZA 3GEPA 4P81A 1OGIA 1QZXA 5GZ6A 1VE7A 1A3CA 3B8EA 4RLSA 2OMEA 3W5DA 2HJHA 1G5PA 4LQLA 3GLFA 4TYQA 3A4MA 2IIBA 1X7XA 4GHWA 3L7MA 3NONA 4I1IA 4MKRA 4M49A 3EVNA 4OHXA 2ACEA 2YVLA 2PCLA 2YS7A 3NIGB 3UFXB 5EWLB 1GG5A 1G4AE 3H2IA 1U7ZA 3FYUB 4N03A 1B4DA 2BEWA 1NVKA 2BGRA 4DMGA 1UBCA 2PRZA 1XA4A 3AR9A 3FPEA 3H86A 1HLPA 2VNSA 1G21A 3MIZA 1DINA 4LXQA 1KDRA 1NN0A 2C3YA 4KFUA 1EHYA 1L9KA 1RYHA 3LHSA 5B30A 1JFLA 1U8FO 1WZCA 2YMLA 2ZB2A 1YQ9A 3SJ7A 3NDBB 1IATA 5IAOA 2FSIA 3N8IA 1V5FA 4H17A 2DLNA 4ZDKA 4L5AA 4D26A 3DTYA 4EG4A 5JMOA 1EFVA 1GILA 4IO1A 5DK4A 1C7JA 2P5YA 3WQRA 3WWOA 4FB5A 1C80A 2HQBA 3CTMA 1KJWA 3UPDA 3QW2A 1OFUX 1DQSA 3IV7A 2IP2A 4Q1BA 4EYEA 2FFBA 2I66A 3D3KA 3WBJA 1O95C 3DB2A 4AIRA 4CU5A 1ZH2A 1SXJB 1KMHA 1XTZA 3JY6A 1TZKA 1UZNA 4H27A 4R0VA 4BRUA 1ZNZA 2C7VA 1T9BA 4ND4A 1XFAA 2ZIXB 3C0KA 4Z1MA 5K9ZA 1ZH6A 4XDHA 5EWJA 4CCAA 1PNTA 2CEAA 7REQA 2BKXA 2C5EA 3D1VA 1MB2A 4KC0A 5AKEA 5F1YA 4DTCA 1XRRA 3GRZA 4AZSA 4D5EA 4IHJB 1AUQA 2M9MA 4RPHA 1XELA 2QPTA 2DH5A 4I14A 4QAJA 2JZOA 4D42A 5EZ6B 3MLAA 3GWZA 2NX2A 5GQSA 3WLFA 3ZD9A 3AWIA 5BN3A 5KDOA 2ID8A 4MR8B 1QGYA 4X92A 4G5YA 4YP0A 4JP1A 1AGNA 1MQ9A 2QD5A 4FZVA 3BSYA 3QKRA 1EZZA 16PKA 4XGKA 4ZAVA 3O26A 2I87A 2HHJA 2MHCA 5G0UA 2PBFA 2WD9A 5DTJA 3I5XA 3DT6A 2W9XA 2YVKA 1W47A 2GZ3A 3AH8A 3C8DA 4XH9B 2XV1A 4BKUA 2VFAA 4I4LA 2Q9UA 4KDEA 2CFIA 2EAUA 3DMYA 1LB1B 3VKFA 4YRKA 3MELA 4W6QA 4FP9A 2XVYA 4XWTA 1YO6A 3DZCA 3L0ZA 4FR2A 4L76A 5JWHA 2O2JA 2J3DA 2XCUA 1AF7A 4MIKA 1AQ6A 3RS4A 2HMYB 1YDHA 3TSAA 2JLVA 3C6KA 3AW8A 1R6VA 1D0SA 5K05A 1OKKA 5IULC 3SZMA 4CL0A 5FWYA 4B3FX 3IH5A 5LLDA 5G1OA 3DDCA 4R3UC 1HYQA 3KB8A 1H2FA 5CCXA 2O2EA 2CE7A 4FMCF 1FFAA 3N75A 3O75A 4GWLA 4OYLA 2YZ7A 1CJCA 3A6PC 1QH0A 3NTXA 4JVNA 4RF3A 5DHQA 3SC2A 1RQRA 1VC2A 2NTNA 3DR3A 3N74A 2VTBA 4DOMA 2FPWA 1X80B 2DYKA 5EIXA 4D5GA 1E79D 1DTWA 5CVDA 3H7IA 4ZQHA 4BUZA 4IOMA 3PTZA 1OLUB 2ZBUA 2EQBA 3QA3E 3WNDA 1NRWA 1Q7GA 5BT9A 1E3MA 4PX5A 2O2ZA 2G25A 2HLDA 3JD1A 3KOYA 4V2UA 3SPXA 2PUFA 1O94C 1IXSB 1D0IA 4JKIA 3D8TA 3F4KA 3O74A 4GOJA 2QRMA 3GXBA 1KGDA 2AQHA 5ALQA 1N75A 2XOEA 4D46A 1GPDG 2JJ2D 2OOSA 3HCRA 5C3UA 8ATCA 4GYWA 2OV8A 1Y4DE 4MW7A 2HM7A 1Z9BA 3L7OA 1QQAA 1XD2B 1TYCA 3WO0A 1DO8A 1JR3A 3VOTA 3BL6A 3OIUA 4GF5A 4NOLA 3OFVA 4WA7A 2J1LA 5D2CA 2JEYA 2OV1A 2VJPA 4A26A 3MWDA 4PAWA 3KSRA 4AP9A 2ODBA 2O8NA 4C6HA 3A05A 5THKA 3BWEA 1JKMA 4ZVSA 3VR4H 3DTTA 3E9NA 3RVLA 3VU3A 3KE9A 4N8SA 3EOAI 4NCKA 3P94A 1SKUA 4HLDA 2J4CA 2VYQA 3O0TA 3GGSA 4CV3A 4WV3A 5EIHA 1RQNA 3NRBA 2JBAA 1ZD5A 1Z0AA 2VEOA 3JAWA 4KU4A 3V1UA 4Z49A 3UC5A 2NVUA 2XX3A 4CYMA 1RXYA 3L93A 1OXKB 1OC4A 3QP9A 4XPZA 3L84A 1GHTA 1N2GA 1MJGA 5P8WA 2EZ9A 4FMCB 1VSUA 5EHQA 5JADA 2PLNA 1WHSB 3AWDA 2QLLA 2RHTA 5HXAA 2I71A 2O0MA 4DIUA 5KZMB 4QUKA 1PS9A 2PX0A 4ZDJA 1CIJA 3VC1A 1C8LA 3CMCO 3R7LA 4ER6A 2W8BA 1KRHA 1AUXA 2GPTA 4L95C 2PZAA 3FMOB 1P2DA 4UMFA 1I4DD 1W48A 5EINA 1RWBA 1Z26A 3LC7O 4HWOA 4O2AF 4DDHA 2OUKA 2ZB8A 3L1HA 3OZTA 4OQYA 3KQYA 5GADl 4I1SA 3TECE 2ENUA 3L6DA 5CA0F 1FFGA 2PUBA 3Q98A 4H6VA 2OEPA 2IXBA 1AQIA 2Y1GA 3OETA 3ROPA 1R15A 5HZMA 1G38A 3FPFA 1ZCBA 2ZJZA 3FGNA 4E2YA 3SC6A 2HF9A 5ITWA 1S89A 4UTXA 3S40A 2PR2A 1G6HA 2CN1A 4JBXA 3T5CA 2WOOA 4D56A 4II7A 4A82A 2HNBA 3M3HA 1QRRA 3I8OA 2J7KA 4WCVA 1FRQA 2PMKA 3ITEA 4I4TF 1I2AA 2B83A 2YMQA 1GU0A 1MORA 1ZHOA 2JEOA 1I3LA 3IR6A 3M9WA 3VGJA 3KU1A 1CB0A 1RFGE 3KKOA 2GTPA 3RYHB 3WC4A 4LZWA 3D2CA 1O7JA 3TXXA 4WPGA 4CG0A 4O0MA 1WPGA 1Z0FA 4IFBA 2G67A 2W2LA 5JO9A 1ZITA 2AOWA 3U7QB 3ER8A 1QQ7A 3GD5A 3PIIA 4MP3A 4GSLA 3U4MA 1JQ5A 2VHZA 1ZXLA 3PXAA 3IVGA 2EV9A 1U31A 5TT1A 2A1TR 4B7AA 1XZQA 1QHFA 2OBMA 3MWEB 3HLTA 3OF3A 1DDIA 1XDZA 3ZZTA 2CMHA 1JI3A 1G3UA 1PBTA 3GARA 2R5WA 3HG7A 3G8YA 3M6XA 4GP9A 1ADFA 2X5XA 4FX2A 4IOJA 4ER7A 1K92A 4H6WA 1YGYA 3GEDA 3PNPA 4GUAA 3JAKA 2JCXA 1L3BA 2V8OA 1VOTA 1U2EA 4O2AB 1ZD9A 5I5GA 5C4GB 5L95A 1YFZA 4LFAB 1KVUA 2V7GA 5C1OA 2NNWB 5CEFA 1UC8A 5CA0B 2QTTA 3P0JA 4MDFA 1DKRA 5KUTA 1U8CB 4D79A 2AB0A 3IMGA 4LCEA 1YJ5A 3QKSB 3RSHA 3ZVKA 3DHEA 4DFDA 3CLSC 3K6RA 3DDHA 4TSKA 4WBNF 1LZLA 2C5HA 3F67A 3I53A 1CK4A 3NNDA 1R0RE 2GZHA 4HUQB 4JAVC 1OAKA 3BF7A 2GN1A 1L7PA 2ZE6A 3JQQA 1PZHA 2AUNA 2O48X 2WJAA 5IDYA 2C8LA 4I4TB 1LVGA 5LWHA 5JU6A 4MXDA 4KQ1A 3MCVA 5H8WA 2VRNA 2HRBA 3FCOA 3CLTC 1O03A 4QFDA 2WFLB 3N39C 1OH5A 3VR3A 4WMLA 2AN5A 3P20A 4GOMD 4HL6A 4M8SA 4P0TA 5E7QA 1EQAA 1ZUWA 4H4DA 4LRTB 3TUIC 4GKKB 3BWBA 1FDUA 1QPGA 1NRXA 1T6BY 3ANXA 1AS0A 2GD6A 3HVHA 3ON5A 1NA5A 1NJSA 1NLZA 1PZMA 3B78A 7GPBA 4J2OA 3EY4A 4JY7A 2FUG1 5IKOA 4P4TA 3QXSA 2EFEB 1IHPA 2ZANA 3EPPA 2B92A 1CJTC 2B99A 2NP7A 3PWTA 4LDQA 1JE1A 2DE0X 3DKVA 4RQBA 2POCA 4JELA 2WSBA 1XPRA 3SDZA 4X8MA 3E35A 2JZCA 5AKHA 3W5HA 1AD2A 1VIMA 2P69A 3DNFA 5HQ3B 4K3UA 5JR3A 4J1TC 3NM4A 1U28A 1J0EA 1FDRA 4B6QA 1MUUA 1MX1A 1UBJS 2ZT5A 3U3KA 2YJ4A 3KQMA 3AKDA 3FCAA 4AG3A 1G59A 3DJFA 1E32A 1EAMA 3CH5A 4D9FA 4RJKA 4LF8B 3OFSA 3GIWA 4Q21A 4GAEA 1AB5A 4MB2A 4RK7A 1DKQA 4I50A 3W6OA 2AK2A 1V43A 3A70A 2UYYA 4D0GA 2VT6A 4DRYA 3CB4A 4EY6A 2PX3A 3GV0A 3FBTA 2IYSA 2I1QA 4K81B 4MGZR 3WADA 3ADBA 2CLMB 4B43A 2WM8A 3H6GA 4IDCA 5C8DA 4FFSA 5L40A 3AF3A 2X4IA 4TXHA 4DWJA 2FPPA 1ZK2A 4P83A 2JFHA 5G1PA 4ECAA 4RNDB 4GXRA 2X8LA 3TCNA 3NNNA 4DEYA 7YASA 5CLQA 5I4KA 3MOGA 2Q6LA 2W00A 4S3MA 4BMDA 3SG0A 2P91A 2NVBA 1S8FA 4HDCA 4J1QA 5F7JA 4YAIA 4B35A 5KU7A 3UVEA 5F98A 2HPVA 3KELA 2ZPTX 3EOZA 2O8VA 1BAPA 1E9BA 2R5NA 2J31A 5L3QA 3TLXA 1O9BA 1PX0A 3NH6A 1GG9A 1PW7A 2R5FA 4YO8A 5C1IA 4KXWA 1KZYC 2DY0A 1PFWA 2FLVA 1NXVA 3VNUA 3V7UA 3QVMA 2C78A 5AJYA 4I3HA 5C8YF 3SZUA 2PCJA 2FQQA 2WT9A 4MWDA 3L4BC 1J7JA 4I5DA 4RMHA 2WJ4A 3C1TA 4TS1A 1B8PA 1QHGA 2XDAA 4KIJA 1RCFA 1W30A 3W8NA 3OLQA 1A7KA 1E4YA 1Q7CA 2P35A 4PAOA 1JLLB 5T4FA 4AMYA 1SIOA 8GPBA 4MEJA 2OZPA 3FNBA 4PFSA 3T3NA 3I5MA 1YRYE 4NDNE 2GSDA 3CF0A 5KNCA 1J70A 4NEQA 3EVCA 3FOFC 1JHPA 1ELOA 4I66A 1J0XO 3ABSB 3QVTA 5D3KA 3UJ9A 3V9AA 5SZJA 4S1VA 1HL7A 1NDUA 3S2FA 4FYKA 2K87A 5TMEA 3HA3A 4EECA 1R4MA 3R3SA 2PU5A 3ZIAA 1GSIA 4ZEWA 3IEUA 1YQDA 2WWIA 1KYXA 4QBTA 1GQQA 1AHNA 1JMVA 1DRWA 1OX4A 5HIIA 4PRYA 1PR5A 3UA3A 1VMIA 3FWHA 3L1JA 4JASB 5ECYA 4B75A 2JIZA 4ZVLA 4E1BA 4HDMB 4IGIA 4CEHB 3BMOB 4EMBA 1RYFA 1SVUA 3IJPA 3U48A 5DSXA 3SYLA 1XEWX 2JIDA 3ELWA 1YUBA 4RVUA 2GCGA 1XMOB 1CFZA 1U02A 5DI3A 3V8EA 2V6GA 1TGVA 4JBWA 4KR0A 3RIMA 3V6MA 2WD7B 3OM8A 5E3HA 2WVGA 1CTQA 2CHQA 3IB3A 1A5AB 1HE4A 1PT8A 2RGUA 3D1LA 4F8JA 2I6SA 1PEYA 1E9SA 1QVAA 2PY6A 2YZ2A 2GKSA 4R1UA 2YFHA 3DHNA 4Q6WA 5DASA 3E58A 4U00A 3ZLTA 4E13A 2ODQA 1R0SA 1VBFA 2CZQA 1JHOA 2JS7A 1KJJA 3OIGA 3G8BA 3IJEB 3K96A 1NN1A 4LPKA 1OFVA 3E2MA 2Q1SA 5K2MA 1AKRA 3B8HA 4BVEA 4D0NA 4D9NA 4ZRMA 2XCQA 4OL0A 9LDTA 1YI8A 3NM6B 1IK4A 1U7HA 1QGDA 3WB9A 5C8YB 3ILHA 5I48A 2CXPA 5E4FA 1KSHA 3NATA 2XPCA 1U0TA 2OCBA 2Z43A 2XZLA 3WZMA 1C50A 1WD5A 3TE7A 1PZFA 1JX6A 5F9MA 3KKLA 2R6ZA 4NNJA 1CRLA 3ENQA 1M6VB 5TARA 3M9LA 4XUCA 4R9SA 2IUEA 2BPOA 1SHKA 5G0SA 1QZZA 1JNYA 1JV2B 2NXWA 4L5IA 3KV1A 4OOFA 4WCFA 5JNVA 5SY6A 2NZ8A 3GZ4A 1UXJA