3PE6A

Crystal structure of a soluble form of human mgll in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
289
Chain Sequence
b'PRRTPQSIPYQDLPHLVNADGQYLFCRYWAPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal structure of a soluble form of human monoglyceride lipase in complex with an inhibitor at 1.35 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 107
structure length 289
sequence length 289
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe6A00
2HA7A 5AIBA 3R3ZA 4LKOA 1T4MA 3BJMA 2J3DA 3D2AA 3C6BA 4MJ3A 4XX1A 4KYVA 3H2HA 2BFNA 3H17A 4HVTA 2HA2A 4K6KA 4B9EA 4EY7A 1XZDA 3B5EA 4NZZA 5KWJA 5C8ZA 2HU5A 3ILSA 1A8QA 3WWPA 3LP5A 3R40A 1UKBA 1CUEA 4U2EA 1EDDA 1LGYA 2QUBA 2ZYSA 1VOTA 5ALUA 4Q34A 1YB6A 4AN1A 3DS8A 4A16A 3NGMA 3H2JA 2FX5A 1MX5A 3KWJA 1CVLA 4GWLA 1SCIA 3EQ7A 2BUBA 4AB1A 4L0CA 3V9AA 2GZSA 5EIEA 3X3HA 3A70A 3QYJA 1ISPA 4GBGA 3IULA 3CXUA 4YK7A 5ALWA 3WYDA 4KE7A 4AO7A 1F8UA 2DHCA 4DSZA 4HXEB 3GZJA 5J3JA 2DHDA 5AOBA 4B84A 1TCBA 5EFZA 5BV7A 3Q8WA 2QM0A 2H9YA 2W6CX 2OCLA 3QVMA 2PUJA 3D3NA 4K2AA 2OCIA 2VF2A 3H19A 2VAVA 5T4BA 7YASA 3TRDA 3WK4A 2WJ6A 4QEKA 4EY8A 4MWTA 2WIJA 1FFDA 2OAGA 5AM5A 1VLQA 1AQLA 5JD4A 4JH0A 4GEGA 4U2DA 5ALMA 4DTCA 2JGKA 3BWXA 3K6KA 1EK2A 5AIAA 4F60A 2VT7A 1ZD3A 3FVRA 3KDAA 4IQ4A 4QDTA 4K5QA 1J2EA 2JF0A 1MN6A 2J4CA 3O4HA 1MAAA 3ESBA 1BS9A 5BOVA 3B3QA 4W1RA 4H0CA 3VISA 1ODCA 1GKKA 1SCKA 5A7HA 4DMCA 1L7AA 1BE0A 3C8DA 1R9MA 5FKJA 2LIPA 1JJIA 3VJLA 1LPBB 1W52X 3E3AA 3C6XA 3IVMA 2ZVDA 4H7KA 1ZJ5A 1ETHA 1ZI9A 2ZJFA 5FXMA 1B6GA 2VAXA 2OQVA 3W04A 2QKYA 3QM1A 4ITVA 1E8NA 2V98A 4O08A 2QVBA 5CT8A 4QDUA 4J0GA 2J4FA 4DIUA 3S8YA 3WKEA 2WHPB 2J3QA 1G42A 1UK9A 4Y9SA 3I1YA 4G8DA 3DYVA 1H22A 2RGUA 3KD2A 4G4IA 3VKFA 2WUDA 2XLBA 4HRYA 5A62A 4AZ3A 4HTAA 1UOOA 1YSCA 4U2CA 4MYDA 1G5FA 3BF7A 3T52A 2WUGA 1IVYA 4Y7DA 5CTAA 2I3DA 2ORYA 2ROQA 3STTA 5AJHA 4B0PA 1FSSA 5ALHA 5AI8A 3WIOA 4F0JA 4A23A 2GBGA 1H2ZA 3IB3A 3G9XA 4CIBA 3ZLTA 4B85A 3CN7A 3P2MA 2QS9A 4IH4A 1OILA 4WFKA 5K3FB 4C87A 4EY6A 4MYSA 3KWFA 1CUYA 2JGMA 5CH8A 2QRUA 4X93A 2VJAA 2ONCA 3D4LA 3I2KA 1H2XA 4BVKA 4KE8A 3FYTA 5DTIA 1XZAA 4H77A 3ZV7A 5LZ4A 3HSSA 5JZ9A 4MEBA 3K9BA 4EY5A 5EGNA 4FKBA 2OG1A 1VXRA 4LXIA 2X8BA 2QMQA 2XMDA 1GT6A 2XMRA 4XVCA 5HFAA 4UBNA 1Q0ZA 3N0TA 3GA7A 4DMKA 1THGA 5JAUA 1UOPA 4MEAA 4G4JA 1UOQA 4Y2PA 1ACJA 2HIHA 4DMFA 5IVKA 2AJCA 1TRHA 5D3KA 4LYDA 3MGAA 2HA4A 1DU4A 1FFCA 2EDAA 1DQZA 4FNMA 1CEXA 1H23A 3BJRA 1G66A 1WOMA 1UKAA 4LHEA 5K3AA 1L7QA 1HQDA 3RM3A 5LKAA 1IUPA 3WI7A 1PFQA 2WG1A 2WSLA 1PJAA 2PU7A 2VA9A 3G0CA 3WK7A 4UBJA 5FV4A 1SOMA 1M33A 5AK4A 2DR0A 2CJPA 2Z3WA 1E5TA 3QMMA 5ALLA 5AK3A 1EA5A 4UHBA 3JYHA 3WL5A 1BEZA 3L1IA 4OYYA 4GLBA 1VXOA 1A88A 4C4XA 1H2YA 4BTLA 1CUAA 5ALZA 5ALVA 2XT0A 5HCUA 3H1BA 5D7BA 2JEYA 3F8SA 3OG9A 3C43A 2HRRA 3H2IA 1NX9A 5T4HA 4B0OA 4M0FA 4IH1A 3FOBA 1VKHA 1ZI6A 1U2EA 3WJ2A 3G02A 3AIKA 4WY5A 4L3WA 4H35A 4AMYA 3UUFA 1XQYA 5HFNA 3V1MA 3WWEA 4OB6A 5JAPA 3FLAA 3DJYA 1UZAA 5AO9A 1EVQA 3QBJA 3QPAA 3AJAA 3FSGA 1XQXA 4B80A 1CQWA 5ALDA 4DNQA 4KAJA 5JAHA 2CZQA 5I7UA 2W22A 1ZD5A 3M81A 2D5LA 2CBGA 3V48A 3WIBA 3MUOA 4BB0A 1C4XA 1DWOA 5DLPA 5CT4A 2WTNA 1CUDA 4ZWNA 4DM7A 4G8CA 4S0XA 5LIPA 4Y2TA 5E4YA 4BVLA 4GW3A 1GPKA 1AC5A 4Q3OA 5KWIA 3OM8A 4G8BA 1WM1A 4I19A 1DWQA 4J0HA 3U0VA 1MTZA 2UZ0A 1ZOIA 1YASA 3BE8A 1QIJA 3HACA 2PSJA 1K5PA 3WKDA 3JW8A 3STXA 2PKYX 3BDIA 5HF5A 4PSDA 3F96A 5CW2A 4WDRA 3WKAA 3ZLVA 4V2IA 4N5HX 4YPVA 4MWSA 1WPRA 1R4ZA 1XRQA 5AM0A 1TKRA 4B9AA 5SYMA 5CBKA 1E8DA 2FJPA 5DYTA 4FLFA 5ALOA 2C5GA 3GUUA 3WA7A 4U2GA 4OUKX 5E4JA 1ORVA 4H18A 2EDCA 3R3XA 2ECFA 3STYA 3D2BA 1CUUA 3STUA 2WG0A 1VJ5A 1OCEA 3DLTA 2QT9A 3DNMA 2Z5GA 1P0IA 5FP0A 1G4HA 4QDXA 1SCQA 1FFEA 3IA2A 3I2FA 1CIJA 3G9UA 2Z8XA 2DCMA 3MVEA 2WUEA 2XMQA 1EXWA 4B7ZA 4BC0A 5E4TA 4N8SA 1C7JA 4CCYA 1K8QA 2VQ6A 4C4YA 3FLBA 5LZ5A 4X85A 1VA5A 4N8EA 1IMJA 4AX4A 4RNCA 1GQRA 2XUJA 2XUIA 5HK8A 4KE6A 5CT6A 3V1LA 2I3ZA 4XWGA 1JFRA 2YASA 3O4GA 1QIFA 5ALTA 4G9GA 1XRPA 3BDVA 1JU3A 6YASA 3VJMA 1SC9A 2WTMA 3F67A 3WK8A 3WZLA 4OPMA 3W9BA 4PW0A 3WWDA 5IVHA 2HFJA 1CUVA 1D07A 1DWPA 1XLWA 5AI4A 4BCCA 3W9UA 1LPOA 5K3FA 3OURA 5AICA 3WYNA 4CFSA 2WQZA 1W6RA 3D0KA 1IZ8A 3O9MA 2DHEA 5LKRA 1ODSA 5FPPA 2B4KA 3ICVA 5HQ3B 4EA6A 4TVKA 4ZGBA 1JI3A 2QXUA 1QIKA 3AILA 1BROA 1PV1A 2OGZA 1UKCA 1ZICA 5ALYA 5AP9A 1MNQA 3DOIA 3LCRA 4Y2JA 2RHWA 4FMPA 4KEAA 1R50A 3WZMA 3MUNA 3G0BA 5BWBA 5AK5A 1JU4A 3WWCA 4D9JA 1F6WA 1QOZA 1SFRA 5ALXA 4X95A 5HKBA 1HLGA 2CMFA 2X5XA 3LS2A 1LPPA 3KOOA 2QXTA 2BGRA 5IH7A 5CT5A 3R0VA 5K3DA 2WIDA 5ALRA 4J0DA 4J0KA 1CUIA 4UUQA 2WHQA 5AOAA 3H2GA 4QLOA 1RWQA 2QOEA 4QWWA 4X90A 2Z3ZA 1BU8A 2CEKA 3ZI7A 3WK6A 3C87A 3DL7A 1MNAA 3WK9A 1XFDA 1WB6A 1XZJA 4CG3A 1YCDA 3W2TA 3VVMA 2VEOA 4BAGA 4Q3KA 2Y1KA 4UFOA 1RP1A 5C8VA 2JBWA 4Y2VA 4X71A 1VZ2A 2XUKA 1MJ5A 2XUOA 5A2GA 5FUMA 4GXNA 1WPXA 5BWCA 3TGLA 4QA9A 3DYIA 4LIPD 3GBSA 1XRNA 3A6ZA 3WKCA 1P0QA 2HU8A 3FYUA 1XKLA 5AKIA 3F9CA 5ALGA 1A8UA 2I78A 4FDMA 2VSQA 1TCCA 2WFZA 1Y7IA 3DDUA 1WB4A 1N5MA 2HA5A 3NUZA 1LNSA 2AJBA 3PFCA 2XMBA 3I6YA 1JMKC 1XLUA 3BIXA 1WHSA 3EIOA 3TJMA 3E0XA 4Y2RA 4UBMA 3A2NA 2ZSHA 4BP9A 5CMLA 1TIBA 3AINA 5HZGA 1CR6A 5JYCA 4BZZA 2XQKA 3QMVA 1MPXA 3AZQA 4EZIA 1UK6A 3WL7A 3O0DA 4FLMA 4MQMA 1Q83A 3IIIA 4G1FA 2R11A 4XIIA 1JMYA 4UHCA 3WLAA 1H2WA 3YASA 4B81A 1MX1A 1BCSA 4Z49A 3QH4A 4G4GA 4C6HA 2VTVA 3WKBA 4M0MA 1CQZA 1YS1X 5CXUA 3E4DA 2AJDA 4E11A 3FLEA 3AIOA 3VJKA 3TEJA 3UUEA 1EVEA 5E2IA 3WL8A 3L1HA 2BJHA 5DNUA 2PBLA 1EK1A 2Z8ZA 3CN9A 5ALJA 5C7YA 3IUJA 4LXHA 3STWA 2YXPX 4NVRA 1W76A 4E14A 3AUKA 2QTBA 4LXGA 4B82A 5K5EA 4PF1A 4AO6A 1E8MA 4UHFA 3ZWQA 1UK8A 5AM1A 1FJ2A 1EX9A 4K6HA 1ORWA 1BN7A 5JZBA 3SWWA 5HF8A 3D7RA 4X92A 4FFWA 2ZJ6A 4PSUA 3G0GA 4CG1A 1CLEA 1LPSA 4AZ0A 2RONA 3DEAA 3HEAA 3DOHA 5EHXA 3PDCA 3C8HA 4UPDA 1GQSA 4BVJA 5FDFA 1T2NA 2JGIA 3K2IA 4OU5A 5LZ8A 4J03A 1EINA 4PO3X 5DJ5A 3IUMA 3W06A 2WFLA 1A8SA 5LZ9A 4JYPA 1UXOA 5EIHA 1KU0A 3RLIA 5JD5A 5JD6A 1CUWA 4AXBA 1W75A 2PPLA 4QE3A 4N8DA 1YAJA 1QTIA 1O6FA 1XZFA 4FBMA 4WY8A 5JIBA 2H7CA 1ZI8A 3G9TA 4EB0A 2V96A 2XQGA 4J0IA 2PSDA 1EB8A 4UHDA 4BBZA 3PFBA 1YR2A 4K6GA 3NWOA 1BCRA 3G0IA 2WHRA 2HFKA 2OQIA 3B12A 4QZVA 4JNCA 3HXKA 3HC7A 4KAAA 1U8EA 1XRLA 1XZMA 2ACEA 3PUHA 5CH3A 5DNVA 3R3WA 2WIKA 2ZYIA 2CB9A 5AKEA 2DSNA 4ZV9A 2HDWA 5AKXA 4DMHA 2XE4A 3SX4A 2VT6A 4QDZA 1DINA 5FPQA 3GFFA 2JGEA 1XZBA 1RYYA 2FUKA 3ZLUA 2WG2A 1CUZA 2C0PA 4BTVA 3WK5A 4L9AA 4J0JA 5AKJA 1WCYA 2AJLI 2ZYHA 1WB5A 2WJ3A 3NOXA 4AMZA 4BAZA 3GROA 3ANSA 1TQHA 1C7IA 4UBOA 3OTQA 4WFIA 2QR5A 3BIWA 1BN6A 1JJFA 4L72A 1EDBA 5AKYA 3BXPA 4WDQA 1ZGBA 1N5RA 1AURA 3G0DA 1MU0A 2BKLA 4A5SA 1QO9A 1ZIYA 4WJLA 4FBLA 4CIAA 4QDOA 4F21A 1QIHA 2OXEA 2R8BA 2HADA 1TK3A 2O2IA 5ISMA 3SK0A 5DYYA 5AKHA 1UFOA 2YH2A 1GXSA 1JKMA 3IUQA 4C4ZA 4C88A 4C01A 3G8YA 5K3BA 2PUHA 3CCBA 4H7EA 3WA6A 3DKKA 2I03A 3R3YA 2HHAA 4OD0A 4ZRDA 4P92A 1EH5A 4RGYA 4TGLA 3BL8A 1R9NA 5DWDA 1HBJA 3OOSA 4GDMA 5AK6A 2PSHA 2PM8A 5D6OA 1BEEA 1AZWA 2G5PA 1VA4A 2GBIA 2OLEA 2WILA 1Y37A 3HLKA 5ALEA 1UWCA 1MO2A 3FYUC 1EDEA 5LP1A 4Y2YA 3G9ZA 2BUCA 3PUIA 3V1NA 2ZYRA 1Z68A 4I4CA 1ODTC 3FAKA 1QGED 5AI5A 5HKAA 1IZ7A 4P9NA 1JT2A 2JEZA 3RKSA 3L1JA 3M3DA 5K3CA 1QIMA 5IVDA 3I2JA 1LZKA 1QONA 1QFSA 4BDTA 3AFIA 2V9ZA 2WHPA 4PQEA 3SC2A 5AM2A 4KRXA 5C81A 5ESRA 2GYVA 1VE6A 5H3HA 3QZUA 4EBBA 3WL6A 3M82A 2XMCA 1XZEA 5AH0A 3S2ZA 2G4LA 1AX9A 4GECA 2JGFA 2BGNA 4Q05A 2NW6A 2Q0XA 1YA4A 3I1IA 2XUFA 5A7GA 5ALQA 1DQYA 3H18A 4W1SA 1WHTA 5EHQA 3D2CA 5CURA 5C8XA 2CKMA 1DX4A 2XLCA 1QIDA 2CUTA 2RAUA 3WWOA 3QITA 5JARA 3T4UA 5I8PA 3O9VA 3O95A 4W1PA 1GPLA 4J0CA 2XUQA 3F98A 3C6ZA 4UBKA 4CG2A 1GZ7A 3HRHA 5JALA 1E66A 1A7UA 5AHXA 4KJXA 4FOLA 1TAHA 1KEZA 3A2MA 1FFBA 2O7RA 4ZI5A 1ZD4A 3HZOA 1DX6A 3M83A 3RK4A 4OCZA 4FHZA 3C6YA 4B83A 5AOCA 2H7YA 1IUNA 1U65A 2G63A 4HRXA 3C70A 5AI6A 2DQZA 1JJBA 1J1IA 4BAUA 2H7XA 1AKNA 4OYLA 4BE9A 1ACLA 4OB8A 1GGVA 2WFMA 2C0QA 1ZGCA 1X2BA 4KACA 2V97A 5F4ZA 1DT5A 4X6XA 4DNPA 3DCNA 1CUCA 2B61A 1O6GA 3OPMA 1XZKA 4RPCA 5SYNA 1E89A 2GYUA 2HA3A 2O2GA 1QO7A 2WM2A 3ESAA 4DSAA 5AKGA 1E3QA 2WIFA 4W9RA 3C45A 2JIDA 1P0PA 2ACKA 2VJDA 3FCYA 5KREA 4J7AA 2HU7A 3DL4A 1QIGA 2BUAA 2PU5A 4UHEA 1DT3A 2HM7A 1XRMA 4IHAA 4BDSA 4W63A 4EHBA 1THTA 4W1QA 1CUHA 3DKRA 1GKLA 4MXDA 5JAOA 3QMWA 4BC1A 2XUAA 4YASA 5HF6A 3HYSA 5IVIA 5JADA 4DLNA 4H7IA 1XZCA 3I2HA 3RARA 2ZJ7A 1Q0RA 4ETWA 3BF8A 4AO8A 1N8SA 2OAEA 3G7NA 1QFMA 2HL6A 2O7VA 2OCGA 1QIIA 3LIIA 3PF8A 2ZSIA 3AZPA 5T4EA 3ESCA 4DNFA 1CUXA 1Q84A 1LPMA 1YA8A 2WU4A 2WUFA 2YYSA 5HF9A 4PSCA 1CFJA 3EF3A 3ZPXA 3H1AA 1J07A 1F0NA 3O4JA 2VJBA 4X6UA 2XMGA 1YB7A 1QLWA 1CUSA 4UFPA 3VXKA 3W05A 4EY4A 2G5TA 4BATA 3FCXA 3PE6A 2RI6A 4CCYB 2RHTA 4FTWA 3STVA 2XUPA 2Y2UA 4JUIA 2EEPA 4BZWA 1NU8A 4H7HA 4N5IX 1LZLA 1LBTA 1QIEA 4BYMA 4OSEA 4FLEA 1P0MA 3EBLA 3I2GA 3EQ9A 5DYWA 3JWEA 4OU4A 3FSGD 4BE4A 4KRYA 3UMJA 5CH5A 4UFNA 5A71A 2IIVA 1AGYA 4BCBA 1LBSA 5AM4A 1XKTA 3H04A 3ICWA 3HABA 4J3JA 5LYYA 5KBYA 2WKWA 1R88A 2AJ8A 5FLKA 1X2EA 1YS2X 5FOQA 4X6YA 3R41A 1LPNA 5AI9A 4U2FA 4Y2UA 3HI4A 3ESDA 4DGQA 2C7BA 2VJCA 4FWBA 2QUAA 1DTEA 2FJ0A 5JATA 1NU6A 4CI9A 4YX9A 2GBFA 2PSEA 4E46A 4E15A 1CPYA 3C5WP 2Y2VA 1MAHA 2GYWA 5AM3A 2XQIA 1QJ4A 2XQJA 4U2BA 2C58A 1XZIA 1K63A 2WIGA 1BRTA 5JZSA 2XMZA 1IUOA 2XUGA 3DD5A 4M0EA 3IDAA 5D3ZA 4BRZA 2QJRA 1CUBA 5I9IA 2Y6UA 2B9VA 4X3CA 5YASA 4ROTA 4ZXFA 4GI1A 5IKXA 5ALNA 1U4NA 3FVTA 1LPAB 4BCDA 1J06A 1QTRA 3A2LA 4JEIA 2XUDA 3PICA 1FFAA 4IH9A 3WQHA 1VZ3A 2P8SA 3I2IA 3CCCA 4X7BA 4UBLA 2PVSA 4Q82A 1HL7A 5AKZA 1S8OA 2HA6A 5CT9A 5K3EA 4P93A 3IBTA 5LLSA 1XZGA 2AXEA 4OB7A 3FBWA 4ZREA 3WJ1A 5EHZA 2HA0A 1HDEA 1XLVA 1XZHA 2C5FA 1UK7A 3ANTA 3IURA 2E3JA 3DQZA 4HZGA 4C89A 1HPLA 1AUOA 1EHYA 3V1KA 4RE5A 2D0DA 5FRDA 1UT6A 5A7FA 1CUJA 4QWMA 1W1IA 1L7RA 4KR0A 1K6EA 2JGJA 3QPDA 5HQ3A 3D5EA 2O2HA 4EUSA 2PSFA 3IUNA 3R3VA 1CUGA 2QJWA 2H1IA 1XZLA 3C5VA 1ZD2P 4B6GA 1F0PA 3FNBA 2VATA 3FYUB 4HS9A 3KSRA 4FFVA 4F5ZA 4Y2XA 5DNWA 1R3DA 2BAGA 4RE6A 2XB6A 1CRLA 4X94A 5JANA 1XRRA 5AKLA 3O4IA 3HJUA 5EI5A 4ARAA 4TPKA 1R1DA 5ALSA 2WLSA 4HXFB 2XMSA 4KAFA 5CXXA 1N1MA 2IX9A 4NS4A 2XQFA 3ED1A 1XQVA 3FWHA 5AI0A 4QNNA 2IITA 5EIAA 3AIMA 2Y6VA 5JASA 4GHWA 4ZV7A 1QE3A 2BCEA 4WCVA 3U1TA 1YAHA 2XUHA 5AKKA 1XQWA 4IO0A 4LYEA 3PI6A 3PF9A 2OPHA 2OCKA 4FNGA 1X70A 4BRSA 2K2QB 1EI9A 4I3FA 4G5XA 2ES4A 5ALPA 2QZPA 1MX9A 2WU3A 4X91A 2DQYA 3I6MA 1CV2A 3H0CA 5ALIA 3F97A 3N2ZB 1MT3A 1I6WA 4X97A 4NMWA 2PL5A 2OGSA 2B20A 3GELA 1Y7HA 3I28A 2X76A 4Q1VA 5LZ7A 1W4LA 2HRQA 4P08A 5CRIA 4Y2SA 2DFPA 1K4YA 2XDWA 3AZOA 3LIPA 2GBCA 4HAIA 1AMNA 3WMRA 3VDXA 1KU6A 4CCWA 4H7JA 2XI4A 4DYHA 4Q3LA 5ALKA 5A6VA 4XJVA 1VE7A 3D59A 5EHNA 3H2KA 1XROA 4DNOA 3E1GA 3QPCA 4H7DA 5ALFA 2GZRA 3VVLA 4AN0A 3EQ8A 1LLFA 2PX6A 1USWA 1QZ3A 1EB9A 5DTJA 4Y2QA 2JGLA 1ZIXA 1ZJ4A 1GPNA 4AQDA 1HKHA 4KE9A 3I6ZA 2WFLB 4X00A 3R3UA 1B41A 4H7FA 5LZ2A 4UBIA 4INZA 4PNZA 4ARBA 2WJ4A 4HXGA 4PV7A 5HK9A 1CUFA 3KXPA 2OGTA 3LLCA 3Q0TA 4QLAA 5T4FA 2RIPA 4MQLA 4WFJA 4BP8A 1OXMA 4UHHA 2C4HA 4JYMA 4G9EA 3OC0A 1TCAA
chains in the Genus database with same CATH superfamily
4IIJB 3CGGA 1Z82A 5AIBA 1QK3A 4EKEA 5EE5B 5GJWC 4L22A 1N2SA 2JHAA 3AXTA 2ORWA 1NHGA 1MXFA 4LI3X 1K06A 4P3NA 4R9RA 2GD0A 3PQ2A 3C3MA 4LFAB 4PFKA 1PFWA 2LD4A 2PYZA 2XCRB 3SEQA 3LBHA 1K6IA 2Q3HA 4G1EB 4XX1A 4Z4CA 1TTPB 1Z0ZA 2HRDA 4KMRA 3GJTA 4LTDA 3R2JA 2AW3A 4R8MA 3VPXA 3KQNA 3BJZA 4QUJA 1Z5UA 3H17A 2JA2A 3I2YX 4OQZA 4BQIA 1XZDA 3FPLA 3KPJA 4LA4A 4AW9A 4ZQHA 1PZGA 5K8CA 2Y71A 5DGCA 1H3FA 1AB6A 4ZGWA 3ILSA 4QJBA 1X39A 3J7AC 4HUQB 1A8QA 4ICIA 1DBPA 2A6PA 2AXNA 3HBMA 3LP5A 2GTIA 2ODEA 2VYNA 2FMIA 3IRVA 5G4KA 2P5SA 3R77A 1GYRA 4O8ZA 4LDZA 5D3MB 5EXTA 1TC2A 1CUEA 4JJGA 3PP8A 4G3XA 4B6PA 4D0NA 1KSFX 1Y7TA 4RC9A 2ZYSA 2WZCA 1VOTA 4TTVA 5FOSA 3PGXA 2YWFA 3DR5A 4ZU1X 1VKRA 2WWGA 4JP8A 1E59A 3IDFA 4RL4A 2J7PD 2VJQA 4TKZA 2VAPA 2HPAA 2WA2A 1I3NA 1WDWB 3KZNA 2IOYA 2FX5A 3ENVA 5FOXA 3SMVA 3W2FA 1KMCA 2PH5A 3KWJA 4A10A 5IJ0B 1IAQA 2Y0EA 3PLRA 2C9ZA 2XH8A 4AB1A 4HGPA 1CB7A 2P9BA 5D85A 4NCXA 3DPUA 2YWCA 3PV0A 1A95A 1X7YA 4D41A 3BWYA 2XCSB 2B6HA 2X2EA 1U7DA 4RSGA 2WWXA 3GLIB 4JGGA 2HTFA 2DVMA 4M8IA 1ISPA 3LKVA 4MR9A 1Y1PA 3CXUA 4BIIA 2R68A 5ALWA 1AJEA 4IXDA 1I7NA 3MB5A 4X1KA 3SR3A 5HUJA 2UUAB 1K5DA 3E2MA 5DW3A 1KDOA 4RFVA 3VYVA 5J3JA 4PPYA 1DQSA 3WVNA 4B84A 4F8JA 5AESA 1EZ1A 3E4CA 1TCBA 2C99A 2O8CA 1ZY2A 4LRQA 3JATA 4YAIA 4ND2A 1Y3AA 4EHNA 3H2ZA 4GPBA 1KEEB 4B45A 5BV7A 2QM0A 2H9YA 1MXHA 2P2GA 2QMZA 1OA0A 1WQ3A 2HLNA 2OCLA 3CSUA 1L4GA 2GD1O 3NIWA 4DLXA 4NBTA 4P4LA 4HR7A 1J5EB 4E03A 2Z5FA 2YV4A 3DE4X 1U3DA 4ZVSA 1UM9B 3LBYA 3OO0A 4XUCA 3AH8A 4DKJA 2BFMA 1JKXA 1LJUA 5E8RA 1VMIA 3FTDA 3JQCA 1KZ9A 2KWIA 4MQEB 5DKFA 4CCAA 7YASA 3WK4A 1XE3A 1S1CA 1JA1A 2WF9A 2XD4A 1ZSYA 3ITNA 2GB4A 3I23A 3L6DA 4EY8A 1AN9A 4RTLA 3FJYA 2JBHA 3LSTA 4P83A 3ZHTA 3NB0A 4L5AA 3TIGA 2IOHA 1CDZA 3ANLA 1T2VA 3RROA 4XDYA 2R8ZA 1ZM4A 3G8BA 1AQLA 4YRAA 1KL7A 1JB9A 3FTEA 4JUAA 4BFVA 1KMNA 1YOVB 1JTFA 4JH0A 4NZYA 4GEGA 2UUOA 3CUVA 4TKUA 4K9MA 3DDHA 5G2OA 3V3TA 4R1PA 1K4MA 4QARA 2GK6A 4YRRA 2EHJA 1N8KA 4KMOA 3PUWA 3BWXA 3K6KA 4LVOA 5I5GA 1Q0PA 1PP4A 3E8SA 1N6OA 3O03A 1QV6A 2PR7A 4Y9DA 1J21A 2ASVA 2P0AA 3OLVA 5GIOE 3MGKA 3V4SA 2A14A 2GF0A 3PX2A 4W5WA 2JDID 4X65B 3ZY6A 5ICCA 4QXQA 3BRWD 4UAVA 4NCAA 3PIIA 1IHXA 2GGSA 3IPYA 3STHA 1G8GA 1PF7E 3LUGA 1BS9A 1LDMA 1SD1A 3QBEA 3QBTA 1C7FA 3B3QA 4FFPA 3PHHA 4TV8A 5EWJA 3WRYC 3EH1A 2A1IA 1L5FA 4FEYA 3WLIA 5K0ZA 2HK7A 2PWPA 1UFVA 4JLJA 2CVZA 2OWEA 3DA8A 1C3EA 2FWPA 3VU8A 4UOZA 4TMWA 1TL7C 4RD3A 4QUIA 3AJRA 2G70A 4DGSA 4DWVA 3BMQB 5E9WA 2GN2A 3QG5A 2WSSD 3WB0A 5A4JA 2QY6A 3LQFA 1N32B 4FI3F 3WBKA 2BGMA 4KK4A 3ESYA 3CPJB 5KQMA 4GZ5A 1R9MA 2ZI9A 3DT8A 1JJIA 3EZ6A 3KEQA 1U2RA 4L4RA 3L79A 4XB6B 3S2EA 1NBMA 3M6VA 3TLZA 1W52X 3L0SA 3AF5A 3E3AA 1COWA 5JS7A 4LBVA 4E12A 2ATIA 1B14A 2X42A 3N07A 1LCIA 3T3IA 4KVGA 3NT2A 1B3RA 1ZJ5A 2A0XA 5AVZA 3U7GA 1NDQA 3EE6A 5DXFA 3F49S 4MJLA 3AEQA 4PR0A 3IBCA 2VBGA 2Q6OA 2EBUA 3DTTA 4M8LA 5KS2A 2ZR8A 1B6GA 3Q7QA 5CAEA 2VAXA 2R62A 2OQVA 4DXHA 1LQTA 5K2MA 3I72A 4ITVA 3C4QA 3WTBA 3V3KA 1Z07A 3ACDA 2RSLA 2V98A 1R27A 3OBBA 4TXMA 3ZH9B 3VSCA 4N39A 3FCUB 1NF2A 5DSZA 5IDQA 2PV0A 2I6SA 3ZD8A 5GVSA 3S8YA 2B0JA 4D3ZA 1M6NA 2ZGVA 3GRVA 2ZRCA 5JJ5A 2R3SA 3WKEA 1JHDA 2B4QA 1D09A 2YVAA 2YR0A 3BS4A 3E9RA 2AB0A 3ONNA 4HEQA 4DV4B 1AS3A 1XYGA 1VCMA 3BD7A 4G8DA 4M99A 3H4VA 1KYYA 3FCOA 4N3CA 1IN4A 2OBMA 2RHBA 3GT4A 3M34A 2RGUA 4G0YA 4G4IA 4YAFA 1EUZA 1QVZA 2ZCUA 2FR0A 4URVR 3GVIA 3TTYA 3UH0A 4AZVA 1CNEA 5IT0A 5EJ7A 2DBZA 5A62A 1P2VA 4D9CA 4AZ3A 1YIAA 1CRPA 3NTOA 2CBXA 1YSCA 3QJ5A 1JAHA 4MVJA 4PZEA 2QX7A 4U2CA 3QYPA 2OK7A 3RANA 3VR4A 5KOJB 4MYDA 1HQCA 3D2LA 1H9AA 4H3SA 4MV1A 4DLZA 2FRDC 2UYQA 2ONZA 3ZCXA 2DPGA 3E27A 4WQMA 1NUSA 3PR2B 4BX0A 3ZS8A 2I3DA 1GU0A 1P39A 5CDGA 1M0TA 1SVIA 4MA4A 1F7VA 1XNJA 3STTA 4GC5A 2O8DB 2DU8A 3KUUA 3AUXA 3W0LB 1IN7A 1IQRA 3G7UA 3NX4A 5AI8A 4ZJYA 2EZ9A 4A23A 4CM4A 4PSKA 4Q9DA 4YLGA 3NBZC 2VDRB 1NFRA 1EYZA 4HAOA 3VFDA 1ZOPA 4GBED 1D2NA 3VUFA 4EJSB 5MDHA 4A6XA 4GP7A 1JWLA 2QN7A 1OMOA 2D4HA 4J2OA 5C37A 4B85A 1SC4A 2AD1A 2QTFA 4KO3S 1RTTA 3AI7A 4IMJB 4YQFA 2C9YA 5K6AC 1RJ9A 2FEKA 2QS9A 2MT9A 3PC2A 4DXAA 3SZGA 2G0NA 5B6JA 1ZX1A 1I9CA 4ZXPA 4DUGA 3D3JA 4JA0A 3A1VA 2YWJA 2YJ6A 2C5AA 2FXVA 4BLRA 3NP7A 5F33A 4MYUA 1X92A 4ZQFA 4MQ4A 4BO6A 1E0AA 1DC4A 1ZMOA 2EJBA 4EY6A 1Z5GA 4Q9LA 3QVVA 3TMKA 3QOWA 1IY9A 4QBGB 3KWFA 3CZQA 3PDHA 3L40A 5AT1A 5A3SA 5CH8A 4PNEA 1G6Q1 3K9LA 3QLUA 3WL3A 1VJ1A 2JRCA 4JHLA 3V2UA 5CDHA 4MGYR 1DJOA 1QH8B 1U7ZA 4LC9A 4LMBA 4X93A 5AJXA 3SHQA 1ZA2A 2ONCA 3I2KA 1U2PA 1XA3A 4G5QA 3PNLA 5COQA 1YI0A 3IMKA 4KE8A 1G5RA 4HNTA 2PXXA 3FYTA 3N2NA 1KH2A 2Z56A 4MVJF 4QGBA 1UKEA 5DSXA 1F3OA 4H77A 2ZUSA 1FU8A 1TEZA 3ZHOA 2W0MA 3I04A 3R5JA 1H6CA 1XWFA 4J7CA 4PTZA 4ZOLB 3UWSA 1QMGA 5BPFA 1EVYA 2VP5A 3H1GA 1UT8A 5LZ4A 3HSSA 5H4HA 1NOIA 3TO5A 1KEKA 1E2JA 2AG0A 1V39A 1E7YA 2P3LA 2Q6LA 3IHKA 3E9DA 1S1MA 3KOMA 4MEBA 1IVNA 1WABA 2QG6A 3N2IA 5KU7A 4FKBA 1G16A 2JJMA 4QYTA 4Y6RA 5MN5A 3O4RA 2N75A 1BX1A 3IAM1 4O63O 2FPOA 5J43A 3D4BA 3AFMA 4V3BA 5FUWA 1Q50A 4TZ0A 3INGA 1V41E 3SOPA 3DVLA 4XVCA 4UVHA 2IQ5A 4TXLA 4UBNA 1VLHA 2X0EA 2WPNA 1ZUHA 1SXQA 4PYOA 3MZ0A 4TTJA 4EL0A 3PA6A 5KC9A 3GA7A 4IVQA 2IH4A 3HN6A 2H1SA 2IZOA 3T3GA 4R1QA 4ZP1A 4V1CB 3MK31 2PWYA 1V9LA 2EBFX 1FIUA 1E1QA 3R6WA 5LP6A 1Q0SA 1UOQA 5JWRA 1ACJA 3RREA 5L3VA 3GJQA 2REXB 1YUMA 5IVKA 1B2RA 1KDZA 2PGIA 4B6OA 2JZOA 3IJPA 4NENA 3L6EA 3MWDA 1F4VA 1W1WA 3EWNA 4PLHA 3HTXA 2PKRA 1NF9A 3MGAA 3X2EA 5E4FA 2ZPUA 1CVRA 1THMA 4PPFA 1ADBA 4GQAA 5FFFA 4XFDA 4JELA 4X1YB 4TSRA 4KHZA 4NEQA 3N0RA 1NLFA 3EW7A 5CPBA 1YCHA 3I83A 1IL0A 3RYCB 1N6HA 3PD7A 5BRJA 4ER3A 5C1OA 2NP7A 2XNDA 3ZDEA 4PGHA 4H6PA 2I7TA 1U8FO 2VQDA 1OB2A 3ZHVA 2V7EA 3BERA 3K5HA 3VPGA 1L7QA 4W9NC 3KLNA 2WF8A 3TI9A 5LKAA 1IUPA 4CLDA 1NNUA 1HFJA 2DKFA 3C6KA 4BJHB 2YJ4A 2UUCB 1Q7RA 4JFAA 4BMPB 4RHEA 1A5AB 4KQXA 2GRUA 3DMTC 2LPMA 1PJAA 3SY8A 2L0XA 3LHFA 4OF4A 3OQMA 4AS1A 4KN8A 3JAWB 1JQLB 1L5NA 3ML1A 4F92B 2OA0A 2IBSA 1SOMA 4D4MA 3DFIA 1I24A 3IBYA 3R9XA 2ZSEA 4R2XA 1K92A 4IDAA 4PSVA 1GZ6A 2ZWOA 5HTOA 1PZEA 2HGZA 4YUXA 3LM8A 1C3JA 2FEOA 1N2GA 3KPWA 2E5FA 1Q5PA 2Q1SA 1PD0A 2NAFA 2ZPAA 2PV7A 3ASZA 3QMMA 4G5GA 4IIGA 4IIBA 3P2YA 1YXMA 4I5IA 1PQWA 2OHVA 5AK3A 3NAZA 3QKRB 4RO0A 3BM5A 3OD5A 4NOMA 1E1YA 2OFPA 4ZYXA 3T3NA 4UHBA 5TQ2B 3RTCA 4NJEB 4R1UA 1BEZA 4P4SB 4DMUB 2GLTA 1UMBA 3V00A 3GJ8A 2GSWA 2PBRA 4G0PA 4WCFB 5DLYA 1KIAA 4RD1A 4MW5A 3NV9A 4E5MA 3F0TA 4GLBA 2PRSA 4E88A 3CNBA 4A8HA 1E20A 3KEGA 3SXPA 2C4VA 2HCTA 4OUDA 5L7YA 1CUAA 3ISTA 1I32A 2ZSFA 3Q3JB 2IPNA 2XT0A 4N6GA 3LT1A 4OL9A 4P3PA 1HNWB 4C0QC 3H1BA 2QPAA 5EMHA 3TXYA 1D03A 1HDXA 1V11A 4L4UA 4CIDA 5IT5A 4B4DA 1DBIA 3SDZA 2JEYA 2ZSJA 3OG9A 1PX2A 5ICEA 1V8OA 3ESXA 2NZ8A 4QGGA 3KYDA 4URUR 2RMKA 5LUBA 2PMDA 4M0FA 2CSXA 5EINA 3I9JA 1K8YB 4KLRA 5FYQA 1JSCA 1JG6A 2OC4A 1VLJA 4IH1A 1E5DA 3HA2A 3HDVA 4C2UA 1FEZA 4NR0A 3PJDA 2N9UA 1AZLA 3FJ1A 3E1SA 1V1JA 3NJ4A 3R7DA 5IWAB 3AIKA 3G13A 2GUWA 4WY5A 1IM5A 2I1LA 1KVTA 4TTTS 2OG2A 4V24A 4JDPA 1BSVA 2V5UA 1HKUA 1UPCA 5KYUA 1DC6A 3ZCTA 4YMUA 3K6SA 2PH3A 1FVHA 3V1MA 4Y6LA 1MQ9A 4DV6B 4R6XA 2A0YA 5JY6A 4MB0A 2OLJA 1FSGA 1NNLA 2CMGA 3D8NA 2RB5A 1D2CA 3E9YA 1L9KA 2FF5A 4P3OA 5GAJA 4BO3A 2H1HA 1XQXA 3W5UA 1CQWA 2GFIA 2D0OB 2ESRA 1E5QA 3KNZA 4DNQA 3DVQX 3QELA 3N3BC 4IYJA 3UFBA 5M7EA 3PHGA 2H00A 5DHUA 4AMUA 2ZJ2A 1Q20A 1QANA 2CXPA 4BMSA 1WSWA 2KS6A 1FNDA 2BGUA 2Q1TA 3MCTA 2CJFA 1SZPA 2QA5A 2YWBA 1YJAA 4MVJH 5TNXA 3IKVA 3HN7A 3VR4H 1DWOA 2IYLD 3NBFA 3W5JA 5J1TB 5K8IA 3EF0A 4GXQA 3DLIA 2NO1A 5BSHA 2PMEA 2BR5A 2H59A 4ETIA 4ZWNA 4CF3A 1VJTA 3ONFA 4QEDA 1M7GA 4DM7A 5CB4A 4GGPA 5TC4A 3TKYA 3EVAA 4GQBA 5HTKA 2Z8YA 2FOXA 3UK2A 4C14A 4EYEA 4J4TA 2OL4A 2E6KA 1VLZA 2H0RA 4QPPA 1NTOA 4BVLA 2QMHA 2QG9A 4RD6A 3BL6A 4EQZA 1GPKA 1J97A 1AC5A 1ZH6A 1EMDA 3A28A 3OPXA 4JS0A 5KQPA 4LHYA 4HDQB 1UJ4A 1KO5A 1PO7A 1EFKA 3L6RA 2NQ2C 4G8BA 4QQNA 4I19A 1DWQA 4LYHA 4UTNA 2BFFA 3NW9A 4J0HA 2HO4A 4PLZA 3U0VA 3UJ6A 3AUUA 2UZ0A 2UZIR 1QP4A 1CYDA 2GHRA 5D00A 3MMZA 4EX7A 3IYLW 3V46A 4O25A 3LGSA 4YXFA 1NFFA 3JW8A 5DTMA 2WWRA 3RFXA 3AVQA 2C3MA 3NASA 3ODPA 3P9ZA 4DEYA 2C92A 3F96A 1F4LA 4WDRA 1CRZA 4BE4A 3UHAA 5B1DA 4J7UA 2L19A 1UBJS 1P2SA 1POXA 1OYVA 2FZGA 1K08A 3KBBA 4YPVA 2OXTA 2QV7A 4BMXA 5LDHA 1WPRA 2IELA 1YBVA 4EG4A 3W9YA 1XRQA 5AM0A 4WNAA 2XTMA 4B9AA 1XYYA 1Q15A 1Y3BE 5CJJA 5ELLA 4DCSA 1V45E 4GZMA 2IV2X 2OO5A 2C8JA 3E22A 4O5OA 4POOA 1JKJA 4MRAA 3CPEA 3I53A 2BRUA 4RSHA 5ALOA 3SJ7A 3QIAA 3IEXA 2C5GA 3QF4B 1U7PA 2RGWA 1T9GS 1PR6A 2JD1A 4JBGA 3S2UA 1CY8A 4MQUA 4U7WA 4IDGA 1MC8A 1RPNA 3KT0A 3EARA 4F8EA 5LQKA 2VNSA 3L8FA 2QX6A 2ADFA 2GAJA 3ENKA 2NV2B 4EKDA 5CB4F 2QM8A 1U5AA 1AKYA 1ORVA 3HI6A 2MSCB 2G9RA 3D2BA 2XDQA 1YBFA 1CUUA 4R7TA 2QTHA 4RHXA 2B98A 1OCEA 3EGDB 1KYXA 3DLTA 3RF7A 2FPKA 3ZKAA 4AVYA 2QT9A 3TLBA 4AZ0B 2Z5GA 4CEHB 2RCYA 3H5NA 5FNVF 4YV2A 2PBZA 3OJEA 4LSWA 4F93B 3MCAA 1RYDA 5C46F 1KWGA 3B8HA 4GZ6A 3G9UA 3AMVA 3HR4A 3I0NA 4FN4A 1D6MA 4A2CA 2JHPA 4K9LA 4L74A 3G8AA 1HOXA 2WUEA 4KUEA 4ENVA 1JA9A 1U04A 4S12A 4B7ZA 4HVLA 4E4YA 4CU2A 1XN4A 2V59A 3AR5A 3KQQA 1TT5B 2O48X 1HC7A 1SHZA 1C7JA 3HRIA 5ER9A 3E5RA 2ZAGA 3AP1A 2X5JO 3JQQA 2HMYB 1CETA 4DR3B 1CZKA 1M5TA 1RXSA 4X85A 3RRBA 4C03A 2BV3A 1HY3A 1XZPA 3OE1A 1C7QA 5AW5A 3V6MA 2E87A 1AHHA 3C7TA 4GOLD 1U1EA 2G40A 1LTKA 2KBEA 1IMJA 2QD5A 3X1MA 2RC5A 2QRKA 4QJ4A 4RNCA 3HJAA 1RC0A 3ILXA 1B8UA 2XUJA 3TCXB 3HWSA 2BFAA 2GDZA 4LJLA 5F21A 2NQTA 3DHYA 3EB9A 4KE6A 4DC1A 2V03A 4Q9HA 3V1LA 1A82A 2CMKA 4TLEA 1THZA 2ID8A 2P2CA 2PH1A 1XPRA 1JFRA 2CD9A 3D7MA 5ECDA 2E2WA 3GLFB 3LQQA 2PVPA 2ECQA 4CETA 3DW1X 4BL5A 1B3BA 1LS6A 5C2JB 3ZDDA 4ZYYA 4C7BA 3LZDA 4HCJA 2FUEA 4LY6A 3NGLA 1G5IA 2GAIA 3DOOA 3Q3GE 1XRPA 3GK3A 4XOUA 4LDPA 4TZ6A 2R1VB 1F12A 1KJZA 2X9VA 1NR1A 1R8YA 3BDVA 1JU3A 2AHOA 3BFPA 3ECCA 3I6IA 4HQOA 3VJMA 1Q6ZA 3JQ8B 3FNRA 4IIHA 4NSNA 4HD8A 5BRAA 2O0JA 2PKEA 4N54A 5DI9A 2XB9A 1T6XA 3NM4A 4G1VA 4MGKR 3WNVA 1JAZA 1NVBA 2BBSA 5IW8A 6CHYA 1S2GA 4K3VA 1PQ4A 2A4KA 5ICSA 1U3CA 3F67A 4ZO8A 3RVSA 1T6YA 4B34A 4OPMA 3DMFA 1S2OA 3WLMA 2A3NA 3WWDA 5IVHA 4C78A 2ZYTX 3O93A 2GWHA 5J63A 3MWGA 5L4LA 1DWPA 4JU8A 4Z1MD 4BWFB 4PN7A 5AI4A 4BN5A 1G6HA 1BGXT 2VS1A 4CR6A 3EFHA 1ST3A 1XF1A 1VMKA 1GGHA 4MWDA 3VAAA 3W9UA 1Z3CA 2W2MA 5K3FA 1V37A 4QC2A 3A9SA 1RRMA 4FE4A 1QQBA 2D54A 5A5FA 5HMMA 2Z1NA 3BMCB 3R5KA 3WYNA 3IPLA 1RLUA 1EG7A 3M6FA 4CFSA 4RORA 1FUEA 4R4JA 3K2BA 3O1IC 4CTJA 3JASB 5DTRA 4QQKA 3T1VA 1UDRA 2FFRA 2R1TB 2VUTA 4PICA 4S24A 2WA1A 3PXXA 4N47A 1JS1X 5FPTA 2QN8A 4IWYA 2IUSA 3JWGA 4FK8A 1CF4A 3FZQA 3ZXSA 2G6TA 1IXKA 5KEIA 3H86A 2KI5A 1ZFNA 4BFLA 4EPTA 3P0JA 4G0WA 3SHTA 1P73A 3NEPX 2ZYUX 5EJIA 3U6BA 2PGDA 2C07A 3RAPR 2Q1WA 5B53A 1B43A 3PS9A 4ECAA 1U2GC 1JBKA 1JI3A 2C31A 2QRVA 5K4AA 1SQ5A 3OJWA 1SAYA 4FQ8A 1NXQA 4PBRA 2D7CA 1YHYA 5C0OE 4HGZA 3JR3A 1ADCA 1XZ8A 5H80A 1BROA 4AKHA 1K27A 3FF4A 4PCUA 3HKEA 3I9V6 2EJUA 3CE9A 4LHXA 5AP9A 3I05A 4PLCA 4HPXB 3EPKA 5CPFA 5CD9A 3V8EA 4CKWB 5KX5A 3ZEIA 2BMFA 3ZWMA 2B8JA 4FKZA 4LZZA 1F0YA 3OCXA 3G0BA 5DX8A 9GPBA 1QC5A 4EG3A 2I33A 1RZVA 2KBFA 2X1VA 2C1ZA 4NFSA 5EIFA 2ZJ1A 3WWCA 4CMIA 1QDUA 1KMHA 4WI1A 4P32A 1KK1A 2R5FA 2WTXA 1Z36A 1K2VN 3HXPA 4A91A 1TGYA 2CXNA 3IHWA 1ZS9A 1SFRA 3U3OA 1BJTA 3JALB 2ANCA 2X15A 3ROEA 3OUTA 1GNSA 3QG1A 4D02A 2CMFA 5HKBA 3I9FA 4ZJPA 4QVGA 4C6TA 1Z75A 3KQPA 1W0KD 2H07A 4ZC8A 3N8IA 2WWVD 4BNMA 1VKOA 2V7VA 2VJMA 4HX5A 4HDRA 6LDHA 3LCUA 4D92A 4AC9A 2RKOA 4OBBA 1OPRA 1KY3A 1UBNA 5L3SB 4ZQGA 3KOOA 1Z0UA 3FOEC 2X3FA 2O8EB 1JHOA 3FROA 3HGQA 4Z9YA 1IXZA 1XHLA 1X7WA 1IB6A 4HPWA 4ZTZB 5JCOA 3UV7A 2BGRA 4PZ9A 2CT8A 3KJNA 4EI8A 1GOTA 3R0VA 2PIAA 3Q8XB 3PT9A 4KXWA 4J0DA 1YVEI 1R6DA 1ZUIA 1MIOA 1QAOA 4PS0A 3D6VA 2ZWVA 3SIPA 1EFTA 1O5TA 1RQPA 3M6XA 1GZVA 1F51E 5AOAA 3OZBA 4CM7A 3JQ9A 2C57A 3RT1A 2FMKA 1Y63A 2IU6A 4ZAWA 2MOKA 1G0OA 2A1UA 2EF1A 4QNRA 5T8KA 5EQDA 3NBKA 4JXJA 1QB7A 1CEYA 4K8RB 1O9HA 2GHTA 1DO2A 1PG0A 1BU8A 1LBQA 3AONB 1RI4A 3NHSA 1IZ9A 5DRTA 3ZI7A 3MOSA 4YWHA 3RW9A 4CG0A 1G21A 2V58A 5CFOA 4DJEC 1DJLA 2GD6A 3GVHA 2N42A 1XVLA 5FJJA 5KYTA 1P75A 3HQ4O 1WB6A 1XJ0A 3BGSA 1YCDA 3M1YA 3W2TA 4OSOA 2AJTA 3TAUA 3VVMA 4URYR 2VEOA 4PS1A 2O5CA 4BAGA 1JSLA 2J9ZB 2QVYX 4RY8A 1E2NA 4MW0A 2WD9A 2Y1KA 2HMAA 4ZOAA 3U17A 5K9ZA 2EV9A 2G88A 5C8VA 4BTEA 3VPAA 1ZC4A 2HSJA 1IWOA 1OX4B 1TIKA 1UBTS 3IXQA 2FOLA 1V9CA 1HLFA 2XUKA 4X71A 3B1KA 1RAGA 3ORQA 3RC8A 2R1ZA 1HTWA 2YIJA 3GYGA 1GFSA 2ZBFA 2P27A 4LVCA 3EDRA 1K3FA 2VIIA 4K6FA 4RVNA 3P52A 3Q98A 5JMPA 1FRNA 3DYIA 3IT3A 3VKGA 3GBSA 2BEUA 1S2NA 2C7PA 3W8RA 2DR2A 2R60A 3JPYA 4X24A 1LNQA 3BJEA 3H3FA 4YV7A 1DEAA 3O3MB 3AEUA 3ZGVA 1CULC 3DZKA 4ODIA 8GPBA 5HNKA 1UBEA 4WLOA 5JRZA 5IFKA 1HXHA 3P9NA 3VR6H 1A4XA 2CHEA 1TZKA 1M8JA 2X6RA 2DQSA 2XRYA 3MQ2A 5I7RA 5B3JC 3OMWA 3D8HA 4JROA 3AF2A 4TRJA 3IEVA 5A0FA 2WFZA 2ZB7A 1XO1A 4EFKA 2FPGA 2H51A 3DDUA 3WWZA 3M70A 4IHKA 1ULHA 1YQDA 3Q8KA 4C20A 1QAQA 2B7LA 2BT4A 3LHDA 2BJWA 1HA3A 3BZUA 3NUZA 1HQKA 2AJBA 2OHOA 3P5SA 4C0KA 2VUHB 2XMBA 4CYMA 5JXHA 1MCZA 1Z8DA 1QX4A 1JMKC 3DLCA 4NG4A 4P7KA 3S3TA 4AMGA 5GTDA 1XMIA 1EUCA 2JEOA 4YMGA 5HA5A 3SICE 1VMDA 5ETJA 1XJWA 3QUBA 3H9EO 2EBWA 3LX8A 5FBQB 2QRJA 3EQ6A 3A2NA 4BP9A 2MYUA 5A4FS 2X9GA 5C7IO 1ZL2A 2V8BA 2PTHA 1OZFA 4DE5A 3BZBA 1NDHA 3EJWA 2HIAA 4D42A 4OXXA 2CK3A 4NNPA 3ZWCA 4RGVA 1TIBA 2AWNA 5HZGA 4WCDA 2WHEA 3RAGA 3AFNA 1CR6A 1ARZA 4JVLA 2NMVA 3WLPA 2C03A 3FSJX 3W7VA 1JILA 2VZEA 3F47A 1MO4A 3QMVA 2IYPA 3AZQA 5LYJA 2D4AA 4EZIA 2FSVC 3LQ2A 1UK6A 3OM0A 1M73E 4L3VA 4PYIA 4ESHA 4L8FA 3O0DA 3CH4B 4HJRA 5D5HA 1R8XA 2PO5A 3WAJA 4E2XA 1QWOA 2V1XA 3AG5A 2XCIA 3R0IA 2VWHA 4KXFB 4Q1DA 4Y9TA 3RSOA 4A03A 4BS9A 1TM7E 2B8EA 1EQAA 1RHKA 1RKBA 2R11A 4XIIA 5JSUA 1XCPA 4QTUB 1BYUA 4M0DA 2Y0BA 4UHCA 3FUVA 3IT1A 3VGPA 5DGXA 3WLAA 1O95D 3A7EA 1U6KA 3QHPA 4QTTB 2IOFK 4IHJA 2IHVA 3PWZA 3LUDA 3D7LA 2ZBPA 3KJEA 4L51A 2ZJ4A 3SEFA 3QH4A 1H0RA 3BULA 2VTVA 4CKCB 2QQGA 4KQ2A 2JKYA 5GOZA 3WKBA 5C4IA 3AHEA 4M0MA 4G9BA 1AZSC 1KJ8A 1YS1X 1A9XA 4ZCMA 3IT2A 2AJDA 4M36A 2JK1A 1SG9A 5KKNB 2W48A 1Z12A 2QU8A 2VSYA 4EB8A 1YIDA 3TFWA 2YHIA 4FYIA 2DSTA 5KSOA 2V7XA 4ND1A 2VNKA 3PFHA 4MDFA 1DUVG 4B8YA 4MARA 1KP3A 4BQSA 1XWWA 3CRW1 3UHOA 2OBBA 3TEJA 3ZX5A 1EVEA 1RAEA 4JLBA 4RIHA 3NVMB 2JFNA 2O1WA 1L4EA 2J7PA 4OHPA 4D57A 3TRHA 2PMBA 1ECLA 1A97A 4KN5A 1ZRHA 3A04A 1R5NA 2ZIZA 3ICPA 1OGIA 2AVNA 4IYRA 1GADO 1YI1A 2C2XA 3K9WA 4POAA 4G0UA 3KL4A 4RQBA 5ULLA 5C7YA 1Q11A 4AUKA 3IUJA 5BURA 1OZ0A 4AD8A 4AJHA 2OT3B 5C7LO 3ZX4A 4NVRA 4OHKA 5GONF 4MIOA 1TJYA 4MAAA 3WFIA 5JLJA 1V47A 1NUPA 1NVKA 3L0OA 1BE6A 4RY0A 5E9QA 5A4AA 4NCNA 1E8MA 5G3YA 4MW6A 3IQZA 4WUTA 3SKVA 2ZS8A 2QQ0A 1T5LA 4Y8VA 3RD5A 1MV8A 4MVJI 1ID8A 5AM1A 1PS8A 1MOQA 1X19A 1NG9A 5HIMA 3THSA 1JG3A 5D51S 1JR2A 5HF8A 1IJBA 3CZ5A 1X7XA 3CZ4A 3VR5D 3NWPA 4P86A 3NWEA 4IHJF 5F9HA 2PXCA 2XAUA 4CG1A 1CLEA 1K9VF 1MO6A 2AOTB 4GD3Q 3U16A 3DEAA 3HEAA 3DOHA 3LH5A 4RA9A 3M49A 4XDZA 1OHHA 5EOVA 4Q7QA 3SN6A 4L76A 3VZQA 4ONEA 3PDCA 3C8HA 3GG9A 2G9VA 3KQVA 4ZVVA 4BVJA 3H1PA 3E9MA 3MLBA 1NBME 4NBSA 4JLNA 5C1IA 2JJ2D 2JGIA 4HX2A 2FI1A 4I46A 2W6QA 3OOEA 1ZM2A 2C8VA 3HJGA 3ZQUA 4Z3OA 2B1QA 3AVWA 4YJDA 3AR9A 4RYLA 4D81A 2I6UA 3VYRB 3IUMA 3ZV4A 3W06A 4KW7A 2A5LA 3JD2A 4AAYA 4GPAA 4H08A 1ISIA 1I0IA 1N0IA 1G59A 3P19A 3ZU6A 4L4ZA 4OBXA 1KU0A 1I3LA 1I4DD 1JU9A 1CC1S 1CUWA 2AFHB 3HUTA 2FQXA 1SQ6A 5JVDB 4N01A 4MKHA 4AXBA 3OTGA 4OJMX 2JS7A 3MCWA 1N8NA 1YAJA 2LP4Y 1QTIA 3ND9A 4LGCA 1PSWA 2LW7A 2GCOB 3ACCA 1HDGO 3NWBA 5KJEA 2GCPA 4JI6B 5A9SB 1XZFA 1H8EA 2LE0A 4X1IB 2QL5A 1DDOA 4XKJA 1L6IA 3UPDA 5JAIA 3DV0B 3QX9A 3WQSB 4CM1A 1PNOA 4O2BF 5JIBA 3RJMA 1TB4A 2H7CA 1JXAA 3R5HA 4P4GA 3ND6A 1ISMA 2JDIA 2F1KA 1XC7A 1OU0A 5DI3B 4G37A 1EWYA 1YJ5A 3PFBA 3RF6A 3UHFA 3ZCVA 4BBZA 3ZI4A 5IP5A 2J30A 4MVJE 3NWOA 5F35A 4FSHA 2XDAA 4BNKA 4UULA 3DLAA 4R54A 3UFXA 4ZYVA 4GZLA 3M1IA 1X87A 3E35A 2QVGA 4PNPA 3DE0X 1CQXA 4LDRA 4ATNA 1OYOA 3BWMA 3L41A 4IVNA 1L3BA 4JNCA 1REQB 3A1FA 1FS6A 3WV5A 3VOSA 2VOEA 2BWJA 1C3LA 1XRLA 2ACEA 4Z9BA 1WCWA 1RHQA 1ZD9A 3KPVA 5AVQA 1PR1A 1M34E 1T3TA 1N5KA 5BSUA 3VZDA 2XZLA 1JQDA 2CB9A 3UJ7A 2IEIA 5FPSA 1SVSA 4YT8A 5ELMA 4HUQA 4IZ6A 4P5DA 4PNHA 5TQ0B 1A4IA 1PJQA 3COSA 4I5GA 4M1EA 5ECWA 1V5GA 1IC6A 1B0PA 1GUBA 2X0RA 2YVLA 5KKCA 3HA5A 3MAJA 5HGJA 2LXNA 1S3SA 2NU9B 4REQB 4UUOA 2QLMA 1L2TA 1JW9B 1VI6A 2W00A 4JBIA 5LD2C 3MTIA 1SHTX 2R44A 3GFFA 2GJSA 4ZYUA 1H5NA 3NH6A 3UUGA 3A9TA 2F00A 3LMKA 3ZK9A 4WN3A 3ZLUA 5BVHA 5CM2Z 3G88A 4OMCA 4QXMA 2YWGA 5JAZA 3H65A 3V8QA 3K94A 3KOYA 6AT1A 2XXAB 2YNMA 4N41A 3PQ6A 1E6WA 3B1VA 4MUMA 1JIIA 5F7JA 5HG0A 5HBGA 4QT4A 1SQSA 3NTLA 1AB5A 1XZQA 3OF2A 4G56A 4QO7A 1FF9A 1HEUA 1O7JA 2YOGA 1OY1A 3DMYA 3GLIA 2A33A 2K6GA 1FNMA 4OQYA 5EPEA 3SDSA 3RQIA 2QD1A 2ZYHA 1Q1ZA 1OWMA 3NBYC 1JDVA 3O83A 4NYIQ 2PUCA 2PJUA 3QY0A 1BJKA 1QKKA 2X0IA 2ZBGA 4WFIA 3KB1A 2P9EA 2YMLA 1JJFA 3RTEA 3QUCA 4L72A 3U19A 1KEEA 1YRBA 3QVJA 5AKYA 3BXPA 2C4NA 2CWDA 4WDQA 4LXTA 2YV5A 5LWHA 2WWIA 1X1EA 4KRFA 3QYFA 3AF0A 2HH9A 3PDUA 4HB2A 4H1HA 5C9ZA 1N2CA 3HSYA 4H1TA 5EE3A 1E1DA 3EASA 2NUTB 1L3IA 1ZN8A 4QDOA 1TJ3A 1E2HA 1PK8A 3M5PA 3IOCA 4H16A 3SLKA 2R8BA 3NC1C 3MJTA 4D7AA 2W2VA 2F9LA 3QUQA 1TIPA 1SKYE 3IX7A 4PBSA 1QVVA 3N6RA 3MMSA 1X86B 4CMEC 4Q1BA 3ZHSA 1IJKA 5A3JA 3K9CA 3ITKA 2P79A 2YW9A 2ZRAA 4S1OA 4TXNA 2XF2A 5AKHA 4ZVOA 1T25A 5J2UB 1YDMA 1YVRA 1VE9A 2CLHB 4XVHA 4PCVA 1PGNA 4RKRA 2FPIA 4JJEA 5F7OA 1ULBA 3F6PA 2D2XA 2XGMA 2RKWA 3DXYA 4OQXA 1M1XB 2JFBA 3TMAA 4EB3A 3LDHA 4FGLA 1B76A 4QRDA 1GPAA 4FEGA 2XBMA 2I03A 3R3YA 2AOUB 2HHAA 3PGMA 1EBFA 4ZRDA 4A92A 4BVGA 4DEVA 2OP0A 2BM1A 3M4YA 2IZ1A 4TGLA 1H3NA 3UH1A 1QHGA 3BL8A 2VZ9A 1EA7A 1IEWA 2BFWA 2G4CA 5DWDA 1W9HA 1Q1QA 3WAKA 4GH5A 2VDMB 1E0SA 1KQ3A 1A2BA 3C6MA 3L0IB 3OOSA 2E4AA 2XY4A 3LPDA 3PNSA 4Q4LA 5EUMA 5H68A 4EPXA 3SD7A 1LW6E 2WAOA 3R6LA 5TQJA 4UOEA 5TMBA 4ESVA 3WNDA 2PS0A 4YCCA 5BPHA 3ZZNA 2C94A 5AW9A 3E9QA 4N9QA 5IRCD 2G5PA 2FGJA 4Y2HA 2GBIA 3R09A 4K9DA 4TSFD 3GFPA 2OLEA 2FX3A 1WTAA 3WX0A 3COJA 1WETA 2M9MA 3IEUA 1JR6A 3HGMA 4W5RA 3V32A 1L7OA 2WYHA 1UM8A 1E94E 1TUEA 1YU6A 2IPLA 1NVMB 3BMQA 1NQXA 1GTJ1 3BZWA 4QXAA 1N2EA 2JIPA 3KLMX 5DP1A 4EOGA 1GLVA 5I51A 1NA5A 4K0KB 3SKXA 3HCEA 1EE9A 4TMFA 3ZE0B 5B3KA 4C6SA 5JSQA 3PT5A 3MJDA 3JSAA 4O2BB 3UATA 3FVWA 1F14A 2Q6KA 3MCUA 3QQPA 3PUIA 3PD1A 1T0PA 4MW7A 4NMLA 3F3MA 4ENQA 2AS0A 5AI5A 1KO7A 3BCRA 3OOWA 5AW8A 4X7PA 3QPBA 2GFQA 4IWNA 5HKAA 1TKCA 5GGYA 3AUFA 3FAZA 4LW8A 4YA6A 3PRJA 2C8LA 4Y6GB 2P62A 3QV2A 3RKSA 2WOJA 3L1JA 3IO3A 2C77A 1UEIA 2QN1A 4GF5A 5I8ZA 3VR3D 1XTRA 1GRRA 3GCXA 1WVMA 2FZLA 2JD0A 1ZONA 2HHCA 4M0CA 1N0UA 5I48A 4MGEA 5TV2A 1JA0A 5IAEA 4DF3A 1ETUA 4RV5A 1OFHA 3ON5A 3OTHA 2AG6A 2ZXFA 1JTEA 4UDNA 4ALJA 3CLTC 2Q3JA 3G2NA 4PAGA 1LZKA 1QONA 5BMVB 3WNBA 2PT5A 1BXGA 2GI4A 4MRPA 4BDTA 4PVDA 4QUGA 1R5BA 1EESA 4H6XA 2HTEA 3CVWA 1HYHA 4D9IA 4PQEA 1IB0A 4TL6A 2YX1A 4Z7NB 4GX0A 4B47A 2ZM5A 1H2HA 4IXWA 1NW5A 3FLMA 1OOEA 4JQZA 3EVCA 4JQCA 3LDGA 3LT2A 3ZWOA 3TLXA 2NVUB 5EJEA 1TAUA 2AT1A 4RZHA 1GPDG 1DADA 1FRVA 2BKEA 3RK1A 3RIXA 2VVTA 5H3HA 1T5SA 1VG1A 1B74A 4UEJA 3WL6A 4C21A 1T4CB 3GN2A 3DPIA 2Q1XA 3E70C 3RFVA 1SBHA 3M82A 2FFBA 3F73A 1N6LA 4QQRA 3R0ZA 3V4LA 1WR8A 2J0UA 2XMCA 3HYCA 3JYQA 1AN0A 3N8GA 3O8OA 2EF0A 3HG7A 4BO7A 4C2TA 4FYWA 1T1EA 4IX1A 3ZOKA 3M1LA 4HDSB 5TPZA 4B7XA 4C3VA 3TZEA 3GJ0A 4I6GA 1GA4A 2JGFA 4KB5A 3SAJA 5IKPA 1KY4A 3CUKA 1YZVA 2J4DA 4LJ5A 3FOAA 4OH7A 2NW6A 2ZETA 2Q0XA 3AXSA 5IUJC 2LNDA 1FRFS 2NACA 2P4QA 5A4KA 1YA4A 3LVQE 1CY6A 3F5DA 3UT5A 1PEDA 2ZAOA 3I1IA 2QI9C 3C8UA 3L4KA 1WXFA 4DA0A 2GAOA 2XYHA 1LD3A 1NNSA 1NVGA 1CW2B 2YCLA 2RE8A 3R7AA 1KVQA 3F7TA 4YXWA 1XTPA 3H18A 4EJSA 2JLXA 3SJCA 1H1DA 2BH9A 4RK7A 1TJPB 3FDFA 5EC8A 4GX1A 4HLUC 4HQLA 4CLHA 1WHTA 3I30X 5EHQA 1II9A 1PGOA 3Q5EA 1ZK1A 2OO7A 4N3NA 4I50F 5CURA 3TSZA 4AWAA 2FOIA 4ETNA 1GQ2A 2R25B 4M83A 1G19A 1BE8A 3DCYA 2GH1A 3ZCPA 1NLUA 3EHEA 2ZR7A 2ZJZA 2GEBA 2Z04A 2YMQA 1EFRD 4X1OA 3T4UA 4HDKA 1E2KA 1PR5A 2HCBA 4F11A 2W6ID 4KFUA 4PZPA 1YGPA 1A9PA 2VYVD 3OKFA 3O95A 3OOHA 4LMAA 4J0CA 4WH0A 1DTWB 2XUQA 1SQFA 1U6JA 1XNQB 5JO9A 1M5RA 1Z47A 4IUBS 2I62A 4KNYA 4KXMA 4OXKA 4WGGA 1ORDA 2OD2A 4PXYA 2W42A 1QH8A 5KQSA 4QG7A 3QEOA 3T7CA 1ECGA 2IHZA 3C39A 1FSZA 3I5AA 4J6FA 3SR0A 4I5DA 3MC1A 4IDDA 2IV3A 2X19A 4XYMA 4MUHA 2PZFA 3KL2A 2H57A 4ZOLA 1HI9A 5JNWA 4LRSB 5JTTA 3PGKA 4FIZA 2EWVA 3MRSA 4K8OA 1BQEA 1DAMA 1RYZA 2VDJA 3LUAA 1HT2E 3A2KA 1QGOA 3KVRA 3M83A 3QE3A 3U9SA 1QAMA 4KQKA 1EP1B 1GDHA 4OH1A 3K1YA 4R1LA 4B4OA 4I2VA 3L6UA 4OCZA 3OJLA 4XCXA 2GKOA 1XALA 4D3FA 1UQRA 1CTQA 3HGTA 3PNPA 5BV1A 5HUHA 2R7MA 3B9PA 3Q3EA 4DDUA 3ZVNA 4MGIR 4NTZA 1V5EA 1M6WA 4X63A 2H7YA 1ZGJA 1H2RS 4JEUA 1SOWA 3E05A 2AQ8A 3MJVA 2C4KA 4PE5B 3NWJA 4DDWA 4CGYA 1F8GA 1YB4A 5F3RA 1SHKA 4PQRA 4NZ9A 4Z9FA 4XPIB 2FP4B 3W77A 2OVBA 1JJBA 4JBXA 4QQFA 3OHPA 3HJBA 4V1CA 3JD3A 1E2LA 3TXXA 1KHTA 2LDXA 4OJKA 2H7XA 5CU7A 5IM4F 1AKNA 5EG5A 5B2ZA 8ATCA 1NJ2A 3CKKA 4JX8A 2NZWA 4KSYA 4YAUA 2DFLA 3E81A 4GMGA 4RIIA 2JFHA 1C8VB 4OB8A 1H6BA 3CUTA 3WGVA 3PC7A 4MOWA 1SVLA 3OQPA 4QODA 2C0QA 5EUCA 4EUEA 2YZGA 1UC4B 4N3GA 4HMOA 3VHXB 1BGWA 3C7KA 1W0JD 3CF6R 4CU5A 3K70D 1A9TA 2H17A 3H5VA 1DHTA 5F4ZA 3FPBA 3IO5A 4JI0B 3MRTA 2QUJA 4J2HA 1V7PC 4N5DA 3KUCA 1X1CA 2O0HA 2PAAA 4X6XA 2Q3BA 4XASA 1F48A 4UMEA 2AQKA 4YB8A 3U7EB 4ZI7B 2E4XA 3DDOA 1QH1B 1VE1A 3CUUA 1VJRA 1R8JA 2OD7A 4FVTA 5FTMA 2YZ7A 1A98A 4X3PA 4EH1A 2HA3A 2RGEA 1XTTA 1FS5A 5J23A 3EIUA 3O38A 1TJ4A 4FDVA 3U49A 5AKGA 3OPNA 3AC0A 5LXTB 4XRRA 4L2IA 1GV0A 2I4IA 3D6JA 4IGFA 2OAQ1 4W9RA 4Y0VA 5FUQA 1O1YA 1SA0B 1UJ5A 3OX3A 1YDFA 4U5QA 5SZHB 4H6WA 4TS1A 1ZKMA 3EAFA 5TJ9A 1MJHA 4CTNA 3OQVA 2GJ8A 3D6FA 4IQ8A 5CCXA 5KCZA 4LVNA 1S7GA 4H4CA 3OKPA 3IP1A 5KREA 2G04A 2Q5FA 4RTJA 4J7AA 4BYGA 1QFYA 2VFAA 5TEWA 5JEEA 5NULA 3FOZA 2BUAA 2RBKA 3AJ9A 3O7MA 5A5EA 4HB4A 4EI9A 2JH8A 3URMA 4R0NA 2AE2A 2JLYA 1OIVA 1D0SA 1H0SA 1MP0A 1RQ7A 2FCAA 2PU5A 3FPEA 1GNVA 2BHSA 4YP9A 3GRPA 5TQ2A 3V7WA 5K0GA 2HBQA 4UHEA 3K7EA 2ZDQA 4NJEA 4P4SA 3NRJA 1KH3A 4OFZA 1IE3A 3QU7A 1DBVO 1XRMA 2GPSA 1J6UA 3HY3A 4IHAA 2HDHA 4BDSA 1URPA 1E3LA 1THTA 4JD5A 1CWUA 1U9IA 2QYOA 4MCHA 4W1QA 4WCFA 3LHIA 4ZO9A 5JAOA 4KR6A 3QMWA 2I67A 3TM4A 1DC5A 2FMUA 4UU8A 4MAMA 3L8ZA 5JJIA 1TCVA 1CZOA 3O8LA 2XUAA 4DDMA 3HYLA 5B7NA 3FPAA 1CZRA 2C20A 3TQCA 2XEXA 3SMQA 4DG8A 3JRWA 1WMAA 4A0RA 3DONA 5JADA 2I8AA 4I36A 4YR7A 1XZCA 2ZBUA 5T67A 1YJBA 2I76A 2IDMA 1G63A 3VSDA 1JHRA 2V3VA 2X2OA 2H6EA 1Q0RA 4ETWA 2BPOA 4KGXA 1N8SA 3BGVA 3MF4A 4S2EA 2W2TA 4CRWB 3G7NA 2HL6A 5ALVA 5JCZA 2HRZA 2OCGA 3LIIA 4HC4A 1RKUA 5AXDA 4LXQA 1Z83A 1QZXA 4A8JC 1GL7A 2P75A 2RGBA 1J00A 3AZPA 3VPSA 1ZCFA 2QROA 1Q84A 3D6TB 3AW8A 3MPOA 4UJ3A 5DEOA 3IXLA 3W4KA 1C3OB 2IS1A 4OATA 2WF5A 1CS0B 2W8ZA 1VCHA 5F51A 3F6BX 3QVOA 1WZ2A 4FUTA 2WUFA 1FUKA 4JKYA 2YYSA 5FJIA 3P97A 4KXNA 4YRBA 3EF3A 4JOQA 4BU0A 1VB3A 3ZYZA 2WT9A 1JKFA 2Y1DA 3ETGA 2ZI7A 3REOA 4JU9A 1F0NA 2DKNA 4B1FA 3UMYA 4BO4A 3F6YA 1TZMA 2W2LD 4KODA 1ZC3A 3FKJA 2G9QA 1IPEA 2YL2A 1NOJA 3U3DA 4DJJA 2G5TA 5BSGA 4XW2A 3WS7A 3AVYA 3PE6A 2IZZA 2G06A 2RI6A 3C15C 3LE8A 1GGKA 3PJRA 1XPOA 4HFMA 1C80A 1Q22A 2H7VA 3WQRA 1VPVA 2D0PB 1RRKA 3STVA 1I51A 2APJA 2HSWA 4ALNA 3AFHA 4KSCA 1OTXA 4UQLA 1U3WA 3CNNA 4WLFA 4BJ6A 3L4EA 2D6FA 1Z13A 4LE1A 1U9ZA 5I47A 4MHTA 1YS9A 4HLQB 4NOJA 3PXCX 1LBTA 1GUYA 2G5GX 3JVIA 4UVDA 1J0AA 4LDAA 1JZSA 5CM8B 3QEJA 2RHDA 1YE5A 2CC2A 3N2GA 1RXCA 4Z1MA 4LJSA 1P0MA 3EBLA 2D5IA 4LX8A 3C1AA 5F2KA 2PUVA 4BX9A 2F9FA 4BZPA 3H5LA 4BASA 3NVKI 2I65A 3IKJA 3JWEA 4HADA 5DYNA 3R9IA 4JI5B 3RQSA 2JLAA 5ESDA 4N7BA 3V55A 4LYAA 2ZZMA 1SGWA 1QHEA 2F43B 1HZZA 4V0KA 3OETA 1LFAA 4EGFA 3QI2A 2P6MA 3BA1A 1VYVA 2HYDA 3H84A 3DLPX 1P8JA 4CTOA 2H1RA 2PFSA 4R2HA 2O59A 1KJIA 3AX6A 1X7ZB 4AJLA 4EB6B 4J0FA 4LQDA 2FG7C 3LKBA 4E5KA 3H04A 3WWYA 3T9AA 4YNBA 2CHGA 2OZEA 3GPIA 4J3JA 1BKYA 1PR3A 2WKWA 1M9NA 3AUTA 3SXUB 3V33A 3ERCA 1MC4A 3H6KA 3PWSA 2O3RA 1LA2A 2FFHA 3K3PA 2R6ZA 3TR5A 3OA0A 1ZJZA 2JFPA 3GJRA 4KO4S 5FLKA 1J8YF 1X2EA 1F8FA 1OBOA 4YHBA 3QFHA 1AO3A 3CUSA 3U37A 5FOQA 4TV9F 1G21E 3IB6A 3R3JA 4R84A 3D7KA 4EECA 2XYRA 5TMPA 4GE3A 4LX0A 1B1AA 3CO0S 3PCTA 1MMFB 1LPNA 5AI9A 4JITA 4JYBA 4ZO6A 2INGX 3PFIA 3ESDA 3DTVB 1XQ1A 4FWBA 1YZUA 5CEJA 3VZCA 1KAHA 1KFCB 4ANFA 2RKBA 1QCYA 5BSEA 3FMVA 1K75A 1J8MF 1OTYA 1YR9A 5ADUS 2GJAA 1RJFA 2IYRA 3GJZA 2YVUA 3P9YA 4M0LA 5LN1A 3E5MA 4CI9A 1VG0B 2ZTSA 3NG1A 1YBHA 4IINA 3PFFA 3GRYA 3PU6A 5KNBA 2R79A 3A25A 1R18A 3EGDA 4FFDA 4LECA 5LQJA 1Z6YA 2R8RA 3P4UA 5LMUB 2XAAA 5KTSA 1GFWA 3WB9A 3DP9A 1W2HA 3DPSA 3ELBA 1YS7A 4E5NA 5BP7A 1SUWA 2Y2VA 2BMAA 1YZNA 3G8CA 4NZPA 5HZHA 5JBNA 4W9MC 4MULA 2WD7A 5LL6P 1RKVA 1W0KA 1W88A 4Y1GA 3T9EA 4DBVO 3Q7SA 1XD2A 2C58A 3LXXA 3OT5A 4N49A 4RK1A 2CVFA 4M9RA 4C06A 2WIGA 1YR8A 1T5DX 1UPAA 3QLVC 4HAUA 4FHDA 4ZGBA 1CIPA 2XUGA 2VP4A 4M76B 1UC5B 3WL4A 3QVGA 4CN8A 1R10A 2JAWA 4M0EA 4EG7A 1TT5A 2IIPA 5LDGA 3H87A 5D3ZA 2SCUB 5BUQA 4LGMA 3O91A 1E58A 3I1FA 4KQFA 4OP1A 4G89A 3R4CA 4N0DA 3WIVA 3L7JA 5A4DA 3A4MA 5I9IA 3MWEA 1U2TA 1TZ2A 4W5TA 3EXHC 2JIBA 1CG6A 4J0EA 4HS4A 4BNIA 1AE1A 5DNAA 5AUPB 3VPHA 2G72A 4JOSA 2AZMA 4ROTA 3TQQA 4IS2A 4CMAA 3QUTA 3KVYA 4GI1A 2FNAA 4FZVA 1DC7A 2SECE 5ALNA 5BRNA 4EVSA 4DT1A 3AO0B 2FMTA 4JOBA 2R2GA 3FVTA 4EAQA 3ZWYA 4J49A 1QU3A 2M2IA 5GV8A 4JEIA 1LSJA 2O7NA 2Z1MA 2NZXA 1FFAA 4TKMA 1Y1SA 4IH9A 3RSCA 3RNLA 4D1YA 4B4UA 1KSJA 2I9KA 5KSWB 1U5CA 4KAXA 5IMBA 1WP4A 3G5UA 2I2AA 4FYHA 4UARA 1RHUA 2AI2A 3H75A 3P9CA 4S1TA 5FLYA 1JDJA 3HJHA 1QWSA 4BVBA 3OLZA 4I3GA 2PLWA 3JQ8A 5AKZA 5K0SA 3RU2A 5EJ5A 1MGPA 1DSSG 1T9ZA 4AKSA 5K4HA 3AF6A 3TW6A 3BIJA 1S8OA 2J9YB 5COAA 1Q7CA 5K3EA 1PFYA 2XYGA 1PDWA 5ERXA 1G291 2R6JA 1L7NA 3EZNA 1G4UR 3R1IA 1M2NA 4G4SP 4M1MA 1DZIA 3KZMA 4AJ1A 2JG3A 4G65A 4K28A 2AXEA 2QLNA 1Y89A 3AERB 1ZJJA 4MUJA 5GOTA 4HI0E 4C43A 2IX3A 2BI7A 3C3PA 2HQ1A 1M2HA 2PA0A 3FBWA 3ZG6A 3ZLBA 1PD1A 1VSBA 4DA8A 4O5AA 3L9XA 3ROTA 5EHZA 4FC7A 3V5NA 1XZHA 3G3EA 3MYYA 2C5FA 1OASA 1XOIA 1Q0HA 1V3UA 4O0MA 5BW4A 5F1PA 3QNMA 4V0OA 4HZGA 5I7OA 2Y1WA 2HNAA 4Q3AA 5JBQA 4U7JA 1XDUA 2Z30A 1NC1A 1VPTA 1YCFA 4KTVE 3FCSB 4D0RA 5K3CA 1SXHA 4MLCA 1QGAA 4DLLA 4AM8A 5JOQA 3JASA 3JQ7B 3OPVA 3U7IA 1H94A 1KYZA 5FUBA 2R1TA 1UT6A 5EXPA 3JD1A 4N12A 3JVUA 3F2VA 2X3UA 1W1IA 3RABA 1G7TA 3K0FA 3NALA 4KR0A 4PCAA 2PZMA 1Z0AA 4EHJA 5C35A 5DZSA 5HR5A 3SOZA 3ELDA 1M2EA 2XKBA 2LCIA 4DXDA 2A5YB 5IAKA 2J6CA 5I9SA 2H5JA 1DG3A 2W90A 3R3HA 4WKNA 3SQMA 3TGWA 1N9ZA 4R1OA 3QPDA 1PKEA 4BQRA 1M6EX 4MEJA 1GN9A 2VQ3A 3N05A 4MUBA 4RSRA 4B7AA 1Y9DA 2E18A 2VWQA 3QOFA 4HH0A 5JAPA 4Q7KA 4XLLA 3UNXA 3W6ZA 3KAPA 3WR5A 2C3OA 3N3AC 3R8FA 3ZDZB 1D4ZA 1RZRD 3I4CA 3K0KA 3WV4A 2P9JA 1ZD2P 2A9JA 2G83A 1SBYA 2CLKB 4IDNA 3TZLA 1F0PA 3KZXA 1S01A 2P9YA 3RU9A 2L82A 2WD8A 1P2UA 1TYEB 5AQEA 2VATA 2CLIB 4P7GA 3UXYA 2VP3A 4CKWA 3DTVD 4BKQA 2QTWB 3BXFA 3Q85A 4WX2B 1IHDA 2FFQA 3WLKX 4FFVA 3RAJA 4QASA 3AKEA 4RULA 1R3DA 3VPDA 1ONNA 4PLPA 4AS3A 1CRLA 1DKOA 4X94A 4OKSA 3T5BA 2IV7A 2P3SA 4LF9B 3I5YA 1JT9A 1OTHA 1V26A 4HXYA 5D01A 5DCLA 3FN4A 5E1BA 1Q92A 5FWYA 4REOA 1DG9A 5AVJA 1KJWA 2FK8A 1EX6A 4HNAB 3P0HA 4YR9A 1R1DA 1XTBA 1K98A 5CLFA 4WNYA 1EFUA 4E94A 2ZYVX 5CXXA 1N1MA 3OY2A 3OZUA 4ZRNA 1WHSB 2R7NA 3G2IA 3LLUA 4FGJA 2XQFA 4J7XA 3KQYA 3OD1A 1ZUNB 3NHJA 3CYFA 1JPJA 2B37A 5HFJA 1VE3A 1G38A 1PS0A 1W73A 3DLBA 1FP4B 2VQSA 4QNNA 2O8EA 1EXVA 4CF5A 1S2IA 5EIAA 4HATA 1NI3A 2OPBA 2CNDA 3GCDA 1HZJA 1MF7A 1TQ8A 4ZCTA 2EGHA 4EJ6A 1C9KA 4D25A 3VU1A 1Z63A 1SCDA 1T15A 2W4MA 1IWBB 1UODA 3A9VA 4DQVA 1FDTA 3OJOA 3HCAA 4NDNE 2JJ1D 3GU3A 4CLRB 4CM9D 4Z2AA 1QE3A 3ST7A 2AC2A 1QKIA 1HT3A 2BCEA 2VRCA 3FR8A 4WCVA 1ODJA 2ENWA 2EZ8A 4YDHB 2WKSA 1XWIA 1R2QA 1G2IA 1MJNA 1Y1QA 1N2JA 1D9ZA 1X80A 1SU4A 4B5LA 3PF9A 3BWDD 1U2DC 1LBEA 1TEXA 1NBIA 2A9QA 2QPLA 3F8TA 4TL9A 3RC9A 1E96A 3ROXA 2DF8A 4LS3A 5TF0A 3K16A 2WZBA 4RJTA 1X70A 4RNDB 1GFZA 2C5SA 2FRDA 3H9JA 1FVOA 3PJGA 5HS4A 1SXJC 3D4IA 3FW1A 1E61A 4EF6A 2J46A 1E9FA 1SPXA 2K2QB 1Z4MA 2MINB 4N4AA 2BHLA 3RYHB 2VQFB 3NEJA 3W3AA 1QO0A 1GVHA 4DPLA 5DRYA 3OZVA 4I3FA 4FW8A 4O4JF 1NN3A 1GTMA 5LLDA 1AK1A 2IBMA 5ALPA 4XVQA 1NLMA 2WU3A 5J59A 4FMCF 3X43A 5AW1A 1ZAYA 1WF3A 4MH0R 1P6XA 2W93A 5JWHA 3VYSB 4BFYA 1OX4A 1DXQA 2LKCA 2ZUFA 1OI3A 1ZHFA 1I4OA 1XEAA 2UDPA 3H0CA 3W78A 5JFGA 4BZXA 3M4NA 1QTNA 4G09A 1KRHA 2DPHA 3ZE1B 1T9AA 2HPHA 4R1MA 3B1FA 1I6WA 4NH0A 3MJRA 1ZXXA 4BIMA 5K6AA 1RYHA 3U4IA 1Z0SA 2PL5A 2OHIA 4K2HA 4A0SA 4AJOA 3KR2A 2D1SA 4KQEA 3DHVA 3RWBA 3BK1A 4EEXA 2OQ2A 1MENA 4B2IA 4Y1FA 2BKVA 2Z9BA 2JI6A 4JLUA 1Y7HA 1RADA 1Z29A 4R3WA 4Z9XA 2WMNB 3I28A 2ZFUA 1L7DA 1XAJA 4KYUA 5JV5A 2IE8A 4L0QA 5KNBH 1PGQA 2V7BA 1SH7A 2FF7A 1V16B 1O5IA 2JAXA 5LZ7A 3T4XA 3ZN2A 7AT1A 1UC9A 5PNTA 3OZEA 3NTQA 4N6NA 1Z6PA 2IHBA 4PPGA 1Q3KA 4Y2SA 5CRIA 4FOSA 3W6PA 4AYWA 1K8ZB 1SHJA 2JIZD 1NLZA 4YN3A 1P4SA 3RBZA 1ZINA 3S2YA 3WDLA 2B4TO 5C80A 5IASA 3HEBA 3EIQA 5DM0A 4HAIA 3OZDA 4DBLC 1AMNA 3ROPA 4XFJA 1KU6A 5A0TA 3JQEA 3AM3A 1T5IA 1TAGA 3EVEA 4B3HA 2PWZA 3GRFA 4L8VA 2B36A 3KZOA 1GV1A 3KCNA 2AZXA 3GPLA 5ALKA 2QENA 5A6VA 1VE7A 1W5EA 1Y8RB 3S6JA 3UGJA 1G5HA 2O8FB 5LOVF 3NYQA 4EYOA 1JIUA 3H2KA 4LISA 3E1GA 1ONPA 5ALFA 1JDUA 2VP2A 3MMXA 4QRIA 1DO8A 1LVUA 3V8NA 3VVLA 4EP1A 5KDDA 4LF8B 1O94C 5HPYB 4S04A 1I5OA 1NN1A 2GZDA 3GLIE 3B6KA 4RY2A 3LV8A 1N1DA 1PYGA 4D82A 3HBFA 3EZ7A 1EB9A 3K9QO 1UMCB 4CQMA 1VSVA 5JDCA 1GD1O 2JGLA 1H69A 4FHGA 4YRPA 3U3ZA 2FPSA 4D45A 3AR8A 3L7BA 1C0KA 1JL3A 1HKHA 3BWEA 3U4DA 3SKYA 2W2QA 2KJQA 1DBWA 1OPXA 1HX7A 4FZ3A 4WESA 3ZGYA 1B41A 1Z5PA 2QIPA 1Y6QA 3EVTA 4PFSA 4INZA 3ICEA 1B4DA 1ZXBA 3M4ZA 2WJ4A 1RHJA 3M7IA 2GPBA 4PV7A 1G17A 4Y9UA 1CUFA 3TPCA 2AEFA 1HSZA 2H2FA 1N6RA 2Q49A 4M9ZA 4KXYA 1NBAA 2VTEA 1N2CE 3IR5A 2OGTA 1HYGA 4P4TA 2FVXA