3PE6A

Crystal structure of a soluble form of human mgll in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
289
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWAPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a soluble form of human monoglyceride lipase in complex with an inhibitor at 1.35 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Monoglyceride lipase
total genus 107
structure length 289
sequence length 289
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe6A00
2D0DA 3MVEA 5JZSA 5AOCA 4BRZA 5AIBA 1CV2A 3CCBA 3Q8WA 3D7RA 2H9YA 4GLBA 3HACA 4Y2JA 2BUCA 1WOMA 2J3QA 1CQWA 3OOSA 1UWCA 3W9BA 4K6KA 2XQFA 4D9JA 1F8UA 4OYLA 4L0CA 1KEZA 2XLBA 4UHBA 5DNUA 4W9RA 4B0OA 3STVA 4X92A 2GBIA 5AM5A 2VF2A 3WK4A 1WB4A 4BATA 1BCRA 1E8MA 3JYHA 1N5MA 4BBZA 5A7HA 5CT9A 2J4FA 2PM8A 2VAXA 2XMGA 3DYIA 2JIDA 4ZRDA 5AHXA 4TVKA 1W6RA 4J3JA 3IUQA 4W63A 2XMDA 3VJMA 4BE9A 4NZZA 3AZPA 2OCGA 3F67A 1A8UA 1N5RA 5K3CA 1UKBA 2W22A 5T4EA 1EXWA 1UT6A 2JGJA 2PL5A 4F0JA 4ZI5A 4K6GA 3EBLA 3HI4A 2RONA 3G9XA 3SC2A 1IUPA 1PFQA 1VZ2A 4KRYA 2PUHA 2EEPA 3PFBA 3LCRA 2BFNA 4KE9A 4B83A 1VXOA 3R3VA 3RM3A 2XUJA 2ZYSA 3FYUC 5JAHA 5AJHA 2WM2A 2XMQA 3ZWQA 3GZJA 2QJWA 4ETWA 4PNZA 4B0PA 4KE6A 3U0VA 1CUEA 2IITA 1JMYA 3C43A 4G5XA 5D3ZA 3JW8A 1F0PA 4C88A 2BJHA 5ALMA 3K6KA 4DMKA 4H7IA 1YASA 4OB7A 3V1MA 1C4XA 4J0KA 4BVJA 3GROA 3V1KA 4UHFA 3BIWA 1UOPA 3VDXA 4YASA 4IHAA 2CJPA 2RAUA 2GZRA 4X93A 2J4CA 1QIIA 5K3DA 3FNBA 4MWTA 2ZYIA 5KWJA 3I6ZA 1JJIA 2PSFA 2HA5A 3STWA 3FAKA 1W76A 1CR6A 4HZGA 3C70A 2RI6A 2PVSA 3IUNA 1UKAA 1LPNA 4FNMA 3R0VA 1XFDA 5CH8A 1W4LA 5HFNA 2Y6UA 4XIIA 4KAFA 5A7GA 3IURA 2DSNA 2I78A 4PSDA 2VT7A 4BTLA 4MXDA 4OUKX 3L1HA 2C5FA 4EUSA 3KD2A 4G4IA 3IDAA 2BUAA 5A6VA 3OM8A 2XQKA 3FLAA 2G4LA 4WJLA 2OQVA 5AI6A 3QMWA 1K8QA 5E4JA 4J0IA 4FTWA 3D0KA 3OURA 4ITVA 5EHQA 4CIBA 1JMKC 1LNSA 2BGRA 1O6GA 5IVKA 2IX9A 5AK5A 4B82A 1KU0A 4X3CA 4W1PA 3KSRA 3UUFA 5LZ8A 1JJBA 3WMRA 3PI6A 4X85A 1TCAA 1MPXA 5AK3A 1BN6A 2EDAA 2JF0A 1C7JA 1EHYA 2CMFA 3M82A 4H35A 2GYVA 3G9UA 2E3JA 1EDDA 2XUGA 5ALQA 3AILA 1EB8A 2C0PA 3VJLA 4XWGA 2PSJA 3KOOA 4GHWA 4Q3OA 1N8SA 1TQHA 5HQ3B 4HRXA 5DYTA 1CUHA 3PDCA 2HA7A 3WL8A 3ZLUA 2G5TA 5ISMA 3H18A 4X90A 1E89A 4OSEA 1QFMA 4CCWA 2QXTA 5ALSA 3UUEA 3WA7A 3QM1A 5HK8A 5ALGA 3WIOA 3D5EA 4ARAA 3QPAA 4MQMA 3G0IA 3C87A 5LZ2A 1ZI9A 4QLOA 4UHHA 4AMYA 5KBYA 4GBGA 4I19A 4QZVA 3IULA 1DTEA 1AKNA 1WCYA 1EVEA 4FLEA 2XDWA 4H7FA 5I8PA 1U8EA 2PSEA 1MT3A 1SCKA 4QDZA 1XRNA 1CUFA 5AKYA 4HXGA 1VJ5A 4U2EA 1QTRA 4AX4A 2R8BA 2AJCA 3FLBA 4OD0A 2XUPA 4FBMA 3DL7A 1GXSA 3WKEA 1ZIXA 4N5HX 3M83A 5AM4A 4WFJA 1X2BA 3LIPA 1LZKA 4HVTA 5JD5A 5BV7A 2WUEA 3G7NA 1TRHA 4FBLA 2DHEA 1JU4A 5YASA 1QIKA 1PJAA 3ILSA 3U1TA 1CVLA 4BYMA 5EIEA 3H1BA 2X8BA 1K4YA 1MN6A 2WSLA 1CUXA 1F6WA 4UBNA 3DKRA 3OC0A 1G5FA 2WTMA 4ZV7A 4CCYA 4UBKA 3WQHA 2HU7A 2WU4A 5I9IA 1H2YA 4LHEA 2WQZA 4EY4A 2VATA 3TGLA 4F5ZA 4B7ZA 2VA9A 2WUGA 1ZJ5A 2HA3A 1GZ7A 3ZLTA 1W75A 1ZD4A 4FOLA 5JADA 2Y2VA 1D07A 1LGYA 4IO0A 5DYWA 3VXKA 1HKHA 1BS9A 2XMSA 4M0EA 3AFIA 3HABA 1YA8A 3I2FA 3O4GA 5EIHA 5EHZA 2HFJA 1XZIA 2XE4A 2OGTA 4KYVA 4TGLA 3AZQA 1Y7HA 1UOQA 5ESRA 4G8CA 2OPHA 5T4HA 5EHNA 1VA4A 3BDIA 1BROA 3A2NA 3CXUA 2PU7A 2XMRA 5HKAA 1IUOA 1E5TA 3AIMA 1UZAA 1AQLA 1CUWA 1MX1A 3B12A 2G5PA 1NX9A 2HM7A 3HJUA 5ALNA 4RGYA 3WK9A 4BRSA 4ZGBA 1E66A 1XRQA 4J0JA 3WKAA 4DNPA 2QZPA 4X6XA 4A23A 1LZLA 4Y2SA 4C6HA 4JNCA 3M81A 1H2ZA 5FPPA 5EFZA 3C6ZA 1DX6A 5AH0A 2QVBA 2Y6VA 3WL6A 5JALA 1TCBA 2HFKA 1MAHA 2JGMA 3LIIA 4X71A 3H2IA 1IUNA 3H2GA 5FPQA 2HA4A 2FX5A 1ORWA 4UBIA 4LYDA 3AIOA 5A7FA 2ZJ7A 2WIGA 3AINA 3GUUA 3KDAA 4OU5A 5K3FB 5KREA 2FUKA 4C4ZA 1DT3A 4UBOA 4QDXA 2GYUA 4X97A 3R3YA 1EINA 5DYYA 4BAZA 3AUKA 5ALKA 1RWQA 3HC7A 3R3UA 4U2DA 3WYDA 5FLKA 5EGNA 4AO7A 4A16A 4H18A 1XROA 3EIOA 3KXPA 4FWBA 2PBLA 1YCDA 4JYMA 1GKKA 3NGMA 2QTBA 4J0CA 2FJPA 2RHWA 1XZBA 1VA5A 2W6CX 3E4DA 2VSQA 2WFLA 3R3XA 2HU5A 4KE7A 5FOQA 5K3EA 1J1IA 1H2XA 4H77A 3LLCA 2ZJ6A 2OLEA 4CCYB 2XUHA 1WB6A 1CUGA 5LP1A 2OQIA 1ZGBA 3SWWA 5AK4A 4FHZA 3DCNA 1A7UA 3H04A 1VE7A 1E8NA 3H17A 1QIDA 3FVRA 5AOAA 1TKRA 4Y2YA 3HRHA 4AB1A 3BJRA 2QUBA 4MYDA 3A2LA 4BC1A 4NS4A 5JAUA 2B4KA 2QOEA 1ODCA 3MUNA 3K2IA 1QGED 4U2GA 2OXEA 1QIHA 5CRIA 4UFOA 4PSUA 4BCDA 4Y2TA 1XKLA 1ZICA 4C01A 2J3DA 2DQZA 3PUHA 1Y7IA 3ESCA 2G63A 4G4GA 1T4MA 1SC9A 2C0QA 5CT4A 4YK7A 2V9ZA 3I2IA 5IKXA 1T2NA 4LKOA 5HF9A 2DHCA 4EBBA 4UUQA 2WIDA 3MGAA 4H7HA 4P9NA 1XZFA 4UBJA 1R3DA 1RP1A 5DWDA 3PICA 4WY5A 4WY8A 1JU3A 4J0DA 2AJDA 3S8YA 5HF6A 3VISA 1JI3A 2O7VA 2WFLB 5AKEA 5HCUA 4A5SA 2RGUA 5AKKA 5DTIA 2HRRA 4HXEB 2QKYA 1SCIA 1CRLA 3FLEA 2XUKA 3N0TA 5ALUA 1AURA 1XKTA 2O2GA 1WB5A 5CT6A 2DFPA 1PV1A 1DQYA 1VLQA 4X95A 4HAIA 4KE8A 1MX9A 1CUYA 1EDBA 4RNCA 5ALJA 5JANA 1LPOA 2OGSA 2WHPB 1LBTA 2DHDA 4WFKA 3I2GA 3ICVA 1X2EA 1XZJA 4MYSA 1UKCA 3DJYA 2DCMA 1XQWA 3VJKA 4GDMA 3D2BA 4C4XA 4G8BA 3QPCA 5CXUA 5CBKA 4ZXFA 4BCBA 1GQSA 2UZ0A 3H19A 2XUQA 2GZSA 3H2HA 2XT0A 4B9EA 1HDEA 5D7BA 4JYPA 3QMVA 1MNAA 3G8YA 3SX4A 5AOBA 1L7RA 1XZKA 4QDTA 1QO9A 4FNGA 5JATA 1FFDA 2PUJA 4EY5A 4XX1A 1R9NA 3BXPA 1XZEA 2WLSA 5ALHA 1UK7A 1WM1A 3WZMA 4Q1VA 1OILA 4U2BA 3DS8A 4DMFA 2PPLA 3STUA 1N1MA 5ALTA 3DNMA 3FYTA 1NU6A 1B41A 2PSDA 1UXOA 4B9AA 1XLVA 3STTA 3LS2A 2XQIA 1BEEA 2BKLA 3FSGA 4QDUA 4GI1A 2ZSHA 1BU8A 1JJFA 3AIKA 3P2MA 4UBLA 5AKZA 4H0CA 3C8DA 5ALRA 5AKHA 2WG1A 4W1SA 5AP9A 1I6WA 3D4LA 3O0DA 2GYWA 1HLGA 3GFFA 5FP0A 3O9VA 2VJAA 1CUZA 1YB7A 3WKBA 2JGEA 3W2TA 1SFRA 4TPKA 3TEJA 2JBWA 4KJXA 4BAGA 4DSZA 2PU5A 3GA7A 1GQRA 2OCIA 2WTNA 2O2HA 4FKBA 2VQ6A 4B81A 4LXGA 1BN7A 1CUIA 5AKLA 1K63A 3KWJA 4UHCA 1K6EA 2JGKA 4X6YA 2CB9A 3WK6A 1P0PA 3GELA 2VJBA 3H0CA 4I3FA 4C4YA 4P92A 1WPRA 3NWOA 4AQDA 2XUFA 3C5VA 4Y9SA 5H3HA 1ZOIA 3WL5A 1IMJA 1HBJA 3H2JA 3WJ1A 4Z49A 2Y2UA 1ZIYA 2DR0A 3BF8A 1DWQA 4ZWNA 1XLWA 1ZI8A 1XQYA 2WHRA 3HLKA 2YXPX 5CW2A 4Y2VA 3R3ZA 4UBMA 1XQXA 3FCYA 1LPBB 4C89A 4H7JA 4DYHA 5C8VA 2JGIA 3OG9A 2Z8XA 1AGYA 1HL7A 4IH1A 5HQ3A 1TIBA 4BTVA 4IH4A 1EK2A 3L1JA 2XLCA 3V1LA 4QDOA 4NVRA 4FLFA 5FKJA 5E2IA 2HADA 3O9MA 4M0MA 2CUTA 1MU0A 1BEZA 2HL6A 4V2IA 4OB8A 1SCQA 1O6FA 2WU3A 5ALWA 1CLEA 5DTJA 1BE0A 4N8SA 4ARBA 2WUDA 2C4HA 1P0QA 2C5GA 1THTA 1CEXA 1CUJA 3G9ZA 1QIEA 4FDMA 3DKKA 1R9MA 1E3QA 3VVLA 2OCLA 5K3BA 5A2GA 2BGNA 2XUDA 1RYYA 4ROTA 4KAJA 4X00A 4YPVA 4DSAA 3IIIA 4ZV9A 3TRDA 3F98A 3V9AA 4KRXA 3HSSA 5FRDA 4G1FA 3A70A 1H2WA 3B3QA 4OCZA 2ACKA 3HEAA 5ALOA 2PX6A 1MJ5A 5IVHA 2ECFA 2BAGA 5ALEA 1AMNA 4BZZA 2OAEA 4W1RA 5CTAA 4J0HA 5ALZA 3WYNA 1DINA 5LKRA 1EH5A 3W06A 4MWSA 5A62A 4F60A 4FFWA 4AZ0A 1YA4A 1GGVA 1YS1X 2OGZA 1EVQA 4K6HA 1FSSA 4N5IX 3F9CA 4MQLA 2NW6A 4X94A 1XZDA 3L1IA 4J0GA 1ISPA 3DOIA 4GXNA 4NMWA 1FFBA 1Z68A 5JARA 4JEIA 1MO2A 2Z8ZA 3WWCA 3EF3A 2VEOA 4X6UA 1HQDA 4EY8A 5IH7A 4G8DA 3I2KA 3WK7A 5LKAA 5JAOA 2BUBA 4KR0A 4IH9A 5ALLA 4HRYA 3QBJA 4JH0A 3WZLA 3FYUB 1QIFA 3RARA 1LPAB 1ZD5A 4H7EA 1DU4A 1THGA 2B9VA 1TCCA 2ES4A 5CT8A 1SOMA 4OU4A 4QE3A 1J07A 1WPXA 3W04A 1UK6A 2Z3WA 3IA2A 3AJAA 1BRTA 3V1NA 1MAAA 1TK3A 1ETHA 1GPNA 1XZCA 5IVDA 1U65A 3QMMA 4MJ3A 5ALVA 4BP9A 5C8XA 3WJ2A 1ACJA 4LXHA 4B85A 1CUDA 5DJ5A 4P93A 3BE8A 3C6XA 4DGQA 4Q3LA 5ALPA 1P0IA 3FCXA 3Q0TA 4GECA 4LYEA 3WI7A 4PO3X 4DNOA 1C7IA 4Y7DA 1GT6A 5AI9A 1QONA 4P08A 5CURA 3CN9A 3EQ7A 4HXFB 1Q0RA 3BJMA 3IVMA 3PF8A 3V48A 3BDVA 4H7DA 4Q3KA 4MEBA 2ZVDA 2YH2A 1IVYA 2WILA 3C45A 3W05A 1ZGCA 3KWFA 4B84A 3E0XA 2I03A 3OPMA 3FBWA 3E3AA 3C6BA 4PF1A 3ZV7A 2WIFA 1J06A 1VKHA 2ZJFA 3HXKA 4QNNA 4GWLA 3WL7A 4BCCA 4PV7A 4XJVA 4IQ4A 2HRQA 7YASA 3G0GA 3QITA 2CEKA 1XZLA 4DNQA 1UK9A 3PUIA 2WUFA 2XI4A 4AN1A 1IZ8A 1AZWA 3BF7A 5AM1A 4KEAA 3D2AA 1H22A 1ORVA 1U4NA 2V98A 4EZIA 5J3JA 2K2QB 1K5PA 2WG0A 3C6YA 3DQZA 4O08A 4WDQA 5AO9A 4UFNA 2XB6A 4E14A 4YX9A 1GPKA 3R40A 4G4JA 3YASA 3ZLVA 1EK1A 2JGFA 3SK0A 4OYYA 2PKYX 5AKIA 4Q34A 2JGLA 2XUIA 3DLTA 1W1IA 1R50A 5T4BA 2HA6A 1LPMA 1MX5A 2B61A 2WHQA 4BAUA 3T52A 3M3DA 4DMHA 1DX4A 1FJ2A 3D59A 1A88A 3ICWA 2PSHA 1DT5A 2CBGA 4Y2PA 2WJ4A 3WK5A 3FYUA 3H1AA 1XQVA 1BCSA 3EQ9A 3AZOA 1HPLA 2QR5A 2HIHA 3ANSA 4PQEA 5BOVA 3K9BA 2BCEA 1Q83A 1QO7A 1WHSA 2RIPA 3IBTA 4FFVA 4CG3A 3QYJA 3JWEA 5JZ9A 1YSCA 3DDUA 2OAGA 5JASA 3WLAA 1ODTC 1ZI6A 4UPDA 5EHXA 1IZ7A 4UHEA 3WWPA 4I4CA 2HA2A 1FFEA 1EA5A 2JEZA 5ALYA 4JUIA 3WA6A 1L7AA 3E1GA 2ORYA 2QRUA 3OTQA 1X70A 3HZOA 3I6YA 2CKMA 1ODSA 4ZREA 3C5WP 4AXBA 2GBCA 1LLFA 4UFPA 4GW3A 3G0DA 3G0CA 1CUVA 1CUSA 4N8DA 2JEYA 1R1DA 4B80A 3WWEA 1FFAA 1JFRA 5ALIA 5HFAA 2X5XA 3IUJA 3VKFA 1XLUA 1OXMA 4L72A 3ZPXA 3DD5A 3STXA 1VZ3A 1XRPA 5CH5A 2HA0A 5HK9A 3UMJA 3B5EA 4EA6A 4E15A 2HU8A 5EI5A 1VOTA 3DOHA 4BZWA 1GPLA 2R11A 3FVTA 5LIPA 5AICA 2QXUA 2B20A 3C8HA 3I2JA 4LIPD 4Y2QA 4X91A 3ANTA 3QH4A 4QWMA 4DMCA 5K3AA 2CZQA 4BP8A 3VVMA 1XRMA 3W9UA 1EB9A 4BB0A 5JYCA 3I1IA 3BWXA 2EDCA 3H2KA 5HZGA 3ESBA 3WWOA 4FMPA 2WFZA 5FV4A 2WIJA 1ZJ4A 1LPPA 3O95A 2ZYRA 2YASA 3N2ZB 2OG1A 1CUBA 5BWBA 1QJ4A 4RPCA 4UHDA 2ACEA 2XMBA 1GKLA 3NUZA 4AN0A 5JD6A 2OCKA 2WKWA 2QMQA 3TJMA 3MUOA 3X3HA 3WKDA 2HHAA 4C87A 3PF9A 1QIMA 5LZ5A 1U2EA 5FXMA 1XZGA 3WK8A 5D6OA 1ZD2P 1A8QA 1XRRA 4EB0A 1EX9A 1QIJA 2QJRA 3S2ZA 2AJ8A 3O4JA 5CMLA 2H7CA 1G4HA 5KWIA 1QFSA 3ED1A 4Y2XA 4L3WA 2LIPA 4H7KA 4Y2RA 5AKGA 5AKXA 3I6MA 2VJDA 1P0MA 1AC5A 2QS9A 4W1QA 2VJCA 5K3FA 4RE5A 1NU8A 1USWA 1JKMA 2QUAA 2V97A 3GBSA 4EY7A 3I2HA 5HKBA 2O7RA 3LP5A 3QVMA 1ACLA 6YASA 3T4UA 4CI9A 5D3KA 1LPSA 1CIJA 2I3ZA 1XRLA 5ALXA 4BDTA 1XZAA 5C8ZA 4CIAA 1JT2A 5IVIA 5LZ7A 3D2CA 5K5EA 5LLSA 4HTAA 4U2FA 2ZSIA 1H23A 3BIXA 4GEGA 5LYYA 5CT5A 1EI9A 3IUMA 5AM2A 4Q82A 4BVKA 2C7BA 2HDWA 4BE4A 2Y1KA 3G02A 1YB6A 2H1IA 1E8DA 1MTZA 1YR2A 1DWPA 5CXXA 5JD4A 1R4ZA 2ZYHA 4Q05A 1QIGA 1QE3A 2ROQA 3WKCA 1M33A 5C81A 4KAAA 5AM0A 4LXIA 2VT6A 5DNVA 4QEKA 4KACA 2GBGA 2Q0XA 3F96A 2ONCA 4OB6A 2GBFA 2XQGA 4QA9A 5SYNA 4B6GA 1J2EA 4FLMA 4PSCA 3QZUA 1FFCA 5F4ZA 4QLAA 3R41A 3FWHA 4PW0A 4OPMA 2WG2A 3HYSA 4EY6A 5AKJA 4CFSA 1XZMA 3PFCA 4AO8A 5I7UA 2X76A 4E11A 1S8OA 2WJ6A 1LBSA 5JIBA 4CG1A 1QOZA 5AIAA 3FSGD 2P8SA 2O2IA 5AI4A 1R88A 1L7QA 3D3NA 3A2MA 5AM3A 2QT9A 1TAHA 1B6GA 3R3WA 1CFJA 4G9GA 4N8EA 4J7AA 5ALDA 3IB3A 5FUMA 1XZHA 2FJ0A 3STYA 5AK6A 3EQ8A 4Y2UA 2AXEA 2AJLI 4QWWA 4WFIA 2H7XA 5A71A 3DL4A 5JAPA 5HF8A 4HS9A 1QLWA 5C7YA 1A8SA 4DLNA 1W52X 3I1YA 3ESAA 3RKSA 4K2AA 5AI5A 2XMCA 1F0NA 1KU6A 3RK4A 3CCCA 1CUAA 3FOBA 2DQYA 2V96A 3A6ZA 1YAHA 4XVCA 2D5LA 4L9AA 4WCVA 1QTIA 2XMZA 4J03A 1CPYA 4RE6A 4F21A 3ESDA 4DM7A 1AUOA 2YYSA 1G66A 1VE6A 1YS2X 4INZA 4X7BA 2I3DA 1YAJA 1CQZA 1UOOA 1ZD3A 4DNFA 4DIUA 2RHTA 5LZ4A 4M0FA 2H7YA 5DNWA 3WWDA 4MEAA 5DLPA 4DTCA 2WFMA 1Y37A 3DEAA 4EHBA 3O4IA 2WIKA 1EDEA 3WIBA 1G42A 2Z3ZA 1OCEA 5E4TA 5BWCA 3F97A 2QM0A 4WDRA 2XQJA 4BDSA 3G9TA 3F8SA 4K5QA 1UFOA 4BC0A 2IIVA 2WJ3A 1AX9A 5E4YA 2VAVA 1QZ3A 2C58A 4AZ3A 2XUAA 3BL8A 4BVLA 3NOXA 4G9EA 2AJBA 4U2CA 1WHTA 3PE6A 5SYMA 1Q84A 5FDFA 1DWOA 1CUCA 5LZ9A 2VTVA 1Q0ZA 3I28A 3QPDA 2XUOA 1UK8A 4S0XA 1VXRA 4CG2A 5JZBA 5HF5A 2Z5GA 5AI8A 4E46A 4AMZA 5T4FA 1CUUA 5AI0A 2WHPA 3ZI7A 5EIAA 1DQZA 3DYVA 3CN7A 3G0BA 4AO6A 3RLIA 5ALFA 1MNQA 3O4HA 5CH3A
chains in the Genus database with same CATH superfamily
1J5EB 2W5UA 1VKZA 2J4DA 2JFVA 1Z39A 2ZREA 3G2MA 4J07A 5FQOA 5HIJA 5JZSA 1TECE 4XIYA 1PT7A 1UBEA 3VC1A 2SKCA 2MIIA 3NASA 2UVQA 3OPYA 4LK2A 4N6OA 4WKOA 1CV2A 1L4YA 2QJFA 4QOGA 4D4IA 1T5OA 4M8NE 5CFOA 4GLBA 1XWFA 3HACA 4Q4JB 3W1WA 4LEIA 2J3QA 1OWLA 1W19A 3OU2A 5FUXA 4H4CA 4OK3A 1UWCA 2EJBA 3B52X 1R0RE 2DLDA 2O1SA 2HJVA 2WVJA 3QVUA 5J5CA 1F8UA 1Q12A 1V8BA 3DHYA 3LFTA 4D3YA 5K0EA 5LXTA 1B0AA 4OMUA 3UH0A 2ZCJA 4PFJA 4Q15A 3W5JA 1QUEA 4HD8A 5BMVB 5G0WA 5DNUA 3KQHA 4YI3A 4Q37A 5DASA 4C06A 1JDUA 1I32A 4MGKR 5AM5A 4ISCA 4AG5A 1SU8A 3K0CC 3VOBA 3K5IA 5FFMA 3X1ZA 2B36A 3HU3A 3KTAB 3ROPA 4DLZA 1JVNA 2XKAA 4PX5A 2W42A 3AGPA 1ZZGA 1N5MA 3H2SA 3OQJA 3VHXB 4BBZA 4EL0A 3UWDA 5A7HA 1VCMA 5CNMA 3KEGA 1MB9A 5ESWA 4KSCA 5HIIA 5BVHA 5C9ZA 5HSGA 2PM8A 5LD2B 3KRTA 1XHLA 4IY1A 1K4MA 1Z4NA 2LCQA 1GAXA 4CV0A 3N3AC 5BURA 4NYJQ 1XXHB 2VN8A 4H31A 5AHXA 3DBLA 4ZALA 4S1OA 3LUAA 4YRBA 3P0EA 2X6RA 4W63A 3CVXA 4PAGA 5TF0A 2FHSA 1EGAA 1GRCA 1YJBA 1JU9A 1X1RA 1T34A 3NBUA 3VJMA 5DM60 1VBFA 4CXMA 1XLTA 1MLDA 1KI4A 1OKKD 4EHAA 4ARIA 3K70B 4KMMA 3HN2A 2IHYA 3WIDA 3H97A 3LYAA 3O74A 5DK6A 2ODTX 5JWHA 3UK6A 2VJOA 3F5QA 3MWDA 3WNBA 4C0HA 2DAPA 2VJQA 4E4TA 2WU1A 5K3CA 1UKBA 1EHCA 1FYDA 4AYTA 1XMOB 5T4EA 1Z0DA 2P78A 3NVMB 1Y98A 5KCZA 2OGUA 1UT6A 2GESA 5CD1A 2QLTA 1N1DA 1H69A 2H0QA 3DC2A 4U8HA 1Z0SA 3OZ7A 2W37A 4F0JA 1A1VA 1ND5A 2OP0A 1Z0AA 4PHTA 3FHCB 2YWCA 3ZCVA 1SIUA 1SRRA 1XYGA 4ZI5A 4NH0A 5HZMA 1UMBA 2ZKIA 2XH8A 3EBLA 3VR4A 1OB5A 1PDWA 2WMNB 4G26A 3OUZA 1FDTA 5DCYA 2O0KA 4HQNA 4BWGA 1D9XA 4DV5B 1G0NA 4MITA 2WSSD 1QYRA 3V32A 2WWGA 4CLRB 1IUPA 3HKCA 1HFJA 3OJOA 1R4MB 4QELA 1VZ2A 2V9PA 5I5GA 4UDXX 4B47A 1MEOA 3H42B 2EEPA 4M83A 3LCRA 3ZC3A 2WA2A 3R3VA 3RM3A 1M7GA 1ILWA 1T0BA 3LK7A 1LUAA 1MB4A 3DWGA 2IPAB 3FYUC 1C0PA 2N42A 5JAHA 1TVKA 1M1YE 3HVKA 4OHXA 4GVLA 4UJ3A 4V1CI 2NU9A 1QH8B 3LKDA 3LO8A 1IBMB 3MMSA 2G25A 2VAPA 2XMQA 3FR7A 1NRXA 2QJWA 1M8FA 3T1VA 3DEFA 3WYAA 4BKPA 5C80A 3ZCPA 3MWYW 4LBWA 4JUAA 4JYCA 2CLLB 2JLRA 1LLQA 5LP6C 4BP1A 5TIIA 3U0VA 2RH9B 1M2VA 1JMYA 3RAJA 2VP5A 2YIDA 5B1DA 3ZDCA 1A4XA 1C9MA 1JYEA 1ISSA 1VG0B 3OBIA 4KQEA 3RJTA 3SY8A 2BJVA 3FHLA 1ULTA 2BW0A 2WYOA 1DFGA 4DMKA 3W3AA 3GFOA 4H7IA 1YASA 4QXAA 4BO4A 1SJ9A 3VU9B 3PQ2A 1UBHS 1TU4A 3L06A 3RJZA 4KX5A 3V1KA 3ZVRA 2AB0A 4URXR 4AKSA 1U7DA 1GQYA 1KH1A 3MLEA 1JDVA 1UOPA 4RGVA 1WEHA 1RYNA 1ZZEA 3A1TA 5KHLB 1N32B 3A04A 3KG2A 1U11A 4P22A 3PPYA 4JKYA 4IHAA 1TQ2A 4ZVOA 3S70A 2Q1UA 3IVRA 3SU8A 2RAUA 2V7QA 4LFAB 3GJRA 4YP1A 2J8ZA 4X93A 1KOLA 3V4ZA 1SUAA 1QIIA 1RJWA 2G88A 1NNSA 3USZA 1YKGA 4ZIRB 4O3MA 5KWJA 2ZYIA 3I6ZA 2CV0A 3NGLA 5LQNA 3N05A 3UJ3X 4PFQA 3ZCSA 1W5BA 5TQ2A 1QGOA 5FPHA 4M9UA 1ECFA 4HB4A 4UUOA 3STWA 2GCNA 1O97D 4WPGA 2Y27A 3KYDA 5EIOA 2PGNA 4HWSA 3FDXA 2G36A 4JY7A 5K0ZA 1G64A 3RG8A 1TQ6A 3E58A 4QYIA 2R6CA 4GUAA 4FNMA 1I0IA 2L19A 4MGEA 4QECA 1XFDA 4V0LA 3SPXA 4BVFA 2IEIA 5CH8A 3UT6A 1UBGA 1W4LA 4F3CA 3NFYA 2VTBB 5A4FS 2MINB 2BDEA 2BH2A 1IN8A 2O2DA 2Q1WA 2JI8A 1TYZA 4TLDA 2DKNA 2XCSB 1ISIA 2HZBA 2J5XA 2DSNA 3I9KA 1WV1A 2R25B 1WAMA 1GQ2A 3DKPA 5H80A 4GC5A 2QRMA 4MCAA 4WFQA 3ZZNA 4ZAYA 2XCQA 3QPUA 3U7GA 4LGYA 3BJIC 4GX0A 4HFMA 1GUAA 3FD8A 1HG1A 1D2MA 3O93A 4X84A 4KX3A 3VYTB 1NXSA 1S89A 1PI3A 5G02A 4CR7A 4RYLA 7MDHA 5CFNA 3IDAA 1A9QA 2ARKA 2QTMA 3UOAB 3MCVA 3AKEA 3G2IA 3F7NA 4Z1MA 3WZ2A 2EAUA 3BMXA 2GFHA 4P36A 3HADA 4MI1A 5CHEA 3NGXA 3MOIA 3TZCA 2Z6VA 3G8DA 3K16A 4NCXA 1RACA 1NJGA 3NXKA 4WJLA 4MVJE 4V1CB 1CZLA 2BI8A 2CFRA 1VIAA 3EVDA 3QMWA 4QSMA 1FVOA 1K8QA 2NXNA 5DLEA 3V80A 4F6LA 3SZRA 3EJWA 2C98A 5K99A 2FEPA 4TUYF 3D0KA 2FP4A 1XU7A 2X1HA 3IHWA 1XTQA 2AW5A 3QPBA 2UZAA 1P17A 4JB0A 4QD3A 4LMBA 2BGRA 5IDVA 5I7WA 3DCJA 2VUHB 1Z6ZA 4WCFC 4QQ8A 4GI7A 1EFTA 3HO8A 4B82A 1MJGA 1EVYA 4KQ1A 5TJHA 3N2NA 3DVQX 4MB6A 1NLZA 1SK8A 3SZUA 3WB0A 3QXHA 3UUFA 1N6LA 1FUUA 2GZDA 4I2VA 4TLBA 2GTIA 1KPIA 5CLIA 5F52A 3VNRA 3E7FA 3W3ZB 4YYZA 9LDBA 1II0A 1J56A 1XVLA 2FPKA 3JR3A 2ATXA 4JLNA 2CNOA 4IJKA 3R8FA 1V7CA 3R77A 1R8QA 3OZAA 4IVNA 5DI3A 3WY9A 1AXEA 3ZHYA 2QTTA 4F7WA 3GW8A 1C7JA 3K4QA 3PDHA 4BO7A 1HDRA 4KQMA 3O38A 4FB4A 3IPCA 4PZAA 4DQKA 2GYVA 2X7XA 1N6PA 4PG5A 3AQIA 3G9UA 3HWX1 2BGMA 2EVWX 2E3JA 3I01M 4RELA 5CGQB 2AI2A 2XUGA 2E82A 1L7MA 1C7QA 1VFNA 3DDOA 3IEPA 5E7MA 3BULA 5E6UA 5SYAA 3TX2A 2VDNB 1P73A 4LPKA 4WOJA 5LQMA 2CCGA 1OIXA 2NGRA 4YQYA 2PSJA 2MTBA 4CODB 4HB0A 1FZQA 5DVZA 2HB6A 2HSEA 2IHZA 2WM8A 3EXHA 3KOOA 2GTHA 2JAPA 2B7BA 4IIGA 5C32A 2WQ7A 3AJDA 4ZIRA 5FOUA 5IBCA 3RADC 4Q3OA 1N8SA 1NW9B 4IGFA 4FCWA 4OLJA 5HQ3B 1ZSVA 3HJNA 3O4VA 4KNYA 1J39A 5DYTA 5LNK6 3V8NA 1CUHA 1I80A 2X77A 4JVLA 2ZM5A 5SZKB 3JALA 3EN0A 1BXKA 2YHAA 3TQRA 2VPQA 2G5TA 3A1CA 2H2AA 3D4OA 5ISMA 1MP0A 4QX6A 1E2BA 4B4WA 1SC6A 1VKJA 3H18A 2XZDA 2OHFA 4UMDA 3AI1A 1VJ1A 1KDYA 1MABB 4QNMA 4WLUA 5ALSA 2YJ4A 4BMCA 5A0VA 1M0EA 3UUEA 2GN1A 3AFHA 1JDNA 3HPQA 4YAEA 4UNPA 3UJ6A 3PEWA 4MDEA 4GLOA 2IY7A 4MJLA 1ZW6A 4EG3A 3ZG6A 5EIWA 1ZGHA 2X1LA 2YWRA 4I4TA 1O89A 1XCLA 4MQMA 2JFWA 3VAAA 3G0IA 1RWPA 3C87A 1GFWA 4NESA 1IUKA 3CV3A 1TTHA 2JASA 2OM2A 1JG2A 2JI7A 3RS9A 1TD9A 4UHHA 2GCOA 5GJVC 1B8VA 2V5AA 2AK3A 1L7PA 5AW0A 4HDSB 3AYXB 4I19A 1KFCB 1FF9A 3K1ZA 2AZTA 3BB4A 3U4IA 4I0WB 4P3PA 3BERA 1USUA 1DTEA 2H52A 4YGXB 3WLEA 1K5DA 4UMFA 2GSWA 2VLIA 4NBUA 5F73A 1ZD9A 2CHFA 4CU5A 2YMMA 3MT8A 4EMUA 2W71A 3ETCA 4XEUA 5SICE 2BFFA 1A76A 3TKYA 4E2ZA 4KC0A 5EJAA 2Q6KA 5LUBA 3UAZA 4ZI7B 5BVHB 4HH1A 5THXA 1Y8AA 4M49A 3DVRX 1BXZA 2IHUA 3HBLA 4QUHA 4AWBA 5B7PA 2QUHA 2G82A 2A9JA 3HZZA 4HGNA 1G8GA 2OP1A 4RK7A 3K72B 4QG3A 2P5TB 3ANYB 1YZVA 2V7BA 3EGWA 2UZ3A 1T0UA 2CNBA 3VH3A 2H48A 2LGJA 1U8YA 1RZVA 3N58A 1CUFA 3ZHBA 4CM1A 2UUAB 5K0CA 4TVSA 4HXGA 4WKCA 4WNCA 4I66A 4MCJA 4ACBA 3F73A 1QTRA 4UCWA 4G9BA 5HTKA 2R8BA 4RYDA 4M36A 2IYRA 4FIDA 5JSZA 2ZDQA 3CH7A 1NVUQ 3M89A 3BWBA 2XCRB 3GLIB 3OOHA 4DIFA 1RKBA 3JPWA 5JY6A 2O19A 5LDDC 1M74A 3EBPA 1UMCA 2GASA 2ODQA 1D4FA 4MQFB 4RMIA 3SJAA 3T5BA 3OA2A 3HXMA 1N2BA 4UC0A 1YGPA 4OMCA 2PEZA 3RVPA 2YICA 4D8YA 5ICCA 4NXNB 2OV2A 1P8JA 1X7ZA 4DDHA 4QFCA 3AL3A 3E70C 2JK1A 4PAQA 4C6TA 2WUEA 4B3HA 1GNTA 1P29A 3MSXA 4YXFA 1J2YA 4KWEA 5BT8A 1JN0A 3AU9A 3L7BA 3GIDA 5KYVA 3MJEA 3LP8A 3R5HA 5DBOA 4RKWA 4L73A 1V5FA 3T54A 3LUGA 4CEJA 4NFYA 3VNBA 4AYWA 3MT9A 4LGCA 2B1RA 4OYHA 3CUYA 3D8UA 3A4NA 4DLSA 2HCFA 5HQTA 1G8MA 5JZOA 3C3BA 2H59A 4D26A 2J0QA 5FV7A 5G3ZA 2GUWA 4U7WA 1PVVA 2O0MA 4RY0A 1QVVA 3DR5A 3SM3A 1AUPA 1IM5A 5EC8A 5C53B 4CCYA 3FJOA 3R5SA 2ZULA 2IEZA 2E4AA 5P8WA 1QH9A 1AMOA 3UXHA 3PUXA 2HYDA 5KOYA 2FWNA 3UATA 1JTEA 4EJ6A 1HSOA 4C3OB 5BP7A 4S2EA 3IQZA 1KIMA 4FHEA 2Q3BA 5CLQA 1QZXA 4RZ2A 4B7CA 4YV0A 4DADA 4B4KA 5I9IA 1TTQB 4ZV4A 4ZZ0A 3AVXA 2H85A 4XWYA 3GRRA 3ORSA 5IBPA 2ZROA 2RARA 3ICPA 3P19A 4UPEA 2OK8A 2VC2B 3HY4A 1BOOA 1E9FA 1EG2A 4D4KA 4XRGA 3TGLA 1EUQA 4OSOA 1NQUA 3BTOA 4YAUA 3QE3A 5F7JA 3QSGA 4MW6A 4BFZA 2C59A 3NV9A 1E9DA 5F3DA 2D1QA 3K2BA 1ZJ5A 1ISRA 3DZ8A 3KOZA 3LE8A 1CJSA 3LCCA 3P9PA 3V4LA 4E51A 1GZ7A 2NLOA 3DD1A 3AHJA 1RWNA 5AVOA 1IPFA 2XTMA 1W75A 4OA8A 4G0QA 1V25A 1OLOA 1HE3A 2QT0A 3CGWA 3W5SA 5T3UA 4G5RA 5IANA 1NWHA 4UU1A 1GTZA 4BX2A 1SVNA 5EE1A 4PG7A 4Q1DA 7ABPA 4EHLA 1JL3A 3L6EA 3TF5A 1NR1A 2IOFK 2R6ZA 3EFBA 1IN4A 3PNLA 1LC3A 1MIOB 1GTVA 3I2FA 3ZJ5A 5DGTA 5EIHA 3CPJB 2ECQA 1SCJA 1GU0A 1PZXA 3OFKA 1W581 1T8UA 2W2KB 1XZIA 3GEBA 3L9WA 2VYCA 4TGLA 3AZQA 4MV0A 3PSHA 3L82B 4FBGA 3A6HA 3DAHA 1WNFA 1T8SA 1UBOS 4PCLA 3ZKAA 1DAHA 1AN9A 4XD7D 2H8GA 13PKA 4JIMA 3SSAA 1KKLA 3AP3A 4G56A 1IL0A 4OATA 1VA4A 3OUUA 3GOQA 3OH8A 3I5UA 4YCDA 1EJ2A 1DX9A 2D5IA 3KEMA 3KSUA 2R1TA 5C8YA 1H0HA 2MYUA 2WZDA 3GWGA 1HE8B 1II8A 2OTCA 3C7AA 1GV0A 1PNVA 3L7MA 2HF7A 4OQLA 1X1TA 3CS3A 3KWMA 5I8WA 1ADCA 1ZS9A 2HPHA 4OHPA 4LHYA 2X0FA 5JT1A 2WWYA 4D99A 1B2RA 3AHEA 3HE3A 5AW8A 1GNPA 2RHRA 3TMKA 5AVUA 2NPFA 5LUAA 1MX1A 2RB5A 1E2MA 1YI8A 5IK2D 5K45A 3ZDDA 5EUCA 2VKTA 4PGAA 4V0NA 5JNTA 4HNRA 1PHPA 1ZK1A 3PUZA 4DLKA 3GD7A 3L77A 3LAWA 1R0CA 3BB3A 2CY0A 1K4KA 2I71A 3O1LA 4I1VA 5AUQA 3IT2A 4TWAA 1P4RA 3E7WA 5DOVA 5AVQA 2P8JA 5F21A 2ZU0C 4RGYA 3I1FA 4TMKA 1E1RA 1FQOA 1G2IA 3K5HA 4ZGBA 1GLNA 4BWVA 2BGWA 5M5BA 3U61B 3FRHA 5LQCA 2AGVA 1EIZA 1R74A 2BKUA 3EXEB 4IVPA 3N2GB 4P4NA 4ANFA 4DNPA 1O8CA 2WWWA 3GLGA 3OIWA 2IHNA 1UL1X 1NONA 1CJCA 1H4SA 3E84A 3E82A 1CRZA 1GPWB 1H2ZA 3C6ZA 1IEQA 3JD1A 4OHBA 4TROA 4CCSA 2VUIB 1RFGE 4LNAA 4QVIA 1XTIA 2CFOA 1K06A 1LV8A 3V4SA 1HYGA 5HTOA 1PS8A 2HFKA 3H11A 2VUTA 4FDUA 3TNDA 1USVA 4IINA 5LWQA 2BSXA 1ZITA 2HA4A 4CCAA 4DLBA 1E5VA 2H3EA 4GR4A 4I55F 1SG6A 1CRWG 1RAEA 3AIOA 4RJ2A 4DCVA 3FNGA 2ZJ7A 4RDXA 3RYCA 3M6LA 3KC2A 3WXBA 3W5CA 1DRKA 2AA3A 2LKDA 3GUUA 1XA3A 1X92A 4FE7A 3KDAA 4V1CA 3ICQB 4DCMA 2WPDD 3C3PA 4X8OA 4NULA 1QHYA 1XPRA 1YQ9A 5I5EA 1GTG1 4B3TB 2A5JA 1CY8A 1NATA 4UNSA 4DV4B 1NJ8A 1I3KA 2O2CA 5A05A 4CMJA 4C4ZA 4WBNA 3ZV6A 2JJ2A 4HNUA 5GPBA 1EWRA 2DPXA 4TRRA 5EMKA 2B5OA 2WTBA 1NVTA 3NOOA 5CXSA 2YWEA 3L7LA 3RTGA 2BLLA 4DR5B 4CWAA 1SD1A 3MW8A 3NYRA 1SMKA 3O8OA 4C4TA 1FC0A 1IG0A 2PIAA 2IPOA 4HEHA 1WXWA 1RWQA 4U2DA 3KQVA 4JVNA 5FLKA 1JQ5A 2FY8A 1BWRA 3LRPA 4KWHA 3NOQA 3NTOA 3QUQA 3EGDB 3LXRA 2PBLA 4TLMB 2NZXA 5FTNA 1JHPA 3LSTA 5KCMA 3V4PB 4R1LA 3DMNA 3RVJA 4A2WA 1QTQA 1ZH6A 2PZMA 2ZI9A 3TTUA 3F6RA 2F7SA 3HU1A 5BWNA 5UKDA 1E4YA 4BKQA 3DG9A 5FJJA 1VA5A 2MMCA 2N0SA 2WEKA 3DFZA 3MGCA 4II7A 2AXPA 1ZJZA 1IBSA 2VDUE 2B5VA 4J2HA 4M9QA 2I8AA 1FP6A 1LY1A 4RFVA 1U4SA 2Q3MA 1CD5A 3C3YA 3IP3A 5KMGA 1UAAA 1ZBDA 2PH1A 1WU8A 2VXYA 1Z62A 4MVJF 5FOQA 4NATA 2N46A 1V41E 1TF5A 3SHFA 5BSWA 3OZFA 4BV2A 1M0TA 1Q21A 1J1IA 3FAZA 3SJCA 2GEDA 3IMCA 1TCUA 5IJWA 2KPOA 3VU0A 4RM2A 1XALA 3DMDA 1C7FA 3K0SA 1TMOA 3KDPA 3E1SA 2XUHA 3NHUA 2O5CA 1LWOA 2Z6QA 1H3EA 1CUGA 4ZA2A 4BQRA 2F55A 4GYWA 3K6SB 3E3LA 3C14C 3ZBUA 2RGYA 5BWBA 1JUDA 2ZJ5A 5T8KA 4FHZA 2LDBA 2JVKA 1A7UA 3CA8A 3CNQS 1Z73A 4O4HA 1REQA 1PJQA 4ENRA 3R5XA 4C0AC 4IVRA 5JHGB 1ZR4A 1NBHA 3EXEA 1YQQA 5CA0F 2XIQA 1G5PA 3HRHA 5F2EA 4AB1A 4L02A 1ZH0A 2B69A 4CKZA 4LE1A 4MYDA 2Z2KA 3B1YA 4TYPA 4BC1A 1W0KD 4HV4A 2DYKA 3ZHRA 4GBJA 5JHHB 3ER9A 2DWPA 1RVDA 1BTOA 2IXBA 1F12A 3K2IA 3MUNA 1I94B 3OJ0A 1QGED 2F9FA 2OXEA 2FFRA 4IYRA 2GEKA 3VPFA 3WMEA 3NIDB 4C2TA 5ARCA 1YIOA 2HXYA 2RI0A 3RUFA 3T5TA 3SVLA 2PIDA 1TA9A 4AJKA 1U7UA 5H02A 3HP7A 1YVDA 3WLPA 1N78A 1VC2A 5FO0A 3UK1A 2BMJA 3T3EA 1SOWA 1PR0A 2O8EB 2I6GA 2WWIA 1Q15A 1RC1A 2IYEA 3ICOA 1I4TD 1U7PA 1P1CA 3IP8A 4GVXA 4ZJZA 2QNBA 1DCKA 3MGKA 2VP9A 1ZICA 4Q9JA 1EVKA 5F5XA 1SOAA 3QSYA 1P7ZA 1D5CA 3D4IA 2EW2A 5EIFA 4H4DA 3ELYA 1Z82A 2ZAGA 5FUVA 1SC9A 2P77A 3RGGA 4IOMA 2BPOA 3U0BA 5A4DA 4XYGA 5CT4A 4B44A 5BV8A 3L7IA 2W0SA 3IHLA 1KO8A 3QUSA 4H6VA 3ZEIA 4V0OA 4B7UA 2ZBUA 1P75A 1QHEA 3TLAA 4NHEA 3T1YB 3I2IA 3LKBA 2BFWA 1U7OA 2F67A 4BNHA 5FBWB 1IY2A 3QTLA 5BUSA 1H6BA 1T2NA 3GRVA 1KEVA 4R31A 4TTQA 4EBBA 1CJTC 3FMGA 4JKOA 4EW1A 1K86A 1VPWA 4OM7A 1EM8A 1IRIA 4UUQA 2F43B 2WJPA 4WHMA 5CNKA 1BQEA 4LZJA 4P9NA 2PAAA 3RW9A 5K09A 2GEFA 1MQ8B 1ODLA 3FPAA 4HEJA 4D3DA 2C2XA 3I01A 4RETA 5DWDA 2QEQA 1PBTA 3PICA 1G21A 3EXHC 3OF3A 4WY8A 1JU3A 1BJRE 4ARSA 2IX3A 1DKOA 3VISA 3CX8A 4LJRA 4RKFA 3CW8X 3BZUA 3TNJA 4MHOA 4LHVA 2NZYA 2C1ZA 2O7VA 2WFLB 5AKEA 4YJ3A 1JWBB 2P9YA 2YZ7A 4Q3BA 1PWHA 2HBYA 5HCUA 5ILQA 1WZNA 4A5SA 3FOZA 4FZ5A 2W48A 1HMPA 1PGPA 1NTOA 3M70A 5DNEA 3CQ9A 2MR6A 2WD9A 3J7TA 2J0VA 1E1QD 1CDEA 3MBOA 4U39A 2J7PD 4MUGA 4QARA 4RIFA 4YP5A 4NU5A 1X1SA 3PQCA 2QG6A 1VBMA 3HV0A 3KR9A 3SICE 4DBZA 1KP2A 4P6VF 5JOQA 1PVOA 2II6A 3LXMA 2HRRA 2VRWA 2EQAA 4R8KA 4W99A 5CA0B 4UKDA 1CRLA 1XMJA 3MIIA 3SP1A 1VLMA 3PTZA 2QSZA 1T2CA 2NQ2C 1UJCA 3FLEA 3OOWA 5ELMA 3U4QB 2PO5A 3QTTA 4HDMA 2MHCA 4DMUB 1P9OA 4ZVUA 2HJWA 1U0LA 3TM4A 4HUTA 5AQ1A 3ILHA 1XKTA 2ZIZA 4IEIA 4RVFA 1SCUA 4UDYX 4AF7A 4EJSC 4TS3A 5BSFA 3CB4A 4OFZA 2F43A 3ZWMA 4KXWA 2DKOA 3TIXB 2OECA 4KFUA 2AXNA 4RS3A 4YLGA 1WO8A 1SBNE 4GI2A 4RJJA 5EJ2A 4R40A 5FWYA 1DDOA 1ONSA 2WHPB 2WYIA 1LBTA 1M2KA 3K2EA 3LQ1A 4Y1FA 1NJFA 5C34B 5MDHA 3I2GA 1AKEA 2VYVD 3ICVA 4J1NA 4WINA 3U5ZB 4R2MA 4BGUA 1UKCA 4RSRA 2QBYA 2AL7A 3C3KA 2D62A 1DKQA 1NQVA 1VB3A 1WTCA 2QX8A 1QH1B 4DY6A 1XQWA 1ZUWA 4CW7A 6ADHA 1G6HA 1HFEL 1QQBA 2W2MA 1IJKA 3HWWA 3PXBA 4OMDA 3D2BA 4IWYA 2ZSDA 1GKYA 2UUBB 1K97A 4NMLA 5LQSA 3FZNA 2R6R1 3A0RB 3R5FA 1M5UA 2YVUA 3GMSA 5ER6A 2IHTA 2YVQA 1SVWA 3GEMA 2EZUA 4B79A 4C0QC 5KJCA 1Z7BA 2J5RA 2ZAOA 3DLHA 5JTTA 4E7OA 4Q48A 1PX2A 3QFSA 1CS0B 3LPAA 4ZEXA 5CBKA 1GQSA 2O3RA 4A36A 3V46A 3H2HA 1FFWA 5FA6A 1H2BA 3QEMA 2L42A 3P2JA 2G83A 4YONB 2R3SA 2J3MA 3QEJA 3QKRB 1E7RA 4Z7JA 1P6UA 4WUVA 3KLNA 4MIKA 2XT0A 3E48A 1RXCA 4RIEA 4Z9XA 4LZNA 4JYPA 3KQLA 2FZEA 4C0JA 4R1QA 1CY6A 4HWOA 4QRHA 2DH5A 3TIGA 3G8YA 3GPBA 1JQKA 1DKNA 2WJJA 2XSZA 2ZE7A 3FYHA 3ORRA 5AOBA 1L7RA 4CM3A 4B3SB 1TE2A 1XZKA 3UWMA 3RANA 2AMJA 3R0XA 1KRWA 4FFBB 5JATA 1F51E 4X20B 1ZH2A 4DRZA 1Q14A 1YR3A 1SBTA 2LPMA 4YBRA 1GTRA 4MW2A 2DLCX 4ZGWA 2VIIA 2H4JA 1Y0BA 2ZDGA 4WK0B 4RHXA 1OT5A 1XZEA 2WLSA 4XX1A 2FZLA 3SDZA 3DEZA 1UK7A 5HX7A 2P3SA 4GRIA 1HL3A 1WM1A 3QV2A 3COJA 4KO2S 1T5SA 3LP6A 5TRTA 2P2DA 5G53C 2E37A 1S3GA 2ODWA 4MYCA 4D4GA 1W36C 2PRZA 4EMBA 2QORA 4CLEA 4NBVA 3LVBA 1NVFA 3F5SA 1N1MA 2IT1A 5LCXA 3RYFA 4DSUA 4ARCA 1ZKMA 3DDNA 4LE0A 3DNMA 2ZBEA 2ZRIA 3FIUA 3FYTA 4HMQA 3ZWYA 4F71A 5IKPA 1T1RA 1ODIA 5IKMA 1B41A 5EG5A 2PSDA 4N5LA 2W4MA 4Y6LA 4ZRNA 3T3GA 2BEUA 3STTA 5FA5A 2V9CA 3KL2A 2E85A 1J0XO 3LS2A 3OU6A 4R01A 1HMYA 1QDEA 4QICA 2X42A 1BEEA 2BKLA 3FBTA 3HBNA 3KVOA 3NG1A 1IXYA 3NVDA 5JC8A 1FMTA 2GD0A 2VF4X 1C4OA 5U4XA 1AGPA 3E27A 3OO0A 1ZU5A 4DTIA 2IDMA 1E9CA 1ENOA 1FMLA 1UFKA 5AKZA 4R68A 4EDHA 5JLJA 3C8DA 3EDQA 4UZFA 2AF4C 2BWJA 2W7TA 1JLMA 4YMSA 5AKHA 2Z9CA 2X9QA 3GHYA 2EGUA 5DI9A 1OA0A 2F8SA 3T1OA 4YRLA 1FTSA 1QPBA 3LH5A 3PT9A 3UNXA 1RMTA 5L6MB 4U0JA 5FR1A 1JDSA 2JJ8A 2Y99A 4NOMA 3UB4A 3ZDYB 1YR9A 3UQZA 1YOVA 3DV9A 1HG0A 3U1BA 1DG1G 3VO8A 2NXJA 2FEWB 2HTEA 2CLIB 1AM4D 3P0RA 3EUWA 4QJ5A 3GAFA 4M38A 3HDHA 5DLYA 3UH1A 2X0DA 4MGYR 2GA9A 3H4IA 4PLYA 5PGMA 5K2OA 1CR4A 3BVPA 2QI9F 2GRUA 4LGMA 3GC6A 3OECA 3O2QB 4QOIA 5BSHA 3N0RA 4L51A 1M1ZA 4D3ZA 1KAHA 1YK1A 2ONJA 4HDOB 1Y81A 1YQGA 3VMMA 2W0MA 3H6HA 4EJMA 4UOZA 4PYMA 1SPBS 1JFTA 3ZHQA 2BMFA 3TEJA 3VR3D 2JBWA 3OP1A 2PYDA 5DHTA 2FEOA 4EB3A 4ZP1A 2QN6A 2XWPA 3HY6A 4KLRA 1HZZC 4JT8A 4QRDA 4WBNB 5KUTA 5CVEA 2D1YA 2RMKA 3QP9A 1UJ4A 3N74A 3WP1B 1Z15A 3BXXA 1TEHA 2O54A 3RK1A 3A0UA 3JQFA 3WNZA 4X6LA 3WFIA 4P4LA 4W9NC 2XZOA 4U3JB 4RIHA 1ISMA 3LUPA 1HI9A 4PLWA 3EPLA 2IDJA 3GLSA 3KWJA 2VXCA 3MBIA 4OAPA 1ZJWA 2EIXA 2FWAA 1V8ZA 5H5JA 4PYLA 1KDVA 3TEMA 4D9FA 4MMXB 3NYIA 2CF5A 5MFZA 1S01A 4P38A 3S1SA 2ZWAA 4FT2A 1P0PA 3MS2A 1KZ6A 1U3CA 2FRDC 4URUR 4Q4HA 5ED4A 2VJBA 2OAP1 3H0CA 4NCIA 1IOWA 4QYWA 2NSHA 3MJCA 3N8GA 3VU1A 2BGTA 4JDPA 3ZXIA 3W4JA 4I46A 2VQEB 3QE2A 4MRNA 5EHGA 3LQYA 3IQWA 3NV7A 1TUIA 1XFAA 3ACBA 4ZYTA 4AQDA 2A8YA 1G2PA 1QK3A 2I6QA 3LY9A 1C0KA 1Y5MA 1IK6A 4D0NA 1NMYA 3AETA 1UAYA 1L4GA 3C5VA 3IKVA 2F3PA 2XWBF 4Y9SA 5H3HA 2YV2A 3HCOA 3WL5A 3H2JA 1UZLA 3Q12A 4MS4A 5ECYA 5GJCA 2XKKA 3NONA 4O63O 4Z49A 4EQZA 4M1KA 3QG5A 1C3XA 1YZ3A 3ZZTA 1YONA 1RU3A 3MT7A 2R8RA 4ZWNA 2WBLC 1ILEA 1XQYA 2VP6A 3OQVA 4DT1A 5DNYB 2XEXA 3IILA 1U9IA 5F98A 4OI2A 1EFHA 3U31A 2PGAA 2PLAA 4Y2VA 3WHKA 3I6IA 1Z2DA 3GT3A 5EWLA 2YWJA 1J49A 3GGPA 3C7CB 1Z6XA 2FZCA 4OHUA 3QELA 3EFOA 4XM0A 5C0OE 1LPBB 3TR0A 3TSZA 2O1WA 4DB4A 2O1EA 4CUZA 1QYCA 2B0JA 3HYRA 2Q2VA 1LC0A 1ESEA 1T8PA 1W48A 3AUSA 4OXRA 3IOMA 4GE3A 4MR8B 4US2R 3ESQA 2YIMA 3OZVA 4HDNA 5IWAB 4M3NA 2AN9A 2HHLA 2YWFA 4WACA 1EBFA 4MKIA 5T57A 2GPWA 1HE1C 4DV3B 3N2YA 3C8ZA 3AVQA 3GT7A 3OIDA 2B83A 2GBLA 2NU7A 1BFKA 1SHTX 4IJUA 4YROA 2VDVE 4RUKA 3EISA 3GFVA 3RYCB 1SN7A 2BMEA 3L1JA 1RAIA 3VR5A 2PRKA 4WTOA 1FFYA 2ZJBA 2R47A 4UQPA 4RA6B 4MUXA 4QQFA 3VSDA 3QE9Y 5ULLA 4OEHA 4UVDA 4CNBA 1CC1S 1YKFA 4IJ5A 5JJBA 4BZXA 5EZSA 5H3LA 2QZ4A 1MQSA 3NDJA 3ETHA 1YUNA 5IHPA 4EPWA 1KJQA 2ZWPA 1HT3A 3D3JA 2ZRMA 4IPTA 3HHEA 1FXSA 2NWQA 3HEBA 2PXXA 4PS0A 3OKFA 3O1JC 3E2MA 3R7SA 2ZRBA 5JAZA 3TE6A 1RHKA 2ZJ4A 4Z51A 1Z3CA 4KDEA 3I61A 4LPSA 4PQRA 1FUIA 1UXIA 3QYAA 4KU4A 2XXJA 5DTJA 4EO7A 4Z6KA 3PDJA 2Z1NA 3TLZA 2VSYA 1Q7EA 4HWTA 4RTSA 4FONA 3KPYA 4ARBA 3L7DA 3R8XA 3G2QA 1BVRA 3G8BA 1Y6QA 2OR3A 3Q98A 3PU6A 3L8FA 3ORHA 4KQXA 9LDTA 4XPIB 2E4YA 3L43A 1MOQA 1BXGB 2OZLB 2PRYA 1TF7A 1EP9A 1PG2A 4G0YA 2L82A 4JSRA 2L18A 3OZSA 4ZQEA 2D54A 1J33A 2GXSA 1Z4IA 3AUYA 1CUJA 3P9SA 3TS1A 3U3JA 3V8MA 2WAAA 3DTVB 3WL4A 2GCIA 2CT8A 2YY6A 4KZPA 2DFDA 1R9MA 5KJ6A 2J08A 2QY9A 3VPSA 1QQ5A 3E6AA 1VB5A 3ZWVA 4DC1A 3AB8A 5IAJA 5K3BA 2ERXA 3ZWAA 4NEGA 4WLNA 3STHA 1DC7A 2BGNA 1CJBA 2XUDA 3DZDA 1F0KA 4TQ9A 1V8OA 3TSYA 3D0OA 1MO4A 1FS6A 3EIHA 4PVDA 3R7FA 4RD2A 1UKVY 3SEFA 1LBQA 3ECSA 3HDJA 4OGWA 4L8LA 5CA0A 2J9YB 3IIIA 3MYRA 4LQDA 3TRDA 1ZM3A 3LQ4A 4JBLA 4XUDA 3V97A 2HF9A 4UAUA 1TXGA 4G1FA 3JVUA 1H2WA 3QXXA 4OCZA 3EVNA 2J3JA 1IC6A 1GNRA 1OIVA 1IY0A 3GD5A 1QAMA 2PX6A 1HDIA 3OWHA 1OBVA 4PZPA 1PFKA 4AJLA 1I10A 1SXJD 1XU4A 1X6VA 1NULA 4AVYA 7GPBA 3ADCA 3QVJA 1D03A 1GNVA 4W1RA 4GUDA 1D1PA 1Q1NA 1Y9EA 1IXZA 4FN4A 4NONA 4QG7A 3VZPA 3DBLB 5ADUS 4BN5A 5LKRA 1GQOA 4CL8A 2ZUUA 2BHNA 3IALA 1CP3A 4FX5A 3W06A 5IX8A 2FF7A 4R9UC 3QE4A 3UPUA 1RE1A 3KOMA 5A62A 5IAOA 2ERYA 5FWXB 4F60A 4FFWA 1I7DA 2O8CA 2NAFA 2PX0A 2QP3A 4P4SB 3WXMA 4E1AA 2FOIA 4EYQA 1A2KC 3M5WA 1JQBA 4U00A 2GZMA 1YS1X 1H0RA 2OGZA 4UASA 3ZBQA 4RV5A 3ZE8A 3FFAA 4ARZA 3SSMA 4EAQA 5KAPA 4AS3A 1PJ8A 2X19A 3F47A 4XIJA 4TQUS 4Q3DA 1EJBA 1JVBA 1UBNA 1FSSA 4RTQA 3F9CA 1NE2A 2NW6A 2PWBA 1KGSA 1VE5A 2PMBA 4N6GA 1KO4A 4KDFA 3QFHA 1LTQA 5E9AA 3T94A 2AI1A 4WJZA 4YPFA 1ORRA 1VHQA 2P27A 3CVJA 3OCJA 5CA1A 1BE6A 4TYYA 1EP3B 1P77A 2DMRA 1OB2A 2ZQZA 2NXEA 4P86A 2J6HA 1BQ4A 4J0GA 4CIVA 2PD3A 1O97C 4CM4B 3KSZO 1FFBA 2V7XA 3P1JA 3REOA 1Z68A 3TLJA 2I33A 5TE9A 4HPXB 1OI7A 1KYIA 4NZNA 3ITDA 3TG2A 3UHPA 3RK0A 3WRXA 5JBIA 3D7MA 2GA8A 3SFVA 2UXBB 2YS6A 1GKIA 1HQDA 3RBXA 5IH7A 1GAWA 3PKIA 4KQFA 4UOQA 4A8TA 5C1PA 3KSAC 1I4EB 3FJYA 3I2KA 4U9IS 1ZXLA 1U8XX 1B8PA 1JR3A 2C5AA 1KYTA 4XRRA 3WK7A 4ENTA 4OK6A 1VRVA 4KR0A 2NZ8A 3H6KA 4NDZA 3E9CA 4MUEA 1T1GA 3EE6A 3SEZA 3K71B 3BWVA 3WDLA 1NFFA 1Q3KA 4DLRA 1DGQA 3W5UA 4CJXA 4B8WA 1FRNA 4FCTA 4YUXA 521PA 1TD1A 1VYVA 5BV1A 1SIBE 3GFGA 2YV4A 1PW7A 3I9JA 1JA9A 2FUG1 2GK7A 2B9VA 2YZ2A 4HS4A 1ZVJA 3T5MA 4EJFA 4F46A 3CRQA 3BEOA 3BPSA 4TV8F 3FCSB 2ORED 4KLNA 1CYDA 5CB4B 1IAQA 4OJMX 4JHXA 2PWPA 1BRTA 1MAAA 1VKRA 3GEPA 1XZCA 2VQ3A 2GVDC 1KEPA 3PQEA 2GZAA 1V45E 3RYHA 1U65A 1SBCA 5ALVA 2D7DA 1GL7A 4YC7A 3U3ZA 1SUDA 1DEAA 1UXKA 4HDRB 3WJ2A 5J23A 2XCUA 4KQHA 4TMZA 1KQGA 3F7OA 4BLSA 4UUPA 1U31A 1GLVA 1J5PA 1O5OA 3NVAA 3SM9A 3WLNA 2EOAA 1G2QA 1JDZA 5DJ5A 2FPGB 1AN0A 1K7EB 1X77A 3LF2A 4IZIA 5I3CA 2AC4A 4DGQA 4D3FA 4OH1A 1HXHA 1RBYA 3JS5A 1KZ7B 4HCJA 4HQFA 3WMFA 4F3TA 1TM7E 2FKNA 3KXDA 2J7PA 2P79A 1S3SA 2BTOA 2QMEA 3Q0TA 5LYJF 2VXOA 5JCOC 3WI7A 3H11B 4PO3X 2J9XB 4DNOA 2B8TA 1U2DA 1D2CA 2G17A 3HU5A 4IXTA 3OTGA 4W6QA 5DTMA 3H05A 4RTKA 2BEJA 2G3YA 1YB1A 2I4TA 4Y7DA 1ND6A 3SVZA 4DQUA 4RK0A 1QONA 2HF2A 1S1MA 1RXIA 3EGDA 4TS4A 3PFKA 1TEVA 4NHOA 4DQDA 4BO2A 4ZK2A 5GINE 4ZO6A 4NE2A 3ZGZA 5JQGA 3PJGA 5ES3A 3BS4A 1YJXA 2DFKB 4A91A 2XGOA 4EI8A 1DIBA 3O8CA 1S7CA 3GY0A 1B6RA 3IEMA 4DMRA 2B3TA 1GEEA 4GICA 5HCIA 2AJTA 4MEBA 2FMTA 4Q7LA 3I5YA 4ZCPA 2QLLA 1R0XA 2V59A 3KAPA 3OQ6A 4O4HF 3WGHA 4I9GA 4G0WA 1TMKA 3C45A 4IJMA 2O05A 4JELA 4M7PA 4YMIA 3NM5A 1PL6A 4LWZA 3W05A 4B84A 2F8TA 3JQQA 3AHDA 1Z8DA 4PCVA 4HNQA 3RAGA 4GS5A 1YHNA 4YNBA 3TPZA 3UHFA 2NX2A 1GGNA 4M8IA 3JXEA 1EK6A 4A2CA 2MSKA 5JCXA 2HN9A 1HUQA 1DAKA 3C6BA 4PF1A 5DTRA 4C07A 1ZRSA 3NR2A 3CJRA 3ZV7A 4AROA 4B32A 5FLEX 1MMFB 1TT5A 3QK7A 2JLYA 4P7KA 1V5IA 1Y3DE 1PZFA 1ZM7A 1US8A 3UA4A 3HSKA 5HBRA 1UC4B 3OX2A 4BX0A 4MVCA 2OA0A 2BEVB 2WKPA 2OO7A 5F23A 2Z9BA 4P5EA 1IE3A 3EW9A 1IRXA 1X7WA 1YZUA 2WMYA 4MP8A 3T7CA 4HVLA 3AKCA 2ZZMA 2VF5X 5ICEA 3I8OA 2X6TA 3QA9A 3G0GA 5JQGF 2HREA 3HL0A 4G37A 3D1JA 4LFCB 1YRHA 4KGZA 1TYAE 3PLRA 3H5IA 1MRSA 3CRW1 4AZWA 1JSCA 3RIYA 3D6TB 1XZLA 1E0SA 4IQ8A 4N3GA 3ENKA 4ZOEA 4CVNA 4BBPA 2O8FA 1VSBA 1PS9A 1RBMA 4MRRA 3MCWA 4O8ZA 1QAOA 4DUPA 1AV6A 1MF7A 3D3KA 1C3VA 2W8ZA 2ON6A 4IVQA 2YJZA 3S2FA 3SXUA 4WN3A 5HOEA 1CTQA 2A7QA 3TD2A 4OYRA 4ZAFA 4B46A 2CXQA 1GFZA 3HKBB 1RYBA 4G5SA 3RYIA 4BKMA 4YR7A 2O50A 4MWOA 5ABPA 4BLOA 3N8NA 2IE0A 3BF7A 3P9QA 4JENA 3H84A 3VBEA 2PHZA 2OYRA 1CDDA 5JDCA 2V3CC 3G79A 4E4RA 3OCYA 1X7HA 1CR0A 2XJ4A 4MV7A 4MS3A 1K5PA 3C74A 3W5VA 4A3SA 1S1CA 2WG0A 1UIRA 3JQPA 3T7DA 3C6YA 4E13A 3JYQA 1UQUA 3C2QA 3VU9A 4B6SA 1P9LA 2KLBA 5CHYA 3E9YA 3B6MA 3CMMA 4JVOA 1MVLA 4O08A 5ER9A 3RCBA 4UFNA 5JYDA 2GXAA 3GGCA 1J99A 5JCOA 4DLYA 3V34A 1RJEA 2XB6A 2YFKA 3FGNA 2H1RA 3PI7A 3QRWA 5E0KB 4IIYA 4AUKA 2UYOA 3O4FA 3E9DA 1PVDA 1EK1A 4UTRA 3F3YA 5I9NA 1H9BA 1XXHE 2G08A 3RSHA 2YYAA 2PKYX 2H4YA 1KMNA 3BGWA 4JLJA 5GWXA 4FNOA 3DTTA 3OQ1A 4Q34A 3ZE6A 4IXNA 4K0KB 4J0FA 4BOYA 1I13A 1YQEA 5ERYA 1FJHA 4GZMA 5C51B 1ZY2A 1W1IA 1RXYA 3UMYA 3L46A 4LX0A 4OOEA 2FUCA 4QQKA 3EHDA 1Q22A 4YRFA 4IXMA 4KIWA 2B61A 2WHQA 1J4AA 4MZDA 1JV2B 1I4OA 1B43A 2IV7A 1EESA 1MG5A 5T3YA 7REQB 3O3MB 1ZH4A 3I8XA 3M3DA 1AGXA 2KSQA 3QVWA 3T7TA 5KX5A 4L8GA 4GFDA 2H5LA 4JL8A 3PA8A 1BA2A 2AR7A 1M9NA 1V7ZA 4NECA 3UAVA 1Z6PA 2FPRA 2NXWA 3IPRA 4Y3UA 4JU8A 4CL0A 3DZKA 1T0IA 1NC3A 3SC2B 2TRSB 1RZRA 3FDIA 5LA6B 1HPLA 5AVKA 2V1UA 2NZJA 5D3QA 1V95A 2AEJA 2X8LA 3A9WA 1DBQA 4MYTA 4INOA 3VKHA 1YKSA 2ZLBA 2Q8PA 3GPIA 5BOVA 3UF0A 3RBAA 1DQPA 2Y1EA 1R27A 1O0CA 1AB6A 4M2LA 1QYDA 8MHTA 1NPYA 3EGEA 1X8LA 3V2GA 4S3MA 2G71A 2QRGA 3CPEA 4KUGA 1I7NA 4ZI7A 1JALA 4UUAA 3B70A 1QV7A 1PGQA 1UBSB 4AM8A 5B7QA 2RGRA 2ISCA 4CF3A 3BDAA 3KAQA 1ZI6A 2M32A 4JODA 5H59A 1ADBA 1PZEA 4Y1EA 2XXAA 1PQUA 2QPLA 2Y1LA 3R75A 1FSGA 4IXWA 1UF9A 4U7PB 4LX8A 4UHEA 1L4UA 3L8GA 4CTNA 3S4YA 3L2OB 2I2XB 5AHOA 2P9TA 2C9DA 2BMDA 1EA5A 1F3OA 3L0YA 2M6RA 2Y4NA 1S3FA 3TZKA 2P6OA 3N59A 3FTFA 2CL5A 2HJGA 1PV2A 3ZWBA 4RJTA 3BHJA 4JK3A 2IF2A 1UXJA 3L8YA 2CZCA 4WXRA 1D8TA 3J81A 3E1GA 4B6RA 4DFDA 3LUFA 5LBUA 4Q4DA 4R16A 2J9ZB 3BIFA 3HQ4O 3HZOA 4MVJD 3G2OA 1UEXC 2CKMA 4Z86A 3RVRA 1JHXA 1KMQA 1W2WB 4HG2A 1ODSA 1JLLA 4M0DA 2JFUA 4C04A 2ZTVA 5LQAA 4AXBA 1U3VA 5ENDA 3KJFA 2P5SA 1KARA 3B9BA 5LOVA 1W87A 4RAOA 2R8ZA 1TT7A 4KGDA 4KQ2A 3GN2A 3KTDA 1U0GA 1NVDA 1DG9A 4Y0VA 5GM2A 4BQFA 4EKNB 3QKRA 3G0DA 3TIIA 1ZESA 1E60A 2FLWA 2EL9A 3AHFA 4P0TA 4GE0A 4G89A 4I50F 4RC9A 5AJVB 3L8CA 4I9HA 3TTXA 5ITZA 1V8DA 3ADKA 4NBWA 1R1DA 2YS7A 3ZXYA 2GD2A 1W4RA 1MV8A 1V37A 2V7EA 3GQVA 3VH1A 4ZJPA 4J2OA 1Y82A 3SDBA 3C98A 2PT6A 1R0YA 1NW8A 3DZCA 4H16A 1W8DA 1S02A 2NO9A 3DLPX 3IUJA 4HADA 4L76A 5EL0A 1Z33A 3NFRA 3QBTA 3RS5A 3VKWA 3VQTA 1NLUA 1XLUA 2Z2YA 3FPHA 4CR8A 3ZPXA 3AM4A 5CA1B 1XRPA 4U6NA 3KS9A 3PC7A 1DIOB 3HDVA 5HK9A 1IDOA 1UADA 1O95D 1PWZA 3UMJA 1N3BA 1ZRMA 2BCJQ 3B5EA 1QQTA 4EA6A 4NRDA 3L4SO 1E5XA 1N33B 5FNVF 5JYBA 2GCPA 1PLJA 2NN3C 2QD2A 4DM4A 10MHA 4TKUA 1N2HA 3DVSX 3KJXA 3SVTA 4M0PA 1RLMA 3JSXA 1Z0JA 4R0MA 2DG2A 4J6FA 2YHIA 5PNTA 1IMOA 4YFYA 4CM8A 1IG3A 2RK6A 5EXSA 4CKBA 1YV9A 3PGA1 5FTWA 2BZ1A 4EQ6B 2B20A 3THRA 1E2JA 1E18A 3TQSA 1UPAA 3DHEA 3RC8A 5JWOA 3DXXA 2HGSA 3EZ6A 4CT0A 3AJ8A 5KYGA 4TRJA 4P35A 1M3SA 1WCXA 3HB9A 1WPQA 2E4XA 4JUBA 4LSGA 4X3OA 1W0JA 3QH4A 4BLPA 1HYBA 3IKMB 3DMTC 4TMXA 4Q7JB 2IYPA 5REQA 4D4MA 1ZSNA 4D8UA 2BV3A 2E4ZA 2CZQA 1MZVA 3AUXA 1YK0A 4Y6SA 4WNAB 3HJFA 1H6CA 3VVMA 2Q07A 1JE0A 1MHPA 1ST2A 2OV4A 1F1JA 4OBXA 4S05A 2FMFA 3P5SA 4BECA 4MVWA 1KAMA 3VZSA 4MUMA 1RYEA 4Y6GB 4ZODA 3OSZA 4C1NA 5LP6F 1SA0B 4L7QA 1MDFA 1G7SA 3FOCA 2IJGX 2GAFA 1UWKA 1OYWA 2WIJA 3KXIA 3P2OA 2EC5A 3AEUB 4L5BA 4CUJA 2JG3A 4MRSA 1Y33E 4KFSA 1EFLA 1P2BA 4FSXA 4L57A 3TGPA 3HUUA 1JMVA 1YE3A 5E0OA 2VPZA 1Z9BA 1CUBA 4W5JA 2Z4RA 1KSHA 3DTVA 1IXRC 2EG5A 4RPCA 2P0EA 5TQJA 1W88B 3CR7A 4L4YA 4QYMA 4UARA 1I2AA 3IAUA 4FCCA 5JD6A 4DR7B 2PFGA 5ITVA 5DBEX 3KU1A 2PL1A 1M0SA 2ZVPX 4KBYA 3WG9A 1KIFA 2WF9A 2GFIA 2WKWA 4D46A 2ONKA 1M10A 4FZJA 4D43A 5DT9A 5DW3A 1PJ3A 2D7JA 2BFMA 3CZ5A 2O7QA 3HB5X 3U7QB 4JI8B 2XZLA 1T4GA 3L7CA 4H7PA 5KYXB 1M2NA 3GGDA 3KP1A 3GUCA 3P2YA 1CP2A 4UU8A 5EMHA 4CEJB 4LXUA 3W2IA 4F72A 4BV9A 1OFUA 2OC4A 3IESA 4CTOA 5B2FA 1WUJS 4FHDA 4I4IA 5JJLA 5AJTA 5FTLA 4XB2A 4ZTBA 2I7CA 4OKNA 2J6IA 2M1XA 5JMTA 3IE0A 4FT4A 5K0GA 5FXMA 1JIIA 5IJZA 4HO1X 1WBBA 1SZDA 4RF4A 4XR9A 3KQMA 4HUQA 1KORA 1PX0A 2I7VA 1ZD2P 2VPXA 4C0LA 4TZ0A 3FX2A 3B60A 4DC0A 1EX9A 3NHBA 1THMA 4WN9A 1J2JA 1GLGA 5FHRA 1LDEA 4FQ7A 3U09A 1WUKS 4R1MA 1SNYA 1MRZA 1JG1A 4IIJF 5JH7B 4IF6A 3BK1A 1GARA 1J5XA 1SVLA 2BFCB 2VDWA 3ZY4A 2K87A 3HYNA 1E9BA 3G8AA 3B9RA 4HFRA 4IDQA 4O2BA 2QAGB 2IOFA 4RVDA 3V5NA 3CTPA 3DWFA 2PS0A 5J2UA 2Y67A 3EY4A 1GL6A 4ND1A 1VLLA 5FLXA 4EFNA 5JVDB 1OPXA 2ZS7A 2IYVA 3FOAA 4P7JA 3RJ9A 2FHPA 5LJLA 1R12A 2OV8A 3AETB 2AMLA 4HQ0A 5EEHA 2C4UA 3CINA 2G4CA 4LF8B 5AKGA 4FQ8A 3KB2A 3HJAA 1MXHA 2VJDA 1TAQA 2PCLA 3M6UA 1PCXA 2EBWA 1J8FA 3O1HB 2COKA 2JFBA 4K9RA 2R6GA 3Q72A 3TBFA 1WP9A 1KK0A 2WVHA 4W1QA 4N6NA 2ZR7A 4ZCLA 2R79A 3JWJA 3L8ZA 5AUOB 1LF5A 4MGZR 3X44A 1BXRA 1NU8A 3IUYA 1ONOA 2AG5A 2R2AA 4XDZA 2RH8A 3M5DA 5EZYA 1SVMA 4WA8A 3GLIA 4HXYA 1MEEA 2EJVA 3NPAA 1JIVA 2J6CA 5TNXA 1KJ8A 1FUKA 2R66A 4P3KA 4QHTA 4R71A 5JQWA 4CIYA 2J3LA 2QROA 3OTHA 1NXXA 2HCRA 4B73A 5LLDA 2O6HA 1SO8A 3L4JA 4QBHA 4YJKA 4HLCA 1IXKA 2QPTA 4TLCA 4CM9A 4YT8A 3T4UA 4HYQA 1LPSA 2I29A 3UMCA 3HMKA 2RKOA 1XRLA 2JRCA 4M1MA 4LQCA 1IXSB 4P33A 4ZVQA 3UHJA 3VHXA 4EX7A 5C8ZA 5AESA 3VX3A 4A6PA 5LZ7A 4D96A 3FWNA 4IDOA 2APJA 3T0GA 3JWIA 4UUMA 3KFLA 1E2NA 4AJEA 3CUUA 3E9EA 5L3QA 1KP3A 4N39A 5E6RB 3MTEA 1DQSA 3IUBA 3ANLA 5C7OO 4QVKA 2ZS8A 3BIXA 1PYGA 2AZ4A 4GEGA 4JASB 4PGMA 5KYUA 4XWWA 1JIKA 4TMFA 1HEYA 1NZDA 3M6AA 4FW8A 5CT5A 1WJGA 4PGGA 4PZDA 1Q57A 4Y67A 3T7KA 2AD5A 5DWQA 5COAA 3UJ8A 3ISTA 5JH7A 3HTXA 3OCZA 1Q1EA 1N9ZA 4OP3A 4MQEA 1PHRA 2OZEA 1G291 1WNTA 2JHFA 2YXNA 3DVAB 3EDRA 4TV8B 3RV3A 2JLBA 2YIVX 1E8DA 1YR2A 4I5IA 1MAWA 2VBGA 4RZXA 1SXJB 2E5WA 2C2BA 3RFTA 3RWOA 1O58A 1Y8RA 4L78A 4FGWA 2O3TA 3D4PA 3DL2A 2IFTA 1QIGA 1UPFA 4FDAA 4LWOA 4MV4A 4PWZA 1FDOA 1U8UA 1ZBQA 2GO7A 2QL5A 5LQJA 1I3NA 1YTLA 2ROQA 1FLDA 4G4SO 3V4RA 3OT4A 2VDRB 2IKQA 1U3WA 2AWNA 3BSWA 1QGUB 2FW0A 3CO0S 1OE0A 2E18A 4TVBA 3T9AA 4GPBA 3UC9A 4B3JA 4D41A 2JAUA 4YT5A 3D5QA 4QOEA 1KQNA 2UVPA 3K8QA 5C81A 4AS2A 4AJOA 2FN9A 2UYCA 1C3OB 1YDMA 3BCSA 4XJXA 2A4KA 3UA3A 2QX7A 2YN4A 2ZTUA 1ZGGA 1RHRA 1U3DA 1UC8A 1W30A 4R1UA 2ZYTX 4TQAA 4XPIA 5DSTA 3GP5A 4A82A 4QATA 2JC3A 4M8LA 1JHOA 3P2IA 2E49A 1P5HA 1X9GA 2HC9A 2ONCA 2P9CA 4MVYA 3CRRA 1S6YA 5LR6A 3N39C 3X2FA 4WXHA 4L6AA 3GH1A 4QA9A 4ZJUA 1VL5A 1FXWA 3RRYA 4ENWA 1L0BA 3IBFA 1JBQA 3QYFA 4QU8A 3WGMA 2B35A 3QZUA 2O5VA 3I6QA 1EJ6A 4M98A 4ND3A 3WGGA 5T7BA 2JCSA 1NGSA 2R00C 1Z74A 2QL9A 3C3XA 2LZ0A 4PW0A 5C3UA 2B7LA 2MYPA 1OXVA 1Y1SA 3FHOA 3R23A 3ZNPA 1W5SA 5K4GA 3N53A 4RTOA 5H9WA 1USGA 3V55A 4BNDA 1KFJB 3MERA 3RIEA 1J24A 2IYWA 3HDTA 1POXA 5I7UA 5BYJA 4E11A 5KIAA 1OJ7A 2NV0A 2AKYA 2X5JO 4FIZA 4U7GA 4OLBA 1F2UA 2G1JA 1QR2A 5KU1A 2QG9A 3FSGD 1K6JA 2YNMC 1TMGE 3V33A 4NOJA 4P31A 4YRPA 3ZXXA 5B5SA 4MW5A 2BEVA 3FUWA 2B30A 2SECE 2CMGA 5SZIA 1BMQA 2O0JA 1IY1A 1WZIA 1TFRA 2H1OA 2G07A 2IVFA 2QU7A 3IP9A 5AM3A 2JIQA 3R3WA 1B6GA 3UFXB 5KKNB 2Z9DA 1D2AA 1U5BB 2P4HX 2JFNA 4G9GA 3WNQA 4HATA 4JLMA 4XQ9A 2JZOA 3FZEA 1KVUA 4O5OA 5ALDA 4AP5A 2P9HA 2FJ0A 3STYA 1PNQA 5DHAA 3EQ8A 4Y8VA 2AXEA 1LW7A 3U44A 4GI3A 4LC1A 2P41A 3ETLA 3ETEA 3GJ0A 2NPOA 3RFCA 3SFTA 3TI7A 2H7XA 1ZK4A 4NG4A 4Z1MD 4PHFA 4YYEA 5CAEA 3BA1A 4GZ3A 2C00A 3IQDB 5JAPA 1E0DA 4UOEA 2HRDA 4MKHA 2JCBA 2CHVA 3DTYA 1OHHA 3GT0A 3ADBA 4EDFA 2YOFA 3F8TA 1I14A 2NSJA 3R7DA 1SB9A 1YC2A 3CUKA 4GPEA 4YCJA 3ON5A 4MINA 4KR2A 2ZSUA 5J5VA 2B7CA 2CXPA 4KTTE 1JHQA 2A30A 3GR6A 1RRMA 3FNHA 4J0EA 3SQXA 4CIWA 4K2AA 1VFPA 4LA4A 1D9ZA 1QC5B 3ZV3A 4HDCA 1TVCA 3JR7A 1V47A 2XMCA 3NDIA 5TT0A 1KDRA 2ZZKA 4K8RB 4LY6A 3WLMA 1HF3A 5MHTA 1CUAA 5J40A 3TSOA 2J9FB 3LNTA 3CH5A 3WNCA 1PEDA 2XVAA 3GLTA 3RTBA 1UEJA 4RAQA 3SX2A 1LF0A 2GBPA 3ZGNA 3L1KA 4RX1A 4WA7A 1CXZA 1XR3A 4DWJA 2Y93A 1JR2A 5JU6A 5CVUA 3THWA 3GLUA 1XE3A 1EQUA 1X7YA 3OAAA 5EE5B 2D0PB 1V4BA 1QTIA 3L0BA 4G0MA 3Q88A 1N77A 4AKEA 3G1WA 2B37A 1IN6A 2IYOA 2VH2A 3WDSA 1VLVA 1E9SA 4BPRA 4E5SA 1EFRA 3AOEA 4UVHA 3HYTA 2FUG6 3OJXA 3LDUA 3NTLA 1GILA 2LNDA 4ZVTA 3WV5A 1BH2A 1YS2X 1Z0FA 2OFFA 2F2TA 1DOZA 1DKMA 2X4GA 2XRMA 3LUKA 2IA5A 3O8BA 2P30A 4X7BA 3ZNOA 4CE6A 4I36A 4CQLB 5DNDA 5CB4A 2CHQA 4OLAA 1CQZA 1MGOA 2I3BA 1TJYA 1ZD3A 1EDOA 1NPDA 1TUEA 2M6LA 1AZTA 3S2IA 5TMPA 2CVOA 2FVXA 5BQPA 1P2SA 1S9HA 3BXHA 3TZQA 5LZ4A 1RW4A 2VDWB 1HDOA 3AR6A 4B09A 3NHKA 3PXEA 3HCPA 2ZSJA 3F5MA 2NUPA 4IS3A 4IOLA 1E9VA 4MEAA 5DLPA 4NBRA 1FYVA 1Z29A 1L2TA 4K9DA 1GL3A 1SC4A 1JE1A 2WHYA 1IAVA 2OHXA 4FR5A 1SBIA 4HUJA 4NFHA 5CBPA 3MGGA 5KPDA 4RGBA 2CLMB 2X14A 2N47A 2FN4A 3DV2A 4XFDA 2XA1A 3RUCA 4AG3A 4EGCB 4HY3A 3DAFA 2VHVA 3AUTA 1D2HA 1ITZA 1NHGA 4JLUA 4S1TA 2Q0QA 3LV8A 2PRSA 4B3CA 3I62A 1OCEA 2BMAA 1GPBA 4ER7A 2IL1A 2VBCA 5HCNA 5IULC 3BSFA 3D3QA 3KQYA 1F8XA 5BWCA 2BEWB 1WCIA 1O03A 3QU7A 4F86A 2R8YA 4R81A 1UP4A 4FKMA 1T36B 3SYLA 4A8HA 1K8RA 2PANA 1CCWA 3ILYA 3LX8A 3JZDA 2PZKA 2CLEB 2DFVA 1Z06A 1MHTA 1EX6A 4F97A 1W34A 4ZN6A 4INPA 1WA5A 3T9EA 1BDMA 2IIVA 4TUYB 3WDMA 4PAOA 1M1XB 3DBRA 1G55A 4EMTA 5EYPA 3OI7A 5JO9A 4K3UA 3COYA 3ABQB 3H8JA 3LUHA 5FAXA 1ZPDA 4EELA 5U9CA 2BGGA 1WMAA 3JAWB 4RHUA 4LCBA 4G85A 5IM5A 4UTPA 1CSEE 3B6KA 5E6UB 3NOXA 2DETA 4C5CA 3IVAA 3ONNA 5J63A 4G9EA 1K2VN 5ICGA 1DE0A 1WXDA 2AJBA 3TL2A 4BFYA 3ASUA 4JP1A 4DEYA 3FVVA 4OUDA 4D3XA 3AJ9A 5H7XA 1Q84A 5IC6A 2QM8A 3A6PC 5I9TA 1BCRB 5EP2A 5TGZA 5JEEA 5FDFA 2JVIA 5CCDA 1DWOA 3SKXA 2V4UA 3TW6A 3ADDA 1CUCA 4TTSA 1UJBA 3K92A 5CDSA 4WW0