1FS6A

Glucosamine-6-phosphate deaminase from e.coli, t conformer, at 2.2a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility, an essential component of the allosteric activation in Escherichia coli glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
total genus 97
structure length 266
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fs6A00
2R5FA 3BXFA 3E15A 3ENWA 4R9NA 1FS6A 4L5IA 4TM7A 4X84A 1UJ4A 3HN6A 4L51A 3TX2A 4L5JA 3ICOA 1XTZA 2J0EA 2W48A 1CD5A 3EB9A 4L50A 3CH7A 3BXGA 2WU1A 3OC6A 2RI0A 2F8MA 3NWPA 3U7JA 4OQQA 3HHEA 1Y89A 1FRZA 4TM8A 3EFBA 3LWDA 3CSSA 1UJ5A 1FSFA 3BXEA 3ENQA 3L7OA 5HJ5A 1O8BA 3UW1A 1LK7A 3KV1A 1LKZA 3NZEA 1NE7A 1VL1A 3ENVA 4OQPA 1FS5A 4L4YA 1FQOA 2GNPA 3LHIA 2OKGA 4IO1A 4GO1A 3KWMA 1JT9A 4M8LA 4NMLA 1M0SA 1HOTA 2O0MA 3IXQA 1UJ6A 4R7TA 4L4ZA 2RI1A 1LK5A 3BXHA 3E7FA 4GMKA 1HORA 1KS2A 1PBTA 1DEAA 2BKVA 2BKXA
chains in the Genus database with same CATH superfamily
3DDCA 5H80A 3VPGA 2VVTA 3UYLA 3FCAA 3MFQA 1T6BY 4QFBA 5BY2A 3PFBA 1P2GA 3W3ZB 3B1VA 4CDGA 5KC9A 4BNYA 3NAQA 5KQMA 3B9QA 2IK8A 2CE7A 2R1TB 4R2MA 5AW2A 5FI5A 1Y34E 5HPYB 3INTA 2VSFA 2FWMX 5DO9A 5DB4A 2Z2ZA 3H5NA 4DLTA 5HKOA 3MBKA 4L9RA 3ZZ0A 2FZCA 1NDUA 1CPYA 1BHJA 1DZ3A 1RBYA 4CTMA 4XCQA 5T41A 3DLTA 1P0QA 1M2OB 2NU7B 3RTCA 4BEJA 2BSXA 3IV6A 3ETDA 2OZPA 4L16A 4IDQA 2QGNA 5HE9A 5JD4A 3AKEA 4LHZA 4RTPA 2AIRA 5CIQA 4Q03A 2V4ZA 2WTBA 4HNRA 4UQOA 3WAKA 3PS9A 4K6OA 4OG2A 4RKFA 1JHQA 2OYCA 1PAUA 3B9PA 1IMOA 3RVBA 5ERXA 1UKAA 2NO1A 2C0CA 2PSEA 3QNWA 1MO3A 5FPSA 5E4YA 1PUJA 2KYRA 2XD9A 3MLAA 4JBNA 5DX1A 5EWJB 4J4HA 1SOAA 3MSXA 4J76A 4TMZA 3HJFA 2FPUA 4QVIA 1V7ZA 3BORA 1UP7A 3I1IA 2R8ZA 3G0IA 2WUEA 4C4TA 1Q0HA 1TA4A 1WQ1R 1BMQA 3HP1A 1ZH6A 1X7XA 1B8NA 1WA5A 5G41A 3WJAA 3VR2A 3Q72A 4PFQA 1XEAA 4JBWA 4NFYA 5FCDA 1NHWA 2ADOA 2QTAA 3BVPA 3V5NA 1MO4A 2XNDD 1Z33A 3G5UA 4OOEA 4JR2A 1F9EA 1GTMA 1OI3A 4DA9A 4KE8A 4P3OA 5D8DA 2BBSA 3F6CA 3OX2A 5DX0A 1MJ5A 1VCMA 3IVCA 2IP2A 3KAKA 3NV7A 1Y4ZA 4QNMA 4UJ3A 4CMEA 5K0GA 1LUAA 1SC1A 2B5OA 3GLFB 4F1WA 4D5EA 1ZC4A 4NP6A 3KQKA 4B8YA 1EVIA 5JV5A 5LA6F 5HUJA 1G0OA 4B3IA 4C43A 3JATB 3ORQA 2D1TA 4XIYA 4B7CA 2CZCA 5ED0A 2QM3A 2XTMA 2W2QA 4PZCA 2BZSA 3GLFA 1WUHS 3ZU4A 2XCSB 3U7FB 4I6GA 3DLHA 1PKXA 2AK3A 5B53A 3I76A 4RZSA 1T3SA 2OK7A 2ARKA 1YQQA 2EFHB 2H4ZA 1K8YB 2V9CA 3CURA 4F45A 1A1VA 2WDZA 5DMXA 3MXTA 1CDEA 3RK1A 4CLOA 5FUMA 2O8DA 3CO5A 4G07A 5C5CA 1THZA 2CWWA 1GA6A 2V7EA 3SKXA 4PE5B 1YGYA 4MIOA 3VZCA 1FC0A 2VNJA 4P92A 1ZY2A 4C04A 1CEXA 3CLRC 3GEGA 1BN7A 1STOA 5LQCA 2OE2A 3LY8A 1FW6A 3RHFA 3HN2A 4Y2SA 2F3PA 3C6BA 2ZYHA 1OZFA 3X2FA 4KO3S 3A26A 5FLYA 2WJZB 3S8MA 2JFXA 1CYDA 5EWJA 1E3JA 2C8VA 3BK7A 4KFUA 5TS2A 4KQMA 2DT8A 2QI9C 4OJNA 3SR0A 5F2NA 1QRSA 2YVKA 2XYHA 3WB9A 3AFMA 3DULA 5LU9A 1Z0DA 3VU1A 3DHYA 2GKOA 5FI0B 3DAFA 3P2KA 1DFGA 3LDAA 2YZGA 4WBNB 1YFZA 2DKOA 2UVPB 4O4IA 2DSNA 3HBNA 3K0BA 3RR2A 3UXYA 3VDQA 3TIXB 5KYYB 2XCRB 1QQ6A 1QGUB 4EYEA 2HWKA 5BSHA 5JTTA 2DG2A 1TA0A 2VQFB 1BX3A 3DDHA 2RB4A 4BWGA 4DBLE 1ZNQO 2Q1UA 4UFPA 5CLLA 2RGCA 4NCIA 5ALSA 3X1XA 5T4HA 2WPNA 3SNKA 2E6KA 1FXSA 2ZJ2A 3JZIA 4WKCA 2PSJA 4PYJA 1JGTA 1L4HA 1R6AA 1MABA 3ICWA 4J94A 5DSTA 5GJVC 5KYVA 2FA9A 3G85A 5T64A 3T41A 1N6NA 3OP1A 2H00A 3PC4A 2VDUE 1OF1A 4MVJI 1X9GA 1L4FA 2P4UA 3GFOA 2BCJQ 2J4CA 4IZ6A 1VPEA 2XECA 5HZGA 1ZM3A 3BRSA 5C31A 1DEAA 1ID8A 4D43A 1O0CA 3OCXA 3N76A 4RQBA 4XGNA 3SD7A 1RP1A 1FFCA 2ZSJA 3CZRA 4HDKA 5WRFA 2WYHA 2JLYA 3KLOA 4KU4A 4GPEA 1F8XA 3BWYA 1LTQA 1XA3A 4UPVA 1A4XA 2J0EA 2YTZA 3TQFA 1ESEA 5BUSA 2EZ8A 1KOJA 1QH1B 1KR2A 2XOXA 4HQ0A 1EB9A 1Q1BA 4JUAA 4DSNA 3T7EA 1QH0A 1RC0A 1E9SA 1LDBA 1H1TA 2FWIA 1DCMA 4WN9A 5AJUA 3RQSA 3NNNA 2IHNA 3HJNA 4GFDA 4UXHA 1E99A 1G5TA 1Z36A 3OCWA 3QLVA 2LNDA 4MGIR 4IVRA 4RELA 4AMVA 5AW4A 2DFLA 1VKNA 4KR0A 4HDRA 1XK6A 4B3BA 2VAVA 2WOJA 3HBAA 4F04A 4I9GA 1UXKA 1JV2B 2PGXA 1MX1A 1UM9B 5ES4B 5DM60 1JXMA 3SE7A 3T9CA 4B46A 3HZRA 4D5GA 4RPLA 2ECOA 3T1VA 2AFHB 3QUSA 1PG2A 3L8MA 3OLWA 1GZ6A 1YR6A 1YQWA 1YT5A 2RH8A 3R5SA 4FYYA 4I9UA 5DT9A 4S1NA 5K1ZA 3UK6A 4JSTA 1U7TA 3BBLA 2ZANA 5AHKA 4FI3C 3LOPA 4PINA 1ZESA 2NZ2A 2QTNA 1H42A 2VDWA 3RU2A 1V3UA 4BE7B 1D2RA 3H18A 3IP1A 2ZPUA 3MCZA 4IV8A 1A5TA 1JAXA 2PJDA 4PZ9A 5JXGA 1BC5A 3M6XA 1DBRA 5DM0A 1EGHA 3E82A 1NQAO 3EXFB 4KN5A 5BSEA 1LX6A 1YH3A 5CH3A 1YQ9A 1Z6ZA 3TVDA 3SFZA 4D9MA 2PH7A 2R11A 4HTFB 3C8UA 3IUQA 2BPOA 1VYVA 4F1JA 4OI0A 1CY2A 2PN1A 2N42A 1MT3A 3GA0A 4CIDA 3IBCA 5KPJA 1PL0A 2HDHA 3JYNA 5KKNB 5LQRA 3NATA 4QPCA 1T25A 4B6EA 2FQXA 3NS7A 5A0FA 1CUBA 4JUBA 3HHPA 3GF4A 1Z18A 4UUOA 4IFIA 4ZA2A 4DR6B 1P7WA 5C9ZA 2XODA 1KAMA 2ZBQA 4PQRA 3CF6R 4X1OA 2J3LA 2QGFA 3H11A 3QJYA 4M1OA 4N5IX 4MYHA 2IYEA 4BX9A 2N3ZA 4UMFA 1M34B 3EVBA 4YJFB 3WLAA 3O1LA 2OGZA 1GG2A 3CTMA 4TV8F 4WFKA 3D4OA 3ZU3A 4X3PA 5CEJA 4LX8A 4EPYA 3WIBA 5M5BA 1YR2A 4YMLA 1J2UA 4UM9D 3N9IA 4HGYA 1PV2A 4PHGA 1VMIA 4DLXA 5C35A 2R97A 2YHAA 1PIWA 4FGJA 3FRIA 3TR6A 2NZXA 2NUPA 1SWWA 3Q3CA 1ZK4A 5JCXA 5LQKA 4YRGA 3HM9A 1F1BA 2WYUA 4YAEA 3RB8A 1QO9A 5LQJA 1Y81A 5JCOA 2HF8A 1VLLA 1AK2A 2ROQA 4KX3A 3KOUA 4MQMA 4OB8A 5DSXA 3AM3A 4DR3B 2NP7A 5KOIA 1ESNA 4LV6A 2DY1A 2VRBA 4CEIB 3LQQA 4MKFA 3RCBA 3GFGA 2IV3A 2OZLB 1Q0UA 2QQ0A 4MR9A 2JFFA 2IW1A 2JIPA 2YCBA 5JR3A 4RTSA 3RH0A 4Q4LA 5MDHA 1PQWA 1W2HA 1YB5A 2H7VA 2W4QA 3DWFA 3A3YA 2P67A 1P72A 4WJKB 4QUBA 4CMEC 1TQ2A 1XFDA 2C9BA 1OZGA 4YYZA 4TKUB 1CR2A 4PHCA 2HX1A 3QJGA 4MARA 3W2HA 5CVVA 3C7KA 3HB0A 4K3VA 2K87A 1QONA 2J07A 3O8QA 2ZBVA 2ZYDA 4UNIA 5TMEA 3V4PB 3VPAA 2FEKA 4DUYB 1WCV1 1R8XA 4FFOA 3F97A 2HMTA 5D84A 2YHUA 1JMKC 2XVZA 3GP5A 3GVXA 3G2LA 4G5YA 5EE5B 3TW6A 3VHLB 1WBBA 3A4MA 4HB4A 1UXOA 3ACDA 4NYJQ 1W9HA 3TLYA 3UJ9A 4B9AA 2C4NA 2HSWA 1IDOA 3HM2A 3V33A 1HT1E 2QTTA 2WUFA 3K2EA 1CQXA 2W93A 4E5UA 4YQZA 1JMYA 2JATA 1JLSA 1OY1A 1UJ4A 1LDMA 1B15A 1N2CB 2IXTA 2QRZA 3FA2A 4HNAB 4D56A 5L7YA 4A8JC 2YFHA 3PHHA 3K6SB 4KX5A 1L9XA 1RYMA 2YVLA 1ONOA 4MVJF 4DR1B 4GH5A 2BRUC 2CUTA 5K05A 2JLCA 1BVHA 3HGMA 1YQGA 4Z54A 5THXA 3MJRA 1ZUD1 4NG4A 1WLSA 1M8JA 2BYTA 3R3SA 1QANA 4MB2A 3QG5A 4XWKA 5TLSA 4Z3OA 3F8TA 1LQTA 3AUAA 3L18A 4MRAA 2D1RA 2J7KA 3USZA 2WKSA 4NBSA 2YVQA 1HETA 3IJEB 3WFZA 2YBDA 3C41J 2OECA 3K09C 1VZ2A 4DV6B 3ROQA 1W87A 4I4IA 4NOKA 4Y9UA 1AD2A 3Q15C 1Q0QA 3ZZUA 4AKEA 5KDOA 1NXVA 4J4BA 3EDRA 4YDSA 3U9TA 5B3JC 5EJEA 1F17A 5FORA 4A10A 3HJGA 4FD3A 1M74A 2VI5A 2WZBA 3CUEF 3HLKA 4PIMA 3RKUA 1IOZA 1MX9A 3GCGA 1U99A 1FL9A 3O2QB 3RBZA 2HJRA 5I9LA 4B3DA 1JI3A 1QMPA 3WKCA 1WV0A 4BZZA 2E55A 4E07A 3DMTC 5CTJA 2VDVE 3B5EA 2B7CA 4HMOA 3ZWBA 2X7HA 1IY0A 2I4NA 2JJ2A 1DO8A 2PLNA 3AXTA 1UP6A 3BL5A 3KHKA 4GR4A 5FTNA 3RARA 5C18A 4YCNA 1DPGA 1NVGA 3DZIA 3NC0C 2GXSA 4QATA 2FZ5A 3CH4B 4NPHA 3ZNOA 2R6R1 3L43A 1D2EA 4LQLA 4K6CA 2V4UA 1MO6A 2FN7A 3AJRA 2IHJA 3KQOA 5IBCA 2BFFB 1TO6A 1YZUA 3O5AA 1PI3A 3O91A 3VSCA 5KNBA 2RAVA 1C9DB 2DWQA 2PLWA 1OOEA 4FYPA 4F86A 2OHVA 4FDVA 4LJ6A 1O0SA 1Q20A 2BFMA 4COOA 4IWNA 4BIMA 4TPKA 4URXR 3GPBA 4B6SA 4A03A 4M1ZA 4EVSA 3H8SA 4L4YA 2E5FA 2PUBA 1SB8A 1E7SA 2HIMA 4O29A 4EJSB 1VIDA 1FDUA 1EXVA 2QMZA 4TKLA 3CKLA 4IAOA 2R1VB 2CVFA 1D6MA 1Z34A 4M9RA 4NJMB 3U4HA 3J7TA 2P1RA 4D6PA 4OSPA 4RADA 3VU9B 5JS1A 1MC8A 3JD1A 3EQ2A 1AUPA 4RTRA 2P9YA 3HMKA 3R6TA 3NCHA 4U0JA 1K0UA 3N1UA 3GH3A 4FLMA 4ENPA 9LDTA 3TRJA 1TD1A 3U61B 3MGCA 1FNMA 5EYPB 5KJFA 1U2GC 1V1RB 1W581 4J0DA 5CW1A 2ZZMA 1ZU5A 3TAUA 4EY8A 4MWZA 2DHCA 1XZNA 4GOOD 4KIFA 4GS5A 3KYDB 2IS6A 1G5FA 4UCFA 5HWSA 2UYHA 1ST3A 1Z2CA 2AFIB 3PXBA 1NR7A 4AMBA 3C85A 3GWGA 1XCMA 2JJYA 2F8TA 1ESZA 1WEHA 1ZKDA 2CFSA 3GP3A 4H6XA 3EXG1 3TL6A 2GBIA 4EHKA 5A6SA 4LJRA 5K8CA 5G02A 2VRCD 3UOWA 4KDCA 8MHTA 1H93A 5SYAA 3TYXA 2G67A 2GS9A 3JZDA 2V7PA 4ND6A 1H1LB 4EY4A 2QWXA 1GHTA 3COZA 4YFVA 4NEQA 4PHFA 1LLUA 1SVLA 3JASB 5FR1A 1O94C 2CXRA 3RJZA 5LOVA 2B3DA 2G82A 1R4NB 1Z3CA 2VPXA 1TZBA 3ZE9A 2E85A 4L9AA 4TWJA 1OXXK 4F5DA 1TU0A 2IU4A 1G8FA 4YUXA 4L9SA 1QIMA 3OIYA 2FR1A 2V9ZA 4DWVA 4P0PB 2BGJA 4AS3A 3L1KA 4AKGA 3G79A 4J1TC 2WWRA 1XKLA 4HH4A 4L1KA 3BMNA 4TQUS 4C0LA 4CG2A 1BSVA 2QI9F 4J03A 1UPAA 1XR3A 4TWAA 5DBFA 4EHJA 2HK8A 5ERYA 1IBRA 5GQSA 1H2HA 1E0AA 1KHTA 2PT7A 2W2LA 4B8ZA 5K3FB 2OBYA 3BE8A 3KWJA 1T1IA 4HKTA 4HSEA 4H0CA 1OW3B 4FGKA 2AN3A 4NARA 1LQ2A 1R6XA 3TDNA 3OH8A 2BZ1A 3PDIB 1WWKA 1UC4B 2Z5LA 3VUEA 2X4IA 4EHDA 4EJFA 5A1JA 1QHHB 3P9YA 4EW2A 3P8ZA 4JYBA 5C7LO 1AH2A 4FLFA 1FMTA 1HYQA 3C3KA 1Y8RB 5F21A 3PT9A 3RJMA 5FO0A 1ZJYA 2OKCA 1WY5A 4PYOA 2HI0A 1SIUA 5BXQC 2XWQA 3GOHA 4JA2A 3C3PA 3FKQA 4UNSA 3V8VA 4E2XA 4A15A 2O2SA 4R9VA 4DV3B 5DWDA 2EYUA 3OZTA 3QYFA 1U8XX 5A2QA 3GG2A 3K4PA 2JHAA 3QTLA 1XMJA 1FX0A 2VUSA 4HGRA 1U2GA 3F5DA 4OQYA 2BGIA 3WRVA 3DLBA 3K5HA 5EUCA 3GLSA 5PGMA 3G49A 1VZ3A 2H16A 1ZWLA 5LP6A 4ZAFA 2CBGA 4GEKA 1FU7A 1QZZA 4LEIA 4DMLA 3KPWA 2ZAGA 4WGFA 1RRFA 1Z0ZA 1Y6ZA 3ISJA 3KIPA 1W5EA 4EBFA 3T7RA 4Z51A 1B6GA 1GAJA 4IEFB 4YRCA 4D4LA 4FYMA 3BD7A 2JCBA 3IUPA 4IOKA 4KDEA 2UYQA 4Q4JB 3KCNA 4YAWA 2VAXA 3SX4A 4F4HA 1MZVA 1CFJA 3EVGA 3L6RA 3D31A 4GWGA 4OHCA 1FYXA 3KJGA 2QMUA 4FSHA 3SS8A 3EQZA 2EG9A 2ZRFA 1MHPA 1N2BA 5CDYA 7MDHA 2P2NA 1G20B 4Q6BA 2GBFA 3KYIB 3OOJA 3R3UA 1KQOA 1W4LA 2RHLA 3PP8A 4NL4H 4A8JB 5F23A 1QO7A 1WXGA 4GE0A 2BGLA 2QP3A 4FDMA 1TK3A 3BWVA 1Z4LA 1Z7WA 1B14A 4M9CA 2QRMA 3B60A 2IOQA 4ND3A 1UAYA 1MRSA 4QOHA 4JKOA 3NZEA 4ON9A 4PCAA 3QE9Y 4ZV7A 2BGWA 2Z43A 5MN4A 1R3UA 2E7ZA 1J5EB 2FV8A 2WSSD 3D6HA 4FFNA 4DE5A 4QTUB 1OE0A 3FBTA 3ICPA 3SEQA 1VB3A 2FPXA 4K5QA 4POAA 2AOWA 2F3SA 4MCAA 4GOND 4WBNF 3RS3A 5F1PA 5K6AC 5ALRA 4KJXA 5FBRB 5L4LA 3JU3A 3KB1A 3HU3A 3OF5A 1WE2A 3FCOA 1VM6A 2PMBA 4RY8A 5TVGA 1NF2A 1P2DA 4MJ3A 1H1DA 4Q7MB 1E9FA 4WOJA 3RE1A 3THRA 1C0PA 2ID9A 3EIQA 1C0EA 1AS0A 2FR8C 1EFUA 2C20A 2PT6A 1BIFA 1PZXA 3FSGD 4UAJA 1E9EA 4G01B 4NRDA 5CLGA 5BVGB 2ZEJA 1U02A 3TRKA 1TIPA 2H85A 4FGUA 2J08A 4JLMA 2C8LA 5LDHA 3O03A 4RZXA 2DYKA 4WN9B 2C7QA 3EQ9A 3DEJA 2EWWA 3F3MA 4MMYB 2XE4A 4YDHB 1RMQA 2HLHA 3EW7A 2GGSA 1I80A 2I22A 3CH6A 3CF2A 3EY9A 3HC7A 1ZM4A 3MWEA 1GUDA 3RV4A 4LGCA 3VNBA 1E1MA 5DSZA 1B41A 4N82A 4XYBA 4KDRA 3HJTA 4TLMB 1GRQA 2HAEA 4G5RA 1U2RA 3S29A 3F5MA 4DABA 1HDRA 4UTXA 3DVQX 1TUBB 3A1SA 1XZDA 5DU2A 3QV2A 4GNRA 3N8GA 5AVZA 2OO5C 2ONJA 2VNHA 3N0WA 4UE6A 4Y98A 2PZKA 3OD5A 4G8BA 4URFA 3SQOA 2GZ2A 3UY4A 1T3ZA 4OUKX 5FPQA 3I23A 5BNTA 3PQFA 3P1JA 2VC2B 4M1EA 4LK3A 1SZPA 3DPSA 1MGPA 421PA 4C4PA 3U3DA 4CMGA 2UUCB 2W11A 2P65A 2OQIA 2QUHA 4RV9A 5FPKA 4GI7A 5AHOA 2HRQA 4BMYA 3BXPA 5AM0A 1L1RA 3RSLA 1CNFA 4MQFA 2RDMA 4G67A 4HZUB 4S35A 3VXKA 1VCIA 4Z1OA 3QIVA 1DUVG 2GJAA 2QQ5A 1VL2A 2WYOA 4JSYA 3J80A 1EX1A 3EPKA 3RFUA 4DJ5X 4BVHA 5CT6A 4BV2A 5TPZA 3LQKA 3H42B 3IQDB 2CVQA 4KV9A 1KI7A 1MEJA 1PDVA 3HJCA 4LOIA 1GQ2A 1RYEA 1XRQA 3SDSA 5EJ4A 5I9IA 4TL6A 1CUWA 2YMPA 5KTTA 2A9VA 4H35A 1LI5A 4RZQA 2IRWA 4CM8B 5BYKA 1YJCA 2VP9A 1ZIYA 3FMVA 4BNWA 1QDLB 4HZIA 1C1XB 1G60A 2IF2A 3LUKA 4M36A 3QRWA 1KF0A 2WWFA 4UXJA 4AZ3A 3THWA 2Q4RA 1L5RA 4OHMA 3WL4A 4BCCA 1R4AA 1ZPDA 3RNOA 4D4IA 2Q2VA 2HPVA 3HN7A 4Y18A 4YP1A 1A9YA 2TYSB 3KEFA 13PKA 2FSGA 5EC8A 4GPZA 1N32B 2NACA 2CL7X 3N28A 3NHMA 3K0KA 1IHOA 3NHPA 1XDDA 1FYEA 3QA9A 2UUBB 3G8YA 2HMVA 3HEBA 3K6RA 6YASA 2GBCA 2HW8A 2O7NA 1TLLA 1U1GA 1HBJA 2ZGVA 4MRPA 4A9AA 4CLOB 1ZJJA 1BDHA 2VDQB 1W36D 4OQFA 1PJ3A 2JIZD 2X6RA 1LLCA 4JLJA 2AUNA 5IH3A 3URKA 2MIIA 2GCEA 2Y2VA 3TKYA 4DYDA 2HNBA 1K9VF 3HA3A 2BEUA 2Y0PA 4OJMX 5CG1A 1EWTA 1Z9BA 2GEDA 4JBXA 2YMMA 4NULA 4YY3B 4LRQA 2IPLA 2Q99A 4KXXA 1YJBA 4IUYA 2P2CA 3L6EA 4MUBA 3TEJA 3ADBA 4BVBA 1N2CE 2N75A 4KLNA 1ZK3A 3G5MA 3VU9A 3TW4A 4F9GA 2IDKA 3GFFA 1JQEA 4MV9A 4CG3A 3BKXA 3LW8A 1QZTA 4OQNA 5K03A 3M6LA 1I7DA 3L7DA 3T7JA 3TQRA 5ITVA 3L6OO 1RXVA 5CURA 1Y8ZA 2XE6A 2VDLB 1Q83A 1R3DA 1X8KA 1DT3A 1NN0A 1C0LA 1YFJA 1PKEA 5C37A 4UE2A 1KJ8A 3BIFA 1ZUHA 3TRIA 1UWKA 2ODQA 3CLSC 3KB6A 4HWGA 3AUFA 3RS7A 5J58A 2ESRA 2I66A 4OMFG 5LM3A 1Y7IA 4MR7A 1TPYA 4Z99A 1Y42X 3BJMA 2Q5IA 3M6FA 2PLFA 4D4GA 4QGFA 1RHMA 1JJ7A 1C8LA 1N5JA 1X3SA 4RORA 4G86A 4TSKA 4E5PA 2FZKA 3CRQA 4LBVA 4UNPA 3DOUA 3OWXA 5T6BA 2BKXA 4ID3A 4WZAE 1XQ9A 4D9CA 1UKZA 5FX2A 4BV9A 4RD4A 1H66A 4LGYA 5DGIA 1C7ZA 1DAEA 1W0JA 1XF1A 1AY0A 2VYVD 4J0JA 2HKIA 3IOYA 1ORVA 1RKVA 1EM8B 1RE0A 3H5LA 4LMRA 5DW3A 1QQ7A 4LF4B 1IN1A 2VJMA 2VKTA 3MTBA 4ID9A 3G2NA 4Q3LA 1CRLA 1EAMA 1COWA 3AZQA 3CPHA 3LWNA 2YN2A 3RFTA 3MUFA 1JEEA 2W37A 3RK4A 3TECE 1JDUA 1T9GS 4QO8A 4AWAA 1NP3A 5BV7A 1CJMA 3SYKA 1KYVA 3V3TA 5BUZA 1WHSA 4KXYA 2EDAA 3IT2A 3B2NA 3WYFA 4NMLA 3D0QA 3FAZA 1RAFA 4IUDS 4M37A 3GXOA 3OJXA 4LSWA 4BPRA 4BATA 5IVPA 1U3WA 2FX2A 4JDUA 4JS0A 3LWZA 4C88A 1P61B 3OMXA 1RXIA 1IJFA 2J31A 4CF3A 2NSLA 3FPJA 3OHPA 3P2OA 4L07A 4CL0A 4WRRA 3K0AA 1MJNA 1TECE 1XTUA 1YQTA 3TPCA 4A6DA 3PGMA 4HBZA 5A7HA 3BL6A 3NNSA 4LFBB 2C2YA 1E9RA 5F35A 3NORA 2AFHA 2JEZA 2GJ4A 1D09A 1P0IA 2QRGA 3JQGA 1UBSB 3MZ0A 2VBGA 4B81A 2D06A 3ZVMA 4H59A 3JQ9C 1HDGO 4P93A 1XLUA 2CBZA 4XFDA 3J7AC 3FNFA 2CVOA 3FROA 4DEVA 4J75A 2LCFA 3O4JA 4YECA 1V6AA 3LPDA 5G0VA 1J8VA 4BTVA 5JDIC 4Z8YA 5EUBA 4OV6B 5JNRA 1ZD5A 1LDEA 1ABFA 1XYGA 2IDZA 2X9QA 3CN9A 3G2IA 4MRMA 5L3ZA 3FNBA 4ER6A 3HJRA 3O92A 5DFAA 1Z2PX 2J9ZB 3WK9A 4I4LA 4AY6A 1W6UA 4NENA 1GKYA 5FLXA 1E8DA 3KQVA 5ETJA 1DTEA 1Z4NA 2RHDA 3WGGA 1Q3HA 5LMNB 4MR9B 5HF5A 1NPTO 3PKIA 2TSYB 1ZZGA 3AFHA 1IB6A 3QOFA 3WFIA 5HZMA 2ZYGA 2JIOA 3NAGA 3OZRA 4HGOA 3FUTA 4XIGS 3AYZB 3JVDA 4OQEA 1PLJA 2DWOA 3TB4A 2AWNA 4EPTA 4M8SA 3OA2A 4UD6A 2PL3A 1O5IA 4IDGA 3B36A 1TF7A 1U9IC 4OHPA 3TXYA 4C29A 4XM1A 4J6EA 4Z53A 1ZZEA 1IEWA 4LHYA 4PQYA 4G24A 2ZOSA 1RJWA 3PSHA 3MD0A 3UMBA 3O21A 1XX6A 3CS3A 1U3UA 4FHZA 3OC0A 4Z7NB 3K96A 3AILA 1PJ8A 2P7IA 1NL3A 3GEMA 1HQDA 4TV9A 5T4FA 4Z4GA 2C1XA 3D8RA 3GU3A 1JI0A 3V42A 2ZI6A 2PWBA 4CU5A 4UOZA 1J0DA 3IAFA 4EUHA 1BDIA 4BEBA 4ENRA 3ZKAA 3SHQA 4IDFA 3VGJA 3OF2A 3ZCRA 1BWPA 1FMCA 1T8PA 4IJWA 5KSOA 5LU8A 4PSCA 5H3HA 2UZ3A 1BAPA 1AO0A 5CLQA 1RHKA 2AJLI 3V7WA 1KNQA 2E4AA 1RHRA 3RS2A 3EH2A 1EHIA 1LPNA 1XA0A 5EQFA 5KWSA 1B4DA 2VWHA 1H4QA 5HBGA 1DC4A 2ZRKA 4Q1AA 4WUVA 4FIDA 2WLSA 3QTBA 3RODA 4TS1A 4PAQA 16PKA 4CMBA 1KMQA 4ETMA 1ISIA 2ZRGA 1MEOA 1EJBA 2MMGA 4BO8A 1WTCA 4O33A 4YUAA 3HBLA 5I7UA 1JIUA 4KAJA 5KNDD 1MOZA 1YQXA 2QM0A 1CUSA 3R75A 1BTOA 3H11B 2COKA 3JQEA 4CNBA 1J1ZA 4Q5IA 2J7PD 4CZ2A 1AHPA 1RJ9B 5CVEA 1QVZA 1U8TA 2YBEA 4LJSA 2A4KA 1P1IA 2Q0HA 2GASA 4ZAZA 5AKHA 1MG5A 1R0XA 5SYNA 4ZK2A 1H9AA 3A9VA 2IYVA 4IXWA 5JCOC 4ZYYA 2CLCX 3EZGA 1YC5A 2WKQA 1QP0A 1NJFA 1JXAA 2QRPA 2I3AA 1ZK0A 2IQIA 4CIXA 4DLYA 4X62B 4I50A 3DPUA 1Q1AA 1AUXA 4R2JA 1SQFA 4LUCA 1R6UA 5CFQA 4GYJA 3H19A 4ZYXA 9ATCA 2R68A 2V59A 1P5FA 4F7WA 3RD5A 2OWDA 5FOTA 2GPSA 4UVDA 3WLSA 2WJWA 3BH7A 3DOEA 1X7YB 3GK3A 3I2FA 3TEFA 1XJCA 3KR9A 1C4KA 3E7XA 3QMPA 1L5LA 3UWMA 2OFOA 5IS2A 3M82A 2YC2C 2YXEA 3T3OA 4LXGA 4BRWA 1WBJB 4HXYA 4DR5B 3R23A 4PO1A 3KTFA 4EFLA 3CLUC 4QGAA 3IP6A 4WA8A 1AIPA 5CFMA 1FVXA 2SKDA 3KKMA 3RRMA 1T9AA 4ZWNA 1H4VB 4CJXA 5JROA 1C7RA 2M6RA 2VK8A 4JVMA 2C00A 1IK4A 2MSKA 2WG1A 5LDGA 1NNI1 3SHWA 5LD2C 2DB3A 1QNFA 2ZVJA 4TWIA 3T95A 2OVFA 1KO7A 2Y3IA 5CGQB 1YDGA 3I34X 2IEIA 3JAWB 4IXMA 2QTFA 4YXFA 4HAXA 2WIJA 2Q4DA 1VJGA 1T36B 3DOOA 1QLHA 1E7MA 3B3QA 3K4HA 1Z37A 1KI8A 4F2GA 3CVUA 1GDTA 3GBSA 5KOHA 5DYNA 5LQNA 3ND6A 4RTLA 1PP4A 3UWSA 4F3KA 5T3UA 1LPPA 1XTBA 4LCBA 2VHVA 1EA7A 3GAZA 4FYJA 1VYHA 3AIKA 1ODLA 1ZOIA 3PB3A 2LV8A 4AZ3B 1I7LA 3E70C 3VHXB 5TQVA 3T4EA 4A5OA 1VL6A 4LVOA 4WECA 4Q9IA 2OHOA 3HWX1 1EJ0A 3Q40A 4E4RA 4C89A 3WZMA 4JOBA 2B4AA 3AM4A 1Q21A 1NW9B 1SC4A 4GI2A 4GKAA 4ZAXA 3KT3A 5KIAA 4UVGA 4MAFA 4CL3A 2FCAA 5CNMA 4IGKA 2M1ZA 1TJ4A 3PZBA 4EFMA 3EOAI 3FWHA 1QV6A 2FSPA 2P7HA 4PONA 4J3FA 4BMDA 1TXGA 1UBCA 5TC4A 4IPTA 1KP2A 2BEWB 4IR7A 3IBSA 2V96A 4G9EA 4AG6A 5ICSA 4XE5A 1PV4A 1UEXC 1NJGA 2O7VA 4U4AA 4ZJYA 5C7OO 2GF9A 1Y3IA 3UCEA 1BXRB 3H9GA 5A3JA 2GJ8A 4C08A 4X7BA 3W1WA 2FQWA 2W22A 4RM2A 1EXNA 4HDSB 3AEKB 4J6FA 3LPAA 1Q22A 3TJZA 1HNNA 4KHZA 5AW8A 4HN4B 1J8FA 2WD8A 1SKBA 4K9DA 2WSBA 1X7DA 5DGDA 1SA0B 4M38A 1U63A 4ZC8A 2QX4A 3DLAA 4Z1MD 1SVWA 1UZLA 3O2JA 4X6UA 5E1BA 1UWVA 3TOVA 1EE2A 3V8QA 3VNSA 3HN6A 1AN0A 3QLEA 4ZRMA 3WDMA 4E1AA 4AO6A 2QXUA 9ABPA 2B1IA 3OQHA 4ARIA 5ERGB 2YVUA 2C4WA 2EJWA 1FY2A 4I5EA 3KP1A 3A37A 4QT4A 1S0UA 1U2PA 2CLKB 2F59A 4QJ3A 1GGNA 2ZP1A 2HWXA 4AN4A 1T0BA 4NH4A 4GT1A 1P6XA 4NESA 4BS9A 1CEQA 5HKLA 5IT9A 3JAMA 1UQRA 4LW8A 5AVTA 3QKSA 5LMCA 4BV3A 2JPDA 5B1DA 1BROA 1BH2A 5KJCA 2WVHA 4LWZA 5FPTA 2DC1A 2XIJA 1ABEA 1OGJA 3U40A 3IELA 4ENSA 4B76A 1PJLA 1PL7A 2AGVA 5CVJA 3FSJX 1EVYA 4EX7A 4CF6A 4NDZA 1EB8A 1F8UA 4M9ZA 1GRCA 2Z9CA 3PGLA 3QGMA 3P9QA 1I4OA 5ALWA 2WI8A 5H02A 3HCDA 4JBLA 3KETA 5HKKA 2YWJA 1WETA 5A5DA 4OH1A 4QBFA 1XL0A 4ZN6A 3PL1A 1IQPA 4NHOA 4IIXA 1AV7A 2R6CA 3EZ6A 1PEDA 3A70A 1GVHA 3VDRA 1PR2A 1ZAKA 3KZKA 4AJNA 1KEWA 2Z1MA 2XOEA 4EHNA 4EO9A 3L49A 3H7IA 2XUHA 2HL6A 1RI5A 2IIBA 2VEOA 5BN3B 3FYSA 3OJWA 1OIVA 2FCRA 3R3WA 4ZO4A 2GZ1A 5UKDA 4IKPA 5FV4A 4XR4A 2ORYA 3UAOA 1I2MA 2GEJA 3CIFA 4G5OA 1DIAA 1PHRA 5CFPA 1ZCZA 2H1VA 3F1KA 3HP7A 3ZE7A 1RNLA 2RARA 4CLXA 4H6VA 3EPJA 3WMRA 3UJHA 3ASVA 4XUEA 1GPAA 5B58T 3UT0A 1CJVC 3E9CA 1HLFA 3MGKA 1U1FA 1C41A 1ZGCA 4C3ZA 5K09A 3AB8A 2I6QA 3ZNQA 2BEKA 3SZGA 3HXQA 5DXJA 3C3WA 2H3EA 3Q7RA 3WXBA 3I6BA 5BMVF 2BFCB 3DV0B 4NONA 3P5BA 2XMCA 4ZAGA 3PLAE 1MOQA 4EM6A 2OD9A 1UC5B 1KC3A 4PCLA 3ZJ5A 4LTMA 1O1YA 1QIIA 3U3XA 2GA8A 2JCGA 3TOXA 1BE1A 2ANBA 2FEPA 3DBIA 4X6YA 2EKBA 4MV3A 1WXFA 1WDLA 1KDVA 2C42A 5L3SB 4GYYA 3BSFA 4JB3A 5LYJF 2P3SA 2XCLA 1UDCA 1CV2A 4WLFA 3Q1KA 3EOBI 2B30A 3DDOA 4UM8B 5GONA 4ZMBA 3CX3A 3N87A 3QZUA 4AULA 2DFDA 1G3MA 3ZEAA 1V5WA 4U2EA 2RJOA 1SXJD 1A8QA 2AR9A 4D9IA 5EHQA 1QYWA 1N8TA 3ZK8A 3H0CA 3ANNA 2ZSIA 3C97A 5KYWA 3ME5A 3H2BA 1GPJA 2B9VA 2DFKB 4PLTA 1NI3A 3H5OA 1Y4UA 4RVNA 2Y1EA 3I9V6 2VHTA 3ABOB 1IEQA 2DE0X 2VUHB 3N86A 2HV9A 2XLBA 4MV1A 1Z82A 4ZYVA 5HKAA 5JZSA 1I3NA 5HHTA 1U7UA 3I8OA 2IT1A 5I4IA 2QLMA 1G21B 3GZ4A 4BRZA 4DV1B 5ELXA 1K5GA 2VOEA 4IJ6A 4WL0A 4JLOA 3DMDA 3SYLA 1S02A 3S68A 4PVCA 4YI5A 4YT5A 4YACA 1M1YB 4P81A 3UMCA 3IMEA 2VH1A 1EFCA 2OT3B 1JUDA 2Z8YM 3CBQA 4FIZA 4JT2A 5TPZD 3NETA 3WYGA 1R0KA 2DQZA 2X9GA 4M8IA 4HH1A 4QQKA 3UXMA 4B40A 3O2NA 4R8LA 1TE2A 3E61A 3F4LA 3GLRA 4WK2B 2NVOA 4X41A 5DCYA 5EG5A 1KEUA 2IUSA 2Y93A 3I2HA 1I51A 4LFAB 3AERB 1O03A 2G8NA 4LXIA 121PA 1M2FA 3RRJA 1W5SA 2FLWA 3ADKA 2FDRA 3ZQUA 4QLOA 1PBNA 4ARBA 3PHCA 4C5AA 7GPBA 1W4RA 1VLJA 3OZAA 5KOYA 4HC4A 1K1EA 1QM5A 3QVKA 5DM2A 4QDJA 2FPLA 3P26A 3B70A 5J1TB 3VJKA 1JEAA 3JQAA 3HKCA 1OROA 2Y0EA 3BULA 5KYUA 3RC8A 4WV3A 1QCZA 1QIFA 1W7AA 1U94A 1XKQA 5LWQA 1KI1A 1NC1A 5B6IA 3MTDA 3OE1A 4X1IA 3DTYA 1Q1ZA 4CKWA 3KALA 1JECA 2HF9A 3HR7A 1MCZA 1OFUA 1P7ZA 3EA4A 1CUJA 3BTUA 3ONFA 4FSXA 3Q8KA 3WA6A 5KTSA 2D62A 4RNCA 4YROA 2G5CA 3CKMA 3PI6A 4YPVA 4PIPA 4ZVTA 1EXDA 1GZUA 2OORA 4OLFA 3A6ZA 1GVNB 3ICCA 4C4RA 1A9SA 4K7JA 3AEQA 3NIDB 5F1YA 2QE6A 1M1ZA 1HOTA 1KYWA 2FJ0A 1U0OC 3A9RA 1UJ6A 3N2IA 1L7OA 2MINB 5DEIA 2O8FA 2AG5A 3NHZA 5LQUA 3PRJA 4KE9A 3PKZA 3RWBA 2RJNA 3KPUA 1FDOA 3DB1A 3VC2A 5JJLA 3JQFA 4DLWA 1NYLA 2RE8A 1V45E 2F43A 2Y71A 1GSOA 2QG9A 2PA0A 1JFLA 1EDDA 2PS0A 1EFHA 3SJUA 4IDAA 3VO8A 5BR1A 1JU9A 1PJ2A 1X7WA 1FSZA 3PWKA 4L85A 4MW5A 3CVWA 3GARA 1GWNA 1X87A 4KRXA 1SQ6A 4GM4A 4TUYA 1L5QA 3COPA 2NADA 3N2EA 4WBXC 3F74A 4RYDA 2OHIA 2ZSFA 3I6QA 4WFQA 1ZGHA 1RD4A 2G09A 2HQBA 4X6XA 4L4RA 4D9FA 1FFYA 1ZEMA 2JFZA 3PFGA 4Q4DA 4DY6A 3U60B 4WIAA 1TD9A 1TQ8A 3HV0A 3ORSA 2O1WA 1T8YA 1V8DA 4UU7A 3VR6A 4EL0A 2AFHE 4TTAA 4BRSA 5BWOA 3F6PA 4RA9B 4YCLA 2XMRA 3DCIA 1RWKA 1ESCA 2COUA 3EFHA 4W82A 5GV7A 5TPWB 3R5FA 3VSEA 4TMKA 2C5HA 2BGNA 2ZSKA 4K2AA 4N7RA 2Y67A 2I6TA 3CZ4A 1TEZA 2G4CA 2Y66A 4ZHSA 3NC4A 4R98A 1A5ZA 4GXNA 1I7NA 2E18A 2YQ5A 4P34A 4LDNA 4NDNE 2C7PA 1PUXA 3QLJA 3LBIA 4L73A 3SP1A 3QKSB 4LKRA 4JI2B 1TYZA 1UKCA 4JYZA 3EEOA 1SUWA 1MDBA 1YRAA 1PG0A 3HRKA 5EXEA 2XGSA 1R37A 2CT8A 3WRWA 1DGQA 3VTFA 5EWLB 1H3EA 1L0BA 4HMQA 2W8BB 4QUDA 1XJWA 1L4YA 2R87A 5DM4A 1UADA 5BQOA 1M2HA 2BHSA 1ZONA 5CITA 1E9CA 1W4ZA 2A1UA 4ITUA 3U9LA 3W0LB 3LY5A 1Y6RA 5AUOB 1AB5A 1JA1A 1OFIA 1YCHA 2NM0A 4NHEA 3WGYA 1XXHE 1WJGA 3L02A 3MAAC 4IVQA 4AX4A 4NXNB 3AVTA 3K7EA 5K0CA 3BHIA 4JENA 4A2PA 2XD4A 4DOMA 4MLCA 1K5DA 3IR5A 4GP7A 1F2TB 2OD7A 2F8MA 3L6CA 1K0FA 4U7HA 3SC6A 3UGKA 3PD7A 1I4EB 1LH0A 3TMKA 1WZCA 4RIEA 5LYJB 1AM4D 2E4YA 5IN4A 2ISCA 1KEEB 4LI0A 1W85A 2BFWA 2WFAA 3W6OA 4EIWA 3ZWDA 4BFSA 4NECA 5KWEA 2RKBA 3OKPA 1YCFA 4NY1A 5CB0A 4ZT4A 2XW6A 3SVLA 2Q1YA 1D7OA 2C07A 4M1QA 3OZSA 4OLHA 1KU6A 3RYCB 3OVMA 4XB6B 1IXSB 3I3OA 4TKVB 3G02A 4NU5A 5BV2P 4UJ5A 5LSAA 2YJ5A 1Z73A 2VNKA 2BKVA 2XQGA 3HL0A 2SBTA 3GRUA 3I01M 4J0GA 1Q92A 1XZAA 2GPWA 2I99A 5EZYB 3DAHA 4KE7A 2DT5A 4GICA 1B73A 2Z5VA 5C5DA 3OE7D 4H7DA 4DR2B 3WKDA 1XAGA 3PR1A 4NNPA 3IQXA 3FBGA 3P9IA 4O02B 3VYTB 3EZXA 1E6EA 1DRUA 3CSUA 5EZSA 1I0IA 1X80A 4F46A 3I62A 4HNUA 1TRHA 4KVZA 1Q11A 2UYOA 3AY0A 3TPFA 5LFAA 1IZ0A 4L0CA 5JDIA 4WBSA 3GLGB 4WK6A 2CL0X 2OLJA 3TRDA 5ADWA 1Y0BA 3Q2KA 2UZ4A 4MDHA 4R84A 4DLKA 2EEPA 2JA2A 1SOUA 2WP0A 2PBFA 3OT4A 4KI0A 4BMSA 4IIHA 4C06A 5LL6P 1FBNA 4Z0TA 4AG3A 2R8OA 3N5KA 4C5CA 3I2IA 1UMBB 1VXRA 4ZV9A 4P3YA 4CQMA 3G7NA 1I2AA 3BMQB 4NZOA 2A1UB 1WV1A 1I6LA 4PLHA 1Y1PA 3IT0A 5JW6A 3EARA 4PXAA 4H0NA 2AQ8A 2W83A 3EFBA 2JKZA 1LY1A 2ZPAA 3DO5A 4CQMB 2IY9A 3ZZ1A 3KKQA 1WXEA 5JH7A 1M1XB 3PX2A 3F2VA 4AFNA 1OBOA 4ZFNA 3E0XA 4WTOA 5K2OA 2ZW9A 3PFCA 3SC3A 7MHTA 4OKIA 5L40A 3JWGA 3FE2A 5REQA 1B8VA 1OXBB 3AL0C 4N0QA 3T5CA 4CLRA 3OQ1A 3NT4A 5K8JB 3T3EA 4PAWA 3SWWA 3HVHA 3F47A 1TZMA 4ZRNA 4FD2A 1WO8A 2AC4A 4U0KA 3I5MA 2HXGA 3C48A 5I01A 5CVCA 4G56A 1KO8A 2W8BA 2QN3A 4XTCS 3IPAA 4E94A 2IYSA 1Z5WA 1NM5C 3N7AA 3OWHA 4LHXA 4P36A 1U2EA 2XB9A 4UPEA 3WL6A 2IXDA 1Z29A 2VA9A 4WH0A 1MB0A 1Z2EA 3RS9A 1ZD3A 4OMDA 1MRNA 4IX1A 3H5IA 4ER7A 5LLDA 1QFJA 4FBLA 2PPLA 4V0SA 2A7XA 3EG9B 4W1RA 3DW1X 4LVCA 2IS2A 3L7JA 1G7RA 1OFVA 3ZN2A 1KZGB 1UBNA 4Q16A 4QQ8A 4HATA 3KU4A 3JD3A 3LKVA 1PW7A 3ZZTA 5LUAA 2PJZA 3WLMA 4K6KA 3EA5A 4RNDB 4ZHQB 4HDOB 3RUCA 2O5RA 5EGNA 5KDLA 4DLZA 2QD1A 5ALXA 1EX6A 3SYNA 1CERA 2X58A 2E87A 2QRUA 3CE6A 3NDJA 3K5WA 3A9SA 3BIJA 3BRCA 3HUUA 4WHMA 3VU0A 1Q50A 2ODBA 1Q5PA 4QECA 1NBOA 3IR6A 1I24A 3ABIA 2DTEA 3GLTA 1ID1A 3N39C 4B3RB 3CX7A 3P4XA 4Q4HA 1P9OA 2GPYA 2PH5A 2B2NA 5IAGA 5KWVA 4ZGWA 1GTG1 4AI6A 8LDHA 2BFBA 2CVZA 5E1DA 2K7ZA 5HIKA 1Z16A 2YUTA 1UM9A 4HUQB 1P6UA 4MLDA 1YE5A 5BYBA 4YCMA 2J41A 2TMGA 3TM5A 5C46F 4NZZA 2CZGA 1L7MA 3AEYA 4GR5A 5KU7A 3AL2A 1LJLA 5HCUA 2GERA 5TARA 4CEJA 1X86B 3W7BA 1Z4MA 3OZGA 2R66A 3AU9A 3QI2A 3KKLA 4QLAA 1PGNA 1JILA 4QYXA 4R8KA 1IBKB 3MSCA 1YJ5A 4H7EA 4KPUA 1H6CA 4L75A 1ZRSA 4LIPD 3RHZA 3TLKA 3K6JA 4A26A 3AM5A 1HFEL 3ONNA 1IZ8A 1MJHA 3PDIA 5C1PA 3TIGA 1YFKA 1Q7GA 5LKRA 2FEWB 2QF7A 3RUHA 3M8KA 1WUYA 3IOEA 1E6WA 3DBHA 3L0OA 1X1AA 3M4ZA 4ODIA 3R8CA 4JV5B 4EW3A 2CXSA 2CUNA 4LDAA 2QJFA 3TUZC 1MLDA 3CNQS 1U5CA 2YDXA 3EE6A 5K6TA 3UJPA 4WCFC 1A77A 1X77A 3JD0A 4BJ3A 4B6JA 1DO2A 1IZYA 1JQJC 2GZSA 3U4MA 4EP1A 1YUNA 3ONDA 1NMYA 1T8TA 2O2DA 3GYBA 3STUA 3HVKA 3ZNPA 1CEYA 3MJ4A 4LISA 1MB2A 3KD3A 3DO6A 2GKSA 4UBKA 4NLLA 3S2YA 3W1VA 4BGDA 4TYMA 1YR7A 1TO1E 1GKIA 3PXXA 3KKKA 3GJTA 1QLWA 3I9KA 5KREA 2I7CA 2I6SA 3B9BA 3FZNA 1I01A 3ZG6A 2J46A 2YOGA 4D81A 1LQUA 2A9FA 1Q0ZA 3DTVB 3F6EX 4TLEA 3UJCA 3FRJA 4XLTA 2D5LA 5DVZA 3AHHA 4CM4B 2P1DA 1S7GA 2EG5A 2QN6A 3IE0A 3NBUA 4GUDA 4FEGA 5IUKC 4WBNA 2YIDA 3S70A 1Y5NA 4WLOA 3UPUA 1TMYA 2ID4A 1E0KA 4IDEA 1CP3A 4D0GA 1P29A 4EY3A 1HZZA 3QE4A 1F8YA 1YQDA 4MA5A 2X8AA 1U04A 1JB9A 2I1QA 3GN2A 5ALLA 5JAUA 2PUDA 4KPUB 4A91A 2IBTA 2GCOA 1VP3A 3GVPA 1XQ1A 1GO2A 1K3UB 2GK4A 3OQ6A 4L4SA 2P8JA 1ACJA 4E3ZA 3L79A 5JMPA 1L1EA 3JVUA 4IJ5A 4TWRA 1H0HA 4RHCA 1EE1A 3H2HA 1GN8A 1FU8A 3G8BA 1NN5A 3AESA 3LXMA 3P7MA 4OHZA 4CTNA 2VATA 3K70B 1S2GA 3KQPA 4D4KA 1JWLA 4HMPA 3WE7A 4UNRA 4YAOA 1L4LA 1R74A 3KDPA 8AT1A 3QFSA 1P62B 3RC9A 5L3SA 2WZQA 3LUGA 4MAAA 1FIUA 1IEVA 3NYRA 1T8WA 3C7TA 2F64A 4QEZA 5LJLA 1E3EA 3RSGA 5I4KA 2C2ZA 1JKJA 1KMMA 4PGAA 4I66A 4LY9A 4OMUA 1ZJ4A 4IG4A 5H4GA 3OZFA 3AF3A 3ST7A 3H1BA 3QLTA 5F2OA 4FBMA 1H2YA 1B6TA 3GAAA 1WZEA 1WZIA 1ZOLA 1NV9A 4G3XA 1V5FA 1Y7HA 1A5SB 1YDFA 3UUWA 2C29D 1RKQA 1CJBA 4LXYA 4QXAA 1F12A 3GUUA 1RYDA 2ADMA 3EVAA 3WDKA 3LIPA 5K4GA 1JFVA 2G88A 3KDSE 3MIIA 3LK6A 1FS6A 4N7BA 1YD7A 1GNQA 4BKMA 1SUSA 5IZ4A 2LIPA 1ZA2A 3O7MA 4RVSA 3TQQA 5JARA 2PSSA 1XN1A 3ZCSA 3P45A 2GESA 4HX5A 1N5OX 3KQLA 3HUDA 3TINA 3VNAA 2R7AA 2W2XA 3E3LA 4QGBA 5FUWA 3LKBA 4CG1A 2D5CA 3CR3C 2QAGC 2GR9A 1FSFA 4W9NC 2JIMA 2PRJA 3JQRA 4IQGA 3OF3A 2W71A 4A5SA 4Z3KA 4I1UA 3N6RA 3UT6A 2IYPA 1RBMA 2C9MA 4E4YA 3KXIA 2AE2A 3IBGA 2A84A 1EWRA 3M70A 1YIDA 2IQ5A 3TTYA 3K72B 5MGBA 5A4MS 4U7PB 3NOQA 4OHOA 2JFOA 2YASA 1T1SA 4GVPA 3KOZA 3PR3A 2Z8YA 3MQ2A 4PC6A 5ENZA 3NO4A 3P2JA 5LXTF 4BNFA 1KARA 3QQ5A 5K0LA 3SC2A 3DP9A 3DUWA 4PZPA 3WO1A 1APBA 4L95C 4ZCMA 4G4GA 3MWDA 3O1IC 3RQIA 1RZRA 3QXSA 4OQQA 4BLOA 3KUDA 2QJOA 3HMQA 1RYBA 4OX9B 4UBIA 3HK2A 1JSLA 3RRZA 4CT4B 3L7YA 1QJ4A 1WHTA 1IBSA 2VF7A 2QLFA 3A27A 1Z5GA 2E89A 3C4VA 2WK1A 2WIFA 3GB9A 4J7UA 4NJEB 4PRLA 1TMOA 3KFVA 4GRAA 2BFDB 2B7LA 3AUJB 5L4NA 2OFXA 1JSCA 4KQJA 2WE7A 4KREA 3AJAA 3HCWA 1O54A 1R00A 2ASEA 4AJ9A 3IVMA 4OX9Y 1E6KA 1RM5A 1H0RA 2QSJA 4G5QA 5F2EA 2ASVA 3OM0A 1Y5MA 3U5TA 4Q9KA 1E1CA 5L53A 3EBPA 4W5RA 3AVPA 5CDUA 1VMEA 2W2NA 4TV8A 3JAWA 1N5IA 3TBFA 4MW7A 1OTHA 4TRRA 2ECKA 1H3NA 5EP1A 5KVCA 2BM0A 3KQWA 4N3AA 2O2IA 3W2TA 3KVYA 4EB8A 4D6XA 3SMQA 1T43A 4PNEA 5HJ5A 1JB1A 2DEUA 2E21A 1AE1A 1GGFA 2P78A 3EASA 3OPYB 3PE3A 4H7FA 4BO2A 3VBCA 4EAAA 3FNHA 1NAHA 2C2KA 2ATEA 2AXEA 3EDCA 1K92A 1M0SA 1EUCA 3HVUA 4JLUA 4NATA 4CM9A 4D9EA 2W9XA 1T15A 1U9CA 4GSLA 5LP6C 3DKKA 3DOIA 4W6ZA 3EBOA 5IKMA 3VOBA 3H1TA 2GSWA 2AEEA 2FX5A 4MQEB 3VR2D 1E59A 5LNK6 4LSZA 4W5JA 1XNGA 2H8GA 7AT1A 3VZDA 3USCS 3UV3A 3V4RA 3KG2A 2FSFA 2A5FA 4UTRA 5ALTA 1OV6A 2AQIA 2B2CA 4WZBB 3RFFA 1SB9A 2FUCA 4KVFA 3TDKA 4AYWA 2C59A 4BMOB 3BGSA 2R8PA 1C2TA 3ZUPA 2PJRA 5E6UA 1BOOA 1GKUB 4LJ9A 2PRYA 4NS1A 4PANA 1UDBA 4Y2QA 4CIAA 1XUOA 3ZDQA 2DP4E 1GILA 1XMXA 2UUAB 5ESWA 2R0QC 1OPRA 4JU8A 4GGMX 1XTKA 3HDTA 2CDAA 4RS3A 5AKIA 4N65A 1SVMA 2EHDA 3HDJA 1Q0SA 3CTPA 3R0ZA 4TMFA 4MP6A 2PR2A 5LDDC 3DBLA 1A9PA 2D5BA 2BFOA 3G23A 3DUFB 3QK7A 4HD8A 4JKYA 1NT4A 4G0ZA 4FHFA 4MMXB 4CV3A 2YJ6A 3N2ZB 1R4MB 3SM9A 3AVQA 2JANA 3CUSA 4F3YA 3OIDA 2ONZA 5EWMA 5DHAA 4US2R 1MW9X 1YNOA 2X15A 1L7PA 2FWRA 3C8MA 2R79A 4M9SA 3EG5A 4M0FA 2X14A 4ND8A 3UK2A 4DEXA 2HC9A 3WZLA 1TRKA 5B1EA 1LBEA 3PTLA 1WHTB 1X7HA 4WKGA 5EZQA 2UYCA 5KQPA 1DZIA 4U7DA 3ROTA 3LA6A 3RIXA 3F5QA 1UOEA 3E48A 3SKVA 3AHEA 3PI7A 3UKJA 4RGYA 1F38A 3FSRA 1U3TA 3QX7A 3RTEA 1SQ5A 3EPHA 1V96A 4JQSA 4DC9A 4YCJA 1WAMA 3HFGA 1G7SA 1ZM7A 3B3GA 3FY4A 5KB3A 4PYLA 4YT2A 3VYRB 4NMWA 4Q9NA 3R6LA 4BWVA 3KXKA 2XRZA 4DJFC 2OD2A 2IBMA 3DMHA 1JMVA 1JDBB 2FRXA 3KM0A 4KXVA 3KLNA 1X42A 3MGBA 2NZ8A 1JG2A 1QFXA 1G2PA 3CISA 5FPYA 2BHTA 5DHTA 1T36A 4RQTA 2ZPTX 2MT9A 1I4TD 1RXEA 4N6OA 1A82A 1Z6PA 4N8SA 4W5HA 3RHTA 3TS1A 5J4VA 3PUZA 2FEXA 1UXJA 1RLTA 3QW4B 2V7BA 3A4VA 5HF9A 5CT4A 5JNTA 3R7WA 3ZWXA 1W0JD 1ULAA 3MTIA 1DCTA 2M32A 1ODTC 2J9GA 2QJTA 1P9LA 2ZUUA 4IBOA 1G16A 3AUKA 3KJZA 3QKWA 3LG2A 1Q1EA 5G1OA 2PK3A 3P2IA 1DARA 1NOKA 3CZCA 3V55A 3V6MA 2G77B 3EXFA 3TX2A 4JN6B 1CJCA 2PIDA 5HDBB 2X3YA 4II3A 5EINA 2VUTA 3TFWA 1U5BB 4JJKA 1EQUA 3NHRA 1VI5A 3EJ6A 3LDGA 4HB0A 3BHNA 4WKBA 4C4YA 1KMCA 2XGGA 1UXHA 5JZOA 4I6JA 1S4QA 1LC0A 4CI9A 5JFGA 1KBOA 3BWBA 1IUPA 4GI3A 3QEKA 4QJBA 2GK6A 4OL9A 2NO9A 4MJ7A 1E5VA 4ZOBA 5AXAA 5IFLA 1Z15A 3IMFA 2OBXA 5G1NA 4GOLD 4OFBA 1GGJA 1RPNA 3RF7A 2VTKA 3L8EA 4C3UA 2AR0A 3T5DA 2PKEA 3FDFA 1ULTA 2W0MA 2ZVPX 1MOPA 1JA9A 2NPIA 4PX9A 4MQLA 2W6OA 3MCAA 1U1EA 2E6UX 4J1QA 4DBLC 4F56A 3ND9A 1CY4A 4KYTA 3M4YA 1GPMA 1MU0A 4W9NA 3R44A 2ODEA 5BV0A 3ZVRA 2FW9A 4U5QA 3LF1A 4IOLA 1RFGE 2FUEA 1N6HA 4UMVA 4RD1A 3U3MA 5F3WB 5AICA 3HUEA 1OLXB 3U4AA 1X94A 2G0AA 1V7CA 3E5RA 3CJQA 3SJBA 3AOGA 3O26A 1KY5A 4KPGA 5H5JA 4I3HA 1T3HA 3BHJA 2ZJ7A 1H9BA 2OXFA 1BYIA 3W05A 1N0HA 5D7BA 2X4DA 3WDSA 1KPGA 4O2AA 2XKKA 1VDMA 2OP0A 2GFIA 2JDIA 3KLPX 5CAEA 2VNSA 4II2A 2PZEA 2C2GA 1RRVA 4ZQIA 1J33A 3UH1A 1IY9A 1E2NA 4HCJA 1YIAA 1AHNA 4QO7A 5FPHA 1AKEA 3ND5A 2YXNA 4KMMA 5CH8A 4TV8B 2B8JA 4QXOA 4FOOA 1AKRA 1YE8A 1HNXB 1EFDN 3E9RA 5I5EA 1YS4A 2HYIC 2CHQA 5D5PA 4L4XA 4NABA 4F3NA 4C5BA 3R24A 4PS1A 1ICIA 3OQNA 3X1JA 5M34A 3KQNA 1FFDA 3L7CA 1KERA 2X4LA 2YRWA 1WKCA 2BCGY 4AMGA 5HK9A 4FTWA 3L0CA 2JCXA 1KBQA 3BMQA 3KOYA 4TZTA 1CUVA 3ADCA 3VZSA 1BXKA 4L15A 3UH0A 1HTBA 1UBJS 4RKWA 2P2LA 1NOIA 1Y1LA 4MW6A 3ENVA 3ECCA 1OXSC 3HZOA 4P31A 3UJ3X 2AR7A 2V7XA 2VKQA 5AJXA 4BJHB 4BX2A 4DA6A 5J2TA 1WW8A 2ZTLA 1XHEA 1DQZA 4MWGA 1BMFD 4J43A 4AJ1A 2AKEA 2FPSA 3DF9A 1YAJA 5AI6A 4ZQHA 2BEUB 1QK4A 2QRLA 4MGHA 4N0EA 1AUQA 4LYFA 4WCVA 3OT5A 4JJEA 4XARA 1HQKA 1DB3A 2PFSA 3VKVA 2HA2A 4F9FA 3A6JA 3NEPX 3HYLA 3LECA 4ZOAA 1N78A 3SR4A 1CZLA 4C30A 1Z0UA 2VG8A 4UAUA 4G6ZA 4ZXFA 4ZRDA 4QYTA 1J70A 3PR2B 5IYZF 1D2MA 3O83A 4TXMA 4X0EA 4BP3A 1I1QB 3H1FA 1CKEA 1SVNA 3ECSA 3CUVA 3CKKA 1C14A 4KCGA 1M5RA 1MHTA 4R3NA 3CPSA 2I0FA 3MB5A 4ZI7B 1G8JA 2CLEB 4KC0A 3JPWA 3LTEA 3OD1A 2IUFA 3LUHA 1Q17A 4YP6A 4DMRA 1US8B 5BN5A 2BEVB 2F62A 3IJPA 2NUBA 3TNFA 2IH5A 2CYAA 3FVVA 2CJFA 5A9SB 3EULA 2AOXA 2DUMA 1TQHA 3JALA 5E6UB 3OSUA 3T8YA 1JG3A 4TVOA 1FCJA 2G1PA 3Q3HA 1T35A 2C2MA 1XZQA 4NBNA 1JP7A 1UT5A 3FF1A 5CYOA 1X13A 3HVRA 2QL6A 2Q49A 4UXIA 2VFAA 1ZOSA 4ARZA 1WVGA 1K27A 1JPVA 1KH3A 2HPAA 3HJUA 1BEEA 1ZVKA 2NVWA 4XWWA 4M53A 4HBGA 1RS0A 4HDMB 2QQFA 1U0BB 5BO5A 1S1MA 4QUAA 1WUIS 3HFRA 4OM8A 1ZLXA 3TZCA 3BS4A 4UFNA 5IJWA 3LC7O 1JTFA 4RFSB 2ZTSA 2A0YA 2R751 4LRTB 3W2FA 5HZHA 3L8YA 5LXTA 3IQIX 3V7NA 3ILHA 4MQUA 1V47A 1BDBA 1EAYA 1PQUA 3MJEA 1W36B 1ACMA 2QL7A 2QKYA 3SK0A 5AFSA 2WSYB 2QMQA 4X24A 2RHWA 1LNQA 1FX1A 5F9MA 4MVCA 5REQB 4OUDA 2G36A 1DRJA 2XVAA 4H3VA 2D4HA 5TGZA 4DHWA 4YX9A 1ZBDA 2PXXA 4RENA 4TT3A 2AMFA 5ESRA 5AIBA 3DZFA 3UEOA 2WMOB 2EQAA 2WTUA 3FOWA 3UMJA 4YT8A 1VJ1A 1Y1SA 4KQCA 5E0OA 3C45A 1SXJE 1HE8B 1Z13A 4RHXA 1M1NA 4MYRA 4U9HS 4WZBE 5JVDB 3TCXB 3T3HA 4PX3A 4F12A 4LDQA 4V3CA 1PJ4A 4K05A 5ELLA 3W3AA 4DARA 2G1KA 1B0UA 1G3IA 2Q3HA 4WI1A 1YZHA 3X3HA 2BMDA 4DUZB 1DFHA 4W8GA 4XJTA 4G84A 4FLEA 1KEEA 1HEIA 5HRCA 1WMEA 5DH9A 3CC8A 3BCRA 5DXFA 5CBKA 3BA6A 4AZTA 5E8JA 3N6VA 3NEAA 1LBHA 5CB8A 1YFLA 1XMQB 1B1AA 2OXRA 4AY2A 1K63A 1KZ6A 4M0MA 3FDXA 2BFAA 4AJKA 1NNLA 4P22A 1IMJA 4RK5A 5AK0A 2UZ1B 3LBNA 3C70A 2CCGA 4A8HA 1J8YF 1JQLB 4AQYB 3U81A 3FNGA 1SUPA 1D0VA 1RR6A 1LK0A 2QTRA 3GVCA 3TZLA 3F1LA 3GOQA 3H3JA 4CUZA 4JT9A 5GZ6A 3T0FA 4F5YA 1EE9A 3IKLA 5EUQB 3FPGA 5LB2A 4BNJA 5ALDA 2ZYIA 3GGCA 1EG7A 1FP7A 3DBHB 2ONCA 2JS7A 4FHEA 3O4HA 5B3LA 3GNQA 1G66A 3PFNA 1ADBA 2YZ2A 2NXJA 2CLIB 5JQGF 4GRIA 3TDMA 2YIMA 3LUBA 4IDBA 1GUZA 2MMCA 2YIJA 2CKMA 2Q6KA 5FXMA 2JI8A 2IYZA 1SPXA 1G1MA 3HB9A 2BP7A 3IALA 1SWVA 2FZ4A 2GO1A 1HQCA 2Y1DA 4DIBA 4Q4AA 5EPUA 4U7FA 3RYFB 2VPYA 2OQ2A 1C3XA 4FW9A 3UB2A 2XTZA 5ER6A 5AW5A 3BZWA 5E2IA 5DN6D 2XDAA 2CNOA 2BD0A 5IXJA 3S7TA 3KJQA 2QLLA 1GPLA 5DI3B 5DN6A 4JEUA 4E03A 3EDOA 1PO7A 2YV1A 1PQ4A 3E4CA 2BGUA 3HYSA 4Z0PA 3RU3A 1EGMB 1NJ1A 3ZDFA 1E9BA 1R10A 1VSBA 1YS6A 5C8YA 3LJKA 4JMLA 2AK2A 3FDZA 5ECGC 1CUYA 1GU1A 1XRNA 3E8SA 4QUJA 3LKZA 1MXFA 2ODWA 4V3BA 3WVNA 5KNCH 3DNPA 2NZUG 4FR5A 2HBZA 2JLBA 2I4RA 1CJTC 1G1AA 5KQGA 1U4NA 3Q3JB 3U1BA 1C7EA 1C4WA 3DFZA 3H1GA 3NVMB 3R9KA 5AVSA 1NRXA 3AETA 4IXTA 5E7IA 2EQ5A 5I9MA 4DQLA 5CFLA 4LQCA 2W90A 1ZR2A 3S28A 4XFJA 2P3QA 5DIFA 3H0EA 1OH6A 1SQ0A 1TLFA 5C8VA 2QZPA 2J6HA 1F4PA 1Y7TA 2VHWA 4EG5A 5ARCA 3TKLA 1M7BA 1AS3A 5HQ3B 4RK7A 3NALA 4GBED 2YMQA 4YRMA 1QRTA 1DOZA 2YXPX 1PR0A 1IQRA 1Q6ZA 1AU9A 4JLBA 2B8WA 4Q4JA 3L4BA 1RAHA 4UEOA 3ULKA 4CW7A 3RAJA 4DCNA 1FUIA 1M8FA 4OYYA 4UE3S 2YY7A 1CT9A 2VJKA 3T38A 3LHIA 1RCTE 3ZWMA 2ODTX 1WB4A 2ES4A 4UM5A 3V8RA 2GLTA 4IV0A 4YASA 1M2NA 3I9NA 1U2SA 3BICA 1D6JA 1BHO1 1G20A 2H57A 3CPJB 1E63A 3IQWA 3LV8A 1G20E 3NHFA 3EMVA 3T3IA 3ZHVA 5HXAA 3JWJA 2I54A 4PV7A 3HXLA 1MAUA 1OTYA 3FETA 3JD2A 2FUG1 3CR7A 4FCTA 1R5OA 3U9SA 2RCYA 1DTWA 4EGCB 4OK5A 4HEQA 2P75A 5JU6A 1LTKA 2ZJ3A 3RRYA 3FYCA 4RE6A 3TFOA 3R8FA 2QR3A 3WKBA 4C0JA 4CLHA 5FOSA 3NBMA 4RD6A 2OP1A 1A9TA 1NBMA 1C2YA 4KXWA 3IAM6 1W0CA 5H3LA 1OB2A 3QE0A 3L0IB 3N2NA 4R69A 1JKMA 1TUGA 1E2LA 1U0NA 2HFKA 2NQ8A 2Z1DA 3IHTA 3IJ5A 3HJBA 2MSNA 1KMHA 1GN9A 2PSFA 1VBKA 3C5WP 2QG4A 1B8UA 1K97A 1OC2A 3IIIA 4R31A 4G0WA 4GQBA 2EX4A 1X0VA 1XD2B 2FW6A 2YWRA 4CWAA 3OFSA 2E1PA 3DZCA 5A6VA 4ISCA 3R76A 1W36C 5IVHA 4YJ2A 3M6UA 2W98A 1CY0A 5JY6A 3HKCB 3RYFA 3GD7A 3O3NB 4JU9A 3SGLA 5HQ3A 1CR0A 1OXTA 2V3WA 4GLLA 3UWOA 4JLAA 5JCPA 3ESDA 3THXB 2BMEA 1VRCA 2FN9A 3REOA 2QZJA 4J4TA 1IXKA 3BA1A 2CJWB 4OFZA 4NV0A 1E1RD 4HG2A 5IBQA 1YS9A 2GD0A 3IUSA 4MYCA 3PLNA 4QREA 4Y2PA 1E5LA 4MYUA 3GLHA 5ALQA 5JYBA 1JW9B 5E6RB 5FTKA 3RUEA 4A8PA 1E8NA 2V0CA 1GJRA 1T1JA 3HRHA 3KO8A 4CV2A 2JFVA 2N0SA 1N9ZA 1YHYA 3KE8A 3MMPA 5FKJA 3W9BA 1QIKA 5IULC 1MV8A 4GSKA 5AI5A 1GZ5A 5AVYA 3FDZB 1TC2A 5C1OA 2F1KA 2X5KO 2A94A 4NKRA 3DEKA 4L5JA 5DPMA 5BUCA 1BU8A 4QQNA 2EARA 2NAPA 4M9XA 1TM2A 5A6SB 2ZT6A 1SKUA 4PLYA 2UVPA 4O4IB 5KYYA 3ABZA 5JDCC 3JQBA 2O05A 4F8JA 1P39A 2D0DA 4E0BA 1ZUNB 4LZWA 1H85A 2G17A 1XQXA 5SZIA 1B8PA 1Y8QB 2VZLA 4KQKA 4RM3A 5BUQA 3NP7A 4WZ6A 5CX4A 2C78A 2OZVA 2IXBA 3K9LA 2AOTB 3H75A 3WK5A 4C21A 4UREA 3RJ9A 1SA0A 3O73A 1V1RA 1US8A 1WXHA 6NULA 3QKRB 5E4FA 4ZCTA 2ZAIA 4IIGA 4EJMA 4XAQA 2ZSHA 1DIGA 3C4JA 4Z5XA 1W88A 4RDXA 5JHGB 3SQNA 3ETLA 4BGVA 2KPOA 3N58A 3SR3A 4CM7A 2Q5CA 3AR7A 3MELA 2D2EA 2ZI7A 3EGDB 2WSLA 5FFMA 3UQZA 4ALIA 2O8EA 1L7VC 4ENWA 4X8MA 5K3FA 2PFGA 4E2FA 4EKGA 4BNLA 2LRHA 2V7VA 1AKYA 4C0HA 5TIIA 1LVHA 1H2AS 1Z17A 3NEYA 2Z4RA 3OUZA 4PO8A 4X1YB 3PGJA 4PSDA 5E38A 3U7QA 3USES 4L5CA 1CVRA 4F3CA 1QBGA 2G5TA 4KSBA 4PPQA 1QO0A 4OHRA 4HPJB 3RYIB 5TVKA 3UICA 5HIIA 3OO0A 2ZRMA 3DMPA 1L5KA 2REOA 2BLNA 2XPCA 4JEHA 3ONVA 2GHIA 3OJOA 3L7AA 2CMKA 4ND5A 3VR0A 1GNRA 4IIEA 4LZJA 1D1QA 1X15A 1N7IA 4FJ2A 3UK7A 4NJMA 2QY9A 3IDAA 3LNTA 4PC2A 3ZWNA 4IJQA 1MIOA 1UODA 2HA6A 2VXYA 5AKYA 4BNXA 1PL8A 4L27A 3MQ4A 3WK4A 1IZ7A 4UBOA 4Q47A 1GFWA 1TL7C 2JGFA 3PNSA 4GAEA 5JOQA 2XITA 3SVZA 1UC9A 3NASA 3HXPA 3MFYA 2ETXA 3NOOA 4GF5A 1H05A 4DIMA 2JIZA 3K92A 4CMHA 5AQEA 1A9ZA 1QG4A 2CNLA 2GVNA 1S4MA 2ZYSA 3BWEA 1AKQA 2JKYA 4RH3A 4DGQA 5JVDA 3O4VA 1KS9A 3GZJA 5ALEA 4KXNA 4CF5A 5IHXA 2A7QA 4D3XA 5KC8A 2PZFA 3R5HA 4W9MC 1DHRA 1KR5A 2LPMA 4J16C 5EIBD 2H54A 2PTHA 1D2AA 1E5QA 2O8FB 1OWNA 1X1EA 2PUHA 1U7WA 2C61A 3OSZA 3VR5D 3VUFA 2AJ8A 2ZE7A 3S2IA 1HRKA 1UZUA 1Y1TA 2OQRA 4OIFA 4YGXB 4PCUA 3KRTA 3O3MB 5DCUA 1G9TA 4BQOA 3TE6A 1CQWA 4N3CA 3RANA 2GWHA 3ZNNA 3SIWA 1FK8A 1F6BA 2A67A 4KZPA 2ZUEA 3ORYA 5ULLA 2FMIA 1S2NA 1FQKA 1GIAA 1NQWA 2A86A 2R5FA 4L08A 5DI9A 1G8SA 1L4UA 2DR3A 4GKBA 3TXAA 4D3YA 1X7YA 4YMTA 2ZYTX 1MP0A 1DVRA 2LKCA 1ODIA 1XMSA 3WL8A 4F2PA 6REQB 2BI8A 1W85B 3V4ZA 1QDEA 3VH2A 2R6HA 3FFTA 4M0UA 1V8BA 3JRXA 3NXSA 3PXEA 4RPKA 3Q0EA 1WMFA 2RHJA 4PIVA 1R0ZA 3O8OA 3KL4A 3CVJA 1JEDA 1PFQA 3MWLA 2OGWA 3CX4A 3QQPA 1E1LA 4DANA 3ZY5A 4PLGA 4Q1FA 4JWKA 5F76A 1FDSA 3IAEA 5DP1A 4B33A 3DNMA 3RVRA 3UJ8A 4ZO6A 4CF4A 3ETCA 1Q0TA 2UV8A 4LZAA 1IJBA 3GJ3A 4X1YA 5J2TF 4ZZ2A 4RH0A 1PEAA 2VT3A 3I9OA 3PVZA 4BFVA 4O4JF 1U80A 3V8MA 4MKIA 4DQ0A 3WNVA 5K8UA 1ZK1A 1G7TA 2RBGA 1QRUA 4I4TA 4WNAB 1O94D 4BWYA 1LD3A 3FIUA 4NF2A 5ALPA 5AK4A 4J0FA 2QRVB 1Q57A 3DMYA 1KJYA 4OI4A 3DE1X 1OHHA 3TLBA 1ZGGA 3CVYA 5DYGA 4AXBA 5F52A 5FFFA 1YKFA 3VR4D 4AAYA 1XC7A 4MO2A 4P32A 5E2AA 3WNCA 1Z8NA 3PDUA 3GPLA 5LP1A 1JKFA 1PJRA 4TTRA 3FCCA 5C8DA 1D9ZA 1V2GA 3GJ6A 1RT9A 3OIUA 4MZXA 1SEVA 4PLZA 5AI9A 1T4CA 5KNCA 4X20A 2J0QA 1X2EA 3KQHA 4JB2A 2PFKA 4FC6A 3FDJA 1E1RA 2BMFA 1XP8A 2ZYRA 4GDFA 1P18A 1I36A 3B1XA 2XUIA 4DG9A 4C7OB 1WM1A 2C0PA 5BNIA 5G1PA 3VYVA 2JLZA 2FEMA 1ITZA 3IX7A 1E60A 4L6AA 2AG6A 3PUVA 3TNDA 1B3BA 5DTQA 5B1HA 3RAFC 1ZWKA 1N1DA 4DCVA 4RFVA 2ZKLA 3K20A 2GFHA 2H9YA 3QBVA 3KJIA 2Q28A 1EVKA 1UFOA 3D2BA 3MEQA 2XB6A 4P3KA 4TTPA 5CU7A 2WJYA 5K3AA 3N07A 4QVKA 1DQYA 3U3JA 2QR5A 2KB0A 4UC0A 5BWNA 1GNSA 1RJEA 5ENDA 3FI9A 1UK6A 1PLLA 1VCNA 5EFOA 1YJAA 4N8DA 4B5KA 2VJPA 5K8IA 3ESBA 4O0LA 1LU9A 1ORRA 3OOYA 4B17A 3T5PA 4LRYA 2NO4A 5BQPA 4W7SA 2DCUA 3HHEA 5TF4A 3BZUA 2A1TR 1UJNA 5I8ZA 1J0EA 4HDNB 5LPNA 3U4QA 1T2NA 3FLMA 3WSVA 2HRDA 3VMFA 3R09A 4ZQFA 1KWGA 1VCHA 3D8HA 3SXUB 3KR0A 1LDYA 1AKNA 4ZCPA 3VR1A 2PV0A 5KYUB 1CETA 1H0KA 1XCPA 4WK0B 1WP9A 4G0XA 4EMTA 1AN9A 2A9RA 1LX7A 4KGZA 3R7WB 3SQWA 1QFMA 1DAKA 1I3CA 1K66A 2WM9B 1AXRA 5E1OA 1BJRE 5KI6A 4F4JA 5IFKA 1AQNA 4YAIA 2WMDA 2CD9A 4JIGA 4Q3DA 3Q9NA 3FIJA 4UTOA 1W1IA 5AR1A 4EAQA 3VRHA 3IPCA 4MGEA 5K2MA 3S2FA 2PBRA 4UCWA 4YRRA 2AW5A 2HFJA 1ZEJA 2RH4A 2ZSBA 4GL4A 3M83A 3HR4A 5E3IA 3WGLA 1WXDA 4ZYLA 1MVOA 1WOYA 3KTOA 3AHGA 4R1LA 1A9QA 1T8UA 3L40A 2JA1A 2JF0A 3ENNA 3QVUA 4MUHA 4ZDIA 4CEHA 2XNHA 1E1NA 1RW4A 2LP4Y 5FBZA 4KAAA 5BN4B 5CA1F 2QRJA 3D02A 4E2WA 4F21A 4YDQA 2F00A 1IG3A 3AVYA 3ZGYA 4EABA 2H1SA 2DKNA 2LW7A 1E2JA 3PRKE 4E14A 2CNWD 3NDPA 4BNNA 3LU1A 1DMSA 1P7CA 4KXQA 4UOQA 2VXCA 1CE8B 4QL3A 4C7MA 2B4QA 2V7GA 4RQUA 4C3OB 3C0KA 3IBYA 3UBTA 1BO6A 4PYKA 1W52X 2PQ6A 3F5FA 4G4IA 4JP5A 4OQZA 5DBEX 3A6EA 4ILEA 4Q3OA 4HWPA 4OBXA 5IPFA 2PO5A 3R6DA 4TLAA 1KZ9A 1EDBA 2IHUA 2Y6VA 4PPGA 3TRFA 4J0EA 1PD1A 1T3TA 3R4CA 1BEZA 2IVFA 1DEHA 1PK8A 2R96A 3HLYA 3TWOA 5FYQA 1CY7A 1OPXA 5T57A 3TTUA 4A1FA 4BASA 3GRCA 4ZU3A 2YJ4A 1E3LA 2HA5A 3R7LA 3BJIC 3R3XA 3R9WA 2ZI5A 4XR9A 2BFDA 2I7TA 1YS7A 1ZXXA 3ZCVA 4ZZ1A 2A0FA 4V0OA 3EZYA 1K8XB 3G9TA 2IUUA 3HCNA 5IT0A 4CR7A 3C3JA 4ZEOA 3QVJA 4UQPA 3VAAA 4HRAA 4N7JA 2NOAA 4D0NA 2ZTMA 4UVEA 3J81A 1R15A 1E89A 3MN1A 2F1JA 4XASA 2C96A 3LUCA 2Z4SA 2XUAA 5AMXA 2XYGA 4DGSA 5ARBA 1E18A 4LRSB 4QNNA 3D3EA 1PFGA 3IKJA 2FWBA 4QQFA 3T54A 2JVJA 4KWIA 4MW2A 1KKLA 2JFWA 4RK6A 3AHIA 1ENZA 2OO3A 1U0TA 2GN2A 4PQGA 3P19A 1PN3A 1RWXA 2FUKA 3S2SA 3N2GB 1VLMA 5C3UA 1R18A 1G7CA 3QWAA 1HTWA 1T9DA 2QD4A 3T1HB 4HVAA 5ICEA 1LNZA 2BMWA 1N9KA 4K9LA 1JQDA 2PX5A 4B5LA 1TYDE 1CUDA 1J9ZA 1Z0KA 2C7RA 2GJSA 2HUNA 5HFAA 4DAEA 2NU6B 4WMLA 3EB9A 2PS3A 4YJKA 1QS0A 2Q1TA 1KOFA 1MDFA 1NWHA 5I9TA 4S2EA 3UOAB 3JQ8B 1HG1A 2NU8B 2JKVA 3WWOA 5CCBA 3L92A 3PVSA 1NF8A 3QWIA 3WIDA 1OREA 5F98A 1PR1A 2NO7A 4U2CA 4FEYA 4LA4A 1KE2A 2DLDA 3B1ZA 1V4BA 2BEWA 3H17A 2ZUVA 5ALNA 3R7BA 3VSBA 2F4VB 3SHFA 1HM5A 1W5AA 2YYZA 2EFJA 3CCBA 1TEHA 2GK7A 2JD1A 2FYTA 5IKOA 3WXMA 4R2LA 4YMSA 5B2EA 5ARDA 3X1MA 1ADGA 4Q4CA 1QX4A 3Q7TA 3GVHA 5M7EA 3FTFA 4CRWB 3K15A 3E3MA 2EW2A 3M9WA 1ZN8A 1XVUA 2NTVA 2D2VA 4JP8A 4KK3A 1ESDA 4O0MA 4XX1A 1OLOA 1ORHA 1IQUA 1BDMA 2QZ9A 3V9PA 4CR6A 5MFPA 4DS3A 1RCFA 3KEMA 5JSZA 1R9JA 3GJQA 2VPQA 2R8BA 4N12A 1J8DA 4OLAA 1WTAA 3D4BA 4JMPA 1CF2O 3ROGA 3KX2A 4V2IA 5B64A 2GCGA 3KBBA 4GX1A 4WLNA 4ANFA 1RTKA 2DFPA 3ESCA 4P4TA 2EWVA 3WA7A 1U6JA 3K0FA 4ZDWA 3JX9A 2G1JA 4TVBA 2A92A 2MYUA 1ADJA 4J3JA 2BCEA 3RSHA 2F3QA 1GRNA 5COAA 1OKKD 1S8NA 1DC5A 4JFAA 1C3EA 1CY8A 1DKQA 3T4UA 4QUEA 2CMDA 3GRRA 1FEZA 3MQFA 1JLMA 3F6YA 4NX2A 2P4SA 4ENQA 1LSJA 1O3YA 3LX4A 4KACA 2PS1A 1JR4A 3B8EA 4IHAA 4U1RA 2C8KA 3W6UA 1R5NA 3KZMA 1NP6A 2Y0BA 2IU0A 3C43A 5EP4A 3ER8A 2DM6A 3C3DA 1EVQA 2CLMB 2PH1A 1A0OA 1QHYA 1QS0B 5LXTB 2FMHA 2OV2A 1PSDA 4X61A 5CEEA 2XF8A 3NIFB 4KG7A 3V6LA 2JD2A 4GEGA 4CFSA 1NVXQ 3FTEA 4U7JA 4YLYA 5HKKD 3H6GA 5LB4A 3E3OA 2CY0A 2KE5A 4TUYB 1Z7BA 1PJBA 2C84A 3HG7A 1NI5A 3NFRA 5F33A 4BNKA 2DHDA 5U1PA 3JQ7B 3IOBA 5ER9A 1DL5A 3PYLA 2NV6A 4M3NA 2O19A 3DXFA 4OA5A 4PC1A 2CLLB 4OU4A 4P4NA 3F78A 4S1TA 1IN5A 4EARA 1N6IA 4EB3A 3Q5DA 3DD5A 1RXYA 1RKXA 2XXBA 3LNCA 4L3VA 4AMUA 3AUXA 3P2EA 4CCWA 2A3RA 2J1LA 1NJ5A 3A4NA 2VAWA 2QN9A 2VJCA 3C8HA 3EUEA 4GM0A 1TNDA 4WCFA 4X60A 4Z1MA 5J1SB 4XX0A 1C9JA 2XEDA 3IA2A 3UAVA 4BU1A 1H8EA 3G3EA 3JYQA 1SU8A 3EZLA 5A4FS 4H08A 4FW8A 5D2CA 3O4FA 1QCDA 3JQ8A 3UT5B 4U7GA 2PX6A 1GGHA 3IP3A 4Q01A 3IB6A 3GJ4A 4ZCQA 2DWPA 2A33A 3I1FA 3Q7PA 4JB0A 3VMMA 1F51E 5FDFA 1Y7PA 2HMUA 2MR5A 3NOVA 3NT5A 4OYHA 3AZOA 2NMVA 1KJWA 1T2AA 2O7QA 4ACAA 3WY9A 3W78A 3FF4A 3HABA 2B8TA 5IDXA 4Q0MA 4X97A 4FHCA 1GP2A 1MAWA 1YZKA 4PSVA 1TFUA 2KW5A 3ZHUA 1TVEA 3E9YA 4GX5A 2QTBA 1HDOA 4U7TB 2BM9A 1XEXB 2IOHA 2W6JD 3GT4A 2OENG 3H0KA 3MJHA 3NJ8A 4UCQA 2ZM5A 4D7AA 3MJCA 1EDZA 1J39A 1IAQA 1TYCA 1YI1A 4NZMA 5IAOA 3GGGA 1EGVB 1GEEA 3U1TA 1WXXA 3AY3A 4CM4A 3GMIA 4MKXA 4C2AA 2H0AA 1X38A 2GFQA 1EFPB 2J0VA 2P4QA 3FLAA 1VFNA 1Z4KA 3I2YX 3I04A 3LT4A 4UAVA 4RIHA 3DH0A 2BW0A 2F3RA 4MJXA 2EEZA 3FMGA 3AKZA 1IOLA 3WGQA 1G42A 1OI7A 4MB6A 5CT8A 2NNWB 2UZ0A 5AHXA 5FYDA 1FFBA 4PZEA 5KSYA 1YB7A 4FT4A 5I45A 1E6LA 3MMZA 1L5YA 1FDVA 2PT9A 3NTQA 4X7MA 3M6WA 1BA2A 2JJ1D 2FMXA 4R2IA 1FFWA 5D6NA 4EO7A 4S0XA 3D0OA 2YY6A 5FOUA 5KTNA 3MPUA 4WXHA