1FS6A

Glucosamine-6-phosphate deaminase from e.coli, t conformer, at 2.2a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility, an essential component of the allosteric activation in Escherichia coli glucosamine-6-phosphate deaminase.
pubmed doi rcsb
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
molecule tags Isomerase
source organism Escherichia coli
total genus 97
structure length 266
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fs6A00
3LHIA 4TM7A 3E15A 3KV1A 1M0SA 4L50A 3ENVA 3EFBA 1HORA 4OQPA 1UJ5A 3BXEA 4L51A 4GO1A 2F8MA 1FRZA 3BXGA 1NE7A 3HHEA 2RI0A 2O0MA 3ENQA 3EB9A 1PBTA 3ICOA 3CSSA 4R7TA 2RI1A 2OKGA 1LK5A 5HJ5A 4M8LA 3NWPA 1CD5A 1LKZA 4R9NA 1UJ4A 4NMLA 2R5FA 1KS2A 2BKVA 4L4ZA 4TM8A 3IXQA 1XTZA 1HOTA 1VL1A 3NZEA 1DEAA 3HN6A 4L5IA 3BXHA 4OQQA 3BXFA 2J0EA 3ENWA 1FQOA 3L7OA 3UW1A 2W48A 3LWDA 1UJ6A 2GNPA 1FS5A 4GMKA 3TX2A 2BKXA 3KWMA 4IO1A 1FSFA 3OC6A 3E7FA 1LK7A 1FS6A 3U7JA 4L4YA 1O8BA 1JT9A 1Y89A 3CH7A 4L5JA 4X84A 2WU1A
chains in the Genus database with same CATH superfamily
4RVDA 2EBWA 4WCFA 1RXCA 1SG0A 4ND3A 4F11A 3AUKA 3Q15C 1DIRA 4G5HA 4HWTA 5HK9A 4E70A 4E2FA 3NWBA 1YZTA 3I5MA 3FCAA 3MILA 3LTNC 4ZO9A 1NAHA 1PCXA 3FD8A 3GPBA 4PO3X 2HFJA 1R0SA 4XH9B 4AN1A 4RANA 2OWEA 4EJSA 4I50A 2FZWA 5EHXA 1U0LA 2IYVA 3B1FA 3IPXA 1GGFA 1VJ1A 2C9BA 3BCRA 2Q3MA 3JQRA 3LDHA 3RSCA 4JBGA 4D5GA 5KKCA 2QM7A 3MS2A 5EUBA 2QLMA 1ATIA 4JKOA 3KG2A 1YK1A 2XUOA 1VC2A 2IP4A 3JAWB 3R4CA 3ROGA 5CAEA 2F9LA 3WK7A 2V6GA 2BY4A 1Z0SA 3IE0A 4L4SA 2FW9A 1KORA 1A4RA 2JCSA 1DAIA 2XCIA 3EH1A 3QLUC 1QYCA 3GZTB 3L4EA 8ATCA 1JVBA 4N7RA 3UMVA 3SQDA 4Q1EA 2JCVA 5BN4A 1TYCA 4OYYA 4Q5IA 3UWSA 4C4RA 2OCIA 4OGFA 4FGZA 3CRNA 3E22A 4TN1A 2PGLA 4X8MA 3IDQA 3TGWA 4B81A 2XZTA 3DE2X 3IBFA 2G5CA 4G81A 5KYTA 2ZB2A 1L7NA 1LWNA 1GUDA 1JTVA 4RTMA 4M4SA 3F2IA 4U1RA 2PV7A 3EXEB 2BEKA 4URWR 3I6MA 3VYTB 3S8YA 3QE3A 3FFBA 3TOSA 4L57A 2XUFA 1YR7A 4YAFA 1G9SA 1RJ9A 1TAQA 1IM8A 5KSZA 4IDEA 2EIHA 4IYJA 5CIYA 5BVGA 1CE8B 2CLLB 3ONVA 4AM8A 4FEGA 4URZR 4JYZA 1KTVA 4RC9A 1ZHOA 1PDVA 3VDMA 3VV3A 3BH7A 1Y37A 16PKA 1BKYA 1HYHA 1P2GA 1K88A 4RLSA 5IMBA 1BFDA 1MVNA 1EX6A 1HYQA 1XP5A 3BDVA 4YJ2B 3W6PA 5CB4B 4JXXA 1Z28A 1QP7A 2IY9A 1V37A 1GY8A 2QTGA 3D1LA 4I9NA 4MEBA 4PYQA 3NIBA 4QDJA 2FQ1A 4DMHA 4AT1A 2Z2JA 1IQPA 1N57A 1Y9EA 2UZ1A 3C43A 1MG5A 4YP5A 1NG1A 2ACKA 4FJ1A 4LYGA 3KJQA 4BO2A 4O4HA 2Z9BA 3FH0A 4ENUA 1ISSA 3EA5A 1E58A 2H4ZA 3WJ7A 5K5EA 3LV8A 3MWDB 3Q10A 5TQJA 1P2UA 3BMCB 1Y6QA 1PYDA 1DRJA 1MZVA 1I2BA 1QH9A 1O4VA 1OZFA 5DI3B 2X9LA 5G4LA 1W35A 2Y67A 3QSGA 4AS3A 3RARA 3ORFA 1ETUA 4QUBA 5FPTA 3U4CA 3GGGA 2FHPA 3U48A 3EQ2A 1XK7A 2DSNA 3ME5A 4LY3A 1E1YA 1ZM9A 1Y82A 3MN1A 2CYAA 2N46A 3L0BA 4PX9A 1JJAA 2F62A 2LWIA 3O82A 4O3MA 4WE3A 2G77B 5ALXA 3S68A 1B6TA 5EJ7A 3LU1A 1KKUA 5TJHA 2WWVD 1AKMA 3LLSA 1L5FA 1L5HA 2I2CA 4RTJA 2YH2A 5CYOA 1ELOA 5BW8A 4YCNA 2O54A 1SC4A 3C3EA 4HH3C 4P7FA 3H4TA 1XX6A 4DMMA 2LPMA 2SCUB 4D4KA 1W0JD 1VL8A 4QWWA 4C4AA 1NX9A 4ZV4A 2QRGA 1PRYA 4H4EA 1ODJA 5FX2A 3L04A 3ESRA 3TW8A 2ZUUA 3BFVA 2AKAB 4UBOA 4EVQA 4U2BA 1NW3A 1QS0B 4MSUA 5CTAA 3L8CA 4NFSA 2VL7A 5HZKA 2Y4NA 1M2GA 5HKKD 3NDIA 3RUIA 1SFRA 2AN1A 3Q6IA 2RE8A 2DWQA 5BSUA 2PGOA 3T4EA 1PE0A 1Y3CE 3MJRA 1TO1E 1RI3A 2QY9A 3DULA 3R5JA 4XFKA 1HEYA 3JXEA 3L7BA 1Z4KA 1IPFA 3HDJA 2Z6QA 4JP1A 1LDBA 1PP4A 2VTBB 1Z82A 1KEEA 5HILA 3S2ZA 3C1UA 3RH0A 3A4YA 3LXRA 1B6GA 1TC1A 3AYZB 1M2FA 3FNFA 3FPLA 3KK0A 3L07A 4CHTA 4K3VA 4PN3A 3HPQA 3ZE1B 4NU6A 5E9JA 4EATA 1H8EA 2KSQA 4B3BA 3INRA 1IUOA 2GVZC 3QELB 4J91A 1BXKA 3VU9A 2KB0A 3DV0A 1FSSA 3TG2A 1KL7A 5KYWB 4AY2A 3DKKA 4EKDA 4RLHA 4DDHA 4B3MB 1Q17A 1QZUA 1KI7A 4PHGA 5DWDA 2P2GA 3LFUA 3IFSA 3BORA 1E64A 4JLVA 1GQSA 4MP6A 3EUEA 3IELA 3K0KA 2X41A 2W6MA 5JZMA 4P4NA 1JEAA 1C81A 1YRLA 3ZW7A 1DX9A 2NG1A 1NW9B 2HA0A 2PLRA 3C6XA 3E5RA 3QUAA 4ZXFA 1WP4A 3SHQA 3TSZA 4LK3A 2VNSA 5LYJA 4ACAA 4FI3F 3H1GA 4TMXA 2K7FA 4I4TB 4Z1MD 4GT1A 1QIKA 1Y81A 4ES6A 4EEXA 1U3TA 3OPXA 3FFTA 5KQPA 1JVSA 4WA8A 4WCVA 1R4MB 2WPDA 1P9LA 1SAYA 3E9ZA 4HY3A 4ZYWA 1VJ5A 3G9XA 4K3UA 3EEOA 3IEPA 2Q45A 3PZRA 4M3NA 4NCKA 3DFUA 2Y27A 3V97A 1F4VA 2DULA 3MTQA 3R75A 2OQIA 2RCNA 3RDPA 2XVXA 4BVHA 5IM4A 3B3JA 2G6TA 4F21A 4KU4A 5LOVA 1P74A 1IL0A 5E0OA 1XCMA 2OD2A 3OFSA 1M0TA 1WSBA 5KYVA 3SYRA 3WDKA 2WG0A 3V2IA 4BEWA 3UW1A 3BM5A 5LNK6 2HU8A 3JSXA 1RKQA 1UC9A 1JMVA 3R5HA 2UUPA 2XXAA 1C1XA 1LLCA 3Q8XB 4M37A 2PWPA 4TYQA 1NI4B 2CL0X 1LXCA 2XWBF 1E99A 5HJ2A 3K0CA 4GP6A 4DJ5X 2P3SA 2QI9C 3W2IA 4WY8A 4E1VA 5BYAA 2IOQA 3O8OA 1W36D 1CEEA 1YB7A 5LXTA 4K8RB 5DX8A 1J1ZA 5H7XA 3GZJA 4RA6B 3EOBI 2C5AA 3MUFA 2EZ8A 4AULA 4Q4CA 4WERA 1KDVA 1LK7A 3VR3D 1A96A 1I14A 4KLNA 3BL5A 5AH0A 1WW2A 1Y3IA 4MOWA 4PCVA 4M9ZA 4YLGA 1JR3D 4P2GA 3LL7A 1NYQA 5G53C 5IMSA 3VR4A 2WDPA 1AKEA 4A8HA 4GM0A 3D7LA 3IGFA 4YGYA 4RTNA 4GE0A 5JAHA 3GUVA 3LC1O 1CT9A 4XYLA 4C0WA 4F9FA 5LZ7A 2W2NA 1LTKA 4PBRA 3KP1A 3NX4A 4FLFA 3HFRA 3DQQA 3IQGX 2ICAA 3CINA 5I7EA 1F2VA 2GN2A 2C2YA 2RARA 1NSTA 5JZSA 3KKZA 2W70A 1MO3A 1WXGA 5IULC 3MFYA 2NTNA 1SGWA 3M1AA 4IGAA 4U7GA 3VQTA 4PWYA 1KVTA 1QDUA 1G2QA 2YMLA 2CJPA 1RXEA 4Q15A 5TJ9A 1XNQB 3NHPA 2HEGA 3PFFA 5C3UA 4B31A 3PPIA 2JGEA 5D3ZA 3CONA 2FNAA 1ZPDA 4A6DA 3KKQA 3LUKA 3U3MA 2C9YA 5C1IA 5D2CA 2HMYB 2I2DA 5TY0A 1LFDB 1RAGA 4AMVA 4RNDB 1I4TD 4ZEVA 3EN0A 2GAJA 5BUSA 4KGXA 4QU9A 4M1TA 4OJTA 2XVZA 4TV9F 5FOQA 3WNQA 2HU7A 4NDZA 1OH6A 3CZPA 3IAM1 3EW9A 3GJXC 1G5PA 1USWA 3FJYA 4ETWA 3K30A 3G0GA 3SM3A 4MLZA 4BEVA 8OHMA 2FPXA 2GK6A 4CQMB 3ADCA 5AOBA 1IZ8A 4HYQA 3Q41A 3CLTC 4L9RA 1M1UA 3G5MA 3ZGOA 5I9TA 1L7RA 4PQFA 4I08A 2O7QA 4TL8A 721PA 3GHHA 2AD1A 3CNEA 3PVSA 4NFYA 5ADWA 3B5EA 3R7DA 3R4VA 3DBLB 4O4LB 2ZSEA 4TV8F 1E4OA 3SHVA 3TL6A 4X60A 2QZ9A 3WLAA 4BY9E 3CTMA 4TLDA 4BBAA 2JGIA 5DX0A 3L92A 4YNBA 3WGQA 1Z88A 1N2IA 4KPUB 3WLTA 1H8HD 1E6UA 1FU7A 1LW7A 3DDCA 3EX7C 1H1LA 3CF6R 3R7SA 1T2EA 2NPIA 2QV7A 4ESOA 2I3ZA 5DHSA 2RGEA 2XA1A 1N2ZA 3H19A 1P1BA 3M6LA 4FONA 3QEOA 4MQFA 1ZG3A 5SY4A 5TPZA 4DBLE 5BV8A 4LYFA 4HAIA 3U3RA 2UU9B 1VB3A 3RC2A 1I3KA 3IQFA 1P9WA 3DVLA 1W29A 3S2YA 4Q3BA 5DX1A 1OCEA 1I2MA 1FCJA 4UMDA 2QORA 2Y71A 1XCLA 1N1GA 5SYMA 3WGYA 4B6FA 1NOKA 3TW0A 5JPCA 3SJUA 4OLJA 4N9QA 1Z7YA 2X2OA 3BIFA 4YS6A 5EEGA 2V6IA 3S1SA 1CG6A 1M2HA 4LGCA 4XGQA 1UKBA 4TWRA 2NZJA 3D7NA 3LWDA 1H6CA 4PZLA 5B3KA 3DFIA 3BJEA 2A58A 5EIEA 2CE2X 3F6YA 4RIGA 1GL3A 3W7AA 4DCUA 5IWAB 4DG8A 1GTRA 2JFGA 1HE5A 2NAFA 2YVQA 2HRDA 1TCUA 4BP3A 2ZBPA 1M8GA 2DPHA 1N8KA 4R1TA 4J1NA 2Z1MA 4KN6A 5DXAA 3K9HA 1T8WA 1H2AS 1K5DA 3D3JA 5K05A 4MDEA 3KBOA 3LLCA 5FPQA 4MUAA 3IUBA 1FA9A 1DUVG 4FJ0A 5EXEA 5IANA 4WZAA 4MPTA 4R2JA 1ODTC 4Q1FA 1DGQA 3CFYA 5CA0A 5A5FA 2I8CA 1WETA 3BTOA 1E0AA 2E87A 2GM9A 2ZAYA 1WXIA 4MGZR 3TKAA 1HLDA 1BFKA 3KSDO 4MAAA 4Q02A 2WF5A 1FXWF 2ZVDA 3ICCA 4KACA 1FLDA 4TSRA 5CMLA 1ZCJA 2MR6A 5G40A 2R7MA 2HLNA 3CO0S 2HDNB 3ZIUA 4EHNA 3IO3A 2MTBA 5A3JA 1BN7A 3GLIE 3QLJA 2JLBA 1ZA2A 3I12A 3JQBA 1CVIA 2QYOA 1N33B 2OUIA 2DKNA 4LF5B 5FWNA 3RYCB 5JH7B 1QNFA 2XBMA 1QF7A 3B82A 2QRLA 2RGYA 5FLEX 3K70C 3LO8A 4CBVA 2CSUA 2NYVA 1X2EA 3G2QA 2BR3A 4MRMB 1NY5A 2QTLA 3PC4A 2G9VA 1RTKA 2GB4A 1YFKA 1JDTA 2BEVA 1N78A 1OZ0A 3GLIB 3EOZA 3LSYA 3JYOA 4QOIA 3H9JA 3LUDA 2YIDA 2ZJ8A 4XLLA 9LDBA 4J9VA 1XZQA 5AI8A 1DV1A 2HJWA 4RLFA 4H1TA 3IT1A 2PA3A 3FYSA 4N5LA 2P62A 1HMYA 4IIFA 4KLZA 3NC4A 1RW4A 4QJ3A 1P9NA 4OK6A 4R16A 5FI5A 3U4AA 1PJTA 4JNKA 4MQ5A 1QM5A 2BE7A 4B4OA 1XD2A 1CDEA 3IULA 3RTEA 2X5OA 3DQZA 2WAXA 4X7RA 1OKKA 3D81A 3RYFB 1VP3A 1QAQA 2UXDB 1OWOA 4JWTA 2YYSA 4JEIA 5FPSA 1N6LA 2BE9A 1IATA 1VBMA 3FNRA 4UNPA 2V58A 3BGIA 4ARZB 1PT6A 1T9GR 4M0MA 2V3WA 4X8OA 4CLEA 1E2BA 3VJLA 2IVFA 1IHPA 1RAIA 4HN4B 4V0MA 4MO2A 2RH5A 4X85A 2PZFA 3OEED 4OQNA 1K7SN 3SBOA 2QAGB 2BLNA 2UDPA 1H2HA 3WADA 3K9FC 2V6BA 5EZYA 1T5TA 1YB1A 4TMZA 2F4VB 3IDSA 1NVVR 1P1FA 1XRNA 1CJBA 2FWJA 1KJYA 2AZMA 3HCOA 1ZHFA 2I71A 3WL6A 1A8HA 3KLOA 4BWVA 1ZJ4A 4RBNA 5IAOA 3M6UA 2QTVB 5ALHA 5FCDA 1J8DA 1MXFA 2VK4A 2XX3A 3OZ7A 4AUKA 2QEQA 2BD0A 3B7PA 1ZVMA 3IJEB 4RK4A 4B82A 1X13A 2XA2A 1TYDE 5E6UB 3NOVA 3OF5A 4G8CA 2PD4A 1O95C 4GE3A 4KWCA 3TSWA 3V4SA 2YJTD 3T3NA 5F3RA 2P7HA 1YQEA 2ZJ4A 4X44A 1DTEA 4XEHA 3UMRA 4L3WA 3PQ4A 5KWJA 2Y0EA 4HH1A 4Y1GA 4GKJB 3LYHA 2RJOA 3B51X 3STXA 1NQUA 3NTQA 1P80A 1PWEA 5LU9A 2HO5A 1U7HA 3ZX5A 2V9CA 4KQJA 2NNWB 3FCOA 1LPOA 2H65A 4OXKA 4F3TA 2BFBA 3G49A 5LBUA 3U40A 1E5DA 4GYYA 2G1PA 2ZJ1A 2XY4A 3HJHA 4QDUA 2GO7A 4X8LA 3Q3GE 5TGZA 3M2PA 1QDLB 4JC5A 1DI0A 3DZ8A 4TYNA 3SX2A 3DDZX 1CETA 1K6XA 1QGED 3GZNB 4ROSA 2OZPA 4ND4A 2Y3IA 4ND2A 3MCWA 3L6DA 4B3IA 3O84A 1EYZA 4WKGA 4ANFA 2VCHA 2NO5A 4X00A 5IJXA 1V16A 5A6SB 4HO1X 3KVOA 3FHCB 1WKCA 3Q3VA 3Q2KA 1U2DC 2X4DA 1MZPA 4NMWA 1CPYA 3BB3A 3L93A 4MV4A 4TLBA 2JZNA 2WWFA 4IGFA 4B83A 4X0EA 1JTEA 3G7NA 2OO5A 4QGBA 3AOEC 4U9HS 2J9GA 1MA3A 1T13A 4EGCB 3IR6A 1QU2A 4DREA 4C20A 2L19A 2FG7C 2FV8A 1COWA 3N07A 4KXLA 4O08A 4UM7A 3VX4A 4ECAA 5HUQA 4A0QA 3T0GA 3AF2A 2JLVA 4DV5B 3KJEA 3MAGA 1XV5A 3AFGA 3BREA 1WCIA 3P4YA 5GV8A 2WZCA 2EL9A 3DL0A 1JJFA 4J7UA 5KQMA 2R1VA 3F8SA 3BE5A 3GMIA 1JEQA 3K8OE 3EZ9A 4RVGA 3MINA 5LQSA 5IKEA 1TOAA 3I5YA 4YJ3B 5KQSA 2ZR7A 3D4IA 4S3MA 4QTZA 2G76A 1D1QA 4NR0A 3ITKA 3KHKA 2OA0A 4BASA 4XJVA 5CTJA 1ATZA 3NTOA 5DNYB 2O8EA 3C1AA 4YJFB 1EINA 1OASA 5JVDB 4OI1A 1E6KA 2EF0A 3IB6A 4J7XA 5FTWA 2WT8A 4CLHA 4PYJA 7AT1A 4UOQA 5JTTA 1Q6YA 4L0QA 3D6VA 1G6HA 3CB4A 3OU7A 4JI4B 2YR0A 2XQKA 4Z0HO 5HNKA 3UWMA 1MRNA 1UDRA 2ZEJA 2IT1A 2P6NA 2V7XA 2YVKA 3E1KA 3F5DA 4LYYA 2VF8A 3ZWDA 1DJMA 1Q22A 2AJLI 4BNIA 5D87A 5J47A 2F9FA 4M0CA 1WX1A 1RI2A 2RAPA 3SCZA 1IUKA 5T3UA 3ZQKA 1VKJA 2QA5A 3WQSB 5FUWA 1H2XA 4IDNA 1CDDA 4WFJA 1XYYA 3G2HA 2VYVA 4L27A 3X2SA 4N47A 2JS7A 4P8RA 4OHBA 2VTEA 1SKQA 2JIDA 3IAS1 4IIJA 4LYDA 1PD0A 5E9AA 4AVYA 3TWOA 4P0PB 1KVQA 1IXSB 4ESHA 1TQ2A 2XV1A 2J48A 2OZKA 3V6LA 1KNQA 1T1GA 2WFMA 4N8DA 3ED5A 4OMCA 2ZW9A 4RHTA 4S2UA 2XXBA 3ZY4A 4C3VA 3GT0A 3KQUA 2J59A 1W0KA 2ZJ7A 3SQOA 1BYIA 3KOMA 3I4CA 4JFAA 3GVXA 2BP7B 3QZUA 1BH6A 4MMYB 7REQA 1SCUA 3M6FA 3C7CB 4G0XA 4ZVTA 3U9TA 3UMBA 3ZI7A 4DCJA 5CFRA 1I4DD 1KSJA 3A4LA 4BNYA 2FKAA 5HIIA 2VDJA 4U63A 1VCHA 1P0CA 3DZCA 4MW5A 1ZCAA 3D6FA 4TMTA 3LT4A 1Y8CA 2O06A 3PFBA 4INOA 3BZBA 1P0QA 1RM5A 2EYUA 4MUBA 4OO3A 4Y2TA 4BCCA 4E11A 3GAZA 4HQNA 3E0XA 2O2SA 2V4ZA 3FCYA 4RETA 4DQKA 4KP7A 1L5GB 2OT3B 1JKXA 1N0WA 4G8BA 5KCMA 4BMCA 1BX3A 4UBIA 3HBJA 1SBYA 5E1OA 4EF6A 1FDUA 2OXTA 2JARA 2OORA 4OHMA 3WSVA 2DVMA 1ZUNB 2FWAA 2IPNA 1DLIA 1N5RA 3QLEA 1DB3A 1J0DA 4OI0A 4UUQA 1R8XA 5K3EA 4PLYA 4DLUA 3W0LB 3QXGA 4BU1A 3VZCA 1B6SA 4GI1A 2N47A 4GVLA 5LQDA 4IJUA 4G0QA 4HD8A 1GR0A 4JBNA 1YS9A 1NKTA 4LPSA 3VPFA 1EGMB 3NWEA 2G88A 2FSGA 1KOFA 1TMGE 2P67A 4OP2A 3M5WA 1NC3A 4KH1A 1R66A 1X38A 1E69A 3MTIA 2AYXA 5GZ3A 1BZYA 1Z4IA 4O4JA 3AG6A 1ONBA 3EFEA 3I8SA 4UBLA 4YCBA 4FMPA 4AMUA 4AWBA 1PLLA 2JW5A 2JGDA 3NEPX 4V0OA 5C1BA 2H1WA 3D5TA 4D44A 1E7WA 4UTOA 3KTAA 2SBTA 1Z6PA 3L43A 4WXYB 5JWHA 3UB2A 4ENWA 3R3SA 2ACVA 3DNFA 3JWHA 3EFOA 4PAMA 3N87A 1YJAA 5K45A 3U62A 1J8YF 2BGTA 1EZ4A 4G5RA 4Z4FA 2VNAA 4HNTA 2ZVJA 3LC7O 5AVOA 5TQ2A 5BW5A 5K2MA 2HA5A 1Q0HA 3AT1A 2PJRA 3DZBA 5IC6A 4QFDA 1IJBA 4PBTA 2CF6A 1X1RA 3GRVA 4OQEA 5FXMA 5THQA 2BMWA 2ZRHA 3T7RA 1OBFO 1SC9A 1TM5E 3HVHA 2ISQA 3WLNA 3HA7A 4L6AA 2J5XA 3KOXA 5EMJA 5C51B 2HWKA 1YR6A 5B7PA 4MIOA 2MSEB 4PM4A 1Z29A 1LS1A 2WKQA 3CS3A 4IIXA 4UCXA 4YAOA 5A2GA 3BZUA 3CVVA 3IA7A 5CX1B 2GBLC 4IDAA 1E3WB 1T6XA 5IPFA 3R3UA 1YR3A 1DFGA 1K5PA 1N3IA 4QBFA 3VOSA 3B5IA 1HTBA 3SEAA 2B1QA 1IHDA 1EQUA 3JAWA 1N2OA 4O4IF 3GJ0A 5MN6A 3HM9A 3PFNA 4BRSA 1A7UA 2VP5A 2X19A 3O1HB 1ZIPA 4DCOA 4PYRA 3L7DA 4BYMA 4EYSA 1R9JA 2EW1A 1FVXA 1W94A 3FSJX 3K1JA 4XM0A 3STYA 1UJNA 1Q7CA 2GM5A 5KX5F 2VTVA 3HBNA 4QG3A 1UEJA 1T9ZA 4R2WA 1SVUA 4QQ8A 2A5JA 1IIRA 1JYEA 3PSAA 3P0HA 4BS9A 4CGYA 2XRZA 3T7CA 2IQ5A 5UKDA 4MV9A 1NMXA 5C81A 3BHMA 2IPMA 3NAMA 3VKUA 1NAIA 1S1CA 4JA2A 4YI5A 3L06A 4JROA 4J0JA 2JLYA 3QKUA 1NATA 2WE7A 2GN1A 3INTA 1RI5A 4CPDA 3EXEA 2DTEA 3HCAA 4ZV9A 4PLZA 4AWAA 5I4IA 5TPWB 2HJVA 2DBYA 4WV3A 4ZQBA 3UF0A 3U16A 1CYEA 2AD5A 3STHA 4BLWA 2G4LA 3GPCA 1NRIA 1U3FA 3GJTA 3ZD7A 1CE8A 1JNYA 2GOYA 5AW5A 3WYEA 1TEXA 1XZGA 1VRVA 2WA1A 3B20A 3FPSA 3I4LA 4O2AF 5KWIA 3DGFC 1I2ZA 3HDHA 3R1IA 2XNDA 2Y0DA 4LRTB 2V59A 5DYTA 2DBQA 5E7IA 3W90A 1HOXA 5JQGF 1VTKA 4HF7A 3JW8A 4YJ2A 2I4RA 1SXJC 2JFWA 5CB4A 1NN3A 3VHLB 3HP7A 4Z4IA 1IC6A 2QIOA 3SY8A 5FWXB 4YMVA 1VL2A 3RSHA 5JMOA 2DHCA 1FS6A 4NATA 4YQEA 2WT4A 2XF2A 4RKFA 4A2CA 3COZA 4MVJF 2NU9B 1EWQA 4DLXA 1FTYA 1HE2A 1G1MA 2P4SA 3MWDA 4FHDA 5ALRA 3RJMA 3BMCA 2PUGA 1QAOA 5TGTA 5LB2A 1NV9A 4CM3A 3R40A 4GW3A 3SSOA 2BZGA 2PGIA 3NDRA 1PV1A 3OPVA 5DI3A 4J2HA 4NCJA 1VSBA 1G2OA 1AD2A 2GEUA 3U9LA 4AZ3B 4C2AA 1BCRB 5B4VA 1Z0KA 5C8VA 4QC2A 3GBSA 2NV2B 1AUPA 2W11A 5A6VA 3SC6A 4BKPA 4BE4A 3KV1A 2NSDA 1H23A 1LV7A 2M1ZA 1Y7LA 2DQYA 1T6YA 2HR1A 1G6KA 3ND5A 1L4FA 2G1JA 3SC3A 2EWWA 1KQFA 5DF1A 4C3UA 1Z8DA 2JHGA 1JFSA 4UAJA 3ZK9A 1EM8B 1JG1A 3H11B 2D1YA 1SKYE 3CLTD 3NHRA 1UFVA 2ODNA 3SR0A 5CCBA 4OMDA 1FNSA 1QIGA 3H2IA 2SCUA 4D8XA 3EUWA 4HEJA 3G6WA 3B48A 3SQLA 3QVVA 2C99A 4TPKA 2Q5IA 3T61A 4XE5A 1OU0A 3I9JA 4EPVA 1A8QA 4L15A 4EGQA 2ERYA 4ETNA 4R68A 4YACA 3TYXA 4ZCTA 2C8VA 4J76A 1QS0A 3DDWA 4NYMR 4P5DA 5F9HA 4HLDA 4LKRA 1SKYB 3E7XA 3DEAA 5I4CA 3L8GA 5ESRA 4W1SA 5T4EA 3TLMA 2OCLA 3MT7A 1Y1QA 4B3SB 2PL1A 4HAXA 5LKRA 3UB3A 1YS6A 3UB4A 3KYDB 3WK6A 1XZDA 4F6LA 2QZJA 3DO8A 3TQSA 2VTBA 1QHHB 3O8BA 2HMTA 1XQYA 3FPGA 2NW6A 1ESEA 1W2WB 2OKCA 4QUAA 1JDNA 3NOQA 1A9QA 3OAAA 3QQPA 4DDWA 1KIMA 4M9UA 1JALA 3W04A 2HLPA 1E0KA 3JAMA 5BSKA 3GUZA 2CL5A 3BWMA 1FNCA 1PKEA 2B78A 3JZMA 3NHJA 3QELA 4IVPA 3HFSA 1IJKA 4LFCB 2FFHA 4U0KA 5BSTA 1K0FA 1FDOA 1XJ5A 3FG9A 4DMCA 4YDQA 3T9BA 5IF3A 5KYWA 1GLVA 5FV7A 3TS1A 2QWXA 1ZI9A 2IXDA 1VE9A 2PSHA 4KKVA 5JPDA 3PIDA 3SS8A 4R8RA 1ZBDA 3VU3A 1R6VA 3SP1A 3HRIA 5CXXA 1UQUA 2PUHA 3IOMA 2FMTA 3WLSA 3EEIA 4DIBA 3WK4A 2AF4C 3O4JA 4CTJA 1L5VA 1JLMA 4P9NA 4IIVA 3O0DA 2JFOA 3NTLA 5DW3A 2BM9A 1ESNA 3HVKA 4GECA 3PNBA 4PIMA 5EOVA 1E61A 3A28A 3A7EA 4I4TA 1NVTA 1FUUA 1KI2A 2H5EA 2TMDA 3FCSB 3OM9A 4HQFA 1DAEA 3L4BC 4QGHA 5KKNB 1DJPA 2XQFA 3B2NA 3HWWA 5A3SA 2X8LA 1VG1A 1KDZA 1R4MA 3K9BA 4GOKA 5C5IA 2IKQA 3C7AA 1WPQA 3IBSA 3RE1A 2JZOA 4RELA 1KJIA 3H75A 2O2JA 4K05A 4Z7NB 2VPZA 3LX6A 3NB0A 4ZWNA 3P2KA 1VGVA 3PC8C 4Q01A 3S2EA 1ZISA 3ENKA 3B6IA 5CM9C 3UICA 1H5UA 1XU9A 3VGJA 3VMFA 3MW8A 5M29A 1E3QA 4YASA 3S40A 1VDMA 1YFZA 3K70D 2MJLA 4KR9A 1T8UA 3V46A 4D0LB 4DA9A 2Z0MA 1T1IA 1TIBA 5IKOA 3C74A 1Y89A 2UVQA 5EE3A 1Y5NA 3RTGA 4KXNA 5CA1F 1JAXA 2J4FA 4N12A 1Y48E 3SC4A 1D2MA 2DFPA 2BKAA 3CKMA 1XF1A 1GG9A 1NI4A 2PX5A 1CRZA 3DT8A 3DLBA 1NBHA 3F1KA 3NUZA 2FSSA 4TV9B 4HMOA 4CXMA 3WQRA 3LY8A 3T1TA 3E05A 1I7LA 3FF4A 3SX4A 3CUVA 2GPYA 2R96A 3JZAA 3OY7A 4ALMA 3QWAA 5JBQA 3OQOA 4K87A 4RA6A 4W5OA 4IVRA 4RF4A 3K72B 1ODSA 2PU7A 4RU1A 5JSUA 1OT5A 4AURA 4TYWA 1QP4A 2YXNA 3KJGA 4I4NA 1Q1ZA 1CUVA 5AD1A 3KQNA 9MHTA 2E1PA 6LDHA 4L28A 2VF7A 1LQ2A 3B3AA 4TV8B 4V0KA 3ESXA 1C7RA 5HKAA 1JIJA 4RH1A 1Y3BE 1E5XA 3CKYA 3GRCA 4OAOA 3CVJA 2X0DA 3VR0A 1USKA 2XKJE 3TGPA 4YQYA 1SURA 5FOWA 3R8FA 2D2IA 3H2YA 1RACA 3AJAA 3IVCA 3QYJA 4CL8A 1RLUA 1B26A 3CSSA 1YI0A 2VZLA 2IX9A 5L40A 2VTDA 2WM9B 2WSMA 1XVUA 2PSJA 2QMQA 1UKCA 1MGPA 4RVUA 4UM9B 3FMOB 4EVIA 1ESMA 3DKVA 3DR5A 4V0RA 2VO1A 4LXUA 1TO6A 1VHLA 3GLHE 3M9WA 4JGGA 4JJGA 4B48A 4JA0A 1SQGA 3H97A 2PX2A 1C7JA 5ALQA 4MIYA 1GZ6A 1XLTC 1UDXA 2CHUA 1J33A 2JGAA 3L8HA 3ZJ4A 3N0WA 3NORA 4S05A 5K6AC 3NRBA 1TPZA 2BELA 4X54A 5C1PA 1VPLA 1XAHA 4DEXA 2IL1A 3GRFA 4GL4A 1JBEA 3JATB 3LPNA 1O95D 5CLIA 5CLHA 3OX1A 1MOQA 1ZW1A 3UUFA 2UUAB 4JXZA 3QEJA 1OA0A 2QP9X 3LF2A 5FO1A 3RHSA 3NASA 1Y9AA 4IQGA 3JRXA 4C87A 5LQCA 1BVHA 3GLHB 2FUG1 2ZIFA 2ZJ6A 3D2BA 2DHQA 3PKZA 3T3GA 1HOTA 1RXIA 4CQMA 3FZEA 1P5ZB 1WL8A 3NWOA 3U7QB 4N82A 1BE8A 5JS8A 4EYGA 1PK9A 1EFHA 4V02A 1NJ6A 2F2TA 4OQQA 1ABFA 1U2ZA 3OI7A 5B3AA 4FE4A 4ARAA 1U7TA 3AF4A 1XPUA 4O4LA 3DBLA 1D6NA 2PMEA 4ABYA 3N8HA 4OATA 4EJMA 1Y5MA 2R0QC 4R2XA 4GX2A 2MSWA 1RYZA 1GM5A 1I6MA 5FPYA 4KPUA 3KD2A 3VNAA 2CGEA 3GP8A 4PXYA 3CNQS 5C4GB 1AQNA 2EJWA 1MOPA 3BERA 2AF3C 2NT4A 2Q3FA 2JDIA 1AX9A 2DFDA 1S2LA 3LGSA 4O6VA 4Q1VA 4YBRA 3PTLA 5F23A 3RK4A 4CQLB 3ND9A 1SN7A 3NHKA 4YQZA 1HMPA 3SJAA 3H5NA 4OQXA 1K4YA 5AVJA 1XHEA 3OOHA 2JEZA 5H3LA 4NTZA 1JR6A 4N40A 4UDYX 4UEKA 2H2WA 2B3DA 4U4AA 4LRUA 5KYGA 5H5JA 5L53A 1E1MA 3UQYS 5L4NA 1QQ5A 3FYHA 3WFZA 4BECA 1Q7EA 3Q7RA 4YB8A 1M66A 3N28A 1NWCA 1KQGA 1PL7A 1F0YA 2EL7A 3K9QO 1EXNA 4C7VA 3MBOA 3VH4A 4B0OA 5IUJC 4TXHA 4F45A 1H05A 2R25B 3B6JA 3AY0A 3BHJA 2PUTA 4IMIB 2K5UA 3GGPA 4MV8A 4RK7A 1MGOA 1NUPA 4W9RA 3VUFA 1YJQA 3KHUA 4G1FA 2GXAA 4MR9B 2FF7A 2H4FA 3GFQA 3X1XA 1Y8ZA 2C31A 3DBOB 2XJ9A 2WW8A 3L7JA 3MGKA 3O93A 3FPFA 1M7HA 1M8KA 3GJ3A 3ZGZA 2A8YA 4LTMA 1D0SA 1DZ3A 1MJ5A 4ZI5A 2Q6KA 2X2FA 1F12A 1H0KA 3TJMA 2ON6A 2M6SA 2R7AA 1GNLA 1Y3AA 3GG9A 4IV0A 1RT9A 3M33A 4US2R 1J5EB 2A7XA 3BJZA 4HUQB 2B4QA 4IJMA 2C61A 5B53A 3RWBA 1PG5A 1YBAA 4LMPA 5CDYA 2O8CB 3IP6A 3JARB 1TVCA 1RWPA 2PU5A 3OJFA 3PX3A 4FZ3A 4JOBA 4ND1A 2D2XA 3B38A 1FDIA 4G26A 4J1TC 3UK1A 3HB9A 3PDHA 2DTXA 3QBDA 3WGLA 1V7QA 2E49A 5FFNA 4ND5A 2YYAA 1J20A 3BF7A 4DEVA 3C41J 3RVMA 3LECA 3U1VA 3T1NA 4TTTS 2XD4A 4Y2QA 3RTDA 4DCSA 3FNEA 3RYCA 1ZGAA 2PTHA 2ZAOA 3G8DA 1YZQA 1I9CA 3D4BA 3QJGA 1RD4A 5HWSA 5M7EA 1KFJB 1A69A 1I30A 1VPVA 2A57A 4KR7A 2A2ZA 2IWRA 3CF0A 4MRMA 4KR6A 1RPNA 3SYLA 3CCCA 4DWWA 1CNFA 3BKWA 4RUKA 2QMEA 4PG6A 4OUDB 4B87A 3GLIA 3DFMA 1VZ2A 2IE8A 4ZOBA 3LA8A 3JD3A 2G04A 4IIYA 1N34B 3DMTA 3SU8A 4IINA 3I1JA 1ZI8A 1KH2A 3ZXXA 1K98A 1QQ7A 2JCBA 3NATA 3WYAA 1DL5A 1DARA 2V5VA 5KHLB 5EJ4A 1VCMA 3ADPA 4D4LA 1FNNA 4NU8X 3I5XA 4F1KA 3FPCA 2RH4A 3AQIA 3JQDA 4MPDA 4WOCA 3U7EB 4CNBA 3RYFA 2G9UA 3RJTA 3OD1A 3L0ZA 1T2VA 4DZZA 3K92A 3VNQA 2XCTB 1AQYA 3JD2A 4ARZA 1ABEA 3PS9A 1I5OA 3OE7A 4GXQA 3W5AA 4M1YA 1NW4A 4BB6A 1ECLA 5D3QA 3ZIAD 2CD7A 2D0DA 4M2LA 1AVTA 5FQNA 4OQ4A 2R62A 4ZYYA 2BI4A 2QAGA 4R69A 4UMVA 3A1CA 3HDYA 4H27A 3TFOA 3FWNA 4RK6A 3RU2A 5F51A 2VAVA 1L7QA 1ORDA 3FZNA 3SSAA 4BTVA 5KI6A 1YQDA 3PQEA 1W9HA 2O0KA 3WVNA 2GR9A 1E1DA 3WO0A 3KSAC 1P72A 4HS9A 1GA4A 3OLCX 4YMTA 5JS1A 5C80A 1OXXK 1UXIA 3PNYA 4E15A 4RJJA 2QTVA 3QUBA 1M0EA 1AOXA 4PYMA 4HXEB 1MUUA 3D4PA 1MNAA 4Q7KA 4BNVA 5FEUA 4BAUA 5E6UA 2E37A 1DQZA 4JLDA 4TS4A 4E21A 1KQNA 1ZXBA 1BSVA 1EZZA 1E9RA 5A4DA 1NJ1A 4L7VA 3RC7A 1SU6A 2F64A 4KAXA 5CLGA 5AKXA 3AK4A 3W1WA 2VCYA 1JR4A 5TVGA 1B6RA 1LS6A 2VDQB 3Q0EA 3K0AB 3BWVA 4BO8A 4K2HA 4BNMA 1HRDA 4WADA 3PC6A 3O2SB 4PLGA 4QGAA 4OX9B 1RYMA 5C7YA 2OHIA 1CNMA 4MV6A 5ALJA 1S2IA 2YINC 3DWIA 3QYFA 4BQOA 2XYVA 5EKTA 3RC1A 1BQEA 2A0YA 3ETGA 1ZOIA 2JJ1A 4E22A 1XTRA 1D6MA 2J3EA 3PRKE 4OJYA 2HBYA 4Q82A 4GMFA 2C5LA 3GZNA 3SI7A 3A9CA 2VSFA 3I0MA 1TE2A 1CR4A 2Y76A 3DEKA 1NVGA 3H9GA 3P9YA 4HZGA 4KOAA 3K71B 4TWIA 3TZKA 5DYWA 5A6SA 1R3DA 4M1OA 4NMXB 2EW2A 1TTHA 4GVPA 1EGHA 2B3TA 4YMIA 3AOGA 3N70A 2V1XA 3RU7A 2MT9A 4RF5A 3MXOA 4WKOA 1JA1A 3EXHC 3BPSA 3EWSA 4FKBA 1ULBA 1CJUC 3NJ4A 4IJ6A 3LI2A 2HSZA 4BNTA 1IZZA 4ARSA 5G0TA 3O75A 3ZD8A 3EZYA 4NYJR 2RHLA 1Y6RA 4XJXA 2BGMA 1CR2A 2WAMA 4YHHB 2D74A 5HRCA 3NT2A 4D8YA 3S1AA 4Q3LA 4P36A 3OX3A 1TGVA 4M8LA 4BBPA 2UUBB 2AOUB 3GOHA 2BFPA 5FWDA 5AHWA 5EJ9A 1JSLA 2PD6A 4A5OA 2DBVO 3B12A 1V35A 3N8NA 1VJDA 1JHPA 2QRNA 1ZQ9A 3HABA 4YBZA 2X14A 4HFNA 3LPDA 2VG8A 4D9NA 3EVEA 2IEIA 3GFBA 1DKLA 3KXDA 3OEWA 3OZBA 3QWFA 4YJ3A 3W6NA 1EDZA 1O9BA 3R6LA 2YRWA 1YDWA 3OM1A 3I6ZA 1QMGA 1IM5A 3ZJUA 4YJFA 4XJTA 3NJRA 1Q16A 2C54A 4EPRA 1Q0QA 2RG7A 2XNJA 5JVDA 4FSHA 4HAUA 1OJ7A 4UNSA 2H51A 4NU5A 2GTIA 3WC4A 2HD4A 1DRWA 3SSMA 1SXJD 4GICA 1JHUA 5C18A 3CPEA 2Q5OA 3ZDQA 3JD1A 1GEGA 3FWPA 2Q9AA 1LBHA 2XOKD 3KFVA 4YP7A 1OUMA 4NYMQ 2I4OA 1Z63A 1Z2PX 1G1AA 2AFHE 5EJ8A 3O3CA 3VAZA 2FGKA 4MP8A 1CFZA 4N01A 1KMCA 3GJ8A 3KZNA 2VYND 5JD3A 4BEJA 1NLZA 4KQEA 4LNAA 2ZTLA 3B5JA 2HNAA 3OZCA 1MOZA 2WTAA 4H3SA 4KE7A 4BKQA 3WMWA 3EEQA 3PHJA 2ZUTA 1CUFA 4JITA 1XDDA 3RVPA 1P5HA 1XLVA 1YS4A 2AFHB 3IVGA 1L4YA 5BSRA 4GX0A 1R74A 2DH5A 2XOEA 1JIQA 3DXYA 1UXKA 3HDQA 2HT1A 4ZU3A 1KE2A 4M9QA 3DXFA 2DXIA 4TZ0A 2FLKA 4QOGA 4RMIA 4WK2B 2WTUA 2CNBA 1L6IA 4N6OA 4F3KA 3IPRA 1J90A 4J29A 1MR3F 1X0VA 2XKAA 4KTTE 3EVTA 2FPOA 2BUAA 3NEAA 2QPOA 3HJTA 1WD5A 1ISRA 2Q07A 3R7BA 1CUGA 3R6TA 4NAUA 8MHTA 3BD9A 4BBZA 1A9OA 5KSWB 2CL6X 4OXXA 1IXKA 5FQOA 3GY0A 4ZVPA 2A1UB 2H9AA 3HVIA 1WF3A 4HKTA 1EFUA 4ZANA 3ROZA 5KAMA 1WMFA 4BVKA 2VOEA 1KO8A 1L5YA 3BYZA 5MFZA 4F4UA 4PSVA 1RQNA 1TUGA 3CU5A 3KJNA 2QUHA 3GT3A 4B6JA 4BL5A 1ND5A 2ZQ5A 3F4BA 1V6SA 4UUOA 5KYYB 1G8YA 4WJZA 1ZUNA 1BCSB 4OLHA 4HB2A 5DPMA 1F8GA 1I3OA 4E94A 4JT2A 1O5OA 2Q9UA 2XAUA 4XIIA 4XEUA 5JCZA 4RPGA 3UYLA 3KM0A 3QVMA 4GLOA 3ZLUA 5CBKA 4FB5A 2CFCA 1I13A 4INAA 5LJLA 3S8EA 2YWBA 1XB2A 4HDCA 2ZSFA 3SZLA 4OL9A 1XQ6A 2G1AA 2B0CA 2QW8A 4I6JA 4O4IB 4R0MA 1WW8A 2BT4A 1PU2A 2A7QA 4FWTA 1URPA 3OU6A 1NMYA 3EASA 1O8CA 2F9MA 5KX5B 4UATA 4OP1A 1YZUA 2A78A 2C96A 2CXXA 2V03A 3F9IA 4DM7A 2NZWA 3HHPA 2Q3JA 2WDZA 3ZI0A 2BRUA 2Z4RA 4D4MA 4Y98A 5LUAA 5AKEA 2KBFA 4LOAA 1OAOC 2COKA 5BQPA 3BSFA 2JAHA 3UGQA 4IFEA 3QMWA 1VE6A 2HW8A 4GGPA 1LJLA 3GGCA 4J0CA 3TSCA 1G63A 1BVUA 1XKTA 3QUCA 4K9PA 1BVRA 3LHDA 3N6RA 4S1VA 1LX7A 1G66A 1QZTA 2G1UA 5DYGA 3QNMA 4TTRA 3FKSA 3RVLA 2V5UA 1E0JA 4ASUD 1AN9A 2D4HA 2OV3A 3INNA 3IRVA 3DLPX 4JJ7A 4MVJE 5F1YA 2DZDA 4O2AB 4A26A 4DCCA 1J0AA 2Q4TA 4PSDA 1O89A 4INZA 2IU0A 1UC5B 5JQGB 3F6BX 4AYTA 1KI8A 1QH1B 5CX1A 4MR8B 1IJFA 4D2IA 4YCDA 4IIBA 2VDVE 1E3TA 4DJEC 4BEBA 1DIHA 3OKPA 1ULHA 3C5EA 3ROKA 2KJQA 3AJEA 1Q12A 4J1SA 3FPKA 1DBSA 2PS1A 1H3NA 3MRXA 3BSSA 3ZS8A 1RWVA 2YY5A 1T2FA 2XUIA 5D8DA 3WV4A 5AW3A 3K6JA 3I8OA 1C3LA 2OK7A 3DTYA 1K6MA 4DM4A 5CXSA 3GLGE 1RSZA 1TM1E 3AVQA 4DLBA 2FRVA 5HKBA 1KYYA 2CVPA 4NOMA 1JJBA 2CYBA 4LYEA 1KXJA 1LDEA 2ZU6A 4OUKX 2H16A 3OOYA 4Q0MA 3FUWA 2BM0A 2X13A 3HB7A 1U1CA 1UAGA 2RGNC 2X0FA 1GGVA 2PNJA 1J7KA 3N2KB 3DFZA 4L6IA 1JUDA 2W9XA 3N7AA 1YJ5A 4G0MA 2GJ9A 2FETA 3VX3A 2OQRA 1GZVA 3MWLA 2B92A 1JHDA 1YCGA 1FX1A 3H05A 1YA4A 3GLGB 3HKCB 3P9NA 5FL7A 4L73A 1P44A 4CDGA 2PT7A 4F8JA 1W1UA 3MJVA 4B71A 3ODGA 2OHXA 3JY6A 1DKNA 2VHEA 3T34A 2PXHA 4RGBA 2X1VA 4CLRB 5CGQB 2E1RA 2FUEA 3P9ZA 4TTQA 3GJQA 5P8WA 2B5OA 2H11A 3AFIA 4JC8A 3EPPA 4ESVA 1ES9A 1PDOA 1Z2CA 4PC2A 5EP4A 2IRWA 1MAVA 5FWXA 5IDQA 2K4MA 2GJKA 3V7WA 5FBVB 4RH0A 1U9JA 2QT1A 3QOXA 3ZJYA 2CDCA 4A2QA 1X7DA 1PZFA 3EG9B 2NU9A 4JLMA 3AY7A 3DMPA 4PFJA 5ULLA 3UYKA 4CDMA 3AB3A 4M1ZA 3O9MA 2J41A 1PGOA 4FS3A 4I8XA 3KT0A 3U3KA 1LBEA 3LC2O 3O90A 3A2KA 3HUDA 2EFCB 1EDDA 2DT5A 4XWTA 4M55A 3ZHOA 3X1MA 3BB1A 3FBTA 1OYOA 4AZ3A 1B2RA 2IZ0A 2HF9A 4GUDA 1BCRA 2QK4A 4WASA 1K4KA 3IIEA 1H9CA 9LDTA 2B82A 1L7AA 4ARBA 4BMOB 4R1PA 2YJ5A 4EG4A 4QPZA 1UJMA 1G7CA 4R4JA 3A14A 3KEQA 1WZNA 5G0VA 5CCDA 1W46A 3UAOA 3OBBA 3JAKB 2A94A 4M8NE 1IEWA 1DTWB 1MDFA 2CEKA 2IZ7A 4XB1A 3W5IA 4M1QA 1J7JA 1EM8A 1N9KA 3H11A 4N54A 4RAOA 3G1TA 4XR4A 4A36A 1CY6A 2FOIA 2TYSB 2XNKA 1I4EB 3A4MA 3UCXA 2ENUA 2IHKA 4EB0A 5B30A 1JA9A 4R05A 2P6PA 1XRMA 5FOVA 4KE8A 2AEEA 2C2HA 5E1BA 4EI8A 3QUQA 1F6WA 3EE6A 2Q4BA 1VBKA 4OHRA 5CFZA 2JVJA 4KO4S 3TZQA 3QLVA 4K26A 3M4NA 1Z62A 2WJVA 2RDMA 2ZWAA 4YRFA 4BJ1A 3GHYA 2C5EA 4PC3A 1E1NA 2O2CA 4TKLA 5BT9A 3O5AA 4CF4A 1Z3CA 2N3ZA 3HEAA 1B0UA 2BMVA 3M9LA 1KA9H 1Q15A 4ODIA 4MQMA 3NETA 1FP7A 1GRQA 1P5RA 3A3KA 3BDAA 3I9KA 3KYDA 5GJWC 1E59A 2GH1A 2IVZA 1QHHA 3BF8A 5DTIA 2FPSA 3SEQA 4E2WA 1DQPA 5L7YA 1PDWA 3O26A 4JLJA 4WD3A 3SX0A 1DKQA 5FA5A 2O2GA 2YJNA 1LRLA 3WP0A 1MMFB 2O2YA 4GUAA 2B99A 5YASA 2QR3A 5ALFA 1IXRC 4EA7A 1XCOA 3HVUA 2GESA 4XUDA 1XKXA 3I72A 5CA1B 1Z9BA 7ABPA 1FS5A 1PS8A 5I51A 1GZHB 4A91A 1GPMA 4ZGBA 3B7GA 2W58A 2XYQA 4Q47A 2M6KA 1T2AA 2FAXA 3D8RA 4PC6A 1U0SY 2HM7A 4XCQA 2PUCA 4LMAA 2MWMA 4H35A 4IXNA 3DOIA 2PVPA 4XDGA 3VSDA 1V96A 1ZWKA 2XVMA 3KO8A 3P2YA 1HEUA 1LSJA 3QWBA 3WYBA 3ZHTA 5KVVA 1WZ2A 4Q7QA 2QV0A 2ZUFA 3IH5A 4D79A 3ZBQA 4GVXA 1F4PA 3GJRA 5FAKA 2QSYA 5I4BA 2DAPA 4ZEWA 1SB9A 2GFIA 2Z04A 4CETA 3HC7A 1Z25A 2O05A 3HQ4O 4ZZ2A 3EEYA 3PLNA 4TKVB 4B4KA 4W8GA 5AVXA 1ENZA 3DBHB 4AMZA 3KKLA 1KHHA 4KWIA 4N3GA 3D6AA 4WJLA 1B43A 4Y9UA 1YS7A 4FUTA 4P4UA 1Y6JA 1CS4C 1I6LA 1RYNA 2VRBA 2WD8A 2IFTA 3HXTA 1FBTA 4QDOA 5DLPA 4JI6B 2OPHA 3FDFA 3PX7A 2GZ3A 1D4AA 4ER3A 5DNUA 2HBZA 2Y0PA 4KQCA 1GNTA 4LOJA 2DHDA 3AHDA 3OD5A 1B3RA 5F1PA 1A9XB 1RPAA 2C98A 4PYOA 1V8FA 4FGSA 4R1LA 2H3HA 2GETA 3BK7A 1IVNA 1M6WA 5G2OA 2BR4A 2FVYA 2GDZA 4EF4A 3TFQA 4QPCA 3L6OO 5C0OE 3PXGA 4KDFA 1OI3A 3FRIA 1HYGA 3T7TA 1JS1X 4FFNA 4L7QA 2PUBA 4ZV7A 4PIPA 5IT4A 1C2YA 1BH2A 2QP3A 4DXHA 5J4HA 1M2EA 3GXOA 1ML4A 4MINA 4UMEA 4D4HA 3ZNQA 5E8JA 1T1SA 3D4NA 4R2IA 1L4KA 1VGQA 1YZLA 421PA 4DBVO 4ZDKA 5IC4A 1FYXA 1RI1A 4TV9A 4YRZA 1FVOA 3LHSA 1KU6A 3ZV7A 1E63A 4BQQA 4CIWA 1JG7A 1SB8A 2D1FA 2ZRBA 2ZRNA 1XVVA 4ZXPA 1AS3A 1WR8A 3LOPA 4K7JA 4W8HA 1R0ZA 2RHTA 3STUA 4IIEA 2DE0X 1BU8A 1L4GA 1MH1A 1PO7A 1UBGA 1YJXA 1FSGA 2ETVA 3LDFA 3LOUA 4GNKA 1W93A 2VSNA 1XZKA 4GM1A 1GPH1 1Z2NX 3OA0A 4RD0A 1E7QA 4TV8A 3HBFA 2L18A 4X24A 3K0SA 3LE8A 3Q85A 3I76A 1Z16A 4LXXA 4YQFA 1ILEA 3NHYA 1STOA 2CXUA 4EHHA 1JWLA 4P98A 1FOEB 3QMPA 5DHRA 1C8VB 3H9QA 4Q3NA 4YMWA 3KKPA 2VF5X 3AI1A 4U9UA 5KTTA 1ZM3A 3H2SA 2HHHB 1Z68A 3TM5A 1G17A 2WV7A 3O4RA 3Q88A 4HMPA 4UBJA 1EVZA 2GN4A 2XTMA 4AYWA 4GKAA 4BMZA 3VBEA 4F7WA 2YQ5A 1VXRA 1TB4A 5H1YA 3RTCA 5JCPA 2AZTA 4G85A 4ZZ0A 1U7XA 3CH5A 3V8QA 3QTLA 5DM1A 2R3SA 3ZTTA 4BJHB 2VDMB 5KNCD 1Z0DA 2H1HA 3WLJA 2WLSA 3RF7A 2V8BA 4DRXB 3MHPA 3K8QA 1SCAA 2AG6A 3GGSA 4TX1A 3P1JA 4UUNA 5ALWA 1KJQA 1N75A 3JATA 1Q74A 1KH3A 1SC1A 3CEJA 2QD2A 1XRQA 3OPYI 1Y4ZA 4OFWA 3RHTA 3TVYA 2VJQA 3WMFA 4QOJA 4PO9A 1RXVA 4J9UE 1EBFA 4CV2A 3GLHA 3B70A 1EJ2A 1SK8A 4NQZA 3PUHA 4TWBA 4DKJA 3OC6A 1SUAA 3LSTA 5HHTA 2EZTA 4ZJZA 2AJDA 2O1XA 3U7QA 4Z8XA 4QDXA 3H4VA 4MP3A 3S5JA 3STWA 2WM3A 3PG5A 3MOIA 3GR6A 1GQYA 2ZAGA 1U2GC 5H82A 5FORA 4UFPA 5SZHB 3ER9A 1FXUA 4GR9A 1OAKA 1RTTA 1XKQA 1T6ZA 4KDRA 2GN0A 4OKIA 3T95A 5KQLA 1LTHR 4YAJA 5EGSA 5CFMA 1B41A 2BKUA 1PBNA 3K35A 4UFOA 4WFIA 4ZCMA 1W7AA 3D8UA 3HR7A 4RE6A 1CTQA 2XMSA 4D02A 4D56A 3HNPA 4DDTA 1JMYA 1FXWA 4RAQA 5HR5A 3H0KA 5AJVB 1JHZA 3IDOA 3M4ZA 4ON9A 4JT4A 3AC0A 5B37A 4G0VA 1P39A 1G0NA 2NSLA 1Q0ZA 3U4DA 4CQLA 2ES4A 5DHQA 2QSZA 3I37X 1T36B 1E2GA 1ZJZA 1YCHA 3WWZA 4X64B 1E2EA 4BQNA 2ZBDA 3F97A 4PRLA 2V8OA 2IV2X 1DQNA 3B13B 5EVJA 2F7SA 3I52A 2FY8A 2AR9A 3IL2A 1KVSA 2X3FA 1O6GA 1TEHA 4RA9B 3T1VA 3LO5A 1L1RA 4XD2A 4EKIA 1T4DA 5CT9A 1RCTE 4D92A 2X23A 2A3NA 4O2LA 1MT3A 3BZWA 4JR0A 2CV1A 2V98A 1PT5A 4IKOA 4JJFA 2YC2C 3D6UA 4NZYA 3WGTA 3ZW8A 4BP8A 4C6RA 3Q12A 1L4HA 2O14A 5KAPA 3CR7A 3I30X 2C82A 4D0NA 4MW0A 3FGOA 1TA0A 4EKEA 3BGDA 4M98A 4MR9A 3D0KA 3PPVA 1VE5A 3WLRA 3V4OA 4GOOD 1QYVA 1YAHA 4IAOA 4LDPA 5DYIA 3IESA 3GB9A 3QPBA 4DUGD 5BOSB 2OG2A 3D4OA 1Y80A 3PNQA 1C9EA 3HBMA 1NYRA 3V6MA 3F3KA 3N5CA 1U1EA 2ZI6A 5JAOA 2EWMA 3B1XA 3I9FA 4HUQA 2X1HA 1GQRA 3W7BA 1GOTA 4UASA 3T99A 2O8CA 2H4YA 2ZM5A 5IJAA 3JARA 1Q84A 2ZI5A 4PAQA 3RAFC 2YWGA 4F4CA 1QHYA 2I80A 2W6PA 1WB9A 4V39A 1ZD4A 2ZB8A 4TM8A 3OSUA 4ZQIA 2C2MA 1E6CA 2FPPB 2PKXA 3M6AA 1D1SA 1MV8A 2BM8A 5DNAA 4DQUA 5AUNB 2YN2A 4P6VF 2EFYA 3CR8A 3T7SA 2IYSA 3ZDYB 4TUYF 1YXMA 3OESA 2GN9A 2I7TA 3FW1A 4HXFB 2W6NA 4MV5A 5EEHA 5JHHB 4IX9A 3WNDA 2PMKA 1N1DA 1R0RE 2G71A 2ODQA 4DCMA 4YR9A 1FQOA 1D2AA 1K8XB 4A0RA 4UHHA 5K4GA 5H02A 2X2PA 1T5IA 2WILA 4GD3Q 3ZX4A 5B55A 5C8ZA 4AW9A 1ZM2A 2WJIA 4PHFA 4OUDA 2IDMA 3MQ4A 5GOTA 2W48A 1PK7A 4KO1S 5T8KA 2Q46A 5JO9A 1W44A 5CRIA 5HYVA 4F4JA 4ZDIA 2YFKA 3ZPXA 3KSRA 5IBCA 4QPNA 3QH4A 1C8LA 3UUGA 3M3PA 1EHYA 4V2IA 1RMTA 3JWEA 1N0HA 2C8JA 2JAQA 1P1IA 3A2NA 1BS9A 1AHNA 2FPIB 2R00A 4QDTA 3TXXA 2H1CA 4OY3A 4RJTA 5H9WA 2QQ5A 4DT1B 3U61B 1LJ8A 2R1ZA 2PV0A 4QHTA 2NP7A 2AN5A 3PI7A 3PTZA 3IQZA 4KC0A 2I9PA 2RGRA 1NUTA 1C4KA 1JWAB 2ZROA 4U2EA 3UPUA 4X7PA 2VDKB 5ALSA 1O94A 2EX1A 2REXB 2JL1A 2K7ZA 3CISA 4NZMA 1XTJA 3SXUA 3HA3A 5IT0A 1BMTA 3FHTA 4YT5A 1JKFA 1JX6A 2ZGVA 3AEKB 4WKPA 2DCMA 3OQVA 3T9AA 4NG5A 4W7SA 3F7OA 2HJ9A 4PLFA 3SIPA 1N1EA 1KDOA 1XELA 2ZB4A 3LJKA 3BSWA 4G9BA 3HU1A 3USES 1OFIA 3SKYA 4DLZA 3Q1KA 2Z2IA 5BUZA 3N0RA 3F7MA 4BFSA 1GZUA 5BR8B 1TU4A 4OI4A 5EP1A 1JI0A 4BCBA 4DV2B 4C2BA 1NMSA 1OXBB 1RZUA 2J3IA 3SZOA 4XLZA 3U13A 2D5BA 2D3TA 4FK8A 2H1OA 4MJ3A 2B21A 2GPAA 2WKPA 5REQB 2PLAA 2FK8A 2PWBA 1PIWA 2C78A 4KAJA 2BZSA 5ALUA 5KTYA 1YDFA 3UFXB 2PH1A 4HNGA 4OXYA 4BFLA 3V1YA 1FDVA 2P6MA 2AEFA 2W6QA 1GPKA 1RPZA 4KJZA 1WMAA 2CMHA 1PD1A 4P54A 3M4YA 4HH4A 1CRPA 4F91B 2I66A 3C98A 4OYRA 3K0AA 2ERCA 3N86A 2QN1A 3UH1A 3VDQA 1J06A 1WTCA 3FI9A 2YYYA 5AKHA 2JLUA 2RAFA 4WLEA 4NZOA 1TD1A 1RDFA 2QTTA 4FFRA 2FUNB 4GR4A 4URUR 2H2GA 4UD2A 5GY7A 2BEUB 4BO7A 8GPBA 2C2GA 1AO3A 1PT9A 3U49A 5B7GA 2Q4OA 1CZKA 2YUIA 1YZYA 3M6IA 4KRYA 4LOLA 2C07A 1Z5GA 3C3MA 1CFJA 1GN9A 2UZ3A 5HGXA 1UK9A 4KHPB 4WESB 2EP8A 2J9ZB 3O4FA 3UAVA 4FOLA 1J2EA 1XC7A 4E12A 3K9LA 5KWEA 1HEIA 3OKCA 5B4TA 3AZQA 2C5FA 4JVMA 1NULA 1H4QA 5JD6A 4Q7LA 1NJ2A 2A4KA 3KZXA 2O5CA 2VUHB 4Y1FA 4BNZA 2VJAA 5JAIA 3D5QA 2QJTA 3C2QA 4FILA 2Q6LA 2IEGA 4EMBA 3PDCA 3Q8KA 4N48A 3KZKA 3QHPA 1CUZA 2UYQA 4CWAA 4KVGA 4X9XA 1Y8AA 4H3KB 3W34A 5DMXA 3WI7A 1QVZA 4MWGA 4CL3A 4MKHA 2BI8A 3OM8A 4JELA 3T5CA 4PONA 3AH8A 4UM8B 2AOUA 2H31A 2P75A 2WWRA 3FTPA 4JI7B 1R4AA 1XFAA 1VBFA 1OX4B 4XQCA 4CMIB 4DJTA 4DFDA 1V0JA 5HTKA 3C3JA 2F1IA 1CB7A 5FUVA 4DG9A 2XB6A 5CB8A 3OY2A 3OTOB 4G3XA 5DNVA 5EN4A 4MARA 3DZFA 4KVZA 1W47A 4LVUA 2JGMA 3Q40A 3RFTA 4HGOA 3WQHA 4MLPA 4IDBA 5HUHA 1ZI6A 3DPUA 2CZCA 2D2VA 4DEYA 5IWCA 2QZ4A 3IQDB 1MPTA 3SJZA 3DQPA 1ECPA 1NFQA 2JKVA 3KJFA 3J81A 3W5VA 5IC5A 4CJXA 4KXQA 1Z6TA 4W5NA 2WWWA 4BZWA 1Z6ZA 5CFOA 5JCXA 3KQTA 2II6A 4X3CA 2ORYA 1OGYA 3ZHUA 3H6HA 3SJ7A 5BWBA 3I5AA 2P78A 2Q8PA 4Z4GA 4JBWA 5BW4A 2GCOA 1IPEA 2GWRA 3O1IC 3R41A 5U4QA 3M1LA 4ZT7A 3S44A 3ZLTA 1ESZA 1QPZA 3WHIA 4MW1A 3TK1A 5AQEA 1NU8A 4BP9A 1ADCA 1NR5A 3BWYA 4TL6A 5E7QA 3H42B 4X6YA 1QWOA 4MO9A 2W93A 2IYQA 2J30A 2OP1A 4HQLA 4YI3A 4AZSA 2BF7A 2M1XA 2AFHA 1VGRA 3GELA 4BMSA 2IS1A 2YICA 3Q7IA 4EPYA 1E9BA 1NBME 2YIJA 3PYLA 3RKRA 3URMA 4ZU6X 3A6GA 4DR3B 2JAXA 1I80A 2OYSA 4B6PA 5DRTA 3HJBA 1EEXB 4KAFA 3UKOA 4ZI3A 4GZLA 1CJCA 2D1SA 2GSDA 4JUBA 4Q4LA 3KVVA 2VEDA 1XRPA 3H3XA 5D6NA 5B1HA 1TTQB 4L8VA 1QGYA 4BPBA 1KR5A 4GFDA 3KDPA 1UWLA 3IC5A 2ONYA 2FZ4A 1M83A 2VAPA 4IDGA 3UAZA 1GQOA 1JEDA 4LJ6A 2F43B 3BHNA 5JJCA 1Y5IA 2VA9A 5AXAA 4XB2A 4CEHB 2FU5C 4Z7OB 4G0YA 3WICA 2OKGA 1XUOA 3GGOA 1Z4LA 3ZYZA 3RS5A 2FEWB 3ZWPA 4MWSA 1KYXA 1PHPA 1WOMA 3QFHA 2CY0A 1F9AA 1RP1A 5FULA 3RVBA 5KIAA 1CD5A 5KHAA 5KYYA 1BCSA 1YR1A 1TGYA 3EC2A 1SUPA 1B1AA 4H77A 5GTDA 1EP3B 5DWVA 3R23A 2FN7A 1E5TA 1X7HA 2BPOA 2NV0A 3EA0A 2HLDD 4GHWA 5FAXA 2FZVA 3EVCA 4O4IA 1SOUA 3QF4B 2VNJA 4QVGA 4CL0A 2ATIA 4LNUB 2JKZA 2BJWA 2UYOA 2PO7A 4KQ2A 1UEIA 1XZEA 5D3MB 3Q72A 2UYHA 3H6KA 2IV3A 5KX5A 4BQSA 2C7QA 1I33A 4D57A 2GXQA 3Q2IA 3AIIA 3VDRA 3DZDA 4TGLA 5E8RA 3ZDZB 2SKCA 3C8UA 4BLUA 5A7FA 5ABPA 4OF4A 3NV7A 6AT1A 1ZM4A 6REQB 1YS2X 5JEEA 3PHCA 1I3NA 2P5SA 4AC9A 1SCNE 1Q20A 3DOEA 4P2BA 4Y6PA 4AXXA 2OHGA 3FNGA 3FRHA 4V0LA 4XXHA 1VCOA 4LBWA 4A0FA 1X9IA 3E48A 4QOFA 1WKBA 4ZZ1A 3W6ZA 2OV1A 3K8YA 4BAZA 1P4SA 1WF6A 2QG9A 2ZULA 3ZZNA 3CVUA 5JSZB 4IHQA 3JQAB 4XYGA 1A71A 3CBQA 1JJVA 3NP9A 3HZOA 4L75A 5EPUA 3WKCA 5IK2D 1JN0A 3E1SA 4O2AA 4F5ZA 3ZNOA 5B6IA 4FZVA 3DKRA 1DAMA 1QKIA 3OPNA 1C3OB 5JQGA 1GTZA 1M6EX 2WJ3A 2ZE6A 2BDUA 2BC9A 1QH1A 3T4XA 4A2PA 4NHEA 4MR8A 2HWUA 5AO9A 1GTG1 2BLLA 1P7YA 3U1TA 5EIWA 2IUEA 4FLMA 9GPBA 2I7VA 1YL6A 1WNTA 2G8LA 1T24A 1KI1A 3NTXA 1E7RA 5LP6C 2Q2WA 5JNWA 4Q3AA 3LQ1A 3FLMA 4GIBA 4IOKA 3ANMA 2JHFA 3R2JA 4MVJA 1P2FA 4NL4H 3RBVA 2DQSA 2GWHA 5KS2A 3MT9A 2QR2A 2FN4A 2OOKA 2YJ6A 2ZRIA 4EKYA 1JHRA 2D00A 3PE3A 4LS3A 1ZC4A 1LZKA 3II6X 4C6SA 4KYTA 3K6RA 2VRCD 3KYJB 4F72A 1E98A 1UMKA 4IGKA 5E2BA 5G1PA 5F3WB 5GP1A 2FW0A 4MTLA 5B3LA 1R6AA 2G67A 4M1KA 3GPLA 1AJEA 2O3TA 2QYSA 5FTKA 4C1NA 3IUPA 4CF7A 1YRWA 5DW0A 1QK4A 5IZ4A 2VPXA 1M7GA 1ZNWA 3N2KA 2J0SA 1J0EA 3FLEA 3WB0A 4KR3A 1RFLA 2V7EA 1G5RA 3EBLA 4ER7A 3IILA 1NL3A 2OG1A 1AO0A 1KJNA 2Q5FA 2CVQA 5BSFA 3GLGA 2WQZA 4S1TA 1EK6A 3HL4A 2B4YA 1XJWA 4M86A 1NJFA 3P9XA 1GU7A 4JZYA 4MI3A 3KQSA 1QLHA 4I9HA 1MJHA 4ZALA 3VNUA 1A4XA 3CE6A 4CLRA 1IBKB 1EWVA 2A0FA 4YXWA 1XZPA 1TKAA 1E1RD 3GXBA 5CITA 1FQKA 1K92A 2I6FA 1LSOA 3VR2A 4H1WA 2OAGA 1WG8A 1P2TA 2YXBA 5EL0A 4B3JA 3ORYA 1K08A 3DC7A 1AKQA 1XYGA 3A0RB 3ELYA 1N7JA 1EFVB 4LF8B 3C4VA 3H9UA 3EG9A 4H16A 4C14A 4COOA 2QTCA 1G9TA 2R7KA 1Z56C 3RB8A 3PL1A 4HWKA 4P92A 1T10A 1X80B 3EAQA 1JG4A 3VAYA 1AE1A 2EIXA 2GA9A 3CN7A 4UPEA 3I01A 4MVJP 1XZBA 4GNRA 4TL7A 4WFQA 3UATA 1LSSA 4LTDA 1C7QA 1Z6GA 1P4AA 3M1YA 4O29A 3AY6A 4CG2A 3IBYA 5JC8A 3NIGB 1NLFA 1JHMA 1O03A 1V9CA 2ZUDA 2YZNA 2JCXA 3AJ8A 3MJ4A 2Q62A 3VI3B 5BUCA 2FHSA 3JAKA 4G8DA 4MUIA 2AN3A 1DTWA 5CW1A 5IJWA 5JNUA 1NRXA 2B34A 5IZCA 2BIFA 3ZZTA 1THMA 2WUVA 4QIHA 521PA 1A9RA 1ECJA 2FJPA 4M36A 1KFCB 1XD8A 2F55A 3JWJA 5LBIA 3WL5A 2XZLA 4AZWA 4TQGA 1GT6A 2Y93A 1NVEA 4LYJA 4EB3A 3TSAA 1JEYB 4RHFA 1EG7A 1JF8A 2GNPA 3TD6A 2NYAA 3ANYB 3G88A 1P6UA 1H1TA 1L0BA 5D1HA 2X0RA 4D41A 5L45A 4O2RA 2HCTA 2BKXA 1UDWA 1ONNA 2AQ8A 3JQFC 5EGNA 4EGSA 3WBBA 1QH0A 1ZD3A 4PSAA 3GFRA 3AEXA 3LBFA 3AHFA 3OF3A 1PZXA 2Q5QA 1VKRA 2VRNA 1JIKA 1JPUA 1RIFA 3V3TA 1VJ0A 3KJZA 1E5QA 3QKIA 4LC0A 4LN1A 4IYRA 5AR1A 4AECA 4DNXA 1OB2A 3MCVA 4D9HA 4MCAA 4BFZA 4Y6SA 3A1VA 3T3OA 4C88A 2DUUA 4FZRA 2WU8A 4A1OA 4EI7A 1BDHA 1AXEA 2NZUG 2IUSA 3QXXA 2DWPA 2GASA 4EJFA 3M6VA 4OH7A 4CKCB 3DHYA 4D9JA 1UBFA 3KB2A 4WMLA 1II9A 2UV8A 5CB6A 3WK8A 1H4SA 5CA1A 3KLPX 3ZDBA 2Q99A 2PRJA 4IJ5A 5DLQC 1K6EA 3EBPA 5I9MA 3RASA 2QRUA 2AI3A 1KY4A 4FGWA 4TTAA 2J85A 3MLEA 3H4MA 4KCGA 5FPHA 2FWMX 3HRKA 1GGEA 5BQFA 4CEJA 3W78A 3ZZUA 4QRDA 2X8AA 3LXMA 4HDAA 2GKOA 4BB5A 3HYSA 5EJGA 2IYNA 3EQZA 4ZI7B 5K6RA 3PITA 4KE9A 1GKUB 3MRTA 2ZLBA 5EJEA 1OWPA 1X7XB 1XZ8A 2GYYA 5ILGA 2XQJA 1G4AE 1CB0A 1YZNA 4TKVA 4NJEB 4C2TA 1JYFA 2NTVA 4OHOA 3DBHA 5EPEA 5G41A 4N7MA 2C83A 3LZ6A 3FRJA 3PQ3A 4W9NC 4BATA 1ZN8A 3A26A 2HDOA 3MCTA 2MHCA 4JC4A 1UZMA 5GPBA 1KI6B 2P27A 4H3HB 2AE2A 3DLTA 5H3CA 4RPKA 3DVRX 4OG2A 1NW8A 4TTSA 5BQ5A 1ZU5A 2YWHA 4CM9D 1UPXA 2I62A 4JDPA 1AKTA 4MHOA 2BSQA 2NZXA 1A9XA 1ZD5A 3UAXA 2GA8A 3NWPA 4NBRA 3VC7A 3WHLA 3SWWA 4YCMA 3IS3A 1W4CA 1FTNA 2Y0CA 4HP8A 3GEBA 4ENVA 3PR1A 1Q3KA 3QNUA 2XCOA 3F5QA 4V3BA 2QT0A 4R98A 2OV4A 2BFCB 5ECWA 5HRAA 4Y18A 4EJ2A 4LXQA 5I7UA 3E3OA 1PNQA 3WGUA 2Q29A 4ZVUA 3H5TA 3VZDA 4B4DA 1VKZA 2X5KO 2ZBUA 3T7EA 2B7CA 3Q7PA 3P4UA 3VTAA 3ZCQA 2HPAA 3LYUA 4JQSA 3L2OB 3PJDA 1JKMA 3VNRA 1B8VA 1VL1A 4H60A 2KS6A 3SN6A 3QX3A 5B7QA 2R2AA 1SUFA 3PPWA 1KEWA 4Y1RB 3E7DA 4BMPB 1O4WA 1UOOA 3UOAB 1Y1LA 2JEYA 2M32A 4Z7JA 2O07A 4MYHA 1TKRA 2EFHB 3RGGA 4LXGA 4NG4A 1U6IA 3ASUA 3UKDA 4ZCIA 4FZJA 4QYMA 3AM1A 1CUEA 3JQQA 1X1BA 2XE6A 3LWNA 5TSDA 1VPTA 4O2BF 3BJRA 2AGVA 3PZBA 1I4LD 2BUCA 2Z2ZA 3CKLA 1M10A 3DAHA 3U4HA 3AERB 3AU9A 3EMDA 4TOIA 4BRWA 2GNOA 2WZQA 5M34A 2IH5A 3TX2A 2GCEA 4LF7B 2WJPA 1S8AA 4QBIA 3P2MA 3K2BA 5FUBA 2EARA 4MIKA 1PN3A 1N5LA 1TZ2A 1XTVA 4PRKA 1LVUA 2OV6A 5JE8A 5TMDA 1FDRA 5AM2A 2H17A 2ETXA 5B7NA 1TMYA 4JSRA 5CXQA 4EARA 2A5GA 1DX4A 2FRDA 3I9OA 1KFEB 4TSFA 1EVYA 1ESDA 4FMBB 2WQ6A 4AY6A 5AVYA 2VNIA 4HSEA 1KJZA 1X9GA 2H4JA 3GDHA 1TQ4A 2ZCVA 1H0RA 1L1EA 3FI0A 1R27A 2I2WA 1S8OA 4H1HA 4Q37A 1JU4A 3ZQUA 4DRXA 1F3OA 4L5JA 5AXBA 5I9SA 2EZ4A 3B78A 3SF8B 1W5FA 3FCXA 1G2IA 3E4CA 1L7PA 1UFRA 4IWXA 1L1FA 2ZRCA 2ZBFA 5ICGA 1H5QA 1C5KA 3K0HA 1SCJA 3N7TA 1QK5A 1B76A 2I7CA 2G3YA 1I5EA 2ACEA 4INJA 4J07A 4RE5A 1VSQA 3SYNA 4FINA 3QPAA 4L50A 5DSZA 2GPBA 4MPPA 3EIFA 4ZARA 2BGRA 4F84A 2JFBA 2IEAA 3PDUA 5AOVA 4DYHA 4KVAA 4GSYA 4REQB 2P0YA 2PAFA 3OH8A 3MCAA 3GRZA 4D96A 1Z34A 1F0NA 2E4YA 3FUXA 4DGQA 1QE0A 5FO0A 3GUHA 1EG2A 2HEIA 2X6QA 1HSOA 1Q1BA 1FYVA 1WW3A 3K32A 2PGJA 4WXEA 4EB6B 5L3QB 1VPWA 5DM70 3BICA 1X1TA 3AXTA 1JDVA 2YWXA 3VRHA 3CWCA 4D3ZA 2VPWA 4DR1B 2ZREA 1IHXA 4OAQA 4MWEA 4U3JA 3MSXA 2WTMA 3OZDA 2AMLA 3BGVA 5LMNB 1BHQ1 1YA8A 2PKYX 4AP6A 1XF9A 4LV6A 3R9KA 1QIFA 1T36A 3T9DA 4IRUB 3UT5B 1W1IA 3L6UA 4QNRA 5HQ3B 3EARA 4KQ6A 2CJXA 2EU8A 3AHEA 1T6BY 1M2VB 4OMFG 2B37A 2BHLA 4PZAA 4TUYB 5FUYA 5JZVA 2QM0A 5LIPA 3FOCA 2DSTA 3T3EA 2QTBA 2REBA 3WYDA 1U65A 3TAXA 1M5UA 1UEXC 3FFAA 4RA9A 2F90A 5JXWA 5CD1A 3T1QA 3GPDG 3SMVA 3E3LA 4B5LA 2HBQA 3KZVA 2HTFA 2P2LA 2AE1A 4H17A 1ZWLA 4JQCA 5JYDA 1MP0A 3WAGA 2C94A 4TQ9A 3TIGA 3AL0C 3PL5A 1WUIS 1HT3A 3QIAA 3IQIX 1ACLA 4BGDA 3D8HA 3FUVA 1EE1A 5K09A 1RJDA 3WGNA 5TGDA 3BMNB 1JR3E 3KQLA 4GEKA 3FMVA 4QM7A 5BOSA 1ACMA 2JH3A 1EFTA 3OOJA 5CW2A 1K3TA 5AVQA 3VKWA 1OTXA 4BFTA 2H4WA 3GN1A 3JX9A 3NVAA 5BURA 1W36B 2DR2A 4PQEA 1QTRA 3K1ZA 3TN7A 4JVNA 3ILXA 3IE1A 3CEMA 4PSUA 3K1YA 2GZHA 4XGKA 3W5HA 1UDBA 4BIMA 1JAZA 1DG3A 3NNSA 4CKEB 1ZMOA 2PKCA 3A6LA 4LQDA 1EXDA 1KMNA 1VIYA 4BWYA 3MWGA 2CUZA 2FPPA 4XIGS 2PG3A 3GCXA 4NCXA 4QEZA 4F2HA 1CQWA 3HMKA 2Q0XA 2ZBVA 3OIGA 2D5IA 4MJXA 2GXUA 1BFUA 5A9TA 2CFIA 3A6ZA 4EUHA 4F3CA 1ISPA 3PFKA 2EKDA 4JT9A 3IP1A 5ELMA 4EA8A 5LIRA 1VPDA 2V7QA 4YYZA 1EESA 5E3HA 3OQNA 2CCGA 1EWKA 1P7WA 3KD3A 3DS8A 3FROA 4PXAA 3WSWA 4D9MA 4DLKA 2LW7A 1TM4E 2OXEA 3OZSA 4FHEA 3GUCA 1FBNA 3RIMA 5MGNA 1AQUA 2OBNA 2QS9A 3C6BA 1CUSA 3RC8A 4NC9A 2A33A 2GTPA 2JAWA 4BJ5A 3CURA 3MS7A 2R87A 1E3IA 1D2RA 2YNMA 5BNZA 5AHKA 3DMDA 5DV9A 3B9RA 2HLHA 2VK2A 4J0KA 4RENA 4EHJA 1UR5A 5CIWA 1DELA 5FTJA 2FPIA 4HXYA 4EM6A 4PGFA 3RREA 2PZMA 2G28A 5CT4A 2G9NA 4FQ5A 1I1HA 4JCOA 4RY9A 5FI0B 1KWKA 3AF5A 3TPFA 4DT1A 2TMYA 3L7IA 5SY6A 1L7XA 1PNTA 3DBIA 3QSYA 2FW6A 4Q9JA 3BULA 5AW6A 4UHFA 1RE0A 2JFZA 3G0DA 5JROA 4B85A 4LDAA 1CRLA 1FP4B 1HG1A 2ZTSA 3FDJA 4FX2A 3M6XA 3ENNA 3C8HA 2VAXA 3KAQA 4LF6B 5CXUA 4B0PA 3SVZA 2GHTA 4RD3A 5J4LA 1P3Y1 3AEKA 1VMIA 3QE4A 5BWMA 2AEJA 1T5LA 1B0ZA 5H81A 2NVOA 3PUKA 1OU4A 3F2VA 1DX6A 4DSZA 4CCYB 4IHAA 4K9MA 3ZHQA 1LX6A 1GPLA 2E4ZA 4OK5A 2IP1A 1A7AA 2B8EA 2CVFA 4ENQA 4XJSA 4M0FA 5FUMA 4MVCA 5REQA 4G1VA 1MJGA 1S2GA 2AN9A 2DT8A 2D1TA 1E6LA 1SEPA 3GFGA 5E38A 4BO6A 3V7FA 1NT4A 1WD7A 4IQ0A 1IOVA 3F6EX 4Y6QA 1NC1A 3UFXA 3PXDA 1H3FA 2VBCA 3ESYA 2Z5FA 1YR8A 4KAAA 2G0NA 1KIAA 4IM7A 4YLYA 2O19A 3LLVA 4B47A 1SIBE 1W8DA 1HE3A 5J3JA 1LPNA 3EXFB 2FWPA 3UV7A 3QKTA 2WUGA 3ZHXA 5FNVB 1H2FA 1ZM7A 3HN6A 4RADA 3OFND 2N0SA 4AN0A 1TKBA 1Z15A 1ZH8A 2O4CA 3A9RA 3HE3A 3N0TA 4L08A 2BEUA 4WOJA 3L8FA 4BLOA 3DLHA 1LB1B 4FMDF 5LLDA 1OYWA 5H68A 4KN9S 1RWWA 1V7ZA 3PCRB 3R44A 4UHEA 4E7OA 4DIKA 3E6AA 1C4WA 3AR7A 3AZPA 3MOSA 4FDLA 4YR7A 3EDRA 3BHIA 4WESA 1PSZA 4QDZA 1XAGA 3CIFA 2CBGA 4LQLA 2W90A 4EFLA 3KSBC 5F2OA 5DM2A 2AG1A 3ILSA 2X9QA 1SHLA 1XYVA 1IUNA 1YMQA 3LQ4A 5AMXA 3ZHRA 2CC2A 2Q5HA 2QF7A 1SVIA 3MTEA 4LDQA 4NCHA 1U5BB 1FUEA 2J9FB 4EX6A 5IP5A 4B7UA 4DWOA 5B58C 3ADKA 1M6HA 2HF8A 5JEDA 1MQ9A 4GP7A 4HAVA 2OCYC 3VTKA 4M89A 4F46A 1Q19A 2I7XA 1LDGA 2H5IA 5CHYA 3DMGA 3ZU5A 4FYJA 3R7AA 3GQBA 2G5TA 3GFSA 4L85A 2DPGA 1C80A 5B4UA 3AR8A 4CMIA 1OX4A 1HL3A 1NDUA 4ZRMA 4DSOA 4NCNA 1V4VA 1E3LA 1BYUA 1HFEL 4A8JB 3GDOA 1D7AA 2GJAA 3QHQA 4HB4A 5H3HA 2PM8A 1GYQA 3PQ2A 4TM7A 3V42A 5JMPA 3U4MA 1JECA 1GFSA 4BO5A 4PPYA 2VP3A 1WUJS 4QSMA 2XQIA 2ZUBA 5EY5B 3HNRA 2I6UA 1Z0ZA 3DD5A 1PR9A 3TD9A 5JCOA 2FSPA 4EZIA 4MYDA 5AVTA 3E9RA 1CR1A 4IKPA 5CUQA 2ECKA 2JPDA 1WSWA 2HA3A 2IXFA 3KKKA 1XI2A 2R85A 4R2HA 4RKRA 1WIWA 4E2ZA 4ZCRA 5KEIA 3ORRA 1WULS 4GPIB 3CH6A 4NRDA 4TXLA 1NE7A 4Q7JB 2A9RA 2JFHA 2GXSA 2AYYA 1Q95A 2F6RA 3E9YA 2FQYA 2VF2A 3ILYA 3SLRA 2CJFA 5HSGA 4BE9A 3KPUA 1IRXA 5KNDD 1VHDA 5IH3A 4AY5A 5FP0A 1EB8A 4RHCA 2IODA 4Z5XA 1OFUX 2W2LA 1CZRA 3AKDA 2FYTA 3DEZA 3IUJA 4JI3B 4F5EA 3WRVA 3M0EA 3CIOA 3BEDA 1IB0A 4CG0A 3JYLA 3P97A 1Q91A 1V9LA 4JBHA 3JQEA 4GSLA 4K6CA 5JAMA 5MHTA 1U6JA 2Y77A 1B4DA 2XUDA 4EECA 4ZJUA 2LD4A 3C3WA 3MFQA 3IQWA 5F5NA 3SZMA 1Y7TA 3D3KA 3BH6A 1PVVA 1S7GA 1J99A 4PCAA 2YIVX 3ZK8A 2XSZA 4MKGA 1QIIA 4DS3A 5AK5A 1BAPA 1SBZA 1G5FA 4ZPJA 4F9EA 1IWPB 4ND8B 3SEFA 3NV9A 1DJNA 2OGZA 4R1SA 3LNCA 2OV2A 1ZA1A 4US0R 1XTUA 4FC7A 2XW6A 3VVLA 1U8TA 1NQWA 2GM3A 4M0DA 5CCEA 2F43A 1AUQA 1RCUA 2V5AA 1NBMA 1OH8A 3NZEA 4NYIR 2M9MA 3UIEA 3NHSA 4DHEA 3AVXA 3A6HA 1OWNA 4HVLA 4CEHA 4OFXA 4O25A 2QNIA 1CZLA 2I3BA 1T4GA 3Q98A 4KUHA 4DV7B 2GVNA 4AYXA 3SR3A 1YMVA 5AT1A 4LX8A 3H5OA 4UD6A 2OD9A 2EYQA 3MJCA 2IOYA 4P22A 4E4YA 4ZJPA 3EIXA 4K6GA 4A8PA 2CXTA 2WOJA 2AUTA 1L2TA 3CT6A 5C1OA 1U4OA 3B3GA 3KE9A 2P8SA 3QF4A 4GXNA 4ZEMA 3PUIA 1GAQA 3M89A 1SJ9A 5D3MA 4N3NA 3K09C 2D54A 3TLBA 4XR9A 2E4UA 1SUCA 2Q3CA 2WT9A 1B8PA 3L1HA 4NBKA 5FDFA 2XHZA 1I7NA 1B0PA 3BVPA 4G5FA 4Y6RA 5ALMA 5H16A 4HG2A 2E21A 1EDEA 2O23A 1U80A 4DQVA 6REQA 2NO9A 3NBFA 3S27A 4UUAA 1TA4A 5KTMA 2NTJA 2IDKA 1EQ2A 1LPPA 1MENA 4GMXA 3U3OA 3WJAA 3R09A 1JHAA 1QYDA 3QX8A 1AC5A 3RV3A 3N3AC 2H48A 1N0IA 1G5IA 1Z4NA 2PXCA