1FS6A

Glucosamine-6-phosphate deaminase from e.coli, t conformer, at 2.2a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility, an essential component of the allosteric activation in Escherichia coli glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
total genus 97
structure length 266
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fs6A00
4L50A 1JT9A 4R9NA 4M8LA 2OKGA 2BKVA 2J0EA 4L51A 1XTZA 4R7TA 1HOTA 1DEAA 3E15A 4IO1A 2W48A 1FS5A 3IXQA 2RI0A 3CH7A 3NZEA 3EFBA 3CSSA 1UJ6A 3ENQA 4L4ZA 1FSFA 2R5FA 4TM8A 4GO1A 3LHIA 1Y89A 3UW1A 2RI1A 1LK5A 4NMLA 3TX2A 1FQOA 1VL1A 3KV1A 1PBTA 2BKXA 3ENVA 1HORA 3HHEA 3KWMA 3LWDA 2O0MA 4L5IA 4GMKA 3ICOA 1FRZA 2GNPA 3BXHA 1CD5A 1UJ4A 1O8BA 3E7FA 4OQPA 1LK7A 4TM7A 5HJ5A 3BXGA 3ENWA 3BXFA 1KS2A 1LKZA 3NWPA 4L4YA 3EB9A 3HN6A 1M0SA 2F8MA 1FS6A 2WU1A 3L7OA 4OQQA 3OC6A 3BXEA 1UJ5A 4L5JA 4X84A 1NE7A 3U7JA
chains in the Genus database with same CATH superfamily
3PE4A 4UREA 2ACKA 2PDAA 4I8XA 4MZXA 1A71A 1SD1A 2QRMA 3EZNA 3HEAA 1C4OA 3IMEA 1FU8A 4ZJYA 4W63A 3AF4A 2W2QA 3Q0IA 4HXEB 1B26A 121PA 1XZMA 4HOYA 4L3WA 3IQZA 2P7IA 2GAIA 1GPMA 1NF8A 1Y3AA 1M9NA 3H5LA 4QOIA 1N25A 2OFXA 1IBLB 4GFDA 4BO4A 1KAMA 2QT1A 2AHRA 3HKCB 5LKAA 1GGEA 4OP2A 1YJXA 3LQ2A 5K0NA 3AVOA 5BYBA 1AH2A 2HZ7A 1GNLA 1KZ4A 4KODA 3TFQA 5DX8A 2XD4A 1N9KA 5A0VA 1T1RA 3NBMA 4QBTA 4LBZA 2O8DA 2R48A 1DJPA 1BQEA 1X80A 2EDAA 1S9HA 1W73A 1FLNA 4QDOA 3V1TC 4C14A 3GLHB 2I80A 8AT1A 5CVCA 3SFZA 4C0JA 1MF7A 2Q2OA 5IBRA 5AVZA 2JAPA 2NO0A 4L95C 2OOSA 2PXXA 2NXEA 1ODLA 1FS5A 3K96A 4LUCA 1NUAA 2E55A 3I6BA 2GOYA 3KYCB 3M9XA 3UAWA 5KUTA 3G0IA 4DMMA 4JJ7A 1NOKA 3HXQA 4Q47A 2RD2A 4W8HA 3OEED 3I1JA 4TZKA 3RFTA 3USCS 3R0QA 5EJ5A 4JJ8A 5FTLA 3PYXA 4BKUA 1Y8RB 5EZSA 1J06A 3DMFA 2E0IA 3A2KA 5KHOC 4BRZA 1YI0A 4HQFA 4OTZA 1T9GR 2FPSA 3IMKA 4EUHA 2GCOA 4U5XA 2RBEA 5L6LB 4LS3A 3R7SA 1RTKA 2CY0A 2AN3A 4PHCA 2PMEA 3T7AA 3PB3A 4YPVA 3IEMA 4KPGA 5L3VA 5KEIA 3E7WA 1O8CA 3R7FA 4OEHA 4DNXA 1UWCA 4NBNA 5MN6A 3LUKA 4EJ6A 3GEDA 3TIVA 1WBJB 3IPRA 1KMMA 1RWVA 4KDRA 3RVMA 4TXMA 5T4BA 5BMVB 3N53A 4TYNA 3WYAA 1A9PA 1JNYA 1WO8A 3OY2A 3SEZA 1F14A 2ZUTA 1C3JA 3N7TA 2B3TA 4DQLA 1U2TA 1JAHA 1Y7LA 4QA9A 1U9IA 4RVFA 4G63A 1UIMA 2D0OB 4ON9A 4PF1A 5CG2A 1KEEA 2AD1A 3VSBA 2JIPA 1FLVA 4RD0A 2DTEA 4J1QA 3TGWA 2XCRB 5JQGB 1XEXB 3Q3GE 4D3XA 5LJLA 2EKBA 3T3GA 4BNJA 4RIGA 4DFDA 1XC7A 1GG2A 3OLZA 1L1EA 4H3HB 4H27A 4YI3A 5FPHA 1BWQA 1QAMA 2XUJA 5B58C 4UE2A 1QS0A 4W8GA 1E0JA 4PR3A 1Q16A 3LUFA 4NE9A 1H8EA 3K5PA 4FDUA 1XZHA 3H1TA 4GUDA 2ZBRA 3LI2A 3M82A 1SXPA 1ML4A 3Q1LA 3MJ4A 5JHHB 1GG5A 1TU3A 1Z6GA 1EVEA 3UYKA 3U4QB 4W6QA 2JCSA 4WFJA 1XL1A 2O07A 4MVJE 3RRMA 1ONNA 3SSNA 3X3HA 5FV7A 3AKYA 3X1YA 3BCSA 4N03A 3HLTA 1OYVA 1MAUA 2HPVA 2WYIA 3HB1A 4UVGA 1JIIA 3AESA 1WCV1 2VDVE 2WHXA 4NBUA 1Z6ZA 5C32A 3T7EA 1NC3A 5CJJA 5K4AA 3K70D 5CDYA 4ESOA 2CN1A 2H2IA 2WLSA 2YASA 3TI7A 4ASUD 2FJUA 1GZ4A 3EDYA 2ON6A 3TTVA 3BXXA 5DT9A 3LX6A 5LUBA 4LHWA 2ONJA 3WGJA 2Q4RA 3OOEA 1F4VA 2ZJ3A 5G0WA 4EUEA 1ULSA 3KM0A 4YQZA 3O83A 4AYWA 1Z7YA 2VCHA 1JPVA 4CLRA 4YJGA 3ZHCA 3LTNC 4HWSA 5DNEA 4N5MA 3DO6A 3UFXA 3B89A 1SCBA 4BNGA 5JNTA 2HADA 3RUIA 2A0WA 3I6IA 4EGFA 5KWSA 1YOBA 5E2AA 4ALKA 3ZWKA 2O1EA 4C43A 1O97D 5CEEA 3QFTA 4FMCB 3TZ6A 3PTAA 1Z82A 4KQKA 3ZYCA 1S3IA 2E4UA 4P7JA 4BQQA 1AKNA 2H1FA 1SOVA 5EGSA 5F51A 3NHZA 3JQFA 1GPH1 4H1UA 2YHUA 2ZPTX 2A9QA 1FCJA 2J9RA 3HCBA 1VLZA 3QLUC 5LXTA 1ZM3A 3QFCA 3HL0A 1DKOA 4JEIA 4XM0A 4HQ0A 4AECA 5CDSA 1O77A 2QN3A 4J0GA 4B6GA 4O0LA 4WN3A 1QAQA 1F17A 4WXPA 1HY3A 1NUQA 2DTXA 4ISBA 4FYKA 3R9XB 2GAOA 3PI7A 2GF9A 3D4IA 1KMQA 3VVCA 1EB8A 2PFKA 5B3LA 4O2BB 4RVNA 3V8BA 4B6RA 1Q17A 3JZDA 2GN1A 4Y0AA 2QMEA 2WJHA 3FPFA 3KV1A 1MU0A 2RGNC 3FHLA 5KSYA 2NVBA 4YRZA 2CXUA 3DXFA 5JAUA 3OE7D 2ZRHA 2CFCA 4TQAA 4CM4A 1U0JA 3Q85A 2CXTA 5KYYA 4RZUA 2C77A 4GC5A 1WP9A 1E9CA 3C1UA 3DEHA 2JEZA 1LKZA 2W8BB 4KO2S 3QQ5A 3MWDB 4OQZA 1Q44A 3AR2A 4GQAA 4MKXA 1FSGA 4YP1A 4JV5B 4OBBA 3FSGD 2IOFK 1JXQA 3KTAB 2BEVA 3MJTA 1VJCA 1DUVG 4KIUA 4LOKA 5CJPA 4IINA 1WSWA 2W2PA 2VYQA 4JOCA 2P9BA 1W85A 2C9OA 4LJ4A 4NEQA 4TOIA 1OB5A 2ZAIA 2RI1A 2BSQA 1ZCBA 1NR7A 1CZKA 2WHQA 3ENNA 3EXAA 3DD1A 4I99A 4AP5A 3LCRA 2VQDA 3ZE0B 1O5OA 3HHEA 1TEXA 2Q4EA 4KFRA 3K2QA 4MJ3A 4QOFA 4GR4A 5E4JA 4ZZ1A 2PSEA 3OJFA 1FTYA 4AWBA 1NAIA 1P0FA 3I0NA 5ANRB 3LV8A 1L8LA 1LB1B 3QLVC 5IJXA 2NXCA 4IWYA 4LNUA 1XWWA 4ZVKA 2KLHA 1NQWA 2OFWA 2FPUA 3STTA 1RI2A 1KI9A 4KKXB 3IHKA 3VZSA 1M2OB 2ZAYA 4F86A 3KZVA 4KVGA 1YB1A 2BM9A 3PNLA 1WHTB 1R5BA 1SKMA 3MC1A 3BJEA 3LOPA 2V6BA 1OZAA 3IXQA 4YCAA 1KZYC 4P80A 3ORYA 4DGQA 4J6FA 4B3HA 3MGCA 3LHDA 4LE2A 4EMTA 2X6QA 2IBMA 2FF7A 2DB3A 3OTQA 2G80A 2OK8A 2HU2A 2WU3A 3GT7A 4YI5A 2WZBA 4HKTA 5K0CA 3CNBA 3CIFA 2FSIA 1QYRA 4BO6A 5I9IA 3CHYA 5F21A 1OI2A 2RHBA 3EVAA 3DV2A 3MZ0A 4QDJA 1QLWA 3HFSA 3BGWA 4YRDA 1S01A 1C50A 5GIOE 4KXLA 2ZCJA 3CX3A 3I6MA 1SBNE 2PJDA 1XZJA 3GAMA 4ZQBA 4QL3A 2DPLA 2ZYHA 1SJ9A 3AXSA 3MJVA 3TNFA 1G8SA 1YZFA 3SMVA 2Z5GA 3VYVA 3KQQA 1DBVO 2H11A 4CKZA 5J2TB 4MRMA 2ZEJA 3P0IA 3TQIA 4F9GA 2C03A 2GAJA 1RU3A 1CYEA 1FPMA 1SC6A 1HDCA 4JYCA 4B4KA 2OD9A 4GRDA 3B38A 4PYRA 3HCNA 4AWXA 2PGDA 1AK1A 4OGLA 3OT4A 3MCUA 4IQ0A 7MDHA 2GF2A 3G2KA 2XRFA 3AXTA 2QT9A 1A1SA 2EAUA 4LHXA 1MABA 1OBHA 4O2RA 3FCYA 5LB2A 1YR8A 3CR7A 2FUKA 3MF4A 4URUR 2GXUA 4WWHA 2D1SA 3JR7A 1GZ6A 2RGBA 3UMMA 1DBPA 3LPDA 3NBQA 2AF3C 4FDTA 1C9NA 1CKEA 1M2VA 3PFKA 2IE0A 5DN9A 1Z83A 4LGCA 2QLLA 2AQHA 1E7MA 1SK9A 3FYUC 3GBVA 2AJDA 2FG5A 2ZGVA 4BFLA 2RARA 1QB8A 2KHZA 3E5HA 3BTSA 3IXMA 4RXUA 4AFNA 2BH2A 4ZI7A 1ZP6A 1NYRA 3ZU6A 2G9QA 3UGJA 4BVKA 4PPYA 1PGNA 1FVXA 3SN6A 4YJFA 1OD6A 1CJBA 1XTTA 4UPVA 4I5GA 3WAKA 5LCXA 1EWVA 4L5AA 5CCBA 3ED1A 4KJZA 3VNBA 2QF7A 2YFKA 3V4RA 1HR0B 2EXXA 2AIRA 1EIWA 4XPZA 5C9ZA 1V7PC 4OG2A 4TVBA 4EJ2A 1LPPA 2AX4A 3FYCA 2P8SA 4LJKA 1DPGA 1RI5A 2OCBA 5G02A 1TC1A 1AM4D 2Z3ZA 4QAQA 5AXCA 1HYHA 4ER0A 4KU4A 2QMUA 5HTKA 2IUTA 4QBFA 1B2LA 1UXIA 2G1UA 3NIBA 1GPDG 1ZRHA 3OT1A 3I5MA 3JPYA 4ASUA 5K6AC 2Q1SA 3NX4A 1LFAA 3L6DA 3HTXA 3Q98A 3TWOA 2W8ZA 4TVKA 1H65A 1MVOA 2NACA 4IFIA 2JI9A 3VU9B 5AVSA 1SXQA 1V39A 1JALA 2AFIE 2GGSA 4GZLA 3H97A 4XCXA 3GLFA 3UGQA 4EEKA 4DEYA 2I67A 4YP7A 5FOUA 4FDVA 2IF2A 4ZOLF 2FQWA 3ZD7A 1C29B 2IYAA 2OVFA 4E2YA 1C14A 2XE6A 4XR9A 5C5DA 1N2SA 3IP9A 4HATA 2NVUA 3DKIA 4TGLA 1Y1KE 1F3OA 3DKKA 3V34A 4DDKA 1YR9A 3AINA 2C9YA 3QE9Y 4O2LA 1XU7A 4MEBA 1TD9A 4Q3DA 1PIWA 4HYYA 1H1LB 1HE5A 1M34A 4JBHA 1UL1X 1RP1A 1ZN2A 2Q07A 5DK4A 3WJ2A 4BVLA 5EJ8A 1R0XA 3C6XA 2C57A 2YJ6A 4ODIA 3L8ZA 2PYIA 2JI7A 4ITVA 4S3MA 5FOVA 4CLRB 4K8OA 4WXYB 5FPSA 3JASA 4AX4A 1JEQB 2O2XA 5A2QA 2YRWA 5EVCA 1JILA 2HLDD 2ZJZA 5K0ZA 3FM9A 1OXBB 4MJLA 2MINB 2R1VB 2PKCA 2RONA 2D1RA 4IDOA 2VXOA 4JQCA 1WUHS 3C70A 2E49A 3RHZA 1DFIA 2W2MA 3RS4A 3AHGA 1TMGE 3CXUA 3NCTA 4LHZA 3ZI0A 4D4IA 4B4UA 4D4HA 4DCOA 2HEIA 4RIHA 3DMNA 4OQYA 4V24A 3J7TA 1G4HA 3OO0A 5FYQA 2Y2VA 4AJLA 1P1FA 1NXSA 5E3IA 4RQAA 3GGDA 4M21A 4O3FA 3BE5A 4W5HA 1FB5A 3DVRX 3BMOB 2JAWA 3UJNA 3QUTA 1OTYA 3NR2A 3R74A 5CNKA 1Z5WA 2AFHA 1L7RA 5DLPA 3EZYA 4CTMA 2BZ1A 2IDKA 3MWJA 4XASA 5G0SA 3WDMA 2DFKB 2K6GA 5CCXA 3OLWA 1WXIA 4G81A 4LZPA 3RO7A 1XF9A 1MQ9A 3NHWA 2O3UA 2N1MA 3N2YA 2I6FA 3DO5A 4D7AA 1H66A 3USES 1HEUA 3IV6A 4OQEA 5YASA 2IYZA 2ZKIA 3HCCA 3LDFA 721PA 4A36A 2P4EA 2L18A 3LIIA 4G9EA 4TWBA 1Q7CA 3HA2A 3STWA 2OK7A 2ASVA 2XMRA 3BK2A 4FE4A 2X8JB 1PLKA 4EFLA 4EMSA 4HGPA 1TO2E 4PG4A 2FQQA 2Y1FA 4FX2A 3SF8B 4C7KA 4AMZA 3CRW1 3ZQJA 2ZJ0A 4EX6A 4MP8A 3AHHA 4P38A 4H7PA 4AB1A 4LMPA 2NUAA 5IS2A 4NDNE 3C8ZA 3NI2A 2XODA 4IIXA 4PVDA 4QWMA 1NX9A 2IWHA 5LQAA 2PZLA 4C6TB 3RRNA 1GGHA 1BGXT 2GZ3A 1DXQA 2EW8A 2ZUEA 2PX4A 1WQ1R 3DVLA 4BC1A 2ZB8A 1IULA 1OGIA 1K1EA 2E9SA 3AIMA 5E6UA 3RUDA 1DG1G 2VOJA 3ZWQA 5ALFA 4A2QA 2YJ5A 3DAOA 3CVVA 3T9BA 2EBUA 1JZSA 1Y6QA 2QTMA 1ZIPA 3N1UA 4I5DA 4K40A 4HFNA 5CDUA 1AUXA 1W85B 3E15A 4HQ6A 3PF9A 3UMSA 1YE8A 3N6XA 2VRCA 3DL0A 1AK9A 5FBRB 4UFNA 4TVSA 4DYVA 2IIVA 3GJYA 4TTAA 2CMGA 3W1WA 4KPUA 4A1OA 2Z2KA 6LDHA 3BKXA 1Y1QA 3G79A 3LXUX 5TEWA 1OJLA 4JI6B 3DULA 2H57A 4LJ5A 4Q3OA 3A1DA 4D02A 2UVPB 2CEAA 3ECCA 1BQ3A 3BD9A 1G63A 3OFNA 1EQAA 1DIRA 2D5AA 2WBLC 3DEAA 4TYQA 5G4LA 5B7PA 2ZIAA 1NXXA 4XUDA 1NI4B 1Y33E 3PGVA 1A5ZA 3JD3A 3IHLA 5HIMA 1STOA 2P1RA 4UAUA 4Y6PA 5ENDA 1VKHA 1W4CA 3SXUB 3TJRA 1W48A 2PM8A 4DNOA 2I2CA 4CIAA 3JQGA 1Y5IA 3KX2A 2AOTB 1DEXA 1E77A 3T1OA 5A4MS 2OV6A 4WZAE 3LBAA 2ZB4A 3K0KA 4H7JA 2BGUA 2HDNB 1E66A 1JWBB 1NQTA 4XRRA 3DMTA 1RQ2A 3CLRC 5DGTA 3QE0A 1QFSA 3QKRB 1F1JA 4BGVA 4WOCA 2HXSA 4P3YA 2HN9A 4MSUA 3PLRA 5AJYA 3VO8A 4ZGBA 5JBIA 1ZOIA 2ATVA 1KR5A 4UQLA 1SZPA 2AHOA 3JYOA 3WJ1A 4GMKA 4BFCA 1YIAA 2XMZA 1QBGA 2X2OA 2Z95A 3AETB 3HCFA 3GHYA 4QC2A 2V03A 2Q1UA 3PC2A 4JT8A 4RIEA 4XLTA 3V2UA 3WHPA 2TMYA 1GQSA 1Q0ZA 2J3KA 5K3SA 3BF7A 3ZKAA 3IBTA 3FJYA 2WD7B 3SBDA 4IYJA 4BB0A 1POXA 1U3DA 3NORA 2I55A 1W581 3JASB 1R0WA 2R6JA 1PD1A 1YL5A 2ENWA 4Q48A 4D9MA 2XUFA 3ZDZB 1XCBA 1USGA 3LTEA 1OLXB 1ICEA 4QT4A 4CLXA 4OX9Y 3HM2A 2OECA 2MYUA 4NMHA 4DXDA 1II8A 4L9WA 2BF7A 2PUFA 3NEAA 2OHIA 3BDIA 1O0CA 4LRQA 1FUIA 2FMKA 1AKMA 3E03A 2NT3A 4EL0A 4DR5B 2DHQA 4RTJA 1QRSA 1E4VA 3GROA 2D2FA 2WHYA 1FRVA 4BASA 4QRDA 4C6RA 4YCCA 3QWBA 2HLDA 4WD3A 4ND7A 5GAJA 4C0SA 4H1WA 5JAOA 1UXHA 3KB6A 4ZOAA 3FUUA 1GY8A 3KFLA 5CHYA 2VAVA 3T9FA 3KETA 2O6HA 3DF9A 1K66A 4QASA 2Q9BA 3HGTA 2EQ5A 1XN4A 1W30A 2Z9DA 3N0WA 2CLEB 3K9WA 4MWGA 1KQOA 4CG1A 4RDXA 4X1KA 4RTOA 4XVRA 1W25A 1JJVA 3RK0A 2C4KA 2ATIA 1BFUA 4CG0A 1D07A 2IDJA 4GHWA 3B6KA 2JCXA 3O2SB 1KZ7B 2PPLA 1EVJA 2ZYRA 1R9NA 1FRFS 1XWIA 3QWIA 1JB1A 2Y1DA 2XOKA 2HFKA 3Q72A 5AXAA 5UKDA 5FPKA 1E1RD 3PQ6A 5IT0A 1DOAA 3MWGA 3GEHA 2X13A 2P9YA 4U02A 4H3SA 1KO1A 1IRIA 1N3BA 5FI5A 4XQGA 5CNMA 1A7UA 1R4NB 3BXGA 1L7PA 5EYPA 3OHPA 2HHJA 3FTNA 4GOOD 5BSKA 1SBIA 2ZCUA 1I7SB 4N0PA 3ASUA 4AY5A 5JQGF 5JLJA 1M1UA 2ACVA 3A2MA 4TMWA 1O0BA 3I04M 3IUNA 4TWJA 2AOUA 4B32A 1B8OA 1JHQA 1DTWA 1Z9BA 3KBOA 3OZEA 4D43A 2WPDD 1A9ZA 1IJEA 2H92A 1JTFA 3WMWA 2WA1A 2ZQ5A 4L4ZA 1QHIA 2BBOA 1P33A 4OFXA 5AHKA 5HX7A 1Q1NA 3NJ4A 4HWPA 5K99A 1JSLA 3EIHA 3CEPB 1GKLA 2DUNA 2GCOB 2KX7A 1FLAA 1TF5A 1HEIA 4QOJA 4XDZA 4ENVA 4ZVVA 5IWCA 1DEKA 2G17A 4F6RB 4CLEA 2IYLD 1P61B 5TQ2A 5IJ9B 4ND4A 3W9YA 5IHXA 3O94A 5F2NA 1CEXA 5DM1A 5EWLA 5A02A 4BDSA 1UMKA 3BC1A 1FQWA 5IAJA 2FSGA 2VZLA 2PQ0A 4EZBA 2DFTA 5KS2A 3OA0A 4HD8A 4I66A 3C14C 3HUUA 4DPMA 2JJ1D 4AKGA 2YRXA 2JHFA 2R79A 4RHTA 1V11A 1YRYE 1U80A 1WXHA 2C58A 3IO5A 1KVRA 3E9CA 4KEAA 5K0GA 4RTNA 5F3DA 1RQLA 2NN3C 3COYA 4H7IA 2WWWA 3FTPA 1AMOA 5LJIA 2V7XA 4IMPA 3D81A 3RVNA 3GP5A 2SKEA 1JZQA 1QUFA 1G20B 1YJ8A 3IAEA 3JVEA 4P31A 1FXSA 4ZV7A 2GFHA 5HJ5A 5HK8A 1DC4A 1O57A 1ZQ9A 3F1LA 4YRPA 3VR4H 2EG9A 2PWPA 1XQ6A 3C3CA 4IZHA 3L0PA 1RYFA 3FROA 4LNAA 3T4XA 3HBLA 1RHMA 2FZ5A 3DM9B 1JAYA 2EZ8A 3C7KA 4FSDA 3WNZA 4ARBA 5LM3A 3FRJA 1PE0A 4BO7A 3L7MA 2VSOA 1YUMA 5ADVA 13PKA 2XMDA 4ITUA 4R1NA 1R16A 5JJCA 2X2PA 2XCTB 3UMCA 3PSHA 2CXHA 2WR8A 4DREA 4GXQA 3TLEA 2QG6A 3ELUA 2QTAA 1U4SA 3NPMA 4KAJA 3VVMA 3DL2A 1ULBA 3E27A 4XPIB 4R0MA 4UZSA 4E33A 2ZUWA 4A5OA 4RK4A 1ZHFA 4P5EA 4BKRA 1RAAA 4EW3A 1XEXA 3E1GA 4E88A 1CS4C 3CE6A 2BGMA 4JYBA 3JWPA 3SJZA 3EFOA 1ZOLA 1QF7A 4TVOA 1N2HA 2H48A 3WAJA 4OL9A 1IM2A 1NQAO 4F38A 4CMJA 3U7HB 1HOTA 3AEQB 1Z4NA 1GG9A 2ISCA 2AQIA 4FGKA 5PGMA 1R6XA 1ACMA 4MUFA 1LRJA 1VCOA 3E2IA 3GLGE 4OHCA 3CVWA 1LGYA 4KMRA 4DTCA 4MJXA 5G0VA 3ZEIA 2G07A 2PS3A 5C1BA 5K4GA 2B5OA 4G2NA 4PFQA 5P8WA 1MGPA 2A3NA 2F1IA 2KS6A 4M86A 4MO9A 3DT9A 1YFJA 3H3JA 1Z6AA 2CKMA 2X3FA 1CUJA 4K6MA 4YJ2B 5C1IA 4J0QA 4JUAA 4Q4HB 4XDGA 2OP1A 4I4TF 1ZM2A 2BR3A 2QVBA 4AZTA 4PNEA 2FUG6 1WPXA 2LNDA 2Z3WA 3EFHA 4GW3A 4L4SA 4Q3LA 3ZLVA 4C07A 2JFOA 1C41A 2YY6A 3ML1A 4S04A 3WWOA 3GLGA 1RWPA 4EGAA 2I6GA 5B3JC 1BDIA 2A30A 4CE6A 3AHFA 1KO8A 1RXIA 2AEFA 2PKQP 3MJDA 4IO1A 5FQOA 1GGJA 3T9AA 3L1UA 1DDIA 1CJSA 4D3YA 1UBKS 2LV8A 3KWJA 5HRUA 1FXWA 1CR1A 4P7BA 1FMTA 4DZZA 2YNMC 3Q7EA 1QANA 2JH8A 2JZNA 4KTTE 4RO0A 2QDKA 2AFVA 4NFSA 4AZ0A 4E1BA 1PGPA 2EQAA 5EIWA 5EP4A 5EPEA 4YYZA 1UOOA 4MGZR 4Z8XA 3EWNA 3IE0A 4L5IA 4QTZA 5FLEX 3TIGA 3KT8A 3ZS9A 4DCJA 4DDTA 3P4YA 1XAGA 2AEEA 3ORHA 5BNZA 1VYTA 5TIIA 3FCAA 5C7OO 3IP6A 1H5NA 1XLTC 1OBFO 1OV6A 4I55B 4UMFA 3TVDA 3MRVA 1C4WA 3ZCQA 5D85A 1C7FA 2RG1A 4C7MA 5K9ZA 2GO7A 1RJWA 3OEWA 3OJOA 3DTVB 1QJ4A 4B34A 3C3EA 2OA0A 1TAQA 3HYRA 3FSJX 1YRQA 2BCGY 3KDSE 3TQFA 621PA 1OGYA 2QGZA 1J0CA 1V8BA 3KZOA 1B43A 3QXGA 4QODA 4JLOA 5EP3A 1T9BA 2IK8A 3PNBA 4RHFA 3JQDA 5FPPA 2IOHA 1HM5A 1SA0A 4BVBA 4I1SA 1I2AA 1XIVA 2FETA 5JXIA 1Z2DA 2O52A 1UMCB 4NXMB 3EPRA 4BRUA 2NU8B 3FWNA 4WERA 2JFVA 2G8LA 2WJZB 4LDPA 2VPPA 5IDXA 4QPZA 5C2JB 4HQLA 4N6NA 1S1MA 3KK0A 4MIYA 1E5XA 1Z2CA 3TUZC 2P75A 3H3FA 2IEBA 4H16A 5T6BA 1M0SA 4NYIR 1FFEA 3PKJA 3PWKA 4QNNA 2WWTA 5IBQA 2ILVA 1C30B 4MWDA 1R6BX 4DJTA 1MX3A 4FFMA 1PZMA 4MEJA 2EDCA 4R1TA 4R8LA 4ZVNA 3HU2A 4YRAA 4ZCTA 2PGXA 1KC1A 3E4CA 1Z68A 2D5IA 3KJGA 4IUYA 4CMEC 1C4KA 5JBQA 5JISA 2WJ3A 2GM4A 2Q2QA 3EGXA 3KOOA 3T7KA 1HDZA 2AG0A 3E18A 1OI7A 2AG1A 3D7SA 2Z9CA 1V3TA 2GEJA 2CCJA 1FVOA 3L8FA 4YX9A 1BEZA 1SR8A 1S3FA 1YAHA 3F90A 3SS8A 2AX3A 2IH4A 4N76A 3S2EA 4KOAA 1Q12A 3FGOA 4PE5B 1HT3A 2EFYA 4I2VA 1N9GA 4G67A 1W88B 4QX6A 2VDWB 3RVRA 3TMKA 3ZG6A 1YS4A 2HHCA 1AG9A 4IICA 3DLBA 2HT1A 4GWLA 3OJCA 2H1OA 4DOMA 1SUWA 1KE1A 5I9LA 3MSCA 4MV0A 1KHTA 2FWMX 2MIIA 5H3CA 2PWBA 1SOUA 2RHGB 4L5CA 3LCUA 4JVOA 4MRSA 4KVZA 5GVRA 3R7WA 1ML3A 1W88A 2FUG1 2QOEA 1UODA 1XRMA 3AEUB 1SXJD 1K92A 2C5GA 1P60A 4YDRA 2JHCA 3HY6A 3MTDA 1EJ6A 2XQKA 4JP2A 1OASA 4PCUA 1PR5A 2J9FA 3IP7A 4ZA2A 4S1TA 5BW4A 1KXZA 1R9JA 4QYWA 4S2UA 2YICA 5FLKA 5JJBA 3I42A 1EQUA 1L7AA 1XJWA 3DFFA 2RH5A 2EZ4A 2NV0A 4N7JA 2PAAA 2W2XA 4KACA 1TECE 5JH7B 4OHRA 1ZD4A 4P4GA 2AFHB 5TJ9A 4BTLA 1IH8A 2WIFA 1QQ5A 1OREA 3AHDA 1ICIA 3UJ3X 4AUMA 4I9UA 4C0QC 4CG3A 3T38A 5TT1A 1D1TA 2QW0X 3GZTB 2AZXA 1E2MA 2O7VA 3V5NA 2WIKA 3V1LA 3HXMA 1JKMA 5JEEA 1ULAA 2G0TA 2H2WA 1I3CA 2ZITA 2E37A 3EQ9A 3PRYA 4BX3A 1I13A 3IXLA 1ZPDA 3LJKA 5ALLA 2X9NA 4Q1AA 4ZTUB 4HTAA 2FFHA 2OOKA 3AB8A 4G09A 3JQEA 4JJAA 4WSOA 3VNVA 1OAAA 2E21A 2XNDD 1W0CA 4HDKB 3GAFA 2QL6A 3O8OB 4X7RA 3JQAA 4H3KB 1O89A 4UDOA 2DZDA 1KERA 4AQ7A 3CB2A 3DG9A 1GV0A 1U5BA 1ZAKA 2PS9A 3GZNB 5DHQA 2P3SA 3T5DA 4B3FX 1Z36A 3GQBB 4EG3A 4EEXA 2Q9AA 1LS1A 2XE7A 4LWZA 3GLKA 1QZ3A 1NVFA 4G0ZA 5KNCH 1UKEA 2RDMA 3FN4A 3UHPA 4CV3A 1WEKA 1DBSA 1XK6A 1OFUX 1GR1A 3H7AA 2XI4A 5TXGA 1C8VB 3W5DA 4MW1A 1JJAA 4TKZA 4BNIA 3NVAA 4UW9A 2RHCA 2P3LA 2OCGA 2QP4A 3GL9A 5AKZA 4FBGA 4BP9A 3JD4A 5BR8B 4B73A 4P3PA 4M0KA 5DOZA 5BORA 4BNTA 8ADHA 4HNHA 4LJYA 4Q9NA 4YROA 3RAPR 4G1EB 3GN1A 2R84A 5B57C 2X5KO 4R2MA 1E8MA 5DHAA 4K1XA 3VTAA 5LFAA 3QMVA 4BMPB 1KORA 4U9IS 4OQPA 5JSZB 1ACJA 1Z4IA 1SK8A 1AHHA 4JDPA 3O2JA 1VCHA 2R6HA 4IWXA 2JCVA 1H2RS 1JLKA 3TKLA 4DQVA 4IXNA 3CRZA 3OC0A 3WICA 2C59A 3DOEA 1G20E 4FOLA 1H85A 2J5KA 3L0ZA 4XYLA 1KI6A 3ZXXA 1HZJA 2R7LA 3CKYA 3NVMB 4GECA 5E0OA 2IUFA 1OX4B 4JZKA 4YBZA 3G1UA 2OAGA 3PFIA 4K9LA 2HZBA 2POCA 4WCFA 3JQCA 3FVQA 3HKBA 5AVYA 1T0IA 3IDAA 1N7JA 3GI1A 2XWBF 2IYTA 5KOYA 1EGVB 5KJ1A 1Q22A 3F67A 2WVHA 4GI1A 3GIDA 1CK4A 1F5NA 1GCOA 1U2QA 2QAJA 3LY9A 1QOPB 4F6LA 1WS6A 3W5HA 3F6CA 2YFYA 2I2BA 4INAA 1Z0DA 2Z2XA 3S44A 4EOGA 1DKPA 1VI5A 3FZQA 5SZJA 3QPVA 4R83A 4YRRA 3F6PA 4BB5A 2QUZA 1NN0A 4C5CA 5AOCA 4QQRA 5JZ9A 1NW9B 4EBBA 4WLNA 1RMYA 2VUTA 2NZVG 2OZPA 3C87A 5A7HA 3ZNOA 1DQNA 5JWOA 3MT9A 1ZK4A 4JLWA 4H9GA 4IFBA 3HB4X 1T2NA 5KI6A 1BA2A 3OO1A 3HADA 1E1CA 1E1RA 1U2GC 1XQ9A 2GEUA 3WWZA 1SBCA 3FR8A 1YQEA 1Z7GA 1G2OA 1H9CA 1KAHA 4EPTA 4DKJA 1CB0A 5BN3B 4FFVA 5L3QB 4DLVA 4NYMR 4EL5A 3K0BA 4FCCA 2FSVA 4Q4JB 3QV2A 3VTFA 2J3DA 1UOPA 4P08A 1CY0A 4D3FA 1KTVA 1YACA 2JB9A 3NTLA 5HVNA 3R9WA 1NPTO 1JKJA 3R7LA 1C8BA 1XOIA 3IL2A 1J33A 4HZGA 4INPA 3FIUA 1U0NA 3CKLA 1Y8CA 2GWHA 4KAXA 1RZRA 3WR5A 5BRAA 3N2GA 2VBCA 3V4PB 4B2IA 1E3EA 2YZGA 1TZ2A 2IU6A 4LRUA 2O0LA 2PX6A 3FOWA 3G0OA 4YGYA 3T95A 3WB9A 4S0XA 1A4UA 4FFNA 5G1OA 1FX1A 1U5CA 4WXEA 3V33A 2B6NA 4L6CA 4R8RA 1DO2A 1PEYA 1HE8B 2EWWA 1XZNA 3IB3A 2VN8A 3OZIA 2AUTA 4H15A 1KK3A 5EHQA 2IBTA 5LOVB 1FQKA 2D13A 3W6ZA 3B2QA 1E1QD 4JBLA 2Q0SA 2WZDA 2CHQA 5H82A 2J1LA 2OG2A 3WGLA 2NSHA 2PANA 1HQYE 3I28A 3SLKA 1IE3A 4F4FA 4P34A 5IKOA 3DNFA 1XJ5A 1SXJB 3O9ZA 4KMOA 1XRPA 3I6YA 2J6CA 3ITKA 3N58A 4HXYA 3B1VA 5EINA 5BNWA 1EFVB 3C39A 4NBRA 1U28C 3SMQA 1NQXA 4S0ZA 3BX1A 2YJ4A 3ZLTA 5KX5B 3X1KA 3GAZA 5ER6A 3OLXA 1G1AA 1YULA 2FNAA 1JXMA 4P4SB 3RFFA 4QIHA 2ODAA 3E61A 4TTSA 4XYMA 3GDFA 3H4VA 3LP8A 3TS1A 1ZY2A 1JWLA 1EESA 5IMSA 2QSZA 2PZJA 3P9PA 2OORA 5DYGA 2O5RA 1O9GA 5BN3A 2DH5A 2PT7A 3FYSA 5CFMA 1EFUA 1Z6QA 3OZDA 4BFVA 4BEVA 1KK0A 1QGAA 3S2FA 4BZXA 3KSBC 2Z2ZA 2BUAA 3Q88A 1Z34A 4PO1A 2G71A 2W2TA 4TMFA 1N5KA 4M7PA 3W8DA 5EQTA 4JJFA 2A4MA 5HKBA 3UMGA 1Y98A 4MYHA 2N1BA 2OXFA 1RMQA 2QLBA 4UU7A 2D2XA 1ZI8A 2WZCA 3HI6A 3ITEA 4TSKA 1TA9A 2FN8A 3OEEA 3HA5A 1W6RA 2VNSA 1Y8QA 2YN2A 5I8ZA 1NZJA 3A6KA 4K0KB 4FYIA 2GKSA 2XNHA 4CUZA 4DL9A 3DE5X 5JI2E 4OXXA 1DEAA 3TTTA 2BJWA 2ALJA 4EQ6A 5DP2A 1JHAA 1SQGA 2IA5A 1EG7A 3LRTA 3SC3A 5LDHA 3PQDA 1R9MA 4L75A 1L5MA 2Y6VA 4GM0A 2OXEA 3UMBA 5JW6A 2W70A 4M9CA 3M1AA 3NJRA 1K8ZB 4WT7A 5CGZA 2BP7A 4PXAA 1ZJ5A 1DJQA 4ZEVA 1CHNA 3EBOA 2FEXA 4FYYA 2C5LA 2O2SA 4PWZA 4F2GA 1T8WA 4Z54A 2EV9A 2C9ZA 5JFTA 4CXMA 3LNCA 5K6TA 1LDBA 2I6QA 2NLOA 1K9SA 2R7NA 3R9KA 5K01A 3PLAE 2FGKA 2B94A 1OIWA 4BQNA 2OCXA 2AVNA 2C8VA 3FNBA 1KYYA 2C9DA 3MFYA 5AR1A 1BH6A 4QOSA 1E3IA 4HLNA 1GN9A 1V96A 1ZU5A 3I58A 4MOWA 3PCXA 4RCVA 1JVNA 2UZ1B 4X6UA 1VOTA 3R9IA 4MQUA 1P7PA 3F6EX 3NFRA 4H0CA 4YUWA 2RHJA 4PG6A 1KDTA 1R0LA 2EEZA 3KR2A 4CM9D 4KN9S 1P6UA 4PW0A 2WV7A 4RLQA 2FW7A 2WD8A 3KVRA 3RVSA 4LZNA 2JGDA 3WGNA 3B3FA 4KE9A 5K1ZA 3NJ8A 3EYAA 2WU8A 4FNGA 1KMCA 4FYMA 3GGSA 3U4AA 5JWRA 1T36A 2HIHA 4L5JA 1OFHA 4UBNA 2HB6A 1DBWA 4H6WA 1SRRA 4NAUA 3U61B 1H4VB 5HRAA 1I1NA 2ZUVA 3JQGB 4BDTA 4LQ4A 1GSAA 4F5YA 4JEHA 5KSOA 4EI8A 1J0DA 3AJDA 4MVXA 4Y2PA 5BVHB 1NR5A 4ML3A 4WNAA 2V7GA 2VXYA 1SUAA 3DE0X 2J3LA 3JS5A 4RHUA 3WNQA 4CDRA 2O05A 1S4MA 4B7ZA 9GPBA 3MGGA 1XELA 1ZVJA 2Y3IA 3AP1A 4OK5A 1HUQA 4TMVA 1IBRA 3U37A 3K9QO 2JLRA 1GSOA 3ZCUA 1D8AA 1FFHA 2GPWA 5AVWA 5MDHA 1A7KA 2A84A 4D26A 3WBBA 3WSWA 2C4UA 2XF8A 2F43A 5HQJA 2E87A 3GLRA 1OWPA 1AQIA 3L8YA 3V4OA 2XD9A 3SVZA 4KR0A 2QORA 1PDOA 2G7ZA 3EQ2A 2DKFA 2O8VA 5KCZA 4UKDA 3F78A 4XIIA 1N6RA 2QN2A 2IXAA 3ONFA 3TQCA 4W5QA 2F62A 4B3RB 2OBNA 4FNAA 1TFRA 1N5RA 2JFBA 4ESVA 3KJQA 1LSUA 2WSSA 4BMDA 5BMOA 3H9QA 2XXAB 1F7UA 3THWB 1VSUA 3KJIA 2HRRA 2ZRQA 3NTXA 4Z2AA 2GZRA 1E5QA 1ID1A 1M6EX 3CGGA 4MTCA 2WE7A 1RWWA 1WX1A 3AG5A 4TXJA 4ZAVA 3GXBA 1JI3A 5HQ3A 2BGIA 3A1NA 2G9VA 2WF7A 3VHXB 3FWZA 5CAEA 4DR1B 2YVUA 4GGMX 1VLQA 4R9NA 1KBZA 2C2HA 1QO7A 1QR2A 1E18A 2NSLA 4NYIQ 4HNVA 3BILA 3LY7A 1HDOA 2MSCB 3OM1A 1P9OA 4ES6A 2WVAA 2DR3A 3U09A 3H75A 1E1YA 3DZBA 5FWDA 1T8RA 4EENA 1ECPA 3PPWA 5JY1A 3U0BA 3R44A 5I5EA 3OLQA 4UFOA 3QM1A 1T4DA 3Q5GA 3UUFA 2FPIB 5ICSA 2CLCX 1QRDA 2B4QA 3STUA 2FEWB 2JATA 1R0RE 4G84A 3TOSA 1GUYA 3O7MA 4A6XA 1L5QA 4DWWA 1Z3CA 3ROZA 1ZNXA 3B13B 5DNAA 5EE5B 1JG3A 3TW4A 3NWEA 1X7YA 3G6KA 2GCEA 2ORYA 2CV1A 2G76A 1T3HA 1UT5A 1XQYA 2GAAA 2IRWA 2A59A 1FTQA 2EGUA 2ZPAA 5KTYA 4IIHA 2OB2A 5TQ0B 3H6KA 4MWTA 1HFJA 3BRCA 1ZISA 2RB4A 3KKQA 2YS7A 5TS3A 5J4KA 3PC3A 3J81k 2UYOA 4D0NA 5ITWA 4G5XA 4WZAA 3H65A 1DIGA 2YRFA 4OUDB 1DG9A 2Q2VA 4ZKDA 4GP6A 1VI6A 3ZWBA 3TXAA 4WBSA 2MYNA 5ENVA 4QWWA 2R65A 2ZI4A 2ZJ8A 4FD3A 4P82A 3RVJA 3V42A 3X1JA 1GVNB 1MENA 2P9TA 5EJ9A 4W4TA 3PJDA 2BVNA 3AVXA 1PV1A 2REOA 5H1YA 2FX5A 1ZJ4A 2ZUBA 3BHNA 3KNZA 1I3OA 2IFTA 2QE7A 3NWPA 4K81B 4OHYA 2OQRA 4I9NA 2VATA 1UJCA 2JANA 4NNPA 4ZEWA 3DL4A 4EHDA 1NBOA 1KJ8A 3MJFA 3AR9A 1S2DA 3QA3E 3DXZA 3P9ZA 3EXFA 1RYHA 4PANA 3NDIA 1GUDA 1KH3A 1WDTA 2HO5A 5FTWA 4EKNB 1VYVA 3QLUA 1LVGA 3ELYA 4WY8A 1GR0A 1ZL2A 3L0IB 1KY5A 4N7MA 5DM2A 4FGSA 3NIWA 1H5UA 1QVVA 3TXXA 3PE3A 2O8BA 2XNDA 4MR8B 5CK4A 1EGHA 3NUGA 2AC7A 4HUJA 1YKSA 1DTSA 3PUXA 2VDOB 4XVUA 1EXMA 1P74A 4EO7A 4DUPA 1XCOA 4OI1A 3ZBPA 3AJEA 2ZPUA 1AXGA 3EZ6A 4JP5A 5EXPA 3KSMA 2I3BA 2Q0XA 4OB7A 3MELA 4V2UA 2PUJA 2VTDA 3AW8A 1L4MA 1UZUA 3G7NA 3K15A 5JAQA 1FMFA 2HQBA 2VXBA 5IYZA 1OKKD 3AYZB 3GCZA 5K3CA 4G0QA 2ZIVB 1SXJE 3HJNA 5KTRA 4S35A 4D8TA 1E1CB 1LVUA 4M3NA 4NMLA 2QV7A 1JFLA 3IA2A 3KZNA 4I1UA 3WO1A 5LP6C 4F21A 2WUFA 1CR0A 5KX5F 4D3ZA 3FPSA 4XR4A 1GKKA 3OI7A 3GCXA 3AGQA 4GNKA 5CLGA 3RU7A 1XMQB 3C41J 5BPFA 3TDKA 1OW3B 1GJRA 1KHHA 2UKDA 3FY4A 3QE2A 4NHOA 5JSKA 4ZOQI 3PEYA 3FA2A 1SVKA 1N8TA 4BS9A 3L0YA 4LDZA 4RKFA 4V3BA 5I8WA 5FORA 2CZQA 4YAJA 2JD2A 5FYDA 2D6FA 2DQSA 4DRZA 2REQA 1IB6A 2C0QA 2N75A 3F97A 4MQEA 4ND6A 5LQUA 4MKRA 2YV3A 3KHTA 2CLFB 1WMDA 4P4NA 2Q3FA 4FBMA 3ZHVA 3KR9A 2XB2A 2GBLA 4MVJP 1NASA 2PMKA 3QVSA 5A9SB 1PJRA 2J41A 1K7FB 5FNVA 3BH0A 4M89A 4LF9B 1YVEI 2PL3A 4UC0A 4DC9A 3AVVA 1JQDA 1CVRA 4LKRA 2VOEA 3RVQA 3AONB 5J9FA 1VHDA 2PGAA 2WQZA 3PGKA 4H1TA 4A8PA 3N05A 2B5VA 1VLJA 4GM1A 3UVEA 3C3JA 4KE7A 2VA9A 2I7TA 4I1YA 4XSGA 1YBHA 1M1NB 4ZDKA 1MB9A 2FCRA 4PRKA 1SVOA 4EZIA 1ESMA 2J6IA 2R751 3EIXA 4U9UA 5C3MA 2C7OA 4RSRA 3RC7A 4X93A 2R8YA 5A5DA 4LRYA 2EU8A 4QQNA 4OSOA 3THYB 3RODA 1EK1A 3DEIA 1DRWA 1A9XA 4FCVA 4GO1A 1WBDA 1K98A 2KMLA 4D97A 3BVPA 3KWLA 3TI9A 5HS6A 2IEZA 4MV8A 4E4YA 5B1SA 5H4GA 2R0QC 1FDRA 2NIPA 1AT1A 3QV1A 1NUHA 2GK7A 4WKGA 1F4PA 4P33A 3EVCA 3VAYA 3AVYA 3O03A 5FEUA 1UOEA 2W6OA 1MJGA 5IK2D 4LF6B 6CHYA 4TKUA 3ANMA 1T2VA 3WL6A 4JX8A 3H86A 4BKQA 2SKCA 4D41A 4XJSA 3AIOA 1RM4A 4D9GA 4PZYA 1N3YA 2QNRA 1P9NA 3ZXYA 3KLOA 4JUIA 1RYYA 5THQA 4NKRA 4N5LA 3MW8A 1L4GA 5J2UB 2FEOA 4LOIA 1PNVA 1RRVA 1ZR2A 1JIVA 1OZ0A 1WE2A 5AKJA 3AVTA 2A5LA 1G9SA 2UUOA 4G4SP 3OPXA 3RROA 2VBGA 4DS3A 1S5PA 3OP4A 1G5RA 4JLDA 4C20A 2GCPA 3I45A 4DIFA 4V39A 4IEIA 3QX9A 2VHVA 3D4OA 4LQCA 1LZLA 4RMJA 2WUWE 2AI2A 4L57A 4TUYA 2B4AA 4I50F 1HTBA 1H2YA 5EJGA 1N92A 1IN8A 1NRJB 2J7KA 5JCOA 1C0IA 3H11A 4MWOA 4BTEA 1UMDB 1ULTA 2YINC 2P79A 4IFEA 4ENUA 5HZGA 3CN7A 2CFSA 2PY6A 5J2TF 3I3OA 3KJNA 2PT6A 1VJGA 2DE0X 2GTHA 1X3SA 3MD0A 3R5HA 1QV7A 3HP1A 4Z1OA 2VSYA 5FCDA 4QYSA 1T9HA 3RS7A 5LNK1 5CGQB 1KY4A 2FN7A 4QTTB 3PRKE 3LBIA 2VJOA 1M8JA 2C4NA 1U6KA 1E0DA 1JBEA 4L0CA 3IR5A 1PW5A 3DAPA 1W19A 2BFBA 2FWRA 4MR7B 1CEEA 4LDAA 1QZZA 3FMPB 1M5RA 2FR0A 4QUHA 2QPLA 3T3HA 4Q7LA 2AR9A 3KXPA 1NT4A 1Y7IA 3AF2A 3MBKA 4LVCA 2HMTA 2VJCA 1QP0A 1T5HX 4NMMA 4RK5A 3ZHSA 2VSXA 3UUGA 2RIRA 2QTFA 3F7TA 2C5FA 3KSUA 3GLIE 3OQPA 3WLJA 4IZ6A 4ZMRA 1P5FA 2F59A 1GPNA 4G5FA 1LPMA 4IMIB 1GUAA 1H3NA 4NY1A 4BJ3A 4DY4A 2QPAA 2C2OA 5K3EA 1PFQA 3AFHA 1G8PA 2I54A 2VCYA 3AEKB 1EU1A 3GYGA 2QN8A 3I2KA 1D4OA 4H6PA 4P53A 4Q9HA 5LB4A 1O4WA 4R1MA 4CQMB 2OO7A 1N4AA 3U39A 2NU9B 1IM5A 2I29A 2YV5A 1E9VA 3QYJA 2RJ3A 1PI3A 3DKPA 3FAZA 4GVXA 4XTRA 1NWHA 4LOHA 4W7SA 3THOA 3PITA 2AZTA 4ENSA 2JGDB 2YFHA 1YCHA 1U3WA 4UZFA 1I33A 2XVXA 4L72A 4X6XA 1TVMA 1V95A 4F2HA 3ESXA 4RSHA 1QIEA 3ZHUA 1O94D 4HNGA 1SKYB 2RHLA 2FSVC 5BW6B 4WI1A 4ZVPA 4FU0A 1PFVA 5AM1A 4E15A 1EHIA 1Z06A 4H6VA 5LQKA 1JDSA 1XMJA 4UUNA 4ZAWA 3FUTA 4BTVA 2AXQA 3OKCA 1VRWA 4F91B 2ATEA 4MA5A 3BZWA 1J6UA 1QKKA 3D6FA 3IO3A 2YZNA 4OQ4A 4L74A 1L5KA 4EGQA 7REQB 1P1IA 2M9MA 1GLVA 3I5XA 1V8DA 3S8MA 1TIBA 5LD2B 4BNLA 3ZEAA 4MGYR 4YFYA 2LUOA 2A4KA 5D8DA 4FUQA 3RVDA 3UAYA 3CF2A 3QEKA 3PR3A 3UGKA 1TTHA 1F2DA 1HQCA 1PUXA 2XQGA 3HABA 4HGZA 4Z7QB 4BU1A 4IDAA 4B4OA 4EWLA 2I76A 2BYTA 2NNLD 5LA6A 3M3HA 1QWOA 1AOXA 2OHVA 5AHXA 4OKNA 4N5NA 5IN5A 1EFLA 1Y6FA 2E1RA 3RYTC 1VC2A 3LT0A 4B3DA 5BUQA 4CEIB 5IVHA 1G19A 4Q9KA 3LZ6A 5LQJA 3GJXC 4N3BA 1N2CE 3EUWA 2FWJA 3PNMA 4A0GA 1EK6A 2OLEA 2YDXA 3JW8A 4TV9B 2JGLA 1W4BA 3A14A 3SF0A 3CH4B 4F2DA 2ZRDA 3H9CA 2PQMA 1VXOA 2H18A 4CT0A 1ZIXA 4TRJA 4U0KA 4U3JA 5EPUA 3RTEA 2RC6A 3D7RA 4J16C 4MI1A 2I62A 2J87A 4JL6A 4DMFA 5HS4A 1I24A 3TW6A 2BLNA 4PIPA 2BGJA 5JIBA 1HLFA 3UJ9A 3QXJA 3GHHA 2YWJA 1JFVA 1UINA 4R84A 3FPBA 4UHCA 3U5TA 1RKVA 2CHEA 3QPUA 2HNAA 3PUKA 2PT5A 5C0OE 4LFCB 3OD1A 4DKXA 1RXCA 3REQA 3AJ9A 4IKEA 3KJEA 3QIAA 3FSEA 3N2KB 4R98A 3QPWA 2XWQA 3ICWA 3SXPA 3L05A 4M6WB 4AO7A 1LX6A 3V55A 5CW1A 1IHXA 3T3NA 2OKGA 2VK2A 3CRQA 3GEPA 3GO4A 3HJTA 3QXSA 5AHOA 4J4HA 5AJVB 4OMCA 4DGSA 5C81A 2VNAA 4FW9A 2EZTA 5C7LO 5KNLA 1Q21A 2V6MA 2FDRA 4ETNA 2AVDA 1GPJA 4JL5A 1PJLA 1HE1C 1L8OA 4HX9A 4OUKX 3REFA 1E3DA 1H1LA 1M34B 4JHXA 2IEYA 3PVZA 3PWTA 4N8SA 3PGMA 3VRHA 2GJ8A 2J3MA 3QI7A 4MVCA 5HUHA 4PZAA 5DW0A 3Q12A 1TU0A 4ZIRB 3PENA 4Q39A 3EXG1 1C9DB 1MHPA 2DECA 3MYRA 3JARA 1QGED 3VR6A 1JYSA 3D2AA 1MTOA 1T2AA 3PDIB 3PHLA 1CLEA 5F7JA 4AM8A 2ZTSA 3L7NA 3ZE1B 4BKOA 3WA7A 3WGOA 5CTAA 1JLLB 3LO8A 2NUPB 3NHLA 4PLTA 1U28A 2AI1A 3TM5A 4MDEA 3Q40A 1SVLA 5CLIA 3TR6A 3V1KA 1JG7A 3W5SA 3MD9A 4TQ9A 4AAYA 1U0HC 6ADHA 2RAVA 5IAEA 2EIXA 2XRYA 3YASA 5TDHA 5AJHA 2YWEA 4BY9E 3A1SA 4HL6A 3QMPA 2WM9B 1D1QA 1ZUHA 3A1UA 1YZVA 4RDCA 3K6JA 4CVNA 3I53A 3HS3A 3Q11A 3VM6A 2P2DA 2H00A 3LW7A 2VHEA 1J39A 2IUUA 2QENA 3LSYA 1KFJB 2FLVA 5JD6A 2PWZA 1AB6A 5E6SA 1F51E 4AG6A 5BR1A 5LQNA 3M0EA 1VPVA 1XJQA 3NV9A 2I6XA 4CKWA 2XUOA 3EVGA 4ZN6A 4RENA 1E4EA 1G16A 1QK3A 2C7PA 1ESEA 2DBZA 1DRUA 4R68A 4XGRA 1OU0A 2V5UA 2IY8A 3F3SA 1BDJA 3BOSA 3F9IA 3HEBA 2VJMB 1BEEA 1QLHA 3I9V1 5EMJA 1UM9B 1DPFA 1QMPA 2MSLA 2ZSEA 3OPNA 1VLLA 1T9CA 3QNWA 3TL6A 3TZQA 5JPDA 1DAPA 3LRPA 3G2JA 2H4HA 1DT3A 3WNDA 4WESA 4WMLA 1ORTA 4DNFA 2O1SA 1NW8A 5I48A 4F3YA 4J7XA 1Z2OX 4Q21A 3WKAA 4G85A 1MX5A 1B7GO 2GARA 1EGAA 1KS2A 2QZPA 3BMQB 3QVLA 2EBFX 3O8LA 3NTVA 4WZBE 2AKEA 3IHTA 5T6MA 5J43A 5C1PA 1GPUA 4B44A 2P6OA 1EFPB 3MQFA 4D56A 2H4FA 1EX6A 2BISA 4FC7A 3ESCA 2WJ4A 4OIFA 2GXQA 2QUBA 3BF8A 2KJQA 1CETA 1EWKA 2A0FA 3GUZA 3LCMA 3CLUD 4OLJA 2LIPA 1JDNA 1T6BY 4PZPA 5EI5A 1SOMA 2REXB 4XWTA 3EULA 3MCTA 1PWHA 3DCNA 1YJBA 1CY8A 1G1MA 1Q77A 1ZH6A 3GUYA 4FJ2A 1RBZA 3H1PA 4HY3A 5AM5A 4OXNA 5DSZA 3VU9A 2C8KA 3K31A 1A4XA 5B6IA 1Z6YA 2YHAA 2ZE5A 1UMBB 4R1LA 2GEBA 1E3WB 3CB4A 4IJMA 4Q66C 4UTOA 4QYXA 1JHXA 5CYOA 3QA9A 2A33A 2X4GA 3CO0S 4PHGA 2BKEA 2YBDA 1LWNA 3FYHA 2ES4A 2HA0A 4L50A 2UYCA 1JU4A 1PJSA 1Z4OA 3EWAA 4C0KA 2H1SA 3V4SA 3VR5A 1LD3A 1SBTA 2ZI7A 3HCAA 4ZCSA 5A9TA 3IUMA 2JK1A 2FK8A 3GJ8A 2WEKA 5BV7A 5SZHB 4WTOA 2QUHA 3AF1A 3BGVA 4L2IB 5DU2A 1RIIA 1JIKA 2QN1A 1UBLS 2EP8A 1ODSA 3IUEA 4FM9A 3ICOA 3RF7A 2X1VA 2H65A 3ZCSA 3O1JC 4BO3A 4WK2B 2P9HA 5FOWA 5M7EA 4ZCPA 1OUMA 4PTYA 4KL8S 3TXYA 4IXMA 4OHVA 5DI3B 1VMIA 1VQ1A 3ANNA 1QO0A 1IBSA 1S8OA 3L4SO 4DBZA 2FFAA 3UBMA 3P45A 1EZZA 3HNRA 1P2SA 1BN7A 2YWRA 1Z0IA 2RI0A 3L01A 1DVRA 4N40A 1USIA 1XD9A 2YXEA 4FMBB 1MABB 2B8EA 1NF3A 2Z08A 4Z7NB 5A5GA 2GLXA 3MA0A 4HBGA 4ND8A 2O50A 1Z28A 2XCUA 16PKA 4NE7A 1PEKE 1UBJS 4IV0A 3WWYA 1NJ8A 3RT7A 3WX0A 1NY5A 2HQRA 3D5QA 3HKBB 4IJ6A 3R8FA 4BVHA 1L5YA 1D2RA 4P0PB 1GLNA 4DLSA 2JCBA 3HR8A 1UMCA 3T34A 1ORDA 3T9EA 2HMAA 4OKSA 1GRRA 3W77A 5BV8A 4NG5A 3SJAA 1XZLA 3L7IA 1YZ3A 4JLMA 1ZMTA 3PCRB 3EOAI 4DSNA 5BVHA 3IERA 1BHO1 4FNOA 3WLHA 1P5ZB 1SU6A 2HK7A 3JALA 3JQ9A 4S1OA 1IZZA 3TD2A 3HJFA 3WYFA 4BQSA 2E3JA 1JHZA 3OURA 3TZLA 1USUA 3MUOA 1CC1S 4MKHA 2HF9A 3DYVA 5EN4A 2HF8A 2HX1A 2IOFA 3CEHA 1G7SA 4N6GA 5F98A 3E05A 2PZFA 4ZQFA 4E14A 1I1QB 5BXYA 3GJZA 5KJ6A 1ZA2A 3UXMA 1DG3A 3LYAA 4Z4IA 2PCLA 3HY3A 3IOBA 1ZSNA 2CZCA 2G72A 2OHHA 3BT7A 3T4EA 3BREA 4ZMBA 3WV5A 3BCHA 5F5XA 1CT9A 4JHLA 4F2WA 3P4UA 3NMUF 2QX8A 1GAWA 1U9IC 2PR7A 4MUEA 2YJGA 5JLAA 2C5AA 3W8FA 5CIYA 3DUFB 1M54A 3FJ1A 4K26A 1IYZA 1ADYA 2A6PA 3VR3D 2Z56A 3CS3A 4DB2A 1QS0B 2YZMA 3TOZA 4MUYA 5CAEB 3MHTA 1I2DA 2QZ4A 4AKTA 1NT2A 1LDMA 1C7IA 1G18A 3DEKA 2RKOA 3EYWA 2OPHA 3DQPA 5EAIA 3V46A 4D99A 5AKKA 5TPZA 5EQJB 1SCUB 1TTTA 5JPCA 1C7QA 3MXOA 4AK9A 1NU8A 2DJIA 1R8XA 4II2A 3F3KA 3R3UA 4DQKA 1JFTA 1BJRE 3U4DA 3EGWA 3DS8A 1SUSA 2HCTA 3L6RA 1P4RA 1ZUNA 1TCAA 4P3KA 2XZLA 4BXOA 3W5VA 1YZLA 4RJJA 1VLHA 5EC8A 5T4EA 2OHXA 1NVXQ 2PUTA 3MWDA 1TKCA 2ZT8A 4PZ0A 5FTMA 2OXTA 3WGHA 2GLTA 4BXOB 2WF9A 1OF1A 1U90A 3MLEA 1R0ZA 1K5PA 4OGGA 3AB3A 4OB8A 4W7IA 1HZZC 1ZN9A 5DPMA 3FUVA 1S7GA 3H2JA 2QYTA 1M3SA 2CDRA 1GTZA 2O14A 2QQFA 2CC2A 4KR9A 5A3SA 1J42A 1N33B 4QGSA 1JMVA 2BAGA 2GPTA 3VKHA 3N7UA 3SYMA 4UHHA 4QXOA 3H4MA 3I5YA 3O9VA 4FLMA 4H4EA 1D6NA 3F6SA 1XD2A 3U3OA 1HURA 3C16C 4F3TA 4N48A 3IC5A 3RHTA 2Y0EA 5C4MA 3O5AA 4Q34A 1NV8A 5TY0A 3UPDA 1WAMA 2H51A 3LH5A 1N36B 1TJYA 5FH9A 3CNEA 3P2YA 3ASZA 3ZXSA 3DLAA 1S96A 2R5NA 1YOVA 1R18A 4A8JB 3Q1KA 4FOSA 5TS2A 2RG7A 3D3EA 4NZOA 4UAVA 3RNOA 2QQEA 2WPNA 5DLYA 3FX2A 5E7IA 2ZJFA 1Z16A 2GM3A 3H8VA 1P5HA 5G40A 4LI3X 3U1VA 4B71A 5CLQA 4DMCA 4RXMA 3L40A 1ARZA 1IEWA 3AOEA 4Z53A 4MW7A 1DRVA 1E59A 2R1TA 3IAM1 4MB2A 4N7BA 4U7JA 5ALHA 1US8A 2JW5A 3PG5A 3FWYA 4O1MA 4OFWA 3THRA 4CQNA 2ZKLA 3AKEA 4IH4A 4UHJA 3TRIA 3KYBA 2NO4A 5LZ4A 1HG1A 2QY9A 1EK0A 4E5SA 3RNLA 2HBZA 3KOWA 1U1IA 1R9GA 4LSZA 3IEKA 2EG5A 2I9KA 2HXGA 4QLOA 1J5PA 1BGWA 2O0HA 2G5PA 3I01M 3OIWA 1PJQA 1XXLA 4BLPA 4E07A 2NZYA 1DC7A 2BTQA 3D6NB 4BZQA 1G17A 3I9MA 2ZE6A 2O7SA 3KZXA 1R8JA 3FI9A 4UE3S 1ATZA 1E5LA 1IVYA 1YDGA 4H59A 5A5VA 4U6NA 5T8KC 3OPYI 1WZUA 4LVOA 1KZGB 2G5GX 1RT9A 1X1TA 2RGCA 1YI1A 2CD9A 3AIIA 3NCHA 3PPVA 4FBLA 2JFZA 1ULUA 2Q1TA 4KQXA 5DXAA 2NMVA 3HCEA 4JOSA 1M83A 1HC7A 2W90A 3USZA 4O4IF 1YRWA 1UBFA 3K32A 5E9WA 4CQMA 1VYUA 2G5TA 3R6TA 2ZE8A 5D5QA 4LYDA 4CKBA 2I71A 4BLQA 3MCZA 1GTJ1 3S7TA 1L7BA 2W43A 3C8HA 2GXSA 1JEYB 3AI3A 3V4LA 4ZMSA 2CLKB 5B2ZA 1NJ5A 1DCKA 1Z26A 2FDXA 2YHBA 4BNKA 2HA7A 4M55A 3HN7A 4AJEA 1T34A 3N3AC 3NOXA 3ABQB 2R1UA 2D0DA 1K7CA 1Y4UA 1UK7A 3PWSA 4ETIA 4URXR 4Y7DA 5KJEA 3PD7A 5TC4A 2IQIA 4EZEA 1LSJA 1CE8B 2QTGA 2UVDA 1J24A 1WV0A 3M6MD 1JE1A 1XA4A 3DD5A 2WHRA 2IPOA 3RBZA 4ACAA 2QTRA 1HNWB 2OESA 4TKLA 3KQMA 3PS9A 3L4BA 4NENB 3SIWA 1FPQA 5TX7A 1Z2AA 4CIYA 4G5RA 2G9NA 4KSYA 4RS3A 4KLCA 5C51B 4XFJA 4GKBA 4K9OA 3WKBA 1RQXA 4ARUA 4DQUA 4D8WA 1D1PA 3VR2A 5I7VA 1TXGA 1UXGA 1ZXBA 5E9AA 2WT9A 3WL7A 4BNNA 4YMLA 5HPYB 1ZM7A 1YZYA 1PR6A 1A2BA 4YIHA 2P8JA 4B4VA 2VZ8A 1CSEE 4AYXA 1YZUA 1RACA 3LT1A 5CM8B 3OTOB 4LISA 4HMQA 1KIMA 2JGRA 2WYVA 2QRZA 4XOUA 4TKVB 2HWUA 2Q7XA 4FYXA 2AN9A 1CEYA 1GCGA 1ZI9A 1K89A 1O97C 4RMNA 2EFCB 4BNFA 4XRGA 3ONDA 1WDWB 4JVSB 1GSHA 1NR1A 2XB8A 2YZ7A 3OAAD 1DAFA 5AW7A 2GESA 3I5AA 3DA8A 3O1LA 1KI3A 4TS9A 1E2BA 2A78A 3ETNA 1G59A 3N3BC 4YMSA 3FFBA 1THTA 1O87A 4XM1A 4IH1A 4OIMA 4X8MA 3VOTA 1YU6A 1SU8A 2VYFA 4NCHA 3OBIA 5CLLA 5C52B 3D1LA 2JPDA 4Q1VA 2X58A 3HJAA 1HBJA 3OVMA 1ZNWA 5JS7A 1PNOA 3T3OA 1S2IA 4UQOA 5U9CA 1T0HB 5AHWA 5ICCA 1ZAYA 4GXRA 2GZHA 4JEUA 1UM9A 1R5OA 3WGQA 3HK2A 1YV9A 3LX5A 3B3QA 2MMGA 3ZJUA 1UXKA 2O8FB 3VVBA 3DZDA 4TV8F 3N2ZB 3EPJA 2B9EA 2ZWAA 1SBHA 2IW1A 3C6BA 1YOVB 2OHFA 1VFPA 3LCJA 3TKYA 1RRMA 3W5JA 2PRZA 2EP7A 4Q4AB 5WRFA 3VDXA 4R8SA 1L5WA 4ECEA 2O2IA 2AXPA 5JNLA 1OBVA 2L19A 1QJCA 4GRIA 4AY4A 2O8FA 2PZ8A 1Z5VA 1ZVQA 5KSWB 1VL2A 2X0EA 3WJAA 2Y71A 2ZREA 2IEDA 2JS7A 1YT5A 5ED0A 5C1OA 4BMOB 3FCSB 1X0VA 2FEMA 3AUUA 1ZW1A 3M49A 3KAKA 1KNQA 3NH6A 2H7XA 3VR0A 2ATCA 4EPXA 1KY2A 1T9KA 2I33A 3DE4X 3PUJA 4MGIR 2OHJA 4IDPA 2O59A 1UAGA 3P9CA 2EBHX 1G3MA 1J8VA 1QFYA 1QHSA 1RHUA 3VQTA 4IDGA 1PP4A 4G0YA 4GEGA 5KNBA 1E3TA 3A4NA 2OSVA 1ZJYA 4AY2A 1T3ZA 2KWIA 4FGLA 5BMVF 2GPJA 4ZI2A 1EWRA 2SNIE 1R15A 3VDQA 3CJRA 4GX2A 4LVNA 4WIAA 1JJFA 2V7EA 1ZGAA 2VHZA 3G9ZA 3UWSA 4HAXA 5TVGA 4RAQA 1XMPA 2ZJ2A 1MC8A 4MV9A 2C3MA 1SVMA 4Y2HA 3TSWA 1HT2E 4JLUA 3SYLA 1ZD5A 4DYHA 1HQKA 1ADBA 3OKAA 3ODGA 3FVRA 4YB8A 4DMRA 4K28A 4YCMA 4CIBA 2C4WA 1SUBA 4LFBB 2PO5A 4ZK6A 2QBYA 1AVTA 3KEMA 1B16A 1IXZA 5LKRA 1QF6A 3OESA 4K8RB 2JLUA 3HY4A 3VKVA 1AQUA 3QVGA 1B1CA 3A28A 1TK2A 1JT9A 2I2DA 2HQSA 2I4OA 2BR5A 2OMKA 3OJXA 3KHUA 5ELLA 3IRVA 4LDNA 3FBTA 4DDWA 2W48A 5LBUA 2QTZA 2XUGA 3SXJA 1Z8HA 1C8KA 2Q8QA 5LLDA 2BR4A 1ESNA 2YS6A 4B6EA 1GTSA 3O26A 3T3IA 1EFHA 1GGMA 1PJAA 1XBTA 2D3WA 2OGZA 4R8MA 4QUEA 3HR4A 2VAMA 2XH8A 2XOKD 4JLKA 4E7OA 1XCGB 3QPBA 3LQFA 2J0VA 4I9HA 4KDCA 2YWXA 1BDMA 1SCDA 2GF0A 3M5WA 1T15A 1X15A 1MIOA 2JHGA 3KZKA 1P2UA 4IUDS 3D9QX 3AJ8A 4Y6RA 1L4YA 1M33A 4HV4A 1W2GA 3WGIA 1ESCA 1PL0A 3VR5H 4DIEA 1EA5A 3TCXB 2MU1A 2PH1A 3BXFA 5DMXA 1YNSA 2YXDA 3L0BA 4DM3A 1I3LA 1PV2A 2IPAB 4RY2A 4IYRA 4UNSA 3UH0A 1UJ2A 2WG2A 3P52A 3V1MA 5LYJF 2AN5A 2QTHA 5A1TA 2HNBA 3P32A 1MQ8B 2YXBA 3KV3O 4MRAA 1NN1A 3VR3A 2RHOA 3LDGA 1JS1X 3AZOA 3CUUA 3K8ZA 4ENQA 1F0NA 2O5CA 3UV3A 3LA8A 3W5AA 4G0VA 4LXTA 1JMYA 4JBWA 3GD7A 2AA3A 2HA6A 3TZBA 3UXEA 3GJ6A 5AW8A 1DB3A 5FBLB 4R1OA 2RFLA 3PXXA 2EZ9A 3PDJA 4U63A 5I9NA 1NXTA 3WRYA 1PL6A 4YCJA 3UANA 4C05A 4ARZA 5DYIA 5LP6A 1RLOA 3A9RA 2DQ4A 3D0QA 4JJEA 3HHPA 2G28A 3B1FA 3BN3A 3IR6A 2CNBA 3R0XA 2C2BA 2PMBA 1KVSA 1P3Y1 4NBWA 1JV2B 4G01B 2CNOA 4U2DA 4DVJA 4ESHA 1K0UA 3C3PA 1P2FA 1CUDA 4KFTA 3DEFA 1TKBA 4IS2A 4Z0TA 4L4YA 4BN5A 4BQPA 4YLGA 1QH0A 5AVQA 5I7RA 2YMPA 3AZPA 5DBOA 5BQPA 3EQ7A 4AJ4A 4E4TA 1F60A 3DWGA 3E5RA 3VSCA 1RE1A 4GOND 3NBZC 3AB7A 3ZDEA 1TJ4A 3IBFA 3ONWA 5JG7A 2ODWA 3EJWA 3SQMA 2QSJA 1JU3A 4I14A 1N2EA 2X77A 1P39A 1WCIA 1YO6A 4LK3A 4A0QA 1IL0A 2AV6A 2N42A 2PRJA 1Z7EA 2ODBA 3PEEA 2G1AA 4HEA6 4L15A 3SLGA 4DA7A 2ZJ6A 4D9IA 3TEFA 3HFGA 2DWCA 4XFDA 4ZI5A 4FZ5A 1VJ0A 3CQ9A 1Q84A 2RAUA 1VL8A 1RXSA 3MB5A 5ES4B 3JQRA 3H5AA 3KVNA 1RAFA 1RQGA 3D8NA 3OX1A 4MV1A 4WK0B 4MV4A 2V6JA 3HSKA 1DAHA 5A3RA 4PC3A 3SXUA 1E98A 3CE9A 2EYQA 5I7UA 3I92A 2EJTA 1VJ5A 1PZXA 2XUIA 4G97A 4OJTA 2XGSA 4RA9A 4CQMD 2WJAA 3KCNA 4N18A 1PK7A 3D3KA 1SCIA 3JPWA 1S02A 3JARB 1LPSA 2IHUA 3BTOA 4PY2A 1C80A 3A1TA 4PTLA 5TVKA 2W42A 3OFKA 3BRQA 1F12A 3C6YA 4QKQA 4IX9A 5JRZA 3RG8A 2BP7B 4HP8A 2NSJA 3HXKA 4J7UA 3PPIA 3M1YA 5AIBA 5HKKA 4X92A 2D4AA 1LA2A 4P0QB 4W8OA 2P1DA 5EWMB 4I3HA 4F2PA 5JR3A 1MC5A 3O4JA 3L0OA 3IELA 2DAPA 3ZWCA 3ZIDA 2C2MA 5I4IA 1OXSC 4UVDA 4WVFA 2IOQA 1IN5A 2DUJA 3WGVA 5FWAA 1ENPA 2XE8A 3KPUA 1JQJC 1YZTA 2FAXA 1VSTA 1QWSA 2WHPA 4DANA 3EEIA 5IEBA 3E3MA 4DLAA 5JH7F 2BC9A 3DVQX 2ERYA 2IUSA 1VPEA 3WXBA 2HPAA 4MV7A 2A57A 2FFQA 1Y4ZA 4N5DA 4BUZA 2K7FA 3C6MA 3OIGA 4PFJA 1ZICA 1USKA 3AY7A 4E11A 3KJFA 1LK0A 3K09C 4A82A 1FFCA 4GDMA 3UTCA 1IAQA 3ESAA 3Q5DA 1PGOA 4G9BA 2DT8A 4HI0E 4G0OA 5AKGA 2Y1OA 3QXHA 4QD3A 3UB3A 2R8EA 4MCIA 2ODTX 2B7CA 2Y9MB 4MARA 1N2BA 1HL7A 3G68A 5F77A 4CN9A 2ANBA 3OIDA 5AM0A 2HSWA 4JC8A 4AF8A 3OZWA 3FYDA 2GASA 2ECOA 3R8XA 4CM6A 1Q7RA 2RGYA 1NBME 1R5JA 1IHPA 1VM6A 4Q4AA 4UMVA 1JDJA 1YCFA 2XUDA 4PQEA 1DZIA 1YJQA 3GFOA 2BZGA 3QBDA 2R96A 2ZIGA 4F8YA 4N0QA 2J4FA 2NVOA 5LA6B 3IFSA 4YGXB 4A7PA 4JN6B 4QVKA 2C2YA 4U8GA 3T4UA 2PBLA 3DB1A 3DLTA 3C45A 2R68A 2P62A 3PGA1 3HACA 3ZVNA 2TMDA 1E79A 3G5LA 4D4JA 2XZDA 2C5EA 1I8TA 2RH4A 3OCYA 3RTDA 1UBCA 5JCJA 3UK1A 1XDGA 2H85A 3MAJA 3NYWA 4C03A 3ZWWA 2ZB3A 2ZBFA 1SQSA 3D4NA 1L8AA 1NJSA 2J9ZB 4HAZA 3MTIA 3RF6A 4B8YA 2MMCA 3EQ8A 5EA2A 3EGDB 1WM1A 3PTLA 8OHMA 3PCTA 2XNCA 1QYWA 4I2NA 2CFIA 2IHTA 1LK5A 2IYFA 2ZS8A 3FRHA 3SBXA 4R6XA 1N1EA 2ZSFA 4R7GA 3SJBA 1ZH2A 1Z4QA 1PQ4A 1TGVA 1Y48E 4AF7A 3ER9A 3QLTA 1ENYA 2B1JA 3MJSA 4REOA 3TLGB 4GMXA 4RLSA 4XA8A 4B0PA 3G82C 1I4EB 2CXOA 1G4UR 2EJCA 1UKBA 1M7BA 2OXIA 1XZCA 1QNLA 1KRWA 2WFZA 3E2PA 1F6WA 2BCJQ 3HBJA 2ZUDA 4J0JA 4JK3A 1E0SA 3AKCA 1EEHA 2EQBA 4I55F 3HDVA 3OWHA 4GYWA 3BFXA 3KUUA 4ALNA 3PWZA 3GDOA 3OAAA 1C7EA 1IOWA 2Y68A 2WJ6A 5E1MA 1RYNA 1U63A 1DC3A 3HJCA 2NU6A 3D6JA 2LGJA 3K70B 2Y66A 3W1VA 1RZ3A 4Z7JA 4LRWA 1XZQA 1N8KA 4ZQGA 5F12A 2VEOA 3LC0A 4DA6A 5B5SA 2NOAA 2GDZA 2PO7A 2AR7A 4LZZA 1D4ZA 5FIUA 3UUWA 1GFSA 2I0FA 3T35A 5BW8A 2SCUB 4YRCA 3FXAA 3PF8A 3ICPA 1ENZA 1TVKA 1E9EA 2P6UA 1VYHA 3O7WA 3OPYB 4EFKA 3B1JA 1PGJA 3AI1A 4O2BF 2F1OA 1Y9EA 3ROKA 3VC3A 2HLPA 1PTJA 2CWDA 2P6PA 1CF4A 1YSCA 2BJHA 2NXJA 4JT9A 4HGYA 1X9GA 3VUFA 4M1OA 2DBQA 2Y4NA 3IAHA 3LBYA 3VU1A 1JHDA 1FVFA 3PUHA 1JRLA 4QBHA 2HSJA 3K1AA 2X42A 2WAMA 1F20A 2W2NA 4KDEA 1CNEA 4FJ1A 4MVWA 3TK1A 3WTCA 4UFPA 1OOEA 4RADA 4N49A 2I7VA 1A4IA 3NHBA 4GLBA 5ALVA 1EFVA 2O3QA 2IBSA 4EUKA 4U7HA 2DF8A 3SAJA 5LP1A 1N0WA 4GYYA 2OAQ1 4ZOCA 5LZ9A 1K7SN 3A10A 3M34A 5JSQA 2Z2JA 2A1IA 1DIOB 2KPOA 4MHTA 2V9ZA 4D0LB 3LHKA 4LJ8A 1E2NA 1NNUA 3X0DA 1OH7A 2AJTA 4V1CA 4FHFA 4M6WA 3KOMA 4LBVA 4YTEA 3JSAA 1E7SA 4H60A 1NVVQ 4CM7A 4YRBA 1J1UA 1XVTA 4DCPA 1L5SA 1R4MB 1R8YA 4IDNA 1UQTA 2LDXA 2Q5QA 4RMIA 4W5JA 4C5BA 2BH9A 3BTUA 4TPKA 1H42A 2FVXA 3BL8A 5TRTA 1R1DA 1S2NA 4BLVA 3TQHA 3VV3A 3WBKA 3SZOA 1B2RA 1IXSB 3UIEA 1DAKA 2BM0A 2XYQA 4BL5A 5K3OA 2CJPA 5BXQC 2CJXA 1J9ZA 3C85A 2J6BA 3G85A 2JJ1A 3ZW7A 1CW2B 4GU5A 4HQNA 2C1EA 4G3XA 1QPGA 2PR2A 2ZWIA 4EF4A 1NJFA 4UUPA 4CQLA 1KU6A 1UOQA 3UA4A 4TV8B 1JPJA 2AF4C 4XGNA 2E18A 1AS3A 1TF2A 1K75A 1KPGA 2ARKA 2AYXA 5AW2A 1V8ZA 4B3MB 1FBNA 3ZCPA 5FD8A 1MAHA 5D84A 3CINA 3UB4A 3NIGB 4C4TA 4DHEA 3O3OB 2HMUA 4C7JA 3A27A 3QU5A 1ZUIA 4KJXA 3RVKA 1SIUA 4IDBA 2OV8A 5JS2A 2PRIA 4GICA 1GXSB 2BMAA 2EKZA 3VYRB 4C3VA 2BLLA 2XYRA 1U98A 2XMGA 1NOIA 4IFTA 2V7BA 4QOEA 4H0FA 2WMYA 3U1TA 2OFPA 4BZWA 4NCAA 5J3JA 1N6HA 4K05A 4AJ2A 4AJOA 2XQJA 3RW9A 3GLQA 2AE1A 2VP3A 4ZRDA 1PSZA 1DFGA 1XZGA 3RSQA 4G1FA 5KTKA 1KMHA 1K86A 3GIWA 2ZUSA 1PW7A 3E3OA 1L1RA 2M6KA 5HR5A 2AH5A 2XRMA 4TZ6A 5ALJA 4KX3A 2QGFA 1VPWA 3HVJA 4F7DA 1P81A 4GYKA 1RQNA 4GL4A 1TL7C 1MB0A 1YQWA 2GMWA 2PZAA 2VNHA 3SLRA 3UMJA 3K6SA 3U5ZB 3ZDRA 1A1VA 3MRSA 4GPEA 4CF3A 3RRJA 5ARBA 1AQYA 4L9RA 4NU8X 2AXEA 3I9V6 4RPCA 3P9NA 4YMIA 1U8TA 2FQXA 2ZRLA 2CJWA 1OZGA 1Q7TA 1SZCA 2RK3A 1CUSA 4BBZA 5A03A 4C08A 1CUIA 1DQRA 2ZXEA 3H13A 5KNBD 2BKUA 3N8DA 3P71T 1KEKA 1DO0A 3LQ1A 4RD2A 2O06A 4AJHA 4GZ6A 3DB2A 3PNQA 3HXOA 4KUEA 2AGVA 2P3OA 3KZMA 4PBTA 5JAIA 1WXEA 1YDEA 3T7CA 1A9RA 2BMEA 1NDUA 2V5AA 3HCOA 5CNIA 1KJ9A 4MGHA 4DV3B 3K9LA 4D6XA 4NYJR 4OJKA 2RGNA 1M7HA 4IVRA 3V7WA 5FBQB 4WXRA 5FADA 1QG2A 4RVSA 2O5EA 1WOMA 4V0RA 4B83A 1WW8A 3NBFA 5K8IA 1YA6A 4MUMA 4RD3A 5KYXA 4F4JA 1NNEA 3VV2A 4CIVA 4Y9UA 3QVVA 1IG0A 4MGKR 1C30A 3RI3A 4J3JA 5H80A 3VC1A 2C0CA 3LL7A 1SO8A 5TGTA 1Q95A 5AIAA 3S68A 1HE4A 1T4BA 3FVVA 3A58B 4KPFC 4LNHA 1PTJC 3G5MA 2XVZA 3VNQA 2JC3A 3FPCA 2Z1NA 2AWNA 3IVRA 1CIJA 2GM5A 2O1WA 4Z4CA 5D87A 4BE9A 1Z15A 4QYIB 1UJ4A 3FG9A 3W79A 5B7QA 1XR3A 2HCRA 3CF4G 3KUKA 4QVGA 1YB6A 2WM3A 4YH1A 3TDNA 5BSEA 4DXAA 3O8DA 3QHQA 4R31A 5ENZA 4AO6A 2Q6OA 3PC4A 4J0FA 4X3OA 2IYWA 3PSAA 4PLGA 1NVWQ 1L8QA 3OCCA 1JJ7A 3VH3A 4PYLA 3LKBA 1ZI6A 2CFOA 3UV7A 2X5OA 1ATIA 2YNMD 4YHBA 2Z8XA 4BRWA 4DIDA 5JVDA 5L3SB 5EZQA 5HM8A 1ZGHA 5TEVA 3B9PA 5HYVA 1SXJC 4RSGA 4QBGB 3INNA 3MTEA 2ERXA 2ODEA 1GO2A 2OCDA 3ANXA 1I1OA 4GBJA 4D6YA 5TQ2B 5E6UB 2ZM5A 1OZFA 5FJJA 3ZPXA 1U31A 4BYMA 1N8NA 4J2HA 1YCGA 3NHPA 1CUBA 3QLJA 3TG8A 2VDKB 4R05A 2FPIA 1HK7A 3ZGXA 3N2GB 2O3SA 1ADFA 2JLSA 2ZYAA 3MWEA 2C7GA 3OC6A 1YC5A 4JMPA 1ECFA 1X1QA 1GPKA 1F2VA 4M37A 3SU8A 4MR9A 3AWIA 5BSGA 5FUMA 1DOHA 1P80A 4FT4A 3K9CA 4R2WA 1AQ6A 4R8VA 4TZ0A 4GP7A 1T4GA 4G56A 1FNSA 3OMLA 2AJCA 3RSZA 1DBIA 1N7GA 5AJWA 4MRNA 3VJLA 2VJYA 2Z09A 4PG5A 2C95A 1KH2A 1XHFA 1U3GA 2DFDA 3ROGA 1PR3A 1PBTA 1P2GA 2ZRIA 3EH2A 1AGNA 4HWTA 3AHCA 4N0DA 4BP1A 3GRRA 1T5DX 4EG1A 2GJSA 1Y3IA 4FMCF 4W5OA 2CGEA 4LC1A 1IB0A 3QWAA 3ZHTA 3KKOA 1FP1D 2NZJA 2BFBB 2VS1A 3AFGA 3OE4A 1AF7A 1Z4PX 2HA5A 1IAVA 1VSVA 1XXHE 3OIYA 4IKOA 4PPFA 3O92A 2VIIA 1JIJA 5K3DA 3QWFA 1IBCA 3LO5A 5AI9A 4MDYA 4TXNA 3QX7A 4WECA 1XMSA 3OOSA 3U3XA 3VU8A 3ZE2B 3K0SA 2BKAA 1I9CA 1SEVA 2R2AA 4NJMA 4EG8A 1VBKA 3MJHA 4WKOA 1IHYA 2NTJA 2DHCA 3TBFA 2CYBA 2ZT5A 3SYNA 3ILXA 4B1FA 3LLVA 2PUCA 2O0KA 2WAAA 2YUIA 3R6DA 1RC0A 3M7IA 2A5JA 3OSZA 1Y0BA 2RHHA 2RH9B 4D9FA 1J8QA 4Q6BA 1MC4A 3RB8A 1E8NA 2FPLA 1R4MA 4FEAA 1RWBA 1FDWA 5D6NA 1RC8A 3N2LA 4EABA 1YQGA 1HI9A 5EIXA 2DH6A 5DM0A 5K8CA 4I4TA 3EGVA 5EESA 2FV8A 1XU9A 4R8KA 4DG8A 3GY0A 4RJLA 1YJCA 4CEHB 3RS3A 5JAMA 3WL8A 5DYWA 4Q1DA 3HKEA 4PEVA 3QPAA 4PPGA 1VJTA 2OKCA 4PQFA 3IURA 1MA3A 3AC0A 3IUJA 3ZGNA 2VDJA 1BMFD 1DINA 5HKLA 1XZPA 1HDYA 4IHQA 4WRRA 3BE6A 2DEUA 1IZYA 3ZX5A 2IS4A 5ETJA 2GZSA 2PD4A 5G1PA 3H5WA 1FJXA 1NX6A 1C0LA 1WZCA 3N2IA 3EXG2 2AJBA 3NRJA 3WP0A 1Z6XA 2VYVD 1OJ7A 3VZDA 2UXDB 1BXGA 4W99A 3ZDDA 3N0VA 2OC9A 3SEFA 5LA6F 3S2GA 5CA0F 1R0KA 5H83A 5CG1A 1VDMA 2CV0A 1TO1E 3ZR4B 4ROTA 3K2BA 3LNTA 2F8MA 2HREA 2CNWD 1ZITA 3SZLA 2FFRA 3UJPA 3V1UA 2JA1A 3RC2A 4EJ0A 2JKZA 3H4IA 3UT5A 4AD8A 4IGFA 4HJXA 5KHLB 2OV2A 1XNGA 2QSYA 2IWRA 1EWYA 1B0PA 2GEVA 3KKMA 4K5QA 4X7BA 3L18A 4BQIA 1PT5A 4A3SA 4DIOA 3INGA 5EXTA 2WDPA 1UIRA 1RAGA 2BEWA 4HDRA 4EPWA 1O95C 1QYDA 1YRHA 2RGXA 3R09A 3GX1A 1MP0A 3PX2A 5IANA 3GZNA 1Z7WA 2OL4A 3OU7A 5FR1A 3RGGA 4A0SA 1ZESA 5JU6A 3CCFA 4JI4B 1IPEA 2L69A 2NU6B 3KOXA 5EKUA 4AZSA 1CNMA 4BNVA 3NHUA 3OCXA 1RNLA 4RKRA 3TR0A 2VNJA 4MTLA 3HJBA 1ONSA 3E9EA 3P27A 5AKLA 2W6JA 2ZT6A 1K88A 1L3IA 4CIWA 2QRVA 2BM1A 3RK1A 1OLSB 2V9PA 1WXWA 3PQ7A 3QG1A 2X1MA 4BO1A 1OFTA 2CYAA 3ZCRA 4DM4A 3P20A 4M0UA 4I81A 3R75A 4W82A 1M2VB 2AOUB 1Q1GA 2EJUA 5CUQA 4WH0A 1KOGA 3CRNA 5GVSA 4OFZA 1HMYA 3CNOA