1BQ3A

Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polyanionic inhibitors of phosphoglycerate mutase: combined structural and biochemical analysis.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1bq3A00
2H4ZA 2OWEA 1DKQA 1IHPA 4D4LA 5HR5A 1K6MA 3E9CA 1RPTA 2A9JA 4JOBA 3FJYA 5AJVB 2DWPA 4AROA 2EKZA 1SK9A 2F90A 1UJBA 3ZHCA 2P6OA 1SKAA 1DKMA 1QFXA 5AJYA 1BQ3A 5HTKA 2ENWA 2OWDA 1YFKA 2P6MA 2H52A 3D8HA 4PGMA 4EMBA 3EOZA 2DWOA 3PGMA 1DKNA 3GP5A 1BQ4A 3O0TA 2GFIA 5CDHA 4D4MA 2EOAA 1FBTA 2P77A 4JOCA 3GP3A 2H4XA 2P2ZA 3DCYA 4GPZA 3IT3A 2IKQA 1H2EA 1V37A 2YN0A 2P9FA 1QWOA 3MBKA 3FDZA 4IJ5A 2WNHA 1DKPA 1DKOA 3IT0A 1SK8A 3EZNA 1E58A 3QPWA 3QPUA 5AJWA 4HBZA 1ND5A 1DKLA 2P9YA 1C80A 2BIFA 4ARVA 2RFLA 3NTLA 1XQ9A 3R7AA 3MXOA 5CU7A 5PGMA 3DB1A 5CX4A 3LG2A 2P9ZA 3GW8A 4QIHA 3QPVA 2EKBA 2WU0A 1TIPA 5AJZA 2P79A 4E3WA 3E9EA 4IJ6A 3C7TA 2HIAA 3HJGA 4FDUA 3E9DA 1H2FA 1BIFA 3NFYA 4ARUA 2P78A 1C7ZA 2ENUA 4ODIA 4PZ9A 5AK0A 4EO9A 4GPIB 1EBBA 1SKBA 1T8PA 3D6AA 3F3KA 4D4JA 3IT1A 5AJXA 3KKKA 2H0QA 2P30A 1RPAA 1NT4A 3K4PA 1CVIA 3OI7A 2AXNA 2A6PA 3LNTA 2WNIA 1FZTA 1UJCA 3LL4A 4TSRA 2HPAA 2PA0A 4PZAA 3IT2A 3K4QA 2P75A 1RIIA 2HHJA 4D4KA 2I1VB 2YN2A 3BIFA 1C81A 1V7QA 3FDZB 2QNIA 1ND6A 2P2YA 3F2IA 4MA4A 1YJXA 3D4IA 4FDTA 4JODA 4ARSA 1QHFA 1E59A
chains in the Genus database with same CATH superfamily
4NIMA 4WH0A 3JVUA 1H6DA 2LPMA 3L0CA 3SHTA 1OTYA 2UU9B 3RH0A 3H9BA 3B1YA 4ZOCA 3R7BA 5HEKA 5K0BA 3HBJA 1SUAA 1QCYA 2H06A 2LGJA 1V6CA 3R4VA 3UV3A 3F97A 4ER7A 2JI9A 3GRRA 1KSGA 3PUHA 3QA9A 1MXHA 5KBYA 5AVXA 5JLAA 3IXMA 4HMPA 2JRLA 4KMOA 4A0QA 4PS1A 3KZ1E 4F1JA 3T95A 4PZEA 3AG5A 5M29A 4CLRA 1KETA 2ORWA 3FKQA 3MHPA 3QOYA 2UUBB 1JEJA 4BRUA 1XZ8A 1V1JA 2VJAA 3HYNA 5JVDB 3D8HA 4DDUA 3RRBA 5EKUA 3W78A 2F1KA 1ZIDA 2LDBA 3E1SA 2CNBA 3OM8A 3QJYA 2X0DA 3K31A 1FP6A 3R09A 4OU5A 1TYCA 1X7YB 2J31A 5D7NA 4ZI7A 2AI3A 2GASA 4JB3A 2R65A 1B8UA 4BNZA 1WS6A 4IMRA 5DTIA 3IAFA 3DLPX 4XCVA 5JHHB 1F0KA 5AVZA 1P0QA 3NT4A 2GBFA 3IBYA 4URYR 4EKNB 2V7EA 4DV6B 1GKUB 3Q9UA 1T1RA 4LY3A 1ZDMA 3S27A 4B2YA 2X7HA 2ZUSA 1K5PA 4BQIA 4I5FA 1MOZA 1Z0KA 3F7TA 3NNDA 4A82A 1NQWA 1A9XB 2PGNA 1WB5A 3GUUA 1ZHHA 3O1HB 3WGQA 2VJQA 1FB5A 1CZUA 1RJ9A 3IP9A 3M6FA 3NDPA 1K8YB 3TL6A 4CMIA 1E2EA 3HNOA 4ENSA 1N5DA 1E2HA 4UM7A 3T9BA 3MXOA 4EA8A 3ZU4A 1HPLA 1SCKA 4S1VA 4PLHA 4WPGA 4EKDA 2P3QA 2BC9A 2J4CA 5INTA 3L4SO 3THRA 4ZYXA 3C1TA 4WLNA 4D96A 1BVUA 4ZYWA 3ZV7A 2FPKA 2B9EA 4IYRA 3IQXA 4BFWA 3PHJA 2Y1OA 4E4RA 2EQ5A 5CEFA 3V8MA 1CZKA 3JD2A 4KOEC 3KBOA 3CLRC 4KI0A 4BVAA 1N6RA 3G7UA 4JLKA 4YAGA 2WSIA 5HJ2A 1YSCA 3QVTA 3IR7A 5AOCA 2CWDA 5CG2A 3ZLUA 4FHEA 3HUDA 4WN9B 1C7FA 2ZSAA 4M60A 1FF9A 1GG8A 3UJ9A 2QMOA 2R1VB 2VRCD 3H83A 2GD2A 4F3TA 3VZPA 1QDLB 3ZTTA 3G7NA 4YV7A 5TGDA 1NF3A 2GM9A 2PEYA 4RW0A 1X80B 2MYUA 2PBLA 1GLVA 1YTLA 1PFWA 2O4UX 2R00A 3KZMA 3NTQA 4KCGA 5DB4A 4EG5A 1CQIA 1RJWA 1OZGA 1E99A 1P80A 3A9CA 4HLUC 3I39X 5TARA 1N3IA 3R3XA 1Q1ZA 2QZJA 3AY3A 3TS1A 1DIGA 2VP3A 1I8TA 3Q7RA 4KH0A 2AEEA 4ZYUA 5JJBA 2DHQA 2Y05A 2XQIA 3MBOA 3DE3X 3O26A 1BSVA 3AV0B 3KVVA 4BAGA 2C5SA 3O47A 3P94A 1ISHA 2FUG1 2QMUA 1F2UB 1U2GC 4MA5A 1QC5A 3CX7A 4ZXPA 2J9FA 3W0LB 4I5EA 1FFBA 2L2QA 3QBVA 4ILKA 4I4NA 3B7PA 4Q7EA 1W47A 3NX4A 2FW6A 4F3NA 1ANKA 2W90A 4BZPA 5IDQA 2J3IA 2WIAA 1AKYA 1SWWA 4JJ6A 1Y7PA 4EPTA 4LFBB 3VU3A 3GFBA 2YN4A 1FUUA 5B1DA 3IBTA 3GJYA 5KOYA 4UD6A 3JSXA 2BD0A 4MR8A 1ZKDA 2P9GA 4FUQA 1DC6A 1P4AA 1XZHA 2BM0A 3ZV4A 1Y5MA 5KNLA 2FVXA 2JI6A 2NO5A 3K8ZA 1TCAA 5JZSA 1F0NA 4JEIA 1HMPA 1LJUA 1Z4JA 4DEXA 1NW6A 2X0JA 3P2OA 1T13A 5DRYA 5CA1B 1TAHA 4MRPA 4RJLA 4YXWD 2D0OB 1YB4A 3EY4A 3AVOA 3KQTA 1J0BA 3H9UA 1Q17A 4LVNA 3ZBQA 2TYSB 3HO6A 3GJTA 3SC2A 4DA9A 2VDNB 5D87A 3E5MA 4REMA 5F4BA 2ZU0C 3BE6A 1BU5A 1T0PA 5HKOA 5HKKD 1M74A 5EKSA 3RARA 3P4UA 1HE2A 4J07A 2RSLA 3B7GA 1E5QA 2HXSA 5T8KA 4FQ5A 5ITZB 1FEZA 3ZWKA 3IVRA 1CR2A 1BJKA 2R00C 3OCWA 3CUWA 1ILEA 1K3FA 3VHXA 3AUUA 2C3MA 1ILWA 5DYYA 1RYDA 3FWPA 3LD9A 2UVDA 4EL0A 4BX9A 4MPDA 3LLVA 1K2VN 1AK1A 4OB6A 2H07A 1PJ8A 3OEHA 3WA6A 2C9ZA 3BL8A 4XWWA 1RAAA 3AEYA 4H1WA 3DB1A 3AEQA 2ZSHA 1C3JA 1KC1A 4UUOA 2HDNB 2NYUA 4GFDA 3CH6A 4P98A 4E6PA 4Y6LA 2P5SA 1TRHA 2QXYA 1PUXA 1UXKA 1RRMA 5B12A 4N7JA 4AY4A 1HYQA 3C0KA 1VB5A 1UBLS 2NX2A 1UFVA 5TX7A 1UKAA 3GJXC 1WX1A 1E1LA 5JNSA 1DRUA 4P0QB 3WB9A 4B4DA 1DOZA 1ZIYA 1KI8A 2B8NA 4QTZA 4QWMA 3VBCA 1P1BA 1KTVA 4WINA 1HOXA 4DDMA 3AGPA 3V4VB 3D64A 3L0OA 1NQVA 4ZYZA 1GTJ1 1DX9A 1UP4A 4X9XA 3TSWA 4DV5B 1SAYA 4TWRA 2G67A 3U9TA 3AF5A 4NP6A 2CCGA 2V6MA 4REQB 1JHOA 1I1QB 2WMDA 2YMLA 3GJ6A 2PVCA 4XWGA 4CV3A 4WGFA 4PIMA 1FU4A 1Z5NA 2PGIA 4HNAA 3V1YA 3GDOA 5BXYA 2PTHA 1EFDN 3KZVA 1VYUA 4UE3S 4E7PA 2GAFA 1GAXA 1D04A 1G8AA 2RH9B 2EGGA 2EZUA 4AW9A 2VUSA 2GJKA 4X24A 5K6TA 4ALJA 4XEHA 3Q7TA 1DELA 1EQUA 4JL6A 5AW2A 1SUDA 4L16A 2Q28A 3BMOA 4EM6A 1E6KA 4BP9A 2HQ1A 3EXFB 3GEMA 4RBNA 3UC9A 3QX9A 1H2ZA 2OV4A 1OI4A 3PCXA 1JSCA 1RZUA 3V8QA 1V2GA 1Q21A 1SOUA 3M6MD 4PIPA 4U2EA 4UUAA 5ARDA 5JJLA 1K06A 2DSTA 3SLGA 4OHFA 2EFGA 2JBWA 2FFBA 2GEJA 4NDAA 4JUBA 3MWLA 2RHJA 2HBRA 2B4TO 2B25A 4ZVUA 4HAOA 3NM4A 1G20E 1PWZA 5BQPA 3ZHVA 1N34B 1MQSA 1ODIA 2VYVA 2PT5A 2H51A 3K92A 3F46A 3WDMA 2OBYA 2NYVA 1A97A 3N0RA 4KQ1A 4QEDA 4A5SA 4BNUA 4YLYA 1NI4B 1C50A 4NZMA 4ZQFA 4Q1AA 1ZA2A 2V45A 5KSOA 1RKXA 5I7FA 4L5IA 3KPJA 1KHHA 2CGEA 1GPDG 4XTCS 2HEGA 5AUQA 4QKQA 3I2GA 3G2PA 3ORFA 1P45A 4PX2A 1UPAA 3VR5D 3QV1A 4GMFA 4DQVA 1FC0A 5JZMA 4LSZA 5AVUA 1ZGAA 2FN8A 5D85A 1B43A 1GEGA 4J8PA 2X8BA 3O8QB 4C0QC 1XK7A 2VPPA 1N32B 2OCGA 1L7PA 2W2LA 1A69A 4GPAA 1HLFA 2WIJA 2GFHA 4DBVO 3UHPA 3H7AA 2NADA 3E3OA 4HD8A 2Y71A 3H9CA 2RHWA 1KRHA 2NGRA 3H19A 3DQQA 4YRJA 1F5SA 4H0FA 4EF4A 4BGDA 3GYBA 3ROTA 1QYVA 1GNVA 1QMGA 3U0VA 2CKMA 3GA5A 1WCYA 3DNFA 4KYTA 3TR0A 1PJ3A 1D9XA 1VXOA 4ETIA 4TTJA 3O91A 4GWLA 2Z57A 3CF2A 1T3HA 4QPZA 2GN1A 3VO8A 4CPDA 4M1MA 1I94B 1K92A 3NV9A 1MT3A 1W0KD 2X0IA 3BBPA 3GZTB 821PA 1JJVA 3GY0A 3L93A 1HDXA 4LNAA 4R7TA 5EIBC 4YIHA 4ZAYA 2OVFA 3KIPA 5JQGA 4JV5B 2EZTA 4MI1A 5F1PA 3PUXA 3FVVA 2QQEA 3HFGA 4BKQA 3N39C 1MVLA 2ZRLA 2JRCA 2J0UB 4FGKA 4V0QA 4EZEA 1CY6A 1QH0A 4PPQA 3F6EX 1FSSA 2VP0A 1KQPA 5BQXA 5BV1A 1TQ2A 5I4BA 5E6UB 5FOUA 5COAA 3KQYA 1OHHA 1M6NA 1DKRA 2HGSA 5EHNA 4C30A 4XWKA 2XE8A 1YL7A 1FLDA 5K8CA 1ULUA 3M9LA 2V9ZA 1Y5IA 2A0WA 1N2JA 2DQKA 2EFCB 4MPRA 4GP6A 2O8EB 1G5IA 1ZEJA 1DXOA 1WLYA 1DBWA 3CZMA 1EKXA 4C06A 1G60A 3BCSA 3R3ZA 1EWTA 5CIWA 5DJ5A 1U8FO 4BHTA 1T1SA 3FYTA 4OIMA 1EE2A 4GVXA 2JAWA 4P8RA 3KJIA 3SJBA 1N6KA 1NOJA 2GERA 3ETEA 5JRZA 2WOOA 1TL7C 3LQFA 3J81A 4F5DA 5I9BA 1L5ZA 2O7VA 4AD8A 3AEQB 4KR9A 4C87A 1XRNA 2E49A 3QBTA 3V1KA 1G291 3S3TA 4W5JA 5HFAA 1ZISA 2A0XA 2X3UA 3PXUA 3PHGA 5HR5A 2AMLA 1DPFA 1NVBA 2TECE 3NH6A 4L6AA 2QN9A 3UCFA 1PJ2A 2DP4E 2VWHA 3VKUA 1NMQA 5JSFA 3CVWA 4B7UA 3BEOA 5EYPA 5HCIA 3AHHA 1RVDA 1T3TA 3NTUA 1W48A 2WUFA 1YHNA 2C98A 1ZJYA 2O5CA 4C89A 2Z5GA 5DCLA 2QW0X 3BWDD 3TZ6A 3W7BA 4E32A 4YAEA 1SG9A 4M9XA 1WXHA 4IHAA 4MUGA 3B2EA 3HSKA 4DC9A 4LFAB 3EF0A 2B99A 4Y0AA 1BMQA 5JANA 1KXZA 5DNVA 3CVOA 4N3BA 3RSHA 5CITA 2ABWA 4IS3A 1RWWA 1NVTA 3MCUA 5J3JA 4NCBA 4PINA 1S2MA 2D1FA 3R3HA 2YR0A 1Y9EA 3S55A 3A11A 4LJKA 4JL8A 1JEYB 1VDZA 2QENA 3JYHA 1MAUA 3O8RA 1PJAA 2IGTA 4WI1A 4C2UA 3CKYA 2FMHA 1YFZA 2OCLA 3ANMA 3AT1A 3GAFA 3L7BA 4NS1A 4BMXA 2PKCA 2QJTA 4WCDA 4BB9A 4CI0B 2IKSA 4K9DA 3OAAA 1ML4A 2XWJI 3V97A 1KOGA 3L04A 3P9IA 1NURA 4KXQA 1ZGJA 1Z2EA 4PCAA 3CSSA 4TM8A 5E8RA 4GGPA 4JLJA 1Z29A 1DBIA 4B84A 5B7GA 1WSWA 4XJXA 5DHRA 3DF7A 3P7MA 4IQ0A 2XDAA 3OH8A 1KVTA 3PFHA 5I47A 1V95A 1V5FA 1KJ9A 3NM6B 3KHTA 5DYWA 1CQJB 4GGMX 4HEQA 2J3KA 1EFKA 2NG1A 2RGAA 2EX4A 1DFIA 3WQQA 5DN6A 1NVGA 3DXYA 3HVKA 3VKVA 4TUYB 2LCFA 1H8HD 1O96B 2A4MA 4LN1A 4Q05A 3TTVA 1C9MA 4A2PA 4DG5A 5B36A 1NW3A 2O19A 3OF5A 1YNSA 1GKIA 3IPAA 4HYTA 3TGLA 5CCXA 2QPOA 1YQDA 2QTTA 1SHJA 4HFJA 3IIJA 3P9ZA 3G8BA 5SY4A 2WFMA 5H02A 3K1YA 3V3TA 2J08A 1HX7A 2H3HA 2JJQA 1XXHA 4C14A 4MV3A 4ARAA 4FWTA 4G3XA 2PJZA 4UBIA 3AOEA 2VHJA 1YH3A 2WY2D 2IOYA 1SG6A 2I3ZA 1H2RS 2JFXA 2TMGA 4QYIA 2YV3A 3E9QA 1M6HA 4ZIRB 1GU7A 2CV1A 2WF9A 1JHDA 4L5CA 4HWPA 4RTRA 5T41A 2I67A 1E3QA 3K15A 2A9PA 4BMOB 5T67A 2OCIA 3CBGA 4D44A 1NT4A 2XMBA 3GLQA 4IL5A 5EIAA 1YVEI 1RJFA 1NWHA 4AUKA 1XDWA 3WR5A 3GL9A 3GQBA 4B4WA 3LP6A 1P72A 2X8LA 2OBXA 3RSQA 3F8SA 2O2JA 4H9GA 4I1PA 1S4MA 2PX3A 1NBMA 4UDYX 1T2CA 2OR3A 1Q57A 3IKLA 3FNEA 3PNQA 4IXNA 4LK3A 5EQDA 1G7CA 1WSAA 2FLKA 1BTOA 1HDGO 3NT5A 4O4JA 3ABQB 3F78A 2HRDA 2YVQA 4JWKA 5IBRA 1XZGA 3WTBA 4LBZA 2BGKA 2OBFA 4HGRA 3KXPA 1DTWA 3J81k 3GRZA 2EIHA 4M9ZA 3VM6A 1MAAA 3OX4A 4MV6A 4JI7B 3TB6A 1X87A 3R9XB 2Q9CA 4LI3X 4QTXA 4DMRA 2PANA 1E2FA 1Z6PA 1BE6A 5HM6A 2ZYDA 4L72A 5T4HA 4QGGA 2F8MA 2OO5C 2HQBA 3GFVA 4RH0A 3KKOA 1KERA 2W2VA 4E2ZA 5F1YA 5EA2A 4TYNA 1ULBA 4NZ9A 2W8ZA 5DNAA 1Q7RA 3RC2A 3CJQA 3D6UA 1IATA 4REQA 2OQIA 2F90A 1KARA 3HVHA 3O2QB 4LY6A 1SKYE 5KAPA 4BO2A 3PHLA 4LG1A 3OQIA 1U1CA 3PXEA 3ZVKA 3OQVA 3AOEC 5CRIA 3E53A 1COWD 1A2OA 2PQ2A 3O8NA 5CH5A 1RXSA 4Y9TA 1AKEA 2JA2A 2JIRA 2HIHA 4BV2A 1IWOA 4LZLA 3OEYA 2X2PA 2CL7X 1KDVA 2BFAA 5BSUA 3EGXA 3T3HA 2NYAA 4A03A 4Z53A 1XDDA 4NMWA 2WFAA 3RRJA 4NOMA 3UXHA 2RHDA 2JZOA 2YBEA 2B2NA 1D0SA 1PR2A 1BJTA 3C1UA 2Q2VA 3CLTD 3GGJA 2B8JA 3QWFA 4PC1A 5CGZA 5DNUA 4X6UA 1T26A 4J0FA 4BNFA 1BN6A 5C2JB 4LJ8A 2BDUA 1JB9A 3TJZA 4G4JA 3R0JA 2B1JA 3KVOA 4PVDA 4KUGA 1Z16A 4BLTA 3MUNA 2FFJA 1FSGA 2JCYA 2AB0A 1V11B 4XX0A 4XRGA 5BMVA 4GT1A 2XVYA 5HS4A 1QU3A 3PZRA 3U7HB 5E3JA 1OLSA 1Z7EA 3RQSA 3R9XA 2Z9CA 3QXSA 3W2TA 2QRKA 3T3NA 1YT5A 3C16C 3W4IA 1N6HA 2QB5A 3D8SA 4L4ZA 3WICA 3R44A 1F0YA 5PNTA 3TLJA 2QM8A 3L01A 4NULA 4Q1VA 3L6CA 3PEYA 4D3SA 4ZYTA 4OFWA 3K72B 1W1IA 1ZXLA 4KXMA 3TZKA 4E4TA 5CBPB 3HJFA 3P9PA 4MTCA 3IAXA 4N6GA 3HU2A 4R9SA 4CCAA 3EXEB 5AM2A 4YV0A 4IIJF 5AFSA 3OE7A 1DDGA 2JVKA 3DMRA 2I4TA 2L17A 3F4BA 3G5MA 4JR2A 3HYLA 2R5FA 4CI9A 2Q9UA 2DFTA 2BKEA 1Q7BA 3RF6A 4YJ3B 4C4ZA 2HJGA 1TFRA 2RE8A 3C3WA 3O8QA 4ZRMA 4JI0B 2WG1A 5IZCC 5AVJA 3O3MB 2CBGA 4Z4EA 3MCTA 4NNPA 1A4XA 3I34X 4BLVA 5JYEA 2PGAA 1EBBA 3CF4A 1YBHA 4RMJA 3LW8A 3ZE0B 3ZYCA 2GM4A 2GVDC 1LX6A 1JPNA 3GEEA 4F96A 1CZOA 4HQFA 1I7LA 2O1XA 5ALLA 2ADMA 1MX5A 1MR3F 3S70A 2JIQA 2YXLA 2IHNA 1OE0A 4IY1A 1NTOA 5IBPA 4AUNA 4DV4B 1L4BA 2AJBA 2QTVB 3IMKA 3W8FA 4ZJUA 1KBZA 3JAKB 1Z8DA 1AKWA 1O96A 4WHMA 2R7MA 4YACA 3BA6A 3U49A 3K16A 1XA0A 2PV7A 4L0MA 4E1BA 4IIJB 4MLDA 2CVQA 4RFSB 3WGZA 2RKOA 1O9GA 3FPCA 5C5EA 4ZT5A 5JPIA 3LKZA 3PX2A 2ZB7A 2AC2A 4KYIB 4OJTA 5K99A 1SXQA 2JASA 1WOMA 5A4MS 2WF8A 4GE3A 3U26A 4D4LA 3T5TA 3KUUA 4L5JA 6REQA 2CC2A 3AM5A 5EOVA 1TGYA 3KS9A 4M0MA 1JKJB 3DZDA 5SZIA 3DTVA 4QDUA 3UMJA 4KE7A 4BO7A 5LXTF 2H7VA 3OIUA 4C3ZA 2R6DA 2PH1A 5EAIA 1CQZA 1VBKA 4OKSA 1Y6FA 4AROA 1SHUX 1YI8A 3AKCA 1H2HA 1PS0A 1Q0ZA 3G2QA 4HR7A 4XCXA 5BMVF 1EUDB 4FLFA 2O8NA 1DFGA 5TEVA 1PSWA 2Z4RA 1NZJA 2HUPA 2WPNA 4K9PA 1ZOLA 2JW5A 4MS3B 1Z34A 1I4OA 4Q4AB 5IVHA 1M8PA 1S6YA 2LRHA 2PWAA 3PDIB 2XYRA 3RGWS 1JR4A 2WWFA 3G1WA 4DSTA 1QRUA 3A7EA 4KE8A 1NW5A 2IHKA 1LLCA 3DAPA 5K6AC 1JAZA 1XI2A 5KQGA 2GF2A 3JQAD 1C1XA 2PX2A 4RVHA 3TD2A 4MUIA 4ZVVA 1NRIA 1XV5A 3O3NB 4MDFA 3AHCA 3COVA 1WG8A 3BH0A 4URUR 4CHTA 5CDUA 3PF9A 4GKKB 1GG5A 4RHFA 3ZU5A 1GT6A 1I2BA 5F7OA 1U1EA 3OMWA 2FF7A 4IWNA 2QN7A 4YAIA 3ZLJA 4YCSA 2NZWA 1ZM7A 5HYVA 4H08A 4P36A 3HN6A 3STTA 1E3WB 1OFTA 3EH2A 4GMKA 1LBQA 4Y2TA 5CJ2A 1FSPA 4PR3A 1PZNA 2FQXA 1GKYA 2OO3A 3K0FB 5C9ZA 1QIHA 1MFZA 3K05A 4M0DA 4AJ2A 2VA9A 5BSHA 5HGJA 3R6GA 6REQB 4C07A 4DCVA 4C76A 4UVEA 1N6NA 1H4QA 1M7GA 4ZTZB 1FDSA 1M2EA 1M8JA 4KQGA 2ISCA 2P2CA 4I5IA 3OCXA 4FEGA 3V46A 3V4SA 1OC2A 4IJQA 5HKAA 5CX4A 1AZLA 3LG2A 3VPCA 1NULA 2VT3A 5F9FA 1P5FA 1OXTA 2R97A 1U9YA 2RAVA 4L08A 4B6SA 1R9MA 3K70D 2EJTA 2IHUA 1W49A 3E6AA 4IKPA 4GW3A 3UCEA 4LF5B 1NLZA 4RCZA 3REQA 3N0WA 2BRUA 3EIXA 4LE0A 4PSVA 3WRYC 4CCYB 1PEYA 3C7TA 3CUEF 1J2EA 4OBBA 1NBIA 2P2GA 1HDYA 3BSFA 1W4RA 3A7DA 4O33A 4IFBA 2O8CA 3SP1A 3Q98A 4CFYA 3M3DA 5JLJA 4IXMA 2RGNC 3IV9A 4FP9A 3FM9A 1Q7GA 5ECYA 3T99A 3IDOA 3C1AA 5BVHB 2BHRA 2JIPA 4O5OA 4UREA 4F86A 5KTKA 5AMXA 1CCWA 3I4FA 1R88A 3C3MA 4HBGA 3RSGA 4TTTS 3OI7A 4KW7A 4IH4A 3L7CA 2EV9A 2JAOA 4YK7A 4LI0A 4W5WA 2WP0A 1J42A 5CDGA 4ZVRA 4HXYA 4EPVA 2R2AA 3L43A 4QFDA 1REQA 3GLTA 5LZ4A 1ZD9A 1AE1A 3LNCA 1P5JA 1DOHA 3AF1A 3QWHA 1KRWA 1P39A 1T9KA 1W25A 4WXMA 1U1GA 5JFTA 1CUYA 2H7YA 3OY7A 1VCNA 4OMDA 2A88A 1IJFA 3VU9B 4Y30A 3M1AA 3MJTA 5DWQA 4DSUA 1OFVA 3W4JA 2ZRAA 1Z6YA 3I2HA 5HHTA 4UKDA 5HF6A 2MT9A 1EDOA 2OLJA 3D0KA 3T7EA 3ZN2A 3R5JA 2X4DA 3DMDA 2C5EA 3D4PA 3H1GA 2FQWA 2H29A 3D5EA 1D03A 1P7WA 1ZIOA 3HP7A 2SKEA 4KVGA 4XDHA 5DSXA 1XQ1A 3KR2A 4BASA 4BX8A 3DF9A 2AA3A 3HJAA 2XRMA 3REQB 4LA4A 2UYHA 2DFNA 2RGDA 2X13A 3O8DA 1I1OA 3R6TA 3CM0A 4DIBA 4KQMA 3URMA 1HZZC 3AUJB 2FF5A 2NAPA 1XJ5A 4G01B 3DONA 3HV0A 4L0QA 2IV2X 4GUAA 5DX1A 3DGFC 3G2IA 2WQ7A 3TQCA 3LXMA 4MI6A 4KQXA 3MXTA 5LZ2A 3EVBA 1S5PA 2QN2A 5AJYA 4DJFC 1DEKA 3L1HA 4P9NA 4MMXB 1IBKB 2ZBVA 2AFRA 4QLAA 1YE8A 1BXRA 1RYMA 1OLXA 1MJFA 2B4QA 1VHDA 3EXAA 1YF3A 4LOKA 5JTTA 3UMFA 2RGUA 1T9ZA 1QTRA 1YZNA 2QRNA 2YBDA 3VV3A 4AMZA 1QHHA 1LU9A 1Y0BA 3WO1A 1GITA 1UOOA 2PEZA 3IQHX 4XM2A 4P3YA 5JNUA 2NXWA 2C7PA 2XNKA 1R15A 2DBZA 3N2LA 1MF7A 3L82B 3MTQA 3KU4A 3M8KA 1L1RA 1RHKA 3BK1A 4FEAA 1LKZA 4XWOA 3E8SA 2HI0A 1WMDA 2ECOA 3FR7A 9LDBA 5BNTA 3M0EA 2I1WA 1G5RA 3QPUA 4QHSA 2JFYA 4RS3A 3TWOA 4BTEA 3IP1A 4F6RA 1JG4A 1YO6A 3IUQA 2Q9BA 2OL4A 4RK6A 1VPVA 3BIXA 4LRXA 3T5GA 5JWRA 4LJLA 4LOJA 1UXHA 3BKWA 4KO4S 3O8LA 4WZAE 5TPWB 3WWEA 3PBKA 4PZPA 3N86A 1AB6A 5A2GA 4HTAA 3I09A 3BH6A 3HCDA 4I8XA 4DLVA 4ZPXA 4MDEA 1E64A 1L8XA 4RVFA 4GBGA 2X86A 3D3EA 1J5XA 1HZZA 3G0BA 3EJ6A 1P4JA 3AM4A 3B2QA 3HB4X 3HFJA 1EX7A 2FOIA 4MW7A 4YP7A 3AW9A 5H82A 4DWVA 4UTVA 4R16A 4YUAA 2BZ0A 2I91A 3QTBA 3CSDA 2WWVD 1W2GA 1BFDA 3GNSA 1CY8A 2QSZA 2BGJA 2FWAA 4C22A 3G88A 3CR7A 3ORQA 1SU8A 5EQTA 2ZLBA 4Y2GA 5LQRA 3AXTA 5FTNA 2OXFA 4NAVA 1E98A 1XCMA 3VYVA 2FDXA 3WL4A 3ENVA 3IE0A 3QELB 2VBCA 4XIFA 3TQHA 5EJ6A 1FUKA 2FZ4A 2WWWA 3KE8A 5KQLA 5CB4A 2Z09A 1AO0A 2AXEA 4MJ7A 2JGIA 5EZQA 3PHIA 1S2OA 1YQWA 1R4NB 1NXPA 1NUTA 4IH1A 5HBRA 4YTEA 3GFTA 3TINA 2E4ZA 5ITSA 3G8CA 3NH9A 3ZDZB 2YWBA 2FE4A 5LD2B 5DM2A 1SCNE 4EF5A 1ADGA 1WHTA 1WBBA 5KC8A 4TV9A 4GLOA 3E22B 5IM4F 2UYGA 2POCA 1EE1A 3RF7A 1P18A 3IDSA 2YIVX 4JWTA 1RXCA 4DDWA 1SXJD 2I54A 4YJ2F 1XT6A 1HDIA 1VPDA 1E8NA 1YRQA 3EZ2A 2ZRIA 2M2IA 3GLIA 1G9SA 3L0ZA 4EG4A 4AY3A 1AXRA 2Z9DA 4GL2A 2H57A 2A4KA 1WCIA 1V26A 1C29B 3A26A 4X64B 4CIYA 1WUIS 2YIDA 4QOSA 5CCDA 3O8CA 3LUFA 1G98A 1VIVA 2ZVPX 2C88A 4GOND 1ADYA 1ADFA 1M1YA 1R4ZA 2QN8A 3AYZB 3VDXA 4OMCA 5AHRA 3M81A 1J7KA 2F55A 3EDRA 2YWHA 3O0DA 3VPBA 4D4IA 2QD5A 4R3WA 4TMKA 4ZQBA 3TIGA 1VRCA 4H4DA 1N77A 4HUQB 4M0UA 5BWBA 1LQ2A 1L5NA 3SR3A 1EVJA 2JNWA 1I1NA 1US8A 1T10A 1TZMA 3MJVA 1Q16A 3VSDA 2OAGA 4FDLA 1BD3A 4QGBA 3Q3JB 4MV5A 1Z56C 1GQSA 4TT8A 5JMPA 1N3BA 1P3JA 1R1DA 2ESRA 2LP4Y 3W2IA 4B3BA 3R9WA 4RPHA 2IP1A 4CF4A 1XXHE 1Z8NA 2W2TA 3M4ZA 1HK7A 4P4TA 1FSFA 1BEEA 2D1SA 3CZQA 3D6JA 4LRTB 4Q39A 2G76A 4JHLA 1Z2DA 1H2AS 3KQQA 1IY2A 1KVQA 4KUHA 4Y2RA 3VYRB 5LQSA 5IWCA 2E7ZA 3W5HA 1PDVA 5ALIA 1GG9A 3IRUA 4L5BA 1HEUA 3QKRA 4LCEA 4KXNA 6AT1A 2IYNA 2NU6B 1JU9A 2BFBA 4MTLA 5KNCH 1YBAA 2ATXA 4MLZA 4EIWA 2JLYA 1ODKA 9ABPA 3UHOA 2XDWA 2BIFA 2DULA 5IKMA 2B1IA 1MAVA 2MINB 2RAUA 3NQ41 4K9NA 1DEOA 2FEWB 2JAHA 5E4JA 2IPOA 2FP4B 1G2PA 1N2GA 4NE9A 2B8EA 1KIFA 2EXXA 2HLPA 1JUDA 4HG2A 3R9KA 4EPWA 5LP6F 1WZNA 1DL5A 3NWPA 1G8YA 2HPZA 4FMPA 3NOQA 3RG2A 4AX4A 3DT9A 2Q99A 3IUBA 1D2CA 1IN8A 1U3WA 4F9EA 4HNVA 1KP9A 3BMNA 3FZQA 4QBHA 4P0PB 2C4MA 5BSKA 1GZ3A 4NFSA 3RUDA 1KDYA 1T8UA 4F72A 1P2TA 2UYYA 3O7MA 1E6WA 1W85A 3GJRA 4WZZA 3FOBA 1UWLA 1SUSA 5G1OA 1WOYA 3ON5A 4GXRA 2D13A 3DMNA 1KE2A 2GFQA 3C6XA 1HUQA 4JNCA 4Q7MB 3ZJVA 4HLCA 2K87A 2ZZNA 2CL5A 4IGFA 4B3HA 1IVSA 4K46A 4C21A 3LZCA 3T52A 6Q21A 4CIBA 1BW9A 2CXSA 4TMZA 2NVUB 4KPGA 1N3YA 1T5LA 4LKOA 1ELOA 3KAJA 5B55A 3B1ZA 2VHQA 4GSKA 4JA0A 1F20A 1N0VC 1FK8A 2B35A 4EAAA 3SICE 4C2TA 3SC6A 1QYIA 3BICA 3IEPA 5D8DA 3ZU2A 3LSYA 3VNBA 2XUKA 3Q72A 1CYEA 2QNRA 5DM1A 4Z9FA 4DIKA 2A6PA 4F0JA 5BYBA 4O4HA 3RAPR 3ZG6A 2QN3A 3RODA 1UBKS 2XH8A 4WMLA 3GNLA 2VPYA 4OQEA 3L7MA 2Y1DA 3NATA 2JIMA 1SBIA 3RVMA 1Y7IA 3RD5A 2FPRA 3DFFA 4CDNA 2R8PA 5FWAA 3O9VA 4LHWA 4EF6A 3ILXA 1F6BA 2ZKIA 2ORYA 2VNAA 1SCAA 3A06A 3L9WA 4FFDA 1T5SA 2R4QA 4MCAA 3GBPA 1QO0A 4KEAA 3KQUA 5HDBB 1F8YA 4JKYA 1HNXB 3FN4A 5JCZA 2EBFX 4E2WA 1N1GA 4JUCA 4ESEA 2A30A 5MF6A 5C8XA 4KLCA 3CX8A 1LQUA 1Z4KA 1I14A 3RIMA 1K8XB 1KDPA 1VTKA 5EQJB 1GDDA 2WPDA 3QX7A 2RHGB 1PNOA 1J4AA 1HL3A 1M73E 2W37A 3BWMA 3IAM1 1QORA 3IDFA 4EJFA 4QG3A 6YASA 3KQKA 2X22A 3PF8A 1XRMA 3I8SA 2HJSA 3M1IA 4RVDA 5EJ2A 4EG6A 2O8BA 1SB8A 4YP5A 4S0XA 4IVPA 4O63O 1PR4A 3ROFA 1RBMA 3ZWBA 2FG6C 5EMLA 4HQLA 1EZ1A 2RJOA 5L3SB 1HTBA 4KSBA 3LWDA 5FI1B 4BP8A 5I3CA 4NEGA 3ICCA 3R3WA 1SZDA 2I66A 4GAEA 4B1FA 2VT7A 2GEKA 4XWTA 2UYCA 5EMHA 2QK4A 2P1DA 4IVRA 3D59A 2IKQA 1XSEA 2OAEA 5CNJA 3G8YA 2DGDA 2YFKA 5FDFA 3HSYA 4RKRA 2J0SA 1GUFA 2H4WA 3P27A 5KJFA 3H05A 4WSOA 3PFCA 1MAHA 4G5HA 3O8OA 3FWYA 4X65B 1L4KA 1WXWA 4R81A 5KB3A 3KUKA 3NRBA 4KRFA 2QP3A 2VF7A 1L7MA 4PPYA 3LOQA 1J9GA 2ZBDA 3OE7D 1B14A 3R20A 4D3FA 4D3YA 2Y9MB 2IYZA 2O7SA 3C70A 5D2CA 5H4GA 1E1DA 1Z15A 1RACA 2G5PA 3OX2A 4B0OA 4J7UA 3U3JA 2XCUA 2NV2B 1E1MA 3MMXA 1PQWA 4JUFA 4WJKB 3K9FC 1JG3A 1HBJA 2O8FA 3OUZA 1E7SA 3V1LA 4AY5A 5LOVF 2BRUC 2YZGA 2IH4A 4KKXB 5JD3A 4DMMA 1IN7A 1R9JA 4GWGA 4TKZA 1YC2A 4BFVA 3ER8A 2HRCA 4JT9A 4LY9A 4J9UE 3ET5A 3RVSA 1JDZA 1GV1A 4IDCA 5C5IA 3JQ6A 3AL2A 1VQ1A 1GGHA 5BSGA 3KPYA 2I62A 4FBMA 4FCWA 4KAJA 3ZHXA 2PIDA 5CJJA 1F1BA 5CH3A 2VOJA 4OHOA 4CL3A 3QX3A 4F9TA 2AS0A 2Y1XA 2HJHA 2QJOA 4DANA 3WWPA 2DBQA 2FVYA 1E0KA 2W2XA 3FIUA 1JNXX 1I7PA 4K1XA 4I5DA 3TE7A 1ZONA 4F9GA 3GUCA 3AUSA 2OFPA 1YB6A 2H08A 4ITRC 2TSYB 1LPPA 2NPIA 4MYHA 1Y4ZA 5HVNA 5JAMA 2EEPA 2ZB2A 3ZYZA 7GPBA 2CHQA 3Q10A 4QDJA 1BS1A 4JOQA 3PQ2A 4R7GA 2RC6A 4G24A 1BRTA 1WBDA 4OXKA 4LTNA 2ETXA 4NZYA 2HPAA 3HEAA 4PO8A 1TM3E 4CV2A 1U02A 2FOXA 4URFA 5DN6D 3CX4A 2PHZA 3ADKA 5KX5F 3DTVD 3WGYA 3FUTA 5LQMA 4C4TA 3QENA 3FDZB 2YFHA 3MN1A 3HPQA 3NOOA 3GG2A 4OA8A 4DMKA 2GPYA 1CY2A 1XC7A 2AOUB 1SVLA 2HHAA 2VK8A 2MJLA 3NVMB 3ZWAA 2JH8A 4YROA 4ZOLA 2W4MA 4K2HA 3ODGA 2EDCA 1QDUA 2XVXA 3PPIA 4YUVA 2VZLA 3MCWA 1V8OA 3OCZA 3OX1A 4RZIA 5J43A 3OJWA 4WFQA 1P6QA 1UKEA 1ARZA 4BVHA 4DCNA 3PXCX 1JTFA 4JBWA 5AJVB 1ZH8A 3LMKA 2VAMA 3LP5A 1E18A 4EO4A 2KE5A 1V1MA 1N7HA 4RPCA 1AQ6A 1B8NA 1R4MA 1RWPA 4OSEA 2VK2A 4JSTA 3BXGA 3N8HA 1UH5A 5TPWA 1BGXT 1DUSA 2H5JA 4BRWA 2WG0A 2IYTA 1A95A 5E2AA 1FMCA 3M2TA 2J6CA 5D6OA 1D2RA 4TYYA 3ADOA 5IHXA 3GLGE 3DTTA 1ZZGA 4V1CA 4DABA 4PAWA 3E27A 1RI2A 1WPRA 4EYSA 3UPTA 2OC9A 3V1MA 1SUPA 4U02A 3JASA 2EOAA 4NZPA 1QLWA 3C14C 2QAIA 4P34A 3B51X 5EUCA 5AD1A 5ERXA 2I2BA 2R3SA 4DNOA 1BDMA 2UUOA 4B44A 2QZ4A 1B0AA 2QX8A 4FKZA 1JDBB 1CQWA 4ZT4A 4H4CA 3PE3A 2J6BA 1A2QA 1DBVO 1GUDA 3IDQA 4FIZA 4EHKA 1GFIA 3K96A 1JILA 2REBA 3QYFA 4PG6A 2UUPA 1UKZA 5CNIA 4BO1A 4UNQA 4BFYA 1JN0A 1PGOA 4JS0A 1U7UA 2DUMA 2Y8EA 4KDFA 4LYAA 2E6KA 1M2WA 2ZJZA 2FDCA 4NZNA 3F73A 1XZDA 2RAFA 3KSBC 1QM5A 1RQXA 3NUQA 2NVOA 2FUKA 1M6EX 4XR4A 3Q8LA 1ZUD1 2WVHA 2XXJA 4ZQHA 4JLUA 3OE1A 5BV7A 4FEEA 4K86A 3RUHA 1IY0A 1O97C 1WTCA 2PX4A 3EIEA 5F5NA 2H17A 4J0DA 3GEDA 1T2VA 4E31A 5K8LA 4B83A 1WLSA 2ZG6A 3HEBA 3LBNA 2WD7B 2ZSDA 4NDZA 1UWKA 2NQTA 1DRWA 4Q47A 2Z98A 3TAXA 4D8VA 1XIVA 2OB2A 4JIMA 5IJZA 4MUNA 3WBBA 1F14A 1H23A 3EXIB 3O8BA 3G6WA 2JJ1A 2HWUA 4KQKA 4G56A 4WV3A 3KVYA 1KO7A 3E7PA 4R1SA 4TQ9A 5ALDA 5T4EA 3TOXA 5KYUA 4HVLA 4F21A 3WSTA 1QH1A 3EDYA 4RJ2A 5CXQA 4HS9A 4MA0A 3O2NA 1X7DA 1TMOA 4EUHA 4EHIA 1PV1A 4YY3B 4GKAA 1NU8A 4M7OA 3FUCA 5GWXA 3JAMA 2GWRA 5BMVB 3U17A 5GOZA 2VATA 3ETDA 1BCRB 1DCMA 3NEAA 3PWTA 4GEKA 2D74A 3IC5A 4HAUA 2XUJA 3MINA 5K0JA 2H31A 4J2OA 3CLTC 4ZA2A 5K20A 3T94A 1W93A 3VR4H 2HXYA 3MEQA 1Z74A 3L84A 3QLTA 1S8AA 2DKFA 1ETHA 3LBIA 5HIIA 4DC1A 2PDAA 3KQWA 2GCOA 5KPJA 5EUQB 1TF5A 4OLFA 4ZKDA 2W22A 5DSZA 4MRSA 4EA9A 2QW8A 3Q85A 1ZL0A 2GM3A 5G4LA 4Z1OA 1L5SA 3GPBA 5A4KA 4Z2AA 1WETA 3R5TA 3SSOA 1E59A 5IS2A 2IEAA 3O4VA 5ERGB 2KLHA 3AIKA 5ADUS 3TFOA 1BW9B 2NVUA 2R96A 3BZUA 3BULA 3OTGA 4NBKA 4IV5A 5B3JC 2WR8A 2QAJA 1INLA 2ZBEA 4J7CA 5CA0B 1DDIA 1HT1E 3AG6A 4RTQA 3U0BA 2RDMA 4EY4A 3PVCA 1ZVMA 2JIZA 1LPSA 3QP9A 5FPKA 2VPZA 1O54A 1VKZA 2I8AA 4W1QA 5EZSA 4ZDWA 3V2UA 3AUXA 3MLAA 5T64A 1QVWA 4NY1A 1WCXA 3OJLA 3EPJA 1XX6A 3OFND 5K0CA 5MGBA 5BYAA 2H63A 1NUUA 3H18A 2IY8A 1RYHA 2VPXA 1BE8A 3H0KA 3MRTA 1GPLA 1P91A 1RRKA 2F3PA 2QLNA 2UYQA 1TCVA 4QWWA 5DEIA 3D0QA 1MB4A 2IQ5A 3WL7A 5JAUA 1VC2A 3GA0A 4NVRA 1W4CA 3HA5A 4IDHA 4E6EA 5AW4A 4LJYA 1Z6GA 1EM8B 2B0CA 2IBTA 2P2ZA 4OSOA 3I01A 1F4LA 3U4GA 5KHOC 1ZMXA 2ID9A 2WZBA 1IUNA 4P3PA 5D3KA 4CBVA 1DAEA 3KKNA 4AJOA 4OEHA 4NAUA 5HRAA 1G5TA 2OP1A 3NUGA 3G0CA 4MGEA 3EZGA 3VR4D 4DSNA 4OY3A 2O3SA 3JWGA 3L6EA 3EAGA 2XLCA 4IXTA 4JJFA 5BURA 4HGZA 2FQYA 1CY4A 1W73A 2JJ1D 2HWXA 2LTAA 4I81A 4MV9A 1EWKA 2IU3A 1R37A 3MK31 1PFKA 3M5CA 2CLCX 2X9GA 4IIBA 1MIOA 3E2MA 2J6IA 2B8TA 4J1TA 2B5VA 2YRWA 2VQFB 1U5AA 4N3NA 3X1YA 1LJ8A 2HO5A 5LQDA 2NVWA 4X66B 1EVEA 1LB1B 4WA8A 2HYIC 2AUTA 1QHYA 4H7HA 3L4BC 1IPFA 3HY3A 4KO1S 1JKMA 2DRIA 3UFXA 1WM1A 3I04M 3IKMB 2HNKA 3JVIA 3EXHA 3WJ1A 5DLEA 4DLWA 2MR5A 4OYRA 3LHKA 1K6EA 1QGED 3H2SA 4KIJA 3U39A 2VWGA 1M0SA 3KX2A 1SC4A 5IM5A 1MN6A 3ZZNA 4RKQA 1JLSA 3I6MA 3WLJA 2ZRKA 3GLUA 2F1RA 1PUJA 5TNXA 3NGLA 3UUWA 4BP1A 4AP5A 2H1OA 3VR5A 4ZEWA 2OCKA 5CLHA 4IIFA 2VDLB 4EG7A 1RM3A 1SQGA 3IPCA 2H18A 1M6VB 1T2DA 1IEXA 3QKWA 4LC1A 1XPRA 1ID8A 4LWPA 1IC6A 2AXNA 5CVTA 2PWZA 2ZE6A 2PAAA 3P96A 3SF0A 2D2FA 3U4QA 3KETA 1O3YA 3TAUA 1PN3A 4CLRB 3MF4A 3IIIA 5FBVB 5EWLA 2G9UA 1E7YA 1NASA 3KKMA 5CAEA 2VYCA 2Z95A 1PEKE 2B36A 3TIFA 3IT2A 1NVMB 3IQIX 4PG7A 3TPCA 4E5DA 1XKLA 3OCJA 4PANA 4JA2A 3TRFA 4IEFB 1L4HA 4RFVA 3A1NA 3PD0A 1MVOA 1RU3A 5EWJB 2ZB8A 1LNSA 3RGGA 4C0XA 5G0TA 1U0RA 3ST7A 1MIOB 1VGRA 2G9ZA 2GVZC 4P84A 1FBNA 3ZJ5A 3PV0A 2XMPA 4ZICA 5J2UF 4F85A 1EU1A 2HD4A 3EGDA 3EZ9A 2QZ9A 3CFYA 4H31A 5JYDA 1JTVA 2C9MA 3I05A 5CFMA 3BJEA 3BXZA 5JCJD 1ORRA 1G4AE 2VAXA 4BQSA 4EGSA 5C1DA 4BKMA 4QEKA 4EMSA 1H8EA 3Q6MA 3S99A 2ZR0A 1ZOPA 3IHKA 3K20A 5KYUB 1AQYA 4JCCA 1AMNA 1YCFA 3GGPA 3PNMA 2E48A 1U5BA 1ZBQA 3JYLA 2C8KA 1WNTA 4RF3A 5FPSA 5YASA 3X1XA 1G18A 3AESB 4YONB 2Z2YA 1N1DA 4RM3A 3B8EA 5JXIA 4FK8A 4R1UA 5LUBA 3A4IA 4GVPA 1HF3A 4N9WA 2X0EA 1UCFA 3HL4A 4EATA 3M83A 1OXVA 2A5GA 3OPNA 3SVLA 3SSNA 3EUAA 2HW8A 4KZPA 1P2GA 5KNDA 4BNGA 3HCRA 4NV3A 1S2LA 5AM0A 3KB8A 3VPGA 5EXSA 3FPFA 1GO2A 1NA5A 4CM7A 3U4QB 1BYUA 3MG9A 4CQLA 4B5KA 1ZK3A 1E3DA 3COSA 4LZPA 1DQNA 3UT0A 4G5FA 4OVKA 1VMEA 4X1IA 5AW8A 1TF7A 2JAUA 3UT5B 2WD9A 3W6PA 3WHPA 2EWWA 3CUSA 3KJHA 3U7JA 4ZVMA 5L7WA 2CMDA 1ESZA 4P5PA 4YFYA 3HWX1 3VR6H 2O2CA 2YXBA 1T2UA 4EHLA 1P29A 3LUDA 3N5KA 1OU0A 2Q1WA 2PSFA 2ZRDA 1O77A 1UOPA 1TC2A 2HNAA 1R18A 1TT5A 1C80A 3M4NA 4MVJD 3H2GA 4Q3OA 2E85A 3T4PA 5K3DA 4UVGA 4RA9B 1GKKA 4CU5A 4IZOA 2XZPA 1LLFA 2OCPA 3F7MA 5DBEX 4CEIB 1I33A 2Z3WA 4ASUA 5ES4B 1JXAA 4WZAB 1G2QA 1YQXA 4AQ7A 4FC7A 1CJMA 3OM0A 1TM7E 2V5AA 4HEHA 4YJ3F 3TLGA 3U3OA 3ZTWA 2B1QA 1E9BA 2ATIA 1SO8A 4W82A 1NVXQ 2Q4OA 1JQLB 2CK3D 2UZ3A 3KXDA 2M9MA 3UY4A 5FORA 1XZLA 3H75A 1TTTA 4AQYB 1O95D 4UZSA 4DRXA 5K0TA 3NHUA 1QCZA 4UNSA 1HMYA 1ZESA 3JQ9C 3GAAA 2PKQP 2Z08A 5E0KB 1X1QA 4M88A 3PS9A 5EMMA 5H83A 5HZMA 3ECAA 3E9DA 1T9GS 2SKDA 4QOGA 3RRNA 1KSFX 3L6RA 4OO3A 4D57A 3DZ8A 4K6OA 3HCFA 2Q1YA 4E5UA 1L7QA 2XYHA 4CLEA 2VHXA 1QLJA 3DO6A 3I5AA 1Q0PA 3A14A 1KAGA 2DR2A 1MBZA 1K6JA 1OR8A 2UKDA 4IDFA 1CQXA 3AF2A 5D86A 4EX7A 4C0HA 3GLGB 1HURA 4ZOQI 1QG2A 3A6ZA 1IN1A 2YASA 3WADA 3RIHA 3JALA 1T34A 5TT1A 5IANA 3VFDA 2JGKA 3C7KA 4L8FA 4J7AA 3PCTA 1C4WA 5KS2A 3O94A 4TV8B 5A06A 1G4HA 5JAIA 3QVSA 1PX0A 4QUJA 4Z49A 2JPDA 3LAWA 4O2BA 5KNDD 1I7QB 4H3HB 3GUZA 2IIBA 3VMMA 1FMTA 3ZZ1A 3LFUA 1P7VA 4NJEA 5TMPA 2WSBA 1N0UA 1DWOA 1M34A 3CE9A 3G23A 3QSYA 3NV7A 2WMOB 3PR3A 3H1PA 4BXOB 1DEXA 1Z7WA 4UTNA 4MQUA 5G0WA 3C15C 2CJFA 5CFOA 4FDMA 3WSVA 4QARA 2W8BB 3I5MA 3PKJA 3S5UA 1KKLA 1O94D 1CNFA 4RPJA 2FMKA 2WWXA 2C8JA 1Z0DA 5LLDA 2Y68A 4TT3A 4U7DA 1Z3CA 4LSWA 4P93A 4WKOA 2BTOA 1SY7A 1YS4A 2ENWA 2ZUDA 5AM4A 3TRHA 3H99A 5BUCA 4C7VA 3HDGA 2QL7A 4NPCA 3FH0A 3L92A 3WYGA 2F9LA 1NY6A 2DT5A 1D5WA 3JD4A 4INZA 2WYUA 4FX5A 4MUXA 5C53B 4MITA 2GR9A 5DX8A 3WI7A 1JI3A 3PX7A 2ZB3A 1DKNA 3HDQA 4TYQA 2G7MC 1I6LA 3MTJA 4CU2A 5F3WB 2CLHB 4N8EA 4ENVA 3TG2A 1QV6A 1RBZA 1GPNA 5CAEB 4AWAA 2GN2A 4C2AA 2P4QA 3AWDA 4C9BA 2XGMA 2K7FA 4EKGA 3ZI0A 1QRAA 5CB8A 2CK3A 1OH5A 2DFDA 3BGWA 4P4SB 4A2CA 3P2KA 1KZYC 3CEPB 1CUJA 1J23A 2Q6OA 5HP4A 1DKPA 3WK4A 4BJ5A 1OFUA 3I0NA 4K8RB 4NJOA 1MQ8B 5CLLA 3D54D 1GPH1 1J0AA 1RXYA 5SY6A 2X5JO 5HF8A 4C43A 3VNVA 2MDTA 2DG2A 3LVBA 4KN8A 1ZLXA 2VHWA 4EVRA 4YV2A 1Y8ZA 2GARA 4G07A 4JU9A 1NJSA 3SF8B 3PWKA 4KV9A 3A58B 3DYIA 4RAOA 5F33A 1T24A 3LE8A 3D8UA 4LC9A 4MO2A 2BOVA 1UWVA 2IUEA 3DFMA 2P0EA 1NKSA 3I5UA 3EIQA 4KQWA 2V4UA 1N2HA 1AUOA 3WRXC 2PL9A 1OH8A 3JQCA 4DCMA 1TLLA 2YJGA 2OHVA 3KYJB 3PTLA 3R7NA 1XK6A 1Q84A 3BWCA 1NJGA 1TQ8A 3HUFA 3JAWB 5IHPA 3W90A 1VPEA 1P4HA 5IYZB 3GRAA 5FL3A 3RTDA 2F1IA 3HB9A 2VUHB 1EXVA 2XMDA 5BN5B 3CGGA 1SKQA 2XUHA 2JLBA 2X4IA 4C7JA 2AOVA 4A3SA 3X2FA 4BCBA 1DQPA 4XGIA 1J24A 1RC1A 4ODIA 2DPMA 4PZ9A 5EHQA 5JBQA 4UQLA 3HJCA 1E1RD 5DLDA 3ACDA 4GBJA 2Z6AA 3KKKA 3TBHA 5P21A 3KVRA 4RQAA 3BMCA 1JPJA 1IZZA 1XHLA 4DLPA 1L4MA 1N8KA 2YWFA 3EMVA 3BFVA 1UMBA 2ZAMA 3HYTA 2ZJ7A 4H7KA 4CM6A 3UWSA 2QPLA 5K01A 5J59A 1OGIA 3D8BA 4PGHA 5JW6A 5AOBA 1QFMA 3DUFB 4MXDA 2ATCA 5F5LA 3UAYA 1GTZA 1C9EA 2BEWB 1K86A 2P1ZA 1LDEA 4E15A 4CDGA 4D9FA 5EWMB 1T0JB 4WOKA 2JHFA 3UAZA 4XA8A 1I6WA 4ZVLA 5DM70 3ZCQA 4A8HA 1I7NA 5ITZA 3K4HA 2XT6A 2HADA 2BGIA 3FMOB 2QMZA 5D84A 3UIEA 4L6IA 5G0VA 1W46A 4XQGA 2WIGA 5BN4A 3ZE6A 2F4VB 4OI2A 3CX6A 3KJNA 1EFRA 3ZY2A 2GS9A 3WIOA 4EHJA 1COZA 3RRYA 1QKIA 2FSFA 3HGTA 1EFVB 4H6XA 1P4GA 1SBHA 4XVQA 3RAFC 4EECA 5I9LA 2CNOA 2H1LA 2R2GA 3K9QO 3RB8A 1ZR2A 4QO7A 4E22A 2QG4A 2B82A 2BUBA 1AOXA 2AF3C 1U90A 4HDNB 3PA6A 4FHZA 5DK6A 4L4SA 3TX6A 5IXYA 4Q9AA 5F77A 4EK9A 1GP2A 2E3JA 3PUIA 1V9CA 4FBGA 4Z51A 1A8QA 4K2AA 5TQJA 4MWEA 1EESA 3LCVB 4MVJF 1Y8RA 4RMGA 4A9AA 2Z8YA 4HATA 3T41A 1GV0A 4BNLA 4JROA 3ZK8A 1HV8A 3PNVA 3JR3A 1G7TA 1H4TA 3VBEA 3NAMA 2WU8A 1FXUA 3IIMA 1ZC3A 3QEKA 4XB6B 1OAAA 3TQFA 4DEYA 4BRSA 3EULA 3FDIA 5DBOA 1UC4B 2BI4A 3E7FA 4PZYA 4F5EA 1IJEA 1GL3A 1RMTA 2O2HA 2Q8QA 3N70A 4L74A 4RKWA 4RLQA 4UBOA 4F8JA 1BDJA 1EG7A 1HKUA 1V8FA 1Y8CA 1CDEA 2E4VA 4P4LA 1GZUA 4TV8A 4S24A 1S3IA 1LSUA 5CIYA 1KYTA 1XAIA 1VLLA 4E13A 1RQPA 1QX4A 2FMXA 2RK3A 4D9IA 4DDTA 2WSLA 3IALA 3DNMA 3QQPA 3THYA 1NR7A 5IPFA 2H00A 4CUJA 2PKEA 2WTBA 3ESAA 3PXBA 3BHNA 2ZWVA 4R2XA 1PO7A 3OQBA 4M36A 1Y8AA 2GZ2A 4I50F 4NEHB 1TW3A 4UULA 3REGA 3HWWA 1EZ4A 2G4VA 2QRMA 2WT8A 4A8JB 3RYCB 1LLDA 4K6KA 4UTZA 2XYQA 2ZJAA 5H68A 2XE6A 2Q6LA 2Q5JA 3DW1X 3HKEA 4MGYR 1IEVA 4QIHA 3SIPA 1QFSA 3PZBA 1BHJA 1P1RA 5SV2A 1SMKA 3K0HA 3BERA 1C30B 4L3WA 3SEZA 2ALJA 2KQUA 1FQOA 2DHRA 2GEVA 3L1VA 5H3LA 3N6VA 2OPBA 1A88A 2ZEJA 1DJMA 1HQDA 1Z6AA 1U0GA 2PTGA 1WEHA 3Q6IA 1WZEA 1DBPA 4Y9SA 4XGKA 1GYRA 5HJEA 4ZQIA 3AVUA 2FNAA 1R3UA 1I3LA 2P78A 2XTNA 3GLFB 1RJEA 3QEOA 4QATA 1ONBA 1V3QE 1YQTA 2PMKA 5FUQA 1IQPA 1UOEA 2PGOA 3F3KA 1X1DA 3R23A 3HLYA 1P31A 1JFRA 2XT9A 4YRPA 1KL7A 5FLKA 3HZRA 4MQ5A 4RV5A 4ND4A 5K3SA 3K1TA 2OOSA 3G2HA 3LNTA 1R4AA 3EDMA 3ED1A 3NBFA 4H1HA 4W7HA 2BL4A 3SIRA 1YS6A 1GZ7A 2PZBA 3WYFA 3GRUA 1GRRA 1TKCA 4DCPA 1VLVA 4EHNA 2GRJA 3GUVA 4DILA 5SZHB 1IEWA 3MWDB 1EUCA 3TW0A 1SD1A 1FS4A 3UF0A 2DY1A 2CFTA 5B4UA 5KYNA 1YAJA 3QE3A 3TSZA 5I9TA 4ZZ2A 4WBNF 1PVOA 4FCCA 3Q3IA 4KO3S 1PTJA 2ET6A 3DTYA 3HR7A 4IIGA 2YC2C 5KTSA 1C1YA 1RP1A 3K0AB 4WASA 4PN3A 1MO2A 2J30A 4FDTA 2PS1A 3CSUA 4N65A 1ECCA 3TDMA 1OH7A 3FPBA 3X2SA 1H85A 3B78A 4U6NA 1V1RA 1Z82A 4IYJA 2AVDA 1KY4A 4EB6B 3GO4A 5DXJA 5K09A 3FKSA 3UMBA 2CXPA 5FWNA 1Q12A 4UNIA 1LLQA 2FAXA 3M6VA 4YCDA 2GYUA 5TMEA 3UMMA 5LMCA 3COJA 2ZR8A 1ZO8A 1G5PA 3ZUGA 5HX7A 2N42A 1OT3A 3LY9A 4H7JA 4NXMB 2VH1A 5KSYA 1NPYA 3GLFA 2PSDA 2UVPA 3AC0A 5TRTA 2VHYA 3JZIA 2RGRA 3BWXA 3SKVA 6GPBA 1IXSB 5K2OA 3U7IA 3ZHZA 4O4LF 2JVJA 2D0DA 5GIOE 1C9DB 3R7DA 5TE9A 1QTNA 3JQFA 1JR3D 1A27A 4ZXFA 1FVFA 2J8ZA 3AEUA 2JGNA 2C54A 2ZJFA 3L0YA 4IKOA 3R8XA 2CNWD 3DEYX 2A92A 3C98A 4S1PA 5TJ9A 4NBLA 2M6LA 2FEMA 4LRSB 3RUEA 5LXTA 4JBGA 3HG7A 1UPUA 1E0DA 3A1DA 4UAVA 2MIIA 1PYDA 2I8CA 1R2QA 2ZB4A 3FNGA 2IYUA 3N8KA 4N6OA 3WG9A 2YOGA 4W9RA 3ZS9A 1NIJA 5JASA 3ETGA 4ZVTA 1TXGA 1H9BA 3IT0A 3KZCA 3L7OA 1UJ6A 4DGSA 3EZFA 3BDVA 1L5GB 1A98A 5JU6A 4NYIQ 3MAAC 2JARA 4WFIA 4OXRA 4DCTA 3DMGA 3NCHA 4MR8B 5JJCA 1S7CA 1BO6A 1L7NA 1E2DA 1QVAA 4JI3B 2IS6A 3M3PA 2GESA 1FVXA 3RJMA 1EP9A 2QMHA 2BEVB 4BGVA 3IV7A 1ISPA 1ECBA 1Z37A 3JAKA 4HDQB 2XDYA 2Y2UA 9LDTA 3ZWXA 2JCBA 3NGMA 3OTHA 3QPVA 1X2EA 3SZ3A 4CN8A 1X13A 3B3QA 5IKPA 1FX0B 5F12A 3TTYA 3GRYA 2DYKA 1C5KA 2A58A 3O92A 4XJSA 3EW9A 4KWEA 3JQDA 3Q8WA 1Z0UA 3EQ7A 1UDCA 2J9XB 1SZJG 3G02A 1GGNA 2W0SA 4ZAGA 5ICSA 4Z8XA 5LSAA 2P9QA 4NBRA 3PHBE 1TNDA 3PJGA 5GADl 5JDIC 2I2WA 3JASB 3E4DA 3G0HA 4YRCA 1IBCA 2BLNA 2REXB 1M5TA 4Z4FA 5LZ5A 3HJNA 2I2XB 5LBUA 4E3ZA 3INNA 3NHAA 2PKQO 2E55A 2BTEA 2J9ZB 3OEED 2YXDA 4WECA 5BNWA 3R41A 4B6JA 1XBTA 2BKAA 4OXIA 1SD5A 1RZRD 1NYTA 2PX6A 2C83A 2FPGA 3LL4A 1H42A 3NBXX 4DLTA 3AFIA 4DPMA 2A9FA 2QAGA 3OZUA 1N78A 4W99A 4M7PA 1L5KA 3HRKA 5AVOA 3MYYA 3RROA 5FR2A 2CT8A 5TPZA 4P22A 1V16B 2M32A 2GD1O 1P6UA 5AKKA 4L75A 4QM7A 4CTJA 3GT7A 3L6OO 2IEGA 1R0WA 3H5LA 5DBIA 2ODPA 5A7HA 3QPDA 4KXYA 1IQRA 3R7LA 1Q3HA 2HSJA 3BA1A 4CCYA 2YZKA 2BGWA 1DZIA 4DR6B 4CM9D 7REQA 1DWUA 4JBIA 4M9CA 3H5IA 3LFHA 5TVKA 3ROEA 1D1QA 3BBLA 5HJ7A 1LW6E 1RWNA 3GLKA 4Y3UA 2ZIUB 1CQJA 1YZVA 5CT8A 3WGGA 4Y7CA 1VA4A 3CVVA 3ZE1B 5BVHA 3EWSA 3F5DA 1T6BY 3ESYA 3CEJA 3P5BA 3NC0C 3ONWA 3FVWA 1NXSA 1OXKB 2QG9A 5EJMA 4J16C 1UMBB 1NW7A 3DE1X 4OD0A 4ROSA 1VE3A 3DBRB 4U2DA 4X8OA 2BEUA 4UCWA 3WMGA 1BVYF 3MRVA 4ETNA 1WABA 1QFXA 1F9AA 1Q20A 1S3SA 5DM60 1Q0TA 3TYXA 3GJQA 3F74A 3ESZA 4KFCA 1N9GA 3B1VA 3H1BA 1FUEA 3OIVA 2KB0A 2XIQA 3S2YA 4Y18A 4ED9A 1D9ZA 3U48A 3DVLA 2IUUA 3EVNA 4IHJF 2C82A 3UMRA 3RVRA 3AM1A 3OWXA 4Q4JB 2YZ7A 1RNLA 1E61A 1QFZA 2W2MA 1DG3A 3I9MA 3GJ4A 5E7IA 2R84A 5JI3E 4H60A 3AQ4A 2V6IA 4N18A 4TVOA 4ZT3A 3FPHA 2QRLA 3I2KA 5BWCA 1EXDA 5EP2A 2ZI5A 1BAPA 4KV7A 3SS8A 1FQWA 3X1DA 2FMFA 4KJZA 2PL3A 1H2YA 1S96A 4NARA 4BLOA 4RGVA 5AO9A 5CDFA 1LXCA 2ERCA 3NNNA 1SXJA 4PZDA 3W79A 4G0QA 2JGJA 4BVGA 3K6SA 1PHRA 3BE4A 3C3EA 4FFBA 4HWTA 3SM9A 2O50A 5JJIA 5KDDA 1NGSA 2QLFA 4GXTA 4BBZA 5BP7A 3T1OA 3GT4A 4O2LA 2O5VA 2GF0A 1ZI6A 2CXTA 2IYSA 2ZTSA 3QOWA 4FHFA 4LJ6A 2ZRCA 4NBTA 5EKTA 3SX0A 2JBAA 2QTVA 1O6FA 3BGOS 1K68A 3HVJA 3K3PA 4R8SA 3K6RA 1GHTA 4NBSA 1K7FB 2XWSA 3PD1A 1TA4A 4IR7A 4BFCA 3AILA 4OQYA 2Q4TA 4URHA 1IBLB 1O5TA 4RH3A 3GROA 4DTIA 2SNIE 2WIKA 4QU8A 1AIPA 3G2NA 4C01A 3O31A 2VDUE 1NDUA 3O6VA 4GIBA 3MT7A 2D5LA 4G8DA 3JZAA 5IJ0B 4MJ3A 2WU1A 5NLLA 2GETA 2IBMA 5CLFA 1RT9A 5EHZA 3WNDA 2C4NA 3OKAA 4JLPA 1L1EA 2WEKA 2H48A 4JGGA 5LLTA 1EUDA 1B16A 1XTUA 3NTRA 3FBWA 1P2BA 3FI0A 3FE2A 2QYHA 2AEJA 1QIDA 3OQOA 1Z35A 3D1JA 4MWTA 4ADSG 2DM6A 1GQRA 4KOAA 2J7PD 3P9CA 1OAOA 4M1WA 4WT7A 5U1PA 1YWGO 3DDUA 1TO2E 1VKJA 2C61A 2FPOA 2O14A 2RIRA 1AZTA 4CKWA 1H6BA 1SB9A 4TTQA 4KQ2A 1TFUA 4XXHA 3VJLA 2YJ5A 2CXQA 4E14A 3VX4A 1CUDA 3QEBZ 1QQBA 4HH4A 1R6UA 1H2WA 1SBQA 4FFBB 4GU5A 2ON6A 4RABA 4Z0PA 3NBAA 3EBOA 4M0CA 5F3RA 1KQNA 3WRWA 3A1UA 1UDWA 2LD4A 4AJHA 1OF1A 1PJZA 1DPGA 4ZHSA 3U9SA 4DHWA 2K2QB 3EQ2A 4PM4A 4I1VA 3FTFA 1GCGA 5FOSA 3PKIA 2G83A 2WYHA 3B1FA 3Q8KA 1EX6A 4DDKA 5AUOB 3IVCA 1E5XA 1FDTA 1YV9A 1A8HA 1NBWB 5ALFA 4GYYA 3VYWA 1JDJA 2C9YA 2R4TA 2XODA 4OXNA 1P0PA 2JFBA 2QTAA 3MA0A 1BVRA 2BMEA 2LXNA 2YIMA 3MM4A 1FNNA 2XGGA 4O02B 4BNDA 2YWEA 3GZJA 5K7SA 2Y27A 2FWIA 1YCDA 3V7FA 1KKUA 1P9LA 2F1HA 1U2DA 2H65A 1XU4A 3AETA 3VZSA 4Z8YA 1LVUA 1ESEA 1I2MA 3FYDA 1N2XA 3BORA 3GVHA 2R8EA 1LRLA 4GP9A 3CMCO 1KJQA 5A7FA 2COUA 4CKBA 3Q5DA 5DLQC 5JAOA 5H80A 1O5IA 1KXJA 1F2TA 5JC8A 4F4JA 3LLCA 1I6MA 1ZNXA 1N2ZA 1Y4DE 1U7DA 2VRNA 4F45A 4OV6B 2F9MA 1U4OA 5EIHA 3UUFA 2DC1A 3IEMA 3H7IA 3FGPA 4ND7A 4EFLA 4XSGA 1EFAA 1UFOA 1X2BA 1GUZA 5GINE 3IE1A 3SMVA 5A9TA 4YUWA 2MSLA 2PRZA 2MR6A 2VT2A 1B1CA 2C57A 1AG9A 2ZATA 4C1BA 1OMOA 1QG6A 1NQXA 3PC8A 1X1SA 1X42A 3PP8A 3EFHA 3SHQA 4BE7B 5JCJA 4F3CA 4CEJA 5JS6A 2A14A 3QU5A 2O23A 4IDQA 4MRRA 1H8ED 1TQ4A 5JXGA 4W7IA 4FC6A 1JBEA 1UEXC 1KFBB 1HETA 3N1UA 4FMDF 4FNMA 4HXFB 4RCVA 4C08A 4CQMA 1NQUA 4NENB 4OP2A 4F04A 3LDAA 2GPAA 2BHNA 5JSKA 1K0UA 3W06A 5BUQA 3JSAA 3OBBA 4FHGA 3RABA 5HZKA 1NF9A 2YOHA 5DKFA 5FLEX 3LUAA 4CM1A 2WG2A 4FSDA 4MGIR 1TA9A 3GHYA 3U3MA 3QHQA 2CV2A 4EEKA 4D81A 3RYHB 1DUIA 5C34B 3T3IA 4QASA 2I2CA 2DQYA 1QTIA 1G7SA 1TM4E 5IG2A 2BE9A 3MTDA 2BEJA 3KP1A 1H1TA 4L4UA 1V6AA 2W6JA 2A9VA 5AI8A 1BU8A 4AAYA 3S40A 2JGFA 1R0LA 3IOEA 4ZMSA 2ZUVA 3QVWA 4TSKA 1BD4A 2O1SA 4DMCA 3QI2A 1QUEA 3DB2A 1BOOA 2WFLA 5AXCA 2WZCA 1JIQA 2VAPA 1APBA 1P44A 1QB7A 2C3UA 3AQIA 4G1CA 1BVHA 1V6SA 4R31A 4Y2JA 1ACMA 3JCZA 3D0RA 4G0VA 3MT8A 4U7FA 3HR8A 5AXBA 1FLAA 1U6KA 1T9GR 1Y81A 3N2YA 3QF4B 1US8B 4NYIR 4R8MA 4TSFD 5ALWA 1RXVA 2ID7A 3GDFA 2ZIVB 5JY1A 1W5SA 3FPLA 2Z5LA 1UBFA 2PMBA 4R1MA 5EY5B 1Y63A 1POWA 1I6KA 3FHOA 5FA8A 5C0OE 2J0VA 3HVRA 1LSOA 1Q1EA 2UZIR 1R27A 1W85B 5H7XA 1TECE 2Z1DA 3U4IA 5LWQA 2ACKA 4Q21A 2MYNA 1JAXA 3FJOA 4PSUA 1VHQA 3O4GA 4CL8A 2HF8A 2EZ4A 3QWIA 4O5AA 4EY8A 3SX4A 1EYZA 4FZRA 4BFLA 3GJ8A 2HFKA 1VIAA 3W7VA 4CR7A 2PYIA 1TLFA 2FWPA 1OPXA 3HA7A 4Z7NB 2AXPA 2A5YB 2FZVA 2ZUEA 2IGBA 3NTXA 4FTWA 4PNPA 2B7BA 4MUFA 2I33A 5A4AA 1ZGCA 3QMWA 3EGOA 3ZV3A 5J4YA 8MHTA 3QBEA 2MYTA 3UJPA 1BQ3A 1K5GA 3DD5A 2P7HA 4B9AA 3STUA 1Z7GA 1JL3A 1ZWLA 2WAMA 4Z1MA 1YB2A 1Q0LA 1I4EB 1U7XA 2XWBF 2YNMA 1TU4A 2YFYA 3Q5GA 3EOZA 1ZS9A 1IIRA 4XVHA 4B87A 3S8YA 2EQAA 2GPJA 3GP5A 3FMFA 5GONB 1DMSA 2ZT5A 3ZE8A 2P4HX 3N2GA 3WK9A 5DHPA 4EQZA 4GVLA 3M9WA 4G23A 5DYGA 4CT4B 3R4CA 4I46A 4RDHA 1WUHS 1NP7A 1M2KA 4XM0A 1XKXA 4KQ9A 1SCDA 3AY0A 1XKQA 3CT6A 4TTIA 5A0TA 1R4NA 1CYDA 2QSUA 5J5AA 3KJZA 1R50A 2LBPA 1KWGA 3GU3A 5CA0F 3LT1A 5IN5A 3NBMA 1IAQA 2C2OA 2PZAA 1VIDA 3VU8A 2G80A 4QTYA 4MUMA 1P6XA 3K0EA 3C2QA 1HTWA 1WVGA 4FJ1A 1HO3A 1A7AA 1GPAA 1PG0A 1MH1A 1MB3A 3A6KA 3RBAA 4BX0A 5A62A 5FWXB 3CUKA 1U9IA 4O4HB 2KWIA 1D2NA 1O94A 2X3FA 1MV8A 3BH7A 2F3TA 2VJLA 4KKVA 2R6R1 3T1HB 1N7GA 1G66A 5D5PA 3V8VA 3Q4GA 4JLOA 4NMHA 2Y1EA 1RM4A 2XZTA 2O3UA 3SYNA 4TTAA 4EEXA 5BNFA 5L3SA 1EIWA 3LKDA 3UMGA 4B46A 3O21A 1TPZA 2AMJA 5JJKA 3DG9A 1PQYA 2UZAA 4ENQA 3V7YA 1KVUA 2FCAA 3WYDA 1GSOA 2X58A 1EFTA 4NCAA 2YJ6A 1JLLB 3U4DA 4GI7A 5CFZA 1T5DX 1D2MA 3LO5A 3GELA 2VP6A 4KQJA 3WLPA 3MQ4A 4YJDA 4QO8A 3ZY6A 4TYWA 3A32A 1PR1A 2Q3JA 3PUJA 3G8AA 4RULA 3OJOA 1CY1A 2H0RA 3GJ5A 3WKDA 2NACA 4S1WA 4EKEA 4MVJP 2P5UA 1EGHA 1YR7A 1YULA 3T1NA 2O6LA 2YQZA 1QNLA 3LKVA 4TLCA 4LE2A 5GV8A 2JGDA 1V5GA 1IE3A 1XAGA 2HU5A 2ECPA 1S8OA 3VPFA 1NNEA 2HK6A 1QHHB 4I3GA 2VJOA 2XT0A 2B5OA 3KAPA 4FYYA 2OGWA 1FDUA 1J2RA 2YY5A 5CVCA 1HXHA 3UK0A 1L5FA 2P8JA 5E3IA 4E5VA 1VDMA 3L02A 3T06B 5HS6A 5LN1A 2RB4A 4IDGA 1T5BA 4YIKA 3T7TA 1Q1QA 2P3OA 2IZ6A 4B80A 2FHSA 5LDHA 2A57A 1E2MA 2VHVA 3LFTA 3NJ8A 2PQ6A 3A1TA 3DPSA 3IVAA 1F4VA 3CB2A 2GJ8A 1Z38A 2PN1A 4AZWA 1CS0B 2XAUA 3JQEA 1QJCA 5KJ1A 4IEIA 4PHGA 1PZHA 2NPFA 2JJ2D 3VDQA 3ZHSA 4DLXA 2YCBA 4DKJA 1SELA 2QUBA 4J7XA 3W5VA 5E3HA 1BWQA 1JXOA 2XOKA 4XGQA 2AGVA 3BD6A 3Q3CA 5HXAA 1C7QA 3EY9A 1E1NA 1ETUA 2R66A 5K9ZA 1P74A 1TAQA 2PSEA 3OICA 4G5OA 1IN4A 1JSZA 2BFCB 5AKYA 3T9AA 3U3DA 3SC4A 3KEMA 5CLIA 3EYWA 1M2NA 3CE6A 3Q3HA 4AS1A 3TLMA 4C0KA 1RC8A 1GARA 4CKWB 2GZHA 1MJNA 2Q3HA 2YV2A 4LDRA 3FCXA 5EFZA 3RTCA 3HU5A 1DO2A 2FWBA 2GJ4A 2R1VA 1UZNA 3TSAA 5C1OA 4HMQA 1BH6A 4F38A 2G8NA 3JS5A 1G5FA 1GU1A 5TXGA 2APJA 3HGMA 1G16A 1QVZA 3L2OB 4Q9LA 3EVZA 4ZAFA 3EZYA 4FMCB 2C2KA 4OU4A 1REQB 1XELA 5FUXA 2Z30A 4RFSA 2WYOA 5IJ0A 1OZ0A 4TVSA 4QE3A 4LGMA 5E1DA 1L7RA 3ZGOA 3CLSD 7AT1A 4OX9B 2VF4X 5T4FA 4IGIA 3E7XA 3BTOA 1EP3B 2IHYA 1HQYE 3WK8A 3AEKB 1EX1A 2ZM5A 5MGNA 5FFNA 1Y6JA 1FFAA 3Q3EA 4II7A 5EJ9A 3TZLA 4BIMA 1RXIA 1HA3A 5C8YB 4QDXA 2ICAA 3LTNC 1WKBA 5HUHA 4BLSA 1MX1A 1V1MB 3CNOA 1JKIA 5JALA 4CEHA 5A3JA 4DXHA 3T1TA 2W0MA 3CLHA 4FN5A 3PC3A 1T2AA 1Y1QA 2GKGA 3FPAA 2IJGX 4P3NA 2AG1A 1DMRA 4QRIA 1QHIA 4XVCA 1A9SA 1OXBB 2MTBA 2UAGA 3ECSA 1XQXA 1E60A 1C1HA 2FWMX 2AKAB 3N3AC 1H94A 3EFBA 1F17A 4HUJA 4B3TB 2GK4A 3NWBA 1SXPA 5CFLA 3MJ4A 3TECE 4FWBA 3HXKA 5AKZA 5E7MA 2Z5FA 4JD5A 5JZ9A 3B9QA 3HXMA 1YRWA 1LJLA 4UAUA 5E9JA 3LVRE 4GYWA 1U8ZA 2DPHA 3EFEA 2BE7A 3OMXA 3B6ZA 1L7XA 3FD8A 4PQGA 1M0TA 1B6TA 3AHGA 3TKYA 1M75A 3W5IA 4DUGA 3R3UA 2WB4A 5D00A 4QYSA 1E3WA 2XJ9A 3F6CA 1ZNWA 5EE9A 3A4YA 2C9OA 5JNTA 2D8MA 2P90A 1I01A 4A7PA 5LL6P 1VJ0A 5IAJA 2JAQA 2JJ2A 2WW8A 3L6UA 5JVDA 2VR1A 2Y4NA 4PEVA 2FLVA 2HWKA 4EGQA 2GJSA 2GEFA 3TNFA 5HSGA 5C46F 1NAIA 1DRKA 2VK1A 4EQ6A 3BIJA 3ZHRA 4F4HA 1VL6A 5DEOA 2QX4A 4HRAA 4LOAA 3F4LA 4F6RB 4F46A 3G9TA 4FCTA 2R25B 2W2KB 4FEYA 4L51A 2E4UA 2UZ0A 3SNKA 1TK9A 3IKTA 1FYWA 1AKTA 5M34A 3ZDYB 5MN5A 3LC1O 5LOVA 2JKVA 2NLOA 1GN8A 3CURA 3DKIA 2IDZA 3MMNA 4DGQA 1RFLA 1YB5A 2C92A 5BW8A 3GOQA 2FUG6 5GZ1A 4CNBA 3WKAA 1KDOA 1PQ4A 4TTRA 4LY0A 4WBXC 1U6IA 4LVCA 1E4VA 4UPDA 4W5TA 4CMIB 4V0OA 5EJ5A 2FMTA 2Y66A 2DBYA 2Q2QA 4IS2A 3ADCA 1AKUA 3LBFA 1KH1A 4QX6A 4N01A 4KQIA 4AIRA 2JS7A 3CUVA 3WLKX 1B6RA 4YJGB 5D1NA 1QPGA 4QXAA 1ZG3A 3FNIA 3NHSA 5F78A 3T9CA 2AHRA 1K63A 3KWMA 4B7CA 4Q1BA 3FPSA 1JNYA 5E1OA 3FB1A 3ZPXA 4CDMA 3AVVA 3CQ9A 4O4IB 2CLLB 3ND8A 1F3LA 1FS5A 4NBUA 1YDGA 4RIEA 4OM8A 4KWTA 4TYPA 4UVDA 4AZTA 2Q5FA 5IAOA 4I4TB 1D2EA 2PQ0A 4D41A 4B3GA 4O25A 3MB5A 4QTTB 1CNEA 1RW4A 1SEVA 3V4RA 1MRZA 2P9TA 3GC6A 2K6GA 4ZTBA 4H1TA 3AL0C 3ZCRA 1HDCA 1JFTA 2XEXA 3DCYA 2QOEA 3H2JA 2QEQA 3BJZA 3F7NA 2BH9A 3X43A 1GSIA 5TQ0B 2OXTA 2IH5A 3AZPA 4DJDC 1U2RA 3TQRA 2ONJA 4Z3KA 3U60B 1O1YA 3W6NA 3U09A 3KEGA 3FPJA 1H1LB 1G20B 3SI7A 5EIBD 3EFOA 4WN3A 4KP7A 4EA6A 4FYXA 1YB1A 1M8KA 3L0DA 2EFJA 2Q8NA 4NV0A 1OSNA 1B00A 1D8TA 5MFPA 1XTIA 3MSCA 4JJKA 1QF9A 5GTDA 1HR0B 2C0QA 4AF6A 2QBYB 1U31A 3FGOA 4I1YA 4XSHA 1L7BA 5ALXA 4BNYA 5K03A 4S12A 1A9OA 4CTOA 3VV2A 2D4HA 2VSNA 4OGKA 4IAOA 5DTRA 4ZEOA 5F73A 4EO7A 5CA1A 4LQLA 2XB2A 1ZH2A 4RPKA 3ZWCA 2G71A 3ET4A 5KVAA 5IDWA 4JVLA 4BS9A 1DIOB 4AQDA 1GXSA 4ALNA 4OBEA 1OYOA 4NX2A 1T9DA 5BV2P 4HGOA 4US0R 1ZU5A 2VTVA 1SXJE 1ICEA 3KOUA 2HU7A 4N5NA 5AOAA 3V8NA 4F93B 2J59A 3Q7EA 2OZLA 1KIMA 5SICE 3ENWA 4HDAA 4U8HA 2A1UB 1Q0RA 1M3SA 1R5NA 1XB2A 1GL7A 4LEIA 3NZEA 1JVNA 1FJXA 2NU7A 1DAMA 3CF0A 4RMIA 2FG7C 1FFXA 4WZBE 3TNDA 4BV8A 1K8RA 2I6TA 1X86B 4DMFA 3NU1A 1JQ3A 2C7VA 1WKCA 3KPUA 3AEKA 3S1AA 1EXWA 4MNTA 4D8YA 3ERCA 1K7CA 3QIAA 4WY8A 2ZWIA 4WX2B 5DSTA 4PBRA 1A4UA 2O2DA 1P0CA 4LMAA 3A0UA 3GR6A 2QVCA 3DDCA 3I9OA 4UU0A 3D6HA 3STVA 2LZ0A 1L4EA 4U4AA 4K6MA 4RFLA 5MDHA 5H59A 2BFEB 4P92A 3W5CA 3A36A 1E6LA 2NNWB 3L3BA 1GEEA 1M76A 2FFAA 1CZLA 2X77A 2X6QA 3NPMA 3NEPX 3QPCA 3UG6A 4HH3C 4BFSA 1KY3A 4QUIA 5F98A 2CL6X 3OF3A 3AX6A 2BHLA 4ALLA 4CM3A 4NU8X 4BFXA 5K51A 4D6XA 1CFJA 1MTOA 3IXQA 5DI3A 2UVQA 3BSSA 3O03A 3QELA 3QUTA 4PHHA 1MOSA 2PR7A 4O08A 3LZDA 4RVCA 5CT5A 4RSHA 2RK4A 4ACAA 5K6RA 5F7ZA 2HMAA 1ST3A 2K2WA 4YT2A 3HCOA 4U9IS 3SBEA 5D7BA 1B2RA 3OEHD 2BM8A 3OURA 4N0EA 5DHAA 2HGZA 4LYYA 3UMYA 1DC7A 1C2TA 2XMSA 2GZDA 4EYOA 3ZD7A 2VJDA 4U7GA 3K70C 1Y7LA 2OXCA 2HIGA 2XITA 4K88A 4IJUA 4ND2A 3JWHA 1RZRA 4KB5A 2Y1GA 2FEAA 4GXNA 1E9DA 4XH9B 4MVXA 2B4YA 2FEOA 2HR1A 1HDEA 4G84A 4DLBA 4UAJA 1YVUA 2ZBPA 3CGWA 3MCVA 5C5CA 1A9PA 2QRQA 1XNGA 2EYUA 2NXNA 4P0TA 5AIAA 5KKCA 2BSAA 2BFDB 3QYJA 5C32A 5TPZD 2C58A 2G06A 4IGKA 3D7RA 2FPUA 3DXXA 2AEMA 1V37A 4X1KA 2QIPA 2QUJA 3KEFA 1E79D 4H7PA 2X7XA 2BI7A 1LGYA 3ZOZA 1FYEA 1PWEA 4GE0A 5IC5A 2ZP1A 3S6JA 4WK4B 3ZH2A 1AHHA 2H11A 2WDPA 1IHXA 2PCLA 4R2JA 1Z0ZA 5LU8A 4K9KA 1M1YE 3HKCB 1DP4A 1C41A 1Y8QB 3QA3E 3OE4A 4TS4A 5FHQA 1U0BB 2WM8A 1E3LA 1H2XA 2JL1A 4NONA 3TTSA 1R66A 4PLVA 2ZANA 4X7BA 1PT7A 5LDDC 1BX3A 3UWPA 1RWMA 1X3LA 2AQIA 2POQX 4WZBA 1MJGA 3UC5A 3USZA 5BUSA 4J16A 3SEQA 2IWHA 1Y1SA 3KALA 5E8JA 4BN4A 3UOAB 1JLMA 1RBQA 2OZKA 2VWQA 3GN2A 1NP6A 3PT5A 4PRYA 2P6RA 4X1OA 3WAKA 1OD6A 2GXQA 2W43A 3H13A 3QFRA 4UMVA 2XGOA 1R0SA 1JRLA 1XD9A 3MJHA 5ESDA 2P2DA 3DHWC 4BN5A 1KJIA 2XUIA 2PGXA 3L06A 3NO4A 2ARKA 2FW7A 3X1WA 5JC1A 2OV6A 4ER6A 3FMPB 3L4JA 1YZHA 2OV1A 3C3YA 4LYGA 4B5LA 5EJIA 4NDNE