1BQ3A

Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polyanionic inhibitors of phosphoglycerate mutase: combined structural and biochemical analysis.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1bq3A00
1DKMA 3ZHCA 2QNIA 1ND6A 2H52A 2HPAA 4GPIB 3OI7A 5PGMA 2H4ZA 3FDZB 2BIFA 3E9CA 4HBZA 2IKQA 4ARVA 3FJYA 3LG2A 4PZAA 2P9FA 3QPUA 4MA4A 3LL4A 1BIFA 1H2EA 3FDZA 2H0QA 1QWOA 4IJ5A 5AJZA 4JODA 2DWPA 2WU0A 4FDUA 2ENWA 1ND5A 2F90A 3F3KA 1BQ3A 3K4QA 4PGMA 2A9JA 2WNHA 3KKKA 1DKLA 1RPTA 1C81A 3D8HA 5AJVB 1IHPA 3DB1A 3NTLA 3GP5A 4D4KA 3NFYA 1C80A 1BQ4A 3D6AA 2P6OA 5CU7A 1H2FA 1DKPA 4D4MA 3QPVA 2DWOA 3D4IA 3EZNA 3PGMA 3DCYA 3E9DA 2P9YA 2AXNA 2P77A 3GP3A 3EOZA 1FBTA 2GFIA 2OWEA 1FZTA 3HJGA 1YJXA 2EOAA 2HIAA 5AK0A 1QFXA 1E59A 2WNIA 5AJYA 1SKBA 2H4XA 1XQ9A 2RFLA 1K6MA 1T8PA 4PZ9A 1DKNA 2P6MA 2P2ZA 2P9ZA 3IT1A 2P75A 4ARSA 5HR5A 1E58A 4E3WA 1DKOA 2PA0A 2A6PA 3BIFA 5CX4A 2I1VB 1RIIA 3E9EA 3IT0A 1TIPA 1C7ZA 1YFKA 2EKBA 1UJCA 4GPZA 3GW8A 1CVIA 5CDHA 5HTKA 4FDTA 5AJWA 2YN0A 4TSRA 2ENUA 4AROA 4JOCA 1EBBA 1QHFA 2EKZA 4EMBA 1UJBA 5AJXA 4ODIA 3QPWA 1SK9A 2P2YA 1V7QA 4QIHA 3C7TA 4D4JA 2P79A 2P78A 4ARUA 3LNTA 1SK8A 1SKAA 4EO9A 2YN2A 4IJ6A 3F2IA 1V37A 3R7AA 2P30A 2OWDA 3K4PA 3MBKA 3O0TA 1DKQA 1RPAA 3IT2A 3MXOA 4D4LA 1NT4A 3IT3A 4JOBA 2HHJA
chains in the Genus database with same CATH superfamily
2NU6A 4BVLA 5TPWA 1T1RA 4TS3A 3A6DA 3ELDA 1FJ2A 5E8RA 1L4LA 1GPUA 2BMWA 2VDUE 4PONA 5K3FB 1YCFA 2HMVA 2QG4A 1MJ5A 5AHWA 1E7RA 3I2HA 3U3OA 1V8BA 1SQGA 1VL5A 1UBJS 2R1TB 4EECA 3TIFA 1CF2O 4JJ4A 1AO0A 5JPCA 2REXB 3ENNA 3R3SA 3JRWA 5DM1A 3HO8A 1GGHA 1VHTA 3I9V6 3D54D 3PRYA 3UHFA 1KIAA 1GNRA 5AKIA 1TD9A 1PTJA 2MSKA 2J9XB 4FFBA 5I7UA 4IVQA 3Q8WA 4MQ4A 1NLFA 3I4CA 2RGUA 4UFNA 1SPBS 4FYYA 4WXYB 4E1VA 1SN7A 4WQMA 5BUSA 4RFSB 4ZQFA 1ZC3A 3QQPA 3WIUA 2ILVA 3IAFA 4ASUD 2VBFA 2JLCA 3TE7A 2WNSA 3CR3C 4BY9E 2YCLA 4QULA 5ILQA 3PJGA 4JU8A 1UM8A 2L42A 3IDSA 4JU9A 4RA9A 4DR4B 4X45A 5B2EA 1R37A 3LW7A 2Y4OA 4TZ6A 4S35A 3BT7A 3H5IA 5BV7A 4WY5A 1F6BA 4E4YA 1NBMA 2ASVA 2OD7A 4HLUA 4XDYA 4I50B 5LLDA 1SXQA 4EKEA 1SUWA 2DHCA 4JEUA 4Z4EA 1Q57A 1TUEA 4YJ3B 4BN5A 2GFIA 2IQ5A 4LQDA 3ZWYA 4E2ZA 1U9CA 2C2BA 3EXG1 1HRKA 1CR1A 3KL2A 1K4KA 3D6FA 4LY0A 2H5IA 4Q3DA 3T38A 5AYVA 1EESA 2V6FA 1U0EA 1T9CA 4PSVA 1GRQA 2ZG6A 1TZBA 3UBTA 2QW1A 1RQRA 1O54A 1O0SA 4IAOA 2VWQA 3R8FA 1HE4A 3M49A 3O3NB 1OZAA 1G20B 3KOZA 1JLLB 2YXLA 4G2NA 4PINA 2JAXA 4WADA 3QNUA 4F8JA 1JYEA 1SOUA 4DUZB 2ZDQA 3GGJA 2WJAA 4MVJD 2XUQA 5EXDA 5HZGA 1TM2A 4L6CA 1OR8A 1VIVA 2KBFA 3AIIA 3QE4A 1KZ1A 4PGGA 3ZIUA 1E3WB 3QFSA 1HK7A 3E58A 4JXKA 4CGYA 2ZUFA 4D42A 3UMSA 4F3TA 1D6MA 3BB1A 4CUZA 2EDCA 5H9VA 1R0SA 3UCXA 3DVRX 2WD7A 3E7PA 5JSKA 1CJUC 4L08A 1X1CA 2Q5LA 1SOWA 4CL0A 1MX3A 2R9VA 2WFLB 1KFKB 1DOHA 1K7FB 3O8DA 4QTTB 1KETA 4G5XA 4B6OA 3B1VA 4X3OA 3IRVA 1I32A 1KR2A 1OV6A 1D9ZA 3FHCB 2G72A 1CDDA 3SYTA 2JZOA 1ORVA 1VMDA 1O9GA 3PFWO 1CB0A 4AP6A 4OHRA 5JZSA 1WNFA 3VR2D 2W43A 5JCOA 3LKBA 5BQ5A 4BQFA 1PJBA 1XYYA 1S3SA 3EXHA 5HBRA 3OIDA 3OF2A 4NVRA 2YQZA 5DBOA 1XSEA 4AJ4A 2O8VA 3G7SA 3TTSA 1DKMA 5BQXA 4WW0A 2G6BA 1N36B 3ZI0A 1T8SA 1VL8A 5J47A 3W3AA 2CCGA 2ECKA 4AO7A 4Q7JB 1N7JA 1NY6A 2F1JA 4BB6A 4HDQB 4X20B 1R1DA 1K92A 3I9MA 1E92A 1XL1A 5J5CA 1VGQA 1GZDA 1I3NA 2AWOA 1ADFA 2VYND 5D7NA 4ZRNA 4CVNA 2I4LA 4M0PA 3D8UA 4Z9FA 4CIXA 5JCXA 4G1BA 4BU1A 2ZR0A 3WB0A 4BNLA 5KVVA 1DCTA 4RU1A 3IJEB 1GUZA 5EXPA 2RCYA 3V4VB 3ORRA 1R0YA 2DULA 2EFDB 1WB6A 1LDYA 3PUKA 4KO1S 1PK8A 1WTAA 4LJAA 4ZVPA 5TY0A 4WSOA 4RZUA 4M0EA 4YAJA 2EEPA 3ZE1B 5IK2D 4U7JA 2YFKA 3BGDA 1H5QA 2WD9A 1KPIA 4UOQA 2BFDB 1J2UA 4HQFA 3ZCRA 2PKQO 2FUG6 4CKCA 1E1DA 2OXFA 3A31A 4J1NA 4MKZA 2JHPA 3PFCA 4YJDA 1MU0A 2OHGA 4JR1A 3EDYA 4M3NA 1HE8B 3QW2A 4L5AA 3DC7A 5F35A 1C80A 4QRDA 4B46A 1S9HA 3CLSD 2OM2A 3I8SA 4H6PA 4XD2A 3SJAA 5HKOA 2BI7A 2F3PA 1XWWA 2ZJFA 4F3CA 4D4HA 1AD2A 5IJZA 3BWVA 2F55A 2QG9A 3ZW8A 2WF5A 3QWAA 4KP7A 2A88A 2HUPA 1CQXA 4RVCA 2XWJI 4F5WA 1ZAYA 2QYHA 3OY2A 2ATCA 5BMVB 2HK9A 3LRPA 4WEQA 3KBBA 3B89A 1NPTO 4YWHA 2ZJ0A 3BGVA 3DBOB 3D0OA 3DT9A 1E6UA 1T4MA 1IN4A 2H9YA 4Q6BA 2JHCA 3LECA 4OXQA 1UPCA 5GZ1A 4YRRA 2PT9A 3ZDFA 4QUEA 1P75A 4NICA 1N5KA 1B00A 2YWDA 1N2SA 2CYCA 3QVWA 5FFMA 2RIPA 4B34A 3BWDD 5ALMA 1Y8RA 2WA2A 2YOGA 1RAAA 3JQPA 4LOKA 4Q3OA 4F3NA 4Q03A 3L6RA 3OMXA 4AFNA 4LJ5A 5EWMB 4C7KA 1WHSB 5IAKA 2YJ5A 4IIJA 1HDEA 3VHXA 4KPUA 4BKUA 4BQOA 2I4NA 4US1R 1U2TA 1QQ7A 1Y3HA 2O5CA 2EFEB 3S1AA 4PCLA 5ITZB 1EU1A 2BHLA 2A0FA 3U7RA 4JQZA 5KAPA 2PV0A 1IZYA 3DR5A 4C0XA 1I2CA 1UOPA 1TLFA 3O95A 3WB1A 1ISSA 2AXQA 4B3RB 1DRVA 4ZTUB 1NSTA 3HGTA 3I9OA 1XMXA 4OLAA 1NONA 2BJHA 3U4MA 3BDIA 1FYVA 3QJ5A 1IWBB 4B3DA 1XZHA 2YV1A 5F98A 3NMUF 1B1AA 1IM8A 3O4HA 4IXTA 2HPVA 4AZ3A 4DQLA 2HFKA 2Z56A 5HG0A 1MDBA 1NSFA 2W2QA 4HAUA 3LPDA 4GDMA 1DRWA 2BEWB 4OBXA 4U7GA 2VPIA 4W7HA 4N5NA 5JPDA 3DPIA 2OQ2A 2FFHA 4KPGA 5C31A 2OYRA 4Q4JB 4YMGA 3AF4A 2TMGA 3JQFC 1SURA 3PB3A 1IOLA 1F06A 5EMNA 4YCBA 1T9AA 1ZYUA 3IHLA 4C05A 2HT1A 5ALIA 2FN3A 2HPAA 4ZCPA 2RGAA 1MABA 5JZMA 2ZYAA 4S2EA 2VWGA 1C9YA 2O8FB 1BKYA 2VSFA 3ONEA 1PFQA 1ABFA 1QHYA 2JJYA 1W94A 4JK3A 2X23A 3H0CA 1O77A 2GRAA 2V4ZA 3Q7PA 3STUA 1SUEA 2Z95A 2QTFA 1C7JA 4P32A 5HFNA 5HEKA 2EBWA 5TC4A 1HYHA 1X13A 4MI3A 1JHAA 4PR0A 1C5KA 1IJKA 2CL0X 3AHFA 2H7YA 3RGWS 3M6XA 3O91A 1UBKS 1TC1A 3DT8A 4HAIA 2O7VA 5KCZA 5JNRA 5KYWB 3K9HA 5EA2A 1HO3A 2NU8B 3HABA 3IVCA 1V71A 1LBSA 2ZJAA 4QXRA 4FOPA 1TCAA 4JY7A 1MD9A 2I7VA 4Z53A 1A76A 5KYNA 1WXXA 1OZ0A 1R0ZA 1RXEA 1X87A 1Z5OA 3H5TA 3KKOA 3WK4A 1JLRA 2FWNA 2OCYC 2PT7A 2YY7A 3QSGA 4JVMA 4PZDA 4ER7A 5TLSA 2VJDA 4YP0A 3H1EA 3IDFA 1A4UA 1ZQ1A 1RZ3A 3TBFA 3BH6A 3X1YA 1O5TA 3COYA 4V2IA 3U7QB 2G09A 2WJVA 3L8MA 3LIIA 3JX9A 1PW7A 4UCFA 1OLUB 2C4MA 4MUKA 1TVKA 4ENSA 4AMZA 1DHTA 3EC1A 1NDHA 2WU1A 3E9DA 4LOIA 4G5OA 2RKWA 2G9UA 2JGDB 5F7OA 4E3ZA 1XJWA 4NV1A 3I05A 3DAFA 5FB3A 2JI7A 4OBBA 1Z3CA 3GXOA 4FHEA 4Q4CA 3K05A 4I46A 1DEHA 1DTEA 1A3CA 1K97A 3AH8A 2K4MA 2PMBA 4G56A 4K1XA 4B81A 2V5VA 2JG3A 3KOXA 3TF5A 2QUHA 2VDVE 3L7BA 4BO3A 3BM5A 3CZ4A 2W2LA 4LV5B 4PNZA 2ACVA 1C14A 2BDEA 4GL4A 1R12A 2BKUA 3P2IA 1GTRA 3RK4A 1UBCA 2VCYA 1YU9A 1UXKA 3BWBA 1EDEA 2QVZX 2QJRA 3LXMA 1DTWB 4BFTA 4WNCA 5JTUA 3RYCA 3WGQA 4K7JA 2YJZA 1D9XA 5JI2E 2H0RA 4BVAA 3BJEA 3O3OB 3CB4A 3KO8A 3E05A 3H65A 2Z0MA 2RKBA 2ZXUA 1ZRNA 1EHCA 5CT8A 4NXNB 3LC0A 4XPIB 4NMXB 3WLRA 1RLIA 2EJWA 1B0AA 1B0PA 1YR6A 1ZKDA 4FPXA 4IX9A 1JDVA 3JAKA 4YRGA 3DHYA 3KAKA 2RD2A 3H97A 2OSVA 2D8MA 3RG2A 5AW0A 4GI1A 2FGKA 2P2DA 2VWHA 3WWDA 2ONZA 3KZOA 3LW8A 3HCBA 4MQMA 1LLFA 5BWBA 3R23A 3KJIA 2VT7A 3ONWA 1D4OA 4HNAA 2FPIB 5IC4A 1O0BA 1FSZA 5JVDF 1DIBA 1AS3A 1GO2A 1J5XA 3OO1A 5JT1A 1YQXA 4C87A 1JKXA 3EVZA 1CZRA 4D0SA 2IYEA 1XYVA 1AV6A 3E03A 4X8OA 1JR6A 3MILA 1YJ8A 1FFEA 5LDDC 4XLZA 4QGGA 3D02A 4V0SA 3QBJA 4QSMA 2O5RA 4K3VA 1NAHA 1TTPB 1J21A 5HGJA 1YFJA 3EVNA 4H3HB 3JQ7A 1NOKA 1JBEA 4KACA 1OLXA 4DG9A 3L4BC 5FRDA 2D5CA 4J3FA 1X7XB 3NHKA 2ODTX 1WRBA 3MJEA 1YDHA 1QDLB 3M3HA 4MQUA 1T9DA 4WPGA 1TEZA 2Z6AA 1XYGA 4XYBA 3IP6A 3BL8A 2C5SA 2ZQ5A 4C7BA 1LEHA 1H6DA 5EJMA 4BV2A 4N8SA 3NNSA 3IIEA 1N3BA 2X14A 4QPNA 2WF6A 5AQEA 2A1TS 2ZSAA 4JN6B 4TXHA 2MR6A 3LPMA 2OVFA 4S1PA 5EIFA 4ZCQA 3V55A 3VTFA 4F06A 3Q7EA 5LDGA 3QWFA 3LC7O 1QXSA 2QD4A 2RI1A 3ETHA 2ZB3A 5I9IA 3C24A 3E0XA 4BRZA 5I7FA 3IDQA 1YASA 2FFJA 3N8GA 3NP7A 1C1XB 3E4DA 1LK7A 2C8JA 3HLTA 4R0VA 4Z6KA 1KY2A 1SVKA 1VIMA 1DFIA 3E23A 4Y6QA 2ZI9A 1JKMA 2VAMA 4C4ZA 1JNYA 5H1YA 2Y0DA 2XWQA 4MIYA 5FIUA 2IT1A 3U3ZA 2NO9A 1YS1X 4TT3A 3RREA 2R8PA 3QX9A 2ODQA 5HUQA 4TWZA 1FMFA 4EY7A 1C1YA 5EWJB 4BFXA 1U3DA 3D4IA 5JJLA 4MWOA 1VG9B 2YRWA 1EK1A 3FOFC 2V3CC 3VH3A 3PITA 1N7GA 4DOMA 1JEEA 5EJ8A 3HSYA 3LFTA 4FNGA 1JHXA 3COVA 4ALLA 4P35A 1JEYA 3NRJA 5D6OA 4BKOA 1QKKA 4Q4HA 4MV3A 1GUBA 1KVSA 2Q3LA 1YOVB 2ADFA 5FLEX 4TL6A 2BKEA 1OH7A 2XRMA 3FOZA 3I8OA 3A2LA 3K9LA 2J6BA 4J7UA 3TR5A 2B8TA 2XH8A 3OFKA 4PFJA 5ED4A 4RV9A 3AP3A 3R6GA 4KV9A 5A5FA 1KI7A 3KHTA 3TCXB 1J2RA 2VSNA 2C88A 1KMMA 1DELA 5FAXA 3QVMA 1W9MA 5AKXA 1RIIA 1C7IA 1IY0A 1JG7A 2DMRA 2DCUA 3BQ9A 3OE7A 4LC9A 4M0MA 1JU9A 1CNEA 3S27A 3LWNA 1YDGA 4J4HA 1G2PA 3ZQJA 2JAWA 1LPOA 3TFQA 5DH9A 1LF5A 3I0NA 4QRHA 4TSFA 3Q10A 4P5DA 5CVEA 3K72B 5LMNB 4ZAWA 5K6RA 3CNQS 4LUCA 3S1SA 1BE6A 1I1HA 2G40A 1AY0A 3D59A 4EB3A 4YH1A 1RPZA 1KHHA 3RVKA 5CFOA 1P62B 4DLVA 4QBGB 1HEUA 3H4IA 3ZTYA 1X14A 1K7SN 1NW8A 1C4OA 1QAOA 3TB6A 3N3BC 1L9XA 2VO1A 5GINE 3ZOZA 4L0DA 4ZV7A 1MUUA 1NXXA 1VM6A 4HCJA 1BS9A 1KMQA 3EIUA 4WFJA 3L84A 3ZY6A 1JIIA 4XGKA 4YA6A 4PNEA 1MN6A 1IN7A 3FCAA 4H35A 1NXSA 3EVCA 1EP1B 1B7GO 3B3JA 3DXXA 2PDAA 1R00A 3W6PA 4YIHA 2APJA 5IYZF 4C6TA 5C34B 3KZ1E 2JFPA 1YA6A 2AQIA 5SICE 5I4IA 2IZOA 5F21A 4CL3A 2FB9A 1FFYA 1YR7A 1AA9A 2JEZA 5CTAA 3ZCVA 3QLUC 3L7AA 4L4UA 3H5VA 3G9XA 4JBNA 4P4GA 1FLVA 3BZWA 4J94A 4Z4HA 2RHGB 4MJ7A 3MPUA 4P81A 1P2VA 1KE2A 5ELLA 4CEIA 2J9ZB 5T6BA 1AK2A 4FVTA 4P3OA 2DERA 3BIJA 3IV9A 4MSUA 1LA2A 1VHWA 1I6MA 3CZRA 1Q12A 3DCNA 3JYOA 2MYNA 5BWOA 4OB7A 3RRFA 1JB1A 2G4LA 1TCUA 2NG1A 4KPYA 3S2EA 1W36C 3SJUA 2QTGA 3TL6A 3B36A 2R8YA 1OWPA 4X7MA 1W4ZA 4K8RB 3U19A 1ADCA 3F9RA 2NZYA 4I1VA 4BV9A 2WQ7A 3LP6A 2YYSA 3UWOA 2PL5A 4NFSA 3VA7A 2BGIA 1NUSA 3KR2A 3WBKA 3A14A 3ABQB 4FLEA 2NYRA 1IOZA 5A3VA 4LK3A 3COJA 1XRNA 4RY8A 4HXEB 4FQ7A 1JJIA 4XOUA 1GNQA 2QVXX 3ZUGA 5K0BA 5KMGB 4IIHA 5A6VA 3GP5A 5F78A 5FL3A 4NS1A 3MAJA 2N75A 2WRZA 3C1TA 4QJIA 3EHDA 4Z2AA 3KQQA 3ZXXA 3QHPA 5K0SA 1RBMA 3H9CA 1OREA 3GLFE 2G0AA 5JNVA 1TTQB 3OJCA 4QHTA 5I7AA 1UIMA 1YU6A 1ZVMA 2R751 4YK7A 2ZRQA 5G4LA 4WA7A 1WOMA 2WWRA 4UUMA 4KSYA 4AS3A 4OX9B 3R3JA 3UFBA 2VOEA 1QNLA 2FEPA 3FGZA 3C3PA 2UXDB 1F6DA 3TLMA 1NP6A 1ZL2A 5L9AA 2XE7A 2XV1A 4OGGA 4QO7A 1AQIA 2CVQA 4RXMA 3MMZA 3QU7A 3QPAA 3OQHA 3I5MA 4XQGA 3WQQA 4YALA 3P9CA 4UU8A 1VA5A 3U61B 4LRTB 3FVWA 3SHOA 1AKVA 3H5WA 4MVYA 4E5DA 2YKGA 2IBTA 3EDQA 4WH0A 4Z9XA 3TK1A 3QYFA 4I1PA 1J2YA 1CY2A 1WCWA 1E58A 3DAGA 3GROA 3M1LA 5EJ5A 3ETCA 4OD0A 1JHRA 1FB5A 4S12A 3QTTA 1NXQA 2ZUBA 1D1SA 1P1KA 1U9IC 3PDUA 2I1VB 1XK7A 1YBVA 2NZ8A 3GMDA 2Z3ZA 4IIEA 2BEJA 2NN3C 3AF1A 2X4IA 3RAJA 4IHJA 3F2VA 1ZI8A 2DPLA 1I2MA 3CPEA 3ILVA 1T5HX 2C4VA 4HY3A 2YN0A 3BA6A 2XCIA 4L8LA 2UZ0A 1J23A 3GVIA 1IQPA 3HCNA 3GAZA 1BMFD 3K0FA 4Y2VA 2WKPA 1UUFA 5BSKA 1NYRA 1Y9ZA 2FMHA 2Q2WA 3HADA 1BVRA 1GRNA 3MJVA 4U3JA 4U5XA 3SIWA 4AG6A 3ZCTA 4BASA 4JFAA 3DBVO 4RCYA 3GGGA 2JS7A 1FY2A 4R84A 4R71A 3A36A 3G9ZA 4R3UC 4OHWA 5B7PA 5EZQA 1CNMA 1L9KA 4HNQA 1M7GA 4JI0B 1Y6QA 3A6HA 1E0AA 1YJ5A 4BVEA 5KQRA 1X2EA 2P5TB 1Q0TA 1SG9A 2Q46A 1BMFA 3CINA 3F1LA 4V02A 4BNJA 3LP8A 3ILHA 2PRJA 3CHYA 4MV7A 4QJ4A 3P4YA 2QX4A 1PDOA 2F62A 4C29A 2X9NA 2QNIA 3W5CA 1PNVA 1KF0A 2H3EA 3IAUA 3NPAA 2AIRA 3UG7A 1XPRA 3FR7A 3GJSA 2H4WA 3K16A 3CLRC 2VAXA 4R2IA 5K05A 5JFGA 1VL6A 4ZHQF 4D6PA 4DPLA 1N9ZA 3NWPA 2ERXA 3GT7A 4GD3Q 1KJJA 4KFCA 4MW5A 1D03A 2GAJA 3RS5A 3X44A 1ZIPA 1N34B 3BKXA 3D6TB 3S6JA 1WBBA 1E2NA 4O4HF 4NI5A 3LUPA 5ENDA 5G3ZA 2WJJA 2XTJA 5EHGA 5K8LA 1IZZA 4LFAB 1PBTA 2W2XA 4L8GA 5BMOA 2GBIA 3FN4A 3RV4A 3S55A 2FRVA 3HYLA 1XAJA 2OILA 4WFQA 3S4YA 4DVGA 2VP9A 4AT1A 5JXWA 3VBEA 3MPOA 1KQOA 1OYOA 1XE3A 4ZDJA 3DE1X 2ZAMA 2FSFA 5GM2A 2ZE5A 1EI9A 4P31A 1Y7TA 2VVTA 4NQRA 5A6SA 1ECPA 1FNNA 2P4SA 3CRRA 3NQ41 3EBPA 1L7EA 4QQ8A 4ENPA 5KCMA 5JCZA 5DNDA 4Z0TA 5C1IA 5A4KA 1Z4JA 4Z54A 1GA4A 3KEQA 4MGKR 4WRRA 4D6XA 3U4QB 1XCOA 2ZUVA 2VKTA 3OBBA 4D80A 1RZRA 1LDNA 1EK2A 5KJ1A 4AQDA 1KGSA 4K26A 5AJHA 3R0VA 1UOOA 2W48A 1YZKA 1ZGJA 3P2JA 4PC2A 4AIIA 1IN6A 2P2SA 3IKMB 1PUIA 1CRLA 2AI1A 1YK1A 1ML4A 2VLBA 1FTSA 2H7XA 3DONA 3GLHB 2V7EA 3W9UA 1GD1O 3WP1B 1Z17A 3PXXA 3O83A 1QPGA 2R3SA 2J0SA 1M75A 2MIIA 4EY3A 2HMYB 5BT8A 2ODAA 3CW9A 2R8OA 2R44A 3E61A 1DC3A 2QPLA 4GP9A 4M0UA 4YV7A 3OE1A 3L6UA 2Q5HA 2YZ7A 2HRDA 5G02A 3ZWKA 5JH7B 3C3MA 2WHRA 3MJTA 3SS9X 4DHEA 3EZFA 2GILA 4HYYA 2H2IA 1PFYA 2O57A 3CTPA 5F52A 3RSOA 3UY4A 1U1FA 721PA 5F2NA 1M34E 3V32A 3OJXA 4NPAA 1OI4A 1GCUA 2BSAA 1T43A 3CM0A 1V8DA 3LT1A 1RMYA 4J9UE 1C7ZA 3EIEA 4PLHA 3TEMA 1SHUX 3CH7A 3H75A 2P1RA 3SK0A 1XRLA 4JI7B 3VNUA 1UFVA 3IXMA 2ATEA 2VNKA 4CV2A 1T0IA 4WBXC 4LPKA 1MDFA 1EAYA 4JIGA 4B87A 1QIDA 1RYZA 2IW3A 4MVJF 4P9NA 2EKZA 2RHJA 4A6PA 4RJTA 4CKCB 1RJ9B 3DDOA 2GAAA 3JTMA 2XZLA 1ZGAA 1QHXA 1TT7A 2OQRA 3G89A 3UPTA 1BROA 4NZYA 2ZWIA 4JEIA 1T25A 3GNLA 4QIHA 4PV7A 1XDSA 2DBQA 2VCHA 4X8LA 4DABA 5ALVA 4N9WA 1ULAA 1QTQA 1ETHA 1VHLA 1Z4KA 5TQ0A 3OTHA 1G4UR 3B8HA 3F3SA 2Z8ZA 4G3XA 4F91B 1LDBA 3B3FA 4PG5A 4ER6A 1XFAA 1DE0A 3SLKA 2P7IA 2H8GA 4Q4AB 3K4HA 1MNAA 2XT9A 4EM6A 5CBPB 4ZQBA 4CLHA 4GRAA 3CKLA 5IJ0B 4M53A 1ILEA 3FOEC 4AECA 3LQ4A 4GRDA 1QGED 2FMKA 4EI7A 3LFHA 2ZBRA 3LVQE 1PTJC 4HZUA 4EENA 5JAOA 3B9RA 4REMA 2DEUA 1JI0A 2QB5A 3CX6A 4Y0NA 3W5SA 1Q3KA 5F12A 2AK3A 4G24A 1G8HA 4LE1A 4MPTA 3M2TA 1K8QA 3FCCA 1UP4A 4GPD1 1JG6A 3AU8A 1G0OA 2VYVA 5HUJA 4KREA 1K27A 2D1QA 5KX5F 1S7CA 1WSAA 2SBTA 3ZQ6A 5BMVA 2LV8A 2IBMA 1IZ7A 3AB7A 4MKXA 2JGIA 5LNK1 2BKAA 1RHMA 1D07A 2VCEA 3AR7A 1KORA 4CCAA 3AI2A 4KWTA 4MWZA 4RK1A 2GARA 1DADA 5KTNA 5CCXA 4NMLA 3S1LA 1Q5PA 3QIAA 3NATA 2WBLC 2FWRA 2XD9A 1EXNA 4MQLA 2HXYA 2O3TA 2RC6A 1E9CA 5TF4A 5EJEA 3PEFA 2CXPA 4BNGA 3ZGVA 1HE5A 5ICGA 4GI2A 5HM8A 4A16A 4ZPJA 2DUWA 4MTCA 3WLTA 2CHFA 1V25A 1I24A 3TR0A 1KZGB 4CU2A 3H7AA 4PG8A 1I3CA 3SVLA 4Z4FA 1YZHA 2R79A 1N1DA 4NJMA 3B12A 4YQEA 1P3DA 3TSCA 4E13A 1LLQA 3IMEA 2D00A 4TROA 5HK8A 4UDXX 2CN1A 2JNWA 1T5OA 3OE4A 1FXWF 2ZJOA 4NJEA 2GO7A 4Q7KA 5LMCA 4CUKA 1W75A 4BGEA 1KIFA 1RI1A 3RJMA 3HZHA 1E7WA 2CUTA 2O7QA 2BLNA 1N5IA 1BWRA 1ZNYA 2EL7A 3BDVA 3OCXA 5DTRA 3TTXA 2A9QA 2MDTA 2X4GA 3LXXA 3LLUA 4F9EA 3VHRA 1ZH4A 1O96B 4BBAA 2HRZA 4ZO6A 3HTXA 3LZCA 2P65A 1F6WA 1FVXA 1QP4A 1V47A 4JUDX 1L7NA 3DMPA 1DU4A 1DKOA 4HHEA 1GU1A 1NNI1 2ZYSA 1L5SA 3MCVA 5EPEA 1GXSB 1OGYA 2HAEA 1YS4A 3BS4A 4DIDA 1OTHA 3DEIA 3BMQA 3PHGA 3ONVA 5BV2P 4BN4A 2OZEA 3CURA 2O2YA 3K9CA 4ZT3A 4ACAA 3ZU3A 1YSCA 4D81A 1CIPA 1IEQA 4FQ5A 4EA9A 1HT2E 4B2IA 4Z51A 4JMLA 1ZGCA 4X93A 5TT1A 2HW8A 3KSBC 2PLFA 2OG2A 4ACBA 1P1IA 1PNOA 2MINA 3EEIA 3CG0A 3FKQA 1DAMA 2IXFA 2BP7A 2I67A 3SBDA 1QPZA 2AUTA 2GZDA 3TYXA 1PG2A 4DE5A 1J00A 1GFZA 3V2UA 5A06A 2V45A 4B9AA 1GL7A 3LF2A 5GV8A 1P1CA 1ECLA 1Y3DE 3WGUA 5EJFA 4RD2A 1H1LB 1NTOA 1CZHA 4JB8A 3WGMA 1EFTA 3VKVA 1E9RA 4O2AA 5LQSA 2QYTA 3DDNA 2AN5A 4F46A 3PG5A 4L4ZA 3DZDA 2ZYWX 1T6NA 5ARCA 2QQGA 1KEKA 4E07A 4K6GA 2ID9A 1L7AA 1GFSA 3WTCA 4TYPA 4GMXA 3WYNA 1UEIA 1VL1A 4JLJA 2O7RA 4NE2A 3N76A 4AU1A 1NXTA 1YO6A 1FRVA 1AVTA 1E4EB 5A7HA 5PGMA 3IMCA 5KYTA 2E49A 3GLIA 1CHNA 1UMDA 2J4FA 1K5GA 1X8JA 3E8SA 4NS4A 4RPJA 3ZNPA 1WUYA 1Z9BA 2MSWA 3EWNA 2P5UA 3G5TA 1USUA 3GNQA 1RZUA 3OOJA 3QE9Y 1H65A 1R9NA 1YZQA 2W4QA 3FX2A 4Z7JA 3OOWA 2B8WA 2IZ5A 1D0VA 2WYIA 1YVDA 3K1YA 5ALKA 5EP3A 1EFLA 2X0RA 2OHJA 3ZKWB 7MHTA 3GMSA 1T0HB 1JHPA 3DVAB 1X86B 1R8SA 2H00A 3CX3A 4LDNA 4WESB 4JLBA 5DRYA 5KC8A 1XBTA 3H2JA 2PUCA 3SQOA 2IUSA 2DLCX 1REQA 1JHOA 1Z73A 1S9DA 3TSWA 1T3ZA 3BRWD 2O8BB 4U2EA 1QTRA 4HAVA 4E2FA 3ZYCA 2DB3A 3R9XB 1JLSA 1UWVA 3D7LA 4C4RA 2GSWA 3HBNA 5A05A 3VTZA 2HCBA 3OM0A 1RXYA 2GKGA 1F2VA 3VDNB 4G0UA 3AL2A 1T5SA 3VTAA 3PWZA 2W8BA 5DTQA 3GT0A 3RFVA 3U16A 4BUJA 2P90A 2YUTA 3TZBA 4QBFA 2F7SA 1HC7A 4LTDA 4ZZ3A 4MA0A 3AERB 1M2VA 4OB8A 3ZZUA 5IN5A 4ZODA 2G36A 5TRTA 3G17A 2WP8J 3IP9A 3LK6A 4BJ6A 4BBPA 2JLXA 4CTMA 3G6KA 4B6PA 1EVJA 1V7CA 5G1NA 4W7SA 4D4IA 3C6QA 2FJ0A 1M6HA 4IJQA 2QRJA 2ZYUX 3BMOA 3RU7A 3ZW9A 4EAQA 2PANA 1XF1A 5CIWA 1K6MA 1N6IA 3LUGA 4C22A 1BEUB 4HNRA 3EF3A 1CETA 4R9SA 1Q44A 1TGVA 4OQYA 4WECA 3NWJA 1PQWA 5CNMA 3D31A 1NRWA 1RQ7A 4I8XA 2Q5EA 5FI5A 3N7TA 3E2PA 4NFLA 1N2IA 2YWGA 1GU0A 5DK4A 1DG3A 2GVDC 4AJJA 1S2MA 2Q9AA 2QN2A 1ULTA 4Q3KA 1USGA 1X7ZB 2CVPA 4FE3A 4GPAA 2ENUA 1A8PA 2VQFB 1MV8A 5FULA 2WWXA 5B3LA 2F9LA 5FBKA 2CD7A 4EPRA 2QRKA 2H92A 1N6KA 1RMQA 2I6XA 2IKSA 5J9FA 3THWA 3ZJUA 2QRVA 3N2EA 3BVPA 2C98A 5CD9A 2GWRA 2E4ZA 2Z6UA 1U9ZA 4Y1RB 2W6PA 2JGJA 1GN8A 1KAEA 1UBGA 2C84A 2J45A 2R66A 3RNLA 4C88A 3WJ7A 2EBUA 4AY2A 3TLGB 4DQUA 4EF5A 2B5VA 3O8LA 1DIAA 3QXXA 2VS1A 3QI2A 5BR1A 1Q16A 4MV5A 1PWZA 4PY2A 4P0QB 1MRZA 2Q4BA 1JIQA 4AYXA 5KIAA 4QATA 3MC1A 1ZJ4A 3EG9B 4S2UA 5EZ6B 5LD2B 2M32A 4S04A 3FCSB 2VP5A 4LSGA 2JF0A 4NZZA 4CLXA 3H11A 2UYYA 2X1VA 2PWYA 4M38A 1P5ZB 3IOCA 4O4JF 3MGBA 1E3WA 1JR3E 2EW1A 5E2AA 1X8KA 2R8XA 1PFGA 4OLJA 3IP7A 2E89A 3A2KA 3MJRA 3TQFA 4IV8A 5FUVA 1GP2A 1IXKA 1ZP6A 3FPHA 3ZI7A 3TBHA 2FDRA 1YQ9A 1NWHA 4RF5A 3DZ8A 4XGQA 3H17A 3IUBA 5F7JA 4F86A 3SDSA 5JR3A 4CEIB 3T6KA 2X6QA 3L4JA 1X7YA 2Y4NA 2QXUA 3IUYA 3DE2X 2BMEA 3AI7A 3RANA 3U7FB 1NUTA 2BBTA 2LKCA 4D02A 5IZ4A 1SQ0A 4TQ9A 5E1MA 2MCFA 3W5VA 3U4HA 2P3SA 1D5CA 2PZAA 3F98A 4C4XA 5FL7A 1G8AA 2JD1A 3IA7A 5JO0A 1M5UA 4PICA 3TNDA 4CODB 4YCCA 3BMCB 3HH8A 4DREA 5BVGB 4P80A 1P2UA 4WOBA 4UM9B 2PO5A 1TPYA 1FP4B 2Z1NA 4AKEA 4UBIA 1A5TA 4RTSA 4P5PA 1IBSA 3TDNA 1WF3A 1NW9B 221PA 3PHIA 3IODA 2R2AA 4BDSA 4DQDA 3UOWA 1XLTC 3MOSA 4Z3KA 3PIDA 1P1FA 4OV6B 4LDPA 4LW8A 4OA8A 4PLGA 2WJ4A 1IJBA 1H3FA 2HEIA 4D3FA 4DGSA 2Q3JA 2V6GA 1MX5A 3HC7A 4QPPA 5DIFA 2A5GA 1KS9A 3C1AA 3OA0A 1VJCA 1TM5E 1F0NA 3ETLA 4Y2QA 3QX7A 2CXXA 3SDZA 2BH2A 4MI1A 4XWYA 3ZGLA 4V1CA 1JAZA 3RC2A 2GPWA 2FJUA 1GXSA 1GAJA 3B38A 3G0BA 4PHHA 4CM9D 1LWNA 5J2TA 5CB6A 1N4DA 1NKSA 5IAGA 2G04A 5BN5B 3GLGE 4DMGA 4EKDA 3GARA 1FQKA 5LKAA 1N9KA 2VYQA 3AUFA 4E70A 1K68A 1YONA 3R9XA 3HU3A 3I04A 5JOQA 2I9PA 4IEIA 2CYAA 2GCEA 3H6KA 4L15A 2IS6A 2PL1A 2IUYA 3HG7A 3N75A 3ZV4A 3EZ6A 1OFHA 5EUCA 4W7IA 2QAJA 4FWTA 2FX2A 1R6VA 3I9JA 4OP1A 3UGKA 2V7QA 4BYGA 1M1YE 2OFXA 3H1FA 1KHTA 1A82A 1N0UA 1YC2A 3UA4A 4MQBA 1HORA 3KLOA 5BT9A 1JEAA 1UWKA 1YS7A 3DLPX 3HUDA 1EUZA 2X41A 4QOFA 2HRBA 3E70C 3FXAA 3IIIA 4NK5A 4MDHA 5DMXA 3VR2A 4BCCA 1P4HA 4O2RA 4B4DA 1QCCA 4HDKA 5DM4A 2QEQA 3PJFA 4QT4A 3AY0A 2Q4DA 1T6XA 3R3VA 3AY3A 4B4OA 2ZBPA 4IIUA 1DFGA 4XVRA 5B3AA 3AOEC 3L0IB 4OXIA 4P3PA 4RPKA 3OEWA 1WKVA 3W3AD 4JR0A 1DKQA 1W30A 3G2OA 1T5TA 4ZVLA 3UJ9A 1SUAA 5DN9A 3WSTA 5CITA 3GVPA 4X61A 4D97A 1GPWB 2E4YA 4QGBA 1I3LA 2C2GA 1IE3A 2IHVA 3BL6A 2G71A 2PMCA 1WNTA 3CUKA 2ZWOA 1I5EA 3QUBA 3ORSA 2NO4A 4DLXA 1FA9A 3P9NA 2IUTA 3T3GA 1CJSA 1R4MA 3FYTA 1PK9A 3Q8XB 3OD5A 4ZOLA 1MIHA 2C95A 4YQFA 1BGWA 3J81A 1JRLA 3C3AA 4NEQA 4CIVA 4AUEA 4O2BF 2IH2A 3EZ7A 4IHJB 4NBRA 3FFTA 1DDIA 4EB6A 5M5BA 5DBIA 4RXUA 3G9TA 3GL9A 1ICIA 3FDZA 4JX9A 3SQMA 1GQRA 4P3NA 1X0VA 4OAPA 1YB7A 1Y9JA 2V9ZA 2JJ2A 3CO5A 1FU8A 3CNEA 1JPUA 1UP7A 2NT4A 2ECOA 1QJCA 2FSVA 2QQEA 1EUDB 4ZKDA 2ZBVA 4FK8A 6LDHA 3MCWA 3UK6A 3OIFA 1U2SA 4JLWA 1HOXA 3BA1A 1THMA 4Y0AA 3IAXA 4NDNE 1TDJA 4KN5A 1SCUA 2E1RA 2JIQA 3IAAA 4I8IA 1OJ7A 1BDJA 1C8KA 2NUTA 2DFVA 3BXGA 5BR4A 4UVDA 3SF8A 1Q0RA 3RAFC 1DI0A 4LRQA 1U2DA 3PZRA 2JIBA 2XQGA 5IKOA 3KETA 1W76A 1DJQA 3THRA 4YRBA 3QU5A 5AUPB 1RDFA 4D9BA 1QS0B 2AOVA 2YH2A 4IKPA 1Y98A 4KCGA 4XTCS 1RFLA 2LD4A 2N46A 1EVZA 1R2QA 3ZHTA 2HSDA 3VDQA 5JAMA 3ZV7A 3OOSA 3EOZA 1ZU5A 4RF3A 3DDHA 1Z0ZA 3ZDDA 3F7MA 4JC0A 3T3HA 3B7GA 3KBOA 4UCQA 5ALOA 2HMWA 3FBWA 1L7BA 3HA3A 4AI6A 4YAGA 1X94A 2FPGB 2WKRA 2HIAA 1JNXX 4LNUB 2WNIA 1OX4B 4IEEA 3KYBA 4W9NA 4I6EA 3QKRB 5EEHA 2PT6A 3FHOA 2PX3A 2YRXA 1OD6A 2ZAGA 4UBNA 4XSVA 5H0IA 1MPTA 5D1NA 3BRQA 1BYUA 2ZI4A 1D1TA 2P9ZA 3K1AA 3EIWA 3C15C 1ACMA 3DWIA 3ZVRA 4CCWA 1PJZA 4OQDA 4WNIA 3TFWA 2EFJA 3RVRA 2BF4A 3VNQA 4ZJPA 5CB4B 4ZYVA 4XWWA 2E1PA 3U4GA 1M2OA 2OZPA 2XHEA 1KK0A 3PIIA 2FHSA 1WUKS 1KYQA 3G79A 3KVVA 3ZDQA 2D3WA 3BIOA 2FA9A 1HYQA 1DEAA 1E9DA 2ZAIA 1I2AA 2R6DA 1P1HA 4GO1A 4MQ5A 5CNIA 3UENA 4ADSG 1A9XA 2X13A 3B1WA 4BNYA 2YW2A 3BB3A 4ND1A 3RQIA 3N2KB 4OG2A 2H6EA 1SCJA 3E0QA 3EQ2A 3HN6A 5C1PA 3KT3A 3ZE2B 1PFKA 3FTQA 5JARA 4HLDA 4YP9A 2NO5A 1LDGA 2NZXA 4F6CA 4MLDA 4PCAA 1HTTA 5HE8A 5A5VA 1XMPA 3GPDG 2BEWA 1Z4OA 4UFPA 3UV6A 1LC3A 4K6HA 1C9MA 5FBHA 4W6ZA 3QMPA 3B6MA 4LRXA 1DKRA 3A4VA 4Y18A 3S29A 3SSMA 3VFDA 4EZIA 3O3MB 1JKFA 4WZZA 2JGKA 1TLLA 3D3JA 3LJKA 3WBBA 2LVBA 2I9KA 2G88A 1JJBA 1AGPA 1LX7A 2A9OA 2FPGA 3G2KA 2C1EA 2Y76A 1GZ4A 3DEHA 4HN2A 1B1CA 4IDFA 4IH4A 4DF3A 1XZCA 2QMYA 4D96A 1IB6A 1DDGA 4KVGA 4K6CA 1BEZA 2IYRA 5KWJA 3GQBA 5CYOA 4JP5A 5HF8A 3WHPA 1DUSA 1C41A 1MMFB 3HU2A 3JXEA 4FC6A 1SXJD 1M8KA 1X7WB 1HY3A 2WIFA 2XB8A 3A70A 3BXEA 3D3WA 1O03A 4KWCA 5DCYA 3TD2A 3B2NA 1ZPDA 4HBZA 4FHFA 3TIGA 4BAGA 4I14A 1H9AA 5B1DA 3VAZA 1E1RA 4JDUA 3UQZA 3VO9A 2G1PA 3BORA 5DNUA 3MHTA 2X42A 1EFRD 5J3JA 4TTJA 2NTYC 3PQ5A 1A97A 3BJRA 4L78A 1D7OA 2W2OA 4YMUA 5HF6A 5L3QA 6ABPA 2YJGA 4NU8X 1PS0A 1U5CA 3L0PA 2C42A 4RDCA 2Q5OA 5HCUA 1RYFA 3ZDBA 3I23A 4R8KA 3BCUA 1D1QA 3HSKA 4QYXA 3GPBA 2OA0A 2O0LA 4PR3A 1BQ3A 1AUQA 2ORWA 1M8JA 4RMHA 3LX4A 2JDIA 4U6NA 4X1OA 5G4KB 3TE6A 4EPYA 3UCEA 3NIBA 5EPOA 5ARBA 2E55A 4EB8A 4OXNA 5F77A 4DCPA 4TL8A 1P44A 2EJVA 1KS2A 1NIPA 3W2EA 1ECBA 3M8KA 2GLXA 4KEAA 3EEBA 4LMPA 3ETNA 2AH5A 4D4KA 3AB8A 1IYZA 3ITKA 1KKLA 4EPVA 2Y0EA 4C08A 3Q7TA 4H9GA 1RSZA 2J3KA 1AV7A 5G0SA 1YDFA 2E7ZA 2OY0A 2Q5CA 3GG9A 3R0IA 4I4TB 4DBLC 3RM3A 4EK9A 2ZYTX 1EFPA 4FZ3A 3BD8A 2COUA 3IXLA 3CNBA 3KVYA 1SPXA 3CUEF 2D5BA 3BGIA 3IQWA 5EIHA 4H1VA 4QX6A 5KYXB 1Q0ZA 1L5YA 2YMLA 3KZMA 4ONEA 3M1AA 5K0FA 2EFHB 4CCSA 2E6UX 2RHTA 1JQJC 1ZH6A 2UUBB 3PGKA 4JUCA 4QVGA 1FZTA 2AFIB 1XT6A 5T6MA 4WVLA 1QFXA 3ISTA 4RHUA 5IPFA 1DV1A 1H42A 2NU9A 3WBFA 4BLRA 4E94A 1ECGA 3ROMA 2D5AA 4PZ9A 3W2FA 1QQAA 2XXAB 2J0UB 3GJTA 1RJ9A 4N6GA 2CJPA 2GJKA 3ZYZA 2H07A 3DEFA 1GTL1 4G09A 4BDTA 4DUPA 5FH9A 3G02A 2Y0CA 1YHZA 4HDSA 5K8TA 2YZKA 1JTFA 4L4XA 1G42A 1AQ6A 2QSYA 5T4HA 4XFJA 2HK6A 4PBTA 3WFIA 3ZWWA 4M9QA 4TWJA 3W06A 4PRZA 2AL7A 1Y8CA 3F5FA 4PNHA 3RIYA 2OENG 4QFDA 1W0CA 3BBPA 3Q72A 3F6PA 1GGNA 1TYAE 3Q8MA 1AG9A 5CLGA 1T13A 4QXQA 4E33A 1XGKA 3CX8A 5FWNA 4UTOA 3H4MA 2VRCA 3NBMA 5CCBA 5GV7A 3GFQA 1EK0A 3C7KA 3IR6A 1FFXB 4HWSA 2NT3A 3DCJA 3PNPA 1A5AB 3HB7A 3P9XA 4O4IF 2R85A 1E3JA 3TRIA 4AAYA 4H4CA 4CLRB 3HSSA 1DXYA 1V1MB 3L7KA 3T5GA 1OX4A 5DCUA 1F8UA 2B6NA 3O4JA 4IJ6A 4COOA 3TKYA 2UUOA 1F9EA 4FHZA 2PZEA 1Y3IA 1PG5A 1MAAA 3P32A 1FL9A 2EZTA 1IU9A 4IMIB 5L45A 3E2MA 1BOFA 4IINA 1SC1A 5CHEA 4R2XA 3A32A 3OUZA 3PS9A 4O29A 5E1OA 5F7XA 5CIQA 3O9MA 4HVAA 3ABZA 3L0ZA 4O4IA 4W8HA 2X8AA 2CMKA 2XMRA 3ZVNA 4JDPA 1Q0PA 3HCRA 1VPTA 2NAPA 3I09A 1R8JA 3U1BA 1V95A 2X3UA 4X6XA 4E5MA 4GKKB 1T29A 2HT6A 3D3NA 1F4VA 3GEGA 3GHHA 1IPFA 3UAVA 1TUIA 2E87A 5IG2A 1O6ZA 2X40A 2GI4A 1TLTA 3QENA 4I9GA 1PT6A 1T36A 4TMTA 1E3LA 1XVVA 3GJ8A 3KB8A 1Z8DA 3HA7A 3JVVA 3L7CA 4GP6A 3C3KA 4E88A 5LOVA 2YYZA 5MN6A 1KI1A 1BC5A 2QY6A 4PZYA 2DBYA 4O1MA 1ULHA 1YQEA 2PSSA 4U3JB 2JGLA 3NB0A 1NRXA 5D3ZA 3DULA 4FFOA 2Y66A 3CVOA 3GF4A 1CR0A 5EZYF 3FZEA 1G9SA 4IRXA 1JAHA 4DJDC 3D1LA 2JFZA 4ZO9A 3Q0IA 3ND5A 2C8VA 3EGXA 1ISJA 1QO0D 1OTXA 1Y5RA 3LDGA 4MKHA 1VYVA 5DXJA 4EABA 2M6LA 1W88A 2WB2A 1MH1A 1NFQA 1W73A 1TRKA 3GD7A 3WYGA 5IBCA 3DB1A 3TS1A 2BMFA 3N3AC 1ORTA 3KTFA 3RV3A 3ZBUA 2X8BA 4DSUA 1Q77A 2ZK7A 4J1QA 3EZ2A 2OZLA 1I14A 2AN9A 1LTKA 3PDIB 3JSXA 4PFQA 5AVRA 3HM9A 1OOEA 4OI0A 4ZAGA 5WRFA 3E22B 1BO6A 2DPYA 4TXMA 3EZNA 3NBKA 1U99A 4OMDA 3KQNA 4NG4A 4OTZA 3TSZA 3ASUA 3AUSA 3GMTA 3E9ZA 4CIDA 1U0NA 2A7XA 3GUCA 4CTKA 3L5OA 5BW8A 1T2VA 2AUMA 3PC7A 4N18A 1C30B 1SU8A 4FFWA 4Z9YA 2FVYA 4IGKA 4Y6GB 5HDQA 1QRTA 1RP1A 4TLBA 1P7CA 4PHGA 1YI1A 2IUFA 3VU0A 2UU9B 3Q6NA 2GM3A 4OAQA 4RDHA 3BQMB 5ICMA 4C0BA 3C7AA 3FZYA 3HP4A 3K9QO 4DIBA 4RKRA 1Y6GA 1N2BA 2O3QA 2OBXA 2D2EA 3DZGA 2CF5A 4TYMA 5KDDA 4MPRA 2B7CA 1ZUHA 3N58A 2QTBA 3DZHA 3DYBA 4WXMA 2AJ8A 4KJXA 3CLUC 3L6CA 1JR3D 3M4JA 3NH9A 4O4HA 2PVCA 1Q1EA 1U4NA 3MJFA 4IVRA 4FBLA 2RGNC 2XNSA 4OQ4A 4N3AA 4ZYTA 1EFAA 3GEIA 3V1NA 3FOBA 4LBVA 1CK4A 1JQEA 4F4UA 1INLA 4AX4A 5DE3A 1R50A 1B2RA 2YICA 1ZM2A 3SOPA 2Z3VA 4B17A 4CMIB 4YPOA 4IJKA 1HYBA 4UJ5A 3EARA 5I3ZA 2PS9A 3VKUA 1FOEB 1N8KA 1LY1A 2DBVO 4OVKA 3F5DA 3ZXYA 4B48A 2VHXA 3THXB 3NDBB 1EK5A 2JKVA 3WJ2A 3NJ4A 1MTZA 3U6KA 5IMBA 3X1XA 1G8KA 2GEFA 1ZXLA 4NTZA 3X43A 4CKZA 3O2QB 1BWQA 1N5RA 1E77A 2AJLI 2F2TA 3FSEA 5JCOC 4XM1A 1YMQA 2C97A 1ABEA 1HNNA 1VTKA 3BZBA 2NXCA 4K9MA 4Y30A 4YVFA 3ANSA 4N7MA 4JJGA 3BE6A 1Y7PA 2XKBA 5CFLA 2E37A 4HZGA 1ND6A 4DAEA 1EX9A 3NJ8A 1GITA 5LA6B 3ZWPA 4ZT7A 2F59A 1Y0BA 2A5LA 2AJDA 4DV2B 3TLEA 1B73A 3F9IA 4KPUB 1KI9A 1UT6A 4KNWA 5HOQA 3AEKA 4F2WA 5C8ZA 4TKUA 5CFRA 4FN5A 3IP5A 1E5XA 1RU3A 1LSJA 4MAFA 3BYZA 3FGPA 2KMLA 4EHDA 1OIWA 1E7YA 2YMMA 4LXUA 1U28A 3INYA 1Z6AA 2HADA 1AZTA 2QZPA 3EGCA 3HKBA 5A4IS 5INTA 1CG6A 4LJLA 4DDWA 5LJLA 4AQ7A 2DAPA 1EQUA 1X7YB 1XEAA 2R2GA 4ND7A 3P2OA 2XOKD 2P5SA 4XB6B 3UWSA 5CVTA 1KZ6A 1MA3A 2O2XA 4UNQA 2JIZA 4IJWA 5IEBA 4BKRA 2LGJA 3HCAA 4UUQA 3FI0A 4ZIRA 2UXBB 1UZUA 4ZFNA 5LB4A 3PC8A 1LSSA 1G6Q1 3HKCB 2CHVA 4Q1CA 2AQHA 3QKUA 4KIWA 3WA7A 1G4AE 2X9LA 1MTOA 4Q3NA 4RPIA 2OV3A 2CVOA 2OHFA 4UE3S 2GEKA 1YOVA 3OQJA 4PGFA 1H2FA 5KJ6A 2VHWA 1X1SA 3AOEA 2FCRA 4MCHA 5JG7A 3K1AB 3RVMA 3FJ1A 4ALKA 4MDFA 4Q9LA 2J31A 1Z7BA 3GFSA 4HMPA 1ZHHA 3L18A 3MOGA 3PGMA 4TTAA 2C4WA 4R41A 1ZXXA 2P69A 3FR8A 2VYCA 3GFRA 4LMAA 3PEWA 1S2IA 3U7GA 3MYYA 5DRTA 4UTPA 1SRRA 2XTZA 1IDOA 2ZIVB 1NUAA 1U6IA 1WP4A 4FFDA 1Z6PA 4DSZA 1A2QA 1ATIA 1T9ZA 1IAQA 3ZS8A 2HJHA 2PSFA 1O5IA 4PLVA 5JWHA 1A04A 1UADA 1J7KA 3ADKA 4H16A 4N3GA 2MWMA 1SUCA 4OQEA 2R00A 4EBFA 3ADCA 2XW6A 4Q3LA 3T7TA 5JBIA 3PU6A 4Q9HA 3GD5A 4KQEA 4DILA 3VJMA 1QG2A 1JAIA 1QORA 2IYFA 2ZIEA 5HCNA 1MC1A 3AVQA 1RKXA 2FPPB 2HTEA 3AV0B 3EEYA 4HYQA 4QXOA 4E09A 1T9BA 4MWTA 5C8DA 5LQNA 1ESMA 3HA5A 2Q3CA 2C5EA 5IJAA 1NURA 2AQ8A 3RABA 2PCLA 2Z04A 1NNEA 3HMQA 2DJ5A 4EWLA 1TYBE 1LUAA 1I6WA 2G63A 3DBLA 3C6KA 4B3IA 3MK31 4HMQA 2SHKA 1MHPA 1YB5A 2P91A 4H3SA 4Z1OA 1XLWA 2AKAB 2XOXA 3H7IA 4IFBA 1Q0LA 2H4HA 3AI1A 2PMDA 1QHNA 5CLJA 4XUGB 3TTVA 3C74A 3SI7A 5J2UA 2CJWA 1K3TA 5JZVA 4FYWA 3LHKA 3AR5A 4IG4A 2R8RA 4QHYA 1E9AA 4LQCA 4CM7A 4ZEOA 5D6NA 1T4CA 2YN2A 3QUTA 4XWGA 3BWYA 3I32A 4C0LA 1YAHA 4DLAA 5KC9A 2Z5LA 3EGEA 3IE2A 2PXXA 1GNVA 4DCCA 2R4UA 1G16A 5EMMA 1II8B 1U7DA 1T34A 3KD2A 4DLRA 3IEMA 2EX1A 3ME5A 2NU8A 1IJEA 1KK2A 1L4BA 2VK2A 1J0BA 5DBGA 5BURA 1UKZA 4KL8S 3UW3A 1IUNA 2BBSA 1YZGA 3IV7A 1CQPA 4NY1A 4RQTA 5BN5A 2RG1A 4R7GA 1FUEA 1QX4A 3EAGA 4JP2A 1XQ6A 3NJRA 4RACA 2O05A 1LPSA 4AN1A 5JFOA 4LVCA 5HYVA 2VRWA 3N2YA 5T67A 2PNFA 1ENYA 2HWWA 2Z2JA 2ZIWB 1ZOOA 3BJIC 1V4BA 5MFPA 4ARVA 3EK2A 3KFXA 1XDZA 2NTVA 2W71A 2FRDA 5FYDA 1RLTA 2I03A 3NBXX 1GSAA 4XEUA 1XNHA 4ASUA 4C04A 2Y99A 1HE2A 1OV4A 3N7UA 2XGOA 2RK4A 3A1TA 1O9HA 2N1MA 2C4NA 3RUHA 4JAVC 2C83A 4F92B 5IYZA 4FYJA 2AR0A 4BP1A 1BFKA 3ZNNA 5ALZA 1CRZA 1M34B 5EL0A 3FUXA 5JVDB 3UGQA 4CR6A 2IZ6A 4RXTA 2V7GA 3DXFA 4RJ2A 5FKJA 1NMEA 2DKFA 2QX9A 2YTZA 2FPXA 1DQPA 3V1UA 4DMHA 1PX0A 2XCLA 4DNQA 1RM3A 2ZJ5A 3A1VA 2ZQYA 2GPTA 3RVDA 4DUGD 2MR5A 5KTSA 5E4FA 3VNVA 2Q1YA 2V98A 1U80A 5TPWB 1KJ8A 1ODKA 2CVHA 3QXSA 4RL4A 1N2HA 1NVFA 2JJ8A 2PGLA 2RGRA 4LV6A 3SX2A 2FUNB 3RARA 4PVDA 3L79A 3UT6A 1G3RA 3MM4A 3OWOA 4ZVUA 4A2QA 4H2DA 4B3HA 4BKQA 1PVOA 1QTIA 1W6RA 3P4UA 4JNCA 1MZPA 3N8NA 2V7WA 2XMBA 2W6ID 2DFNA 2FG5A 3CKMA 5C1BA 4RSRA 4NH0A 3RVPA 5CBPA 1HDIA 1P2GA 5T3UA 3LI2A 4M8NE 4I99A 5CW2A 2QI9F 3LRTA 1BOOA 1CVLA 4OH7A 3SBXA 5KUTA 4YCMA 4NULA 1UXJA 5KWSA 4BVBA 1ZSNA 2OESA 3AUXA 2EKLA 3MRSA 1QHGA 2GJAA 3L8GA 3RTBA 2J7KA 2WUWE 5G0UA 1JB9A 3OSZA 3LLVA 3H05A 3OQMA 3U56A 1T1IA 2ANCA 2O2HA 3AIKA 2XRZA 2IZ0A 5JYDA 3UFXA 3BK7A 2R1TA 3I3OA 2GA8A 2JJQA 1RS0A 5KQPA 4G0QA 3HRIA 2JFWA 3I9FA 4EVSA 4TZ0A 4GQAA 3ROEA 1P9RA 1KQFA 4FYIA 1QG0A 1U8FO 4FJ0A 4RGYA 3IBGA 1Y1SA 3M7IA 4AWXA 3E4CA 3K70D 3TL2A 4KNVA 1WZ2A 2GEUA 1CERA 3WRVA 3W5BA 4I7EA 1R27A 2KLHA 4UVGA 1M7BA 1YB6A 3WL3A 4ZI5A 3TVDA 1GLGA 5ESRA 2DFPA 4K03A 1SK8A 2J0VA 4JJZA 2VSOA 3ZE6A 4XTRA 1PFVA 4JGGA 4BJ1A 4YUWA 1N4AA 1FK8A 4G41A 1BWSA 1WR8A 1PRYA 1XP8A 3OT1A 4UZEA 5BN4A 1NF9A 2VH5R 3T0IA 4G26A 1I5RA 5I4BA 3EPKA 1NG9A 2ZIZA 4ZT2A 3R5FA 1DBPA 1SC3A 4MCIA 3ZCUA 3A2MA 5FOQA 1QHIA 3KUUA 2NYUA 4KODA 1AJEA 2Q7XA 4GVXA 4ZOEA 1ZIDA 1Z4IA 2XYQA 3B1XA 1HT0A 3ER9A 4CBVA 2HWXA 4D8XA 4DNPA 3BXPA 4HAWA 4IVNA 4L2IA 1YQGA 4PHTA 2HX1A 1JDTA 3KWFA 3KOYA 2V7XA 3JQDA 3OQOA 4WCFC 4K2AA 1TIBA 5E2BA 5LOVF 1Q1NA 4Q4LA 3WB9A 4ZQEA 2B8JA 4BRUA 1IFXA 4G0ZA 5A6SB 2F1KA 2JEYA 2ZUTA 5F3WB 4YECA 3TBKA 1PFUA 4DIUA 1AS2A 1F20A 2JASA 2R7KA 2EARA 1AKRA 1H66A 1EJ2A 1OXBB 2QVGA 4JA2A 4QTUB 3NONA 3IPLA 3QJYA 4HRXA 2QW8A 4HXYA 2YQ5A 1U8YA 3CX4A 1IG3A 5JLJA 4JELA 4NJMB 5I47A 2DHQA 1DL5A 5LXTA 5DHFA 1E2BA 4B8ZA 5IT5A 5DBFA 2X3FA 3FVTA 1WA5A 1RRCA 5CT9A 1DCFA 4X94A 2RBKA 2IPLA 1ARZA 4EHJA 1BXRB 4TRRA 1L5GB 5BQPA 4B82A 4BBZA 3ESAA 2Y8EA 3KAPA 3NASA 5BMVF 4N6NA 3QSYA 1EPUA 1A8IA 4FBGA 2HGZA 4KUHA 4K9LA 3B8EA 3H11B 1WDTA 2R60A 3MMSA 4Y98A 2OUIA 3C45A 3LV8A 3R3YA 1W85B 2FSHA 1RRVA 3G5LA 4CM1A 4RQUA 4CDMA 3SYKA 4J91A 3C39A 1CNFA 1SZDA 1A5BB 3EVFA 4W1PA 4D9IA 2OC4A 4KHZA 4TWRA 2DBRA 2VHYA 4MWCA 3SEZA 3L7LA 4NCXA 1SBZA 4KU4A 1VBMA 4W1QA 2X8JA 1Z36A 3T7DA 3WQRA 4DIOA 1KMNA 3M2PA 4OJQA 4Y2RA 5D3MB 3AUYA 4GLFA 4QVKA 4FGZA 4Z0NA 5K3AA 3TAHA 2GPNA 1NW3A 3PUJA 2DZDA 3LOQA 1TADA 1W47A 1ISPA 1B6SA 4MVJH 3NCHA 5IXSA 2Y93A 1V6CA 2J9RA 3GJQA 4U7TB 1XR3A 1ONOA 1KI4A 4TT3D 4MAMA 3ES9A 4K8OA 5KQGA 4LYAA 5AOCA 2ZSEA 3W1VA 3Q4GA 3ICOA 4BMVA 2WY2D 2Y71A 4GOLD 2BFPA 2HCRA 2JGNA 4RKEA 3JZIA 5ERGB 4HJRA 1NKVA 2WTAA 3D6VA 3ORQA 1D2NA 4F2GA 3P2KA 4JT2A 2FEKA 2DWCA 3R4VA 2WKWA 4Z9BA 3T5CA 1GWNA 1KY3A 2C0PA 2FZCA 3PE4A 4JSYA 4WESA 2H65A 1LBIA 4ZMBA 2RGEA 5IWCA 3C3XA 2INGX 3TXAA 4FR2A 3NKLA 5LQCA 2GTHA 1Q3HA 1QVZA 2VQDA 1P2TA 2XVZA 4UD6A 3EVBA 1Q50A 3N0VA 4I1UA 3NEJA 3OIUA 4TV8B 1E2LA 5EPUA 4AF6A 5BO5A 3EISA 1U7TA 2JDID 3PUIA 4CCYB 1OWLA 1I51A 2J08A 3JZDA 2VTKA 5K0JA 2EF1A 3HUUA 3IB6A 3ZWBA 4UTRA 3ISVA 2HMTA 3FYSA 4MWEA 5DGTA 1CZUA 5H4HA 4DMCA 2Q41A 3K6RA 3CYFA 3KAQA 5G53C 1PEYA 2XWBF 3AI3A 4NSNA 1XVIA 1DC7A 3EXHB 4GPIB 2V0GA 1RAIA 3DOEA 2WM8A 2YNMD 4TMFA 1DIHA 2CFOA 2X2FA 3LBFA 5TT0A 2DY1A 4FXOA 1E7MA 4KGXA 1USIA 4K9OA 4BFVA 4DUYB 1T8TA 2ZW9A 4QARA 3HJNA 4BLVA 2IYTA 3GUHA 3CRZA 5L3VA 1TD1A 3R7WB 2XB2A 1Z4QA 3IKLA 1FDUA 3CVWA 4YRAA 5BP7A 3GOHA 2PS3A 4JVOA 5AESA 5AKYA 1G1AA 3OZWA 4QEKA 3COWA 3ACBA 1ZLXA 4N47A 3KKKA 5K0ZA 1V6SA 1XNJA 1YQDA 3FE2A 3NIWA 4DBVO 1WMSA 4BNTA 3SFZA 2DQSA 2HD4A 3KTAA 4LGCA 3SSNA 2GETA 4TUYB 1RWOA 2HXSA 4YFVA 3NEPX 3VDRA 4V24A 4MV1A 2R1UA 3NHBA 1R9MA 1V16A 2MT9A 2QM3A 2X9GA 1Y1RA 3CNLA 4J0IA 2OV8A 4RMNA 1DLIA 4R8LA 5B3JA 3S28A 2QRGA 4W5TA 1WZNA 2RB4A 5CU7A 3RRBA 4XFDA 4B7ZA 3QFRA 4IIVA 4IP0A 1PEDA 3WIVA 3O75A 3PX2A 4Y9UA 2IYOA 5EE3A 3PPWA 2ZRDA 4YB8A 1HG0A 2B94A 3SXUA 1JSXA 4AKTA 2PUTA 3GDGA 3JQ9C 3I2JA 1ZM4A 4YUZA 1G9TA 4ME6A 4CM4B 1RJDA 4AP5A 3VR4H 1OJLA 3MQ4A 1NX6A 2HO5A 1ZOIA 1GVNB 1N7IA 2DRIA 2FV8A 1HQKA 1E59A 5CM9C 4EB6B 3DB2A 1W4LA 5IX8A 5F4BA 1E5QA 4JI5B 2YWRA 3WKBA 4U02A 3V3KA 1N57A 4EHNA 3O8RA 2ZUSA 3V5NA 3A7EA 3OEYA 1WUHS 3TNYA 2AZMA 3JD4A 1KNXA 4NLLA 2CCJA 2XB9A 4DRXA 1TGYA 5JSYA 2PJZA 3TG8A 1KPGA 4FZJA 3UWKA 2O2JA 1XZDA 4Z3DA 2NP6A 1Q14A 1CSEE 2LP4Y 1HOTA 4G9BA 4MR8B 2X7HA 2PUHA 2VDKB 3GBVA 1CUWA 4Q21A 2ZB7A 2AMVA 2EXXA 2VP2A 3LF1A 4P7GA 1GRVA 3A6PC 2GD6A 1BHO1 2G25A 3PF9A 2Z5GA 5LFAA 3U39A 1W85A 1ZXBA 2WR8A 2VHZA 1OFGA 2FQ1A 3B9PA 4UEKA 2H11A 3G2NA 1I80A 3SQLA 4BQRA 1E0JA 1TQ8A 2GXQA 4EJMA 1E9FA 1QH9A 1EKXA 2WVJA 5AIAA 4EG0A 5DN6A 1KO7A 3SJBA 2YQ4A 2BN4A 5ALFA 3RYFA 1G7CA 2X0JA 1W4RA 3O5AA 2QKYA 2XZPA 3JRXA 5AVSA 3OX4A 1RRPA 1B4DA 4GX0A 2CWWA 2JLWA 2GMWA 1YA8A 2VT3A 3A1DA 1MF7A 1QRRA 4V3BA 3V2IA 1FC0A 2AFVA 3EVGA 4YRDA 4ND3A 3NDPA 2QUAA 4EEKA 1QQ5A 2CF6A 3DTNA 4REQB 1UM9B 1L6RA 1VSUA 1Z06A 2VA9A 1KI2A 5TX7A 1I5OA 1Z0KA 3N86A 4Q7LA 1OQAA 1XZEA 1XAHA 1PGQA 1SHJA 5FTNA 3TOCA 3ZKWA 2NPIA 2PR7A 4X60A 2BUAA 5DI3B 5AO9A 4Z0HO 3DGFC 4R0NA 3REQA 1ZA1A 4DDMA 4IOLA 4EB0A 2ZBGA 4C4YA 1SGWA 2P3LA 4ZTZB 1LBQA 3PHJA 3JYNA 4QEZA 4DJFC 3TQSA 3NHYA 4KVAA 1SVSA 4R5MA 1WV1A 3UG6A 2ZPUA 4FOTA 2WYHA 3NG1A 1ODSA 5CVVA 2O23A 1F8GA 5E1DA 3MTJA 2EKDA 1QC5B 1JHDA 1G8PA 3AEXA 2JIRA 4F7WA 1Q22A 2FSIA 4QC2A 4RA6A 1P0MA 2QTLA 1OYWA 3K32A 3VV3A 1VGRA 3MRTA 1PZXA 4WJKB 4Q82A 2P6UA 5JXGA 4AO6A 2VPTA 4IH9A 5JAUA 2C2XA 3ANTA 4G07A 4F11A 1L8LA 1ZGHA 1IY8A 2DSNA 4B71A 1JILA 3AR9A 2QNBA 3R20A 2FR8A 1NJFA 3SYNA 2I87A 5A71A 3UYKA 2H7VA 3K0FB 5FJJA 1DFHA 2RHWA 4OHFA 4XQ9A 5T8KA 3EUAA 4EUKA 5A3SA 5HIJA 3N6RA 1W35A 1LW7A 2PMWB 5M04A 2D2XA 2FKNA 2IIVA 4RD1A 2JEOA 1V8PA 2BMAA 1N3YA 2C1ZA 3Q7IA 4JKIA 1IEVA 3KR9A 1GJRA 3D5TA 4TRJA 5FBRB 1WCXA 4DMLA 2C5LA 1B43A 1IZ0A 1ONNA 3ZV5A 2DG2A 2VZ9A 5EE9A 2KYRA 4BTLA 3Q98A 3LHDA 1N5JA 4HD8A 4BWYA 1VE5A 1P7ZA 4ITVA 3ERCA 3WHLA 3UHAA 3IX7A 5AKKA 1A9RA 3HXQA 3PFHA 5D51S 3VM6A 2P75A 3CEAA 1AB6A 1QVVA 4KFSA 2VHEA 5CHYA 5H81A 5BSVA 2QD1A 1Z75A 2BGUA 2G8LA 4UQOA 3EJ6A 2OGWA 2W2MA 1U8ZA 3CE6A 1Z88A 3VO1A 4FFMA 3OLYA 5E2IA 3TZKA 4XIIA 2NVBA 3E9EA 4KGDA 4R1SA 4XPIA 1Y81A 1W0JA 4PPYA 2QGZA 4YR7A 3KS9A 3NV9A 1SBIA 3C1OA 5IZCA 3HXKA 4ZOAA 3PFBA 3EC2A 3MTGA 1ZVQA 2HRRA 2YJTD 1DTWA 3QVOA 4EO7A 3X1WA 4BN0A 1KRWA 1H0HA 4ZT4A 1ORWA 2PBRA 4RSGA 5G41A 3H6GA 4LZNA 3TECE 2B1GA 2MYPA 4TWIA 2J87A 4CIWA 3WQHA 4ERNA 2WLTA 1V48A 1VCOA 3FPBA 4RY9A 1OZFA 4L2IB 1MOQA 3QOXA 3WA6A 3MMNA 2VATA 2HCJB 1C2YA 4KGVA 4O2BB 1QKJA 4R9RA 3PQDA 1K6JA 1QIGA 2RB5A 4NCJA 5K03A 1D2MA 1JGTA 5LMUB 1JEDA 2FZGA 4DJTA 2AMYA 3V4ZA 3EZGA 3D9QX 1UFQA 1KEVA 4Q47A 4AS2A 2Z43A 4K3UA 3ZPXA 3ZLJA 4F2DA 1PS9A 3CXRA 1W2WB 1SC6A 1DJOA 4EGFA 1JN0A 2RHRA 2AI3A 3JPWA 2ZJ6A 2AJBA 3M0EA 2GK3A 2QAGA 4IIFA 1J49A 2QTCA 3FWHA 4Q6WA 3MWLA 3PFKA 2CFRA 4H1UA 1M8FA 4DRZA 3GA7A 3DXYA 1JEYB 2HV9A 1SZCA 2MYUA 2OGSA 2QUZA 2ZBQA 5EMKA 4B8WA 2PD4A 4HGYA 5K9ZA 1DT3A 2XCTB 4QHSA 3K35A 4DWOA 4IRUB 4FHGA 5AM2A 3MIZA 4HUJA 4XM2A 3N1UA 4E6EA 4JB2A 4RV4A 1E32A 3FTNA 1RI3A 1UBMS 5H5JA 3QUCA 4URZR 5ILOA 1LC0A 3ILYA 9LDTA 1W44A 3HQ4O 4S1OA 5ALPA 5GM1A 1DQNA 1QRDA 1G19A 4RJLA 4QJ3A 3MUOA 3QNMA 1YNOA 1JEQA 4OXYA 4P08A 4R2LA 4EZBA 3X1KA 5CA1F 3SD7A 1O7JA 4XWAA 2O5EA 3U3KA 4WBNB 3SC6A 2AXEA 4Y2SA 1BW9A 4M6WA 1T1JA 1UBFA 1K8ZB 5B55A 2IA5A 1JQBA 2XGGA 3TI7A 2WSBA 2ZIXB 5AVXA 1DKPA 1ODJA 2Q5JA 1KTIA 3R5SA 4ILEA 2I78A 3OLWA 2PKYX 3SSOA 3H3JA 5LDHA 1WULS 3EFOA 2BJVA 2J32A 1Y8QB 4NYIR 4V3CA 4L5BA 1FBTA 4J0KA 1RJWA 3AJDA 3OZAA 3HDQA 2BEVA 1N0HA 2BZGA 3C3JA 1GTZA 1V5IA 5B6PA 3AINA 3I6YA 3PUXA 2BELA 4YDSA 3ZVKA 1ZN7A 3DW1X 3QVKA 4CMAA 4A0FA 2ZR9A 1M2OB 1M1XB 1YE8A 3MTAA 3RSGA 1AX9A 1PN3A 2ZUUA 3SQDA 4KIJA 3VPAA 5KTTA 4TLAA 2Z9BA 2PNJA 3CMCO 1P9LA 2Q0QA 3M5PA 3CS3A 3UMGA 4ESHA 4AMUA 1K06A 1RAHA 1GPKA 1HXHA 3UAWA 3UJ8A 1X77A 2O48X 3CLHA 1ZO8A 4LVOA 1BU5A 5IHXA 1DRKA 5C0OE 3EC7A 3HJHA 4BNZA 1X0XA 1YUMA 2QLBA 1FNBA 3FLAA 1YKSA 1YS2X 4PG7A 3HL0A 4PQFA 3JWHA 5F73A 1D4AA 1CVIA 4YYEA 2OCIA 1ADBA 5HTOA 3N2ZB 3EOAI 2PH3A 4WXRA 5LR6A 4L8FA 3KRTA 4YLEA 1QC5A 1ZWLA 1JHMA 1Q7CA 2HJWA 4NYMQ 3T7AA 2HQSA 2Q3EA 3QPWA 1B8NA 5AW9A 5LUBA 4EF6A 7AT1A 2KB0A 1T2DA 2WTNA 3U4CA 5JQWA 3OLZA 1ZEMA 3BSFA 3D5QA 2CNNA 2DGDA 3C4QA 3JZAA 1HFWA 4DR2B 1H6AA 2C7GA 3EJWA 1PQPA 2JIDA 3MS7A 4QAQA 4U00A 2A3NA 3AZOA 4R2MA 4HT3B 4FDLA 2HMUA 3DT6A 1BH2A 3I53A 5AJUA 5DI3A 1SXJA 2I7CA 3EZ9A 2E85A 4KRGA 2FOLA 4F1JA 3EQZA 1HEYA 3FNFA 3ITNA 3TQOA 1YTLA 3W0LB 4D4LA 4JCCA 3UAYA 4OQQA 1P0CA 1JH8A 1BVUA 3EIFA 4IDPA 1XALA 2W2TA 4DBZA 2VNSA 3ULKA 4D0RA 3AWIA 1JU3A 3KC2A 4M1OA 4TTRA 1CULC 3VSAA 3D1JA 2GEVA 1FX0B 3OI7A 2GRUA 4Y67A 2GCNA 5M3BA 4EFNA 1ADJA 1ZR4A 2IKQA 1XMSA 4Q05A 4JROA 4ZD6A 1GNSA 1EXWA 3O74A 3KJEA 4PHCA 1FW8A 2F1HA 1K4YA 4M7OA 1LVUA 5C51B 3INRA 3KQLA 4R7TA 3SVTA 5EIOA 3GGOA 4HDRB 2R4QA 3EWSA 1QZUA 4YV0A 3PFIA 2H4JA 1F2TB 1ZSVA 2NV2B 2QAGC 1L3BA 3GRCA 1I7DA 3QEMA 1QQBA 1XMOB 1XFDA 4XI9A 3EN0A 5F1OA 4PGMA 4RPHA 5AICA 3IRUA 4EFLA 1BX3A 5DM60 1PQ4A 3NGMA 5BNIA 4ZJUA 4KR3A 3BICA 4UC0A 3ZTWA 2HYIC 3EF1A 1QH8A 4BFWA 1BCSA 1O97D 2W6MA 5DGDA 4CHGA 4J0EA 4GOMD 1EFPB 1MIOB 3DAYA 1NBWB 1R18A 1XIVA 2JAHA 1J20A 4IWXA 3VAYA 2IEDA 2YWFA 3JW8A 2EP7A 2V7BA 3GGPA 1TK2A 3A1UA 4L9WA 1IG0A 4JASB 2X15A 4UCXA 821PA 3GZTB 1NVKA 3RKUA 3GNSA 3OLQA 4EUEA 1ILWA 3OOYA 4FNMA 5EJ6A 2Z9CA 3T7IA 1K98A 1YKFA 3A1WA 3SEAA 2G0TA 3UNXA 4OP3A 2E4AA 2BFBA 3W5HA 4HVCA 1ZG3A 1Z15A 2ZRPA 4HSEA 5JMTA 1PNQA 1Z26A 1RHKA 3U60B 4EYGA 3AF5A 3GYBA 5JH7F 4YXFA 5C5CA 1U8TA 3CEHA 4NR0A 4EG1A 2OL4A 2DPMA 2XB4A 3UPUA 5HA5A 1SXIA 4WXPA 1HQYE 2C3PA 4X54A 4U7DA 3LT4A 3ZGNA 3OPYI 5EJAA 4BB9A 6ADHA 1ZH2A 1PL6A 4WVFA 1ZJJA 3MD9A 4YPFA 2PV7A 1KRXA 1FJGB 2WYUA 1P60A 1UMDB 3IT0A 4MLCA 4DLBA 1GEGA 2BGMA 2JRCA 2EQAA 3F8SA 2IZ7A 1P6XA 3KYCB 3EGWA 1QH8B 2GR9A 2MU1A 3N6XA 2QRZA 5REQB 1ZU4A 3VZRA 1DEXA 5MFZA 4YT5A 1TM1E 2G67A 5HIKA 5MF6A 2Q2VA 5JANA 3NBUA 1L7RA 2JJ2D 2VPWA 3BFPA 2C0CA 3L46A 3MT0A 1MHTA 3B60A 2WTUA 3G49A 3NBQA 4HRYA 1Q6YA 1QGAA 2W2KB 3I8XA 4K2HA 4M0KA 1H0RA 1T8UA 1JHZA 3IAEA 1FRQA 4XUDA 4ZZ0A 5ECWA 2FQXA 2B4RO 3QKSA 2ZZKA 2ORIA 3FYHA 3GPIA 2WPNA 1EXMA 4HP8A 4NRDA 4WJZA 5BXQC 2JLVA 3P9IA 3UXMA 4D3ZA 3Q7QA 2J3HA 4DMUB 2ZJZA 4O4LB 1ULUA 2F1RA 2Q2QA 1D2HA 4JKYA 3KX2A 4MVJI 2R7MA 1ZIOA 3BD7A 3C97A 1A95A 1J1ZA 3KL4A 4Z8YA 2OGUA 4CDRA 5KPJA 4GE0A 1HDRA 3EYAA 3FPLA 3KWMA 1DWUA 3WLJA 3P2YA 3DMRA 4GMKA 1GZHB 4W5WA 4C7MA 3DBRA 3LT0A 3Q3HA 4OUDA 1IUPA 3NOXA 4KQ6A 4ER0A 2VXCA 5MDHA 1AQNA 2CV0A 4MS4B 3JQAA 4DC1A 1TC2A 4WZBE 1W34A 4V0MA 1RLJA 1QFJA 1WM1A 1F38A 2OO3A 2HEGA 3FCOA 4NAVA 1I33A 4NH4A 4C0HA 5CA1B 3KZXA 3R0JA 2YZ2A 4IX1A 4A0RA 4EQZA 4CQMD 4OQLA 4IILA 4X97A 1NJGA 2CHGA 1TCBA 3IDAA 3QM1A 4GM1A 2XAAA 2XDYA 4IIDA 5IW8A 5KO2A 1Z4PX 4I4CA 3N6VA 5C7IO 1FMJA 1RP7A 3QE2A 3PC2A 4U0KA 2ZWPA 3VPBA 2GKSA 2HPHA 2QXYA 3W6UA 3WR5A 4CQLB 4DMKA 2ZI5A 2J9FA 2RK3A 3SYRA 2O54A 1E79A 2IXTA 4A15A 3AJ8A 3L43A 1I2ZA 5CXXA 4GLJA 2G7MC 5I8ZA 4B4UA 4JL8A 2WUGA 3JQBC 2HM7A 5BNWA 4WKPA 1OAKA 3GH1A 4JBXA 4TQAA 3F0TA 4E5PA 4QUGA 1ZD5A 4FEEA 5AI0A 1ZOLA 4J3NA 3EPPA 3SEQA 4B2PA 4L8YA 1IC6A 2GKOA 1TUBB 10MHA 3WHKA 1CJCA 1S2DA 3BAFA 2EL9A 4CIAA 4CWAA 3FPSA 3GP8A 2Q07A 4N3BA 4EHFA 2N3ZA 4FWBA 16PKA 2VEDA 1V39A 5KNCH 2WD8A 2MJLA 2CL6X 1E1RD 1C4KA 3X3HA 2F3QA 3I83A 3LTNC 4RORA 1BYIA 1NDQA 2P8SA 3QVLA 2LXNA 1XEFA 4HYEA 1XZAA 4K9QA 4R01A 3M5CA 1F17A 3W04A 4LDQA 4YJKA 3K3PA 3M6UA 2W42A 4E0BA 1G6KA 1H2WA 2V3VA 3HJCA 5HF5A 4A10A 4TVSA 4KPFC 1ZD9A 3EVAA 4U7WA 2ZUEA 4WKNA 1PJTA 5K8VA 1KZ9A 3TAXA 5IULC 3K1ZA 1GUAA 1CP3A 1BU8A 1JAYA 1GG8A 1ZZEA 2HJGA 2WAXA 1BE0A 4Q4HB 3KXIA 4KX5A 3C8DA 2VHQA 1XD2B 4EQ6A 8AT1A 2PX4A 3E3OA 2C5BA 2LCFA 4QDJA 3P1JA 3IJPA 1HKHA 3H2ZA 2A5JA 1J9GA 3L07A 4ND8A 1X8XA 2J3IA 2ZYRA 2PH5A 2YXBA 3CF6R 3NTRA 4LJSA 4BO1A 4EA8A 1PZEA 3K5WA 2RJ3A 3KXPA 2VNJA 4OQZA 2HV8A 1XZPA 1T9KA 1U02A 3AONB 4J4BA 1TUGA 3C7TA 3NALA 2IITA 1QF6A 1UK7A 4TPKA 3H1TA 4CM9A 5K3SA 3L0BA 8OHMA 2P3OA 2WU8A 2PS0A 2I34A 3DOOA 3DAPA 1Q2XA 3P9RA 3HKEA 3GCGA 4TTSA 4UVHA 1P2DA 4IIJF 1E9SA 2D4AA 4M9SA 1Z5UA 1EFUA 1UKEA 5CK4A 3T3MB 1JLLA 2R1ZA 4URUR 5T4BA 1SBNE 2R97A 3CA8A 4KLCA 2GS9A 4UW9A 3CVUA 4CLDA 4LF9B 4PTZA 2WU3A 1CQWA 1TVKB 2Q5IA 1RVV1 2RBGA 4MWDA 2O0MA 4F4DA 4LISA 2DFLA 2A9FA 1Z5PA 3RU9A 2VF4X 2Z5FA 4FU0A 4XYMA 3PCXA 5D01A 2XX3A 2QTMA 5E95A 2Z2KA 4IS2A 2AYYA 2VXYA 3PT9A 2UVPB 3NBFA 4HEA6 5A3JA 2GNPA 2ZDGA 2RG7A 2JHAA 4RLFA 3Q8KA 2XHZA 4C7VA 5DHPA 4D9MA 1NVXQ 4JEHA 3ICQB 1IN5A 1QWOA 2GF2A 3I5YA 1J22A 4J6FA 3SQWA 3M34A 4QQFA 2NQ8A 1E8MA 1LI5A 3ZHSA 3RUIA 5EWJA 4BPBA 4JMPA 2OV6A 5CB4F 1AGXA 2QUJA 4W5OA 2ZRMA 2R6AA 2I7TA 3RYHA 3I28A 1WU8A 2UYHA 4UXJA 1WOYA 1IY2A 3V4LA 4OL0A 3SWWA 3CKKA 1CB7A 2X0DA 2ZTSA 5P21A 3G8CA 1BX1A 3VOTA 4IDCA 2FFBA 1OHHA 2BPOA 1XV5A 1SBHA 2QYOA 5D85A 2ORVA 1G21E 3G8YA 4PQRA 1FP7A 3IBTA 1LLUA 1YB2A 3OPVA 5TF0A 2OXCA 2PRIA 3BMNB 3HJRA 3OJWA 1J9ZA 4JYPA 5F3RA 5I3CA 2I62A 3NHMA 2PUJA 3F4KA 3RT9A 5CMLA 1VG0B 2VF8A 2QVYX 4LCEA 1UBTS 3F46A 1NYQA 5TQ2A 5B7NA 5KWIA 1N33B 3HJBA 4IIYA 4HB4A 1KJWA 1F51E 4KWEA 4TV9F 2PXHA 1CUUA 2YWXA 1ZI6A 5FHQA 1ORDA 2NXJA 4D98A 2FN4A 1FP2A 2XIQA 1I9GA 2EIHA 3ROGA 1X7GA 4EFKA 1V9SA 5B1YA 3ZWOA 1EA5A 1ZMOA 4WLEA 1AKTA 2HJSA 4JHLA 1X74A 2GNAA 1C29B 3MRVA 2ZVDA 4N54A 1FLAA 1M6YA 4FYKA 1W5SA 4I5DA 4Y1GA 3ED1A 4YRCA 2Z6VA 5DYGA 3ZE7A 5I6DA 1U0BB 4BECA 2FKAA 3PA8A 3AW9A 1EFVA 5EYPB 4P2BA 2OFFA 4B4WA 3J7AC 2CBZA 1A8HA 2BI4A 4YFYA 4QWWA 1QJ4A 4LV8B 2P67A 4BTEA 4ETWA 3L01A 1H4SA 2H5EA 3GRAA 4TMZA 3KOWA 3BX1A 3H0KA 3JWPA 2WSIA 2XOEA 4PQEA 2Y2VA 1P8AA 2DFDA 3E5MA 5LLTA 1K9SA 3CW8X 1YT5A 2JH3A 3Q12A 4UCWA 2KQUA 2QP4A 5BOSB 4KQHA 4EDHA 5B2FA 5LXTF 2O1SA 3M5DA 4MLPA 4KMOA 2HF2A 2XSZD 3D43A 2WPDD 3S5JA 2BGWA 3USES 1NDUA 3RYIB 1F0KA 2AD1A 5NLLA 1ID1A 2B3DA 1D09A 2XA9A 4NOMA 2WC1A 1RKQA 3IAS6 4KAFA 1NPDA 1AUOA 5FPTA 4MKIA 1YMVA 2II6A 3FUTA 5DYIA 3FCXA 2RHHA 2ZB2A 4FINA 4MYTA 4RABA 1A88A 4GR9A 3VAAA 1RHRA 3HCEA 2GCOA 4MEBA 3P2MA 1W19A 2IXDA 3ICWA