1BQ3A

Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
publication title Polyanionic inhibitors of phosphoglycerate mutase: combined structural and biochemical analysis.
pubmed doi rcsb
molecule tags Isomerase
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1bq3A00
3IT3A 2WNIA 1SKAA 5AJXA 1DKQA 4D4LA 2OWDA 3QPWA 3GP5A 4ODIA 4ARUA 3ZHCA 3EZNA 4TSRA 5AJWA 4D4KA 2P77A 1YFKA 4JODA 2PA0A 2H0QA 1E58A 2HHJA 2P9FA 3QPUA 2WU0A 4FDUA 2H4XA 3D4IA 3E9CA 1SK8A 3IT0A 2I1VB 1C81A 3MXOA 1SKBA 2IKQA 1CVIA 1H2EA 4E3WA 4PGMA 4AROA 2P6OA 1C7ZA 5AJYA 1ND5A 2OWEA 3DCYA 1C80A 2RFLA 1DKMA 4JOBA 3E9DA 5CX4A 3F3KA 2AXNA 3HJGA 2P78A 2P75A 2DWPA 3R7AA 2WNHA 1V37A 3K4PA 1YJXA 4JOCA 1DKLA 1UJCA 4EMBA 1BQ4A 2EKBA 3IT1A 2A6PA 1DKNA 2DWOA 3BIFA 3IT2A 4MA4A 3NFYA 4D4JA 1BIFA 5AK0A 4PZAA 1NT4A 4HBZA 2H4ZA 2BIFA 3DB1A 3C7TA 1DKOA 3MBKA 1E59A 2YN2A 1ND6A 1RIIA 1T8PA 1V7QA 1FZTA 3O0TA 1FBTA 3FJYA 2HIAA 3LG2A 1IHPA 2ENWA 2YN0A 1DKPA 2P2YA 4IJ5A 1RPTA 5HR5A 5PGMA 3GP3A 2HPAA 2H52A 3D8HA 5CDHA 1QHFA 1RPAA 3GW8A 1TIPA 4PZ9A 2EKZA 5CU7A 3F2IA 4EO9A 3FDZA 2A9JA 2P9ZA 3QPVA 3LL4A 2P79A 3D6AA 4D4MA 3LNTA 4ARSA 4GPIB 2ENUA 3EOZA 1BQ3A 5HTKA 2P2ZA 3KKKA 5AJVB 4ARVA 3NTLA 2P9YA 2GFIA 1SK9A 1UJBA 3PGMA 5AJZA 1H2FA 2P30A 4QIHA 4FDTA 1K6MA 3FDZB 4GPZA 2EOAA 2F90A 2QNIA 1QWOA 3E9EA 1EBBA 1XQ9A 3OI7A 3K4QA 1QFXA 2P6MA 4IJ6A
chains in the Genus database with same CATH superfamily
1FDSA 1HYQA 3PCRB 3KSMA 2D59A 3PXAA 1L4UA 2OSBA 4NPCA 4FB4A 1I36A 2I71A 3SU8A 1VBMA 4ZKEA 1N1MA 1JPVA 4DCPA 5CEFA 4TLDA 4EUEA 1SXQA 5ECWA 3HDQA 2JFBA 3D6JA 4IKEA 4NYMQ 1E9EA 3QM1A 3KQPA 5K6AC 1KWGA 2REQB 4RY2A 3X1WA 5LYJB 4JMPA 3H5LA 2OXIA 2BGWA 5CB0A 3ZDAA 1MIOB 1GO2A 3BXXA 1HEYA 1NFFA 1KI7A 2ETXA 1KOFA 2C57A 3PHLA 4WOJA 3R8XA 1NIJA 3VDMA 5BOSB 3VUEA 1QQTA 2B9VA 3IAXA 2L18A 1JTVA 1HT3A 3ODPA 4I6EA 5J2UA 5HCNA 3VUFA 1XD2B 1QF9A 4O3MA 1Y3HA 2ZROA 3DOOA 4LJ7A 1FFSA 2FA9A 3OEHD 5F52A 2IVFA 1D6MA 1EFTA 1U2GA 5LQAA 3GLRA 4ZOAA 1WMBA 3FSGA 2CLHB 2NX2A 2YXBA 3QUTA 4OL9A 5AOBA 3SGLA 1IHYA 4XWYA 1PR3A 2BGJA 3FYUA 1SG6A 3VTAA 4F4JA 4NLLA 1Q57A 5EXTA 1AX9A 4OLBA 4F1JA 4R7ZA 4DQUA 5C0OE 2IYEA 4OATA 5FBZA 1JKJA 1CULC 5B4TA 1C30B 2QGNA 2A59A 2ZQ5A 3ANNA 1X1BA 3K9HA 3MJFA 3SNHA 1P4HA 4BO5A 3P2MA 4KSYA 4RSHA 5AM4A 3LUPA 3V34A 1XEWX 2F1OA 2ZG6A 3AYZB 4N3NA 2ZXFA 4LGYA 5FADA 4C88A 1PWYE 4Q7LA 4W5WA 1H8HA 1WVGA 3EUWA 1P1CA 1YRQA 3NHFA 4HDMA 4YN3A 3VI3B 4AECA 1LX7A 1HYGA 2R6GA 4HL6A 4N8DA 4MP8A 1NV8A 5LOVF 4RSMA 1LK0A 3SR3A 3B1VA 3DOJA 1HT0A 4OHVA 5GIPE 1M75A 1SA0B 2W9XA 3H9JA 1Y0BA 3EZ7A 3B1KA 4WNAB 4KX3A 3W90A 4NFLA 3DVQX 1G19A 4CKWB 2AN1A 2OD2A 1EFLA 1QYVA 4KJZA 4URZR 5D86A 1WLYA 2O8DB 1G5HA 2C84A 1NVDA 1WKCA 4FXPA 4G3XA 1Z22A 5LN1A 1KYIA 3TKYA 1BXZA 4AIIA 1GZ3A 3KQHA 5F3WB 3CNHA 2FUG1 5HYVA 2QI9C 2K87A 4IVRA 4J07A 2VJQA 3S27A 4JV5B 4LMBA 2O2YA 4YH1A 5KNCD 4XGRA 1R7RA 3K15A 2QBYA 3DOHA 5ELLA 2C5FA 1Y3CE 3EXG2 4JJ8A 4DQDA 3K0EA 4OQQA 4BLPA 5K8VA 3PC2A 1EWKA 2Q3BA 4RDCA 3C3WA 1E2KA 1DFIA 1KQOA 4BJ3A 3PPIA 3CXUA 4HH1A 4LOIA 4ZARA 1ESEA 1QMGA 1D6NA 1A8SA 3KZ1E 3HB9A 4NXNB 3OCVA 4YIHA 1AUVA 2GZHA 5FDFA 2C5EA 3DF7A 1H66A 2WUEA 2HSEA 2QG4A 2VVTA 3QWAA 3WWCA 2H1LA 3DLIA 3G88A 3QNMA 4PX9A 4P81A 2JFYA 1JIKA 3K9QO 2QYSA 5EXEA 4BNDA 2ZYDA 2ZIZA 3PKIA 5IZCC 5ED4A 3O92A 3B36A 3T9BA 5G3YA 1WZNA 3K1YA 2KB0A 2HWUA 2I33A 1VIYA 3HV0A 1Y1LA 1BH2A 4QOIA 4AZ0A 3SJAA 4N12A 3VO9A 4BNJA 3ET4A 5B2EA 5GVSA 4X62B 2B36A 3UG6A 1BO6A 1NW8A 4JB0A 5K20A 3RIGA 1FP1D 4QHTA 1ZGGA 1GNTA 2JK1A 2V7TA 4KMSA 4OQNA 5D3ZA 2D74A 1NR7A 4J6EA 2J5XA 3L84A 2JIDA 1A8QA 3FUXA 3HXTA 2A86A 2IBMA 3RBZA 1NN1A 3DV9A 3IKMB 2EKDA 1A9ZA 3PF9A 3ZWXA 4NYJR 1N2OA 3HFGA 3TLEA 1A7KA 1XXHA 5K8UA 2KI5A 3AUKA 3PNVA 1ADYA 4MUMA 2DU8A 2HMTA 4QPNA 3ZNPA 1KQPA 1O4VA 3MGKA 3Q40A 1GA4A 1TQHA 4EITA 4OQXA 2HCJB 4ZPXA 4GWLA 3RYFB 2QPTA 3DR5A 1Q1GA 1ODSA 3LTNC 1IZYA 2AK3A 1N1GA 4MW1A 4WK0B 1HYHA 4DMKA 1XTQA 5DNYB 1G3QA 3FPLA 1JDZA 6YASA 4C2UA 3RWBA 3S6JA 3J81A 2VUIB 3VV2A 3RPEA 5BYJA 4LMRA 5JAHA 2C2MA 1H4VB 3I83A 1F14A 4UNIA 1GM5A 3KHUA 3LT5A 4OGLA 4POAA 3UWKA 2IS4A 5A6SB 1N2CE 2QT9A 3BMOB 1UQUA 2Q5CA 1E3SA 2KYRA 3CU5A 3MJSA 1WP9A 3OJ0A 3PJDA 3Q72A 4M9RA 3EK2A 4NK5A 2NU6B 4R1MA 1G9TA 3ZHQA 1WU8A 1ABFA 2VSXA 1OMOA 5P21A 2A88A 1IJKA 4CNBA 4DSOA 3A28A 2OESA 1R64A 3PV0A 5TMEA 2AWNA 1GQOA 4LRXA 4RK5A 3DMTA 3OZTA 1PDVA 3ZK7A 1DV1A 4E6EA 1E7WA 1HC7A 1YL7A 2FETA 3WGZA 1E3LA 4C4SA 3DE3X 3GH3A 1EWRA 1J70A 2NTNA 3H1EA 3HPRA 4XX0A 3EIFA 3D31A 3MOSA 4L9AA 4G0XA 5EQDA 3N3BC 5LWQA 4R5HA 1E6WA 1S8FA 2VEDA 4TXLA 2E21A 1TVCA 4IX1A 3RSHA 3LQQA 3RUAA 3GA5A 2DWQA 4DSAA 2IUEA 1GSAA 2WHRA 1QRSA 2CCGA 5CMLA 4F6CA 1J56A 1CZOA 3R5XA 4GMDA 4I7EA 5KC9A 1K89A 4NZZA 3X2SA 2DB3A 5CCEA 5H3CA 1X3SA 3U80A 1XEXA 1IRIA 4FYYA 3PDJA 1Y4DE 4MDHA 4DKJA 1ZLXA 3DP7A 4JA2A 2C9DA 4DLUA 2I5PO 1NP6A 1QH0A 1R6XA 2GD2A 4Q1AA 3VAZA 3DW3X 1E2QA 2YYAA 3OESA 2FPIA 3AEUA 4I14A 4B33A 1R9JA 4OFZA 2VFAA 5LJLA 1U8YA 3THWA 3FWHA 3CX7A 2C03A 1V5EA 4BWFB 2WIKA 4ISCA 1QAOA 4WESA 2JJ2A 4P4UA 4X95A 1QTIA 4XLLA 3P2EA 4CM8A 1KDVA 2HX1A 2WYIA 1HH4A 4KPYA 1FYWA 3FYSA 1F0KA 2AXQA 4YJGA 5IAGA 2H9AA 1K7CA 1GV0A 4PIPA 1VPVA 4LOJA 4TKMA 4N0MA 2PYZA 4TV9F 1FBNA 4ZO9A 3B3GA 421PA 1ZN7A 1JIXA 3WGVA 5AUOB 5BVGB 1DAOA 3BD8A 4AJKA 3D4IA 1L7MA 1K7XB 5AK4A 1NJ1A 1EIZA 4B3MB 3REOA 4I50A 4B3FX 5C51B 2O7VA 3KTAB 1VSUA 5EINA 3IFSA 2IKQA 3ZR4B 2GKGA 4OMUA 3ID6C 5G2OA 4LXYA 4FC6A 1DDIA 3RHZA 4P7FA 5B53A 1KEWA 3T5GA 3FAKA 1PVOA 3OHSX 2VK2A 4C3UA 2HRDA 1TEVA 3IJRA 3ZWPA 3MLEA 2HUNA 3FKQA 4K2HA 2DT5A 2QZJA 1UJ5A 2JHAA 2WHPB 3OIWA 1W30A 2PT6A 4HQFA 3ZZ1A 5BMOA 1SVUA 1DZIA 2IF2A 1BFKA 2IYAA 1V5FA 4GUAA 2P3LA 5BMVA 2Q3JA 5L3VA 4K3VA 1XRJA 3GLTA 4L0QA 3LVQE 1YBAA 1VQ1A 3P8ZA 4RKRA 1B6RA 2B78A 2EFEB 2VDRB 2VIIA 3FUCA 5JCZA 2QX6A 4J4BA 5L3QA 2BHLA 3U44A 2H29A 4OSOA 2IQIA 2AI1A 3WNQA 3GOHA 4MI9A 3PEFA 4BZQA 1QRDA 4CR8A 2XYHA 4QNNA 4YCLA 1VHLA 3P94A 4WINA 2E4UA 1Z6GA 3EEIA 5FAKA 3CISA 1DJMA 3A06A 4BN4A 1C50A 1SUIA 1YJ8A 3UPDA 1UBLS 2IYXA 2M1ZA 2WT4A 3RSOA 1EB8A 1W8IA 4W6ZA 4CN9A 5DNUA 1YB2A 2HNAA 1CZNA 3W5UA 4D45A 1NPDA 5BYAA 3C24A 5JYCA 3BMCB 3MWJA 4IYJA 3S7ZA 2HPAA 3H4MA 1U9IC 3RR2A 4F2HA 4EFNA 2HLHA 1SUCA 2WQ7A 1UBNA 5B55A 3EGXB 2JFNA 2J32A 4M38A 4UHJA 4EGSA 3VZQA 3I2YX 5E9AA 4OH1A 2D5BA 3JQQA 1DBQA 1CUDA 2WILA 1COWA 1FOEB 1ZJJA 4KUHA 4YMTA 4ZQEA 4U3JA 2CF6A 2Q29A 2N75A 3PA8A 4Q7JB 5LMCA 3L9WA 2CJFA 4IVNA 2Z2ZA 2N3ZA 4DIKA 3RVMA 5JQGB 1ECBA 2P2NA 4L7VA 4EPTA 4LAFA 4JJ4A 1X1DA 3KKKA 1W52X 3WG9A 3EVEA 4E07A 5DVZA 2QE7A 3TEJA 1M0EA 4MS1A 2AFHA 1UT6A 2CVHA 3W5CA 4PLHA 1DFHA 1KEEB 2R8RA 3AUYA 1P39A 2JNWA 1A4UA 4NKRA 2PIAA 3CKLA 2WIBA 2XKJE 2A1TS 1AXEA 3EGEA 4OX9Y 3BMQA 1A2OA 5M29A 3NEAA 3AF5A 4UUPA 2A5YB 1L5OA 4YAIA 1DS6A 2IHZA 3R8CA 2Q8QA 4LJ9A 1TMKA 4JJGA 5E6RB 5HJ5A 4H4CA 4ZV4A 3N07A 2ZIXB 3IDSA 3NHLA 1BE6A 3ZOZA 2F55A 5A05A 2VXCA 4ZVKA 2I4RA 1I3MA 3INGA 5DB4A 3QXGA 1CUZA 2BFAA 2Q27A 1B00A 1SUWA 3ZU6A 2NMVA 1U0LA 2Z4RA 3Q10A 2W42A 4G8DA 3HL0A 3GUUA 1DUIA 3HCDA 4GX2A 2OBYA 2WU4A 3GMDA 2I7CA 1U8XX 3K2BA 4HVLA 4E1AA 1DIRA 1OFGA 3A1CA 3VDNB 3MT9A 1JQ3A 1SXIA 4ZPJA 1XVUA 3HH8A 4IAOA 3I30X 3IMEA 2XGSA 3N2NA 2VF2A 2OZEA 1NXOA 1NVMB 3O47A 5AQ1A 1WXQA 1JNYA 1GZUA 2HU8A 4JOBA 2QRKA 2ZYHA 5EKUA 1Z47A 1P6QA 2L82A 5KTNA 3L4BA 3ON5A 1IUPA 2IWHA 3BRWA 1U0RA 3UJ6A 3IIMA 2JLVA 3LQFA 5LUBA 2C54A 1CWUA 3UCEA 4ZOLA 3IVGA 5GJWC 2PX8A 3BCRA 5LM3A 1B14A 1ZIDA 1SXJC 3NHMA 4PO8A 5HS6A 3PEYA 1QRTA 5AXCA 3NBUA 3GP8A 5IFLA 2AG1A 3AJEA 4ZVQA 2UVQA 1N2SA 4Q4HB 1S02A 3IMKA 3EFHA 4O4LF 5KS2A 1DXQA 1EJ6A 4HAUA 2Q41A 2IUTA 1UPXA 4NYIR 3ITDA 2QYTA 2B99A 3EVFA 1N2JA 4YT8A 3EF1A 2Z30A 1ZVVA 4A4DA 3QKUA 1SUBA 521PA 5LDHA 2RGRA 2DPGA 2HBQA 4IDQA 3C4QA 5DGTA 4JBGA 2CXOA 5K3FB 1IONA 4ASUA 3CCFA 3D5EA 4WFIA 1RLUA 1EVIA 2FGJA 1CZHA 4XB1A 2NO9A 3C70A 1M34A 2XMCA 4EA6A 1QHFA 1PBNA 5BVHA 1KYYA 1QC5B 3H2KA 3K35A 1T1SA 1WDWB 4X97A 4RMHA 1TU0A 1DIBA 1QXSA 5CU7A 4HN4B 5BV0A 4HKTA 2ZR8A 4J0EA 4KU4A 2BFFA 4PHGA 4RIEA 4F84A 1AB5A 4Z0HO 1Y33E 4H59A 1F7UA 3LC7O 4OBBA 1P9RA 2XB9A 4BQFA 2J4FA 2B6NA 3BKWA 3CH7A 3HHPA 2C7QA 2JAUA 3WMXA 1TK9A 2P5YA 3OA0A 2JBAA 4G63A 1M2KA 5EC8A 3WR5A 4A8JB 3ZHSA 1M1YA 3KKEA 3H8SA 1FIUA 2GLXA 5FBKA 5F51A 4D26A 3AF4A 3LV8A 3M7IA 2VWGA 4Q00A 2X1HA 3DOUA 2XKKA 5LQSA 4CF3A 4YRJA 4N01A 5DSTA 4A0GA 2D8MA 5EJ8A 3VKHA 3ZQKA 2BDTA 4PSAA 4A91A 5E3HA 4CHTA 2WKPA 2VAMA 2GN4A 1SIUA 2VQSA 3DL0A 3U3JA 1K6MA 3RAGA 5F21A 1M5RA 4UOQA 1R6VA 3RGGA 4R3NA 3R6DA 4EPVA 1X2EA 3GLQA 4BMXA 3A6ZA 1RQ7A 4IHQA 3IP1A 1Z8DA 3FMVA 3VPFA 1KETA 4NC9A 3RREA 1IXZA 2FHPA 1G60A 1RABA 3WDLA 3HN7A 4RF3A 2PMDA 5HFAA 3U5TA 2GK7A 1ZXXA 1F8FA 4UBNA 4KE8A 5A2GA 1KMMA 4IY1A 4KPGA 2W4IA 1IDN1 2XMGA 2RHDA 3JTMA 4JUCA 4ZQGA 1OSNA 4ZRDA 2Q9CA 2YY7A 1PN3A 3RVKA 1OVGA 3OZWA 1OA0A 2GZMA 1GPLA 1OF1A 1N6IA 2GJ8A 4NV3A 2IHYA 2QORA 3I8SA 3WK9A 1TMYA 2EJTA 3ZW9A 1D2CA 1FDRA 1YS1X 1TLFA 3WGYA 2VAWA 1VSBA 4LVCA 1V16B 3DWEX 4TL8A 4EHIA 2O8EA 2BFEA 3FRIA 4HI0E 3U81A 2UUAB 1N8KA 2VYCA 2ORED 3NUZA 2GPJA 4MRVA 4FE4A 4UHFA 1KORA 2PZJA 3ZI0A 5HOEA 1C7ZA 2ZE7A 1M1NA 2IP1A 1ND5A 2BSQA 1OB5A 1TYDE 1URPA 2OBBA 3NANA 2J0EA 4DLZA 4WK6A 4PNEA 4O2BB 3UV7A 1VZ3A 2C4UA 2C5BA 5J2TF 1GOTA 1VPDA 2DF8A 3A4TA 3UUFA 2HREA 3SXUB 4A5SA 4DKXA 1Q21A 3ZJTA 4KQ6A 4TS3A 2EP8A 2J48A 3QBDA 4NMHA 4KLCA 1QG4A 1W4CA 1SQFA 1L4MA 3O82A 1TTTA 1UJCA 2OFWA 4E11A 2ZAMA 4E4TA 2O8CB 4QKQA 3P9YA 5BT9A 4YMIA 1VBKA 1O8BA 2OOKA 1NW4A 5IJ0A 1KIFA 2PPLA 4KUEA 1YF3A 2CE2X 3QLUA 1KO1A 3MZ0A 3V8EA 3ONEA 1P77A 1TJNA 4KLRA 1B2LA 4URUR 4MZXA 4FHGA 5HKAA 3JQ9C 4UBJA 3DJYA 4XJXA 3U37A 4F56A 3UH0A 4U39A 1ZESA 3P97A 4Q4AB 3SZRA 4BKPA 3E15A 2O0MA 3STXA 4S1NA 5D84A 3RRMA 1QZZA 1V2GA 2AE1A 1KA9H 3JQDA 4RLHA 5DX1A 4DLXA 1E7RA 2E55A 1JJAA 1SNYA 2VSYA 4GX1A 2HIAA 5JZ9A 4JFRA 1DC5A 4Z7QB 1SQ5A 4PLTA 5U4QA 1M6NA 1FCJA 3TOVA 1QP7A 3CE9A 4F93B 4KRFA 1Y3BE 2E82A 2NSYA 3WMEA 2VRCD 3CRW1 1ISGA 4LG1A 3E7XA 5EJFA 1OXUA 1KJ8A 3OX1A 4LY9A 4KPFC 6AT1A 5CB4F 4OMFG 1O5IA 3P9CA 5JCJA 3HCAA 1FF9A 1A95A 2R00C 1E3DA 1T2DA 1IZZA 3ZIAA 2BLNA 3L18A 3UAVA 4ANFA 2IXBA 2Z2XA 2AC7A 2HLPA 3H0CA 4WXHA 2FWPA 4KRXA 4PG4A 1EUYA 1J22A 1XHFA 1D7OA 1U9CA 2CBGA 2O6HA 3QH4A 3HU2A 2B5WA 2IUYA 1NLUA 4UTXA 2C4NA 5HDQA 1UAGA 1EVKA 3GWGA 3KEOA 2FFQA 2JCVA 3NOOA 2X9LA 4J76A 5LA6B 2DUNA 4D81A 3ITEA 5LBUA 2OFOA 2CBZA 2J1LA 2I6XA 1NQOA 2ZATA 3LWBA 3LX5A 3RQIA 2Y77A 3VR6D 4JUFA 2ZTVA 4TTIA 4YJDA 2Z2KA 3HDHA 1PJLA 1V3TA 3H9GA 4W1SA 5IC6A 2PGIA 4V0ME 1KMIY 4OXIA 4PEVA 1DBSA 5CH8A 3THXA 1TTQB 3LBHA 4UQPA 2CVFA 3ZX4A 5F64A 4ZYZA 1TM1E 4QFBA 4R9VA 1ECFA 4KR0A 4U2EA 5FTNA 1FTNA 1Q0LA 2P8SA 5LQMA 2HU7A 3ROPA 4M0LA 2V97A 3OF3A 4RLFA 3TK1A 3V8NA 1SFRA 1M74A 2YJGA 4L5IA 2XBLA 1M10A 4UDOA 4GRDA 4FNGA 4UMFA 4D9MA 5FOTA 4QOJA 4Q15A 5HMMA 3E70C 1DAFA 3GG9A 3SQOA 3H8JA 3NORA 2HHJA 2NXWA 2J6HA 3EG9B 2WWFA 1MNQA 3PB3A 1D2MA 4FCVA 1N8SA 3P9PA 4CQJA 1N2GA 2XPCA 3F98A 4JKYA 2CXPA 2CHFA 4YCMA 1J8MF 4IIDA 4E22A 1DC3A 1ZMXA 1ZS9A 4FYVA 1YFLA 1RC8A 3JASA 5ESDA 2H4YA 2C8VA 2LZ0A 4EGFA 5AVUA 3AHIA 4HRYA 1M5TA 2Z3WA 4M0UA 5JR3A 2V4ZA 1E1CB 3V1UA 5FOSA 3ITNA 2H2WA 2ZYTX 2A3NA 3OQPA 1Q1BA 1UFQA 5F7JA 4AWBA 3TQCA 1J0XO 1G98A 1BEEA 4JL8A 5CDFA 2COUA 1KI6B 1FXWA 2QTGA 1G1AA 3ESZA 1KP3A 2CMDA 4KQ2A 1T9CA 1W88B 1GADO 3BIXA 4KP7A 2H1OA 3N2YA 3L7OA 4EIWA 2B3DA 4B3GA 1EM8B 3OJLA 4MUYA 4BB6A 1MAHA 5DCUA 2QZSA 3MGGA 5AYVA 4DQLA 2RH8A 2FCAA 4PBTA 3TJMA 5H9VA 3CF4A 1PIWA 4CM9D 2R6CA 5F3RA 5B4UA 1FFAA 4D3ZA 3TSCA 3E1GA 3UA3A 4GC9A 1M67A 1XK6A 4TTVA 5I8PA 1PDWA 3AR5A 1G16A 3MTAA 1CFJA 1RWOA 4KMMA 4BVGA 1H2YA 3FNEA 4IHJF 3HACA 2FEWB 4J8PA 1JHXA 3O38A 2P7IA 2G9ZA 3AU9A 3IKJA 3B6KA 4IFIA 5GONA 1O08A 1ZONA 2QVYX 3LC1O 4LRWA 5KSPA 3U7EB 2CZCA 2LPMA 4FIDA 1ZKMA 1HQDA 2QW8A 4NEGA 3S5UA 1R4ZA 2NPIA 5C1OA 2PBFA 3GW8A 3N2KB 3WMRA 5BN5A 3FMPB 3VXKA 2R1VB 2NIPA 3RKRA 1X74A 4I1UA 3RSLA 5EL0A 2AXEA 4CPDA 5F9FA 1G41A 4YJ3F 1M6EX 2Z6QA 3UUWA 4ALIA 2OYSA 2JEZA 4RK4A 4BTLA 4TV8F 1E0DA 1T1JA 4PLVA 1PX0A 4P92A 4PVDA 3VHXA 4EUNA 2OYRA 2R3SA 5BQOA 2V96A 1XEWY 4L5CA 4R9RA 3ZYCA 1QIKA 4FDLA 1U0HC 3S28A 4XGQA 2Z8YM 2WJAA 2XDQA 4ITRC 2YJNA 2VDMB 2Y3IA 4KTTE 2EFYA 1NDUA 5T4HA 4NX2A 2EFHB 1WXIA 2ZI5A 2JHGA 2ZRNA 3DDNA 5FFMA 3RRZA 4YPVA 4R69A 2QDXA 3AZOA 1ZOOA 3ITKA 4QIHA 4ZTZB 5D51S 2GK6A 3L1UA 2WWYA 2I2CA 1BVYF 2X76A 2HK7A 2WJ6A 1E7SA 5TSDA 4HNAB 2BL4A 2HJVA 1PI3A 4BX9A 3NTVA 3PQCA 3UEOA 3DBHB 4LXIA 3KG2A 2XNSA 1G2PA 2XWBF 4GPD1 5K0SA 3A4NA 2A9KA 5IRCD 2B3TA 1C9YA 4C07A 4D9BA 2H2AA 5JG7A 1CR1A 1KR5A 3DWFA 3F47A 5LQNA 4L7QA 2WJ3A 4LXUA 5FPQA 1QH8A 3FRJA 1E1LA 3KAKA 4X85A 1HUQA 1BYIA 1WZIA 3GRZA 3M89A 3U3MA 1YZLA 3ORFA 4MVJA 2YVUA 2O3QA 2YS7A 4ZVVA 4E21A 5ARBA 3RAEC 2GAOA 2PTHA 3SX0A 3PYXA 5KSYA 1XZMA 3PDIA 3E9QA 2BR3A 2Y92A 4RU1A 3TI7A 4DLKA 2IU4A 3C5WP 1V8ZA 1ECCA 3NGLA 1Z83A 5BWNA 3Q3GE 3EEBA 2CUNA 1FX0B 4LYEA 2QMZA 2XODA 4MVCA 1Q7BA 1PUXA 4C87A 1HDOA 5MN4A 2J7PA 1TZMA 3SQDA 4R2KA 4BOYA 1J2YA 2X40A 3T3IA 4CF7A 1D4ZA 1DPFA 1LY1A 5BURA 4AS1A 1GARA 3EXIA 1I3OA 7MDHA 1GUZA 1AURA 1LDNA 4ZZ0A 2WFMA 2XJ4A 1TMGE 4CMEA 3BEOA 1Z5UA 2JLCA 1JKMA 1OUMA 1R8SA 3F90A 4NG4A 4YRQA 4RCYA 3ZGXA 3HMKA 2AMFA 3UK1A 4D44A 2JIQA 5GJVC 2QDKA 5CFMA 1RRKA 4U9IS 1SVOA 1VKNA 1JMYA 3Q3IA 5ALTA 3QVXA 4JNKA 4DV3B 1ZITA 1R16A 4H3SA 3WA6A 4C7OA 2NOAA 5K01A 1P74A 1ZISA 4PX3A 2ZJ3A 5D3KA 4CKZA 2O5EA 3WC4A 4X84A 3JAMA 3EVZA 5AHOA 3G85A 3PQ8A 4B83A 1E3JA 3IE1A 3DOIA 2X7HA 4EX7A 3SYKA 3HUDA 4AJOA 1OBVA 1BX0A 2XE4A 4E2XA 4HP8A 5I3ZA 1AD2A 2Y76A 4IDOA 3S5JA 1JHZA 3F6EX 1Z2EA 2BONA 2J85A 4KXVA 5DJ5A 3WDMA 3ZX5A 2ZJ4A 5FQOA 1H4TA 2VYNA 4DIEA 3PXEA 3W0LB 3EFOA 1W5TA 1H8EA 3M6IA 4G0VA 1K06A 2WDPA 4G5XA 4TRRA 3CIFA 4ZQBA 3TTTA 4EA9A 2H00A 2UU9B 2BY4A 2EEPA 1DTWB 1PVDA 3GYBA 4N18A 4F1WA 2BFWA 1IVYA 1V95A 1FMJA 2XA1A 1J8DA 2FUKA 5CXXA 5ICFA 7REQB 1H4SA 2VNSA 1J2UA 2QE6A 2VPTA 4K9PA 1MLDA 2XDAA 3BGOS 4LXGA 4W8HA 1C7EA 4XOUA 4ZV7A 5AXDA 5BNFA 3F2VA 3RJ9A 4DWVA 4L4UA 4R40A 3KJXA 4D4MA 5LOVA 4ND2A 5KTTA 3PICA 1NMXA 2IVZA 3DKRA 4G89A 2QXTA 4J16A 4Z49A 3H9EO 2C7BA 4ZA2A 4L6AA 4YMHA 4GMKA 2FX2A 4IJKA 5L7YA 4MK4A 5JJIA 1YT5A 3G2KA 5GZ6A 3A6GA 3VZRA 3WLMA 2PL3A 2IPAB 1KL7A 4IIYA 2F90A 4CLRB 3QX3A 4YMLA 3DMYA 3OI7A 4GSYA 1L5LA 1AZLA 2ZDHA 3OJXA 4R9SA 4XLTA 1DG9A 3CX6A 4LFBB 4H6PA 4X44A 3SJUA 4C4RA 3UW1A 2ZSHA 1K08A 3D43A 3E5RA 1P33A 1EEHA 4C6RA 3AK4A 3KHKA 3LYLA 1BXKA 2GHRA 5L4LA 4M1MA 1NQTA 2CHGA 4ZEXA 5EERA 1EK6A 2PAFA 1XDSA 2FN7A 4O8ZA 1LWOA 2NU8B 3SK0A 3BKXA 4HK4A 5IT9A 1C0KA 2OZKA 3DVRX 1FDUA 5FP0A 3CKYA 3ROQA 4GBMA 2ZI9A 2NSJA 1P72A 4PTLA 4R3UC 2VXOA 3KEFA 4DDWA 2VPQA 1QQAA 1GT91 2V7BA 4MR8A 2EP5A 1DBRA 3BOSA 2BFBA 2QD4A 4F86A 1XZCA 2H48A 3L7DA 4U0KA 3M9LA 4B0OA 3G0HA 1M2EA 2DY0A 2VTBA 5DO9A 1R88A 4AFNA 3HKEA 4O2LA 3PITA 1NFRA 3AG6A 4JJEA 4S1WA 1I1NA 4UKDA 1ZZEA 2GM9A 2XYQA 4O25A 2DFKB 5LU8A 2XXAA 1S01A 2HSWA 2JFVA 2X8LA 3LP6A 4C5BA 4S05A 3TUJC 4MI3A 1QHEA 2AC4A 4G85A 1NRWA 4QC2A 2P65A 1XZNA 3WLRA 3CZQA 2IBSA 3RWOA 2ZCVA 3C8ZA 1L5FA 1YIDA 1UBKS 4UPVA 5C80A 4HAIA 2MYNA 1YK1A 3FTPA 4PHCA 3VOBA 1AH2A 1P29A 1XMPA 3E9ZA 4F38A 4MKRA 1X1RA 3HDJA 5KTSA 1M1UA 1L5YA 3VGPA 3FSEA 2F59A 3B6JA 1JDSA 5HBRA 1L5KA 4YV0A 2OHJA 1EDOA 2EGGA 3OLZA 5GADl 4W5OA 2HJSA 1QTRA 1R27A 1CY6A 4JBXA 4QQ8A 4R84A 4IV0A 3RI3A 3ILYA 5IVIA 1OX4A 2FZKA 1G3UA 4EZEA 3V1TC 4G1BA 1L3IA 4MRNA 1A4XA 3LQ2A 3L8MA 1KO7A 4EVSA 1Q0UA 4OK3A 5EHXA 4DCJA 4NZMA 4JI1B 4RSGA 4ML3A 1ZCJA 2RHRA 3OUUA 3L43A 1B7GO 2CEAA 4BV9A 5J1SB 3WRYA 3ZD7A 1VLQA 4OGFA 5HQ3B 4KFSA 5K3BA 4QQRA 5JS8A 4CM5A 2CD9A 1YB7A 4EO9A 4U7DA 1TEZA 1CRPA 1W59A 3I9OA 4MRMA 2Q5JA 3YASA 3HDTA 1Z2AA 3SFVA 1VI2A 1E7MA 2B0CA 3SN6A 4HEA6 2XB2A 2L0XA 3EMVA 3OZEA 1WTAA 2FOLA 3NALA 2JIMA 2WB4A 1G6KA 2IIQA 1EE2A 3HB1A 4JHLA 2ENUA 5JCOA 5IPFA 4NZYA 1M2JA 3JRNA 3L5OA 1C3OA 3R23A 4F2GA 3G5LA 2AZXA 5ALLA 2I3GA 3EFEA 1KZ9A 1JX6A 4MV5A 3QWFA 3I23A 5AVVA 5K0LA 4FQ8A 4HJRA 3T7AA 3LHSA 2WV7A 2Y1EA 4CQNA 4MGKR 1UK6A 2HCBA 3ZQ4A 4ZC1A 4FM9A 2AOTB 4I55B 2VR1A 4X1OA 5K99A 4LZWA 4YY3B 3UB4A 3SOPA 3WLNA 4WKOA 5DTMA 4IIXA 4IG4A 3G89A 5FIUA 2FR8A 2MSDB 4YI5A 1C3LA 3ZTWA 1A96A 2YV1A 3CLUD 4EA7A 2P2DA 3C8MA 4CLHA 5LZ2A 1IWBB 1Y63A 1L4BA 3EPRA 1CS0B 2AG6A 1L8QA 4YJ2B 1K88A 4L0MA 4Q3CA 4J9UE 4FLFA 1TUBB 1N5DA 4ZVOA 3LDFA 3TVDA 5FR1A 1U9ZA 3HB5X 4PIVA 2XVMA 4LC1A 4LF9B 2FKNA 3SJBA 3D2AA 5KKAA 3FOWA 4RE6A 1JEQA 1X7WA 2BI4A 4B7AA 4N9QA 5A9TA 3DAHA 5CFRA 3ME5A 1NMYA 2G8NA 4WJKB 3VR4D 1GZVA 3TW8A 4OG2A 4PR3A 2WG0A 1JFFB 4LJ6A 5ENZA 1G7RA 3UJHA 3M5PA 4EI9A 1BXRB 4UOEA 2KSQA 2ASEA 2PWBA 5CFOA 4NBRA 3THYA 1RLOA 2R1ZA 4JX9A 2NAPA 5SYMA 1HQKA 3GIWA 1ZSNA 2VTEA 3U7GA 2ID8A 1XELA 4XVQA 2GOYA 1DSSG 3R6TA 4U2CA 3A31A 3AEKA 3GBSA 4QXAA 4Z2AA 1IG0A 5AWFC 2VHEA 2ZBDA 1I3NA 3QVWA 4RD1A 1W94A 1BIFA 1HXHA 2GILA 4HHEA 4OHMA 1NQUA 2D54A 1OAOC 5KOHB 1TFUA 4JAVC 4CCWA 4AJHA 2E37A 5KYNA 3AFMA 5I8ZA 4WNIA 3ZKWA 1U7PA 3E81A 1LSOA 4MKZA 1Z63A 2HAEA 1J5PA 1N6OA 2ODPA 5AVKA 1EXNA 4UFPA 3MJRA 4PIMA 1BE0A 3ZK8A 1P5HA 3NVKI 1X80A 1QIGA 4PSVA 3KHSA 3E2IA 1EE1A 2C1EA 3L8GA 3QY0A 4COOA 1MAUA 4L6CA 3D7KA 3A6PC 3MILA 3GAAA 1QHHA 1QV9A 2Z8YA 3TKAA 4LCEA 5CVCA 3OZXA 2OAGA 4WKNA 3V1MA 1PW7A 2ZIWB 3UAZA 1T1EA 1NQXA 5B1EA 5AVSA 5F5NA 5IBRA 4KZKA 5AI5A 3ZWAA 2CV0A 3RC8A 1RADA 4M0EA 4H27A 4ZAWA 2BBSA 4L07A 4NJEB 3LO8A 4BMDA 5BW8A 3EZLA 4HWRA 4D9NA 3BBLA 5TMBA 2PRJA 4TLLB 3EA5A 3EIOA 3SLRA 3U9TA 5JO0A 3AETB 3ZZMA 3GT3A 2NTYC 1PSDA 3NTLA 3RK1A 3CZCA 4JJAA 2X58A 2YN4A 1TVKB 4RKEA 2GBIA 4EUFA 5KI6A 1V3QE 2J31A 3PFGA 5DN6A 3R4CA 5FNVA 4BKMA 2AXPA 1CT9A 2F3RA 3PHBE 5BV7A 5JAQA 3RAJA 4O4JF 1XXLA 4PCUA 2C2BA 4BS9A 2EX4A 2IYFA 5EWMB 1HFEL 2FPKA 3P5SA 4QOGA 3C7CB 4YEDA 5CXSA 3DYIA 1TJPB 3HUFA 1OYOA 3GEHA 2Q8NA 4KVGA 5FTLA 1U65A 3K5PA 5IU6A 1BJRE 2G4LA 4BO7A 1A9XB 3DDHA 2VLIA 3QLJA 4EO4A 1OAKA 3IP8A 4KQKA 4DV4B 4MWTA 2CL0X 2ZITA 3WQHA 4LXXA 3ZJVA 2ODQA 1HRDA 1E2BA 1VFNA 1SIWA 1JQEA 5E38A 4RKWA 1DHTA 1ORHA 3N7TA 4YREA 4GPAA 9MHTA 3PR2B 2QN8A 4R1UA 6LDHA 2EG9A 3KV1A 3OUTA 3IL2A 3SYMA 1RVV1 4BMVA 3IUQA 3BXHA 1QH1B 1GN8A 1WMSA 5TPWA 2WFLA 1JLLA 1NVXQ 3K1JA 4Z3DA 2ZRPA 3LY7A 4P5DA 3V8BA 2ADFA 3ZDZB 1K2VN 3UCFA 1Y8QB 1RP1A 2YHUA 5DGDA 1U9YA 3C0KA 2OKGA 4HGRA 3GLFA 3OO1A 2GDZA 4YLEA 2IW3A 1P3JA 4BEJA 2BEVA 1XG5A 4QJIA 3SE0A 4DLAA 3U31A 1OQAA 2HDNB 3IRUA 3TNDA 4GKKB 2KQUA 3DMNA 3I6MA 5LQCA 4RTNA 5CT8A 4HSGA 1SB9A 3HDVA 1C1DB 1T9HA 2P78A 4EB6A 2B7CA 2PGXA 4K81B 1OFVA 2RI0A 4XSGA 3G1WA 3DGFC 4AJ9A 2PWAA 3RFCA 1HE1C 3QVUA 4LI0A 1DX6A 4H2DA 3VPXA 1VCIA 4KIGA 4UMEA 3BVPA 2QMHA 3H83A 2P9HA 4EMUA 1JEYA 1EDZA 4ABTA 2OY0A 1Z0IA 3C74A 1OLUA 1FU7A 2JFGA 3OQOA 1SUAA 4GYWA 1T5OA 3O1HB 5BW4A 5G0VA 5CURA 4PSUA 3BWDD 2H2DA 3GK3A 1E2EA 1IULA 1X7GA 4Q34A 2JLRA 2Q4RA 3PDWA 5CDTA 2BSXA 3A3YA 5BSHA 4KRGA 1U1GA 3ND8A 1OH6A 4PYKA 1HYEA 1Q0SA 1UJ2A 4G0NA 3W1WA 4I5FA 1Z7GA 1DAMA 4ER5A 4O2AB 1XNRB 1REQA 2QX9A 2VUSA 2VXBA 1K86A 2EEZA 1GTZA 1Z2CA 3DC7A 1GD1O 1PR1A 4OQDA 5E4JA 1KOLA 4EJ6A 3Q8KA 1Z33A 2ZVDA 2IJGX 5IJ9A 4OKNA 1KOJA 3ZV3A 4UUMA 5HIKA 1UXHA 1EHCA 2ZWIA 4UHBA 2EFJA 1D4AA 1JIVA 4DMGA 1I24A 3FPKA 3AHDA 4GMHA 1E2NA 4UFNA 4F6RB 1U3DA 5LR6A 2FF7A 4JVSB 1R4MB 5FI0B 2IV3A 3WLIA 9ATCA 2ECKA 3CRNA 5KAMA 4NWIA 5LP6F 1QIIA 1BDHA 2H2HA 3A1UA 3FRHA 1Z18A 3JD2A 4QUBA 5I4IA 4HFMA 5H9WA 1ADGA 1JG2A 1GUDA 1NM5C 2BT4A 2ZB8A 4L6IA 3GA0A 4RW0A 4OI1A 4ENPA 1MZPA 1H6AA 1ML3A 1NQWA 1KFCB 1ZD2P 2RSLA 4RK7A 3ZCRA 4D4GA 2V0GA 4HO1X 2H1SA 3KR2A 3KZXA 4CF6A 3A4LA 3GRVA 1R10A 1MEOA 3M4ZA 5F33A 2ZEJA 4X3OA 4G56A 4KPUB 3FNIA 3K0CA 3LCRA 5IYZF 3VZCA 2E5WA 5JWOA 1J1UA 4KVFA 1BN6A 2GEJA 4HUQB 1AIPA 1AKUA 3FB4A 3EMKA 4TT3D 1HRKA 5D3MB 5T8KC 4PQGA 3GI1A 4JU8A 4ALJA 3FDFA 1P0QA 3ZNQA 5ITVA 1YR8A 3JD3A 1D2GA 1J9EA 3EXFA 3PT5A 3PYLA 1ZMRA 3SYTA 1WULS 1G6OA 2BJHA 3U0VA 3VR0A 1XU4A 2B98A 2VHJA 5ESRA 3S1AB 2AN5A 4GI2A 4MB6A 1RXIA 5KNBH 4BXOA 2XZOA 1R12A 3D4NA 3Q5GA 1Z5PA 3NNDA 3OMLA 4ZT3A 1L8LA 4PAQA 1JHPA 4DQXA 5DKFA 4AJEA 4EM6A 1WR8A 1XLTA 2IPOA 4J7XA 1SWVA 3CVOA 3FB1A 3QKRA 4DIBA 1LTKA 2C9YA 2GYYA 5BUSA 1PUIA 4M1WA 2WLSA 2ZWPA 4V3CA 2HMAA 1NQAO 4JT2A 2AFIB 4H1VA 5AESA 3IODA 3II6X 2XHZA 3KXIA 1XVTA 1JLRA 5HM6A 3EF3A 1GNSA 2YICA 5ITSA 2CLEB 1ZCBA 2NUPA 3BRCA 4PFKA 5E1DA 5JD3A 1Z8NA 4JYBA 5A4FS 1FNCA 1Q3TA 4ZO7A 1M2NA 1TKRA 1VSVA 4FOLA 4P3YA 4J2OA 2CLDX 4TWZA 3FCOA 4QXQA 4WFKA 3E7PA 2CKDA 1FVXA 5TGTA 4M9CA 1IPEA 4BO2A 1A9SA 3L0SA 4GOKA 4DANA 3GFSA 1GQRA 1LS1A 4WXPA 5ALRA 5JMTA 2B1JA 1DIGA 3QV1A 4DIUA 1Z5ZA 1WHTA 2YFHA 1C9NA 3DEYX 5FI3A 5J4YA 3I2GA 4PG8A 4UVIA 3NIWA 3TLGB 2VPZA 3BXFA 2Z3ZA 1F60A 1RXYA 4JS0A 1KJYA 4Q0MA 5DT9A 5G0SA 3CG0A 3IDQA 3OKFA 1W2GA 1T36B 2AF3C 5A5GA 1XVLA 2AR0A 2JJQA 3TRDA 4LMAA 3MRSA 4XD7A 3GJ7A 5ADUS 2UUOA 3LOPA 3DKPA 3QEOA 3EUAA 1NT4A 1VLJA 3PUJA 5I7RA 4EP1A 1X38A 5KWIA 2O3RA 2QE7D 1ZJ6A 3TGPA 1VPWA 4IG9A 5EMJA 5AW7A 2GCOB 2RCYA 3H75A 3B5EA 4OJKA 2BCJQ 5J2TA 5TV2A 4G4SO 3AVWA 1V7QA 1QVZA 4QUAA 5IJXA 5IVKA 1B93A 3U13A 1EZ1A 5ALIA 3ZY2A 1FTGA 4CDRA 5LMNB 1DC4A 3OSUA 5A6SA 1GEEA 4PAGA 5H0IA 5TF0A 3QI7A 1T3HA 2ZZKA 5GM1A 3VV3A 1OB2A 3HVJA 1F17A 1PFGA 1QP8A 1YDWA 4JLUA 1CB0A 1T3GA 4I9NA 2FPOA 4ILEA 2ZB4A 3CZAA 3R0JA 3FHTA 4WN9A 4Z2YA 2XHEA 1TFRA 1BMQA 4H17A 4B6EA 2P9QA 1N0UA 1Q22A 3FCCA 4RIGA 3TPFA 4ITVA 2GUWA 2QP9X 4WCFA 1FS6A 4EENA 3GEGA 3DMFA 1AMOA 3I0ZA 4XJSA 4CN8A 3COVA 3WGMA 3N9IA 3K8YA 4RQUA 3TG8A 4X3CA 5FL7A 1DQZA 2ODEA 1ST2A 2EFDB 2XDWA 4ZDKA 2WIAA 4QBHA 3FLEA 1GG9A 1MQ9A 2R9VA 5EESA 1XXHE 3PUXA 2TSYB 1H0RA 4WQMA 1E20A 2BKVA 1TZJA 4KMRA 1GTRA 2VOJA 3T12A 2Z4SA 4V02A 2OV8A 2WMOB 2C0QA 3H86A 3Q12A 2G8LA 3JWHA 4JB8A 3MYYA 4R0NA 5BSEA 3NBYC 5CB4A 1V6CA 4MKFA 4ZOCA 2G17A 5DISB 1WOYA 2G83A 2BFMA 2EATA 1B6SA 1AQ6A 3A27A 3O03A 5B3KA 4P4GA 3GYGA 2ZJBA 4EEKA 2ACVA 4MOWA 4YR7A 3F8WA 3FPEA 3TTYA 1CIVA 4I4TF 2YIJA 3R5JA 5CDUA 5IMSA 5DEIA 4RHEA 3AKYA 3DJFA 3DZBA 3MAAC 4HWGA 3ZQUA 4IJVA 4XWOA 3EGOA 3BA6A 3M6AA 2Q99A 1BCRA 1XD8A 2PUGA 4E5NA 3A9VA 4AUEA 2PWYA 4BRUA 1B4DA 1XMVA 2YYZA 3GMSA 1NG1A 2FPMA 1IIBA 2PT5A 2NO4A 1IAVA 3QRWA 2QSUA 3UT0A 1AK2A 1ZA1A 2H4XA 3GLVA 1UBCA 2C4MA 3WGKA 1H93A 1SK8A 3IHTA 5FUXA 2ZU6A 4ZRMA 5E2AA 4CL3A 2G08A 5CFLA 4OREX 2IYRA 5F5LA 3JQ8A 4BFVA 3W7BA 4Q1CA 4FGZA 3HXLA 2O4UX 4EAAA 1JKFA 1L5HB 2YHAA 1MH9A 1JBQA 2PUAA 3KQTA 3KU4A 5KVSA 5I7VA 2BE9A 4P7BA 4RSRA 4DQKA 2GKOA 5A1TA 2AEJA 2C83A 3BC1A 2JLZA 2J59A 4OGWA 5FI1B 3OD1A 1ENYA 2YCBA 5EZSA 2VDPB 2DJIA 2ZYAA 3IKVA 3NDRA 3NNNA 4GUDA 3ICOA 1I2AA 2VDOB 4H35A 1H3FA 3V4FA 2VWQA 4BX0A 2GBPA 2O0JA 4QUDA 3OEED 4BFTA 2CT8A 1E2DA 3WNZA 5F1PA 4RQBA 5DNCA 1N5LA 3MB5A 3X1ZA 5C8VA 3WKEA 5JSHA 2VH5R 4WBSA 2WOJA 1O77A 2CLLB 3DDUA 4JVOA 5FPPA 5SY4A 2WSLA 1GU1A 5AVQA 4Q37A 3ETJA 4JI5B 1TC1A 4EY6A 3CINA 1SG9A 1LUAA 2Y4NA 1SN7A 1GN9A 2Y1DA 1NI5A 2QRJA 4OY3A 4IM7A 3PFBA 1T24A 3JAWA 3PC4A 3N6RA 5ECGC 3BFVA 1O94C 2PGJA 4MGZR 4YRFA 3E7WA 3RHFA 3WLQA 3ZU4A 5ITWA 1GSIA 1VG8A 3QU4A 1EUCA 2Y6UA 4H3VA 4C21A 1NVVR 3S2UA 3R75A 3H6GA 1GLVA 3VO8A 2OCPA 1DADA 3ICQB 4Y2HA 1HLFA 1K75A 1ZH6A 2PZGA 1H1DA 2WG2A 3AQIA 3B3QA 3ENWA 4LF6B 4UE2A 4TKVB 2G67A 4N0QA 5DBGA 1UP6A 2GCEA 4AMUA 4N39A 4RHUA 1KKLA 2GM4A 3FDZA 1ST3A 2Z5VA 4MICA 3ZCPA 2F6RA 3TBKA 3U6BA 4MPJA 3BPSA 2VZLA 4EBFA 1SD5A 2A94A 3JZDA 3A7EA 3MWYW 3OT1B 3VU8A 4IEFB 4AMBA 2UZ4A 2HRRA 2VP5A 1KJIA 5DHQA 1PS9A 1QQ6A 3GFGA 4W7IA 5IJAA 3F7OA 5HKOA 2RI6A 4D9HA 4AS3A 1B3BA 1JU4A 3Q88A 4C76A 1QIHA 1E2HA 1XCJA 3TW4A 4EHHA 3RNOA 1D8TA 3MQ2A 2V55B 5BR8B 2NG1A 4DXHA 4K9KA 4IDCA 3LF1A 1OBHA 2J0UB 5TNXA 2HMSA 2BM8A 2XSZD 2P6MA 2V5VA 2BKAA 1UKZA 2V4UA 2X4LA 3WJAA 3ZJYA 3UPTA 1JE0A 1JEJA 3G59A 5C46F 4EGAA 5CNIA 4TKZA 1I6MA 4R9UC 1VZ2A 1FDOA 1VFPA 1P7CA 2WJWA 4KTVE 3OSZA 3LECA 3MFQA 4MB2A 3RVDA 3KSAC 5TEWA 3T3NA 2V7UA 3HNPA 2Y2VA 1LFAA 2VLBA 3GELA 3KC2A 4K9MA 3TSWA 1ZU4A 1QHYA 2ZJ2A 3TW0A 5CDGA 4RL4A 1Z73A 1Q1EA 3RVPA 2Q2VA 1PR5A 4AJLA 4DLWA 4ZI7F 5K05A 4X7RA 1J9GA 4XD2A 1C81A 1A1SA 1L9XA 3WV4A 3H2HA 4GOOD 4TTTS 3ZV5A 4DAOA 4Y7CA 1I7QB 2IPNA 2OK8A 3K6RA 3P4YA 1SU6A 5E6UA 2YZ7A 5EJ6A 2FE4A 4M7RA 3TLKA 1G21A 4CIAA 2WKQA 3C97A 3WFZA 3PIRA 1A88A 2A0UA 1QK3A 4KAFA 1JV2B 1A98A 1FQOA 4UM5A 2P1RA 4JNCA 2H7YA 2XCQA 4KX5A 1DRUA 1PLKA 4OFWA 5HDBB 3ZCQA 1Y8ZA 1F06A 1MO4A 4UHKA 2PN1A 4X91A 1GL7A 1PAUA 4FU0A 3U2QA 3GLHA 4RF2A 5LZ4A 4GRIA 3LC0A 2FPSA 2FSSA 1UL1X 4M8LA 4PXYA 2AJDA 1G5PA 3Q5DA 4MB0A 4ZCTA 2OCAA 4IYRA 4QHYA 1Y6FA 4DL9A 5C1IA 1R5OA 1QO7A 2GHIA 5H68A 4KR9A 2PDAA 1G5RA 3HG7A 1OGIA 3SYLA 5JXIA 1WDLA 1E6UA 3GBPA 1PGQA 721PA 3EQZA 4YLGA 4BLWA 3AUJB 1ZMBA 3BD9A 4C2TA 2VZ0A 1J25A 1T4MA 5HILA 3S2GA 4EW3A 4N8SA 1SHKA 2BFOA 4KBGA 3TOZA 1U99A 4YUVA 5ES4B 1NUHA 4DR2B 1EBFA 3BFXA 3IUSA 1NTOA 4YT2A 1EQAA 1KU6A 3T1OA 1H0KA 2LIVA 2YN2A 3GD5A 3T4UA 1ND6A 1RIIA 3MCAA 3SF8B 3E5NA 3O3OB 5D00A 2WP0A 4L16A 3RYTC 2O8BA 4BNNA 4ZYTA 1YR9A 2C1ZA 5FOQA 1R9NA 4MWCA 3CEMA 3JAKA 5K2MA 4BLTA 2WTEA 4HVTA 4OQMA 5SV2A 4MHTA 2ZRIA 3KZNA 5ALXA 1Z0UA 3O8OA 1FFXA 1G8HA 1FQKA 1XQWA 2I0FA 4B2YA 5BN3B 1K6IA 2R6AA 4JLJA 5JS2A 4F5ZA 4GKJB 1P62B 3R3ZA 4LQ4A 5F23A 2RH5A 2WMDA 2XMPA 3BQ9A 1Z26A 2YJ5A 4PFQA 1U4NA 4GL4A 1QG6A 1KAOA 1OLSA 2WI8A 4L9RA 4MUHA 1O95A 3S2ZA 3U1VA 1Z4IA 1NJ5A 1XQXA 4CM3A 4F5DA 3D64A 5IC5A 2PLFA 2X3YA 3FSJX 2EWMA 1IYZA 4GPEA 4ERNA 4S24A 1F8XA 3WWEA 1PSWA 1Q0PA 5DGIA 4B8WA 5LZ8A 3LUBA 4BYMA 4G4GA 5FTJA 3EPKA 2HH9A 1R9GA 4U7TB 1TM2A 3DW1X 5EP4A 4E7OA 3TIVA 5CNMA 1NR1A 2D4AA 1K7YA 5A4DA 4BE7B 3USES 1CUGA 1H65A 5JQGA 1ID1A 4I66A 3H2BA 4BQIA 1IPHA 4FGWA 3AMVA 3KVVA 4C06A 2WD8A 3BTUA 3GA7A 5JHGB 1Z5OA 4MV3A 3W5JA 3VI4B 4IOKA 1G4AE 2AG8A 3DAPA 4UDXX 4HJXA 1ODCA 3UHJA 2X0RA 3QU2A 4X1IA 4D4LA 1NXVA 4D57A 1RM4A 4ARUA 3HXMA 2X5XA 2HMVA 3UOAB 1WP4A 5AKZA 5TLSA 3PT9A 1O5OA 4F71A 4V38A 2X8AA 5L3SB 4M0MA 1Q20A 2XE6A 5DGCA 5KPJA 2V3CC 3IV7A 1Q0QA 2FUNB 3VNQA 2YTZA 1E0SA 3EZYA 4C14A 2RARA 3QU9A 3B3FA 2IEBA 5CP8A 3A9TA 1Y6GA 3N0WA 4PE5B 4ZZ1A 4RTKA 3KQVA 2Z8XA 4IDNA 1JG1A 3R5SA 4OP3A 3FOFC 2GUGA 2PUBA 4D25A 1X1AA 1QAMA 1QK5A 2ORYA 1XCPA 2QRGA 3AR2A 3C3DA 3LTEA 5AOVA 1F5SA 3CHYA 1W5FA 4JHXA 3ZI4A 1ACJA 1KDTA 4RMJA 4L4RA 1NMZA 4QAQA 2O05A 3CO0S 3GT0A 3TRHA 3K9FC 4LNHA 1KSGA 2G06A 1HFKA 4FFWA 3ZTTA 5KYTA 1G63A 2C94A 3R9KA 1UPFA 2DWPA 1MAVA 1UR5A 2XBUA 1FSPA 1W6UA 4G4SP 3DD5A 3DXYA 4Z4IA 1FMFA 1XWIA 1N8NA 1W4RA 1LC0A 2WF9A 3ODGA 2ZBRA 1L3BA 4RPHA 2YV4A 4IW3B 1KGDA 4X45A 1QANA 4GE0A 2QZPA 3DLCA 1NONA 3TPCA 2BEUB 2FK8A 3MTGA 3I9V1 4DNPA 4UM9B 5FLXA 5IM4F 1M7BA 1AVTA 3R41A 3DVAB 4GP9A 1QP0A 1HR0B 1H2RS 1WOMA 3BWXA 1EESA 2XKBA 2YY5A 2JLAA 3CH4B 1KI4A 4QQKA 4NR0A 1QUEA 4TT8A 5COQA 5LZ9A 1GPH1 1W0KD 1C9MA 4EKIA 2ZXUA 3A3NA 2ZRLA 1EAMA 2P1DA 2HA7A 3DT8A 2Q3DA 1X39A 1V11B 3VSAA 1T8PA 3EVNA 5CIYA 4BGVA 4CKYA 1ZI6A 4LYDA 5AXAA 3GCGA 5J1TB 1UDCA 2YZ2A 3BB1A 3G8DA 4G2NA 4S1OA 1XO1A 3RU3A 4ISBA 3EX7C 1JBEA 4TTSA 1NX9A 3ABIA 3R1IA 3D4PA 3F49S 5HIMA 4PC2A 1XAGA 3NNSA 1JNXX 3QJ5A 4HDCA 2WD7B 4P4SB 2IQ5A 3PPYA 3PUZA 4UNNA 221PA 1SJ9A 1LDEA 1RW4A 4U7HA 1T2CA 2NO1A 3T7EA 3LE8A 4LF5B 4CUZA 1NF9A 1MO5A 4L73A 1HDYA 2Y1GA 2H4HA 5IBCA 3IIKA 1RE0A 4MVJD 5CLQA 5AFSA 4BNKA 5HE9A 1FTYA 2HIGA 4ZHQB 3UJ9A 5FWNA 2WVHA 1A9YA 1UMCA 3Q7TA 2C9MA 1BX1A 1YZVA 2IOYA 2YHBA 3D6AA 4XQ0A 1IOVA 1UOOA 2R6FA 1P61B 1KDOA 4YXWD 3FY4A 3B38A 3DNFA 1PG5A 1R00A 3NAGA 2I7VA 3K2QA 3GJ0A 1QWSA 4PCVA 1JUDA 2N42A 1YFZA 4LJSA 4GOLD 2JASA 5AK6A 5EIEA 4N5DA 2F1KA 1GNVA 3OFSA 3UATA 4D9KA 4E5SA 1EFPB 2O8FA 3AY6A 4GP7A 5KJFA 5JVDA 5DLEA 4IEIA 5C5DA 2BKXA 3VU0A 2IYUA 1X8LA 1OXKB 3RO7A 3UCXA 5GPBA 2R87A 4NS1A 3KL2A 3VU9B 1OV6A 2C9OA 3QMWA 1OZHA 3IPRA 5JATA 3K1AA 1WHSA 3ZE7A 3EVGA 4HB0A 4QT0A 1ZD3A 4JASB 2FEKA 4YQYA 2EVWX 4QRIA 3BILA 5ANRB 3BB4A 2RIRA 4L27A 1OVMA 3T34A 1PNRA 4B32A 2QG6A 3NDPA 4JJKA 1FFYA 4GR5A 4I1IA 5FFFA 1CEEA 1PZGA 1FY2A 4QASA 5IANA 3AFGA 2QLJA 2HKIA 1U0BB 5A5EA 1FRZA 1LPBB 3DULA 3F9IA 4U7PB 4HZUA 1R18A 2AH5A 4ACAA 2JFUA 4F4IA 3HI6A 1UZUA 1S9HA 4OQZA 1I80A 3AP2A 2JD1A 2HBZA 2QTLA 3CF0A 1ZW6A 5A4IS 3MRTA 1XZAA 3QVOA 3HU3A 3M6FA 5K51A 2WPDA 3NHAA 2I76A 2WWHA 1M2HA 3H19A 3E82A 5AXBA 3ADOA 4HPWA 5B1SA 3AQ4A 4RFLA 3H1GA 1CG6A 5FUYA 2EV9A 4O4IF 1LRLA 3K7EA 5C4GB 4RGVA 3H87A 1JE1A 5DLYA 1W9HA 2B0JA 1UK9A 4LDAA 4RA6A 4NTZA 1AKMA 3WLAA 4NZNA 2XJ9A 1T2EA 3SM9A 3G8AA 3E9RA 1NUTA 4NS4A 1SD2A 1VE5A 1N6KA 4CM6A 2R751 1NBEA 5JCPA 1PUJA 4P7GA 1FU4A 1T91A 1G4HA 4BUJA 16PKA 3AINA 2A7QA 2DQZA 4ZT7A 3B6IA 1E59A 1SAYA 4IFTA 4NJOA 2HMWA 4UTRA 2AJBA 1E32A 3V8RA 3QENA 3ZV4A 2HPHA 1ZICA 3D5QA 3PUWA 5BT8A 3RTAA 2YN0A 2UXCB 4NENB 5DEOA 2YNMA 2ZPUA 5WRFA 1YZUA 1X13A 2ONCA 3F4KA 1W44A 2GO7A 3DA8A 4KQGA 1ZD5A 3X1MA 4FCCA 3SNKA 1JQDA 1PR6A 2UZIR 3L0BA 2VHWA 1JFTA 5CK5A 4Q4DA 4W9NA 5EJGA 3OCUA 1E8DA 3AV0B 1O0CA 4YS6A 1Z13A 1KQNA 3M49A 2XUKA 3V5NA 4BJ6A 3A05A 1E62A 4Y2JA 3OP4A 3GUYA 4PZLA 4CDMA 5LYJF 3BGIA 1GG8A 5BV2P 2QD5A 4KXWA 2I87A 2F62A 3D8RA 1BDMA 2D2IA 2F67A 1SGWA 3EGCA 1WXFA 5BXYA 3JQBC 4GD3Q 3K94A 3MRVA 5CDFE 4AICA 2PKWA 2X41A 2DPLA 4GXTA 3JPWA 4NNPA 4BMCA 2V7GA 3HRKA 2FMKA 3QXHA 1GU0A 4Z0PA 2H57A 3CVWA 4DRZA 2WB2A 4ARCA 1DAIA 3T9CA 1L7DA 4DOMA 1ESCA 2RK3A 5COBA 4AZ3B 1SZDA 1MB9A 4PWYA 4C7MA 4BP9A 2F8SA 4AG5A 1LDMA 2BVNA 2H51A 4DDKA 4DDTA 3OWXA 3C3AA 1PS0A 2VNHA 5JT1A 3IDAA 3T3EA 5IVDA 4JD5A 3ED1A 1ULSA 2HNKA 1R5NA 4FJ2A 2R4UA 1ZW1A 2HJHA 1DEKA 2GRAA 3KYDB 1XTBA 1KHHA 4N3BA 4ZCQA 1MG5A 4YCBA 4LVNA 4WKGA 1QFMA 2QTCA 3B7WA 2BN4A 3GQBA 4CFYA 5TS2A 2FN4A 5EIXA 3E2PA 5KNDH 3DBRB 1WG8A 4IXMA 3RTCA 1Y6QA 5FPKA 4A26A 3I45A 3V9AA 2P9FA 2B4RO 4FDUA 4KQ1A 3N1UA 2QL5A 3Q3VA 4O4JA 1W5SA 2C4HA 3OJEA 1G4UR 1PFYA 2C2YA 2JVIA 3DBLB 3P9NA 2P0AA 4MQFA 4AMYA 3AUAA 1WZCA 5E2IA 3WS7A 2QTHA 3BXOA 3FPGA 2O06A 1MB0A 1HTBA 1YHNA 3WBKA 1MDFA 2P4UA 1CQWA 2XRYA 3R5TA 3R7WA 3SDSA 4C0JA 5FV4A 1LLUA 3NKFA 2J9FB 1P0CA 2HDHA 4QGAA 4U8GA 1HL7A 1WUIS 2C4WA 2WTXA 2YRXA 3E53A 5EHQA 5G4LA 5KTOA 3LI2A 5G0TA 5T7BA 3GLIA 2IIPA 2FCRA 1H1LB 1ZK4A 3VH3A 4BIIA 2V7VA 3WXMA 1J20A 2V9CA 1IN4A 4Y6RA 3LKVA 1M3SA 3DE0X 1P9LA 2IIVA 4GLJA 2PY6A 4JBHA 4XJVA 1GL3A 4AAYA 2ZP1A 3VBCA 1GAQA 4ZODA 1GKYA 2FE1A 3B2QA 2J6BA 4ZYLA 4ZGBA 3U6KA 3ZDRA 1PNOA 4PS1A 1T4BA 3ZBUA 4JIMA 1T5SA 3ROZA 1A8IA 2VJAA 3ZEAA 1TA9A 5ICMA 1ORDA 2H4ZA 3P0FA 1CY0A 3P27A 4B43A 4J3NA 2C3UA 2VDVE 4ZXFA 4FMDB 2UZ0A 1U3TA 1CJVC 1PZHA 4DDHA 1PR2A 2ZPTX 3GN2A 1L7VC 3BTOA 4ND6A 3USCS 4WZAA 4WHMA 2UYQA 4LEIA 4EFLA 5JS6A 3Q3EA 2B8TA 5ERGB 4CETA 5JTUA 3E27A 4HRXA 1RI2A 1I4TD 4CZ2A 3DFIA 1OILA 1UC4B 4I8IA 4FINA 2CLFB 3JD0A 1GNQA 1TZKA 2D7CA 4FGUA 4G5HA 1Q7GA 2DTDA 4MVWA 4Q39A 4WCVA 3W7VA 4ADSG 1UM9B 2JIOA 3C15C 2DP4E 1OFUX 4KEAA 3TUIC 2H5IA 4DCTA 4QM7A 3ADCA 2W2PA 3P0RA 1NNEA 4RD3A 1B8OA 1EZ4A 2HM7A 5IAKA 3NEPX 3OIVA 3R2JA 2X0JA 3HJCA 1LPOA 4RM3A 5J43A 1Q74A 2XH8A 4YWJA 1WCWA 1QTQA 3OX2A 1T2UA 1X0XA 1ZPDA 3NRJA 3Q9SA 4J0DA 5K3EA 2REXB 3B1FA 1E2MA 1MZVA 3ES9A 1SH7A 3I1FA 2M1XA 1X7ZB 3PLRA 4MS3B 1UDWA 3HBMA 4UNRA 2W6OA 1L7AA 4MZDA 3RDPA 2WF6A 3OE7D 3K72B 3Q2KA 1AO0A 4DR3B 1VRCA 5LD2C 4AN1A 2V9ZA 5HZKA 3PZBA 3PIIA 2IDKA 5DGXA 1L4LA 1JR4A 1RT9A 3T3DA 2G9RA 1RM3A 1VKJA 1ZM4A 3G1TA 4KWHA 1RMTA 3DZJA 3SZGA 3K73O 3WDSA 2V9PA 1I32A 5LP6A 5HF5A 1KVRA 1SU8A 4EG1A 3UMVA 4ND3A 4AMVA 3AP1A 3K3PA 3ZLVA 3ZYZA 3KLMX 4TMVA 3LT0A 3IVRA 4Z9BA 1YVDA 2QTNA 3RUCA 3T5CA 1JEEA 3EVTA 2F8LA 3VPSA 3DMRA 4FFMA 4Q3LA 4JQOA 1VE9A 1X15A 4UBIA 2D1QA 2L69A 1PP4A 2BDEA 3LGXA 4MS4A 3UFXB 5CA1F 1J2RA 1YJCA 1P19A 1W76A 3ONVA 4QJ4A 4TXJA 2XOXA 5ALQA 4KOEC 5CLHA 4DEYA 4ZI5A 3IBSA 2O5VA 4JLKA 5I47A 3C45A 3B7GA 5KNCH 2AEMA 2CFCA 1VC2A 4O4HB 3PK0A 4O3FA 1S2DA 4U7GA 3A9UA 4RTJA 1NUQA 2CC2A 5HUHA 3SQXA 2CV2A 3MG9A 5SYNA 4XCXA 2HRQA 4DA9A 2EG5A 1W48A 1I4DD 1DCFA 2BCGY 1JLHA 1XDZA 4GH5A 1KQ3A 4N3CA 3DDCA 2V5UA 4B4UA 1FFCA 3NH9A 1NVKA 1SC3A 3WZ2A 3TCNA 3MLBA 3OPVA 1QONA 2BFDB 3N70A 3D8BA 5DI3B 4EG4A 4C0KA 1WB4A 1M8PA 4AJ4A 5KDDA 1UKBA 3DCJA 1FMLA 3SX4A 2R2AA 2AZ4A 3IH5A 5JU6A 1US8A 1HM5A 3AR9A 5IZ4A 3OLCX 1JDNA 3LLVA 1ONOA 4XQ9A 2FWRA 1L5SA 2Q0QA 3WIOA 1MO2A 3I76A 1J06A 3MA0A 1FL9A 3AESB 1AQYA 4XOIA 1Z0SA 1II8B 2PEYA 3OVMA 4M98A 3P0EA 2Q5HA 5DBEX 1BMDA 2ZS8A 3T95A 4C08A 4E1BA 1Q12A 1OGJA 1T5BA 2HGZA 3IQHX 3OZUA 4JH0A 4ZO4A 3GUZA 3WJ2A 1YB1A 5FWYB 4L4YA 4OA5A 4TWIA 1E9VA 3M1IA 1UMDA 1SOWA 4RULA 5CGQB 5CNKA 1I94B 1ARZA 1AZSC 2O14A 4PG5A 2AX3A 3NGXA 4YRRA 2J3LA 1TB4A 2XMBA 3ETHA 2HN9A 1A8HA 4WX2B 1Q11A 2VH2A 3HCRA 5D6OA 4DSTA 1R50A 3EWAA 4E1VA 1D1SA 3A6FA 3NM4A 1TLLA 1YOVA 1P4SA 2VAVA 1PNTA 3CGGA 2VQ3A 2IS2A 3CWQA 4BFWA 1QM5A 2WABA 4DV0B 4R4JA 4DQ0A 2BR5A 2XUHA 3P19A 3HKDA 4QQFA 4WJLA 3COWA 4K0KB 4BBJA 3B89A 3OFKA 2XIQA 3S3TA 4BDSA 1YC5A 2P9JA 3AF2A 1ZP6A 4ALLA 5AOAA 5E7MA 3D2BA 2EKZA 5J2UB 2D3TA 2N1MA 1J0AA 3PCTA 4ZAYA 2NUTA 4C05A 4G9EA 3I0MA 4W7SA 3KPJA 4NV0A 3M4YA 1DT3A 1WM1A 4L78A 3A11A 1O97C 3AONB 4BNVA 4LQLA 2P9CA 1FC0A 1CF9A 1DMSA 3ILXA 3P2JA 4RCZA 5CW1A 3AO0B 3HNRA 3M4JA 5DM60 3ZDEA 2FZLA 5GQSA 5KVVA 1U28C 2J9RA 4LYAA 2GBLA 2EBHX 2JDID 2FEAA 3ED5A 3GJYA 4GLBA 4LY3A 4XWAA 3TWOA 2AHRA 5CBPA 3JQFA 3LPNA 1JKJB 1G64A 1E9DA 5DFAA 1DCKA 2N47A 3RIMA 1E7YA 4FQ5A 3EAFA 4JVMA 5FHQA 2ZPAA 3CH5A 3EPJA 3C1TA 1JDJA 2CFTA 3VHLB 3OX3A 2PQ2A 5AVRA 4BKOA 2OECA 1T8RA 5LXTF 3DS8A 4ND4A 5EQFA 4E5YA 3GZTB 5KYYA 2GD0A 1LRJA 2W83A 4AP5A 5HS4A 3LCUA 3N2ZB 3IXLA 3RT7A 1O6GA 3PC8A 4UXHA 5I51A 3H1TA 1OFIA 3AF0A 3GFQA 3WOHA 2KWIA 4XRGA 5B12A 5BNWA 4AY2A 3KQQA 1F51E 4CM4A 2H0RA 2WHYA 1KBZA 4J49A 4ROSA 3HHEA 3UN1A 3HK2A 5DZSA 1QCYA 3ZGYA 1JQAA 3F8SA 3ZY3A 3Q2OA 4LRQA 3PBKA 2EQAA 4QXPA 4LZLA 3B2EA 1E92A 2DPMA 4IHAA 2I22A 4G2TA 2PWPA 1GNLA 1Z82A 2GVDC 2P9GA 1UZNA 1WW3A 3DAGA 3GJ3A 3MF4A 3G0GA 4QGHA 2OXEA 4Q9DA 4Q3KA 5D2CA 5EXSA 2DFVA 3G2OA 5U4XA 5FUVA 2CLMB 4B48A 5BWBA 1CB7A 4CU5A 2H5EA 1Y5IA 1SXGA 1SXJD 2BZ1A 2ZT8A 4I4TA 4IDHA 5BSTA 4BO6A 1PGNA 3C1AA 3ASVA 4P3KA 3HBNA 4TLCA 2V7XA 3SZUA 1RC0A 4J9VA 4UJ3A 1ZUNA 4BY9E 3ZDBA 2B83A 5FUWA 2RAFA 5JALA 4UASA 4RXUA 3BT7A 4FBMA 2R5NA 2HYIC 1WS6A 1RIFA 3MXTA 1XCOA 3K4PA 1Q6YA 3H99A 3GNQA 3N28A 4HY3A 4N40A 3Q9NA 2OL4A 4URHA 3C3BA 4WMLA 2G6TA 4OBWA 1TUGA 5C3UA 3U1BA 2F4VB 1C9EA 2VRNA 1PQYA 2NVUA 2XUGA 4OHRA 1AXGA 2EKBA 1CY8A 5B3AA 4FNMA 1CDZA 3BHIA 3SC3A 6NULA 1W2HA 4P7JA 2R8PA 2X0IA 2OORA 3QVKA 4FYJA 3EYWA 1X9IA 1HDEA 3RW9A 1BWRA 2OTCA 3D3EA 3IX7A 2CMHA 4UHEA 5DWQA 5JZBA 5FA8A 2IIBA 1XL0A 2XXJA 1JH8A 4TYMA 2HWWA 2YUTA 1JB9A 4IJMA 3D1JA 2DOKA 4JUAA 4BNDB 5HRAA 5L40A 2B8NA 2QUZA 4K6MA 2F00A 5MFZA 5K2OA 2UUBB 3UHOA 1BRMA 5EXPA 4KQHA 5FI5A 1P1KA 2ENWA 4MVJP 4KBYA 2R8BA 3NAQA 4S12A 2JA1A 1M0WA 1BXGA 2G0AA 1BQEA 1D5WA 1CQZA 1XRPA 3OPMA 2HD4A 2FG5A 4R2XA 4YP5A 4AZ0B 2GAAA 2GF9A 1O89A 2PUVA 2NO6A 2XQKA 4UATA 1JR3D 3VR3D 1Y5RA 1Z6PA 2XTAA 3MHTA 1XR3A 1CEQA 1QK4A 4HN9A 1GUYA 2VAPA 2OCLA 3A2MA 3G49A 4CLOA 4BQRA 1B43A 1A82A 1UBGA 2LUOA 5K0JA 2VYVA 3V6LA 4HXEB 1U63A 2E6KA 2RK4A 1P5FA 1OWOA 2BV3A 1D09A 2BRUC 3G79A 3PQ3A 4G8CA 1DRWA 4O8CA 3ECCA 4JC0A 5EVJA 2HOQA 3FI0A 3ETEA 3QXXA 4ITUA 4L95C 2HZ7A 3NV7A 3HGQA 4UM7A 3VVCA 1P9NA 5HTKA 4L50A 3JXEA 4K3UA 2UVPA 5REQB 4EABA 4ZJYA 2JB9A 5KKNB 5A3VA 1P7YA 2GZDA 2LDBA 3V2UA 3WLTA 3NKVA 4MR7A 4BHTA 6ADHA 3OQBA 4OP1A 1BAPA 5TARA 3R3XA 3Q11A 2PCJA 3R7FA 5JY6A 1PD0A 3MCWA 1TJ5A 4J7CA 3T15A 4PYQA 4JXJA 1FNBA 4EF4A 3C7AA 3OF5A 1X1EA 2JLYA 4NZ9A 4EKGA 2DSTA 3CW9A 5AJXA 5CA0B 3LY9A 5C31A 3LUJA 3AEZA 1W46A 3I32A 4KSCA 3SMQA 3VH4A 2Q6VA 4PXSA 2OMEA 2OQ2A 3NWEA 1MCZA 3FZGA 2TMYA 1I6WA 5TJ9A 3EVCA 3HVIA 1D4FA 3R9XA 4JYMA 5CX1A 4AC9A 3ADKA 4TYPA 4HGYA 1PL0A 2OFFA 1DG1G 3RHSA 4A82A 3QLVC 4M9SA 3IJEB 4B2PA 2ID7A 1JPJA 3QFSA 2F2TA 1F0YA 1IY1A 4XX0B 3LCJA 4EFMA 4PCAA 4LGVA 4R8KA 2MCFA 3M1AA 3KXLA 4E3WA 3PFIA 4GICA 4FYKA 5D87A 3K32A 1C3JA 4B6PA 4BLRA 1MPTA 2PSFA 1JSXA 2PTGA 4YACA 1PJCA 3K31A 3F5FA 5SZJA 3NRCA 5L4NA 5JD5A 2GYUA 1YI1A 1VLVA 5EGSA 3AOGA 3N75A 3ZN2A 4OI0A 2IYSA 1Y98A 1E4EA 1PSZA 3CTMA 3OQVA 5DHPA 1XEXB 5EJ9A 4PS0A 4JWTA 5HIIA 2R44A 2XF8A 3TLMA 1SD1A 1W5BA 3V7NA 3KB6A 4EMSA 4ZI7A 5ESWA 4F4UA 5K6RA 4GWGA 4E03A 1EWVA 1RKQA 2JRCA 3F6CA 4NPAA 5B5SA 2Q5QA 4Q7KA 3AEUB 3WNCA 1KYTA 4ALKA 2GJ4A 4LV8B 4UBOA 2I2BA 1Y5MA 2X7JA 1M2VA 4M1TA 4URXR 3THWB 2CB9A 3BF7A 1CYDA 1V7CA 2G07A 1JWBB 2PX2A 3ICVA 3OZ7A 4CM8B 4DG8A 4R8VA 2CEKA 3A6DA 3SPXA 1MV5A 4B4WA 3HO6A 1U81A 4C3ZA 4YJGB 4HS4A 4EW2A 3V1LA 621PA 1B1CA 1VIVA 4V03A 3HP7A 3NPAA 3RE1A 3UJPA 5JC8A 1BD3A 1X7XA 4JLVA 3ZBQA 1CW2B 2BHTA 3NPMA 3WYBA 4BGIA 4PFSA 4NCIA 4KXQA 2H1WA 3OBBA 4IOJA 3R5HA 5AI9A 5TIIA 3OP1A 3IUBA 2ZYRA 1RKUA 2JJ1A 2PGNA 3G9UA 4I50B 2B4KA 4ED9A 2GEVA 2BDUA 1IZ7A 5DHAA 4ARZA 2ZOSA 4NOKA 2CFIA 1KVUA 3RWMB 2IYPA 2Y27A 4DGSA 3PS9A 5TVKA 1XPRA 2V7QA 1RS0A 1ZUIA 2A1UA 1A8PA 3L4JA 4LHYA 2Y71A 3PX7A 1DHRA 1KU0A 4TUYA 1E4YA 2GASA 2I6SA 3LKZA 5DCYA 1PK7A 2JS7A 3FFTA 4GO1A 3SD7A 3FNHA 1U5BA 3WRXC 1XFAA 3C41J 1FFEA 2C3YA 1NHWA 1FW8A 1N2CA 3D3NA 5KHLB 3W6PA 4JELA 2VQFB 4FVTA 4O2BF 2ZYGA 4KSBA 1JT9A 2W7TA 3HCNA 1F4PA 4JT9A 4IIBA 4K9NA 2IV7A 4B3HA 4DWOA 2OZLA 3RS4A 5L3QB 1NJSA 1ZNQO 1TAQA 2O0HA 1PLJA 4MWGA 4UD2A 3I01M 3P7MA 3VSBA 4TMWA 3SEAA 4F11A 2X2OA 3DO5A 4FUTA 1XEAA 2GWRA 2D1RA 1MRNA 2PUTA 2HFJA 2ZRDA 3WYNA 3W8DA 5LDDC 3GJ5A 3GZ4A 3MWDA 5TJHA 4XB6B 3JWEA 3R3UA 1UPTA 3IQXA 4GOJA 4HXFB 1TKCA 2VWHA 5EWLA 2WSSD 2Y1WA 1QMPA 3AIMA 2GPYA 2RJ3A 2W6NA 3TQOA 2ZULA 2QZ4A 3H5WA 3QE3A 4HH0A 4RK1A 4YCDA 3TJZA 4OJTA 1RMQA 3A3KA 3BD7A 2YV2A 3IAUA 4XWTA 1OLXB 2Q6LA 3EJ6A 1YVEI 3I9NA 4CMKA 5I7FA 1F0NA 4JI4B 3KOXA 2PZAA 3G5AA 1LDYA 5HWSA 3L06A 1ZUD1 4A27A 4CMBA 4LJ5A 5TB5A 1R5BA 4ENWA 1F9EA 4QYTA 1RR6A 3UJBA 3GJTA 3S4YA 2OSVA 4X60A 3WLHA 3U4MA 3KLBA 2AB0A 4DCCA 3QEAZ 2UYYA 1QCZA 4XTCS 2JLQA 4NZPA 4U02A 3I0NA 3WWPA 3M3DA 3AR6A 3PHIA 4FFBA 1A7JA 2D1YA 4WVFA 2IPMA 3IAS6 1KSFX 2IY8A 3E8MA 3L82B 4DV7B 4B4VA 4KLNA 1HBJA 3MMPA 3ORSA 3HCFA 1CETA 3QELA 2RGWA 3I5MA 2JAHA 2W0MA 5AIAA 1JHUA 4FYWA 3HZHA 2WTAA 4BVLA 4OCZA 5FBQB 1BDIA 1OR8A 1WUHS 4MS1B 1I2MA 4RK0A 4D4HA 3MOGA 4MRAA 3IESA 4C4ZA 5JYBA 5AW8A 2HSZA 5MFPA 1V1MB 1YULA 2Z3VA 4TSFA 1BJKA 4PXAA 5F4BA 5ABPA 2B7BA 3D6VA 4MYRA 1LZLA 2PRKA 5DN9A 3CF6R 2FEOA 1GAWA 4JB3A 4LJYA 3WK5A 3LPCA 5M7EA 2F48A 1S3GA 4HLUC 2C96A 2JKYA 3RANA 1OXSC 3CUTA 2EF1A 2GD1O 1D2RA 5KX5F 4TYYA 4EB0A 4AJNA 4HBZA 3ETCA 3H65A 4RBNA 1N77A 5MN6A 1XCGB 3BWEA 1XTKA 1CUJA 2BFCA 1N6RA 4P82A 4R2LA 3IGFA 3EIXA 4NBUA 4E14A 4E12A 4IIUA 4Q03A 3GEEA 1K5DA 2FLWA 2BYTA 2WSMA 3U19A 2IF0A 2J5KA 2BC9A 4KDFA 3IERA 1USGA 2AFRA 3D0OA 5TT0A 3ISVA 1YDHA 3SM3A 2QVLA 4I3FA 5LCXA 2WU1A 2PT9A 2N0SA 2PVPA 4ZO6A 5KQLA 2PKXA 2OZPA 1OW3B 2FPLA 4B6JA 3EIUA 1VCHA 1S2GA 4EKDA 3G23A 3WBFA 2JEYA 3KUCA 2GLUA 2OLEA 5IM4A 2OKCA 2BKLA 2H3EA 4LF7B 1PL6A 4E0BA 1V8FA 1RQRA 1Z2DA 1FUUA 3ROXA 2ON6A 1ZUHA 3TMKA 2PZFA 3F2IA 4NBTA 4L5BA 5FEUA 3K71B 1I3CA 1S7CA 1R0BA 3M6XA 1N5KA 4L57A 1LWNA 5IAJA 3CLRC 3BJMA 1CERA 4PHTA 4BAUA 2XY4A 1K8RA 1U5CA 4Z53A 1VRVA 1H2AS 1V5WA 3I42A 3K0AA 1N33B 3AVPA 2FYTA 2WJZB 1UQTA 3T5DA 4ZOLB 3TVYA 2BGGA 5DCWA 1FUYB 4J0CA 5BV1A 2EAUA 1A7UA 3TO5A 1PCXA 4TTJA 2O52A 1D7AA 2VJKA 2JIPA 3TDNA 4O59O 2Q8PA 1CF4A 2PS1A 5HX7A 1N0VC 3E22A 3OO0A 1TX4B 3D02A 4L5AA 3A7DA 2FSVC 2K7ZA 2XNCA 5AHWA 1KYQA 2FWNA 3JYOA 2AD5A 3JQ6A 3FMGA 4TWBA 4MI6A 2VWPA 3SZ3A 3ZGLA 5KOJB 4OO3A 3GGDA 3WA7A 3T6KA 4QATA 3LBIA 4BZZA 2VQDA 3KSBC 1GQYA 1U0NA 2DFTA 2IW1A 2KHZA 4R16A 3UYKA 3WL5A 1G5FA 1R37A 3C3MA 4ZT2A 5DYYA 4E6PA 5DPMA 1JDVA 4E5PA 1DXYA 4RVGA 1T4CB 1DRJA 4FWBA 5C2JB 5JNWA 1G59A 5CDSA 3ELBA 1RYYA 3OY7A 4DTIA 2DBYA 1M34B 2VUHB 2VPYA 3PXDA 4JJFA 4N54A 3TZ6A 3VHRA 3GRCA 2KBEA 1U0SY 1V25A 4XDYA 2DTXA 3MWEA 2Z1DA 4S1TA 1DEXA 2V6MA 3VR6H 3WLKX 4LGCA 3FMIA 4BVAA 1QG0A 3DONA 2I4MA 3GOQA 1E3WA 2BFFB 4X24A 2PAAA 4EHBA 4KIJA 4A2CA 3PGLA 4DV1B 2GGSA 4M46A 4DWWA 2A0WA 4GYKA 3OFVA 1NNLA 5CITA 2X0FA 3QEMA 3P2IA 1QKJA 3LKDA 4CMGA 3ZVMA 1TOAA 1U3GA 4W1QA 1M1YB 3V1NA 1TADA 1C80A 4R2JA 1FJXA 2ZBQA 4NCNA 3PLNA 2XBMA 1E0KA 2IUFA 1NFQA 4UCWA 1YR1A 1SCDA 4HAOA 5EKDA 3S99A 5FFNA 4GE3A 3TR5A 3UJAA 3ULKA 2D0DA 3MD0A 4RGBA 3TBHA 2GT1A 2GM5A 1NZFA 3NWPA 4ZVLA 4RCVA 3DL7A 1DNPA 1XMIA 2Z9DA 4NPHA 5CVUA 5KYWA 1KWKA 3ZCXA 1QFJA 4MI1A 3WSWA 4YPOA 1HE3A 1KZ4A 3BGDA 3B1ZA 1N3BA 1RHQA 4RENA 3FPFA 4E70A 4PHFA 3MIZA 3WO0A 3AFIA 5EUCA 4NE9A 2W93A 5FOWA 5KWJA 1SCIA 3HBLA 1NVFA 3L6DA 1T29A 3C7TA 4Q82A 1VJRA 2O7NA 1FDTA 1M2GA 5FD8A 3PJFA 4FHZA 5AHKA 4CM1A 3COSA 1J8QA 1C3VA 3L0ZA 5EY5B 1TRHA 1NYRA 4HDRA 2V74B 4WEQA 5L3RA 1DO2A 3LG2A 4ZU3A 3UICA 1W0CA 3EDMA 3DL4A 1AV6A 3IBFA 2XB4A 4UHDA 4ATNA 4DMMA 4EL5A 3S81A 3QE2A 4MUAA 3A58B 1EP1B 3O90A 1PWZA 1NY5A 3FVTA 3G5MA 3R4VA 4MQMA 5JAZA 1XYYA 4KIWA 3U5ZB 2O8EB 2BFEB 4RXTA 1GA1A 5IK2A 2I6GA 1YMQA 3EVBA 4OQLA 4F3TA 1M1NB 2PIDA 1PFWA 2CUKA 2PX4A 2VSFA 1PT8A 2ZUFA 3KOOA 3TTWA 2AQ8A 1PGOA