1G2PA

Crystal structure of adenine phosphoribosyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
170
Chain Sequence
SYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYESDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE 1
publication title Structural analysis of adenine phosphoribosyltransferase from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 49
structure length 170
sequence length 174
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g2pA00
2FXVA 4LYYA 1W30A 1A98A 4S2UA 2JBHA 1A95A 1QK3A 2DY0A 4RAQA 1A96A 3M3HA 1XZ8A 3ACCA 1ECJA 3GEPA 4KN6A 1A97A 5JSQA 5EUCA 5KAMA 2E55A 4M0UA 1DBRA 1ZN7A 1I5EA 1ZN9A 1XTVA 1PZMA 1P4AA 1U9YA 2EHJA 4LZOA 2PS1A 4X45A 1DQPA 2YZKA 4Z1OA 1NONA 1Y0BA 4RHYA 4QYIB 2H07A 2P1ZA 1G9SA 1QK4A 4PAWA 1G2PA 3ACBA 3DMPA 2WNSA 1OPRA 1U9ZA 1JLRA 5K51A 3MJDA 4RAOA 1ZN8A 2H06A 4LYGA 1I0IA 4WN3A 4P84A 3KB8A 4P80A 1VSTA 4JLSA 4RADA 5HIAA 3G6WA 4P86A 1TC1A 5JV5A 1P19A 1ECCA 5BRNA 1QCDA 4JITA 3OHPA 1VDMA 1YFZA 4OHCA 1AO0A 3S5JA 3NAGA 1UFRA 5E38A 2PRZA 1CJBA 1FSGA 1XTUA 3N2LA 4PFQA 4ZFNA 1OREA 4MB6A 1XZNA 1IBSA 4RACA 2PRYA 2C4KA 1A3CA 1A4XA 3QW4B 5IAOA 1O5OA 1D6NA 1DQNA 4FYMA 3GGCA 4RHUA 3HVUA 5ESWA 3GGJA 1ECBA 5HKLA 4RQAA 4WMLA 1O57A 4RABA 1GRVA 1L1QA 1BD4A 2IGBA 1TC2A 4P82A 1ECFA 1V9SA 4F8EA 4TWBA 1XTTA 1I13A 4QRIA 1OROA 1GPH1 5IPFA 3EFHA 1G2QA 2GEBA 1MZVA 3MBIA 3DEZA 1DKRA 2AEEA 1VCHA 4RANA 2JI4A 4IJQA 5BQPA 5ESXA 1HGXA 4QYIA 1DKUA 5BQOA 4P83A 1P18A 1UPFA 3H83A 3OZGA 3LPNA 3ACDA 4RHXA 1JLSA 2HCRA 4RQBA 2XBUA 1L1RA 1STOA 2JKZA 1R3UA 4M0KA 1BD3A 1UPUA 2H08A 1J7JA 3OZFA 1I0LA 4LZNA 1QCCA 1Z7GA 4RHTA 1NULA 3DAHA 4RV4A 1QB7A 2JKYA 1I14A 1ECGA 4P81A 4M0PA 1QB8A 1QK5A 5BSKA 1WD5A 2VFAA 3LRTA 4P3KA 1HMPA 3O7MA 4LZAA 5KAPA 1P17A 4X44A 1G9TA 1LH0A 1BZYA
chains in the Genus database with same CATH superfamily
5H4HA 2OGWA 3MQFA 1PZEA 3N7AA 1J56A 4MA5A 5E3JA 1V1MB 1I6LA 3IBCA 4MWDA 1DTEA 3SDZA 3SOPA 2I62A 4MP6A 4KNYA 2R65A 4A9AA 2E5LB 2F1IA 1VHDA 1SKAA 1I3OA 1Y6QA 2ZBFA 5BMVF 2BFFB 4YACA 2RGGA 1XKLA 3B9BA 3SBDA 1ZZGA 4G4SO 1S3FA 1U2EA 5ES3A 1KZHA 4A0GA 3EFOA 1U0BB 4GYWA 4TVBA 2WSIA 1T2EA 3IMKA 2FLKA 2JK0A 1UOEA 1YNOA 3PQDA 1T8RA 4L8YA 4MVXA 4XWYA 1A9RA 5C37A 4HEJA 4KMSA 1DXYA 3BILA 1XKTA 3FVRA 1U11A 3NNDA 2AVDA 2V5UA 4GVLA 3PEFA 4JUBA 3CRMA 5AW0A 2WOOA 2A35A 4XDHA 4BEJA 4RYLA 3B3AA 2QNRA 4ML3A 4RDHA 4DGQA 2XECA 2Y68A 3I53A 4UCWA 1WS6A 4US2R 1E3JA 1IQRA 1WOYA 1QO9A 1QV9A 1GYQA 1RM5A 3EQ6A 3IUBA 4I5FA 1IZ8A 1UAAA 5JJBA 4I6EA 4L5IA 4L0QA 4HEQA 4ND6A 2ZKIA 1AUOA 3NTVA 4RHFA 3TJZA 3BB1A 1H2EA 4G1VA 4MS3B 2ZW9A 5DSXA 3WY9A 1DHRA 4CR7A 3ZHZA 5FOQA 5E38A 1TKRA 3PX3A 3HCNA 5G0VA 4ZVUA 2DF8A 2Y76A 3NCHA 3V00A 2UDPA 4XYEA 4TXMA 3UPUA 3UC5A 5HQJA 4OATA 4YUYA 4R31A 5IKOA 3IT1A 2I71A 1SUIA 3DBIA 3RSSA 4ZI3A 4HADA 4PZLA 1MT0A 3BGIA 3SC2B 2R6GA 2VHYA 3GRUA 3I32A 4MULA 2PQ2A 1F2DA 4IDQA 3EMVA 4M99A 4RLHA 2CFOA 1QFJA 2H2HA 2OCDA 3LNCA 3PC7A 1ECFA 2QIOA 1IB6A 2WZBA 3A1WA 3DD5A 4LJAA 5D87A 4DCSA 4L2IA 4X95A 2IHYA 3TYXA 1NATA 4P5DA 1ZGHA 4QRIA 1FF9A 3MW8A 4KXLA 4BE9A 4C6TA 5C7LO 1SBTA 1BFUA 1PWEA 4RZXA 3IXMA 1T3GA 1YJQA 3WGJA 1DDIA 1DRVA 2NAFA 4Q9JA 4B4WA 2HWWA 2D62A 3RS5A 4C4TA 1W76A 2C5BA 2Y1FA 3R20A 4FYKA 4QPCA 3DTVB 2EERA 3LUFA 1V26A 4XSHA 3P9PA 1STOA 4P98A 3K9FC 3B60A 4BWFB 2NV2B 2MSEB 3P4XA 3QFSA 1DHTA 4RHTA 4CDRA 4QWWA 1XGKA 2UXDB 1IRXA 5JEDA 1VZ3A 3DUWA 5JS2A 4DLPA 4IQ4A 4DDWA 1IK6A 4FYWA 1TPYA 4D8YA 2Z1DA 2AN3A 4I4TB 2X6QA 4HWSA 3ZV6A 1Q11A 2IHNA 2SKEA 4Z4FA 4Z1MA 4B4DA 4RTLA 4UCXA 5B2FA 2YFQA 2WTMA 2PHZA 4EW6A 3EN0A 4AS2A 2O3UA 2ADFA 4PS1A 1BA2A 2ZRIA 1NVVQ 4MQ4A 4OLAA 2HCTA 3QNUA 4AZWA 1F06A 5BOSA 1VI6A 2HWXA 3CLHA 1VIAA 3RUEA 2VPPA 1YZKA 3OPYB 1V25A 3AUAA 1XTVA 4YQFA 2DHQA 4RM2A 2A2ZA 4BLPA 4ZVOA 3LO5A 1DAOA 4PFJA 3IJPA 3PE6A 5KU7A 1CXZA 4J6FA 4JENA 4QGAA 1HYHA 2GTPA 4ACAA 1LSSA 3NYWA 3ZI7A 2HWUA 1GZVA 2G63A 5KWJA 2B9EA 1X9HA 2E37A 2ZRMA 4CIDA 5T6BA 2EP5A 4C05A 3N28A 3GJQA 2J32A 1E4OA 4BO6A 4N40A 1O5TA 2OB1A 5I9IA 1DO8A 1YKSA 3A25A 4E1VA 1U3WA 4UEKA 1FU7A 5EJ2A 4MIYA 1GFZA 2IXEA 3RUIA 3CKYA 4V0ME 5KNDD 2VZLA 3QP9A 4GFDA 4P0QB 1HZZA 3FPBA 1QAMA 3DVQX 2NV0A 1BQEA 3LS2A 1U0NA 4FE7A 3F3SA 2CXUA 5JTTA 3AF0A 3TR6A 1WB4A 3H8WA 3BM5A 5HIAA 3JQFA 2IX9A 3KWFA 3NX4A 1GZ6A 2A14A 2DFPA 4PQEA 5DLPA 5IH3A 5TRTA 1M6NA 1QFSA 3JQQA 4PAOA 3RVKA 4CG2A 2YWFA 1W1UA 2QTTA 2INGX 3DCJA 4NYJQ 2IXGA 5EE9A 4YP6A 3O2SB 4E5VA 3QF7A 3K8ZA 2Z57A 4RO0A 3ZG6A 4ZOLF 4X6UA 2DUNA 4I99A 3K6SA 4AY5A 4M0CA 5TMDA 4W1RA 3V8BA 2ZJ3A 5BNWA 3E3MA 1TVEA 1S1CA 2PKCA 3OA2A 1Q7TA 2BF4A 4P0TA 4KQJA 1Z0ZA 1E1LA 2MJLA 4L50A 1C8BA 3HRKA 4V0KA 3TLMA 2KYRA 1C9NA 4H6XA 5BUZA 1H1LA 3I04M 2ZVJA 1EFAA 4UAUA 1IZZA 3RSFA 1EVLA 3ADKA 1E2UA 2YIMA 4JIMA 5DNAA 3NTOA 4OEHA 4Q03A 3UMVA 4BB5A 4KRFA 1XTTA 4MQ6A 4G2NA 3C0KA 5A04A 2H1RA 2ZAIA 3BIJA 1WEKA 1X14A 1JHRA 3M4XA 5IPFA 1SWWA 1PGNA 3CIOA 3H1GA 2XGOA 4L3OA 1YS7A 1GXSB 3PEVA 3CR7A 3L9WA 3E1SA 4ZOAA 1K08A 4S1VA 3P19A 2WKPA 3AESB 4Q1VA 3HDJA 2P9GA 3GJYA 1JHDA 3O94A 3K70D 5EP1A 2VHWA 4RCZA 1ZLXA 5K0CA 3JQ9C 5CDHA 3KU4A 3KSBC 3A28A 3ESAA 4HRYA 4GGPA 3LC1O 3T4UA 4BO1A 3MD0A 4EJMA 4MKHA 5HRCA 4KCGA 3VOTA 3MWFA 1QRAA 1JR3E 1LTQA 5FFNA 2GASA 4WKPA 5EA2A 3FRJA 3NVKI 1SVKA 3LVBA 1E79D 1HR0B 3NP9A 3BREA 2AL7A 2KS6A 2QE6A 4O4LB 5ICEA 1OXVA 4BZXA 2WOJA 3NHSA 3I5YA 2NU7B 2H5LA 1JIJA 3PHGA 2X2PA 4N5HX 1CVIA 4Q4AB 3FYUB 2J3QA 1TGYA 2PGIA 2VSYA 5TVGA 4O2AA 5A4DA 1R7RA 3TNLA 1SUDA 1ZGJA 1BXGB 3A6LA 1NVKA 1Q20A 3I52A 2QN1A 3K5PA 1JU4A 4G0WA 1ZVKA 3FCEA 1EE2A 1Q0RA 4KVGA 4OBBA 4YECA 1Y3IA 4KYUA 4YS6A 1PP4A 5H83A 4FWIB 5CH3A 1CK4A 1CQJA 2ONZA 3OHMA 2PKEA 5T57A 1M34E 5JSQA 1AXRA 1ZWKA 1K6MA 2DEUA 4MV6A 5TF4A 3KJGA 1NF8A 1NXVA 5CM8B 1FVOA 2R8PA 3IUJA 3WO1A 2Z4RA 3OCJA 5B58T 3ZQ6A 5IUNC 1E96A 1ZMOA 1SKQA 3L0DA 3L8EA 1H8EA 1NG1A 1VJRA 5E7JA 1HQKA 2A9QA 2X0DA 3SHOA 4DB4A 4FHGA 1LW7A 1DO0A 3DYIA 3MYRA 3IDZA 1H93A 1GRCA 1PK7A 2WG1A 3ESYA 3I30X 3KYDB 2EKZA 3O3OB 1UP6A 2RHWA 4REOA 5JDCC 3TTUA 3O82A 3VI4B 2X0FA 4HH0A 4M46A 4E4RA 1P2SA 4NE9A 2Z2YA 3GA7A 3I6QA 2XMDA 4DKJA 4NFHA 1V41E 3M4ZA 5AVXA 1H2FA 3FVVA 2Z2IA 3RRBA 3ZXUB 5A4AA 4BUJA 5F12A 3S2FA 3QBEA 1TIPA 4I1VA 4PLYA 3KVOA 4PLHA 4EG5A 1B4DA 3HDVA 1OIWA 1EP1B 1DC8A 1KPGA 3AFIA 3OX2A 1ADGA 2ZJ2A 1NVBA 1WSWA 3MSXA 1GGEA 4FDTA 3CZMA 2JBWA 1J49A 2VF7A 1NDHA 2XTZA 3DB2A 3UJCA 2DGDA 3EULA 4FFBB 4U1RA 3PTLA 1UM9B 5F1OA 4MLPA 4I5GA 4IGKA 3CH5A 4FSXA 3HCBA 4M98A 4W1SA 1Z2NX 3CLTC 1RRPA 4DEXA 1JH8A 1IVYA 2FKNA 2IUYA 4LMPA 3W04A 1I30A 1VGRA 1UC4B 1VB3A 1ZM2A 4MIOA 3D6FA 2P41A 4I36A 4PZCA 1U2TA 3ND5A 5IKPA 3TR5A 1LY1A 4II2A 4MA4A 3KYJB 4LQCA 3WB9A 4Z6KA 4UHEA 1XN1A 2JLQA 3FTQA 3KQVA 3A4LA 1S5PA 3X1ZA 4RJJA 5AJTA 5L6LB 4AMUA 1SXJC 1M73E 2FQXA 4IEEA 1SG0A 4Z9XA 2CXRA 3GELA 3VUEA 4UUPA 1PYDA 3A70A 2WB4A 1X1DA 5U4QA 3ZTYA 4IIBA 5FNVB 4RL4A 4MW7A 3DWFA 2BMVA 4IXNA 2NO9A 4I50A 3SE7A 2GAOA 2ZJ0A 3AI2A 4MWZA 4IDOA 4J16C 5ALNA 4GR5A 2XTNA 1MV5A 1ZH8A 3KFVA 1JG7A 1GG9A 1HNNA 3GFSA 3PV0A 4IYJA 2Q5CA 4BMVA 5JSFA 3W7VA 2CWWA 4PGHA 2P9CA 2BFMA 2PLNA 4J2OA 3CZ9A 1BAPA 4LWPA 3G23A 4QBHA 4YCNA 4Y30A 5THQA 4RBNA 5CB4B 5F4BA 3KXLA 4AJIA 2JKYA 2H0RA 3VHRA 3IIMA 5LKAA 2IZ1A 1U3CA 4J0IA 1O5IA 2CN1A 3AEXA 3C6XA 2CMHA 5E4JA 4BFTA 5KJFA 5IUKC 3DAPA 3Q8WA 2CLLB 2ZJZA 4E3ZA 1NVTA 4FYJA 1M34B 4G67A 4XTCS 1QHYA 1YTUA 3CS3A 3PIIA 2IYNA 4H6WA 4PINA 3RR2A 4AKIA 5JHGB 3H87A 1UZNA 1D2CA 1K9SA 1KDPA 1D1PA 4NFSA 4PAGA 3UWPA 5BR8B 3M83A 5C31A 2V54A 2Y77A 5ECDA 1DAEA 3MWGA 3P1JA 3PC8C 4MPJA 4DPLA 2UXCB 1W47A 2XUOA 3HYLA 4UM9D 3SC2A 3UCXA 5KOIA 1M54A 1DC7A 2FX2A 1FFYA 4J2HA 3OX4A 2CDCA 3NAQA 1V37A 4BMZA 4YMLA 2AZMA 5GPBA 3L1VA 3WB0A 2DX7A 4EFDA 4EUHA 3LTNC 2AC4A 2ZTHA 2HL6A 5L3SB 1VHLA 2VJYA 4WK2B 4D79A 2XZOA 3I5XA 3VZCA 3F4KA 3KSRA 1V7CA 1WB9A 3OPMA 2L18A 1DX4A 1F8FA 1XLUA 2ZSUA 2QZJA 3GRPA 1E2NA 5IXYA 4G5XA 1SUFA 3RC7A 2WF8A 1AC5A 1ZL2A 1C4OA 4HVTA 4KBGA 4DSNA 1I32A 3ENKA 3MLBA 3OZDA 3KAKA 4DQKA 4D9MA 2VIIA 3HVJA 4FGUA 4Q7KA 1ISPA 1N8KA 5TEVA 5J2UB 5ALKA 3MHTA 1IQUA 2MYUA 3U2QA 4O1HA 3O8NA 3SR0A 1T8SA 1NOKA 2VSNA 5LZ9A 2ZI4A 2CW5A 3HA3A 4MPPA 1RM4A 2FZVA 2JEYA 3A3KA 3IKJA 5F5LA 2A58A 3ND8A 2YUIA 4TXHA 2IP1A 5BV7A 1KKUA 1IOWA 4LXIA 3R5KA 4EGCB 3ZZNA 3IMFA 4OAQA 1PVOA 2AFRA 4WE3A 4F4HA 3NYQA 1F6WA 4HYTA 1WPXA 3DR5A 3HZOA 3GNSA 2VCEA 3LQ1A 2YIDA 1JEEA 3AF3A 2VAMA 4I4TA 3UK7A 4JLDA 1HORA 1TZMA 1RFLA 2HU2A 4JLUA 1KAQA 1W0JD 1DCMA 5TIIA 1U8XX 1HSOA 1GZUA 1K5HA 4TZKA 1VE7A 1B8UA 1L1QA 4M3NA 1J6UA 1RHMA 2ETXA 1IXZA 2WK1A 3KYIB 2CEAA 3D81A 4GIBA 1Q57A 3TD2A 3WA6A 5EEGA 1QAQA 1OZHA 4FQ5A 5HR5A 3FROA 1RP1A 3HCAA 1Z06A 5CLJA 3OPYA 6REQA 4ZEVA 3R23A 2YJGA 4G8BA 3JQGA 4RJTA 5JXJA 2ZBDA 4AI6A 1HDRA 2PNJA 1ZA1A 4JJIA 4MS1B 3MG9A 3S0JA 4CV1A 5KPDA 5AHXA 1Z73A 2W8BA 2H0QA 3ER6A 3GGSA 1Z6ZA 5C51B 1RC8A 1Z56C 2XTJA 1MHTA 3FLEA 3GEMA 2UVDA 3QG1A 4GSLA 4UXHA 2VWHA 4GLBA 5DNCA 3T7AA 3SF0A 2BGUA 3VR5A 5B6PA 1KHTA 2PRSA 5K4HA 5BN3B 1J7JA 3FWHA 3KB6A 2CMFA 3IPCA 1FYEA 1T0BA 1WCWA 2QMHA 3O0TA 1T0UA 4A73A 2D1YA 3B1VA 4HGPA 4J1QA 4E2XA 5G0SA 4QOGA 1JEOA 5KREA 5FOVA 1Y48E 4D6YA 4ENRA 1F51E 3FCUB 3H13A 2IQ5A 4Z4IA 2PCLA 1I5OA 4KQIA 2CD7A 2XH8A 5EE3A 1Y6GA 3RSHA 4B6GA 4JJZA 4EB6A 5LQCA 4FGJA 2GD6A 1RHUA 1FVHA 2RB4A 3PYMA 5EKUA 3TGWA 1W9HA 5GWXA 3ZHOA 4I9FA 2GBPA 3ZV4A 3ZUPA 2HOQA 4HJRA 2JBHA 1YCHA 4IS3A 4E32A 4UD2A 3GU3A 3WLHA 1KETA 1OTYA 2QT0A 2SCUB 3PT5A 5H3CA 1JVSA 1LS6A 1F48A 3FYCA 3QMWA 4MDFA 3N59A 3L6BA 3FBTA 3DKPA 4KN5A 4A16A 3HB4X 1RWNA 3F0TA 1RAIA 3H1BA 3L8MA 3LDUA 1SHJA 4JHLA 5DHFA 4IV5A 1MB2A 2J46A 2Q8PA 5KJCA 1MR3F 1A2OA 2EHJA 1RLIA 4G81A 3U60B 3C3YA 4J43A 4WZAE 4ERXA 1BSVA 5ADUS 2VATA 3H2YA 4L6IA 2CHQA 1FYXA 3DQPA 3RKSA 4XOUA 1M0TA 3K9CA 4EG7A 1CIJA 2ACVA 2JVIA 5FUWA 5LMZA 2ZB7A 4QBKA 5GONF 2JGDA 4XFKA 1MB9A 5B6IA 4Q9AA 5LU8A 1OHHA 1J0BA 3HP4A 2AR9A 1IIBA 1SOUA 3QKTA 4B87A 5KX5A 1THZA 4H0FA 4PNHA 3HO8A 3SFVA 1CUUA 4MCIA 2WTEA 4YCDA 4HUTA 2NO4A 2AJLI 3OZSA 3SCZA 1F8UA 2YHBA 3BICA 2HI0A 1G16A 5JZVA 1QH1B 4K1LA 5ALDA 2WINI 4YPOA 1EVJA 3I76A 4JBYA 2ZDGA 2PD4A 4IV0A 1S9HA 5I01A 1ZXBA 4F1JA 3H5LA 1O0CA 5BSTA 3TPZA 5ITZA 2C2YA 4QYSA 1P9LA 4O4LA 4ZQFA 5FWYB 4F97A 2E85A 4M1YA 3VJKA 3ZEAA 4AICA 5ICCA 1PVDA 5AFSA 1EQ2A 4C3ZA 1FP6A 3IDSA 3OUUA 4LY0A 2WY2D 2ZUBA 4AD8A 4LXQA 4YMIA 3REGA 4Q4AA 3KALA 2ZT8A 3NVMB 4HGOA 4EYGA 1YRAA 1XVTA 3L1KA 3I34X 1FJ2A 3IPXA 2AEMA 4Q18A 1RBZA 4EW1A 4U7WA 5EWMB 3LQRA 5IVKA 4WI1A 1TO6A 1JJFA 2M6RA 3CF0A 3ESBA 4BVAA 1W36B 5DEOA 2WQ6A 3E9DA 4JUDX 2CBZA 3KPVA 3HLTA 1USGA 5LP6B 1O94A 1SVMA 2BGWA 4HNTA 2BC9A 3S7TA 4HDSA 3V7FA 3VISA 2IOHA 1G64A 1W44A 2L42A 2VYQA 1RAGA 3FCSB 3LYUA 2AFHE 1L8XA 2PX6A 1GYRA 1PNQA 3GT3A 1UBNA 1GVHA 4GI5A 4TWIA 2J31A 3R76A 5I9SA 4X20A 2E5FA 4YMVA 1XZMA 3W5BA 3G5UA 5J2TB 2PJUA 2HJWA 2D5AA 1FJXA 3P2IA 3PNVA 2X7JA 3TD9A 4MMZB 2O1SA 3BULA 3CUEF 4ODIA 1Q0QA 1DRWA 1P18A 4FPXA 4INAA 4RCVA 4S1NA 4V0MA 4E5DA 5HG0A 5LR6A 4OK6A 2I1WA 2A3NA 1O2DA 4AG6A 4B6SA 4BBPA 3IB6A 4EKDA 1JDTA 3ILHA 2H08A 1DBPA 4AUMA 3JAKA 1FJGB 4XB1A 3ZIUA 4D9EA 4UD6A 4DA8A 5HUQA 3BE4A 3VGJA 1N5DA 2RC6A 1NF2A 3VNQA 4N6NA 3NDJA 4PHGA 3V6MA 4GKAA 1RCTE 4JROA 4RZ2A 5H3LA 3O8QB 4EGSA 2AVNA 2R8ZA 4EX6A 5ARCA 1PV4A 1B43A 5T5QA 4EO7A 2O4CA 3CSSA 3GPCA 1B23P 1C9MA 4XCQA 5HVNA 3L1HA 5K0LA 4C7VA 1R9GA 3QXJA 4JJ8A 5BXQC 3WNBA 1OV6A 3BJEA 2H1CA 2BEVA 2C8VA 3CZPA 4CUJA 4FFBA 4I1IA 3HN2A 1GLVA 1UM9A 3LSTA 4QPDA 1T36B 1JEYB 4TWZA 3KTDA 4WZAB 4LHYA 3TVTA 2ICAA 1Z4NA 2E4YA 2PFGA 4FKZA 1ZD8A 2WJZB 1AS3A 4CDMA 4K9PA 2NVUA 3EJ6A 3AQ4A 3W2FA 4G0UA 3L3BA 2FW6A 1QLHA 1YWGO 4KIGA 4ZZIA 4TMWA 2QQEA 1JJVA 1G4AE 4O2BA 3EIHA 4Q6BA 4EA9A 2G0NA 2OV8A 4RHYA 3V1UA 4PG7A 3SICE 3VPBA 1EX6A 4QVKA 3OJEA 3PI6A 3RC9A 2EVWX 3DFUA 4UM7A 2ZE6A 4G1UC 3FOFC 3OY2A 2AG8A 4HQOA 4DJEC 3Q41A 4FZ3A 3WBBA 4DIOA 4RTPA 2Y1WA 3HL0A 1XQYA 1JR3A 2A67A 3RODA 1TIKA 5KKAA 2OCGA 2V9CA 2JIOA 1CUSA 3CMCO 3Q3IA 3QXHA 3PI7A 3K9BA 5GJVC 3HN7A 1Q44A 4QG7A 1XRJA 2REXB 1DKQA 5AI0A 3SDBA 4WXYB 4EAQA 3C1AA 2P9YA 3WGIA 4G0QA 1EAMA 2GVDC 1PLJA 4X66B 1U7UA 3LRPA 2C0PA 2H31A 3NNNA 4F2PA 3OWOA 1GZ4A 3S1SA 1RLJA 5ESDA 1AJEA 2B1GA 3AHJA 1KIAA 1TAHA 1U0JA 3R0QA 3ZHUA 4JP2A 4BNMA 5CB4A 4NIMA 4K0KB 3L0IB 4YRLA 1R9JA 3ELYA 5CDFA 2C2XA 4FXOA 5KIAA 4L8GA 2V6FA 1A4XA 1E6UA 2J33A 1LA2A 1Q95A 4J49A 4OJQA 5KYWB 3PF8A 1JDBB 2DUUA 5ADHA 1WPRA 3LUDA 4OMFG 1KPIA 3O9MA 5KVVA 1M34A 1LBHA 2RGDA 5IDQA 4AJHA 5FPSA 2W2NA 2ZBQA 4DR3B 5AD1A 1SQSA 3KQPA 4DJTA 2E1RA 4NH4A 3MTDA 4CM1A 2W98A 1XPRA 1XZHA 1H4QA 3TNFA 7MHTA 4RE6A 3DULA 2DLNA 4LOJA 3Q7EA 4BCDA 4F86A 3OO1A 4HXGA 3H4TA 4ZPJA 3T7KA 5TJ9A 3F6EX 5EQDA 4KWHA 1KERA 2ZB8A 5AXBA 5CYFA 3M1AA 1DEXA 1QZZA 4M9ZA 4UASA 3KXKA 1AK1A 1UPTA 1R6TA 5CB6A 3N9IA 4UUBA 4ZU1X 5C3MA 2FSFA 1VE3A 4OXIA 5NULA 4Q00A 2JD2A 4E3WA 2HK7A 4HLQB 3MWDB 2OGSA 4G5SA 5GGXA 3G2HA 4X1KA 1WCIB 1N9GA 2YN2A 3K7EA 3KAQA 4NXMB 3SKXA 3T7EA 1GZDA 1D8AA 2CB0A 4D02A 2UZ4A 4ZOQI 1CDDA 1V4BA 3A3OA 3LWNA 4LMRA 4F8JA 1F12A 1L7VC 1FUKA 1QDEA 5LLSA 2D00A 1MGOA 1B42A 3VXKA 3CG0A 3T94A 1L4FA 1M1UA 2R7AA 5J2UA 1WXEA 4F56A 4QPZA 3C14C 1JFRA 2FSGA 1JA9A 4PQFA 4R5MA 1XZLA 3FCCA 3RGGA 3WL4A 1XTZA 3K92A 1TVKB 1WU7A 1YA4A 5AICA 2BYTA 4MA0A 4E1AA 1O95A 5KCZA 1NBAA 4WOCA 4D80A 2JJQA 2JJ1A 4BECA 4LYYA 2QW0X 1MB3A 1IN4A 1EB9A 3GUUA 4IVNA 4AYTA 3JAMA 2O8FB 2A8YA 2P5UA 1F8YA 3GGDA 2YV1A 1QYCA 2XYQA 2YW9A 3OJCA 4KN6A 3LE8A 4NESA 4MGHA 3TLJA 1IJFA 1X13A 2Q9UA 1FA9A 2VTKA 1EIWA 3QA3E 3GUZA 1FFCA 2CJXA 1E5VA 3KAJA 4JD5A 4BV9A 4QQ8A 4M2LA 4CIVA 2FR0A 1PW7A 1Z2PX 2WJHA 221PA 1M2JA 5JUWA 2VUSA 3IB3A 1G4HA 4QX6A 2ZI5A 3DQQA 5EP3A 2HM7A 2I87A 1AUPA 3GR6A 1DARA 2PQ0A 3KO8A 2OE2A 1T1GA 4YCSA 1CJMA 2DBYA 2QRPA 3H9CA 3FR7A 4LEIA 4TS1A 3EF3A 3BKWA 1MCZA 3CWQA 4CODB 5AVTA 3C97A 4J7CA 2IPXA 3ANTA 1OYVA 4AUEA 4B6QA 5EIHA 3EHEA 2IHKA 4B6FA 4UE3S 2YY7A 4PZUA 1XJWA 3C85A 2O5EA 2FUEA 2ZB3A 1YJCA 2FMXA 3SIWA 2O7QA 4JKOA 4NARA 2I6TA 4D9JA 4L02A 2CT8A 4JLSA 4DNOA 4B46A 3JASB 4R1PA 1NW3A 2GYYA 1P19A 1U1CA 1EP9A 5A3VA 4IXWA 3NO4A 2F62A 2CUTA 3TSWA 1D5WA 1YBFA 2HJRA 1RYBA 2Y0BA 3PUWA 1E9BA 3QVSA 4GZ5A 4YFVA 1PCXA 2Q2WA 5AM1A 5H80A 2PRZA 1EVZA 2HF8A 4JLAA 1JR4A 1OAOC 3QFCA 4R1SA 2GSDA 2MSKA 2LZ0A 3Q2IA 5E2AA 2YJZA 4WPGA 1KGSA 3PTAA 4P4NA 3BEOA 1X1BA 4RKRA 1MJHA 1NMXA 1W1WA 3OC6A 3UY4A 4DNFA 4LF6B 5L40A 1Y1QA 3EG9A 2AA3A 2ECKA 1LTKA 5F1PA 2VCYA 1HDIA 1NOJA 4EVSA 5GTDA 2OYSA 1L9KA 2J3LA 4FYMA 1UC8A 4KO4S 2AQKA 4RIEA 5ELMA 3HVUA 3UAXA 3NKLA 1RHJA 3M6VA 3LXUX 1HL3A 3H42B 3X0DA 2Q3CA 2SCUA 1OH8A 3LOQA 4LMAA 1SXHA 4PLTA 3L2OB 1FYWA 2FOXA 1E4VA 3T5DA 1QP7A 1M8FA 5C7OO 2PO5A 4UOZA 1GPH1 1W6RA 3TLKA 1AHIA 3DJFA 3H19A 4GXNA 4DM4A 4YT8A 7YASA 2VHXA 3EQ9A 3TVYA 4IFTA 2QRGA 4V0SA 5AQ1A 3O38A 5AJWA 5HJ7A 2XOKD 3OP4A 4LDRA 5B1HA 3AETB 3VO9A 1C0PA 3MWYW 4MMYB 1T24A 1EFRD 4YP7A 1PZNA 3LX6A 3TECE 1Z0FA 2C9YA 3TLAA 3WAJA 3ENWA 1K3TA 2XJ9A 5A62A 4I9GA 1KSFX 1MO6A 1ML3A 1R0XA 1X9IA 2ZYDA 3EXHB 2UYCA 3BJZA 1AZLA 5BSEA 2VP3A 2GA8A 2ODEA 5EUBA 2BCEA 1PTKA 1QH1A 1EFHA 1D6SA 1R66A 4GPEA 4OUDB 3TL6A 4HB4A 1WXDA 3HU3A 3EGWA 1PS9A 4MO9A 5I9TA 2XA9A 3T5CA 2OKGA 3A7DA 1VJCA 2ZVQX 2B82A 3Q9UA 4NRDA 1W5AA 3BTVA 2PSHA 3D8HA 2JS7A 3HBNA 4Q48A 2D3TA 3NS7A 4A8JB 2HWKA 3LPCA 1RZ3A 5FWYA 4L0DA 3TCXB 5ICMA 1E3SA 1RQNA 3DUFB 3TLBA 4HNUA 1OPXA 1URPA 1ECJA 2HC9A 4Y6QA 1I7DA 3KOOA 2CEKA 5K09A 1H85A 3BIXA 3HKEB 2FEOA 2GD2A 4PN7A 1VCNA 2ZCJA 1Q0ZA 4XTRA 2B8TA 3IQIX 2FDCA 1KAGA 4IFEA 5K3EA 5EWMA 2BKXA 4IINA 4I66A 3BF7A 2A94A 1Z4JA 4FFRA 4OJNA 4QC2A 5JW6A 3ECSA 3ENZA 2P6MA 2VSQA 1RCUA 3ZHTA 4IWNA 2UZ1B 6PFKA 2Q8NA 4PSDA 1SHZA 4LXUA 1G8AA 1E4YA 2V1XA 2XXJA 1NPDA 1MVNA 3CUKA 3FKSA 3K5WA 3QWIA 4TOIA 1ZCBA 4U00A 3BCRA 3PNPA 3QBVA 5AHRA 4OQYA 5CVUA 4E31A 3M5WA 3WRYC 3FDXA 2CL0X 2C2WA 1JJ7A 3HE3A 1Q1GA 1WHSA 2C4NA 5LBTA 2IRWA 2QX4A 2VS1A 2WIAA 3I6IA 3KB2A 4QUJA 1O97C 4Y9RA 4B9EA 3QUBA 3ZTWA 4HO1X 4BGDA 2KPOA 5J2TA 3VH4A 1MORA 1PZGA 2J5QA 4IRXA 4KUGA 1V5IA 5K8LA 1IN1A 4L7QA 3JD0A 4JB3A 4JLOA 4NNOA 1ZH0A 4QLOA 4WD3A 2RCNA 3E35A 3IMCA 4Y67A 2H2DA 3G6WA 3TFOA 1MAVA 1T10A 2AWNA 3H5OA 1UC9A 4DMLA 3FY4A 1PSWA 3GZNA 1JZTA 3HN6A 3IVCA 3MBOA 3FDZA 4GC9A 5IJWA 2V7QD 1ICIA 1GPLA 1Y5LA 2G40A 2OYCA 1F4LA 2OEPA 2ILVA 2AX4A 1JXMA 5JATA 2X42A 3RV4A 1NVGA 3TAUA 1Y34E 4PVCA 1FP1D 4NBRA 1BEEA 1YRYE 3COPA 3LJKA 4LNUB 2FSVA 4L4RA 4OAPA 3FPEA 1I2DA 1SM4A 3PB3A 4JLPA 3ZDBA 1PHPA 1US8B 3DDOA 3IAHA 2ZPAA 4KN8A 5DU2A 1YR6A 3VM6A 2EYUA 3FTPA 3WJ7A 3AG5A 5CX1B 1Z8NA 2E5WA 2FQ1A 1HYGA 3N76A 4HTAA 1J9GA 1HF3A 4G85A 4KGVA 2F00A 4TMFA 4B5LA 5KQLA 1MQ8B 1TC2A 4KMRA 1CUBA 2PXAA 1HBJA 3C87A 5A1TA 4WZAA 2HN9A 2P1RA 1QWOA 4YJGB 2A9OA 2EZ9A 3FNIA 4OREX 3IE2A 3K9LA 3IODA 1XQ9A 3UA4A 5A03A 5JRZA 4UBIA 4BMDA 3O1IC 4YCJA 3M34A 1NLFA 3PPXA 3FSJX 1HNZB 1EDZA 2AQIA 3USZA 2EYQA 2H52A 2P6UA 4JA2A 1ECPA 5JVDB 5K3DA 3AR6A 3HEBA 3T3NA 3IERA 1K2WA 2Q2QA 3IBFA 1GPUA 4M0DA 4AZ3B 4NZ9A 4PNEA 3GRYA 4ZAWA 5ALEA 4WLOA 1Q1NA 4DLLA 1E8DA 1B1AA 1JEDA 3E8SA 1IPHA 1TW2A 3FCXA 4JLMA 4PR3A 1SZCA 5D6OA 3VPCA 3L18A 3H3JA 4KUEA 4FEGA 1NRJB 3KEQA 4OHXA 1X7XA 2G08A 1T5DX 1QVAA 3IKVA 3EASA 3QLEA 1L3BA 1KIMA 2R6ZA 1ORRA 2FX3A 3CNEA 1EVQA 3ODPA 3VTFA 3VYWA 5HOQA 5E7MA 5JZ9A 2QVLA 1LH0A 4X65B 1LSOA 2DQYA 3S40A 2ZK7A 1Z0KA 4RY8A 5HIJA 1J5EB 4OA5A 4QGHA 4GDMA 2XQJA 2Q6KA 4ER3A 2DKFA 4ZALA 1ULZA 2RJ3A 3H5NA 4GWKA 2QY6A 1QHEA 1VXOA 3R6WA 4TV8B 1OFVA 3R3ZA 3EZNA 2V7BA 3HS3A 2PIDA 3PIDA 1E9AA 4BX2A 1PIWA 1RQ7A 4TROA 3G2PA 2L19A 3NDRA 1Y8RA 4OHPA 3RE1A 3WMFA 1O3YA 2PS1A 4UARA 3H0EA 2B9VA 4BB0A 4I50F 5E6RA 2ZWOA 4JXZA 4D81A 2YWHA 1SPXA 5B30A 4KH0A 1SA0B 2AFHA 3IP1A 4OHFA 3UOWA 2B6HA 4J4BA 4F5WA 5DKFA 2QTVA 5ALPA 4TZ0A 5IC4A 2Z43A 1CETA 5B4UA 1G20A 4UFNA 1QQTA 3E5HA 1XQWA 2Z30A 4RAOA 1I3LA 2G5CA 4M83A 3UWKA 5C35A 1K7FB 1NNEA 4CM6A 1C4KA 2Z98A 2D2EA 3G6KA 2BM0A 3EVNA 4XGRA 3M6XA 3NBFA 2Q5LA 5A7FA 3R9KA 1XZJA 3ANYB 3KHKA 2P79A 3C2QA 4FX5A 1VFPA 4B6PA 2OVBA 3MWDA 4MDEA 3MOGA 3GROA 3K0BA 5DE3A 2EHDA 4H3VA 1OC4A 4H1UA 4L75A 3A6DA 1KARA 3QFFA 4TKMA 3TINA 4U9IS 1JEQA 3ZVRA 4KGDA 3DBVO 3C3WA 1FDVA 2NO7A 3MNFA 3MGBA 1N2CE 4KTTE 3IILA 5HGJA 1N4AA 3V1KA 5IWAB 3OJWA 5JS6A 1BO6A 5DULA 5K03A 1DMRA 2GHQA 3ADCA 4RPIA 2FI1A 4DA7A 2NZVG 4KN9S 3GJ8A 1VMEA 3OG9A 5E1MA 4GLOA 3D8RA 1L5NA 1KYXA 3MOSA 4AJJA 3W34A 2IZ7A 4QARA 5JPCA 8GPBA 2PX3A 3D7SA 3NANA 1N8NA 3F6BX 3K1AB 2PYDA 1SHTX 2J1LA 3ONDA 4L5JA 4WMLA 4DLSA 5L95A 1X19A 2BJHA 5IN5A 3O3CA 3N0XA 2LDXA 2FN3A 2WD9A 5IW8A 4ILEA 4ZRMA 5JCJD 2XRYA 5CTAA 4UMDA 4ALKA 5C8YB 4GWGA 5CFMA 5KVCA 4YRJA 2F4NA 2G1JA 3OLWA 4OXRA 4PZ0A 4RIFA 2QKYA 3PD0A 3HR7A 4RANA 4H15A 1DLIA 1Y4ZA 1PZXA 5FTKA 1SD2A 2JIPA 3ZK8A 3E9RA 5CJPA 4EHIA 1GCGA 1LNZA 1M2HA 2K87A 4E5KA 3WRVA 3CPJB 1QU3A 4KJXA 3FMVA 2RHLA 4CQMB 2DQZA 3K0FB 3QFTA 2EWWA 2QJWA 1IBKB 3AO0B 4BO2A 1QHFA 1XYYA 5JQGB 1JVBA 3ELWA 3IO3A 3KWLA 4I0WB 1XJQA 4EECA 4PONA 2J07A 3T1NA 5DTEA 3F46A 1P8AA 3SI7A 1YSCA 4IGEA 2FEXA 5HUHA 3AWDA 1M3SA 3CX4A 1KI2A 2ETVA 3DONA 3JASA 4I4TF 6GPBA 2ZCVA 4OK3A 1GGMA 4YI5A 4MW6A 2DPHA 2Q2VA 1PJ3A 3VJRA 1IL0A 2J3IA 3MJRA 4MICA 1XMVA 1Q14A 1M2NA 1KEUA 3T3IA 2FPWA 4Y2RA 1A71A 2F9LA 2JH3A 3FAKA 1U7DA 3OTWA 4JB2A 2RGBA 2J4CA 3WGTA 1JALA 2ZYGA 3JYOA 1VLVA 2J7PA 1UDWA 2XMCA 3DLCA 1NRWA 3TW8A 1VYHA 2I2XB 4PWZA 3F74A 5KWVA 3VR6A 3PXDA 4KE9A 4FWBA 3ETGA 3C3EA 1K66A 1V11A 4CLRB 3DA8A 4YR9A 1QIEA 2PE5A 4CUZA 1HK7A 5EN4A 3B1JA 3M5PA 2OD9A 1M1NB 2PUTA 1SHKA 5I8WA 5KKCA 1GQRA 4CKWA 1J1ZA 3JQ6A 1RXIA 2YHIB 1R8XA 4KO8A 5T8KC 4CM5A 4MHSA 1W581 3PNBA 4HMQA 4MCAA 1G21E 2YCLA 1C1YA 3N58A 1OPRA 2OBNA 1G291 2O3QA 2RG1A 1B0AA 4EPVA 3J80A 5F3WB 4DIUA 3B8HA 3HYSA 2AV6A 1QX3A 3G0DA 4KAJA 4Q5IA 5LMCA 1FQKA 2ZPTX 4W5JA 2FFHA 3BG5A 3KXIA 3SIRA 3PJFA 1GPYA 3ZJUA 4D0RA 4C4XA 1XU4A 3MF4A 3AU9A 2GD1O 1CW2B 4R41A 2NU8A 2KE5A 4AWBA 1N2CB 2ZYVX 1RJEA 2CVHA 4DCNA 1KEVA 1PUIA 3AEQB 3VDXA 1P9NA 2OYRA 3ZLUA 4WFJA 2Z4TA 4ZK2A 4UKDA 1ADBA 2ONJA 2A9RA 4JQZA 3EXHA 1EK6A 1PAUA 4XQ9A 4UW9A 1OLUB 4ZEMA 3D7RA 3RYCB 1GV1A 4OUDA 1WP4A 1NMYA 4BC0A 1FUUA 3CRW1 1YB5A 5TB5A 5CB8A 5EZ6B 1S02A 3OKFA 1RHKA 2MHCA 4DANA 3NATA 2PKYX 5JDIC 1WW3A 2BL4A 4P9NA 4D4LA 5AW8A 1EFCA 4R3WA 3CX8A 4PXYA 4JNKA 1RKQA 2XUAA 2CXXA 2XB4A 1NBWB 2D2XA 2HJSA 2ASEA 3F5DA 3PR2B 4ZYZA 1X80A 3DUFA 2IODA 3EXEB 5C52B 3T5PA 2IYLD 3KSZO 3RARA 2XNHA 3LFTA 1G5TA 3STHA 1I2AA 3B8EA 5I4BA 1I13A 4FZVA 5BN4B 2Z8YA 3L6EA 2JJ2A 3BFXA 4H4CA 2H7YA 3IPYA 5KSYA 2CK3D 4NCHA 2YY6A 1Z2OX 3I9FA 4H1HA 5DTMA 2UZ1A 3IS3A 1QIMA 2YMLA 3W6PA 3HWX1 2BFEB 4JX9A 4Q39A 1R64A 2VZ8A 4J0CA 1H2ZA 1XQVA 2FYTA 2W71A 4NFLA 3REFA 3ROZA 4IMJB 4OMCA 5IVPA 3GD5A 4OQLA 4M7OA 4O4LF 1JJIA 2XVXA 4EW2A 3A11A 3UKDA 4J03A 4I81A 1NBHA 1PWXA 3LCRA 3LQKA 4XKJA 1I4TD 3FFXA 3UMYA 2Q49A 2VL7A 3VAZA 1NQUA 3FE2A 4DQXA 5CVVA 3IVAA 2CFSA 3FD8A 4Z49A 4AN0A 2NUTB 3VOAA 1NY6A 2OO7A 4WNIA 4JYPA 2J6HA 3DKIA 1LJ8A 4KB5A 2NZYA 3GVIA 4FD2A 1FSFA 2D6FA 1D5CA 1GTVA 4LWQA 5EJ7A 1ENOA 1RIIA 3DF9A 3HMKA 3THSA 4RELA 3FUVA 3VPFA 3VPAA 4KQEA 5EXDA 1UFQA 2IYOA 2R79A 3IUSA 3WV5A 5EL0A 1WSBA 3O1LA 1G6HA 3GFBA 1ZC4A 621PA 1DGQA 4LNUA 4YEDA 4ZHQB 1DTWA 1HE1C 1FMCA 1JUDA 2V8BA 1YBHA 2QWXA 3P9SA 5J59A 2ZRKA 3PYXA 1CYEA 4WNAB 5B7PA 1FDUA 2I4NA 5AOBA 4OU5A 2IH4A 1NJSA 4HSGA 5ERXA 2WLTA 4M86A 3TCNA 3H2BA 4HAZA 1XD2A 1I3NA 4L6CA 1ORTA 3VHXB 3L7KA 3IUPA 4ZREA 1G9SA 2IYAA 3TKLA 2LTAA 3I0MA 3WNVA 1IAQA 3X3HA 4YHHB 1O95C 4DF3A 4YJGA 4WK4B 4D26A 2ZQZA 2X3UA 1T0IA 4IDFA 3O8OB 4N7MA 5TMPA 4RV5A 3Q5EA 2ZXUA 2W2MA 3G8DA 4NQZA 2ZSDA 2CXOA 5IXSA 5J9FA 3D9QX 7REQB 3TL2A 4Q1DA 1PJRA 1VECA 1Y4AE 3DAYA 4FYVA 4OQDA 3V4VB 3W1EA 3K8QA 1U4SA 1QRDA 3JQ7B 1E9SA 3CVXA 4B7UA 4JFAA 4AZ3A 4NYMR 2BISA 3RCBA 1OA0A 2JCVA 4D74A 4D97A 1IQ0A 3GLRA 5JD4A 2BM1A 3ZGXA 4JI2B 5CVCA 2JEZA 3JALB 3G3EA 3LGAA 4JLBA 3ZCTA 3RVPA 4YJ3B 3OLQA 1BHQ1 5JMOA 4CMEC 1Z5GA 3NRJA 3BA6A 1R6DA 4IGIA 2XGMA 1WVIA 1AN0A 1EXMA 1Z5ZA 4MB6A 1FTQA 1LPNA 4P92A 3SZMA 5KMGA 1TTQB 2OV6A 3CSDA 5KWIA 3TZLA 1A3CA 3KV1A 4TWRA 4AKEA 2VHTA 3ETEA 3MUOA 3PIRA 3LT2A 3QOYA 2H65A 4WN9B 1VA4A 1K4YA 5IJ9B 4GXTA 4O2BF 4OMDA 4ZVRA 3Q72A 1UPCA 1A2BA 3MLAA 4LRYA 2W93A 3AR3A 2JGJA 4MV7A 5DF1A 3WHPA 5FEMA 2BFBA 3UMJA 4B0OA 1LXCA 4QTYA 4QREA 4Y6SA 4GKJB 1D2MA 1M6HA 4B3JA 1I1HA 2D59A 2REOA 3DE2X 4DSAA 3ZDDA 1N33B 2XADA 2O59A 3K73O 2NQ2C 2C96A 3UHFA 1NC1A 1AKEA 4RMHA 1WLYA 1IWBB 1UBJS 3JYQA 3NBUA 1AK2A 2Y66A 2LIVA 3H7IA 3WQSB 4DBLE 1L5RA 3RIEA 5J43A 4IFBA 4R1OA 1BJTA 1P9WA 3MJTA 2FEWB 5DM0A 3RFXA 5JAZA 4UE2A 1XTKA 3JPYA 1QKKA 1Q3TA 4IJWA 2B1IA 1UKVY 2NU6A 4LF5B 2YXPX 1FFAA 3GB9A 3PLRA 1MT3A 4M8SA 1MO5A 5KYWA 1NLMA 2J5KA 1TXGA 1LKZA 3GVCA 1BX0A 4M9QA 2AZ4A 3FSGA 3FWZA 3JTEA 5K4AA 1GVNB 5CB4F 1HTTA 1DCKA 1RZRA 1E4EB 2ZJ4A 2IW3A 3O4GA 1XHEA 1CBUA 1YZVA 3GY0A 3ZE2B 3DLBA 1WF3A 4YTEA 3EGXB 3M49A 4XLZA 1W5TA 4JCOA 4KE6A 1Q6ZA 2JLRA 4K6OA 5IXJA 5J1TB 1B6SA 4UZEA 2Y0PA 3U56A 1XE3A 1E5LA 2G6BA 3OU7A 1HKUA 4Q7JB 4Z99A 2PRIA 4CL0A 4LOIA 5FWXB 4DSUA 1TMKA 1VLJA 3L6RA 4IUCS 3T5BA 1U1DA 3LQ4A 5H9WA 3HFJA 3BD7A 3RREA 1JA0A 3MJHA 4CM9D 4P7BA 3IEMA 3GPLA 3LFUA 1DAIA 4RD6A 4OP3A 5G1NA 2YX1A 1M2OB 5ITWA 1TM5E 2I1LA 1ZAKA 2FQYA 4L78A 1NM5A 2XKAA 2Z56A 3NKVA 4EHLA 1RPZA 2YVAA 1VJ1A 2YICA 4Q3OA 2PRJA 3D3WB 4N39A 3UJDA 4C01A 1C3VA 1GZHB 4Q3LA 1M6YA 3OF5A 5K6RA 1R00A 2ZI3A 4YA6A 2XYRA 3E2IA 3EDRA 3HZHA 4C89A 5FYDA 3T1OA 3U4QB 2PKXA 3HDTA 2XHZA 1Q7GA 1VYTA 1O6GA 1VKNA 4HUJA 5C8YA 4CEIB 2X0KA 1SVOA 3OMXA 3OKAA 2ZIGA 1U0SY 1JDSA 4GXQA 4MWOA 4WJKB 2FCAA 1JFFB 2JFWA 4URFA 2QSZA 3P52A 2I7VA 4AJEA 4CIAA 3G2QA 3GT4A 3QJGA 5M04A 1E2MA 1BROA 2Y1GA 4RIHA 4B40A 1NP3A 1SKMA 1YUBA 4ARZB 1ZJZA 1WXGA 2WIKA 3TIGA 3WIOA 2CCJA 3ZWDA 3IIEA 1MABA 1N9KA 3K0FA 4IIFA 4Q82A 3E82A 4CQMA 4YR7A 1ZJ5A 1IFXA 2WM9B 5C0OE 1XZAA 5TQ0B 5TVKA 3B9RA 5JQGA 3FHCB 1NF9A 4P32A 1NTRA 4U2FA 4RENA 3V1LA 3RAFC 2QTCA 3RVNA 3F6SA 1TF2A 1R0ZA 1ULUA 1LQ2A 4TVSA 2PWYA 1H6DA 3VHQA 3MTGA 1LI4A 4ZMBA 1WMSA 2Q1XA 2HMUA 1OBFO 1G7SA 2FPPB 5ENZA 3T9CA 3TRIA 3NHBA 4J90A 1E69A 3QIAA 4NATA 2YC4C 4TTVA 2JI8A 3OF2A 4CTMA 2ZIUB 1Q77A 4F12A 2ZBRA 1NIPA 1ZJYA 3CW2A 1RYDA 4L4UA 4MROA 4ESHA 1GGHA 3OJXA 3T3OA 3CEHA 7GPBA 3SDSA 2C7RA 1N0UA 3D31A 3GEEA 3QEOA 2PJRA 4P22A 3GUYA 2WT4A 2IU0A 1RXCA 4V0LA 2P8SA 1AGPA 5ICSA 3UXYA 3H5RA 1UDAA 1YBMA 3NM4A 1ZXLA 2QYTA 1TPZA 1I6WA 2D1QA 2XLCA 4W5QA 2ACEA 1NSTA 1JG3A 5LJLA 4IXTA 4Q1EA 2JLAA 1ESDA 5F2NA 1Z26A 4R2HA 4CR6A 4ESOA 3BIWA 5IMBA 1E0DA 2OT3B 1R8SA 3IESA 5A06A 1HQCA 2FSVC 4QU0A 5AIAA 2ZTLA 2D1TA 5BSFA 1KVSA 2FDRA 1S8NA 5B5SA 2M98A 4IO1A 3CO0S 1G8KA 3IP5A 1OH7A 1CZUA 5IT5A 2FK8A 3LXXA 3OIVA 2VSFA 5DH9A 1OJLA 1TJNA 3GLSA 3MFYA 2DXIA 4NBTA 1DL5A 4BFXA 4WGGA 5LA6B 3IULA 3LZ6A 3QOWA 4JC5A 1QF9A 2A1IA 1KDTA 4BNDB 1SG9A 3OZ7A 5DYYA 1PEAA 1Y9EA 4FJ1A 3WIVA 1LCIA 5CLQA 4AJOA 1O54A 2R47A 3COVA 4JJ4A 2P6PA 3AGQA 4WY5A 5KHAA 2R6AA 3AEQA 1UF9A 4YDRA 3USCS 1CUFA 1RD4A 4M7WA 2PKWA 3IMEA 4Y2VA 3VJMA 4H7JA 2Y2VA 4NBLA 4LXYA 4C07A 4XR9A 1WHTB 3KZMA 4MB2A 1M1YE 2JZOA 1FP2A 4DXHA 1QC5A 1SUCA 3U7QB 4EAAA 2LP4Y 1UODA 1T3ZA 2OFWA 3UTCA 5DISB 4EKNB 1AB6A 5EUCA 3RYCA 1ENYA 1R4NB 2OG1A 2RONA 4HDNB 4R16A 1MIOA 4U2GA 4U7PB 2HA4A 4LBZA 4PE5B 2GAJA 5HF6A 1BWSA 2AOWA 4A5SA 2HPHA 4C22A 4TKVA 1GQQA 2JAXA 2EEZA 2NW6A 2GZAA 3T9DA 1Q6YA 4IPTA 3EVDA 1WUKS 3DVAB 3DL4A 2JF0A 2A86A 1XK7A 1YI0A 4FS8A 2VA9A 3PPVA 2YKGA 3EXEA 1GQOA 4C14A 4XVCA 2R7MA 4AZVA 5BN4A 1DAPA 1CUEA 5EXEA 4EABA 2BMAA 3IE0A 3MJDA 5JE8A 2NYRA 3MJSA 3OZTA 4N3NA 2R8YA 4BNJA 2R6DA 1YCFA 4HEHA 3RUHA 1PZFA 4B80A 5FX2A 4PR0A 4GAEA 1G0OA 2B6NA 3HFRA 2YWJA 1GPDG 1LWNA 4X41A 2HIAA 2V7XA 1JS1X 2IYYA 2ZI7A 4BP9A 4KZPA 3TR0A 3UFXB 5JV5A 4UTZA 2ZQ5A 2C3YA 3STYA 3D8TA 1XZGA 4HG2A 4JITA 1U9JA 3UT5B 1DVRA 3D0RA 4ZPXA 3WGKA 3TW4A 1CRQA 2GEJA 3AFOA 2AC7A 1HOXA 2AOVA 4KXNA 4NX2A 1OREA 2O2EA 3QU7A 4GVXA 4DARA 4IJ5A 3L04A 4HFRA 4KXMA 4CKZA 1G5RA 1H4SA 2GHTA 4IUBS 2VC2B 4LX8A 1LX6A 2ODQA 1U63A 1ZNYA 2R4UA 3BE6A 1KDZA 2NUTA 3NC4A 4PSAA 1R4MB 3ETDA 4U7HA 4DRYA 1NR7A 3DEJA 4BASA 4MLCA 4QE3A 4E15A 1VPVA 2C5AA 3V48A 5L51A 4F71A 1NI4A 1VMKA 2M2IA 1DUIA 2I03A 5EHIA 2VRCA 3VR5D 2W5UA 5BNZA 3KHSA 1DKLA 4MJXA 4L7VA 2VUIB 4HDKA 5AW9A 4D1YA 2WHPB 4DRZA 4ECAA 1ND5A 2AYXA 3HY4A 1TM3E 4REQB 3SYTA 2QXTA 2AF3C 4DLTA 2PMFA 5GV7A 4CU5A 5CXUA 4LDAA 4YC7A 5J2TF 2A9FA 1RI5A 2J67A 3GAAA 1G21A 4RK0A 1KP9A 4AIIA 1W35A 3FVQA 4NNPA 3TCKA 5H4GA 3PLAE 2XZPA 1GRNA 2IH2A 5T3UA 3TLXA 1XYGA 1YQQA 3QE0A 4O4HB 4RNDB 1CUVA 5CURA 3LUAA 2B0CA 3VO1A 3N0VA 3UAZA 1C3LA 1WEHA 3W5AA 2XE6A 4AF8A 3PQ7A 2YDYA 1QCCA 4NPCA 1KRHA 4Y2GA 1X94A 1T8WA 7REQA 1ZOLA 3VKVA 5KSOA 3CH6A 1C3EA 2JATA 2RSLA 4PGMA 4O1MA 3DTNA 2AKAB 2QTNA 2YWXA 4MVJE 4ZRDA 3I61A 4LS3A 4EG4A 3ZVNA 3JQ7A 5I6DA 1H6AA 4DR1B 3K6JA 4NDNE 1M1YB 2RHMA 1AMNA 2C4VA 2BFDB 3A0RB 3WWPA 1I33A 4O8CA 1XFDA 3LWDA 2EGHA 2HLDA 5F7XA 1A1VA 3NTQA 1I6MA 3JALA 3BC1A 4L5YA 2EQ5A 3WP1B 4RFSB 1XF9A 4PANA 1AKWA 1J06A 4MRAA 4RD4A 4HAXA 1QFZA 2CY0A 1YXMA 4JUAA 2CFRA 2GUWA 1APBA 4DWJA 3ITDA 5I47A 2VYND 2XA2A 2IVFA 2WEKA 1LPAB 1XXLA 2DH5A 4P3XA 1TQ2A 3MOIA 2WZCA 4P54A 1UBKS 2CVFA 1OLXA 1J9EA 2OD2A 4KG7A 4YASA 2ARKA 3CT6A 1P5HA 2GCEA 3I4FA 4K3UA 1L3IA 3S2GA 3VDMA 1E3TA 1OT3A 2BZGA 4JT8A 4NE7A 3ROTA 1CZRA 1MVLA 2BCJQ 5FKJA 4AMYA 4BQNA 1ZCZA 3H11A 3P2YA 4MV5A 3VU1A 1XEXA 1K6IA 1UOQA 2AHRA 3GZ4A 3L05A 2FA9A 2R8XA 4MDHA 1OBOA 1SXQA 1A4RA 2POQX 3DBRA 3GLGB 3D54D 5AW2A 2IX3A 2XQFA 4N3CA 4H6PA 1YRLA 3L7AA 4K6FA 1UM8A 3TKYA 5BQ5A 2O8EB 1CZOA 3CZAA 3K31A 2YV4A 1IUNA 1O94D 1HO3A 2O6LA 4RCYA 1OIXA 1YS1X 3BK1A 1QHSA 3BQMB 4CFYA 1IE3A 4N5NA 4EX7A 1IZYA 1V2HE 2C5HA 2PN1A 3EA0A 4PFQA 3GOQA 2QVXX 2XCQA 4TRJA 2BGLA 1A82A 3PXXA 1XZNA 5H70A 3TW0A 4JWKA 1IPFA 4MHTA 3AUSA 5K0GA 2O52A 3EGXA 4AJ4A 5BXYA 3EBPA 4IIHA 1PQUA 4M1QA 1KO8A 3HKDB 3SAJA 1O5OA 5D7NA 4EA7A 4G4JA 3ISJA 4K8OA 1ODFA 4C7JA 1SQFA 3BMQB 4JEIA 1NPTO 4ZGWA 2WWFA 5LQMA 2O8BB 1ZMTA 2WSMA 1A7JA 1GNRA 4KPGA 3HGTA 1F3OA 1THGA 1MMFB 2BI4A 5FULA 3FFAA 3K0AB 5IDWA 1DT3A 4RXMA 5G0WA 1LJLA 5E4FA 1M2OA 1XYVA 4GEKA 4BGEA 3GMSA 2QMUA 2CKDA 3AINA 4XUCA 4IMRA 4KXYA 1HE3A 3PNMA 2AEEA 3Q0EA 4PIPA 2GF0A 3HZRA 1VB5A 3T15A 3BS4A 4C5CA 5JASA 3BHIA 4DDMA 3T0IA 1D7OA 3V2UA 1U5CA 4ZYYA 1CY8A 4RGBA 4BPBA 1F9AA 4MRNA 2VBGA 4ZEXA 3T4XA 2Y0DA 2ZBEA 4Q1CA 1EKXA 5IDVA 5A4JA 2FMKA 4EARA 4B44A 3ZVLA 3GBVA 3UG6A 4NBKA 4C3UA 3ASYA 4LYAA 1JWAB 3A3PA 4Q24A 1YVUA 1UAYA 1R5JA 2PVPA 2X19A 2Y92A 3DZBA 3LIPA 3LVQE 4EGAA 5TS3A 2P4SA 2B2XA 3P45A 1TK9A 4B7ZA 1QK5A 5C5EA 1IUPA 1R6AA 1P2BA 2E4VA 4IRUB 4D3XA 1CSEE 1JG4A 3EBOA 3QTBA 4IP0A 4M1OA 4MUHA 4E94A 1ZICA 2XRFA 1OV4A 4F5ZA 1P7YA 4G8CA 3A9CA 2CFTA 4BE4A 1CJKC 2J9ZB 4BE7B 1NSFA 1E0SA 1EDDA 1WZUA 3GX1A 1T34A 3IO5A 1ZA2A 4JVNA 5FPPA 5KB3A 1J21A 4KIFA 2QTGA 4HDRA 1UINA 3AXSA 4I9HA 1JR3D 3G8AA 4IIEA 4MWBA 1JJBA 2HA5A 3ZIDA 3WKAA 2ZVDA 1K4KA 3EFEA 4NAHA 4EHNA 1E6CA 2A0YA 3CNOA 3E4DA 3EOBI 3MT8A 4BNLA 3HB5X 4ZT7A 1OZ0A 5BP7A 4JOSA 5I4CA 3Q6NA 1S6YA 3D1JA 5LB2A 2PUDA 3QKSB 3D6UA 2O0JA 5ALWA 2OO5C 4BQQA 3ZE8A 1HYBA 2W42A 3VZRA 4ZJUA 2FWPA 1PFVA 4GOMD 1I6KA 3DE7X 4F3RA 2FZGA 5KYXA 3B1FA 1S3SA 1VL8A 2GN9A 2IU4A 2QAGB 4P08A 4BN4A 3WGUA 4C0WA 4ESEA 3DPSA 5KOHA 3EG5A 5KHOC 4QWMA 4OSOA 3H6KA 2XT0A 4WBNA 4XA8A 1F2TA 1C2YA 4MUGA 3QXXA 3VSAA 1ZD4A 2OWEA 4W9NC 4WADA 1NUHA 1XF1A 2Q1SA 3R5TA 1Q0UA 1GZ3A 2WKWA 3BBPA 1ZJJA 5LN1A 3I64A 4GKKB 4OQFA 1A7AA 1IEXA 5FDFA 3OJOA 2X2OA 4K6CA 2RJOA 2PFKA 5HRUA 1NBOA 4CNBA 2EC5A 4M0EA 4E4TA 3ICQB 1SUWA 1KI9A 2FY8A 3O92A 2FW7A 4KQ1A 3A8TA 3NT4A 2M6LA 3EC2A 1N92A 1M0WA 1I3CA 2KWIA 3HCEA 5AHKA 1XLTA 4B82A 1A5SB 4YRPA 3TTXA 3WMWA 1JHUA 5MFPA 3ZWAA 4ZT6A 1JFVA 2IYQA 2RB5A 4CBVA 4KR3A 3VU0A 4QJ4A 3V7YA 3FMPB 1E66A 1FC0A 4R05A 3KQHA 2X6TA 2A92A 3B2NA 4DMUB 3IV6A 1QCYA 3QUTA 4G5HA 4MIKA 3RQSA 1E6WA 3U7QA 3ER8A 2I8AA 3EXIA 4UU8A 3IP7A 3KCNA 1KBZA 2PZBA 3GNQA 3KK0A 4OM7A 5FHRA 3HXMA 1LDNA 5D3QA 5AKXA 1M66A 1EG7A 2ZAGA 2QM8A 2QV7A 4U2DA 3VHLB 3ANMA 5CD9A 1L4HA 5JJIA 2PZKA 3AIIA 4G24A 1PU2A 3ZJTA 2QZ4A 1QE3A 2QZ9A 3H9UA 1NW4A 2JJ1D 3DVAA 3IQXA 3NHYA 4WEOA 4YP5A 1N34B 1P2DA 3AM3A 2JJ8A 3RHFA 1V8PA 1V43A 2IUFA 4GYJA 3WYFA 1P33A 3TKAA 2IHUA 3WK5A 5HUJA 5HA5A 3MD9A 3JX9A 3G0BA 3M3PA 3P9IA 4ZI2A 2PGAA 1AE1A 1EDEA 3AB8A 4OSEA 4Q9KA 2EX1A 5JXGA 4UPDA 2Y2UA 3KZCA 3EC7A 4JJ7A 1T0HB 2I2BA 3F4BA 4IXDA 2NXNA 1KI7A 3KPJA 4R54A 1IJEA 1WQ4A 2WUDA 3DZ8A 4DOMA 2BSQA 1LI7A 1VG1A 3NJRA 3W3ZB 4D6PA 1E2PA 2GLTA 4MLZA 4HDMA 1PSDA 2XUPA 4M0MA 4NULA 4BBAA 4BYMA 5LFAA 5BSHA 4RZUA 1Z2CA 2ORYA 3U4AA 7MDHA 4MTLA 4GX1A 3DAOA 1JLLB 2OCAA 3NIWA 3BQNB 5FQNA 4W1QA 5J4VA 4UVEA 1KOGA 2R5NA 1TU3A 3EF0A 3LBHA 4FILA 1R4MA 1CC1S 5L3ZA 3KL2A 4JLVA 2NTEA 4JVLA 1IY0A 1O87A 2OBLA 1Z16A 5ALSA 4TTAA 3SBXA 4LRUA 2ZULA 5HJ5A 4MQFB 4A6XA 5CJ2A 2LCFA 5KTNA 2ZT7A 4E5MA 1ZPDA 3O0DA 1HEUA 1ND6A 2BFCA 2H4XA 4UEWA 4ZVSA 4KPEC 3PX2A 2OQRA 1Q1EA 1SAYA 3DTYA 3MT7A 1V8ZA 4JBGA 4CI0B 1IY9A 1RZVA 3OTQA 3HFGA 3LIIA 3VBEA 1TJ3A 3NIDB 4QOEA 2WYIA 2RAPA 4D82A 2Y9PB 1P45A 4HXEB 1VSTA 2PT5A 3HKCB 3IA2A 2NX2A 1YK1A 2DUMA 3LRXA 3AX6A 4Y6LA 5IN4A 4PW0A 2ZTSA 1KQGA 2BUAA 2Y99A 1YOVA 3EZFA 3N2KB 3HR4A 4O4HA 3HJNA 4NV1A 5EE0A 3Q9SA 1DADA 2EF1A 4NQRA 4B33A 2X1VA 2FP4B 4NZYA 1Y37A 4U7FA 4ZZ1A 3VOBA 3RWMB 1FBTA 1JQJC 3F6YA 5G1OA 5JCZA 5GP1A 4UTOA 1MC8A 1S8FA 5AVVA 4B35A 4F4FA 3FIJA 4OXNA 1ZSNA 1N0HA 2CB9A 2YXLA 1DQYA 3KVNA 1NLZA 1N2BA 4J0JA 2WJPA 4Q9DA 1U4NA 2ENWA 4BO4A 1XUOA 3DJYA 1M1YA 1J25A 2GERA 1NOIA 1CJCA 2PH5A 1FPMA 3TLZA 4D9IA 1UKZA 3K94A 2BMWA 3IAM6 5DM2A 5DW0A 3U9LA 1CU1A 4CLOB 1GNQA 4FX2A 2H4FA 2J6BA 2KJQA 5TR9A 5T4FA 3SWWA 2OCPA 1CV2A 1Q7CA 2Z95A 1J0CA 3CUSA 1NYLA 1MV8A 1RJWA 4GM0A 3H9EO 3WHIA 3KT0A 5JBNA 1IIRA 2PGNA 3IHWA 3R3WA 2ATXA 3IMGA 4YGXB 1OXTA 4Y6RA 1Y7IA 2GEBA 3OTHA 2JHAA 1OXBB 3S70A 3PRHA 4MUNA 3TNDA 5FCDA 1N75A 2OD7A 1RU3A 2QRMA 3HZZA 1P1RA 1ZUD1 4DMMA 3OOSA 2PA3A 3FWNA 4NCNA 3MQ2A 5H82A 1UJ4A 3G9XA 4JC4A 3GFPA 2AFIE 2JANA 3H83A 2ZJOA 5FP0A 5B6JA 3B3GA 2NYAA 2LXNA 1SQ5A 3DVRX 3ESZA 3ZI0A 4BMYA 1G59A 3SBOA 1DCFA 1DZ3A 1VJTA 2BE9A 1Y6FA 1OMOA 1B26A 3RUDA 1F8GA 2JVKA 4MOWA 1I7SB 1GZ5A 3O31A 4KLAA 4GYYA 3D0OA 4R3UC 3ONFA 4G56A 2SBTA 4CMKA 1NKTA 4ZO7A 4YUWA 1YA6A 2IVZA 3SYLA 1OFTA 3GCXA 4MR7A 1Y9AA 5HIIA 1FQJA 3KQYA 3FKSD 3G59A 2CHFA 1JHVA 4UTPA 8MHTA 3OAAA 1UMCA 1Z18A 2VH2A 1CQPA 1P1FA 3EGCA 3AF5A 3IOYA 3MRVA 4FR5A 4EL0A 2QLJA 5JYEA 2CNLA 3PHIA 1M1XB 3Q10A 3O8DA 5KYUA 3D7LA 4NOLA 3SEZA 3SNHA 3JW8A 2WA2A 1TK3A 1Z7EA 3MMSA 3UVEA 4F91B 3VPDA 3L1UA 4YWHA 4KIUA 3OT5A 3DLPX 5DGDA 3KSMA 3V5NA 3E22B 4RF2A 1U6JA 3PWTA 1TUBB 3MT9A 4H3HB 4RDIA 5DHSA 3SC6A 3UAVA 4OK5A 4RDCA 4CLHA 3V2IA 1XCBA 3N87A 4FBMA 4AJPA 2YJ3A 1V7ZA 3UIEA 2FPMA 2ZANA 2O8BA 2VF8A 3CUTA 2EJWA 2W2QA 1HI9A 1N6OA 4Z1OA 4D5EA 1GSAA 1Z68A 3QWHA 4N1AA 2Y6VA 4D56A 3N2GA 4MS4B 3RU7A 1BTOA 4REMA 3SPXA 2BKVA 4QPNA 1ZVQA 2AXNA 1A5ZA 2YIVX 3A1TA 4RTJA 1JLRA 1SKUA 4UNSA 1YFLA 3BDIA 2VQEB 2QL7A 2UAGA 3PE4A 3D2LA 4Y2YA 4GMGA 1IU9A 4PZPA 4QTZA 3S1AB 3WX0A 4K81B 4MZDA 3BJRA 3T7RA 3IHTA 4BJ5A 4RVSA 2JAQA 1ADCA 1DQRA 3OLCX 5ILGA 4BEVA 4CMIB 3S7ZA 4K8RB 2JAHA 4DZTA 4BN5A 4BO0A 4N8SA 4XD7A 4WESB 3OIFA 3EEQA 1V5GA 4PLCA 5ECYA 3WP0A 5E9JA 3NEAA 3NALA 3K16A 5EMJA 3VR4H 3RV3A 4D9KA 5JSHA 4TUYB 3DDZX 4N01A 4YRRA 3X1YA 3WXMA 3CU5A 4TT8A 3FSRA 4D4GA 4P38A 3V1YA 2QT1A 2VJBA 1QFXA 3GLUA 1BCSA 4MKRA 3IUYA 5DWDA 3S1LA 5IULC 1Y8AA 1C7FA 2COKA 5CGZA 4Z2AA 5DHRA 2CDRA 3C16C 1X2EA 3GRAA 3R6GA 1YZNA 2ID9A 3GCGA 4NZMA 1W7AA 1UL1X 3NFRA 1MHPA 2W37A 1C9JA 1G8JA 4A3SA 2DCUA 3FTEA 1ZHHA 1T8YA 2QD2A 1EESA 1EFPB 4QGBA 4NP6A 4P82A 1PR2A 1ILEA 3PHBE 1NNI1 2PSJA 2DQKA 3UGJA 5C8YF 1BGXT 1VLQA 3L1JA 2IITA 3ZBUA 2H92A 2JHFA 2F1RA 3CLSD 2BGGA 2AFIB 4ZARA 3T99A 4UCFA 3L6OO 4TS4A 3UK1A 4BATA 2GPJA 2VZ0A 4EO9A 2PH1A 1DRUA 2BEUA 2WFLB 4PRLA 2JLUA 2X1LA 2QN7A 1ZHOA 4GR9A 2X0IA 3F73A 3RHSA 5L9AA 4LC9A 3IDOA 2EIHA 1NJGA 5JQGF 1ZK3A 4G97A 4KSBA 2O0MA 2QAGA 2F8MA 4EG6A 4CCWA 2JGNA 1TF7A 2COEA 2PUVA 2UUOA 3MBKA 3N7UA 4PIVA 5AW6A 1WXQA 4UMVA 4R7GA 2GAAA 1UMDA 3BD6A 2WDPA 3GGPA 5C3UA 1CUJA 4KDRA 1CJVC 4KSCA 3ZE6A 2B1JA 1BN7A 1P5JA 1IB0A 2I34A 4QTTB 4P3KA 3C6BA 1DEOA 1P0CA 3OH8A 3Q3HA 5E9AA 4DLWA 1UQRA 1G18A 3QVGB 1XR3A 2K5UA 5D5PA 1LSJA 4WUTA 4B3GA 1O4WA 1JHXA 3AY7A 4F4CA 4TTPA 1JA1A 5DRYA 4XH9B 1KE2A 3KQUA 2I6GA 1ORVA 2XPCA 5B7NA 3I1FA 4IIDA 1EA5A 4AXBA 3WBKA 1L8LA 2RHDA 3DG9A 2QOEA 5DTIA 3STUA 1MP0A 3VVCA 5AXAA 5H81A 1IMOA 1J2YA 3W5UA 2V0NA 3B5IA 1A9ZA 1GIAA 5G3ZA 1AHHA 2RC5A 3RSLA 4ARVA 4DMHA 4HDAA 4RJIA 2WIGA 2ZSAA 5C7IO 3GFRA 5K5EA 2NT4A 2QVZX 4KPFC 1U9YA 3LDFA 3VX3A 1VMIA 2I1VB 3C24A 2G9ZA 2XCSB 1USWA 5AT1A 2HX1A 2D2IA 3KPWA 4HFNA 4R2XA 3U62A 2ECPA 1UXOA 4GLLA 4BVLA 4ZCMA 4FKBA 4CDGA 3GLIE 1RWQA 1VMDA 1WMFA 1OW3B 3QU4A 2A5LA 2IIQA 5EKXA 3COSA 2XXAB 3QPVA 5DGHA 3K6KA 3KZXA 1E2DA 3B1XA 2VRBA 5IAJA 5JWHA 3V2HA 3VO8A 4Q02A 1S4MA 3D4LA 4GUAA 4RVFA 3MWLA 4F04A 2GRUA 3R77A 1T9HA 2C8KA 1GKUB 4IUYA 4ETWA 1IHYA 1ZGZA 2HIGA 4DA9A 3I9NA 2O0LA 3LCUA 4EKEA 2H17A 3C6YA 4Q4DA 3JSXA 2J59A 4N6GA 4MKZA 1DKMA 1N4DA 3E27A 4X9XA 1T1EA 4BRZA 2F3UA 1F4PA 1WDTA 3HO6A 4WASA 4HHEA 4D0NA 3CLRD 3IGFA 1U2RA 2B1RA 2W2XA 4LTMA 3ZW8A 3G2KA 5JNVA 5B53A 5A6VA 5DX1A 1UBHS 3U4GA 5GIPE 1KAHA 1ZXXA 2C4KA 2GGSA 2X41A 1GNVA 1X9GA 3QKUA 5LZ2A 3LHFA 4Q7QA 3Q3CA 1EJBA 3ZBTA 2R1UA 1R0RE 1SU7A 2HBZA 3ANXA 3CA8A 3H18A 4C4OA 2WBLC 2Q5IA 2Y3IA 2Q07A 1QOZA 1R37A 3H2ZA 4Z7QB 1U2SA 4OKIA 2QN3A 4HWKA 4JOBA 1XL1A 1RHRA 2B98A 3T9FA 3U3KA 1ELOA 1SVIA 3G49A 3JR3A 2UYYA 4JQYA 1JLLA 4DEVA 1D2AA 1G2OA 4YVFA 1XVLA 5D7BA 5EJEA 2ORIA 5AM2A 5IBQA 3VVBA 1MZVA 2G72A 2HSZA 2VHVA 5EWLB 3WIEA 2UU9B 4A36A 3ZBPA 1BMFD 1E98A 2CDAA 3LYLA 3M6FA 4MQFA 3N6VA 2IXBA 4N18A 3ZDEA 3DZCA 1HE5A 2X15A 4KWIA 1P4HA 2FW1A 4YXWA 3U44A 2XZLA 1E2GA 5FORA 5BWNA 2NUAB 3AB7A 3H1AA 2JRCA 3E03A 1A8IA 5ULLA 2V59A 3STWA 4BS9A 5BSVA 1S9DA 2C92A 3PVZA 4DV3B 2ZT6A 4LRXA 3OZFA 3VR6D 3I2YX 1RM3A 4HQKA 2XMSA 1KF0A 3ERCA 3SGLA 1RXSA 4Z53A 4KXFB 1EJ2A 1GCAA 3HKCA 3CM0A 1VM6A 1RWOA 1OKKA 3AHFA 1OGIA 3O8LA 4M0PA 1NFQA 2WJVA 4MP3A 2A9PA 4RXTA 3KKEA 3TK1A 2XZDA 3N2KA 4DJJA 4AQDA 1AA9A 1WUYA 2X77A 1OZFA 2G4LA 4PF1A 2OESA 2FP4A 1D2RA 3VKWA 2OLJA 4F5EA 1Z2EA 3VOSA 3EFBA 1XNHA 3GNTA 5AYVA 1WOMA 2IYWA 2ZRCA 3A04A 3NH9A 1GA4A 3ICWA 5FL7A 5EZQA 4M76B 4D8WA 5JYCA 3V9PA 3BL8A 6CHYA 1YACA 3RS2A 1ZN7A 3HABA 3JQCA 1YDGA 2QTBA 2ZYHA 4QHSA 1ZNQO 5KWSA 2Q1UA 5DPMA 1XEAA 1RVDA 3EZ7A 3QJYA 3GLIB 1T2NA 2AI3A 2GPNA 1Q84A 3FF1A 4G1CA 1FIUA 1KYQA 1SCIA 2D7DA 3FNHA 2ODNA 4OXQA 5CM9C 3O3MB 2XXAA 3OMLA 4HMOA 3N2IA 1GL7A 1T9GS 5CDYA 3GLGA 2BFPA 4U7JA 3TRFA 2FHPA 4LWZA 2GTIA 1XVAA 3JARA 4Y2PA 4OMUA 3ZQJA 1H2AS 3FHJA 3HDHA 2WA1A 2CLKB 1EK0A 1Y81A 2H4JA 1T6XA 2R2GA 1KU0A 1QM5A 4R2MA 1PJLA 4TTTS 1J0XO 3QPCA 1H8HA 2IEDA 1EU1A 1KQNA 2XT6A 4IX1A 4UHHA 3DV0B 1CD5A 1UK6A 3D59A 1CUDA 3QXCA 3RVSA 1KYWA 1MB4A 2XW6A 1AH2A 2V3VA 1VRVA 4KWCA 1IH8A 4U6NA 4YJ3F 3N0TA 1N5RA 2VP4A 3W3AA 5CT6A 2FRDA 2AXEA 2OHHA 1SVUA 2HMSA 4KSYA 4DSTA 2JJ2D 1AY0A 4PRZA 4EJ6A 4TSRA 5HYVA 4DSZA 3ETHA 3QLTA 4MVJI 1N7HA 1JEJA 2E2WA 4DQLA 1T4CA 5JXWA 4R1MA 5CFRA 1QHHB 3KX2A 4DMGA 2BDUA 2OILA 1CUCA 4EO4A 1PJSA 1F2UB 2JFXA 4JLKA 4P35A 1ZLYA 1HYQA 3JWGA 1BRTA 3ZW7A 1X1QA 4BEBA 5BY2A 3IVMA 1OLSB 3H7AA 1L5MA 2YUTA 2ZPUA 3ORSA 1BX1A 3EVEA 4GBED 3CYFA 4RS4A 2JLBA 4XM1A 4NG5A 2R8OA 1S2MA 5E7QA 4ZAZA 1N6NA 1TUBA 3NJ8A 3U26A 4CUKA 3I9LA 1KK2A 4OPMA 3HDGA 1TJPB 4MSUA 3OIWA 3FFWA 3SXUB 2PMWB 4KFTA 2ZSBA 4JELA 5DXFA 4XDZA 1BW9A 4JJEA 5HKKD 1FP4A 1UK8A 4CIXA 1ZITA 4OOFA 3QUCA 4MS4A 4WJLA 2WE8A 4J76A 5DGXA 1MQSA 5C8XA 1MO4A 2BHSA 3NWJA 3BZUA 1VJ5A 3A4TA 2DSTA 5DGTA 4KACA 2CLDX 4W5NA 4H7DA 3SNKA 2D0IA 3KIPA 5BMVB 1QQ7A 4JU8A 4RA9B 4TWAA 5GM1A 4DCGA 3VNVA 1RLTA 1RRMA 4LE1A 3S1AA 4R1QA 4DM3A 1QP0A 7AT1A 3R4CA 1QB7A 1V47A 4G1EB 3TIFA 4U0KA 2VJDA 4EG3A 3WK4A 4Z4GA 3SF8B 4J1TA 2ID7A 3UUGA 2CE7A 4CMIA 1J9ZA 1DOZA 2J6IA 4CLXA 5K6AA 1N6IA 3EPHA 4U2BA 3R40A 2DPLA 3CEPB 4KYIB 2C4MA 1XHLA 4G5GA 2IYUA 3DLAA 4KBYA 4WESA 2GXSA 3TB4A 1ORHA 3ET4A 1U3UA 4F1WA 1DAKA 2O5CA 3PRYA 4MUMA 3L4SO 1BWQA 2RH4A 5D00A 1F20A 3PUVA 4TUYA 3QG5A 4AY4A 1VPWA 1TU0A 2P69A 4CKCB 3DTTA 3NTRA 3WMXA 2XVYA 1KSHA 4TMKA 5IYZB 4ZV7A 1Z5WA 3TPFA 2V4UA 3FZYA 1IN8A 1RMQA 2YJNA 3C41J 1RTTA 4X63A 2JI6A 4FFDA 3VC2A 3R6LA 4QU9A 4ZYVA 2XMQA 1NE7A 3AEKB 2WJYA 1CDOA 1DS6A 2JB9A 3LQYA 4NAUA 2RD2A 1JB9A 3H8VA 1O77A 1ZUNB 5C34B 1YULA 4RMGA 1L5LA 3SEQA 4BYGA 2I3AA 1EFPA 1EPUA 3D8SA 3LFHA 1ZJ4A 4QDUA 4ZODA 2OXRA 1GG5A 5HBRA 5KQMA 3S81A 3U4MA 5AM0A 2JFHA 1AK9A 1QIFA 2G80A 4KKVA 1NU8A 4AZ0B 5LZ8A 5FUXA 2ZS9A 3ULKA 2NTYC 4CT4B 5ARBA 5ALYA 1LBQA 4JP5A 2AFIA 1M8JA 3CLVA 5LQRA 4FB5A 3WYCA 2YOGA 4K6KA 4IX9A 1L4MA 1DDOA 2AK3A 3G9TA 3GEBA 4GW3A 2JFFA 1JQLB 2VH5R 3L9XA 2WFLA 1SZPA 3OEHA 5ECGC 5HFNA 5JFOA 3OVMA 5DBHX 1YMQA 2FWBA 2W2LA 5CXXA 3LUGA 4GPD1 5KOJA 1H65A 2IDKA 3GOHA 3LSYA 4BO7A 2W6MA 4HTFB 4L95C 3WSWA 3MTIA 2PS3A 4RS3A 4D7AA 5AK0A 3PJGA 2PGJA 3K0HA 4HH1A 1V8BA 4NJEB 4X90A 4QLBA 3E2PA 3Q3EA 6LDHA 3JQ8A 4QD3A 3UUWA 5CT5A 2BE7A 3AC0A 2OB2A 1TB4A 5HQ3B 3VTAA 2IA5A 2XDWA 2HCBA 1RLMA 2C0QA 2EEPA 3NBXX 3K2IA 3NBYC 2OZKA 1D1TA 3RYTC 4W1PA 2WSSA 2WPNA 4ZAVA 1QH0A 4JQCA 1II8A 4HFMA 2PSFA 1KFKB 1TF5A 3QVGA 3CXRA 2HUPA 2AZXA 2QX8A 3CY6A 4O5AA 4BB9A 4FMCF 4KXQA 4UHJA 5CRIA 4X85A 1ZL0A 3WSTA 4S0XA 1KAEA 3C7AA 3ORFA 2H2FA 4NF2A 3HXTA 4TQAA 2QE7A 2O57A 3FBWA 3WLAA 3AMVA 3W8NA 1AUXA 1X7ZB 1W5EA 1JI3A 5AW1A 3SQWA 1IONA 3TIXB 4E1BA 3BE5A 1YF3A 1AHNA 3U16A 3PNSA 4LJ7A 3WNDA 5HXAA 4ARIA 2AKEA 5ALMA 4WBNF 1JIUA 2XF8A 9MHTA 4R0NA 2G9VA 5F9FA 1KKMA 4S12A 3ZY5A 5KQGA 1U65A 2W83A 4GYKA 2Z3WA 3I6MA 5BT8A 1JRLA 1YIDA 4GMDA 4M36A 4DLKA 4KR7A 3AOEA 3OKPA 4BQFA 1ANKA 3QEAZ 3AV0B 4NCJA 1NAIA 2P62A 2PSSA 4INPA 4DE5A 1T43A 1JPJA 2ADMA 4E12A 4JQSA 3KUXA 1M2VA 1E0AA 3O2JA 3RG8A 3PGA1 1N2GA 4L4YA 1UJ2A 5A5EA 3I9JA 3ZNOA 3Q8LA 1K3UB 1KA9H 1Q3HA 2XA1A 1RXWA 2YWBA 4CM8B 2VHZA 4L8LA 1PJ8A 4ITVA 4QGGA 3E4CA 4B85A 2NP6A 2VI5A 3I1YA 1BU8A 5BUQA 4ZJPA 4HN4B 1O6ZA 2VFAA 5AJVB 1ZIOA 3H84A 3O7MA 1P17A 2DWQA 3EA5A 2MSWA 3DO8A 4FJ0A 2JGFA 2PXXA 5EXSA 5CW1A 2V03A 1FSSA 2RH5A 3ZD6A 1JFLA 1ESMA 1LDBA 1U2DA 1T25A 1KY5A 3AHDA 4TS9A 1GEGA 3W2HA 3SQXA 4DB2A 3V8MA 3JQPA 1WB6A 2ZUDA 1RDFA 1A72A 4FXPA 1AMOA 4W8HA 4G0ZA 2ZJ5A 2ZKLA 4N0MA 3BH0A 5F3RA 5TQJA 4CQMD 3AYXB 2X22A 3DNPA 4C4AA 1TUGA 2I6FA 2R1VA 3K0CC 1GSHA 2FWIA 3V6LA 1ONOA 3KXDA 4EHAA 2DKNA 4OHOA 2QLTA 4ZJZA 2ASVA 3E3LA 2NVOA 3VNRA 4BEWA 4L72A 5HNKA 3QENA 1NY5A 3BT7A 1UEJA 4PSKA 3ZYCA 3ND9A 3Q2KA 3B2EA 4MYDA 2VYCA 3P4UA 4OHBA 5CLHA 5TQ2B 4B47A 2GYVA 2AOTB 3AVPA 4GF5A 4KGXA 6Q21A 3DGEC 1T9ZA 1U3TA 1N8SA 1USIA 1ZSYA 2VF2A 3BDVA 2F7SA 4H3SA 3ZQ4A 5GINE 3I83A 4FMDB 2VBIA 2H1WA 4Q1AA 1VTKA 4XM2A 2VAWA 3ZWOA 5DEIA 3MEQA 2QNBA 1DFGA 2NUAA 1KYYA 1TRKA 5IP5A 5JNSA 5LDDC 5KNBD 2XUHA 3HWRA 1R0BA 4DDHA 1P2VA 2YASA 4AMGA 1YFZA 2WWYA 4DV4B 2W48A 1V9LA 3D5EA 4I8IA 4J0KA 2VK1A 1HLPA 2FPSA 3L7LA 4JSYA 1YB6A 3H3FA 4MYCA