1G2PA

Crystal structure of adenine phosphoribosyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
170
Chain Sequence
SYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYESDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of adenine phosphoribosyltransferase from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE 1
total genus 49
structure length 170
sequence length 174
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g2pA00
1R3UA 1P19A 4MB6A 4QRIA 5JSQA 1I5EA 4P81A 2P1ZA 4FYMA 1I14A 4RACA 5HIAA 1AO0A 1HGXA 3OZFA 5BQOA 1QB7A 2GEBA 1A97A 1QB8A 2C4KA 5KAMA 1I13A 1ECGA 3O7MA 5K51A 1ECCA 1Y0BA 3M3HA 4RHXA 1BZYA 1UFRA 1PZMA 4P83A 4QYIA 1U9YA 1QK3A 1BD3A 1IBSA 3OHPA 4X45A 5HKLA 2VFAA 1VSTA 3GEPA 1UPFA 1L1RA 1GPH1 2HCRA 1QCDA 2JKYA 4OHCA 1STOA 2JI4A 3ACDA 3S5JA 4Z1OA 5IAOA 1A98A 1BD4A 3MBIA 1NONA 4IJQA 5ESWA 3DAHA 1J7JA 4LZAA 1FSGA 1ZN9A 3LPNA 3N2LA 1ECFA 1O57A 4JLSA 4KN6A 3LRTA 3ACCA 2JBHA 3MJDA 5BQPA 4QYIB 1A3CA 1P18A 1G2PA 1MZVA 1LH0A 1ECBA 2FXVA 1QK4A 1VCHA 3G6WA 4X44A 1JLRA 1WD5A 2PRZA 1I0IA 2JKZA 1DKRA 4RHTA 4RV4A 3ACBA 1I0LA 1CJBA 2YZKA 1JLSA 1YFZA 4WMLA 4LYGA 4RQAA 4JITA 1NULA 1L1QA 2DY0A 2IGBA 1XTUA 1VDMA 4M0UA 1GRVA 2PS1A 4RABA 4RQBA 5JV5A 4ZFNA 4P80A 4RADA 3GGJA 3GGCA 1DBRA 4P82A 1P4AA 1A96A 5IPFA 1V9SA 3DMPA 2EHJA 1G9TA 4P86A 1A95A 2H06A 4WN3A 1OROA 1TC2A 4P3KA 4RAQA 1DKUA 5BSKA 4P84A 3EFHA 1OREA 4LZNA 3HVUA 1QK5A 5ESXA 1DQNA 2E55A 1P17A 3DEZA 4PAWA 2PRYA 1D6NA 2H08A 4RHUA 1TC1A 1DQPA 1XZNA 4RANA 1XTTA 4TWBA 1ECJA 1O5OA 2XBUA 4RHYA 2AEEA 5KAPA 1XTVA 1QCCA 1W30A 1ZN8A 3H83A 3OZGA 1U9ZA 3QW4B 3KB8A 4RAOA 2WNSA 2H07A 5BRNA 1XZ8A 5EUCA 5E38A 1Z7GA 1G9SA 3NAGA 4LYYA 4LZOA 4PFQA 1HMPA 4S2UA 1UPUA 4M0PA 1OPRA 1A4XA 4M0KA 4F8EA 1G2QA 1ZN7A
chains in the Genus database with same CATH superfamily
1SZJG 4X85A 3H4TA 2IU3A 2HYDA 3UWMA 4FEYA 4ZV9A 4XPIA 5EMNA 4YHHB 3TCNA 1EVKA 5CX1B 4DANA 3GLGA 3GJSA 3OQIB 4GI7A 1A97A 3BJMA 4IV0A 5D6OA 5BSFA 1JBQA 1QH9A 5LBTA 5TQVA 3ZK9A 2B36A 2PK3A 1UFOA 2YWXA 3L6OO 1YK0A 3D5TA 1TF5A 1NGSA 2XRYA 2O5VA 5A9SA 3BFJA 5A2GA 3L6UA 4EMTA 1DI0A 2X58A 2EJWA 4C0SA 1II8B 3F6PA 2GYUA 3GMIA 3PJDA 2XUIA 1ZD4A 3O38A 4BNWA 3IERA 4DG5A 1JQKA 1Z38A 1Y9EA 2V6MA 1RPZA 3PRYA 4BO4A 3HR7A 4TV8B 2NUAB 3VHRA 3LX5A 3PRHA 3LC1O 2BGRA 4OK6A 1H6DA 2GPTA 3LVBA 4RFVA 3QJ5A 4LG1A 1EQ2A 1JHDA 3TX6A 3W7AA 1J0AA 3I9MA 3KYJB 3IMGA 1PZEA 3IR5A 3CLKA 3ICWA 1I5RA 3NO4A 3OD5A 1JU9A 2ZIGA 3QELB 3JTMA 2ALJA 3EBLA 5B3AA 3NH9A 4CFYA 3C45A 5IG2A 4L4XA 3Q9SA 5FTWA 2X0JA 3FPFA 4XD7D 1R0WA 4YJ2F 2E1PA 4L07A 4MRSA 4OGWA 3RYIB 3U44B 2E82A 4LF7B 4IYJA 5AUNB 3SJ7A 4S04A 2ZP1A 1GN8A 3TLGB 3CY6A 1H2YA 3ZBTA 5B57C 4FFPA 3GRPA 1CDDA 4FSHA 1GPNA 1DKRA 1OAAA 2I4RA 3A0UA 4J7XA 3ND5A 3WZ2A 4HLUA 3FRIA 3CR3C 1NXXA 4I9HA 1TYBE 2ZB4A 4NBWA 3QPWA 3ETGA 1PKXA 1KYYA 1AGRA 4JODA 4YI3A 3VKGA 8ABPA 2DMRA 5SY9A 3KTFA 2LTAA 4NDAA 2YN4A 3CLHA 5I7UA 1ULUA 3NH6A 3SEAA 4XJSA 3RFVA 1WY7A 2J0UB 4Q9AA 3TLKA 5HA5A 2GKSA 1DZ3A 4HNTA 3NZEA 1HDGO 1Q6YA 1P0PA 1XRMA 3AF3A 3I32A 4MTLA 1W5SA 2R85A 2VP6A 4IOKA 4QJ5A 5DVZA 3SJCA 1IC6A 4H15A 4MUIA 3BERA 4BKOA 3MWEA 1H1LB 2CLMB 1KEEA 5E6SA 3N6RA 1WXGA 4RJTA 5JEEA 1A7KA 4DCCA 5LKAA 3FNIA 5ICEA 4F2DA 3GUZA 1IE3A 3UJDA 5JZMA 3DDSA 1P4SA 4YV1A 2GK3A 3DDWA 4KN9S 1M6WA 2HDWA 2LKDA 4BC1A 3FPCA 3NHLA 5H59A 4BP3A 5CYGA 2Z2KA 4Q9LA 1NN0A 4JOBA 5DWVA 2JIRA 4UTRA 1O5OA 5AM0A 3E2MA 1NUQA 5FOXA 4R8VA 3U3KA 1XXHB 2FJ0A 1FVXA 2XKJE 1HFWA 3D6AA 2BN4A 3VHXB 3IXLA 3CVOA 2FF7A 1Y6QA 2WNSA 2WTAA 3L5OA 4KG7A 1NW4A 3A1VA 2R00C 3ER6A 2GRAA 4E5YA 2FYTA 5JXJA 4ENSA 1U0EA 3HJHA 3IAM1 1XB2A 2BY4A 5IM5A 5EXEA 2P5SA 2KBEA 2JJ1D 2I6TA 2QXUA 4D8WA 3QELA 2LDBA 4NBVA 2PTHA 4GQBA 2WUFA 2WWRA 5KEIA 2HHAA 2WD7B 3VVCA 4U63A 1P19A 3HUDA 2REOA 5JZSA 2GCGA 4P81A 4EJ6A 1YFLA 4PZZA 3WWOA 4PRLA 1GG5A 1EFRA 2VBGA 4EBFA 1UMCB 4E12A 4PXAA 1VMAA 1EX1A 1I24A 3QKUA 4FWIB 4Q39A 4X71A 4YAWA 2GPWA 3KPYA 2OHJA 4LNAA 1JAZA 2EP7A 2WA1A 2WJHA 3P0IA 4FMPA 4FZVA 4RHXA 4ZAVA 5DM60 4XWWA 3EXEB 3D8BA 3DTTA 4DIDA 1WU7A 1YU6A 2AMLA 3AGQA 3DE5X 2P1DA 4XR4A 2XVZA 5CNKA 3RS5A 4BMCA 3T34A 1EJ6A 1CW2B 1VSTA 3TTUA 1ADYA 1H9CA 4YMWA 3K5IA 5TQJA 3TNFA 2CXRA 1CUDA 16PKA 1G7CA 2H4HA 3AM5A 4K9OA 1X7XB 2FP3A 1QQ6A 2ESRA 3DEJA 4RPJA 1GTJ1 1R9GA 4CN9A 4I9UA 2P2SA 5H80A 2UUBB 1QYRA 1E3MA 3N0WA 4BXOA 5H4GA 2XMQA 3HFGA 4RW0A 3F0TA 3LPNA 9ABPA 1ODSA 1R00A 3WAKA 1AK9A 1O9HA 2GUGA 5JCJA 2GB4A 2PUVA 5E6SB 2CZCA 1YQWA 4DTIA 2QL7A 3FROA 4YGYA 1P9WA 2WU1A 3A6FA 3FYTA 2J8ZA 2NZYA 4KAJA 3V9PA 3BEOA 4IHJA 2LXNA 3ZVLA 1U3WA 4S1VA 2WWFA 4UUPA 5ALDA 4ETIA 3AP2A 5FORA 3ZDCA 1VHJA 4CNBA 3MTIA 1UXGA 3KSUA 5BWCA 4Q3CA 3KQSA 2X6QA 3R1IA 4MIYA 3KALA 3CH4B 4DSOA 1L3BA 3JQPA 2NADA 5GGYA 4MV3A 3GU3A 3KR0A 3GWGA 3CUWA 4M7OA 2ZI7A 3KDPA 1L7QA 4F8YA 3TF5A 4IDBA 2QLLA 1K8XB 2D1SA 3EY9A 1SVOA 2PUAA 3JQAD 1W4AA 3QFCA 1FYVA 4ZVSA 1TRKA 2H4FA 3PFWO 3TFWA 5LQSA 5I5GA 4Q37A 4BCCA 4DW8A 2VQ6A 2QRGA 2G70A 3D0QA 3HUFA 3QH4A 1T9GR 3KOXA 4ALJA 4DLSA 4JGIA 4ESOA 1DLJA 3LF1A 1IK4A 4GE0A 2ORVA 4HMOA 4QOFA 3U44A 2VJOA 1WHTB 3AESB 2VKTA 5JNUA 2O6LA 1A95A 4KQMA 5FWDA 4QG3A 3QZUA 5IMBA 5A03A 4KREA 1JHPA 4Y7DA 5FIUA 1JYSA 3G9QA 1A9RA 4FFRA 5BSKA 5DN6D 4CQJA 4IQ0A 2D1YA 2ERXA 2ES4A 5TMBA 1C1XB 4HSEA 4XTCS 2I87A 2WUEA 3ANYB 5I45A 3PD0A 2ISCA 4NSNA 2REBA 3HEBA 4H7FA 2NIPA 1FX0A 3E5MA 1V8BA 3W2TA 1DQPA 1V3QE 3OTIA 2Q4BA 2IHUA 2Y9MB 2YV4A 3NDRA 4LXIA 3TIGA 2BFDB 3V55A 3ZIAD 3BPSA 2ASEA 1HLFA 3GARA 2VWGA 4NBUA 3V2GA 4BBAA 4BO1A 4CYMA 4W9MC 1L3CA 3VX4A 2IYYA 5BW6B 4JFRA 5AVWA 1TMGE 4Y18A 1YD7A 3NV9A 2C58A 4D9MA 3O4FA 2H52A 3ENKA 4R1UA 4A8HA 1G6Q1 4M1SA 1Z47A 1T4BA 4NR0A 4H6WA 1JBKA 1Q1ZA 1TTTA 3L7BA 4JHXA 4LYYA 4XWKA 2C8LA 4F84A 1DO2A 3LMKA 3ZZMA 2QJOA 1UT6A 1XNGA 1SC4A 2ETXA 2XZPA 4IVPA 3D1VA 4PINA 4E5UA 1T36B 1TZ2A 1JG4A 4QTYA 2G9UA 4M8SA 5GADl 2REQB 4DWVA 1EEHA 5K8IA 3AM1A 3K4QA 1SA0A 2M9MA 1BDBA 4P22A 3WIVA 2VO1A 4OIFA 2B1JA 4L0MA 2WYHA 4V0MA 1QV7A 1PDOA 3RS7A 4TZKA 4PE5B 4MQLA 1GPLA 2R8PA 1U0JA 4O1MA 3O8DA 1HNZB 2A3RA 4QUHA 3VOSA 5ED4A 2MYNA 2QN3A 3EZGA 3WL6A 4LC9A 5DM0A 3O9VA 4L9RA 2YMLA 1FS4A 3A4NA 1JEQA 2VNKA 3A36A 5DX8A 5TGZA 5A0VA 1NLZA 3S0JA 4QRHA 1SBTA 1EVLA 1PUJA 2YC2C 1GADO 4LF6B 3DBLA 3EXAA 3F3MA 3QPAA 4MQEA 4UCWA 3K9NA 3EGOA 1K0FA 2XODA 5D1NA 4E0BA 1EUQA 1ZPDA 3HBLA 5KDDA 2F9MA 4GGMX 3WXMA 4QU5A 4NJMB 4CEJA 5GTDA 1AKWA 4BVLA 2X9QA 3MERA 3K2BA 4U2FA 1SU6A 4A0QA 1FBTA 3UA3A 2BM9A 2DT8A 4UUBA 4CM9D 3CLTC 5CH8A 2YFQA 1AIPA 3AHHA 3ED5A 3QU2A 4IQFA 3GP3A 3NS7A 1R0BA 2PSJA 5JH7B 1IEVA 3VR6D 3VDNB 4B84A 3NHYA 1LNZA 1TM1E 1FDTA 1J22A 1UXKA 2OQ2A 1Q21A 2ZTHA 3TL3A 3MILA 2ZM6B 4Q4HB 4LJRA 1VL1A 1JR4A 5EWJB 2PKYX 2RAFA 2DU8A 4BJHB 4UVEA 3FGZA 2I76A 1QTQA 4HX5A 3PLNA 1CYDA 2AX3A 3GRRA 1O94C 1EXDA 2X8WA 3DV0B 1W4CA 3T7CA 1E9DA 2PGAA 4WMLA 4DJ5X 4TPKA 3O2NA 2EJVA 3I2YX 2Z2XA 2X86A 2RGXA 2XE4A 3K0AA 3N8GA 4JR0A 4YP5A 2XUZA 1RFLA 2C4HA 5D7NA 3Q8MA 1X70A 2GTPA 4X95A 3TB4A 4G23A 4DT1B 3PFBA 1Y5MA 1GL6A 3NUZA 1COWA 1P62B 3IQHX 5EJAA 4RVUA 1ECPA 3R3SA 4H31A 4IR7A 3T9FA 1IOLA 4A6EA 5KJ6A 3T0GA 2IXGA 4WBNA 4G1FA 4BMOB 2F55A 4GYWA 5IAGA 2R1TA 4PZ0A 1HFJA 1H2XA 1YR8A 1J0XO 1RRVA 1U2SA 1DEHA 2IOYA 2WYOA 2PZBA 2OCXA 2X9LA 4FUQA 4ZC8A 1B0ZA 2JFVA 2A1TR 1SA0B 1SCKA 4GNKA 1E2KA 4GRDA 4EJSC 3DL7A 5C81A 2WTNA 5HMLA 1W47A 3FYCA 1TU4A 1L6RA 3JV7A 4DZZA 3AVWA 1P2TA 2DJ5A 3EFHA 4XWOA 1NXQA 2CMHA 3FGPA 5FBRB 3RHZA 4B7AA 1AKMA 4A3SA 1EXVA 1B6RA 4Q4AA 4DNXA 1MRSA 3BZUA 3HH8A 3PNYA 2Q99A 1CQJA 1TC1A 1ULSA 2I54A 1O87A 2AN1A 4G0QA 5GJWC 4QTUB 3M5PA 1YB7A 2IYLD 3C8MA 3ONVA 2XBUA 1DKLA 2EG9A 3G2OA 2NZUG 1E0JA 5CLIA 2QMUA 1XA3A 1YE8A 2D2IA 2VZ9A 3BWCA 1VA4A 2D0DA 1O4WA 1MP0A 4MVJD 4YRJA 1KFKB 2FXIA 1KK2A 2ZUUA 2GEFA 2JI7A 2QLNA 3HVJA 3MWGA 3OPNA 1IH8A 3RYIA 4GXNA 4E2YA 4EI8A 3RUHA 4G37A 2Q5JA 2G40A 4E6EA 5DTRA 2K7FA 5BSVA 2NPOA 1XFAA 1OZGA 1R3UA 1C30B 4B44A 4NYMR 2OC9A 5KYUA 5CHEA 3WC4A 4FVTA 5M7EA 2JBWA 3F2IA 3KV1A 1F5NA 1Y8AA 3BC1A 3K3PA 5EE5B 1LX7A 3AI7A 2W00A 2JK1A 4QPZA 2COKA 3LP6A 2CNBA 3FOAA 2AZDA 2O05A 2AG1A 1TUIA 3I28A 1EUDB 1XZGA 1ZOSA 3D59A 5KKCA 2O4UX 2QP4A 2V7XA 2XJ9A 4DREA 2WKQA 3DV0A 4LGVA 4KV9A 4IF6A 5M34A 5HKAA 1JAXA 4JI1B 3C5CA 4XAQA 5F3RA 1EINA 1RQ2A 2C2MA 1D2CA 3CMCO 4DCGA 1XZLA 1O94A 1BW9A 3EK2A 1T5SA 3RRBA 2W6QA 3E9NA 3K09A 1VJCA 4GSYA 5DX0A 2WMOB 4AF8A 5BSWA 1UFQA 3I42A 2C5BA 4ZAXA 3INTA 3GLSA 2VHEA 4HL6A 2P8SA 3DDZX 1GZ7A 1ZA1A 4ZO7A 3STYA 1Y5IA 5EP3A 2Q46A 1TQ8A 5KINB 4I4CA 2BTQB 2QXTA 1OB5A 3EY4A 3PB3A 4JB2A 5FWAA 5EERA 2IH4A 1MQAA 1DIRA 1IXZA 2QJFA 5C4IA 1PT6A 3DKIA 3HL4A 1CR6A 1CQJB 2ISSD 4GGPA 4MINA 4YJHA 5TE9A 1O89A 2C0QA 2GWRA 4EHDA 4DDTA 4BMNA 1GTG1 2QW0X 5CX4A 1SU8A 3WE7A 3OFKA 3AB7A 3K9FC 1F4VA 2FW9A 2QTRA 1YO6A 3MEQA 4FIDA 2DEUA 4MA5A 4M8LA 4EPRA 1M33A 1P39A 3EG9B 1PJLA 4QO7A 3AZQA 4MIEA 4RMGA 4J7UA 5LQMA 1YR7A 2HO4A 4WZAE 4IO1A 4NG4A 4RZ2A 4YJDA 1WETA 1GGHA 3VPXA 3IAS6 3VNSA 5A5DA 4B7ZA 3L84A 5CIQA 4C7KA 1ZM3A 3JZDA 1WMDA 4MVJE 1U3GA 4WBNF 3LLCA 4XSVA 3BMXA 4G63A 3CRVA 3QOWA 3L1UA 1U8UA 3WQQA 4C7VA 2XOXA 4DCOA 1DQZA 1J99A 5J5CA 3TRJA 5BSTA 4B8WA 1IOZA 1BCSB 4KLRA 3RK0A 2CV1A 1N6OA 2QAGC 1BS1A 2YV2A 4BFTA 4E88A 1I6WA 3MF4A 4FR0A 3HGTA 4P84A 3H4MA 3AW8A 2L18A 3PICA 2AG0A 3SC6A 3I9V6 1HG1A 1LF5A 3ETNA 4GR9A 2RGDA 1TVKA 1FC0A 1JVSA 1PT9A 3ESCA 5FWYA 4CLHA 1X7XA 2FLWA 1IVSA 4HYTA 4ZOLA 1PFGA 1XTVA 3PDCA 1CUVA 4MYUA 4LE1A 4YJFB 2GN1A 5EKSA 3LYHA 1XZJA 1RCUA 3EEBA 1CUBA 1UXIA 5AM3A 2PT6A 4W1PA 1E2JA 3ILHA 2X0RA 2Q3MA 4FHDA 4I1IA 2R7LA 1PR1A 3S8YA 1N3BA 2WQ6A 1FNDA 4K9NA 1Q0TA 5CD1A 1U1CA 1WU8A 1H8HD 1NMXA 2YL2A 3GDHA 3Q8LA 2XUOA 4BVBA 3CLSD 1SUBA 1ZN7A 4PXSA 4Z0PA 4D97A 5DW3A 5B6PA 2PJUA 3KP1A 1AY0A 1T5DX 4M22A 1BJKA 3KAQA 1V96A 1OKKD 2RK3A 3ZVRA 5K99A 3CIFA 3SQMA 1JHAA 1XNJA 1O9BA 5IKPA 2Y0PA 3CINA 2Q9UA 3HB4X 1C7JA 4JDUA 4DM4A 4X7PA 4ETNA 4MZXA 5FPSA 3CVWA 3ETEA 5FR1A 2HQRA 4YCJA 4YJHB 3T1OA 1EZZA 1PDVA 4B4UA 3KFVA 4RTSA 1C8VB 2JGEA 1OXKB 3R75A 1YZQA 3CW8X 4BBPA 4X54A 3UG6A 2V3WA 1MVNA 1EVYA 4Q21A 2WWYA 3SF0A 2NN3C 1CF4A 2GZ1A 2Z08A 3BKXA 3VZRA 2HF8A 2ZYHA 3DL0A 4O4IA 3UC9A 2EW8A 2HPZA 2IQIA 5DWQA 2VWQA 4LHWA 2PSDA 3E1SA 3QUTA 1UUFA 3ZK7A 3GLFA 5IP5A 1GA6A 2NW6A 2PGOA 3GPDG 4GMFA 3I9FA 3DHYA 3OLWA 4NABA 4RIEA 5ALNA 5BYKA 1WMBA 1IHOA 4D3DA 3L8YA 1J9EA 2BISA 4D9GA 1B42A 1KOFA 4BU1A 1RKBA 3T1QA 3BWBA 1UBNA 2I1QA 3LGSA 1DEXA 3IVXA 1XFDA 4M53A 4PC6A 4Y9SA 3WMWA 1A7UA 2P9FA 1N4DA 4MKHA 3MJCA 5JDCA 1ISJA 5KX5F 2AC4A 2QA5A 3KK0A 3L93A 1GCOA 4ZEVA 4FR2A 2ATCA 1V26A 1FTQA 2R6JA 3GYBA 3V1LA 3AUSA 3GYGA 2FXVA 4AJHA 3HL0A 4RK4A 3IODA 1JMVA 1SBHA 4XYGA 1J1ZA 4LDRA 4C2TA 4EFLA 3NTXA 4J4TA 2D2EA 4X1OA 3U4AA 3DGFC 2F8TA 3RS0A 4KPYA 3L7LA 2P69A 3ZXSA 5I4KA 1EFPB 4AS1A 1XTSA 5J23A 3DE1X 3CKMA 2PX6A 2QD5A 5HMMA 1GAWA 5LBUA 3AEKB 1X9GA 3WIOA 1U0HC 2RGYA 2B37A 3GWZA 1NG9A 5HQ3A 1TO2E 1GNQA 3MMSA 2HYIC 1JYFA 2ORIA 6REQA 3TAUA 2BR5A 1CS0A 3I6YA 1DFGA 2PAAA 2JFHA 1QVZA 1TT5A 2QIPA 3GCZA 2XUJA 1TO1E 4QU9A 3VPDA 3M34A 4N6OA 3OJFA 1TMKA 2A58A 4KVGA 4RVFA 1P7PA 5E1BA 2GZDA 3QVOA 2IOFA 4PBTA 2H4YA 1SB9A 4WLUA 4XPZA 2AJCA 5DM1A 4GM4A 4BUJA 1P3DA 1WO8A 2D1RA 1DBQA 1U0SY 3BF8A 4F56A 2DWCA 4EJSA 1TK9A 3VR2A 2FSVA 3IE1A 4AKIA 3DB1A 4J94A 2DHRA 4QEDA 3DAOA 1Z6GA 3MB5A 4WZAB 3WI7A 3PNMA 2VP2A 4RHYA 3FPBA 2O5EA 4X6LA 1X94A 4QYXA 2EWVA 4DMRA 1W581 3AETB 1D4FA 3KPJA 2M1XA 2FX5A 1QCYA 1NQVA 1E9VA 1RM5A 1SBYA 2UZ0A 3DLAA 3MGAA 4D42A 4HI0E 1K8YB 1P44A 1H6CA 1TJ5A 2BEKA 4AF6A 1EHYA 1U0TA 3OU2A 1M6EX 4F8EA 4R2WA 3TPZA 1EFDN 2ZANA 4GOOD 4RF2A 4R1NA 1RRMA 3KOZA 3KYBA 4I99A 1R4NA 4NH4A 2FN7A 1B26A 4OY3A 1NNLA 4CF6A 2O57A 1E2PA 3BORA 4KRFA 2J6IA 5K7SA 4UHDA 4MSUA 1MF7A 2POQX 2QTCA 2HXSA 3FTQA 3INGA 5EHNA 1OI4A 1V8ZA 1U2GC 3PD7A 3BXGA 2Z6UA 3MOIA 5LB2A 1XQWA 1SFRA 2HWXA 2UYQA 1DVRA 1S2NA 1UZUA 2YIMA 3JSXA 3NWEA 3PFNA 3IQEA 1R7RA 2QDXA 4HFJA 1IHPA 3QMWA 3C5WP 1DZIA 4LDPA 5SICE 5E7JA 1MHPA 2JRCA 3AEKA 3KCNA 4RVHA 5HILA 5HFNA 3ACDA 1O96B 2BI8A 2GF2A 4ND1A 3P2OA 1UJCA 1C50A 1IIRA 1RLJA 1V2HE 4C5AA 4ZI5A 3RFCA 3PXGA 1P2DA 2ZI6A 1ATZA 2FRDC 4MR7A 3VNRA 3WISA 1G4UR 2RJOA 2VUSA 4EUEA 1EP1B 2VDNB 2BSXA 1NQAO 4WCDA 3DOHA 3N8IA 1KDYA 3PUZA 4GZMA 3G59A 1CB7A 2C95A 5BSRA 2W6JA 2Y0CA 3V7WA 3K5WA 2YIJA 1ZMTA 5IYZF 2IA5A 3QF7A 1R6BX 2BSAA 1Z7WA 5IEBA 4RXTA 4E3WA 2GK7A 1YTLA 3EDYA 3RSGA 4HUJA 5K9ZA 2FUCA 1E69A 1WCXA 2QYSA 3O4VA 1ZIOA 1YOVB 3EUEA 3X1WA 5E4TA 5TR9A 1PWZA 3N7UA 2JJ1A 1JR3D 3ZY5A 4ENRA 3EGXB 4DSTA 2E4YA 3CNEA 2YZKA 5JS2A 3SZ3A 4ZJUA 4OX9Y 3M5WA 1LI7A 3K9GA 4FKBA 4B0OA 4LZZA 3ZW9A 2BKEA 4FHGA 5GAJA 3BJIC 1Z12A 4JI2B 4ZWNA 1GEGA 1QMGA 4GP6A 4PSCA 4H16A 3HYRA 1EVZA 1XKLA 1N5JA 2FR8C 3WGTA 1ECLA 1VPWA 2RBGA 3VR4D 4B5KA 1ZNWA 1QVWA 1SVMA 2YY7A 1HL7A 4NV1A 1BVHA 1UCFA 1GTRA 4G2TA 4LF4B 4UPDA 1C7ZA 4BLUA 1NUAA 3KV3O 2CUTA 2IHJA 2J5XA 3HV0A 3NBAA 3ZYZA 1JHQA 4GXTA 4Y6SA 1QC5A 3AW9A 1A04A 3FKSD 1FXWA 1OREA 1X1QA 2WFLA 2WTBA 3BAZA 1C8BA 4FILA 4X8MA 3FSGA 2R86A 4LK2A 4AMYA 2NU8B 5GONB 2XAUA 4RVSA 2ZTMA 5T57A 1X8XA 3WBFA 1M34B 4RTNA 5E9AA 3TZEA 2F6RA 1P4GA 4NCHA 1UBKS 4UM9D 2VQSA 1AHNA 4KXNA 2AEEA 3DFIA 3OM9A 4QWWA 3DYIA 4F71A 4F0JA 4Q9NA 1ILWA 1CNFA 2QTWB 1RPNA 4LSZA 4Q7EA 4P0QB 3HVKA 4KHPB 1ETUA 2K7ZA 4QT4A 2ABWA 2IYNA 5EJIA 3DBVO 2I2CA 5F51A 5A0FA 3F7OA 4MR8B 2OZPA 4HNSA 4TMKA 2BV3A 4Q7MB 2A9OA 1ZCAA 2BBOA 4IDGA 2I3DA 3MJSA 2OLEA 3RDPA 1NSFA 5D3MA 4EKDA 3CRZA 5EN4A 1X7ZA 2I4LA 4TTVA 5ITVA 3HU3A 1BROA 3NHPA 1LLUA 5FPYA 3FHLA 2Q1XA 4MXDA 1G3RA 4X8HA 3A6PC 3A1WA 3JARA 3GEHA 5BMOA 4OM8A 1ZVVA 1ZK2A 1ZDMA 3CF0A 3OI7A 4K0RA 1CEXA 4MROA 3GBVA 4OGGA 2WT9A 3DBHB 4QYTA 1RJGA 3IQIX 5H4HA 1ZVKA 1BYIA 1FMLA 1R66A 5FF9A 3LQ1A 4U9IS 4AK9A 5G1NA 5IC6A 4YK7A 1Y7PA 3R23A 1RJ9A 3E53A 4ZZ0A 5EUQB 3HWWA 4IVRA 1KO1A 2F1JA 2R96A 4HPWA 2BCJQ 3DEIA 4MARA 2QQGA 1PQ4A 4E5SA 4A8PA 2I4OA 2W9XA 3CO0S 1V11A 2PFSA 2J85A 2CHQA 1R9NA 3DD1A 3SQNA 4CM7A 4CT0A 1E8MA 4PN3A 2V5VA 2GVZC 2C7BA 5CT8A 1UK7A 3AM3A 5BW8A 1ETHA 1EGQA 3CWZA 2LCFA 4N1AA 1DBWA 1ZA2A 2CYCA 2Z2YA 3MWLA 3DOUA 2H5JA 4TMFA 1G5TA 3C16C 3GLHA 4ER3A 4YRNA 1AQNA 4BQFA 4ZGGA 1ADBA 2CFOA 1ND6A 3PTLA 3BUSA 1NNI1 3C43A 3D0OA 4GUDA 4WKOA 2J33A 5T4BA 4D96A 1QC5B 4Z4EA 1BDMA 2RK6A 3M5CA 4BL5A 1E7WA 1EP9A 1YQ9A 2JLXA 3PC8C 1ISGA 1MZVA 1UJNA 4WXRA 3TLZA 1B6SA 3VHQA 1GRRA 2DTEA 1MQ8B 2ZI4A 4HAWA 1IN4A 1U81A 2A9KA 4K6KA 2XUFA 4NATA 3HKEB 1GT91 1BEUB 5EP2A 3FVWA 2PZKA 3RT1A 1HOXA 3D64A 2AHRA 4NFYA 5JAMA 1G2IA 2VIIA 4RY0A 4V1CB 4OHBA 3F74A 4OA8A 5TIIA 1JHZA 1QHYA 1A7AA 5LOVA 2XZDA 3A6JA 2SKEA 4QEKA 4J3NA 1TVEA 4BE7B 4URVR 2R2AA 1AC5A 4RZSA 5CPFA 3TIVA 1EUZA 2TMDA 4BAGA 3I62A 1YHNA 3OAAA 2PL5A 4UBNA 2X1VA 1EQAA 2DGDA 3ILYA 5LYJF 2J0QA 4LISA 1CZRA 4JHLA 2RAPA 2AR9A 3EMBA 2RKWA 3GJZA 3Q4GA 3A37A 4XGIA 5FL7D 5EJ6A 3EQ9A 2O54A 4OL9A 3IURA 2B1IA 5ALGA 1Q0SA 2XQIA 3BXEA 1MFPA 4DWJA 2AMYA 3VVBA 3ZE8A 4Y1RB 4DC1A 1Y3AA 3H1AA 2B69A 1DOZA 2FQQA 4BYGA 1QYIA 2HB6A 5F21A 4HDAA 3H9BA 1B0PA 2B78A 2JIZD 3ZV7A 1TVCA 3RIEA 4GPAA 1I2BA 4ALKA 4K9RA 4ONEA 1T1EA 3TYXA 4DXDA 4IJWA 4ZYVA 3G79A 5IZCA 4CNQA 3MBKA 4H0NA 4WHMA 4J1NA 4AFNA 4HAUA 2DT5A 4P5DA 1ZOPA 1PD0A 1DUVG 2NTEA 4EFKA 1N77A 2HJSA 4D4LA 5A5GA 3RGWS 2FCRA 3TXAA 4L2IA 5JLAA 5KPDA 4RY2A 2X42A 1FZTA 3F6SA 5TGDA 4HB4A 1M10A 2ZJ2A 4PG4A 1LSSA 4IDAA 3QVTA 1R6VA 3GLHB 4A91A 4PQFA 4D6PA 3GGOA 5P8WA 4DLLA 3K6JA 3JD4A 4HAOA 1NF3A 1UDBA 3ZI4A 4C7MA 3HG7A 1YOBA 3C8ZA 1OX4A 5LXTF 4CL3A 1HA3A 4WXEA 2BCEA 3N6VA 1Y82A 1L7EA 1PGNA 4QXMA 1YJ5A 3S7TA 3R40A 2J3DA 1QOZA 4XLTA 1RAEA 1VKOA 3AFNA 3BRQA 2XCQA 3I04A 1YI0A 5ALXA 2WT8A 5EWLB 2YOHA 4AY3A 5CBPB 3DOCA 1QR6A 4OK5A 1X14A 3VR2D 3FFXA 1Q7RA 1SKYE 3DZ8A 1E1QD 3EHDA 4RQTA 1KBQA 5B7QA 4RFLA 1L7XA 4BP1A 4PRKA 2IVZA 2P78A 2AZXA 5E95A 1GPH1 3MWYW 4LJ4A 5KCZA 3EVZA 4OJNA 2F7SA 1G8JA 5G40A 2X3UA 2B82A 3GMSA 1W25A 2WYVA 3HYCA 4B8YA 3O1JC 4WUTA 2WUDA 5TSDA 4AX4A 2EKLA 1XDZA 4TT3D 4EO7A 2CMFA 3RVQA 3N0XA 3UM9A 1A5TA 4WXYB 1YRHA 2QVLA 3B2EA 4L9SA 4BYMA 3DBHA 1D09A 4UPEA 3WOHA 3HMKA 1VJ1A 4KDRA 1QYCA 4KPUA 2NTJA 4YPFA 1U2GA 3CUEF 2RGRA 1E1DA 1IATA 1K08A 3BRWD 1Z2AA 1F2TA 1Q16A 3N75A 4UEKA 3CUKA 3V5NA 4AJNA 3NHUA 3E7XA 4FBLA 3VJLA 3KDSE 4X7RA 2W2TA 3T12A 1BXGB 4FYPA 4X62B 1C1DB 1H5QA 2FG7C 3PCXA 4K87A 5KB3A 2BJWA 3SYMA 5A1TA 3HR8A 1NMZA 2Y2UA 1X2BA 3BWVA 3DEHA 2GCEA 3UCFA 4DPMA 1WDMA 5FUYA 3UAZA 1G9XA 2HIGA 4C14A 2YKGA 4L8WB 2A0KA 4OCZA 5BUCA 1KI7A 1H85A 2OYCA 3N9IA 5IAAA 3KHUA 3L05A 3P4YA 2QRPA 2QVGA 4XZ3A 4TSFD 1I10A 1V9SA 1CP3A 2P6UA 3GNLA 3PFHA 2R8BA 4IXDA 2MINA 5ESDA 2Q8QA 1Z0FA 4PLYA 3TLGA 4L4RA 3QXCA 4KSCA 5TNXA 4HEHA 4RAQA 5EOVA 3DQQA 1IZ9A 1XEXA 1N6NA 1QHHB 4L0QA 4NV0A 2D3TA 3L4BC 2JFOA 4L74A 4P6VF 5FUMA 2JA1A 1KVQA 5K0LA 4AP6A 4KEAA 1CY8A 2OCPA 3OJWA 2JLVA 3DHWC 5HM8A 4RULA 1ECJA 1L4BA 1PHRA 3K8ZA 1EAYA 1TQDA 3QKSA 4N3CA 5KAPA 2WE7A 1OIXA 2O9JA 1Q7EA 2NXWA 1IJBA 3A25A 1A27A 1Q3HA 3I1FA 4UM9B 4CKBA 5JRDS 2OBNA 3ZQKA 2QRJA 4AC9A 1X7WA 2G09A 4R2LA 3MGCA 2A0WA 4KC0A 3GJYA 4OKNA 5G4KB 4TVOA 2XV1A 2C4WA 5J2UA 4Z4CA 3WVNA 3HCWA 4OI4A 4BKRA 1KO4A 1IZ8A 3H9CA 5I7EA 1GKKA 1W35A 2OOKA 1N2HA 4G5HA 5CT4A 4DR2B 3KG2A 1GCIA 2ZAIA 3CRRA 3WSWA 4ICIA 3TQSA 1COZA 4TYMA 2BHRA 4V0LA 3IIMA 4BKUA 1LZKA 3I5MA 3L7DA 1SXIA 2HSDA 4DV4B 7AT1A 1YVRA 5C9ZA 5CDTA 1KK0A 3TW6A 2PTGA 1DXQA 1ZINA 3M6AA 3WP0A 1T8PA 5C46F 3KWLA 4GOJA 3PQDA 4ENTA 1D07A 5FKJA 3HB9A 3PBKA 2JLYA 4HZIA 5L40A 2H5EA 4MGYR 4EG1A 3MWJA 3DVQX 1QCDA 4K1LA 1E2GA 3CJQA 2X5XA 1JLLB 3FHJA 1R6AA 5H5JA 3SYNA 3SHFA 4FZRA 4YDRA 1CFZA 5IAOA 1WCIB 3IKLA 4MRNA 3WV5A 4JEMA 4TV9F 4NCXA 2C7OA 2CJWB 2JFYA 2Z8ZA 3VDRA 2EWMA 4DLBA 4CHGA 2HCJB 4NHEA 1O57A 2JIQA 3S29A 4LJAA 1RRCA 1ZM9A 3BIWA 4FI3F 2WWGA 1I6MA 3H19A 3LYUA 3GRYA 5F5XA 3KXPA 3S1AB 4DB4A 2G88A 4WCVA 4AUNA 1XLUA 1NC3A 4N0DA 2VT3A 5FFMA 3SF8B 4DWWA 1Q1BA 5JNTA 5IVHA 5CJ2A 3JYLA 3RVPA 2FH5B 2QZPA 4KX3A 1JJ7A 1AT1A 2EX4A 4N54A 3KAJA 3RRJA 2F43A 2ICAA 5AHRA 3NEYA 3EWNA 5KOJB 1LWOA 2B7LA 2XYQA 2OHGA 1AS2A 1T0HB 2C3MA 2HA5A 4CIBA 5EXPA 4M0MA 2GZSA 3ZWMA 3KVOA 5DLYA 3L4BA 4DKXA 2BF4A 4FDLA 4OU4A 4ALNA 4YXWD 5KQMA 3GELA 2B4AA 3LXRA 1LSJA 4BXOB 3HEAA 1Z0JA 2XNCA 1X7ZB 3EWIA 2GYVA 3NAZA 1XZQA 4XQEA 3TRDA 4GQAA 3TRKA 3X1XA 2Z1MA 3ESZA 3LLMA 3ZLBA 5DW0A 4CDGA 1VFNA 2QSZA 3RUCA 4PPFA 1Z7EA 1QQ7A 1NPDA 3A8TA 4KE6A 2PBLA 5JVDB 3GLGB 1S89A 1HL3A 1PW7A 1YS7A 2F9FA 1TT7A 2QYOA 1EUCA 2ID8A 4OAQA 4XDYA 2B94A 2WWWA 5H3CA 5H68A 3G2HA 4I3GA 2EXXA 3JZMA 2WRZA 2WYUA 3RU2A 4LDZA 4GU5A 2ENWA 1PBTA 5BXQC 3EA5A 3EE6A 1J24A 3MFQA 4IKOA 1X8LA 2WI8A 4RD2A 1EWRA 5KOHB 4G5XA 4Q19A 5HZHA 3LQYA 1X8KA 1FPMA 2DH6A 4HQ6A 1OWNA 4Z9AA 4JLJA 3RS3A 4B4KA 3HWRA 2ERYA 4B2IA 3MJFA 4BDTA 2DPYA 1E7QA 2CDAA 1P31A 1VE5A 1J5XA 3COJA 2PYZA 1H2RS 3O8RA 1DCMA 2J0EA 3OM8A 4R2IA 3RBZA 3N39C 3MJ4A 2DTDA 3BA1A 4MJLA 1UPBA 2WQZA 1XWFA 2WW8A 2GHQA 5J5VA 2WSLA 4DCVA 2XYPA 1U31A 2IY7A 1NVMB 4Q7QA 3R2JA 4IDPA 5KWJA 1HMPA 1EVEA 2B8WA 2V9ZA 1JEYB 1QHNA 1U2TA 4RHEA 4MRMA 4XEHA 2NVOA 3QMPA 1DC7A 3EDMA 3QVLA 3DVAB 5HBRA 1DMSA 3C98A 4OGFA 3UBMA 4ARBA 4WKGA 2Z6AA 3HVHA 4C7JA 3ADDA 4XCVA 3FCAA 3FLAA 4HQOA 5BPHA 2O1SA 1H2EA 1U3CA 2ZJ4A 3EDQA 2XNSA 3MT0A 1Q5PA 4H7EA 4GOMD 4PQEA 3SVZA 1S3GA 3D7MA 3T15A 4KOEC 1AVTA 3GVXA 4LBWA 4ZDJA 5I7RA 3S81A 3T5BA 4PFSA 3WRWA 2PUEA 1IWPB 5TMEA 5EE1A 1DELA 1XEWY 2G9VA 4D80A 4DLVA 1X7WB 1OHHD 2JZNA 2AD1A 4QYIA 4W5WA 4IQGA 5FPTA 1RHMA 2QT0A 3NM5A 1JR3E 2HKIA 3GQVA 4FZ3A 3WGNA 5HKLA 1RNLA 3TG2A 1BDIA 2EDCA 4UMVA 3KKNA 5ENZA 1TZCA 2VHTA 2VYQA 3GHHA 3TK1A 1H22A 3E35A 3WDSA 1HLDA 3CCBA 5ARBA 3W77A 1XC7A 2V7WA 3P9QA 3AF5A 4WVFA 4EQ6A 3TD9A 2ZR8A 4U7GA 5ARCA 1OYOA 4DIUA 1XNQB 3VTAA 5AJZA 2V97A 4F72A 5KVSA 4E5MA 3QE4A 3AOEA 4NEQA 2DFTA 1WSBA 1NRJB 4QBGB 4EBBA 4KN6A 4UVGA 1FW6A 1POWA 3QX9A 4YT5A 1TIKA 3ZDYB 4L75A 4IINA 1V25A 2D06A 2WV7A 1B14A 1XRJA 3KKOA 4WINA 5KOHA 3LZDA 1VM6A 1XZHA 4RESA 1KYZA 4PYLA 4JBWA 3WK9A 2O8FB 1J8MF 4X84A 5CLHA 2PGDA 3UW3A 4OJQA 2Q3CA 4G1CA 1N33B 1EWQA 1GTMA 1RC8A 4EGJA 5FXMA 1M9NA 1ZK3A 4M21A 4L1KA 5CCXA 1NUSA 1EVQA 5KHAA 1PKEA 1NULA 3V4ZA 3QV1A 3LY7A 1R27A 4RQBA 2PS1A 5B2EA 4IDNA 2YBDA 4IXMA 4UDYX 1DXOA 3KWJA 3QUQA 1Y8RB 1UIRA 5JMPA 4CV0A 5IXJA 1ESZA 3HP4A 4WKCA 4ARZA 4GX5A 1YULA 3BULA 3OM1A 1QDUA 3AUAA 3IO3A 2EDAA 1YKSA 1QJCA 2PRJA 3ZD8A 1IJFA 1U7ZA 2X77A 4B3SB 2R47A 3BMNA 3K73O 2XTZA 4U7TB 4XYMA 4EPVA 4HNVA 2NAFA 4KYVA 1T0UA 4NOMA 3U4DA 1YE5A 4GRAA 4UHJA 4C03A 1P45A 1Z7BA 4AKGA 1I4DD 2C04A 3V8NA 4RTLA 1HTBA 2PXHA 2ZSDA 3OQPA 1ICIA 2L2QA 3AFGA 4UQOA 1MAUA 1Z5WA 4WZ6A 5CUQA 1G5PA 3CSDA 3RRXA 1JL3A 3IESA 4DQVA 4FD2A 5DCYA 2IYZA 4W1QA 2AOVA 5FFNA 1A5ZA 2OD9A 4C06A 3FUXA 4RCZA 4V0SA 3HUTA 1UBHS 1NW5A 3WYGA 2QV7A 4OO3A 2GAOA 4FFOA 1B6GA 2PHZA 3BA6A 3H4IA 4DHWA 3WYDA 2C0PA 5CT5A 3WIUA 4C3VA 2A1UB 3I6QA 3MOSA 4GMKA 3S5UA 1BMFD 3OZUA 4Z4HA 1NJGA 4U2KA 2VJYA 1NU6A 2UZ4A 4OAOA 3H2ZA 2JZCA 3PKJA 1UBTS 5C1DA 5HZGA 2R5WA 5DGCA 5KYVA 2GJ4A 4GUAA 1G8GA 3NUQA 4J76A 4YCLA 4ZQEA 1KPGA 2FCAA 3M9XA 3IE2A 1VHTA 3HY4A 3SIPA 1OTHA 1FP1D 2LRHA 2P6RA 4R2XA 1HRKA 2Z8YA 2G1JA 4NNPA 3WLJA 1XCGB 2QR5A 4KQEA 3QNMA 1FUKA 1KSJA 3JD0A 3T5DA 2JI8A 1RI2A 2R48A 3CSSA 2PWYA 3MB8A 3SNKA 4FEEA 1O3YA 3GG9A 1U1DA 3NV7A 1QZUA 4YCNA 2VRWA 3HN2A 3LW8A 4OP3A 4Y2XA 5LLSA 3D2CA 4GQIA 3OZDA 1Y6RA 4O2AF 1R1DA 4EWLA 3IP3A 1RADA 4RM2A 1NZJA 2IITA 2P9QA 1T15A 4QASA 3D2LA 4U7FA 1HG0A 3MMZA 3NT2A 2XWQA 4LY6A 4V24A 4Y9RA 3IEMA 2AA3A 3BB4A 5L7WA 2FPIB 4E32A 2Q3EA 2Q4OA 4WK0B 1BKDR 3L7AA 2FWPA 2RBEA 1J1IA 2XNHA 2ZBGA 1CVLA 3JQFA 4HQFA 4HNAB 4Q24A 3FYUC 3F4LA 3LC2O 5HKKA 2H11A 5FUBA 1LLDA 1V3TA 2OZLB 4II2A 1FXUA 2VJBA 2JC3A 3OC6A 1XTPA 1C9EA 2BGIA 2GD2A 4KSYA 5EQJB 1THTA 4EL0A 3KUKA 4RC9A 2C61A 5JG7A 4D9BA 2VYND 3RVJA 1KGDA 1MAWA 1QE5A 2OL4A 4W5TA 4MNTA 3JVUA 2R1ZA 1Z6QA 1VIAA 2HCBA 3ITDA 3TTSA 4Z9YA 3ES9A 1JTEA 3GFBA 5AHWA 4YY3B 4JUDX 2HZBA 1CJVC 2J9GA 2YS7A 1LK7A 1YZNA 2QZ4A 3PENA 1Q83A 2H2GA 2Q28A 2YZGA 4KVFA 2OSBA 2PS0A 3A26A 1US8B 3BTOA 2YCBA 1AJEA 5ADHA 2C3YA 5IPFA 3RM3A 2FRXA 4QPJC 2WM9B 4IIHA 5BSEA 2VOJA 5FLYA 1RBYA 4DCPA 1GUAA 1XAHA 1JECA 1SXJB 2ZAOA 4CLEA 2OD7A 2XLBA 3FYUB 4GMHA 1HDCA 2FPMA 3GVCA 4L02A 2QTLA 4ND2A 1XG5A 4XYBA 4GIBA 5CH3A 3WYEA 2RHHA 2CUKA 3OP1A 5IUNC 1TQ4A 2IYTA 4R9RA 4B73A 1OI2A 1XI2A 3B1ZA 1QYDA 3T8YA 1QP7A 4MV5A 2AXQA 1A2QA 3ORQA 4RVCA 1LDEA 5H9WA 4UMDA 2CZGA 2C1ZA 2Z04A 4S1WA 3GMDA 3KBOA 5KOYA 1WCV1 3EHEA 3WG9A 1PX0A 2I1LA 2A92A 1Y7HA 4Y7CA 1AKEA 1XTIA 3W5JA 2FLVA 4OQFA 5FI3A 4EVRA 5L6MB 2AZMA 2P3OA 4FW8A 3JQDA 5L7TA 3GLFB 1PWXA 3ROZA 2DUMA 1NPTO 1VPLA 1MOSA 1VLMA 1S2MA 1Z7GA 2P8JA 1PUXA 5EGNA 1GCAA 4J8PA 1DBSA 5ER6A 4LXTA 3AQIA 4IIDA 3OTHA 4OYLA 1P0IA 4I1YA 1F8GA 2GZAA 1G2QA 2QRKA 2JGDA 2C77A 1X92A 4DCJA 4EYSA 5BOSB 1I33A 4F9EA 1ARZA 1BE1A 1G5RA 1N8TA 4WACA 2H9YA 4B80A 1M5UA 4AUMA 2NU7A 1ODLA 2XT9A 1SCUB 4AIRA 3KU4A 1SQGA 1YJQA 1XKQA 2PVSA 2HEIA 3AO0B 1QV9A 4XVHA 3H5IA 4MYCA 4AJPA 5P21A 2CDNA 3JQCA 3QPDA 3LP5A 5BVHA 2WUWE 3B7PA 4JCCA 5EFZA 4V0RA 2W98A 3JATB 3W2HA 1FMFA 3JQFC 4RJKA 1HURA 2XUDA 2A5LA 3QVJA 3AUXA 4B3TB 4ZRDA 4AY5A 5DBIA 3ZCSA 3ZDRA 1A1SA 5CB4F 2Z6QA 2PUTA 2WZDA 2YOFA 5DXFA 3BXHA 2PO5A 3HI6A 1IQRA 4INZA 1AMUA 2FZLA 5F4ZA 4QXRA 1O03A 1VG0B 4KQIA 1PFYA 1G0NA 4NFLA 3MN1A 3A9SA 2IV3A 3THSA 2AG8A 3Q6NA 1KR2A 4FGWA 3HJRA 3ZK8A 1RXSA 4L8FA 2X5NA 5IJ9A 4GFDA 3N2LA 2V3CC 4F3CA 4JLSA 4BBZA 1PR4A 2CWWA 2JAUA 1QTRA 3D7SA 4OXXA 4M99A 1DG9A 1R0SA 4L7QA 3SGLA 5FOQA 2I9PA 2GD6A 5FUVA 5AKZA 1PWEA 4Q6BA 3F6RA 1DWOA 1BOFA 2DBVO 1P74A 4JSYA 4JY7A 2P2GA 4M8KA 1DU4A 2G07A 2VPWA 3IAEA 5DV9A 1ENPA 1JG7A 5TF0A 4YAFA 2OYRA 2B5VA 4HO1X 4F04A 5HUJA 1B76A 5IJXA 3LA8A 3ZLTA 4Z3DA 1R0LA 3FFAA 1UWLA 4KJXA 3TSYA 4M36A 1QGZA 4OEHA 1R0CA 4JVOA 2X5JO 3UUEA 2X1HA 5JOQA 1P72A 1LW6E 4UOEA 4XYLA 4US2R 5JXWA 5K8JB 5E3IA 2OWEA 3NIWA 3SHTA 2E48A 2IEYA 1LRLA 4PANA 2ZSFA 5CYPA 3ZHBA 2OCYC 4RXUA 3FLEA 3NNDA 1O95A 3V46A 5D3QA 1TAHA 4QIHA 4WOCA 3VBCA 2BUCA 2PBFA 4E4RA 1ZXXA 1YTUA 4ZEWA 2FP4A 2HU8A 2TMGA 5FNZA 2D1QA 3AI2A 5F2OA 4HGNA 1UP7A 4PZDA 1E5TA 4QUKA 2WFAA 2X9GA 1DWUA 5FTNA 1HYEA 5AVOA 1P2VA 2ZDGA 3ZNOA 4BUZA 1QIDA 5E4FA 4UZFA 4L5AA 4LJSA 3WDKA 1GGEA 1U02A 3GCGA 4C04A 2WU3A 2C9ZA 1W76A 5TS3A 3RK1A 1KI6B 3K1ZA 4L16A 5EIFA 5JWRA 4PX5A 1XVAA 3PJGA 5AHKA 3Q1KA 4LV5B 1E5LA 4G25A 4WN9B 4MDFA 1AKYA 1Y6JA 4Y6PA 5A3SA 4C0BA 3T95A 1US8A 1UJMA 3HDHA 5JCPA 2G8NA 4X6XA 4FWTA 3UK0A 2C1XA 1RZ3A 4D9IA 2XDYA 1KRHA 2A84A 2WWXA 5ALMA 3QPBA 2D7JA 2CJPA 1KO8A 3QVKA 4MQFB 3V1UA 1BJRE 3KXDA 1IUOA 4MWTA 3T4XA 4TTIA 4F5YA 1Z63A 1CIVA 3OZ7A 1UC4B 3LX8A 4LCBA 5BSHA 2HSEA 5D00A 4XFDA 1UXJA 1UMKA 5MDHA 1C9KA 4QRDA 4OF4A 4MVXA 2IOHA 5JYBA 2P1ZA 4Q1VA 1CQXA 3EWSA 5LA6F 4E3ZA 5MFPA 4FOSA 4NECA 3OETA 4QHYA 3DZHA 3ML1A 1G55A 3DWFA 4MS4A 1QKKA 4N5MA 3WZMA 5A02A 1VJGA 2OFFA 1MJFA 2GPJA 3AESA 2A5FA 3ZD6A 2DX7A 2G67A 4PPQA 3TO5A 3CUSA 2QUJA 3CBGA 3PI6A 5SZIA 2YDXA 5AW2A 4RSMA 4C3ZA 4EG4A 3N2KB 1MZPA 3UJBA 4CRWB 2WNIA 1PL8A 2OGTA 4QKQA 1I9GA 1KOJA 4HZGA 4P38A 1Y7TA 3F97A 5FBVB 3H3XA 4F1WA 2FW7A 2NV6A 2ZSKA 1FS6A 4J16A 1GR0A 4OYYA 4KXFB 2B3TA 4QOSA 5AM4A 2NU7B 3G02A 4PNHA 1RIFA 5IM4F 1FTWA 1GPBA 4N7MA 2Q3BA 5K01A 3TECE 1DIAA 3GUHA 3MW8A 3B6EA 3HYNA 1BHO1 1ZHOA 5EMHA 4UD2A 3H05A 5BQPA 3AHEA 3KJQA 4N9WA 5FOTA 3THWA 3GLHE 1LPSA 1CJTC 1G2PA 4J0DA 5EVJA 1NBMD 4FK8A 4D26A 5CFNA 1S2GA 4HSGA 3OY7A 1P7WA 3ZDFA 1WZCA 5M3BA 1SEPA 1EWVA 3B5IA 1TYCA 2O7RA 3TSOA 4CT4B 4FB4A 1UBSB 2Y68A 3PEWA 3KQUA 5DCUA 4KCGA 1DO8A 1AZLA 1P1BA 2SHKA 3VYUB 5AKLA 3AWDA 1TUBB 3QXHA 3V1YA 4E2WA 1FBNA 1M54A 2QEQA 3EN0A 3ROPA 1KMNA 5DLDA 4C6SA 4BIMA 5CD9A 2QM7A 3EZNA 4U9HS 3QVGA 3RTDA 4XM1A 4PNEA 1ODFA 4FNGA 5TPZD 2C7QA 3HABA 1QQAA 2GPSA 4PHGA 5DNAA 3GVIA 4LX8A 4TYQA 5LA6A 3ZXXA 5JBNA 3VU8A 4N0QA 4YONB 1OXBB 1ZIPA 3VA7A 1U1GA 2ZRLA 1OBVA 1W4BA 3M6VA 5CFMA 1D0IA 3ZE9A 1W5FA 4MVYA 1SIWA 2I7XA 4BLQA 4E31A 3ESDA 2VHXA 3C8DA 3DKPA 5L4LA 4QBFA 1A1VA 1PVVA 4C21A 1EAMA 3G8AA 2PG3A 1HNXB 1W52X 2C96A 1JSLA 3RPEA 4N3AA 1N5RA 4FOLA 2CEKA 4KYUA 4XVRA 5GV8A 4U6SA 2GKOA 4CR7A 1GL7A 3L4KA 5BR1A 1H93A 1NU8A 4ACBA 5HRCA 5HZKA 5KYYA 3N2KA 3WKEA 2CHFA 2WJ6A 2GEVA 2BELA 1Z5VA 1XXLA 2DKFA 1YZGA 3QLJA 4DS3A 3DTVD 4CXMA 1BQEA 3HU1A 4J0JA 1AA6A 3W8FA 3C6XA 1WUYA 3CPSA 1YUMA 1XZ8A 5E38A 4U2BA 3KR2A 5DGXA 4EB3A 1EXNA 1EX9A 4WUVA 2D0IA 5C4MA 3EPJA 4PFQA 5FPKA 2PMKA 2FV8A 1IOVA 4Y6RA 4ZVNA 3RFXA 5MGNA 3RTBA 4D9EA 3OEHA 5JNWA 2FWMX 2E2WA 4OQMA 3MBOA 1NJ1A 1M67A 1LXCA 5T6MA 1PNVA 3OQBA 4A2PA 3KSBC 4LAFA 1TI7A 1C3VA 3GLTA 5D3KA 5EWMB 4EI9A 3A9RA 1DMRA 3R6TA 4Q02A 4MEBA 2RC5A 4F4IA 3ZU6A 3VJMA 3U7RA 1T1IA 2QSJA 3K1JA 3V34A 2IXEA 5A5FA 2WD8A 2OHIA 4LVCA 4DVJA 2WAYA 3QQ5A 4HC4A 3UK1A 3VU9B 3DTYA 5BNIA 3KHSA 4O2RA 3VAZA 1W0CA 5DYNA 3LNCA 4RO0A 1CR1A 1XCBA 4UOZA 2B7CA 3UAGA 3IRVA 1CP2A 3CVJA 4KLCA 4ES6A 5JMWA 2C98A 4AZ0B 4MGKR 4UXIA 2B2CA 3EZ7A 2JKYA 2VJQA 2W6NA 5D3MB 2ZAYA 4EPWA 3A6ZA 5E6RB 3H0CA 4ZVTA 5F7JA 4RBNA 2O0JA 2PCLA 5CM2Z 2HNKA 2G80A 4C4OA 4BU0A 3GG2A 4F6CA 5CVCA 1FSGA 1GAJA 2PU5A 2ENUA 2GCOB 4WK4B 2G1UA 4DLYA 4ZMRA 2JEZA 3A6HA 3EWAA 1KQNA 1V37A 4NZYA 3TKYA 2HZ7A 1H05A 4BNHA 3O90A 4OXKA 1FLNA 2V7EA 1SAYA 4NXNB 1MW8X 2WJVA 5AI4A 4KR7A 3C3MA 4RMJA 4DJAA 2JNWA 5JZOA 3IUQA 1SURA 3B78A 5EJGA 3WFJA 4UNQA 2XUPA 3UAOA 5IC4A 4CCWA 4I1RA 2O8CA 3OLXA 4RIHA 3BIXA 5IYZA 3OKPA 5IWAB 4BRZA 2I8AA 5DHQA 4JP5A 1E4OA 5G0VA 1IHYA 1Z08A 2IT1A 4PCLA 4LYGA 2EZ8A 621PA 1XXHE 2WZBA 3WICA 1PJ8A 1R0RE 5KVCA 1KAQA 1QGED 3P9KA 4KXYA 4E1AA 3TLAA 2BGGA 1Z25A 3PQCA 1W46A 4C7OB 1M34E 4JXXA 1FNSA 3DH0A 2F8LA 2ST1A 2ZJ1A 3GGJA 4DADA 1WB5A 3M8KA 5EHQA 5F1PA 4X3CA 2IPXA 3R76A 721PA 1DJMA 5CVDA 3L0DA 2CV2A 5IBCA 2QNRA 2ZYDA 1HDZA 3FYDA 3PLRA 4UHEA 4ZXFA 2CGEA 1A76A 1JZQA 2QZ9A 2L82A 2QZSA 3THWB 1CULC 1JR2A 2Q6IA 1YV9A 3ORRA 1T5BA 3DEYX 1GIAA 3DAPA 4JYCA 5LQAA 2K4MA 3K1YA 3GPBA 3LUKA 4PLFA 1YH3A 1LBTA 4OHXA 5C32A 1HETA 2Y2VA 2F8MA 4TSRA 3VVMA 3JWJA 2NV2B 3HLTA 3QWAA 4UAGA 3BRWA 1I4WA 2NZJA 4N48A 1BRMA 3I4LA 1Y3CE 1XU4A 3IC5A 5CBPA 3J7AC 1LC0A 1DIBA 3FKJA 2A1TS 1T2FA 3PGA1 2Z30A 4DQXA 5LMNB 2N75A 3ZE0B 1VE3A 1JE0A 1A71A 2HK6A 2QXYA 3LDAA 4IDOA 3OZRA 2OPHA 3FDXA 3L0BA 1O95C 3NIDB 2EGUA 2AVNA 5IT4A 5C1IA 4I1OA 2VJPA 4UM8B 4KXWA 1VCIA 5E6RA 1DAEA 1Z2NX 5KSYA 3TTVA 3X2SA 4CM9A 2GNOA 4XWYA 1QUFA 1T5LA 4YQEA 3W6ZA 3VR5A 5AJYA 4UXHA 1N6PA 2CVOA 3KIPA 3FG9A 2GLTA 1ISSA 3HKDB 2JGKA 1E58A 2H54A 4U4AA 4Y1RA 2P90A 2HJVA 1NVTA 5JQGF 4DV0B 5LJLA 1GZUA 2B35A 4KI0A 2XQFA 4JP1A 2C88A 2VDVE 4JBNA 1A5SB 3IP8A 3ZGLA 3G2LA 1KEKA 3SMQA 4HTFA 4ZO8A 3SFVA 4KO8A 5AYVA 3HCFA 4R1QA 5KYKA 5C7LO 3WA7A 2X8JB 3CTMA 4JC0A 4I6GA 3JQ8B 3KJNA 3F8SA 2ONYA 5I48A 3IPRA 4H6VA 4X97A 5T4EA 3RAEC 3GR6A 3OMLA 3BB3A 1EX6A 2DWUA 1CKEA 1UANA 2J6CA 3LPLA 1KAEA 5FUQA 1XF9A 2C83A 1SCDA 5KNBA 2EKBA 1X9IA 2OQIA 3WL4A 4RPGA 1NN3A 3ZQ4A 1OXXK 2RH9B 2P6PA 1DAGA 5DOVA 3UPDA 2P68A 1KTVA 5HS6A 4XKJA 4JNKA 3C6QA 3LAWA 3ND6A 1TKBA 1O7JA 3GFSA 1KY4A 1NF2A 2BC9A 3B70A 4V2UA 1XTZA 4PGGA 4FYVA 4YWHA 3WLHA 2DH5A 3MA0A 3PUWA 1SRRA 1MNAA 3JU3A 3B1JA 2XXAA 4QOGA 1KU6A 4IQ4A 2NU8A 4D46A 3N70A 5KTMA 1OMOA 1GA1A 1M73E 1J2YA 3WGOA 5AQEA 4IZIA 2BHLA 2F1IA 1R6XA 1YZHA 4Q7KA 3SSOA 3K7EA 1C9NA 3W4IA 1K6MA 4BO9A 4Y2YA 4TXLA 3GUVA 2VATA 1SU4A 3S7ZA 3P52A 2XMCA 4EW2A 9GPBA 1CXZA 1LRJA 4ZVRA 1EESA 5DP2A 5F1YA 3QSGA 2CXTA 4OQ4A 5FTJA 3ODGA 4F9TA 1Y3FE 1V1RB 2HI0A 4B3HA 2AG6A 3ZC3A 4FE3A 3WB9A 4MLZA 1H4VB 1T4MA 2Z1DA 2CDCA 1VBKA 1DINA 2D4AA 3V7YA 2FI1A 3H11A 1XTUA 2WU4A 3HXKA 2X76A 1DX4A 3EFBA 2A88A 4C89A 4Y9TA 2EHDA 2AC7A 5FO0A 3L7MA 1QGYA 3LSYA 3ZY4A 2DFPA 3VSEA 2CE2X 2Z8YM 4FDVA 3L6DA 3LY8A 4FHZA 3S2YA 7ABPA 2UYCA 3OMXA 4G86A 4HNGA 1U9IA 3ZI7A 3QE3A 4EPYA 1WY5A 2DSTA 4NL4H 5KJCA 3BXXA 3RJ5A 5KWEA 4RPCA 3AFHA 1WF3A 4CKYA 1R2QA 3ZGXA 4TMXA 4EYEA 2BLNA 1TPZA 1O0SA 2OTCA 3DCIA 3FMOB 3GFTA 4QULA 1KQFA 1D4ZA 2N47A 1LI5A 4NFHA 4R98A 3DO8A 2DBZA 1AS3A 1WCYA 3FWYA 2IXBA 1VLLA 3VX3A 1TKAA 5F64A 1YQGA 3MJRA 3NWPA 1Z9BA 1ISFA 4HXFB 3V4RA 3UGKA 3RYFA 5DLQC 1DTSA 1E2DA 3P8ZA 4LMAA 5EMMA 3M70A 1NSYA 1XDWA 3LECA 3CZ4A 3NXSA 5IH3A 2OB1A 5EE9A 6CHYA 4P7FA 1WM1A 3IVGA 2HA3A 1OLUB 2YJ3A 2D3WA 4FMBB 3TB6A 4B4DA 5EKUA 1IM2A 5F7OA 4Q6WA 3PEYA 1PJ3A 3A9CA 3PWTA 3HN6A 1ZRMA 3IX7A 3T9BA 1KK3A 3N0RA 1KVRA 3JAWB 1QB8A 1U5AA 4DC9A 2I99A 4AM8A 1PYOA 3FHOA 6AT1A 3UUGA 1C3OA 1L5RA 3EDOA 5LOVB 4JOSA 3B1VA 4MWCA 1TMYA 3OF3A 4IFBA 4NMLA 4M1MA 5ECWA 1DUSA 1F1JA 4B79A 5JSFA 1XZPA 2A9PA 3THYA 4PYQA 2BGLA 1V1RA 1Z8HA 3BFXA 3LX4A 1JFRA 3GUUA 4JEHA 4EJMA 4WLEA 5ALVA 4ITVA 1L5ZA 3DJFA 3FIJA 2A8YA 4RSRA 1ZONA 2EG5A 1V4BA 2DAPA 4IFEA 4R6WA 4K0KB 1V16A 2Z58A 3L6RA 4YROA 5ES4B 1F06A 3KJEA 4TTSA 5LLTA 1X80B 3WL5A 2HXGA 3W5AA 4H4CA 2WC1A 1JDSA 3CJTA 5HJ5A 2G9RA 4Y67A 4MWEA 5KTTA 1M6VB 2GBGA 3LRPA 1FUEA 3DCYA 4Q4DA 3SJAA 3JYOA 5H1YA 4G81A 1RYNA 3AJ9A 5JR3A 1YRYE 1PJ4A 2FWBA 5K3FA 3RF7A 2ZIWB 4JASB 4K9DA 2CUNA 4OJTA 1QIIA 2QLJA 4TMYA 2LNDA 2R11A 1RJFA 2YY6A 3LL4A 3Q3JB 4X94A 2JBHA 4ECAA 3LIPA 1ZCFA 5B58C 2H1LA 5AVRA 2DRIA 3U3MA 3WGMA 1WNTA 1CB0A 1P0QA 4YQZA 2CNNA 1ISHA 1JT9A 1RD4A 2YYZA 1OGYA 3FSGD 4HQKA 3EVFA 3TOSA 4EX6A 3VOBA 2IX9A 4ZCMA 3AR7A 5FLEX 3GLIA 3HRHA 4B2YA 5AI9A 1N0HA 3UQZA 4CTNA 2GBPA 2C3PA 2GRUA 4JYMA 4CMBA 3KLMX 3ZH2A 2I03A 2UU9B 3PX3A 4AJ2A 3AERA 4MQ6A 2YOGA 5LVAA 2BFFB 2DWQA 4F9GA 2PUCA 1VL0A 2Q1SA 3KOMA 3HXQA 3P0EA 5JFTA 3VYRB 4KH0A 4DPLA 2Q9CA 1F2UA 1QHXA 4IVQA 1S6YA 5GZ1A 5IT9A 3HDVA 2BFEB 3U3OA 2G1KA 1S4MA 4FCVA 5FA6A 2LDXA 3PNSA 4MZDA 2VRCA 3CNBA 1PL6A 1V1MA 3E81A 1BE6A 2VP9A 3R8CA 5AW4A 1CZKA 5JISA 3OIVA 1WEHA 1E94E 1DEAA 5A6SA 2YWCA 3JAWA 1RT9A 3FNBA 2N9UA 2V7QA 3H8VA 3DAYA 3GXBA 5ILOA 1EDOA 2XA9A 1DDOA 1L7DA 4HLUC 1QRUA 4LY3A 5KYTA 2XXJA 1I7DA 4IGIA 5C51B 3FD8A 1JJBA 3R9XB 1I94B 3SX4A 1RHRA 2FZCA 2PSHA 2W6CX 1HI9A 3F7NA 5EIOA 2QZZA 1E2UA 1KOLA 4EVSA 2I8LA 1UXOA 2PZ8A 4NDNE 4X1YB 5HKOA 3EMKA 4DVGA 3RIHA 5DWDA 5LM3A 1NNEA 4L4SA 4BEBA 1K3TA 1XE3A 4D3SA 2IK8A 4JUBA 2VYFA 4HAVA 3WB1A 1W87A 1U28A 5IFLA 4BMXA 5HEKA 4O29A 1XMVA 4X64B 5IDYA 3ZKAA 1NJ5A 4YAGA 5LPNA 3FAZA 3DOEA 1LA2A 2Y27A 4W5QA 2X0EA 3UY4A 3CEMA 3BGSA 3FNHA 4JU9A 2VHQA 3LKVA 1VOTA 2LUOA 4PWYA 4V2IA 3WYBA 2WA2A 3TUZC 3E4DA 2VF5X 1GQQA 2IZOA 3BIOA 4MUKA 5BQOA 1D1TA 5TY0A 2ADMA 2EVWX 3OIFA 4NNOA 1RLMA 4BFUA 1ZRHA 5K8UA 3KJFA 4MW2A 3U31A 5FQOA 4UQPA 1YA8A 3F5MA 2EZ9A 3K70B 5JAUA 1DRWA 1M1YE 1U6JA 2CXOA 1RR6A 1ZUNB 3GXOA 5FJJA 2G7MC 3DMYA 3L02A 2H16A 3WLOA 5PNTA 1QK3A 3F90A 4J90A 2FK8A 3OPVA 2PZMA 3Q2OA 1P33A 2BBWA 3GEPA 5FI5A 2QPOA 4KQXA 4YRGA 2R97A 3MOGA 2XJ4A 2G1AA 2GVNA 3U1VA 4JZYA 2CFIA 3OIGA 2Z2ZA 3L7KA 1M0SA 1X1TA 3INNA 2V4UA 1KZ4A 4HH1A 2B3DA 5I9TA 2YHAA 3SNHA 2IKSA 1JP7A 1Z5GA 1T9DA 1N92A 3RE1A 1HKHA 1NASA 1HK7A 3EEFA 4MPJA 2JJYA 5TJHA 1VMEA 2GNAA 4LJ8A 4E21A 1HDXA 2DSNA 1Z4MA 5LQRA 1PFVA 3WHPA 1UJ5A 2GCNA 4PR0A 3FUCA 4M9ZA 2P79A 3OJXA 1WUKS 4ND4A 4D8XA 3THYB 1J2EA 1TPYA 4UDOA 5LN1A 2HU5A 3M81A 4CKBB 3HCRA 1YQTA 4UNNA 3E3NA 4GPIB 5BT9A 5BUQA 3RR2A 4DLNA 2PXCA 5CCEA 4CQNA 2BKVA 1YDWA 1ZKDA 3PPXA 3U1BA 2DCMA 2JDID 4J0EA 2XBMA 3WL8A 1QQBA 1RYFA 1ZD5A 3Q3GE 3ZBPA 4AN0A 3AHDA 4YRZA 4YR9A 1ZI8A 3PG5A 1KO7A 1SHLA 5I9BA 1OOEA 4DR1B 3TW8A 1BWSA 1VQ1A 2BHTA 5D3ZA 1E7YA 1YZYA 2EAUA 3PXCX 1K7YA 4R81A 1UC5B 4PPYA 4QSHA 3EC2A 3Q85A 4YV7A 1ULZA 3K4HA 2GBCA 2ODTX 3OKCA 5ALEA 3LXXA 2DETA 1NM5A 1WQ4A 5E6UB 1ZY2A 2E0IA 3FI9A 4M6WB 1ZC3A 4LXXA 5K0GA 1D03A 1V7ZA 1Y9DA 2RGEA 3REOA 1Y6GA 1Y8QB 4F7WA 2RGUA 2AN5A 1ZK4A 3GROA 5HE8A 1X38A 1U2RA 1YKGA 3A3YA 3GJRA 2DQSA 3ABZA 1AV6A 2P2CA 5IJ0B 2O50A 4DLRA 1BDHA 4RHUA 1OGJA 1Q0RA 4X00A 2BDTA 4UDNA 4FFSA 4CCAA 1NV9A 2FFRA 2R7KA 2CF6A 4J9VA 3G2NA 4K9PA 4L3VA 1GN9A 1P77A 2OP0A 3HCAA 4M4SA 2OC4A 1XYYA 1R6TA 4RH1A 7GPBA 3D7RA 4D0SA 1Y8RA 3B12A 4GVLA 4ZOAA 4URXR 2B1RA 3Q7EA 3VC1A 3OZGA 4W1RA 5T41A 1T43A 4L8YA 3WLSA 5GIOE 4YCAA 2QL6A 5B37A 4OI0A 2P6MA 1JJIA 3Q3HA 2XTMA 2WJ3A 3WGGA 5HZMA 5EKXA 3SE0A 3KZVA 2DFVA 4TVSA 1A9QA 2WHPB 4FYHA 2J9RA 3I9KA 3VNBA 3GPCA 3VZQA 1T2DA 1BX1A 2W4QA 1TW2A 2R6GA 3BWMA 3K0FA 4C07A 4YAIA 3S1LA 3ZU2A 1JFSA 2Q2WA 2RIPA 3VOTA 4TTQA 3R5XA 5JWHA 2QJRA 3FVVA 3BFVA 4QICA 3K0HA 3WLIA 1T13A 3F47A 2C5FA 1A9YA 4EHJA 2VT6A 4H27A 3DZBA 5C35A 1K3UB 1T1JA 5EIBC 2Q45A 5L3RA 4ER6A 1DTWA 1X1SA 2B5WA 2WFMA 1KQOA 2AFHE 4BKQA 2XDAA 1C7QA 2GETA 1N5MA 1M7HA 2HLDA 5GWXA 1QS0A 3U0VA 4BGDA 1BA2A 5JVDA 2OCGA 1Y1SA 1O54A 1EKXA 2I29A 2FX3A 2VCEA 3A3NA 3ESXA 3O2QB 5HXAA 3GJQA 4PSVA 2WF7A 4W7IA 2GN4A 5HK9A 1FLVA 2Y1LA 4CKCB 1G17A 2H1CA 2Y8EA 2CXHA 4ZCTA 1HE1C 1UQTA 1IZZA 3E9QA 3C24A 4HN9A 4PYKA 5A4AA 1R9JA 2O8DB 5KVAA 2XBLA 4OUKX 1FSZA 4CL0A 3GP8A 2CKMA 4DLTA 4A0SA 3KL4A 4BNZA 3BHMA 1X13A 2AXEA 4NYIQ 4PV7A 2YMMA 3OHSX 4A10A 1B0UA 1UIMA 1MN6A 2E87A 1Z17A 2B2NA 1E4EA 1KZHA 3SS9X 1K2VN 3KFLA 3QP9A 3BJZA 4NI5A 4JYBA 3HVIA 4DV5B 5IJ0A 3PPIA 2IXTA 3UWOA 2CE7A 3T9AA 4LJYA 3ZPXA 4XVCA 5JADA 4JYAB 2QAGA 1FPQA 1VJRA 2A9JA 3E9CA 1A69A 3FWNA 1XCPA 2FN4A 1WDLA 3P7MA 5TQ0A 5FJIA 1D6JA 3INRA 1Y9JA 4GR5A 3R6LA 5EHIA 1ZD2P 3LTEA 3R3YA 5FTMA 3QMMA 4LYFA 1Z22A 4TVKA 3SZLA 1QKJA 2AZTA 2FEWB 2M1ZA 2PSSA 4TWIA 1L1QA 3NTQA 3WXBA 5DN6A 3MPOA 4ZPXA 4YMTA 4EB6A 4ZFNA 4D3FA 1UPTA 4FFDA 2IPAB 4WPGA 2YRWA 3ZXIA 5D87A 2J32A 3DMRA 1WL8A 1JKMA 2NO7A 2FPUA 4MWZA 1ESMA 3B6MA 3N05A 4Q34A 1VYUA 3ROGA 4ZT2A 5HIMA 3UOGA 2Y76A 3F96A 2VBIA 4AS3A 5C1PA 3F9IA 2Z09A 1DHTA 3NBXX 3DXYA 3H1BA 3T5TA 2WZQA 2YNMA 2FEKA 1OWMA 2PVCA 1PEAA 3C0KA 1W88B 3SSMA 2BM8A 1TZKA 1Z56C 3UF0A 1GL3A 1ZJZA 4DYHA 3NX4A 2VH2A 1JEOA 2WIBA 3U19A 4YBRA 1Y8CA 1NT4A 2RAUA 3DWEX 3RV4A 4DJJA 1DQNA 1KH2A 1T25A 3AXTA 5A6VA 4CIYA 1VCOA 4DYDA 3KB6A 2EX0A 5HDQA 1QVVA 4V1CI 4TKUA 4ML3A 4OD0A 5EMJA 2I66A 4YJGB 1MGPA 1JEDA 5IU6A 3EASA 4REQB 3W6NA 2E3JA 2JHAA 3MCVA 1G3QA 1X7GA 1EFVA 2P9YA 3KZNA 4OBBA 3WWZA 1KU0A 4C0JA 1EDBA 5A4DA 1LDGA 3I83A 4MYHA 2OXEA 3QVXA 1EXMA 2YWGA 4BN5A 4YT8A 4FZJA 5JNLA 1W73A 1BE0A 5AW8A 4O2AB 1MT0A 3JVDA 4Z53A 4QM6A 2JD2A 2OCKA 3Q7QA 5DE3A 3VDMA 2HC9A 4CIWA 1QH8B 3FTCA 3VH3A 1R8SA 4IDCA 3UMJA 2DC1A 4TKVA 3HDTA 1CR0A 3PVCA 1YS2X 2K2QB 5ADVA 1F3LA 5EJMA 4BQSA 4M1TA 3MHTA 5HSGA 1GUYA 4HGRA 3EAQA 2BKLA 4UKDA 5FX2A 5KNBD 5JJCA 4MW5A 4FYYA 2HA6A 3A28A 2DR0A 1L7AA 3A04A 4DM7A 1J49A 1PSZA 4QG7A 5ALSA 3O7MA 3PRJA 1F8FA 3M3HA 2J45A 1NF9A 4Y2QA 4BFZA 3UKOA 8ATCA 4LQ4A 1CJMA 4NAHA 4XIYA 3VMMA 3HO1A 1XVUA 5T4HA 5JARA 4AIIA 2GEDA 4Q3EA 3BMQA 5CVUA 5FB3A 2GA9A 3L8MA 2HCRA 2ZUWA 4W7SA 3NRCA 4LMBA 4IIYA 2GERA 1BMDA 2B4YA 2JI4A 1YR6A 3ABRB 3NNNA 3G49A 1GYRA 4IX1A 4PYJA 4B3JA 1NYTA 2ZR0A 3X1JA 1XK7A 2OHFA 3C6MA 1EFKA 2XGOA 3JZAA 5IN4A 3U4QA 1QE3A 2G36A 1GPMA 3W9UA 2OLJA 4YREA 2CLFB 4KB5A 4WX2B 1CF9A 2Z4RA 3TQHA 5A3RA 3E9ZA 1BGXT 1OWLA 4PGFA 2OYSA 4LVOA 5B4TA 1M8JA 3D8HA 4FGLA 2DR2A 2PVPA 1EGVB 1SCNE 4ESHA 3DCNA 2PLWA 1O6CA 3KJHA 1NDHA 2YHIA 4TLDA 1LH0A 1TYZA 1DAKA 3LC0A 4J1TA 4N8SA 4N3NA 3RSCA 3UWDA 1GQ2A 1J56A 4DDMA 4L6CA 3H2SA 5A9TA 5A04A 3DLPX 4QDUA 1WW3A 4ARUA 3UB3A 1AE1A 3RUDA 4LWPA 4F2GA 3ZZ0A 4C6TB 1WBJB 4WNAA 1K8RA 3W5SA 1YZ3A 2C9BA 4W5RA 1B2RA 1V4VA 3HM2A 521PA 1K63A 2EIXA 2NXCA 2W0SA 1M66A 3EVDA 5ARDA 4EABA 3U16A 3ZLVA 4QGGA 1GZ6A 1V1JA 2QGFA 4GX2A 5CDSA 3DEAA 2W2KA 2ID4A 3TLBA 4J7AA 4NJEB 1RI5A 1X3SA 1YI8A 1OXUA 4IVNA 3IV7A 1N57A 5CP8A 1J8DA 4MQMA 1ZP6A 3SIWA 2VAMA 2O59A 1S9HA 4E03A 4P3KA 4GWKA 3ZGNA 3URMA 4LNUA 4IQ8A 1D9ZA 2ZT8A 3JVIA 2YWFA 4PX3A 4CEHA 4AXBA 1MRNA 1GG9A 3JX9A 4MS4B 4ZT3A 3QU9A 4FFVA 4G24A 4PAWA 1QR2A 1XRLA 5A7FA 1XEFA 2Q3JA 2Y4NA 3ZZ1A 1EG7A 3CR8A 2NQ8A 4A92A 4O4LB 4GMGA 3BD8A 1KAGA 5MF6A 1LTHR 1FK8A 3BMQB 3GY0A 3VZBA 1TXGA 4DLZA 2QNBA 1U3DA 3MSCA 4WOJA 4WL0A 2ZB8A 1TJYA 2X3YA 3QKTA 2HSWA 2FP4B 1Z6AA 1DAFA 2FQYA 2IIVA 1K7CA 3G2MA 1CZNA 2GPAA 5G1PA 1VSBA 2FPIA 4MVJG 2QJWA 5AIAA 6YASA 1GCUA 1M2NA 2H1IA 2HQBA 4PS1A 4LVUA 4PGAA 3FZEA 1RWVA 2POCA 3GCXA 4D8UA 3NTVA 1VRWA 3OPMA 3TRIA 4ZEXA 4E22A 1PR3A 4YJ3B 1KI8A 3PFGA 4HX9A 3BE8A 3NBQA 3QU5A 3HBFA 2I3BA 2VAVA 3CYFA 2W70A 5MGBA 1ONPA 3EH1A 4Y6OA 1WABA 2AIRA 2QPTA 2X14A 3AY0A 1BN6A 5K05A 3L1JA 4N0PA 1PEDA 1Z0DA 4PAMA 4M55A 1NDUA 1G98A 2VOEA 4RXMA 4DUGD 5K4HA 4MVJI 1EJ0A 1P5ZB 2C78A 1ZRNA 1UFRA 3NBYC 2J7PD 3SHVA 3LUHA 4RLHA 2HK8A 1B8VA 1OCEA 2I3AA 4ZCQA 2R00A 4BZPA 1MG5A 2AUNA 4J3JA 3OOWA 4U9UA 4CKWA 1U2DA 3PF8A 1TUBA 4TZ0A 5ALIA 4ZQIA 3HY3A 5HTKA 1YBVA 3KDAA 4G0XA 1TKRA 1DAOA 3F4KA 4WVLA 1UINA 4BTEA 2HSGA 1H5NA 2UV8A 4FW9A 1LVUA 5H3LA 3RU9A 1A9OA 2QGNA 5G3YA 2JFZA 5I8WA 3MTDA 3Q7IA 2HMYB 3BGVA 4HK4A 5G0TA 1QIKA 3QFRA 5AKKA 4S1OA 5HGXA 2BCGY 1GARA 2XE6A 3TKAA 2ZDQA 1LUAA 4EY4A 5TLSA 3QLUA 2RHBA 3ESAA 3LQRA 3W5BA 3SYLA 1Y34E 4I2NA 3J7TA 4QOHA 2FR8A 2WJJA 5CM8B 3UMCA 4YT4A 5C8YF 4A16A 1CHNA 3RB8A 3PNLA 5IDQA 3IKTA 3VHXA 4OM7A 3BHJA 2IDKA 1K7SN 3WHKA 5J4KA 1XN1A 4JBXA 4I7EA 5TMDA 2ZYIA 2EP8A 4GVPA 3KQWA 3ZDEA 4HCJA 3L0YA 2WWVD 3N8HA 4DARA 4UBMA 1CDZA 1EM8A 1QPBA 1Q6ZA 2YFKA 3LO8A 5E0OA 5BQFA 5BN3A 1YONA 2BFNA 5BNZA 1JAIA 3E5HA 1ZAYA 2TSYB 1UMCA 1XOIA 1JA1A 1MIOB 1A9TA 1ES9A 2Q0HA 3B3JA 5DHFA 5DFAA 3GRKA 1KZGB 3PUIA 2OCDA 4NZPA 2XIJA 1JQAA 3LVFO 3QEKA 1ZAKA 2OOSA 3OQVA 2Z0MA 1KXZA 3IYLW 4E14A 4IDEA 3GVPA 1SOUA 2I71A 3M9WA 3OQNA 1FEZA 3DV2A 5FH9A 2NNWB 4AJOA 2VSXA 4QGSA 3LOQA 4JVNA 3EXG1 3DW3X 2AJ8A 3NU1A 4GM0A 3CS3A 2O0MA 3E6AA 4BWGA 2WSIA 2O48X 3I37X 3AR8A 2RFLA 1JQEA 3G6KA 5SYAA 3CX8A 2VPQA 1XELA 3DM9B 1MQ9A 4KIGA 3B6ZA 5GJVC 3VU9A 2JVIA 4CKCA 1I3NA 3MLBA 1JDPA 2YWEA 4MAMA 3SSAA 3ZXUB 4F4CA 4LJ6A 2DHQA 1HQKA 2VPZA 2GJ9A 3PGJA 5IARA 4MMYB 4V39A 4EHBA 4NU0A 1ONOA 4PICA 2X6RA 3FWHA 3MGKA 3AP3A 3SLRA 4YYEA 4B3DA 4H1WA 5B7NA 2OV4A 2VAWA 3A3OA 3ZVNA 4YB8A 1SKQA 2YC4C 2YFYA 2XVMA 3CWCA 4J07A 4A03A 4AY4A 1EFUA 4YRAA 1DL5A 3KXKA 1CIPA 1I5OA 4TRRA 1USVA 3VAYA 3FCXA 3V1NA 3STWA 1B4DA 5E2IA 2WTUA 4FHCA 1SWVA 3HB1A 1QF9A 1B73A 3QUBA 2CYAA 4OI2A 4QJIA 1NVXQ 3GGGA 2WSMA 3K1AA 5C3UA 4BO0A 1QO7A 4L5YA 2YBEA 4EPTA 1EK0A 1P2SA 4P7BA 3ESBA 5TT1A 1CHDA 4Z4QA 3JASA 2O2IA 3CEJA 1E2IA 4X1IB 4BS9A 2QRQA 2ZJBA 2BFMA 5HCUA 2X40A 4A1FA 4UBIA 4LYDA 1GG2A 1BXRB 3PIDA 3QUCA 1OT5A 3N86A 4GICA 4U2CA 1EH5A 3MMPA 5BRAA 3NDBB 1PYGA 1YMVA 2VWPA 2XWJI 5FLKA 2AJDA 2Q5QA 3O1HB 1I3KA 1Z74A 1PAUA 1QLHA 1TLFA 1Y3BE 2XQKA 3PNQA 4JUFA 3QYJA 3LQ2A 4G3XA 4R3UC 3KX2A 5FBHA 2VP4A 1GDDA 1XEAA 5HJEA 3Q12A 1FYEA 1L5VA 1SZDA 3DE3X 1NI4A 1ZN9A 2EGHA 2R8XA 3DZGA 1NMYA 5EYPB 1V9LA 1AQYA 3LI2A 3GUCA 4XB2A 3TL2A 3FUWA 2IL1A 1Z35A 1ZC4A 5JO9A 4N8EA 3QK7A 2WZCA 1W7AA 3RJZA 3ZKWA 3DE2X 1B43A 5C1OA 3RG8A 4CKZA 5IM4A 1SG6A 1DRKA 1HT0A 1Z34A 4INJA 5EY5B 4A7PA 1NW6A 3DONA 3IB6A 1BOOA 4WOBA 1Y5LA 4X44A 4P4TA 3P4XA 1REQA 1V45E 3LLUA 4RSGA 2JIBA 1XQ6A 4JLAA 3VYWA 2VPYA 1DC4A 4KAAA 5JAPA 4YMLA 2JASA 2FJPA 1RBZA 3GGDA 4TKLA 2GK4A 5AKEA 5FBKA 3AEZA 4AX8A 2YQ5A 3RF6A 1SY7A 3B3AA 4DBLC 3RVLA 4F3RA 5B4UA 4NNJA 5EHXA 2G04A 2C8KA 1GRVA 3L8ZA 3RHTA 2DBYA 4CN8A 4EUNA 3U7JA 3QHAA 2BFBB 1UP6A 2V74B 2ZWMA 3CBQA 5AVKA 3TPCA 2RHRA 3KKKA 4R71A 4YMHA 4UHBA 4OHOA