1G2PA

Crystal structure of adenine phosphoribosyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
170
Chain Sequence
SYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYESDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE 1
publication title Structural analysis of adenine phosphoribosyltransferase from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 49
structure length 170
sequence length 174
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g2pA00
1O57A 2FXVA 1A98A 1QK4A 1JLSA 4RHTA 1DBRA 1A97A 1G2QA 4QYIA 4RACA 1ECBA 1A95A 3H83A 3N2LA 1ZN7A 4JITA 4M0UA 1UFRA 3M3HA 3DAHA 1PZMA 4RQAA 4P3KA 2DY0A 5ESWA 2EHJA 1ECGA 4P84A 1WD5A 1I13A 1TC1A 1CJBA 1VDMA 1NULA 1L1QA 4LYGA 2JKYA 2YZKA 1JLRA 1U9YA 2PS1A 1YFZA 3DEZA 3GGCA 5BQOA 2JBHA 2E55A 5K51A 3ACCA 5HKLA 4OHCA 1I14A 1TC2A 4RV4A 5IPFA 1DQPA 1VSTA 1HGXA 3NAGA 1BD3A 2PRZA 4FYMA 1Z7GA 3OHPA 4LZNA 4IJQA 3MBIA 3ACDA 3LPNA 1D6NA 1QB7A 1A4XA 4RANA 1DKUA 1GPH1 2VFAA 5KAMA 5EUCA 4WN3A 1BD4A 4KN6A 5E38A 5JV5A 1XTTA 1I0LA 1OPRA 4LZAA 1QK3A 2H08A 1V9SA 3GEPA 4JLSA 4PFQA 1I5EA 1G9TA 1UPFA 1XTVA 1ECCA 5JSQA 1OROA 1A96A 2JI4A 3ACBA 3KB8A 1Y0BA 4QRIA 5ESXA 1A3CA 1ECJA 4S2UA 1GRVA 4RABA 2JKZA 3G6WA 4QYIB 2H07A 4RAOA 1L1RA 2WNSA 2C4KA 1ZN9A 3O7MA 3MJDA 4RHXA 4TWBA 4X45A 5BQPA 1P4AA 1I0IA 1P18A 1G9SA 1XZNA 1G2PA 1ECFA 2IGBA 3QW4B 4P83A 5IAOA 1QK5A 4MB6A 1ZN8A 4M0PA 1P19A 2H06A 1NONA 3OZFA 4P82A 3HVUA 2XBUA 1OREA 3DMPA 1P17A 1UPUA 4RAQA 1DKRA 3GGJA 5BRNA 2AEEA 3S5JA 4RHUA 2PRYA 4LYYA 2GEBA 3EFHA 5KAPA 1VCHA 3LRTA 1XZ8A 4LZOA 1DQNA 1J7JA 4P86A 4RADA 1HMPA 4X44A 4M0KA 1MZVA 4PAWA 1QCDA 1AO0A 1W30A 4RQBA 1STOA 1BZYA 1O5OA 1FSGA 1XTUA 3OZGA 4F8EA 1LH0A 1QCCA 4P80A 1QB8A 1IBSA 1R3UA 4ZFNA 4P81A 4WMLA 4Z1OA 1U9ZA 5BSKA 4RHYA 2P1ZA 5HIAA 2HCRA
chains in the Genus database with same CATH superfamily
1ZIXA 2HJVA 2IYWA 2R4QA 5EFZA 5GOZA 5HTKA 4DG5A 1GZDA 3GLGE 1ZXXA 5FEUA 1Z74A 1J70A 1YRQA 4UTZA 1HUQA 2RHJA 4F60A 1IWPB 3DB2A 3HC7A 5L3ZA 1ISGA 3IR5A 4JT2A 3TLEA 1M33A 2GBCA 4UQLA 2DCUA 2XYVA 5KVCA 3PC8C 1HQDA 4HNAB 3WNZA 3A31A 4REQA 4Z0HO 2AFIA 4TX1A 3BEOA 1SXJB 2HRZA 3PC8A 3QE0A 4KJZA 1UBUS 3ZZ0A 3VR5D 2ZITA 1HEYA 1XA4A 1KYQA 1NQXA 2C7BA 2E5WA 1JSCA 1XCOA 3CNQS 1NUQA 3DL4A 3LVFO 4IXWA 5ADWA 3C6QA 1ISJA 3RV4A 3EEQA 3KT6A 4HAOA 1Z5NA 4TLMB 5I51A 3KR2A 1MNQA 1RI4A 1N1MA 1WNFA 2R8YA 5L3RA 2OP0A 1O5TA 1XDWA 3ANYB 4KIUA 4F2HA 4I36A 4URWR 1JDSA 1RBQA 4W9NC 1B73A 5C9ZA 3PKJA 2G36A 1UOEA 1DFHA 1ZZGA 2IY9A 4WOJA 3BSFA 2JANA 2RE8A 1QV6A 4WGGA 4F4UA 3ASYA 1UK8A 5LQJA 4WIAA 3R8XA 5AJXA 2KB0A 5K8LA 3N8IA 4OP1A 4UBJA 4M60A 1SXQA 1UZUA 1VOTA 1H6AA 2Z83A 3OJOA 2AOTA 3GLUA 4PZYA 2AOVA 1XCPA 3OEHD 4LI3X 4C08A 3PITA 3FKQA 4U7TB 2CNDA 4R5MA 2EWVA 5J5AA 4GPZA 1RLUA 1KIMA 2FN8A 5H68A 5EHQA 2ZIZA 1A96A 4RWEA 4WE3A 2RG7A 1XRJA 3K6JA 1TYAE 1K8ZB 1IULA 2J67A 4FU0A 2ZT7A 4MQFB 1ABEA 5F73A 5SV2A 3M7IA 1GYRA 1G8KA 5JQGF 1CT9A 4Y6LA 2AZXA 1WF3A 2JLCA 2VJMA 3W5CA 5IARA 4G26A 3KZCA 4OCZA 1GGVA 4EL5A 3K70D 2R751 4B5LA 2P4HX 1GPMA 4H3KB 3W6ZA 5U4XA 4MHTA 4P3XA 2RHRA 4GZ5A 1H2AS 4IV0A 1YBAA 4UOQA 1H9AA 5FF9A 5F7OA 2HA4A 1DXQA 3PEFA 4QUIA 2XWQA 2HQSA 3U4CA 1YQEA 2H2AA 3HXTA 1TO1E 3CLSD 4CIYA 1SXJA 3W4IA 1L5HB 2H0QA 3MJHA 3FDZA 3OKCA 4MRMB 4B83A 4Y7CA 2YVKA 4NENB 1VSVA 3DDHA 3HDTA 4U4AA 2SNIE 5FT9A 2J3IA 4A27A 1OT5A 3BXOA 4QIHA 4D7AA 4Z7JA 2PVPA 2G0AA 3I9OA 5ELXA 3GUCA 2A9FA 4HADA 4M0KA 4RZHA 4Y6GB 1L3BA 2QE7D 2VZ9A 2Y68A 4EH1A 2G9ZA 2HAEA 2FQYA 1WVIA 4YMIA 1ULAA 1ZD3A 4IBOA 2IEBA 4NXNB 4YDRA 1JR3E 3I04A 1CQXA 3H3JA 3P1JA 4KW7A 1F2DA 4DLYA 4DV0B 2C5SA 4JKYA 1Y6GA 2GUWA 5HEKA 1KJ8A 1H5UA 5DM70 3K4QA 4EUNA 1MO3A 1W48A 1XLVA 2UUPA 4OM8A 4EHFA 2IW1A 3NIDB 1GTJ1 4ZT2A 3E9NA 2BZ0A 4GG1A 1WVMA 2WLSA 3CMMA 2Q7DA 4IIYA 1T1GA 2ONZA 1PEYA 2ONKA 5HQ3B 2VUIB 3DAFA 3FJYA 4Q4LA 1IY2A 4RK0A 4MQFA 1RRPA 1NUHA 1A97A 2GBPA 1E4VA 4H6VA 4RH1A 3KKQA 2ZDHA 4ZKEA 1XD9A 1QR6A 4HPXB 4B76A 2FK8A 3K7EA 3IUMA 5AM2A 2J46A 3JQQA 1NVVR 1W59A 4ERNA 1QUFA 5IKPA 4UUQA 1YR7A 3GT4A 2UVDA 1TCCA 2P27A 3LBFA 2Q5EA 4O33A 2ZBVA 2COEA 3I4FA 1SUWA 5FNVB 1WULS 3KXIA 4P3NA 3PQ2A 1W4CA 2XD4A 3V1NA 4MPTA 4Z7OB 3DDZX 1PO7A 1M34B 3GF4A 5JTUA 3F78A 2QW8A 3M1AA 3FUUA 4QDJA 1EA5A 3WJ7A 4EG4A 2H1RA 2LXNA 4FMDF 5HCIA 1ZOPA 4U7PB 2FF5A 1YHZA 3QUCA 4HDQB 3KUDA 4KDEA 1KDYA 5FUQA 1E89A 2D4HA 2AC7A 3BA6A 5DT2A 2A58A 2BOVA 3PWZA 1PG0A 3VDQA 1JBEA 3WYAA 5K4HA 5KUTA 1SXIA 2ZJOA 4G5GA 1AMUA 2B82A 2BLLA 4GW3A 4D41A 5ETJA 1X92A 1XF9A 1WQ3A 3VPSA 1KTVA 1MP0A 3A6GA 3QKSA 4E2XA 1R74A 3AETB 5LZ8A 3KQLA 1YJAA 2ID4A 1OILA 1UCFA 3I45A 4X54A 2SICE 3DMDA 4DOMA 1PLKA 1VHQA 3X2EA 4M3NA 4HVCA 1ST2A 1N6PA 2O50A 2J30A 4L15A 1GQQA 1C29B 5LQUA 2GK7A 4JKIA 4W6QA 1DS6A 1P7VA 1M0TA 2BBWA 2VYQA 3PYXA 2P68A 2GARA 4R51A 1BN6A 1L1FA 2H4XA 1QYWA 2WAYA 3PE6A 1AS0A 1M8FA 3BCRA 4B4WA 2CJWB 3RASA 3ZE0B 4AS3A 1AQLA 2YOHA 4F4HA 3Q7IA 1U6JA 3D3QA 4ENTA 1M8GA 4LV5B 5K3FB 2GD2A 4HF7A 2O2CA 2WPDA 1G3QA 2GILA 1IHOA 1RJEA 4GOLD 3B9RA 4IJKA 3JV7A 2QGFA 2YC2C 4KDFA 3H5LA 2JGIA 4Y2RA 1OUMA 4DYDA 5BR4A 3W2IA 4X92A 3ZWXA 3KC2A 2CVZA 4ETWA 3A6PC 1FTYA 5FNVA 4AURA 1E9SA 1W5BA 1R5OA 3H8VA 4B33A 3R6DA 1GTVA 4DWVA 1PNRA 3TSAA 5K2OA 3W5SA 6REQB 1UBKS 4IMRA 3TG2A 3L5KA 1HTTA 1EXDA 3V4FA 5J2TB 1VRCA 3W78A 1T8YA 4I3FA 4DNPA 1WPXA 3GUZA 4PM4A 5FWNA 3GLFE 2AJDA 3ZHZA 2O8CA 2BKVA 3NDPA 4BNKA 1W581 1P73A 1KEWA 4LHWA 1FLVA 1IZ7A 1FFHA 1XZLA 1R88A 1MQ9A 3E2PA 4HXYA 1ZINA 2IPLA 1J42A 4BB5A 3CVWA 2Q0QA 3OOSA 5FI1B 5DNYB 1IEVA 2BJHA 1OWPA 4MVXA 3GNTA 2PT6A 3KTFA 2NVWA 4P54A 5EGNA 3QXXA 5HBGA 1PK8A 1CUWA 3MSCA 4I99A 4Q9NA 1BGWA 1UXIA 1ZW6A 2XITA 4PFSA 5C5IA 3EBLA 4N03A 4LRXA 1U0HC 4BL5A 3OCCA 1IRXA 1B41A 3C85A 3I37X 4ND4A 1R4AA 3KOWA 5JO9A 1NX9A 1DWUA 3FLAA 4R05A 2R44A 4JLVA 1J0CA 2ECQA 1FJHA 3HKCB 2EFGA 2YICA 3O92A 4P98A 2VPZA 1ZWKA 4GI1A 3C3XA 4RGYA 3V3TA 2ODWA 1POWA 4F6LA 3ZD9A 1RYFA 3T5CA 3LAWA 4HDMB 1QDEA 4WLUA 4G5FA 4OO3A 2DERA 1E6MA 1J2TA 2IZ0A 1PLLA 5DBOA 2CJWA 4PGHA 5CUQA 4TVSA 2FPIB 3NWBA 4I4CA 1DVRA 4HQKA 1UZLA 2A4MA 2RK6A 4RJIA 3SKXA 3WLSA 2PS1A 2AGVA 5K3FA 1BFUA 4IRUB 2PZGA 1RYMA 3GGCA 3PPYA 2ERCA 2XJ4A 1VMDA 2A86A 4XYBA 4BUZA 4IUYA 2X40A 5AW4A 1VXRA 3E23A 3DFMA 4E30A 3PNMA 1Z0AA 4RF2A 1O0BA 3A4VA 3A1UA 6REQA 4LTDA 5IJAA 3QLVA 4RPGA 3PGXA 2CT8A 4QU5A 1CQZA 3ZDYB 3EYWA 3RRBA 1FXUA 4LQDA 5J2TA 2WWWA 5ARCA 4X60A 3CNOA 1A88A 4MRPA 1XELA 4Y2HA 2PFKA 3QY9A 3TZHA 1ZK2A 5D3QA 3MSXA 5E6RB 1X0VA 1ZOIA 2V1UA 2AF4C 3UTCA 5JI2E 1FTGA 5FL3A 3Q0TA 3BHMA 3C3EA 5PGMA 4OJNA 4RPHA 5JADA 4BASA 1R12A 2J9XB 1N33B 2XSZD 3NR2A 4IQ4A 5KHOC 1QG2A 1N32B 1A27A 3HXPA 4XUCA 5DSZA 2C7GA 3R0QA 5CTAA 3ZHBA 4LIPD 1RPJA 1HT1E 2SBTA 3G7UA 1NOIA 2DLCX 3RBZA 2QR3A 2C7OA 2VG8A 4HS9A 1G20B 1YH3A 4DBLC 3BAFA 3I83A 1UFQA 2YJ6A 2NV2B 5B3AA 3MEQA 4PE5B 2XA9A 4RL4A 1QVVA 3HKCA 3SLKA 5JS7A 1Y3CE 2G1UA 2IHUA 4ZO8A 3PNYA 4ZDJA 1GSHA 4D4JA 2KLBA 1GV1A 2GWHA 4HDKB 2F8TA 1Q1GA 4CIVA 3KFLA 2BBOA 1O6FA 1P7WA 2JI9A 2PX6A 1I4TD 4KYUA 1R5JA 2YVQA 1JQDA 3OQVA 3FI9A 5GAJA 1GNVA 2P9GA 1VE7A 3OESA 3NT4A 2NVOA 1IZZA 2ZYWX 3U4GA 4CR8A 3B6EA 1EYZA 3BHNA 2VYND 3KXPA 2MINA 2VP2A 4D9GA 2FMKA 4KX5A 5ALIA 4W5TA 3VKHA 3IEUA 2W48A 2P41A 4PN3A 2BLNA 3MBKA 2V6FA 1J49A 4A7PA 2OK8A 4LGMA 2XYGA 4FR5A 3OX4A 5AKZA 4HRXA 1SK9A 3JR7A 4CR7A 4BRUA 4CM9D 3P71T 1LH0A 5ALWA 5AVXA 3AHGA 1BEEA 2HWKA 5KQGA 1PQ4A 3GEEA 2F90A 3GYGA 5FB3A 4GPBA 4R2XA 3VO9A 1HQYE 4EB3A 3ZVLA 1O97D 4L16A 1OI7A 4N0QA 2JFNA 4QBTA 4H0FA 1FFCA 1UQUA 2VT6A 3ILVA 4AWXA 4BNLA 3KG2A 1T6NA 4W9RA 3T7EA 4DCUA 1X19A 5H82A 1E5TA 1NN0A 4AICA 5JR3A 1ZS9A 3QTTA 1IY9A 4Z3OA 4IFBA 3L8FA 3PL1A 1XZIA 3CJQA 3W2TA 4XX0B 1DAFA 1EWTA 4PRZA 1YRLA 3AXSA 3FFTA 2YQZA 4NJOA 1G20A 4Q9AA 1NFRA 2BT4A 1AUOA 5ECYA 2BEJA 1VDMA 2H4JA 4B79A 3PD0A 2PMEA 5J63A 5HSGA 5AVYA 1ZDMA 4HAWA 3QE2A 2CL5A 5EZ6B 3W9YA 4MI1A 1E64A 1USKA 1W0KD 3DJYA 3KKMA 5DYTA 3WQRA 3ZHTA 3D8UA 4C1BA 1C9YA 4PC3A 4S1TA 4HDKA 1J25A 2QN7A 4RIHA 4ZT7A 3UHPA 3PBKA 2LCIA 1DTEA 3NEAA 1ZK1A 3IDZA 2DX7A 4YJKA 3RJ5A 1LLDA 1CY7A 3HJHA 1Q14A 3KKLA 2XF8A 5FO1A 3QIVA 2HB6A 3RNOA 3W7AA 1LX7A 3OOJA 2FN7A 3E05A 4AX4A 3ZU3A 4P1ZA 5KAMA 4EEKA 3WA7A 1MMFB 1PBNA 1U1CA 2E37A 3B82A 4ZTUB 3FOBA 3HNRA 1T4BA 2CGEA 2QT9A 3TB4A 4DANA 1FC0A 3IL2A 2D2FA 1NXTA 5DLYA 3I5UA 4ZMSA 1POXA 4GC9A 1NQVA 1UM9A 3ZDBA 4ALMA 2CLMB 4HB3A 1V1MA 4P7FA 1JJAA 2PBLA 3P9RA 2PX0A 3PQ5A 3Q8WA 2W6ZA 2GAJA 5K0CA 3C41J 2PX4A 3R6TA 1ORTA 2V9CA 4X91A 3L7OA 1WHSB 3UNXA 1W7AA 1E1YA 3M34A 2Z4SA 5C8VA 1GZ6A 1T5SA 5C7LO 1RI2A 3HSSA 4MP8A 1PWYE 4EKIA 1DV2A 3BMNB 3O75A 4AI6A 4GXTA 1KMMA 2OXTA 3EWNA 1SU8A 1WAMA 1KERA 3I1JA 3RC1A 2R5WA 1C0EA 1D2RA 2OZEA 2WU8A 3PCXA 3PR1A 4G1CA 3IALA 1UXHA 4QX6A 5LQRA 1NXQA 3V8NA 3A9CA 2AKYA 3MCVA 1UFOA 3R4VA 4PSDA 5T8KC 4XX0A 1DRWA 4EFDA 1FLNA 2YV4A 4I5FA 1XTZA 2A2ZA 3PNLA 2P9ZA 4GAEA 3P0EA 3MAAC 4MWGA 2VF8A 4P32A 2ZIWB 1TT7A 5T8KA 1TGYA 2OBYA 5F3RA 3G9TA 4NYMR 5EJ9A 1BE8A 3OZCA 3ADOA 1I32A 1T0JB 2FJPA 3KB1A 1Z5VA 3GJXC 3LLMA 4JYCA 1GGKA 4QUKA 2C1EA 5LQDA 2DULA 1MEOA 3ESQA 3SHWA 5JHHB 5K8VA 1BX3A 2B3TA 1XLTA 1RHKA 1GWNA 1AV7A 1RXSA 2P2CA 3OE7D 3UWSA 3A4TA 4CMEA 1V6CA 3G5MA 1XUOA 2JFHA 1JHQA 5G3YA 1ZNQO 3EHEA 3O84A 4ZAWA 3M6FA 1QB8A 4Q01A 4ENPA 3B2QA 1IMOA 4A6DA 4J91A 3VO2A 2QF7A 3ZZUA 5HJEA 1PD0A 4NLLA 4OI2A 2ZEJA 4F1JA 3HSYA 2DWOA 2F9MA 3DYBA 4H31A 4Y2YA 5F52A 1TFRA 3SI7A 4MUMA 1LWNA 2ZRLA 5EQJB 3QGMA 3R7NA 5AKIA 1ZN7A 5I7SA 2IYTA 1WHSA 4INAA 4MTCA 1T9BA 4IILA 3ZVMA 4EFLA 3QOYA 4X64B 4NG5A 3TQHA 1R8QA 2WIKA 3DEIA 3BMNA 3BKXA 3U3DA 2R25B 4JHXA 4DDVA 2H2WA 3L1KA 3LLCA 1XNRB 3PUYA 4IW3B 2XY4A 2I6FA 4Z3KA 1EP1B 1NBWB 1OVMA 1OI4A 2C31A 3NATA 5L4NA 5IDXA 3P0JA 1GQRA 2AVNA 5H59A 3DTYA 2WT8A 3L7AA 1N3YA 3RLIA 4OYLA 2O2DA 1FQKA 3L2OB 3OF3A 4FCWA 3LUFA 1XHEA 2YFKA 3S1SA 3Q7QA 4M8KA 2PU7A 3TQRA 4ZAVA 3ESYA 5FOVA 3E53A 2WF5A 2W0MA 4Y2JA 2RAUA 2YNMD 4DABA 2OAP1 5ENVA 4CU5A 5LQAA 4ZZ1A 1A4XA 5L7WA 5GZ3A 4P5DA 1DAIA 3BH7A 3RLFA 3QFRA 4YUZA 1HR0B 3RRNA 1J0AA 2A9PA 4P9NA 4Z9BA 5G41A 5IBCA 2GA8A 3DCJA 1RBZA 2XOKA 3MRSA 3OECA 3QLUA 3WK8A 2NUAB 5ALRA 1FU4A 2AG5A 2PUVA 1LVHA 3Q1KA 2VI5A 4RZXA 1CEQA 1QONA 2AMVA 3GG2A 4N4AA 4ZZIA 3M6UA 3HLTA 1ZUHA 2E49A 3B6IA 1OAAA 2PUJA 3HCBA 3IT0A 3K20A 5CNMA 2V6JA 4V0SA 3UJ9A 2PQ0A 1ITZA 3G68A 3VXKA 4IKEA 1Z82A 2ZJ2A 4BQFA 1WB5A 3PI7A 4YRZA 1L4MA 3R9XB 2BZGA 5BWCA 2H4HA 3TBFA 3BYZA 3IV9A 4HYQA 3FNHA 4DKJA 3NHWA 2ZRAA 3KDAA 1X1QA 1OLUB 1B76A 2ZIUB 2MMCA 1F7UA 2C9DA 1WB6A 2I4TA 5KYUB 2E5FA 2VDNB 5AMXA 5TQ0B 5JS2A 3HO6A 4DDUA 2AJ8A 1QGUA 3V7WA 1YI0A 2F4VB 4M0MA 1V39A 3OLYA 4HBGA 1JH9A 2WE8A 3WZ2A 5DLDA 3RW9A 3G02A 4XPZA 1TF7A 5FOQA 1N6KA 1AXRA 3GMIA 3WK4A 2BBTA 2M1XA 1O95D 1W19A 2XQJA 4F8YA 4LVCA 3S7TA 4AP5A 5KSYA 4IDQA 3FPEA 5DT9A 4EB8A 2VBGA 1LY1A 4K86A 2WNHA 2ZVJA 4HNGA 2O0MA 1FP6A 1B0PA 1OH5A 2VJBA 4IQGA 5AVTA 5ADUS 3K1ZA 3TXAA 1CPYA 2XMBA 4XLLA 4C4ZA 4BKPA 4H6PA 4AC9A 5AD1A 3JD2A 2DC1A 3K6KA 3BXHA 4H6XA 3U9TA 2CJYA 1XTPA 4MIYA 4R0VA 1TVMA 3LC7O 4YIKA 3KEGA 3TR5A 421PA 3I9V6 4FX2A 4RVHA 3IIKA 3N3BC 2HTFA 3ZCPA 4XRGA 1JFLA 3RS8A 1AY0A 4DLAA 3DBVO 2NUAA 5FPYA 3LHIA 4ZOCA 1P8AA 2V55B 4C0KA 4HNSA 4ASUD 1YB6A 4TRNA 4MGZR 1KAMA 2DPYA 3RUEA 4BDSA 1XG5A 5FWXB 5TVKA 5GADl 1Q44A 3G2KA 4YEDA 2GN4A 1YE3A 3A6LA 1C9EA 4Y67A 4AUNA 1B0UA 4G36A 2I7CA 2EWWA 4G01B 2O14A 4C7KA 2HZ7A 2M9MA 4OLHA 2E1RA 3HKBB 4L78A 1A77A 1P31A 2D5IA 3EB9A 5I7OA 3R9XA 4CDNA 3L79A 2CLSA 3K31A 2FG5A 1ILEA 5KQSA 5JWHA 3EEYA 3GW8A 3AO0B 3OPMA 1OLUA 1ENZA 1TTQB 1U9YA 1NPTO 2PX8A 3QU7A 1YQTA 4PZUA 3AGQA 1S2NA 4U5QA 5IM5A 5KYUA 3USZA 5TQ0A 1NBOA 4CCYB 2X6RA 3I05A 3ADPA 3B1XA 4GM1A 2H92A 4M0FA 3PX3A 3OD1A 3TNJA 4JP3A 2I7VA 3G88A 3C6XA 5KC8A 2A35A 1LJUA 3BOSA 3C8MA 2Y05A 4TKMA 3ZXIA 3CLSC 5A04A 3HU3A 4QOHA 2BE9A 5K8CA 1SULA 2VUSA 3EAGA 5E4JA 1EVKA 3SYMA 2X58A 4A8HA 9LDTA 4L02A 1QZUA 1XKXA 4LY0A 2PRIA 4B7CA 1TCBA 2AV6A 3ABQB 3GB9A 3IVGA 4OHBA 2C7VA 3V42A 3ROFA 1C0IA 2GAAA 2O07A 1KQGA 4TLBA 4TMTA 3V7NA 4GRIA 3T95A 5DZSA 4EMSA 2NSHA 1WP4A 4XFKA 1EZZA 3T61A 5FLKA 1CRZA 2Y1WA 3B78A 1NWHA 3RHTA 1G8PA 1VG1A 4BECA 3AJEA 3L8CA 3OQNA 1H2ZA 4AJIA 3G6WA 2AKAB 5HUQA 4UPEA 1TM2A 1TX4B 4Q03A 4QLOA 4Y2PA 3SE0A 4JGBA 1MQAA 3A27A 2ZUBA 1WUIS 1WETA 3TINA 4CI0B 4C0AC 2HIMA 1D2MA 2NIPA 4K9DA 4MDFA 4PN7A 3U40A 1AQUA 5FWXA 5GGYA 3ZBTA 5JZOA 1Z5WA 2J3KA 1IXYA 4YRSA 5FNVF 3WFJA 2R97A 3CF0A 4WZ6A 3LUBA 2ZYRA 4FWIB 1ICIA 2QX7A 4XIIA 5EXTA 2UYHA 2WTUA 3IEPA 2PTGA 3AIMA 3PJGA 4LVNA 4O4JB 5AXDA 2XMQA 2P62A 3LCRA 3QX9A 2XUAA 8AT1A 1ADFA 3KETA 1OB5A 4DXHA 5J5VA 5AHRA 5KSOA 5D51S 2JH8A 2NO5A 1YV9A 2BFWA 4RCZA 2NVUB 2TRSB 1F0KA 2VR1A 1JB9A 1SHUX 4H7EA 3VU1A 1F0YA 3QV1A 2FLKA 3V2HA 4CCYA 5LOVA 1UXGA 1NL3A 2NXWA 5IUJC 1VA4A 2XR1A 1P7CA 1BMFD 2O3UA 2RKBA 1FL9A 5EHIA 3P2IA 1PVDA 2H85A 3FVTA 3V5NA 1JQLB 3IURA 2Q3JA 2BFBB 3ZLVA 4AMVA 1G42A 1R6DA 3EC2A 3NFYA 1K5PA 1OJLA 1DSSG 2R8RA 1NBAA 3EMKA 2GPYA 4RHEA 4OJYA 4RELA 1NQAO 3UV3A 4C0JA 5B3JC 3GQVA 2G09A 4NNOA 4TS9A 3QH4A 3QG5A 2ZR0A 1O6CA 2IYSA 3UG7A 3H9EO 4O1HA 4DQKA 2O7VA 3M2TA 2Q9UA 3TVDA 4E46A 4OM7A 1V1JA 1I1QB 2JAQA 2GFIA 3BZUA 3OKPA 2GLUA 5LBUA 4XD7A 3DH0A 3MGAA 5CCBA 3A58B 2GA9A 3BXGA 5E4TA 4DR4B 1UBHS 4UMFA 2AX3A 3LCUA 4ZK2A 5AVJA 3UUGA 1ZH2A 5KYTA 2J6IA 3B6ZA 1SCBA 1VB5A 4YP5A 1V41E 1KOJA 2B25A 1JN0A 1QP4A 4WD3A 4AUEA 4O25A 5CGZA 4QEDA 2H7YA 3A11A 1YHNA 3GR6A 3P5SA 3INTA 4JJFA 5COQA 1FSPA 2W6QA 4D96A 4FHCA 1OBFO 1GG9A 1JH8A 2VYCA 3V8RA 4RENA 3QWHA 4NFSA 4WCFB 1MQ8B 4LWZA 3PHLA 4FHEA 3ITDA 4KQJA 3ZCXA 4BNTA 1GR1A 3GP5A 5HGXA 4E07A 5J2TF 4YIHA 4MVJA 4PBTA 3ZQ4A 5DKFA 4K1XA 4ARIA 2IE8A 1S3FA 1K7FB 5EJ8A 3K0BA 4PYJA 3ZHVA 1FFBA 3MJTA 1ZJ5A 1AHNA 1H9BA 1RRKA 2Q7XA 2DSTA 3FMIA 3MS2A 4F5DA 2C8KA 1U7TA 3UOWA 1XTIA 4CQMD 1AKUA 4C6TB 3K5PA 1U8UA 2WV9A 3Q3GE 4J0HA 3QPBA 3SIWA 3VR2A 1I36A 2I2DA 2OHVA 3BT7A 1MHPA 3CT6A 4LISA 1LTKA 3FAZA 2C4TA 3E9YA 3PUZA 3JQBC 4L6IA 4EK9A 1H66A 2PT9A 3HXLA 1KETA 2NXNA 1JBQA 2FMXA 4RK1A 4V03A 5EJMA 1CK4A 3L0CA 2Q3EA 2NQ2C 4NECA 4BMPB 1RZVA 1I33A 4JL5A 4LDPA 3JQBA 4D4HA 1E9FA 2DHDA 2GM4A 4YHBA 2W6NA 1HFJA 4RGVA 4BO2A 2CNBA 3K1JA 2HLNA 4EY4A 3E3NA 4O0MA 1UIRA 5T67A 3SX0A 4E5DA 3TZQA 4UZEA 1Z2CA 3AEUB 3EUEA 2GM3A 4B3BA 1Q77A 1OZFA 3UQYS 1QLHA 1L9KA 3MTQA 5F9FA 2D2EA 5KZMB 4F91B 2AB0A 2D59A 3UICA 2PQMA 3ZQKA 1HZZA 3G2PA 4EYGA 5JH7B 1SBIA 3PNQA 1FQJA 3FTNA 4PCLA 2H1LA 4K9QA 4EELA 4YQYA 1RQNA 2YFQA 3G0OA 1WV1A 3SMQA 5BOSB 4QJ3A 4O2BB 3EVZA 4EJSB 4QUBA 1M6WA 2G71A 2EFDB 3BF8A 3DOIA 2V7UA 2V98A 3QENA 3WNBA 3ZHRA 4DIFA 5EJAA 2XUZA 3JQCA 4H60A 1FVXA 3QU5A 2OSBA 4TYQA 4QNNA 3JQFA 4UHDA 1C9KA 4BP8A 2V03A 4LCJA 5AVUA 2JJQA 5D3MB 2DRIA 2AEFA 2DKOA 1OTHA 2ADMA 2VNAA 4YWJA 1NVWQ 5HOEA 3OQMA 2VH1A 3EXEB 4QWMA 1LBIA 3B1JA 3QFHA 4OQPA 1IONA 2XAUA 2QVBA 2W2OA 3GFGA 1H0KA 2IIVA 3LQRA 3OFJA 2RCYA 4MX8A 3VX3A 4EGAA 3OZVA 4KL8S 3C3YA 4C6TA 4P4UA 2XZLA 2XNJA 4KXLA 3AIOA 2CFIA 3DLAA 3JQEA 4D9CA 2WUGA 3ILHA 5CVUA 4MS3A 3QSGA 5IK2A 1VJ5A 2HO5A 3GXOA 3HRHA 3KAQA 4JMLA 4C76A 4ZEMA 1PV4A 4QJBA 1B16A 2XB4A 3U3XA 3THRA 4CNBA 4AO6A 4EHIA 1XXHB 2V4UA 4DZTA 2QRQA 4EZEA 2EHDA 3N6XA 1XYGA 4FILA 2Q4EA 1USWA 4UE6A 4Q4JB 3AEUA 1EBFA 3PXXA 1CNEA 4FFVA 2PBRA 3JD4A 4LXGA 1RFGE 1LI5A 5K0FA 3HK2A 5LP6B 1LBSA 2GI4A 1MEJA 5JY1A 5KTRA 3ME5A 4I1RA 2P6RA 3LL7A 4HJRA 3LGXA 1IXSB 3DFZA 4MGKR 1L3CA 2JK0A 4GPIB 3EGOA 2YRWA 2QX9A 4YAIA 2OVBA 3BL5A 4OHXA 4W63A 1XB2A 4WNAB 2JI7A 5CFMA 3CXRA 3JAWB 1FY2A 3GT0A 4IZHA 2VWGA 5FTMA 4YUAA 3OVMA 2I5PO 4OSPA 4O2BA 5FR2A 3V8PA 1QB7A 2FE4A 5DTRA 4EJSA 2QLBA 1PEAA 3VTFA 5IASA 3N39C 2A4KA 4RJLA 5FHRA 1Q74A 4UMDA 1RYNA 3RYTC 3OLVA 3OIUA 2GAOA 5EWLB 1ZRSA 4OLJA 5FPPA 4HI0E 5CM8B 1KOGA 3LCJA 1ZL0A 4IDEA 2GAIA 1E5XA 3HV0A 4EA7A 4PFQA 2JLQA 4AMBA 2Q6OA 1WUKS 2ZR7A 1EDBA 3DO8A 3QKIA 3CV3A 4XDHA 2QL6A 1YR2A 2ENWA 5D3MA 2VLIA 5D6NA 4C6HA 5KNDD 3C70A 1PTJC 1SG6A 4KAFA 3ZIDA 1XRRA 1NXOA 3ELDA 2C5FA 1KZ7B 1LDYA 1XJ0A 3FNEA 2WABA 3WNQA 3PCRB 3ZE7A 5KNLA 2VCYA 2PSSA 3BEDA 1EFRD 3G9QA 1R10A 2AC4A 4AQDA 4Q15A 1VECA 1B74A 1O97C 1K6JA 1ODIA 4LV8B 1DIGA 2HXYA 1ZI8A 2ZIEA 4A2CA 1VDZA 2HHHB 1LV8A 4FJ2A 4ENQA 1OT3A 4KXFB 3STUA 3TF5A 1Q11A 3NKVA 2R7KA 1YU9A 2EJVA 2VJNA 2EKZA 4WFJA 4H6WA 1XXHA 4AS2A 5BRNA 5DN9A 1XPUA 2D1FA 3G2OA 2GO7A 1GZUA 4QBKA 2PRYA 4UAUA 5EKXA 3P9PA 6ADHA 1KRXA 3DV0B 3JQ6A 4Q4JA 3GAZA 1WPGA 2WYHA 3JRXA 1ZONA 2MSKA 5ICSA 4FFBB 3FA2A 4GNRA 1K63A 2QORA 4DSZA 5LP6A 1VKOA 2QUKA 4BMSA 5LZ2A 3A1WA 2X3UA 3PFKA 3LTEA 5ALLA 4CUZA 3WOVA 4DCTA 4B43A 1ZU4A 1PQPA 1PV2A 3FYHA 2WU0A 5DTIA 5JPDA 2H5JA 1W0KA 3L49A 3T5DA 1QC5B 3KJFA 3JAWA 3R3ZA 3TRKA 4GYWA 4AY3A 1YS1X 3K9QO 4FDMA 3WGOA 4KSBA 4DCVA 1UANA 2NAFA 2OQ2A 2ERYA 3GAFA 3LUCA 5TV2A 3AYXB 3VTAA 5EWLA 3VPAA 2H7VA 2GJ4A 1Q0UA 1XZPA 4NOJA 5EGSA 4BB0A 2CN1A 2DF8A 1JL3A 1RQGA 4ZIRB 4R81A 5ECGC 1I0ZA 1JTVA 1UC5B 3Q3JB 3LJKA 4LXXA 8GPBA 5AOCA 3M9XA 1T9HA 4GXQA 5CRIA 1TEZA 3EVDA 4YREA 3EZNA 3CWZA 3L0YA 4C3ZA 4NX2A 1CZRA 2GDZA 4D74A 2IU0A 2WM2A 3UQZA 4EUEA 3D0RA 5HUHA 4B40A 3INYA 2G88A 3LP5A 2HX1A 1DXHA 3NBXX 4HL6A 4ON9A 3JCZA 2VNIA 1I3LA 4IR7A 1NSFA 1JSLA 4KN5A 2CXNA 2I4LA 5EP2A 1IU9A 3MT7A 5BWOA 3OG9A 3HI4A 1P0IA 1W73A 3CM0A 3UJAA 4YRCA 5CDGA 5IXJA 1K88A 3U19A 3GU3A 3OMXA 3DOJA 4JLUA 4M9QA 1ZFNA 3GJ0A 1XDSA 5CH5A 1ATZA 5A3RA 4HRYA 4DAOA 1RWVA 3C8UA 1QS0B 1HDXA 1R8SA 2ZWMA 4WLOA 5JVDA 3I1FA 2XDWA 5GJWC 2OFOA 3H13A 1U28C 1LZLA 3OUTA 2JD0A 4XFJA 4YONB 4BB9A 2FWIA 1IOLA 2PS0A 1GVNB 1PL8A 5CBPB 3ENNA 4H4CA 1QZXA 2YY7A 4NMWA 2EQ5A 4NL4H 1Q20A 1SCJA 2XNKA 3OWHA 4M76B 3FHTA 2I6TA 1JVBA 1QC5A 2AN5A 3UANA 1NNI1 5SY9A 1L2TA 4MULA 1E79A 2GPWA 1G8GA 1OTXA 3W5AA 3VJMA 2YDYA 1IK6A 2EATA 3AKEA 3DOEA 4BMZA 3ZD7A 2Q07A 3HJCA 3AEKA 3NV9A 5IT5A 2ST1A 1L1RA 1AS3A 1KAEA 5NLLA 5U1PA 3UVEA 1ZH8A 3W8DA 4RA6A 1E2NA 2EW8A 2VAVA 3BXXA 3PVZA 1GFIA 3FPCA 4S1PA 3SF8B 3T1NA 5JYCA 3OQOA 1K2WA 1TQ8A 2LRHA 3DDOA 3IKLA 3IVRA 3FJOA 4JL6A 4QLBA 3OA2A 4P92A 121PA 2X7HA 3W79A 3ZU5A 1VCIA 1U7UA 1SFRA 1X14A 1GAJA 2OXRA 3KQPA 1Z6XA 4TSKA 2CUNA 1U31A 1FRFS 2CJFA 4DDHA 1KR5A 5IM4A 2BJVA 4YJGB 5AHKA 1L5NA 5FBKA 4LOKA 4LJLA 3L0ZA 4ARBA 4MA4A 3JQ7B 2X1LA 5T3UA 5T41A 3NHAA 1JPUA 4FE4A 4U7HA 1BHQ1 1L6RA 3ONVA 3HBLA 3LHDA 2P5UA 3O9VA 4V0ME 4WBXC 1AQ6A 3Q41A 1TIPA 4D98A 2QUIA 7ABPA 1ZJWA 1TECE 4MVYA 5G1OA 3T7SA 1ADBA 1JDJA 1EJ6A 1QS0A 3BK2A 1DBPA 1XBTA 2FA9A 1OKKA 3C8DA 3A6DA 3DLPX 1HURA 2JJ1D 1G4UR 4LXIA 1M2VB 2CUZA 5CBPA 4L9AA 2J0VA 4YRNA 3QMWA 2YNMC 2J32A 2CNWD 1NC3A 3ZE9A 3TZLA 2WBLC 4W9MC 4GNKA 1GITA 5A5EA 2Z5GA 2AG1A 3W3AA 2RJNA 4PSVA 1MO5A 3SDZA 3CX6A 3U3KA 2DUUA 3WNCA 4DCMA 1U2TA 2BKLA 3I1YA 3CW9A 1ZHFA 5F33A 1JW9B 1J20A 1XCBA 3B20A 1FYDA 3OM1A 4N9QA 1ZVJA 1YDWA 2B5VA 2IKQA 3WIDA 3ANXA 2XCRB 1B7GO 5BSVA 4E13A 4GPAA 3S8MA 3GJSA 2RHHA 1ZQ9A 1RU3A 4DDWA 1U2GA 4PG5A 3R5XA 1YS9A 1OJ7A 4ZU6X 3S28A 4NK5A 1UFRA 3W2EA 3ZHXA 1V6SA 4JU8A 4MI9A 4QBGB 3SF8A 4BO9A 2PX5A 1BOFA 4KFCA 1MXHA 3MW8A 1ZY2A 2WF7A 1DARA 3C3DA 3WR5A 2IXTA 2Q3LA 1Z88A 5EJ6A 2ODQA 2X22A 5CPFA 3ZIAD 4RXTA 2X2FA 3OLXA 4LSZA 3R44A 2ZBQA 1TMOA 3KV3O 4N8SA 5B1HA 3L04A 4DNFA 3SOPA 3JTMA 5JISA 1PFQA 1ADYA 1JA1A 3IERA 3VBCA 2Q1UA 2PUDA 3GV0A 5BSFA 2FPLA 3A4NA 2VWPA 3MXOA 4YJGA 1Z2OX 3E18A 2R5NA 5TT0A 3SVLA 4AJ2A 1Z16A 2G9RA 2RFLA 1E4EB 3JQ7A 4QJIA 2I91A 1B8NA 1IIRA 1Y4AE 3WJ1A 3KPVA 3L7DA 1ISSA 1CRLA 2A33A 2ZSDA 1MW9X 3L7NA 3SOZA 3URMA 3OHSX 1UL1X 1XKQA 2GQ0A 4S1VA 5F2EA 5HZHA 3PCTA 5IVDA 1O95C 2BMAA 5CVDA 1HTWA 4G65A 4QPPA 4CKYA 2VSFA 4D9IA 3FWZA 1G5IA 4EBBA 1CNFA 3RVPA 4HX9A 5K3DA 2VJCA 4RGQA 2O5EA 5ICEA 3N0WA 1J0DA 1M2OB 2VAXA 2ZRBA 4TTRA 1A9TA 2C5BA 1EFLA 1H1TA 1M2VA 1TIKA 1YDEA 2FUCA 2ICAA 3ICWA 4V2UA 2KMLA 3I3SR 4HO1X 3SICE 1CZNA 1EM6A 1K6IA 3CLUD 3D02A 2Y99A 3UAOA 4YP1A 3PTAA 3SXJA 3TFQA 1LPAB 3G2QA 5K3AA 4C0SA 2FEAA 4TN5A 4E1VA 1C4WA 4EUHA 3A1VA 3GLGB 3IAEA 1MB4A 1DIRA 5ELLA 1NMQA 2F1OA 3JYPA 4RC9A 5KDOA 4LBYA 4D9EA 4K9MA 4XH9B 4MPJA 4MR7B 1H4VB 3GY0A 3LY9A 2ZYSA 3OC6A 4GVLA 4X7RA 1HF3A 1JP7A 3INNA 4JUFA 1KU6A 1IB6A 3DZJA 4RMNA 4DGSA 3UJ3X 2F1KA 1NRXA 1KTIA 2CCGA 5KTYA 4IDOA 1WMEA 4YY3B 1JAYA 3WMGA 4ANFA 3T4XA 5LOVF 1HO3A 2ZOSA 5ITWA 2QSJA 1JPJA 2REQB 3IVCA 2ZYTX 4QODA 4RFLA 1EA7A 1RXVA 2J3MA 4FD3A 3WNDA 2RHOA 4YJHB 1IXRC 1BXZA 1IG0A 1ZNYA 4O1MA 5D7NA 5G2OA 5GPBA 1RZRD 3VC2A 1HLPA 2N0SA 4I1IA 1BS1A 4TSFD 4JENA 4XIJA 1E3IA 1VPWA 4FCCA 5DNCA 2IP4A 4EUSA 1KK1A 2JDID 5L40A 1X7HA 1A4RA 3HADA 4EG6A 4L57A 3CC8A 1X77A 3G9UA 2ZYAA 3EPPA 4BP9A 4CHTA 4J0FA 3RHZA 4KMSA 1G63A 5JXGA 2FJ0A 1JFVA 2FP4B 2XWJI 3UB4A 3FKSD 1Y5MA 4Y30A 3LGAA 4GKAA 1IBSA 1NT4A 2A0WA 5E6SA 4B4OA 5CFNA 1E9BA 4JXKA 3QUQA 4CEHA 2A9QA 1W49A 4MKIA 1ULUA 1DDIA 4JI5B 1M2OA 1T4DA 3H8SA 3GDHA 4DILA 1EGVB 4E2FA 1L7RA 5F7ZA 4LBZA 1OASA 3NAMA 3W0LB 1ZYUA 2O8NA 4ZT4A 3VR1A 5F2NA 4LRUA 1NUAA 2GZ1A 3MFQA 3SC6A 3DAHA 3AI3A 1ZSNA 4D1YA 1DQRA 2BFPA 2J59A 5C18A 1Y9AA 1XOIA 4W1QA 5TQ2B 3IAFA 3Q8XB 4FQ5A 1R6UA 3HFRA 3A14A 2I55A 4EO7A 5JBIA 4DQ0A 4RTSA 3LT0A 4ZJZA 1DWPA 4MR7A 1MOPA 4J16C 4M0EA 1L5YA 3PHJA 4QU8A 4ZO9A 5LIRA 1M6YA 4MVJF 2JA2A 3O90A 1T5HX 1WSAA 2E4AA 2PZEA 3QG1A 1IZ8A 2QQGA 4J16A 4WKPA 4ALJA 1GXSB 1I9CA 2G06A 4M36A 1AZTA 4DKXA 1Z8DA 1NXWA 3OFSA 3QVGA 5IVPA 3B1YA 4MCJA 2REQA 3HMQA 5IC6A 4F7WA 1Z25A 2RB5A 4E22A 3LNTA 3OPXA 1J39A 4MP3A 3A3PA 3I92A 2XQIA 1JHVA 3FCXA 3NH6A 4R9RA 4EYOA 1GN8A 2QTVB 4AN0A 2OBMA 4NU6A 1XZAA 1Y89A 5H3HA 4RK6A 1B1AA 4DIEA 5DISB 4LY9A 5AI4A 5AW7A 1I4LD 4L9SA 4XD2A 1YQXA 4H1UA 4X66B 4OI4A 1I0LA 3UBMA 1O5IA 2DCMA 4S2EA 3R5KA 3ZCUA 3SJ7A 4F56A 1LLUA 4GOOD 4XPIB 1D2NA 2XGOA 2PUTA 3NOXA 2AKEA 1F3LA 3ISVA 1Z4JA 3R23A 2IEAA 4I2NA 5FQNA 4ZN6A 4JDPA 2QL7A 3R77A 5EUQB 1VKJA 4RA9B 4V38A 4YP6A 3LTNC 1NY6A 1HT0A 3AM4A 5FJIA 3T7DA 3B7WA 3NQ41 2BMVA 2ZQ5A 2PMWB 4MGYR 4YLGA 4HGYA 2B6HA 4K6HA 3BK7A 4BC0A 2IIQA 5IZ4A 3ITNA 1TQDA 3R0ZA 3CZQA 4KFRA 5AK4A 1QUEA 4RCYA 3B51X 4NULA 1KNQA 1QMPA 2FX5A 1FX0A 1P2DA 3R2JA 5FV7A 4UXJA 3O1LA 1ZD4A 4R9SA 4UHJA 4M0LA 3OTOB 2JLXA 3OZWA 1EX9A 3TXXA 5JBNA 5KTNA 3RT7A 4QYMA 4UHEA 2O19A 2FFBA 2R7NA 1U1DA 2I8AA 3DLIA 2DHEA 4NZZA 4OLFA 3AF0A 4RCVA 2IYZA 1RKXA 1R5BA 3I2KA 4H1TA 4MWDA 5TQ2A 2OPHA 5E8RA 2AFRA 2JGFA 1BH6A 4X3CA 3T7CA 3TAXA 3ASUA 2O3JA 1I5OA 3ZH2A 1V37A 3R3JA 3GRVA 4LDQA 3SYTA 5KPJA 3R40A 3V8MA 1ZVQA 3GUYA 3IOEA 4DA8A 2ISCA 1X3SA 4PPQA 2ZANA 4QBIA 3FOFC 3HEMA 1EFTA 2O3RA 2C4VA 4A26A 1GXSA 3M3DA 5M29A 3II6X 1Y6FA 1VFNA 3C1OA 4JIGA 4ND7A 2M6KA 2CFRA 2EGHA 1E2PA 1DMRA 3ASVA 1T26A 4M8LA 2RJ3A 2IDJA 3MVEA 1W36D 2QTVA 2WVGA 1OIXA 4M7RA 2HRRA 1SQ5A 4YDQA 3E84A 2WJWA 4K9KA 3I0MA 4FFWA 4K5QA 2WY2D 4BN0A 2GESA 3FRHA 3HBMA 2BF4A 1EP9A 1PG2A 3T4UA 2OGSA 4J1TC 3GG9A 1HG0A 4XPIA 3H97A 2VK8A 2JH9A 2JW5A 3FHJA 3D31A 1E8MA 5DYNA 4OXXA 1D0SA 3KPWA 4YACA 4DS3A 4D0GA 1YQWA 4EMUA 1IB0A 5EKSA 1QP7A 3WLIA 1UT6A 4Y1GA 1YTUA 4CQMA 1P33A 2G1AA 4BEVA 3RVKA 2FQXA 3PEUA 1KZ6A 4F2WA 2VTEA 3FNFA 2P5YA 3OI7A 4P84A 5ARBA 2VSOA 2ZWVA 4AECA 2VPIA 3I9KA 2MCFA 1XRQA 3H99A 4CKXA 1NUSA 2OCBA 3C16C 2YXLA 4MVWA 3ZV7A 5JXIA 3QNUA 4BV2A 3RSLA 3FETA 3K2BA 2QW0X 2WG0A 4D9FA 4RH0A 4YJ2A 1F4VA 2WU3A 4O2BF 4ZQIA 1YIDA 3O82A 3VMMA 5KC9A 3N6VA 1KFBB 3EXAA 4RIGA 4L72A 1L0BA 2PKCA 4J49A 4JB2A 5HQJA 5DEOA 1VPLA 4F06A 2W2VA 4WINA 3RSZA 1TUGA 2Z6QA 5FPSA 1T36B 4G1VA 1H0SA 5AIBA 1WOYA 3HY4A 4EF6A 3GLFB 2WJZB 4MKZA 4RF3A 2AFHB 4C88A 4B35A 4QXAA 2VZLA 4DNOA 1BYUA 4GMKA 2QRLA 1S2GA 3MC1A 3VR6A 3RO7A 5I6DA 4BMCA 5EHXA 3ACBA 1MKYA 3OQBA 3PU6A 1Y0BA 2P9HA 1F06A 3PNOA 5E7IA 5LD2C 4IWNA 2X77A 1TU4A 1AQNA 4I7EA 4RL6A 3MA0A 3O3NB 5CX4A 1A5ZA 1YBHA 4J03A 4TWBA 1XWWA 5FO0A 4AJ4A 3U09A 2WJ3A 1DQZA 1I1NA 2IHBA 2WAOA 1IHYA 2WIJA 2P6UA 5FL7A 5I7FA 3HGTA 5G1PA 4DWWA 1OAKA 3ICPA 2UVPB 4QO7A 4Z4CA 4GL2A 3GN2A 4C4PA 1QK5A 1M8KA 4X8OA 2C94A 3VZPA 2YKGA 5LUBA 4TLLB 3A6EA 2ETVA 3D8SA 2RJOA 5LZ5A 2H51A 2WYWA 4S05A 3EODA 3KOYA 2I1LA 3RHSA 3LDUA 5IHXA 5LP6F 2GVNA 1VLVA 4KXWA 1N1GA 1NLMA 3GJQA 3MUOA 2H1OA 3OLWA 1VCHA 4OHWA 3ZK7A 3SX2A 2DYKA 2MSLA 1X13A 3LI2A 1T8TA 2O1WA 1ADGA 1UXOA 2JCYA 3RK0A 4GP6A 1VE9A 2C77A 1DTSA 3BE4A 4TZTA 3SJAA 5BVHA 1E18A 1GUFA 1ZXBA 2IS6A 4WESA 3EVAA 1E2JA 1P4HA 1SXHA 1XF1A 3OBBA 4PZEA 2ZS8A 4J6EA 2HK8A 3SHOA 5IAAA 1U1EA 4DTCA 3QFTA 1MG5A 1FRNA 1CDOA 1T36A 3E4CA 1H5QA 2QG9A 3F9RA 3IR7A 4CVNA 1A0OA 2B0CA 1AKNA 4UTXA 5EG5A 2IUUA 4BS9A 1ZIPA 3GLFA 4LTMA 1Q84A 1U9ZA 1NIJA 1S0UA 1ZESA 3CH5A 1WWKA 5THKA 1R1DA 3TLJA 4BMVA 5JWRA 1BCSA 1ZJJA 1PWZA 3WYNA 4A3SA 2O6HA 2WFLB 4HAZA 3HN2A 4RY9A 3BXFA 5HOQA 1LTHR 4H0NA 4RKQA 2JGRA 1KY2A 5CLFA 1BROA 2EARA 2QAGB 2YYSA 5JAMA 1J2EA 4QUHA 4AZSA 1XL1A 2E4UA 4IH9A 1KO8A 1LBTA 4WDRA 4GUDA 1LSUA 3BBLA 3MWJA 3R5HA 1SUAA 1DBWA 2ZYDA 2A57A 3HYTA 3VNAA 3WKDA 3ZIUA 4PAGA 2UVPA 2HYDA 3F5SA 4KUGA 5EZYA 1TM7E 1ZJYA 1LDNA 1QWSA 2X4LA 3H6GA 2G0NA 5KOHB 2DH6A 3C45A 1E9CA 2ZRPA 4F38A 5FWYB 3F7TA 1B8VA 5F5LA 1QX4A 5JVDF 1YL6A 1A4IA 1P2GA 2N1BA 3LUHA 1U3CA 2YYYA 2VQFB 5BUQA 5FLXA 4BVFA 4JJ6A 4GYKA 2GJKA 1QYVA 4DRZA 1WNTA 5AW2A 4A2QA 3D4PA 1T4MA 1BEUB 3UAGA 1XAJA 4HH0A 4PX3A 4Q4DA 2UU9B 3LD9A 4NBNA 1P1KA 2PKQO 4O59O 1NDUA 2IF0A 3VDRA 5KTKA 1TK2A 4A8TA 1SPXA 3RODA 4HAVA 3G17A 4TPKA 3MILA 4K8RB 2IOQA 4G81A 2QMUA 2F17A 3CW8X 1N7GA 4IG9A 4F8JA 3N28A 4EG8A 1L8QA 1TL7C 1GQ2A 2VPYA 3I23A 1GL3A 1XKTA 3MWFA 2A5YB 3TMYA 5JJLA 4M54A 3MQFA 3OTIA 1N6OA 4O5AA 4MJLA 2WE7A 3HCOA 3QYFA 2ECFA 3HUFA 3G7SA 3JVIA 3H5WA 4WOBA 4D9KA 1GCGA 2NZVG 3MTGA 4N5NA 4NWIA 5B3LA 5IM4F 5EUBA 4DV3B 4C7VA 2FWAA 3NHJA 2YTZA 4LC9A 5LBIA 1L7NA 1NVTA 4HEA6 2ARKA 1N5IA 1DX4A 5AJZA 4C6SA 2AT1A 3PDIA 4MS1A 4E5SA 3U56A 6ABPA 1X8JA 1JAIA 2B8TA 4FP9A 4BDTA 1KEUA 1Z9BA 1QDUA 1RAGA 3CUUA 2I03A 3IUJA 4YTEA 2YZ7A 1OY1A 1GZVA 2RONA 1FDSA 2BGUA 3AEXA 2D2XA 2Q5HA 3BGWA 4R40A 4RTKA 4NU8X 1WCWA 1WF6A 3PFGA 5KOHA 3F3SA 5GM1A 1PJBA 5FWYA 3M4NA 5ILQA 4ZDWA 1Q91A 1OLXA 4BEWA 4GD3Q 1NW3A 4MWSA 4Z86A 2C98A 3K0CC 2HBQA 2PLRA 3A06A 3C43A 4JQSA 4QFMA 4YDHB 4AJ1A 3LXUX 1I7DA 1DO8A 3P2EA 4ESVA 4EX7A 1JMYA 3DS8A 1K6MA 1OHHD 2TMYA 1CG6A 3L77A 1F4LA 2FG6C 3IDFA 4EPWA 1XRMA 3N6RA 3F5QA 3V2UA 2OLJA 3LC2O 3HVIA 5TY0A 4BQRA 2NQTA 9LDBA 4Y3UA 1ILWA 1JAXA 3ORSA 2Z56A 1MUUA 3VC7A 2B1QA 4QAQA 4X1KA 4CYMA 4GM4A 1DZIA 4JC4A 2AQHA 5BSKA 3IAAA 3UJNA 2R68A 4F9EA 1E8DA 2XWBF 1XMJA 4MKHA 3QVKA 3R9IA 1MB9A 1AKMA 1G8JA 2DWUA 4V3BA 2HPHA 1MX9A 1NSYA 2AUNA 2TMKA 4JN6B 1I7QB 2OXCA 1OOEA 5FULA 1EGAA 3GVXA 5C4MA 2JCXA 1XDGA 1B14A 4MV3A 1V16B 1B42A 1MABB 1LRLA 1CR1A 1OCEA 1MV5A 1OYWA 2XODA 2PWZA 5L51A 1ZPDA 3DBIA 3ZHYA 3O31A 4IMJB 1DFGA 4JLJA 4FHZA 1VL5A 1U7OA 3PWKA 2R11A 1CCWA 4NFHA 3LH5A 1J0XO 4NQZA 3RWMB 4LYAA 4C4YA 4YLYA 5E3HA 4RTOA 3HN6A 5DBFA 4DYVA 2BKXA 4U6NA 1RQ7A 3MT9A 2ZRFA 5EZQA 1E3WA 2JBHA 1FFEA 2R6FA 2XGJA 5TB5A 1ZICA 3E81A 1JWBB 4QVGA 4Y2UA 3HY6A 3NGMA 4BQEA 2O0HA 3KFVA 3RC7A 1WSWA 3WLNA 2FCRA 1JI0A 4I1PA 3FOAA 4G63A 2VATA 4QBHA 4ZO6A 4FGSA 2WICA 1PGPA 1I6KA 4A9AA 3T3DA 3OT5A 3G3EA 2QUAA 7YASA 2GEKA 2BMFA 4PINA 2FN3A 1E3MA 3HP4A 1EAYA 1KL7A 2WK1A 3NNNA 3T1TA 3DSRA 3RTAA 2Y9MB 3RJZA 4B3XA 3QK7A 5DF1A 2FN4A 1N8TA 2O2SA 3KJXA 4XDZA 5EN4A 1IVYA 1Q2UA 3IB6A 2L17A 5JS1A 1L5LA 1Q0TA 3HU1A 4CEIB 4LW8A 2YRXA 3NHKA 1KZGB 4DIMA 3NDJA 2NO4A 1DP4A 3QE4A 3CE6A 4TYWA 2HF2A 2W2TA 4Y9RA 2FHSA 1A3CA 1U1IA 2VHQA 4WDQA 2B8JA 4LXTA 1N77A 4G97A 1K8YB 2C20A 1CUSA 2ZE5A 3F96A 2VDPB 1J7KA 1RPNA 3K1AB 5HS6A 3ZU4A 1JQKA 4R68A 3BWDD 1GT91 3BUSA 2OQRA 4BO0A 2JZOA 2Q28A 3EGIA 4AW9A 2TECE 3PXBA 4NY1A 3D7RA 2OFFA 2O57A 3NANA 5TPWB 3TIFA 4G85A 4YV1A 2BRUA 4WWHA 1VSUA 2ZT5A 1V16A 1DC6A 2PCJA 1MABA 4MHOA 3RC2A 1D1TA 4V24A 4JGGA 4PSCA 1U11A 3D6AA 4JQCA 3OCXA 4FMBB 1TM4E 3F8WA 4KV9A 5CYGA 2HHAA 3PNVA 1KS9A 1Y3DE 3KHUA 1JIIA 4OJTA 3B1VA 1QNLA 5TS2A 2G6BA 3WLAA 2I4OA 2OENG 2NYVA 4KWIA 3A6FA 4GQAA 4A8JB 5F3DA 1Y9ZA 2B2CA 2VVTA 2XDQB 1D2AA 2M6LA 2YBDA 3HVJA 4R1OA 2Q4DA 1O1YA 3M8KA 4ZVNA 2QMYA 4DDMA 1GNPA 1VLMA 4KR3A 4JYAB 1UBJS 4IKPA 4IS3A 4AJKA 1GIAA 1WP9A 1XNJA 2DR2A 1VL2A 3LIIA 4DA7A 5MN4A 4MAMA 4NCJA 4B4VA 1QRTA 2YHSA 1Y5RA 3ENKA 3KQOA 4KQXA 1M5RA 3B1FA 1H8HA 7MHTA 1WTAA 2YL2A 2GLXA 3C3BA 3L92A 4CEIA 3Q98A 3U16A 4RZ3A 1PU2A 1MJGA 2MU1A 4NAVA 4BO8A 1OSNA 3NONA 2HMVA 1HX7A 4II7A 2DETA 2YOFA 1D09A 1NBEA 3UV7A 1BRTA 4YRPA 4OB8A 4BNHA 1N5LA 3E27A 5KWEA 4KQKA 1MO6A 3OQIA 4TMXA 2V74B 3CLUC 2Y1FA 3K1AA 4MK4A 4UD2A 5K2MA 2FW6A 1EUCB 1LDGA 5HA5A 1GV0A 1NW8A 3ZJ4A 1YFKA 2GXAA 2NUBA 4C7OB 2R65A 1KXJA 5TGZA 2R1VA 1GNQA 2VAPA 1X7DA 1JT9A 5DLPA 2QJWA 1CJTC 3GHHA 2YINC 4B82A 3C7TA 3RC8A 2OLKA 4X00A 3U39A 5A9SB 2JLAA 5K51A 2PTHA 2FWBA 5HG0A 3JALA 2PV7A 2QIPA 4QQNA 4EYKA 2JB9A 5JCPA 1O4VA 3S0JA 2CV2A 3U7EB 1U6IA 1SWWA 1FZQA 2IIBA 4CUJA 3HNOA 2GCNA 2HJHA 1J2JA 2NP7A 2CE2X 4A8JA 4GICA 5A1TA 1XXLA 3FHLA 1X8XA 4B3SB 2F55A 4MUHA 1JYSA 5JFOA 2AWOA 3PQ3A 5J4VA 1G8YA 1K1EA 3VOTA 4QPNA 3NORA 4F4DA 4LJ6A 3ADKA 3RT1A 3NWEA 4JAVC 2QXUA 3F6YA 2ZZNA 1MJFA 3RU9A 2HCFA 2XH8A 2JJ2A 3WIBA 3MD0A 4Z2YA 1CJCA 3IGFA 1WDTA 1WMAA 1WY7A 1HFEL 2GERA 4WLNA 4XVRA 4DR2B 1L9XA 5FAKA 1SQ0A 3G0HA 4TRMA 1DJPA 2QVLA 3F6SA 1SUBA 3LVRE 4LFBB 1OXTA 1PFWA 3AB3A 3W04A 3ED1A 3QPVA 1SO8A 2RHCA 2ZK7A 3NXSA 4DMCA 4HRVA 3QVXA 4TRRA 1SVIA 2AYXA 2JGEA 3V1MA 1HT2E 2CLIB 3MTDA 4JR2A 2IDZA 4TTIA 4WKBA 4X9XA 2P65A 4FT2A 4OTZA 1XU4A 4Z1MD 3WK6A 1XA3A 3O8BA 1EUCA 3TL3A 4XSGA 3IELA 5TJHA 2NZ2A 3I62A 1NQWA 3LQKA 2J4FA 1E5QA 3DKVA 5B12A 4LZLA 3IV7A 1K68A 5A05A 3UWOA 1HDOA 2WG1A 3H8WA 1QH8B 2HMAA 1CUHA 3C4JA 5A1JA 3BG5A 1V7PC 2IYOA 3JVDA 4MRVA 3W5IA 3W8FA 3ROEA 1EVQA 2IXDA 4I46A 5A9SA 3I5XA 4UEJA 1Y1PA 4RADA 2PSJA 4COKA 4J9VA 3W77A 3IMKA 4F2GA 4BLRA 2Q6KA 4MW2A 1R0LA 2OM6A 3EXFB 1XKLA 5BWBA 3DLHA 3SAJA 3MLEA 4FYKA 1RVV1 1XNHA 1M75A 1DOAA 3IT2A 1ZA1A 3LX5A 1QIGA 2N42A 2UYQA 4J2HA 2XNDD 2CFCA 3IP7A 3WLOA 1JVSA 1YONA 3UOAB 3F49S 5FP0A 3ZCQA 5DDIP 2E2WA 1M6HA 1W5AA 3H6HA 3T0IA 3OM0A 1MTOA 2JIZD 3M4YA 5GZ6A 3D5EA 2GTHA 3P4YA 4I50B 3L4BC 1N0VC 3TZ6A 2BR4A 3IAM6 3CUSA 2GK4A 4AZWA 5M5BA 2PUHA 2PL1A 4RGBA 1SA0B 1MU0A 1V6AA 3DNPA 4IYRA 5FUXA 2ZQYA 1IIBA 2OK7A 4URVR 2G1PA 1J9EA 4KLCA 2QG4A 1JXQA 5LM3A 2GBLA 3FVWA 4QQ8A 3DMNA 3F3YA 5DV9A 3A4IA 2V7WA 3AFIA 3R3HA 4J07A 3DDUA 3TD6A 4QXPA 1KO7A 4MROA 2GNPA 3VR5A 2J6BA 2ZS7A 2C84A 1HYBA 4BV8A 2XB6A 1YZHA 2IOHA 3MB8A 4PQGA 4TRJA 4YJ2F 4LYEA 4N7JA 4CLEA 1GSIA 1MX3A 1RFLA 1ZD8A 4MQLA 4JXXA 1HETA 3TQTA 1SIOA 1Z07A 2GCOB 4C0WA 3MCAA 1ZMRA 1THTA 2RGYA 5BNIA 4OHCA 3VZQA 3QPDA 5U9CA 4BNDB 3IRVA 3IODA 4PV7A 2BSAA 4NBWA 1S2LA 2FMTA 3DPIA 2YBEA 1QH8A 1QQ6A 3N2ZB 4X8LA 4Y0AA 1WQ1R 2CHFA 2AJLI 4U00A 3ZWOA 1THGA 3VPHA 1WLSA 3H2BA 2X42A 1YVDA 3FN4A 4C5BA 3PIDA 2B37A 2OA0A 4MWTA 4E70A 1BD4A 2RBEA 3ZE2B 2WWIA 3DWEX 4YXWD 3EXFA 2WU4A 4M1ZA 5SZKB 3MJFA 2IYXA 3EIWA 4ZODA 3RUIA 3ZGYA 4JLSA 3W3AH 1QH0A 1UH5A 1OR8A 3DZFA 4KNWA 1SZDA 3VVBA 2JI4A 4P7BA 4HFNA 2D62A 4PGAA 4ZYZA 5JDIA 1ZJZA 3H04A 3I01A 4BV3A 1RI3A 1TQ6A 2Q8NA 3EVNA 4JLPA 4S1WA 3HBAA 3JWJA 1W36C 1ISMA 2ODBA 1W5FA 4GYYA 2G9NA 1HTBA 2WSIA 4I50A 2QYTA 3JY6A 2ZG6A 5AH0A 4BVAA 2IJGX 3LYAA 4F92B 5BR7A 3SU8A 5TC4A 1SA0A 1NQTA 5TX7A 3KVRA 2QZ9A 2B20A 4FSXA 2G07A 3ZXYA 4CIBA 1T0UA 1G5PA 3Q88A 2PEYA 1L7AA 1QMGA 1NXVA 1W75A 4K28A 3R09A 5LZ7A 4WUTA 4DUGA 1YRYE 3OAAA 4RM3A 2R5FA 2ODNA 2AI2A 3FVQA 2Z1DA 1BDBA 1S01A 1NVAA 2EJCA 2LBPA 4BUJA 4IHJB 1ECPA 1U0NA 4M49A 4NCIA 3BZWA 1A9ZA 1Q92A 3QPWA 5DO9A 1DQNA 2I54A 3ZWYA 4R1PA 5CLJA 1V4NA 2D3TA 4N5IX 4OFBA 1HMPA 2V7QA 4EG5A 3H4TA 2QZJA 1Z0IA 2VUTA 1E6LA 1GA1A 3IKMB 1MOSA 4MH0R 4X8MA 3L8GA 4NCXA 1Z0JA 2CXOA 2XUJA 4Q00A 4BNDA 3CG4A 3NHBA 1D9ZA 4KIFA 3WDSA 5E8JA 4IHQA 3G5UA 3TLXA 3AIIA 3M4XA 3T54A 1I01A 4GQBA 5FI0B 4H27A 4B3GA 3TRJA 1A76A 1A4UA 1QFXA 1X7WB 4JJZA 4XB2A 3R5JA 4AXBA 4EPYA 5IJ9B 5IX8A 2EP8A 4DLWA 1E7WA 2GXSA 3LWBA 5CU7A 4DMLA 5KINB 1BE6A 4J7UA 4BCCA 2CF5A 2LR0A 3EHDA 3GBPA 5CCDA 1NV9A 1YZYA 3TLKA 1Z6QA 3O83A 1ZK4A 1XFDA 2FOLA 2ZJFA 3CZRA 1EUDB 3D3KA 3MWDB 1KJNA 1T3SA 3HDQA 4RORA 4A5OA 4LOHA 5C32A 2NP6A 3WXBA 3HS3A 2XUIA 1SKYE 3WWEA 3FPAA 2QTCA 1EBBA 1SHLA 4CF5A 4E4YA 3I72A 3GP8A 1SK8A 4ER3A 1P75A 1TZCA 4B6JA 1Y1SA 1L3IA 1II0A 3OM9A 1L7XA 1MGOA 4IVNA 4X3OA 5CVEA 5EZYF 3LXMA 2FI1A 2ZTSA 4EY7A 5G3ZA 4P5PA 1TC1A 3OD5A 1BJRE 4BFLA 5EIAA 3FX2A 1G38A 4QFCA 4DLRA 1YKFA 4HEHA 1GQFA 1UBTS 3AW8A 4INOA 5J2UA 1M7HA 3UUWA 1L4UA 2RKOA 3D8BA 4LKOA 5I3ZA 3QJGA 4P8RA 1BDIA 2W2LD 1I2CA 2X15A 4LJ4A 3UHJA 3NTRA 4WXPA 3FTFA 2BC9A 2ZVQX 4F6RB 1NFFA 1N2CE 1QE0A 2JAOA 4IHJA 3TIXB 5BXYA 2V5UA 3CRW1 1IN8A 4UBOA 1CLEA 4CTMA 4R98A 4BGIA 4C06A 1WJGA 5JECA 1GPH1 1QHNA 1EK0A 3AF2A 4O63O 4YMHA 3T5PA 3K5IA 2XGMA 3I8OA 1DC7A 3PFFA 2VHJA 3DMFA 3DTVD 4ZV9A 1HOTA 4A23A 4FOSA 3PICA 4W1PA 1X7WA 3VAAA 2N75A 4B1FA 3TZCA 2JARA 2PPLA 4ZQHA 3IA2A 1GRVA 3JQGB 2OECA 3QEJA 2WG2A 3KHTA 4IF4A 5ILGA 3NT5A 4CKWB 3ZOZA 1YIAA 3OT1A 2QYSA 1JJFA 1AZWA 3IUPA 4S1NA 4KO1S 5ER9A 1K27A 1NU8A 2NZUG 4I9GA 1EUDA 3MWDA 4HB2A 5JG7A 1JWLA 1SVOA 1DADA 2BMWA 5CM9C 2JAWA 2X3YA 3L40A 3NTOA 3H2SA 3H1FA 4FHGA 3E7FA 1DE0A 1YZNA 3W5HA 5DM0A 4MS4A 3RABA 4INZA 1J8MF 1ODLA 3WXMA 1RI1A 2H06A 1UDXA 2BGMA 2IK8A 3RSCA 4CG1A 2F3TA 1TT5B 2QT1A 4JUDX 3SZMA 1PL7A 3P9YA 1HRDA 2LDXA 4EG7A 4MVCA 1Z6PA 2EOAA 3L0IB 3L6DA 4AMYA 4AUKA 1KAHA 4HB4A 1P1JA 5L3QB 3GUVA 5CDFA 3DHEA 5EJ5A 3WJAA 1CD5A 2ZPAA 2CD7A 3FZYA 4K6OA 3W5JA 4P4SB 3LT1A 2R6DA 1JDNA 1EDOA 3BRWD 4Z4HA 3HP7A 3KSDO 1WPQA 1IDOA 1YCDA 4BPBA 4Y18A 4WOKA 2W22A 3SC3A 4GKKB 3SZLA 3A7EA 1MA0A 1WMFA 2I65A 2VT7A 1SR8A 2HJRA 3I2HA 3WGGA 5BQ3A 1UWVA 3T1OA 1GPNA 3NEJA 4EYQA 4ALKA 5KYGA 1BZYA 3WP1B 4W5NA 3UZUA 4PBSA 3KJGA 3MN1A 3ND8A 1Z17A 5JDCC 3TPCA 5DM60 2YJTD 4K6MA 5C1OA 1ISIA 1LDMA 3GLHB 4LSWA 4AFNA 1UC8A 1H94A 1FBTA 3AG5A 3G8CA 4KODA 5C52B 3A6ZA 4DR3B 3U4HA 3AMVA 3EZ6A 5AK3A 2WDPA 3DV9A 2IPMA 5L7YA 4CFZA 2C03A 4G89A 4ZEXA 3UGKA 1YK1A 5DK4A 4ZAXA 4B0OA 3EQ2A 1UJBA 3C87A 5K01A 1KMIY 3RVNA 3MMPA 2Z09A 3JQGA 1Y3FE 2K2WA 2ZJ0A 3DM5A 3C74A 2WT4A 3DDNA 1K7YA 1FCJA 3HDHA 4GPEA 2I2FA 3GA7A 4CKWA 2O8DB 4EAAA 4NMXB 1V8DA 1B3BA 2WHPA 3JPYA 3MM4A 3OZDA 4PVCA 3WAKA 1TA9A 2XWPA 3VU0A 3PVCA 1UDWA 5JS6A 2MOKA 2UZ3A 1UJNA 4X8HA 2A5DA 3ZBPA 3H6KA 4HMQA 3GWGA 2W71A 4PX2A 2ZREA 1S9HA 4ECAA 2JFQA 2FEKA 2J31A 3L4EA 4KPYA 2JJ8A 2PKXA 3KVOA 2JRLA 4JUCA 1Q7GA 4KAAA 3I9MA 4ZI5A 4DTIA 3O4VA 3PC4A 5CT5A 1QE3A 4IRXA 1RC8A 2N46A 1WXWA 1Z73A 3TGWA 3ZY4A 1JX6A 4JBWA 4TXJA 1U0OC 5AM4A 3SVZA 2VPPA 3KKEA 4P4SA 1XMQB 2B7BA 2OWEA 1KZ9A 5CK5A 1CZUA 3ZK9A 1GPUA 3GJRA 2FR0A 1N5KA 5EOVA 2O7NA 1PK9A 1FEZA 2AHRA 5CVCA 4KJXA 1UEIA 4M9XA 4BRZA 3EUAA 4UM9B 4G09A 2BCGY 1SIWA 4LFCB 2FPWA 1YZKA 4C05A 2X2EA 1EEHA 1NVFA 1V8PA 4JGIA 4JNKA 2RK3A 3L0OA 2Q5OA 3R5SA 3EXHB 2XKAA 1OHHA 2PNFA 3UJCA 3KL2A 4DQXA 5T4FA 4ZJUA 4NCKA 1ZI6A 5BT9A 1E92A 2IYEA 4XGQA 3EVGA 3OEED 1LCIA 3ZI4A 2DJIA 1ZQ1A 2GETA 3ZGXA 4LDNA 5FOWA 1Q3HA 4EATA 3IRUA 5DOZA 3JQAD 1Q95A 3DQZA 4ZEOA 3ZE8A 4BKUA 1G64A 3B5EA 5AI8A 1QIHA 3E5NA 2RHWA 3G8BA 3QSYA 1FNBA 4KSYA 4ABYA 5JRJA 2R84A 2GEVA 3M6XA 1ORDA 4J9UE 4B7UA 2JGLA 4KR2A 2F48A 3MUNA 4XW2A 3HVKA 1EK1A 1PYOA 4ZT5A 2J87A 4NBRA 3QFFA 1CZHA 3ZTWA 5ILOA 1TZJA 3FOWA 3QW2A 4IQ8A 4OXRA 4AZ0A 5EE1A 3R1IA 4ZYLA 1D04A 5K0NA 3I32A 1TQHA 2R1ZA 1CWUA 2YHAA 4KCGA 3M1LA 4PPYA 1EI9A 5KWJA 3KUUA 1QHIA 1GHTA 1TB4A 3NTXA 3U26A 3RF6A 4PG7A 1OGJA 4PZ9A 2FF7A 3P2OA 3WLMA 3QXCA 4JOBA 3X43A 4BB6A 1MZVA 2QNIA 3CR3C 3W1EA 3J80A 2WWFA 5AK0A 1MV8A 1YA4A 1RWKA 2HCBA 2FEWB 3G1WA 1FFGA 3OEYA 1UPCA 1XZQA 1TF5A 4CLHA 3RARA 2WMOB 4RBNA 5B2EA 4D2IA 1Y9EA 3STXA 4AJPA 5C8ZA 1E2LA 1OBCA 1S1MA 1WU7A 1KDOA 3H9BA 3ANTA 3KO8A 1E6KA 4PLWA 4BPRA 3VR6H 1M0SA 2QMEA 3FUVA 1R3UA 2JFXA 1ZHOA 3QY0A 5F21A 1N2GA 4Z1OA 3EGXA 1G2IA 2ADFA 2BKAA 2EZ4A 2P1ZA 3KB2A 3LE8A 3P9XA 4J8PA 1L5VA 3NBZC 4TL7A 1V1RB 1THZA 1SWVA 2HFJA 1K86A 3H1PA 3LCVB 4JT9A 5EWMB 4DC1A 1T2CA 3OJ0A 2P77A 4WADA 2HSWA 1QHHB 4QG3A 2OBNA 5JSHA 1EIZA 1QO0A 2FX3A 3CEAA 4FFSA 3H83A 4OOEA 3EXHA 3U3RA 1NMXA 3FDJA 3FTCA 4A73A 3TI9A 3WYFA 2XCSB 4OIMA 3NCTA 1GR0A 2VJYA 1C9DB 3MERA 4RESA 1QBGA 3PQ7A 1BVRA 5IZCA 4R9NA 1JDBB 1NNLA 1NP6A 4Z0NA 4OA5A 3DC2A 4R4JA 3MJCA 5K20A 1WPRA 3COJA 3A28A 4L50A 5KJEA 2YJNA 1KAOA 1W6UA 4A0SA 2WM3A 1Z0ZA 1JLLA 5B7NA 4RTMA 1M1ZA 1MAAA 4OXQA 4R0NA 3ZV5A 4BMNA 4O29A 2XCQA 3PWSA 1L7DA 4KIGA 3K92A 4UD6A 5EKUA 1CQIB 5BXQC 1Z39A 3OT4A 3DFKA 4AG3A 2DHCA 3QXHA 4W4TA 1KYVA 4JEMA 3DCYA 2D06A 4X1OA 3WV4A 1AH2A 1JAZA 4G5RA 4WKGA 1CUYA 2R0QC 1KMQA 3FF4A 3PHCA 1CUCA 4JBXA 4EHKA 3AJ8A 4TS1A 3S44A 3X1MA 4GP7A 4Y1RB 4BMOB 4E94A 5K0ZA 3WZLA 2PUEA 1KH1A 4MGIR 2VSNA 5BSMA 4DJEC 4PLFA 5EXEA 3HLKA 3ZDFA 5DBEX 3SN6A 2J7PA 4EHAA 4BOYA 3DOUA 1SELA 2W2PA 5JXWA 1R7RA 2C88A 4KGDA 2GZHA 2H2HA 2QQ0A 1R0RE 2P4EA 3D7KA 1GDDA 3KU4A 4DSTA 5A7FA 1FE8A 2QN3A 4K40A 3TI7A 1YZUA 1XDBA 1YAHA 2YX1A 4G1FA 4H08A 1RZUA 1GUYA 3JD3A 1YOBA 2ACKA 4YCJA 1TTHA 4QGFA 4E12A 3GFOA 5F12A 1V1RA 3AINA 3K05A 4OQEA 1XZNA 5EWMA 4D9HA 3NEPX 2EBWA 1U8ZA 1QHHA 2IPOA 1COWD 2Q99A 2N47A 3IILA 4KXYA 1WCIA 3LO5A 5KNDH 1W6RA 1RQPA 1QYRA 2AK3A 5CEJA 2DUJA 3KEQA 4LYFA 4PLZA 3TO5A 3T5TA 1BCRB 4LPKA 1Z5PA 1C4KA 4KQHA 3ZCRA 1J2UA 1H4QA 3EWAA 1Z3IX 4DF3A 1U2DC 5CMLA 3E82A 3Q2KA 5LWQA 2WJ6A 2QDXA 3QEAZ 4MUFA 2JBAB 2Q50A 3AIKA 2GBIA 2ZRDA 3AP3A 4CM3A 721PA 1NU6A 2QVZX 2PSEA 5DX1A 2LDBA 3NS7A 1Z2EA 1RLMA 5CFRA 5CTJA 3AESB 3QVVA 3WHKA 3F47A 3DGFC 1CQIA 3DW3X 1P7PA 3BL6A 1U02A 4I1UA 4RNDB 3KLMX 4L73A 5KWSA 1GARA 5H1YA 3M1IA 2QLFA 1TJPB 2X0RA 4A6PA 2XWSA 1Y98A 1E58A 1R0YA 4G5OA 4NFLA 3USCS 1ZSVA 3AW9A 3EEFA 1W2GA 3MJ4A 3L4SO 2E21A 5ALDA 4D4KA 4V0MA 4C1NA 4F8EA 1WDWB 3K09C 4HFRA 1AQJA 2VNKA 4Y1RA 1W88B 2EV9A 3DMTA 4LJRA 1WZ2A 3EAFA 4CDGA 1OAOC 2QN1A 3NEYA 4BNWA 1EHCA 3AWDA 4L0QA 1QQ7A 3EQ9A 3L1HA 4XFDA 3HWWA 2AD1A 4BVLA 2Y1XA 2B99A 4OXIA 5EFOA 2CK3A 3HXQA 1VQ1A 1XQVA 3IVAA 4OYHA 3H11B 4WZAE 3RTDA 3V7UA 3W4KA 4D3ZA 4ZTBA 2Y93A 2A1TS 1I3CA 1XAGA 2XHZA 4GR4A 4UMEA 2HUNA 1FW8A 1P77A 3NZEA 3EQZA 4PR3A 2CKDA 3GI1A 3H3XA 4OMDA 1K8XB 3FSRA 3H5TA 1OFIA 1J99A 2EDCA 1SCDA 4TTQA 1PQUA 2VL7A 3OLCX 4PCVA 2XADA 5HHTA 5CD1A 5LU9A 2E6KA 2ZBEA 2PZJA 3T8YA 2CY0A 4G23A 4ZCRA 3O4FA 4L0DA 3MD9A 1U0BB 3TMKA 1E1QD 5H3LA 1ZC4A 1BCRA 1U2QA 5BQOA 2F8SA 2BR5A 3KT0A 3N74A 3TNYA 3CZPA 3K9HA 1CQPA 1DFIA 2BM1A 2W98A 4XASA 3HCCA 1K8RA 1NLYA 1HYGA 2IU6A 3GDGA 5ER6A 2JBAA 3SQDA 3M5PA 4EG1A 5HUJA 4L5JA 2UYCA 4TWAA 5LJIA 1L4YA 1Q2XA 3OHPA 1N6NA 4KGVA 3N07A 1SM4A 1VIDA 4NESA 4OHUA 4YRBA 1QPGA 1NNSA 2R6GA 4OH7A 4CV2A 5B7PA 2C8LA 3AESA 1A2OA 2ZSJA 4MITA 3JZMA 4HWGA 3RBXA 4BBAA 2WB2A 4HH4A 4L22A 5AI0A 5KQRA 3WRYC 1Q0RA 2XOEA 2YJ3A 3O8LA 3Q0IA 3FFXA 2J5BA 5FBWB 1XZJA 3BN3A 2DB3A 1FBNA 1M0WA 3JYLA 1U4NA 3O2QB 3OE1A 3AM1A 1FP7A 1OC2A 3WGHA 2RMKA 1DEHA 4I50F 2DQYA 2YN4A 1QHSA 3KHKA 4GOND 10MHA 1W47A 1W88A 4B4KA 1JT2A 3N2NA 4RK4A 3PGVA 1F1BA 1RLTA 4E51A 4CL2A 3BIXA 4MEBA 3RS0A 4E5YA 4R1MA 2W6PA 5C1BA 3LUDA 4FXOA 3CMCO 1K97A 2AN1A 1HNWB 3IHKA 1RABA 4ZEWA 1FDUA 1VHLA 4M9UA 4GSKA 3SEZA 2VN8A 2YMQA 3HCEA 3AONB 5DXJA 5JASA 2ZAMA 2V8BA 1I3OA 4I9NA 3TR6A 1ZN2A 3K73O 3R20A 4JK3A 4UBMA 1U8EA 2HKIA 2XD9A 1SN7A 1GA4A 2ZJ4A 2CBXA 1PCXA 2P67A 3QHPA 1T8SA 2P11A 1KJJA 3GP3A 1AUXA 1ND5A 4LXQA 4OXKA 4BFYA 1V7ZA 3M5CA 3DCNA 2X9QA 1LW6E 5GZ1A 5L45A 4OUDB 1LPSA 1NJ5A 2IZ7A 2QT0A 2XZDA 4G5HA 1SCAA 2DVMA 4TMYA 4NU0A 4P22A 5AVKA 1B6TA 4LTNA 5JY6A 2C0PA 2Z95A 5CAEB 3ICVA 5EMMA 2ZWAA 1L5OA 5G4KB 3AUAA 1CTQA 2QHXA 4HX5A 4PG4A 2R96A 5LZ9A 1XPRA 4Z9YA 5CFLA 1VL8A 2VP6A 3LHKA 2WKWA 4IEEA 3NDBB 1E2IA 2Q7OE 3N0RA 3H19A 5D8DA 3AFGA 1KFJB 2F62A 1QZTA 4GU5A 1GKYA 4FS8A 3HGQA 4G86A 1H0HA 2IQIA 4K03A 3TQFA 4WXRA 3E03A 1STOA 1GADO 1BFKA 1JLKA 3N70A 2I4IA 5B2FA 2B83A 3OZGA 2QBYB 3SNHA 1USIA 1QANA 4A0RA 5ECWA 3UHOA 1XTQA 3W7VA 3OBIA 1P0CA 4FGLA 4MARA 5B4VA 4PQFA 1DKNA 1N0WA 2ODEA 2P9FA 3OOHA 1JIUA 2QL5A 3H9JA 5G0SA 1BA2A 3O8DA 1CIPA 3QIAA 1TMYA 1SUIA 1ZUWA 1WSDA 2Q9BA 2LWIA 1WABA 3CZMA 1S96A 3H18A 4X7MA 4EOGA 4I19A 1FOEB 1KY4A 5D01A 3WKAA 3ZWPA 4KACA 4B2IA 4LJAA 2FR8C 5EMJA 4F85A 2HK6A 3EPLA 3PL5A 5K5EA 4JODA 1Y1LA 4Q9IA 3H7AA 5J2UF 4U2CA 2A1TR 3A37A 4J1NA 5LYJB 2RI1A 3FGPA 4E08A 3AEQA 2JI8A 4RTJA 5KTSA 3MAJA 5JNTA 3CH4B 4UEOA 4NS4A 4AMZA 2BEUB 4IHJF 4NZNA 1IYZA 3LX6A 3ZGZA 2H1VA 1WE2A 3OUZA 4IOJA 4OV6B 2XVYA 4Q9KA 4JDUA 4L8LA 2PU5A 4FSDA 1DKOA 4OUDA 4C0BA 3OJEA 1IJFA 1FUYB 2QTWB 1WBJB 3A1SA 2VTVA 4FYMA 4N49A 4I4TB 3EC1A 5CAEA 5GIPE 3K30A 1VE1A 3B3FA 3LQFA 2PM8A 2J3LA 2P2YA 1VFPA 4B75A 3ZV3A 1YGPA 4NTZA 4OQMA 2C04A 2NLOA 3U7GA 3SHTA 4UNRA 1DJMA 1VP9A 4Y2VA 1DC5A 2HA5A 1YR9A 4D8TA 5HKKA 4F3CA 1ZITA 4NCHA 3O26A 2VHEA 3U3MA 1QTRA 1AGPA 2QBYA 4KQ1A 2CL7X 1SQ6A 2QSUA 4HLCA 4BCDA 5FA6A 5D87A 2ZPUA 4DR6B 4KLAA 2JVIA 2ENUA 1PJQA 4FLMA 1VIMA 4X41A 2R6R1 5LDHA 3EF0A 3AY7A 4DLLA 4E31A 1TZMA 4R2LA 1HDYA 2IS2A 2NU9B 4DM7A 2VZ8A 5ALXA 3QW4B 3FM9A 3EA0A 4UXHA 1GVHA 1UOQA 2VK1A 1ZN8A 3N8KA 3LX4A 1KRWA 4UDYX 2IYLD 3EUFA 2OZVA 4WK0B 1OZHA 4MSUA 3A4LA 2AR9A 3KZVA 5T4BA 3KSBC 1TAUA 4B4UA 3B3JA 1PZXA 3CLTD 5LYJA 5L4SA 4PLYA 1DRVA 2Q6VA 2PUWA 5DHQA 4MGEA 1W93A 3SFZA 1O9BA