2VZ0A

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066641
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development and Validation of a Cytochrome C Coupled Assay for Pteridine Reductase 1 and Dihydrofolate Reductase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vz0A00
2DBZA 3DZIA 5TS3A 3NJ4A 2JFFA 9LDTA 1JTVA 3V1TC 4R51A 5ER6A 4GVLA 4B4VA 5KKCA 2GCGA 4UAGA 3K8ZA 1Q7CA 4IMRA 1W8DA 4S1VA 1DSSG 3FHLA 3MTJA 4J6FA 1YJQA 2HK7A 2XF8A 3IIEA 5KKAA 4IDCA 2VHWA 1MXHA 5FI5A 1UZLA 1QXSA 1PS0A 4QUKA 3PHHA 4XWYA 4L8VA 4B7XA 3QVOA 3LYLA 4HX5A 3RJ5A 2I3GA 4IJVA 4UULA 1F8FA 1ID1A 1V8BA 3UN1A 1UAYA 3LK7A 3CXRA 3H3JA 2JCVA 1CQIA 3GAZA 4PLPA 4H7PA 1O8CA 1JAYA 4AJ1A 4BB5A 1IPEA 3QW2A 4BNMA 4B8WA 4BUCA 2LDXA 4NG5A 4PLVA 4BVAA 4M8SA 4EUHA 4BO0A 5A05A 3W1VA 2C7VA 1IULA 3WG9A 1Q7GA 4M89A 1ADGA 2QW8A 1RYDA 1I33A 3ASVA 2R00C 1PTJA 5TJ9A 3OA0A 5ES3A 4FBGA 3DMTC 4D41A 4TZTA 1XWFA 3HFSA 3ZWYA 3DAGA 3VH3A 2R6JA 4MVJF 3GN2A 4IDBA 2NM0A 4YA6A 1N9GA 3ANNA 1NPYA 2NVBA 2J8ZA 4ONEA 3WYEA 2PFGA 2C5AA 2VYNA 1ORRA 1U1IA 1PJCA 1QYXA 1O94A 3G17A 2IDZA 3KEOA 4R68A 4RPKA 1PGQA 3DC2A 5L7WA 3INTA 5JDIC 2PLAA 1DLJA 1NHWA 1P45A 1Y8RB 2OHXA 3EAGA 1X7HA 1G0NA 2W2KA 4DLLA 5BSEA 4QO7A 1E1LA 4NMHA 2VQ3A 4MVJD 3OIFA 4CMEA 3KETA 2E48A 4CV1A 4MINA 4MKXA 4CMAA 3KLMX 3BXXA 4BO6A 1ONNA 2NQ8A 4E2ZA 3Q11A 2H63A 1JW9B 4FC6A 4JGBA 4GVXA 1RM4A 2WSBA 3L4BC 1R0KA 1HDYA 2ZB7A 1X0XA 1ENZA 4J7UA 4WECA 3W6ZA 3PFFA 4II2A 1IYZA 2ZQZA 5JPIA 1T1RA 1I3LA 1T2FA 4WLFA 1LDBA 1WMAA 3K30A 2WD7B 2WEKA 4QX6A 3S2IA 4Y98A 1HDXA 4IIUA 4CLXA 1WVGA 1NHGA 5G4LA 2HAEA 2YHIB 1JKIA 1GQYA 2ZYAA 1WWKA 2E49A 5JDCA 2NTVA 4Q3CA 2AQKA 4RF2A 3H2SA 4MPDA 3DBRA 3B20A 4L9RA 3D3WA 1BXGA 1LSSA 2BKAA 3P7MA 2NU7A 4BNFA 2OXIA 3LLSA 4GSKA 1UXJA 4MIEA 1EUCA 2YW9A 3ZN2A 2VRCD 4CM8B 4NNJA 5BT9A 1O5IA 4W9NC 1P31A 2O7QA 3KZVA 4EZBA 2HRZA 2O23A 4J9UE 2IZ0A 1ZK4A 4QSMA 1LQTA 5A4DA 3IDSA 1PJSA 3DAPA 1ISFA 3I9KA 4I08A 1JDJA 5EJ2A 1A5ZA 3PP8A 4J9VA 5KJCA 1LA2A 3BMCA 3QLJA 2DFVA 1C0LA 2O3RA 1GPJA 2AEJA 2NLOA 3ZU2A 3RSHA 3OEYA 3K2BA 1DOHA 1M6HA 2EERA 2ZJ0A 3I9LA 3D4NA 1WLYA 3L77A 3P2OA 5DP2A 4DIFA 5FF9A 4E5KA 1WDLA 2C5EA 2UYYA 1SEPA 3PFWO 4MVJH 4XA8A 4EW6A 4DLAA 2CF5A 4UREA 4A73A 1YGYA 1J4AA 1I30A 3GEMA 4OJNA 5THKA 1NQ5A 3CMCO 2NVWA 1UP6A 2PWZA 4PZCA 3ROPA 3FTNA 1I3NA 1DRWA 2Y1OA 3RFXA 2YFQA 4JBHA 2HKIA 5H81A 1PL7A 3H5RA 1V6AA 1MC5A 3WMWA 2Q2QA 4F45A 3GGGA 2QIOA 4EYEA 1EUDA 3SXPA 4KDFA 1LLCA 4BB6A 1R66A 1V35A 2E6UX 3AY7A 5CDGA 5JXWA 3LT0A 2Y1CA 1DB3A 1DAPA 2PZKA 2VTEA 4J0EA 3LZ6A 3T4XA 3ANLA 3SC4A 4CLOA 4PCVA 4XGIA 4J43A 2X23A 3BMQA 3BMOA 4M49A 4RF3A 3CKYA 3HDQA 4KP7A 1YBVA 2XXBA 4CM4B 1W73A 1E3IA 1S7CA 1U5AA 1BDBA 4IJKA 3OIDA 3E1KA 1UR5A 1T4DA 3ENNA 2CSUA 5DF1A 2GYYA 2DBQA 1NX6A 2EGGA 2C7GA 4WCDA 3O8QB 1TLTA 4ZQFA 5TT1A 4HY3A 5I9LA 1HLPA 1K5HA 2UV8A 1K6JA 3JD3A 4FJ0A 4BNKA 1VSVA 2DBRA 4KMSA 3F6YA 4CLRB 5KCZA 4BO2A 1LXCA 2O50A 4R4JA 1UDAA 5DOVA 1GV1A 4OXKA 1R15A 4F6CA 2ZTVA 4MP8A 4GGPA 3WIDA 1ZMOA 1DIBA 3FR8A 2PKQO 3PYMA 2Q1SA 1C3VA 2VUUA 3PJFA 1BW9A 4FGSA 4AJNA 2GZ1A 4YJFB 2D59A 1KY5A 5EL0A 5TRTA 4HFJA 2B37A 2B4QA 3W8FA 2FP4A 4FC7A 4E33A 4EJMA 1A9ZA 2B4RO 2QRJA 2I9PA 5JNLA 2V6GA 4BNTA 4PN3A 5JY6A 4GPD1 2RAFA 3ZV5A 3GGPA 4MVJI 1MX3A 3E82A 4TRMA 1ONPA 2FR0A 4I5FA 1GFSA 3OQ1A 4M54A 4UVGA 4L0QA 1P1KA 1XSEA 4OQZA 4TKLA 4JJIA 5TLSA 1V9LA 1GYRA 2Q2VA 4NJOA 1BXZA 2WE8A 4B3JA 2AEFA 1VJTA 3KTDA 3JQAD 4RJTA 2ZQYA 1R4NB 2R00A 4JLWA 4NBTA 3DR3A 3MEQA 3GHYA 5A02A 3VDQA 3D7LA 1KVTA 4IDFA 4RVUA 4IDDA 3V8BA 2CVQA 3D3EA 3ZNPA 5F1PA 4BNLA 2P4HX 1LDNA 3MOIA 4ZRNA 2NVUB 4LISA 4E6PA 4RDHA 3NEPX 1U3VA 4OAQA 3B1FA 1KVQA 3PHLA 4ZD6A 3GRPA 3QY9A 2HU2A 3GVPA 1SOWA 4LSMA 3C24A 2Z95A 1MGOA 5EPOA 1OAAA 1U7TA 3KYBA 4BNYA 4HFRA 4PG8A 1BVRA 5IN4A 3JD2A 2GERA 4EBFA 3QWFA 3M6IA 3JQ6A 1E3JA 3CZMA 3U4IA 4P38A 2VYVA 1E7SA 3EW7A 4W7IA 2PK3A 1XLTA 1L1FA 4DQUA 3HDYA 4QT0A 5JCJA 2Y1EA 3GUYA 2VWGA 4LSWA 4BO8A 1XU7A 2AE2A 1YDEA 4RF5A 1BXKA 1BGVA 1UXKA 3H5NA 3R3SA 4Q3EA 2RCYA 1O89A 3IJPA 3ON5A 3JQAB 3RCBA 6LDHA 3O38A 3WICA 1VPDA 5CDTA 1QP8A 1CDOA 3MJEA 4U0JA 1DIGA 1P0CA 1GUYA 2NTJA 5JAIA 3AI2A 2X7HA 1NVGA 2Q45A 3UVEA 4KUEA 2IYPA 4DREA 5TX7A 3ICPA 4TSKA 1LTHR 1GDHA 4NI5A 4YRBA 1P1RA 1P1HA 4JQCA 2E4AA 4B3IA 3O9ZA 3ROMA 1VLLA 1O0SA 3RBVA 1A4IA 2NQTA 1ULSA 1I3KA 3DOCA 3P2YA 4CUZA 1H2HA 3TRIA 4BOYA 4D0RA 3K5PA 4L74A 3FTPA 3PQFA 3DZFA 3WS7A 2BFOA 4O59O 2OUIA 2FR1A 4OOEA 3U9LA 1PGPA 1A71A 4WNIA 3WSVA 1ISMA 3DMTA 4XGNA 3SJ7A 1TVEA 3EVNA 1I2CA 4WLUA 5JAZA 2AA3A 2XAAA 4NK5A 4LW8A 5AXAA 3RUHA 4MVJG 3HSKA 2JCYA 4PFJA 1KVUA 4J90A 5EMHA 4MP6A 3GLQA 1QYDA 3MJVA 3G0OA 1J49A 1W0CA 2D1YA 2ZATA 4EGFA 4MIOA 3K6JA 1CYDA 3JYQA 1JQBA 4J16A 3AFNA 1TT5A 1E5LA 2HCTA 3AWDA 3I4CA 3IAHA 2EW8A 4YCAA 4D44A 5I7SA 3OM9A 1NPDA 1Z82A 3ZWWA 4NBUA 2YV1A 2HK9A 1UDBA 5ILOA 1YQXA 4N7RA 5IG2A 1E7YA 1ISIA 1I8TA 3PLNA 3JV7A 4OL9A 4EI2A 1AHHA 2PH5A 3ASUA 1EFLA 1H5QA 5L4SA 3UCFA 4MKZA 1R0SA 1R4NA 2ZCUA 3NTOA 1ZSVA 2OP0A 4U6QA 2AE1A 3U49A 5FFFA 3O26A 1JU9A 1W6UA 1X1EA 4CMIB 4XCVA 2PZMA 1Y7TA 3TL3A 1FDUA 2P2SA 3H2ZA 1D3AA 2VUTA 2FPPA 3DTYA 3GZNA 3ITKA 3PQDA 1PGOA 2SCUA 2HLPA 3RFTA 3KBOA 1LLDA 1AUPA 2O3SA 5KJFA 3AOEA 2D5AA 1X7DA 2DT5A 4FR5A 4IY1A 1ZK1A 4RLHA 1NTOA 5IN5A 2R2GA 1DC3A 1TI7A 2JAHA 4ROSA 4IZHA 1ZK2A 1CJCA 1PZEA 1L7EA 5G2OA 3VOSA 1RWBA 2WD8A 3BMNB 2C0CA 3AM5A 1Y8QB 1HF3A 3HB4X 3D0OA 1LQUA 1P0FA 2GZ2A 3BTOA 4LRTB 4PG6A 2IRWA 3VH2A 3VZQA 4AJPA 1NM5A 3U4HA 1FDWA 2TMDA 4INAA 3NV9A 1MA0A 4XKJA 3OSUA 3WTBA 4QECA 5A04A 1ZUD1 3PGXA 5CPBA 3H9QA 4NFHA 3F3SA 3WNVA 4CLRA 3K92A 3WTCA 2CY0A 5FWNA 4BNJA 3FWNA 2OO5A 2ZB3A 3HNPA 1VL0A 4PLCA 4DRYA 1HETA 1P44A 1ZSNA 2IZZA 3JQEA 3O8QA 4A5OA 4DQXA 2HDHA 2X9VA 3T7EA 2GPTA 3WQRA 2ZTUA 5COAA 3B1KA 4IQ8A 1GCUA 3IL2A 2Q50A 3EDMA 4CV2A 1Z74A 4JXKA 1ADCA 3RI3A 3ZWVA 3KEQA 2DTDA 3DXFA 4WEOA 1RM0A 1Y8RA 1YXMA 4XB2A 1X14A 2Y05A 2O4CA 3HADA 5COQA 2NU6A 2I67A 3TWOA 1SNYA 1DPGA 1GUFA 1C0IA 3LC7O 3DZBA 3ULKA 4CL3A 3BIOA 3RBZA 2GASA 3B1JA 4FPXA 2AEMA 5BSFA 2BGLA 1SPXA 5JC1A 3B6ZA 4ND2A 5I7EA 3QVTA 1BWSA 1ZIDA 3QVSA 3DBLB 3U62A 3VPHA 3MWEB 4ESOA 3GDFA 3LDHA 7MDHA 2JCXA 1DDOA 1UAGA 2X4GA 4CMBA 4KTVE 7ADHA 3MJCA 4FFMA 3X2FA 2PZLA 2BF7A 2NUAA 4F6LA 3AY3A 3EGOA 1YOVA 4FN4A 4P4LA 5F1OA 4OSOA 4CLHA 5ICMA 1EVIA 4ZQHA 4MDHA 4RZIA 1KEPA 5IJZA 5GMOA 1Q7BA 1D8AA 1TA4A 1K0UA 1UXHA 5ADHA 1ENPA 3LF1A 4XQGA 4D3FA 1J5PA 1ZZEA 2WYVA 3PVZA 1LEHA 1B7GO 1PQUA 3WLFA 2IEDA 3PDUA 1PR9A 3I4FA 1E0DA 3GK3A 5GZ6A 3AI3A 4QTZA 4IINA 1FK8A 3CE6A 1WXDA 4U6SA 4F46A 1B26A 1HE5A 4HFMA 1DBVO 3GNQA 1CQJA 1G6KA 2IXAA 2ZCVA 3GHHA 3PEFA 3VH4A 2HO5A 1F12A 3G3EA 2O4UX 3COSA 4U5QA 4DVJA 2NADA 2IXBA 1CIVA 4BNWA 3Q9NA 4XQEA 3L0DA 3NDJA 1C1XA 5DNAA 2XPCA 5F21A 3RC1A 4A03A 4DPLA 1UP4A 4LVCA 2FZEA 1PSDA 1YS4A 3PWKA 1JA9A 1N5DA 4GL4A 3PIDA 4PVCA 1MLDA 4N5MA 4WASA 2VYVD 3FWZA 1YH3A 3LLVA 1KEVA 2O3JA 4G81A 1DEHA 3N7UA 4J49A 4CQMA 3EZYA 3D4PA 3R6DA 1WNTA 2GLXA 3ZDFA 4CM7A 3W4JA 1E6WA 2AQHA 4RVGA 2WYUA 1MV8A 1LJ8A 4RCVA 1NQTA 2Q46A 4Z6KA 4KOAA 3OEWA 4IXWA 3KVOA 1U8XX 3L9XA 1U8FO 2Y0DA 3I5MA 4D7AA 3ZH2A 1GV0A 1DFHA 2J5KA 1YB4A 1N9GB 1H6BA 3ZW8A 3NGXA 3ZNNA 4E31A 4FCCA 2Y1DA 5H83A 1W4ZA 1WMBA 4UEJA 3U4CA 3EMKA 1BVUA 5CDSA 1ZK0A 2JJYA 3BA1A 5JBIA 1PGNA 2JFGA 2DC1A 1QORA 3SX2A 1O6ZA 1B8PA 2EW2A 4YEDA 3IS3A 4GKVA 1UH5A 4RPJA 1D4FA 4J4HA 3O03A 1U4SA 5LDHA 4JNKA 4WCFC 2FR8A 2DAPA 3ZU5A 1NXQA 3DBVO 4WUVA 3VPGA 3BTVA 1P74A 3K73O 4TVOA 4CUJA 1ISJA 5JE8A 2DKNA 3TDKA 2AQ8A 5DCWA 5TNXA 3PJDA 2ZJ1A 4JIGA 3ZWBA 4BNUA 1ONOA 5DOZA 1XKQA 3F1LA 5BR7A 2J3HA 4NH4A 4BGVA 5IXYA 3JTMA 4Q39A 4F3YA 1LDGA 3AM4A 4PLFA 5ENDA 1E3WB 1YKFA 3C1AA 4W4TA 5KVVA 1I0ZA 2EP7A 4JBGA 5HRUA 4BGIA 1PL8A 2GUGA 1WZIA 4YYZA 1Q0LA 1P33A 1UUFA 1X0VA 3UOGA 4WK6A 4GWGA 2IYOA 2A9FA 3OJEA 5DCUA 2IE0A 3WGYA 1QV7A 1KYQA 2B35A 2EXXA 3OBBA 4R9SA 3VKUA 1Q0HA 3ZI0A 4D3DA 1IHYA 6ADHA 3F5SA 4RDIA 3GG9A 5DT9A 1Q2XA 2VT2A 5FEUA 4CQLA 4DPMA 2GR9A 4OGWA 1AN9A 4NJMB 1HT0A 3D64A 3FF4A 4A7PA 4IUYA 4P22A 4MO2A 3W8EA 3H7AA 5K6AC 4XJSA 3PI7A 3GN1A 3Q1LA 3AM3A 1PS9A 5FYDA 2WDZA 1E6UA 5KWEA 3OA2A 3WYBA 2Y93A 3GVIA 5T8KC 3T7CA 1KC3A 1ADFA 1NVTA 1R6DA 4GQAA 1V0JA 4NIMA 5AXDA 3IOYA 2GZ3A 3C8MA 1U3UA 3DBHB 3FPCA 4WCFB 1C0KA 1NFFA 5C5IA 5CG1A 5I7VA 3HN2A 5KOIA 3Q6IA 5CEJA 4UVHA 4IZIA 3GFGA 4W6ZA 1ZXLA 4DYDA 1AHIA 1HYHA 3E9MA 3F1KA 4NU6A 3TZ6A 2FY8A 1VM6A 2G1UA 3ST7A 3AW9A 2DVMA 4NQZA 3QQPA 4NZ9A 3NT2A 4W9NA 4Y6PA 1HE2A 1XDWA 4LMRA 5HS6A 1R0LA 2BRUA 4Z3DA 3E9QA 1TB4A 4AG3A 2I76A 2ZK7A 1T2DA 3A06A 3GNSA 1S6YA 4DTIA 3UW3A 4EJ6A 3HB5X 4MVJA 4J4BA 4TROA 2VTDA 2AW5A 3IKVA 2ZYDA 2YZ7A 2J3JA 4LK3A 4NHEA 2YJZA 4R1NA 3WSWA 2DBVO 1HLDA 3OP4A 4MJLA 3V2HA 4Z9XA 1NR1A 3KXDA 3O4RA 4Z9YA 1PEDA 1SOVA 4BL5A 1NP3A 1HZZA 3BTUA 4OM8A 3IP1A 5IDWA 1GU7A 3I6QA 4FGWA 2Y0CA 3ZCXA 3WMXA 4IMPA 1LRKA 1DJQA 1IHXA 3QSGA 4ND4A 1H94A 4CODB 4BQPA 2POQX 3H9UA 3ETEA 3VZRA 1HE4A 4BNVA 3CINA 3FBTA 4CMCA 5I7FA 4D0SA 1H9AA 3KYDA 5L40A 4IDAA 3TZHA 2RH8A 3JQ7B 1LRJA 2A35A 1T25A 2ET6A 3UHAA 4CM6A 1PL6A 1ZH8A 2EG9A 3V1UA 2BI8A 1V3VA 3MCVA 5DDIP 5DCYA 4I5GA 3PZRA 3JYPA 2VHYA 5AYVA 4UUPA 4TRRA 3HJAA 5G0WA 4GWKA 5L95A 1PQWA 1EE9A 2WJPA 4CR8A 4WE3A 1PJBA 3M1AA 1MB4A 1HYGA 5KTKA 2EKQA 1WAMA 4YTEA 1EVZA 3KUXA 4WJZA 4C7JA 4P8RA 3RU7A 4BIIA 2W4QA 4EUEA 3DDNA 2ZB4A 1EK5A 1VJ1A 3OF2A 3UH1A 1LBEA 4HADA 4FFLA 4JCOA 3ROQA 1KC1A 1GEGA 1VC2A 2OZPA 4L75A 3MZ0A 2PGJA 4EUFA 1E77A 4CM9D 1ISGA 4XEHA 5TC4A 3GAFA 3E6AA 2D2IA 3FSRA 2B36A 3RAJA 3NT5A 2NVUA 3A14A 4RVDA 3D5QA 4L4XA 5IF3A 4IGEA 5CEFA 4R41A 1P1JA 2X0NA 3PQEA 3DEYX 4NR0A 4QFCA 5DBIA 3VVBA 1B8UA 2X5KO 4L76A 3FD8A 4D43A 2VT3A 3GVHA 1A72A 4LGVA 5L7YA 1RPNA 2GN6A 4ZRMA 4UUNA 1BMDA 1BRMA 2BGKA 2RHRA 1PJTA 1EFKA 4YDRA 1NWHA 4ALLA 1ZFNA 4NFSA 1NFRA 2H6EA 3RC2A 3VHRA 1QLJA 4E5YA 3KSZO 2GN8A 3SC6A 3JQBC 3UAGA 3W4KA 4BNHA 4HNHA 4E4YA 5JMPA 3VPFA 1XG5A 4WOJA 1RM5A 4AJKA 4B8ZA 1LLUA 2VUSA 3EK2A 5T67A 2NNLD 4FJ2A 1N8KA 2GD1O 3C85A 2BH9A 3JSAA 5B4VA 4IXTA 1OMOA 4E32A 2YQ5A 4UEKA 4DUPA 1SEVA 5JO9A 1GCOA 2I65A 1I2BA 3JQ9A 3CPSA 3GR6A 4M87A 4FDAA 4XRRA 5BSGA 4DQVA 2X8LA 4BO1A 1X13A 3VH1A 3RFVA 1HL3A 1WP4A 4TVBA 1ZSYA 2PR2A 3OJOA 1I3MA 3Q9UA 2B83A 2HRBA 2EIHA 4AJOA 3JQBA 4CV0A 3PHIA 1QYVA 1YL5A 4YJHA 1HXHA 2I6TA 1J6UA 1B8VA 4EDFA 1MUUA 1XA0A 1QRRA 4CPDA 2O2SA 1OOEA 4J1SA 1IPFA 5C7OO 5I9NA 4ZQGA 2Q3EA 4B7UA 4CQLB 1DIHA 3CEAA 2VHVA 4ZQBA 2Q4EA 4J2OA 3AU8A 4ND5A 3GZNB 1OC2A 4J1QA 4YAGA 4O6VA 1PU2A 1EK6A 2FOIA 3QWBA 3QJ5A 2PY6A 4MVJE 1GL3A 1SCUA 4KQXA 4G2NA 8LDHA 1K89A 1KBZA 4TKMA 2G82A 3ZV3A 4DYVA 3MJTA 4BKRA 3PPIA 4E0BA 1NYTA 1Y6JA 2P9CA 1F06A 1C14A 3BYZA 3JCZA 1GAEO 4MVJP 3FNFA 1T2CA 3RQSA 1M67A 2I3AA 1NPTO 1UXIA 3NKLA 4BMVA 2O3UA 3PHGA 3QIVA 5TJHA 4P4GA 3RROA 4TRNA 2CF6A 4QXMA 3ZNQA 5L4NA 1D7OA 1GZ3A 1GUZA 1Y9AA 2OOSA 1DJNA 2FPIA 2CD9A 4NBWA 1PZHA 2Y68A 2P9EA 1PS8A 3PWSA 3ZWMA 4DIBA 3RC7A 3NT4A 2FMUA 1BSVA 3KSDO 3KYCA 5KVQA 5GZ3A 3FNHA 3MOGA 4RLSA 1BW9B 4OXNA 1DLIA 4KDEA 1QLHA 1KS9A 1MFZA 5ILGA 1UZNA 4DWVA 3TSCA 4TRJA 3UF0A 3IKTA 3WR5A 4CJXA 5TIIA 3JYLA 3GEGA 4B7CA 1N7GA 1R4MA 5EQFA 2JFHA 1WW8A 4M1QA 1SAYA 3S55A 1DHRA 1ZO8A 1Y8QA 4JN6B 4J2HA 1XU9A 2B5WA 4R5MA 4WEQA 1NVMB 2AG8A 2P91A 2VHXA 3DZHA 5KJEA 2GNAA 3GPIA 4L4RA 5L53A 4II3A 1HDRA 1JAXA 4DL9A 4M55A 3GMSA 1U7HA 3AUTA 4FW8A 5CEEA 2QHXA 1N1GA 3H5AA 2X5JO 1MXFA 3AY6A 3GUCA 3TNLA 4DMMA 3U5TA 3HFGA 1TXGA 2WD7A 2WWRA 2ZTMA 4HUJA 1ZJZA 1TEHA 2O3QA 2NTNA 4ZVVA 3JQDA 3I9MA 4DMLA 2PKQP 1FF9A 1EE2A 4UEOA 2Y66A 2VRCA 4Q9NA 4B3HA 3OMLA 4XD2A 5U4QA 4UVIA 4DLBA 1N92A 3Q2IA 2FRDA 5T8KA 1Y9EA 3RU9A 2YFHA 3C7AA 4PZEA 5CDUA 1A7AA 2X0IA 4KQWA 4DC0A 4TZKA 1CWUA 4YAIA 4YWJA 4PGFA 3RWBA 1HSZA 1O9BA 1XEAA 1ZXBA 2OL4A 2QYSA 4DPKA 5A06A 4ZN6A 1Q0QA 4MOWA 4CR6A 1IE3A 3INGA 4FSHA 3ZWCA 5JMWA 5JYDA 4XYEA 1DC5A 3R1IA 1R37A 5CPFA 1IB6A 3V2UA 3D1LA 4IM7A 3T4EA 4HFNA 3EY4A 4ALKA 3S1LA 2VCYA 2C2YA 3S2GA 4BNNA 3L6EA 4ZHSA 8ADHA 4HKTA 2H1SA 4Z0PA 2QZ9A 3TN7A 1SBYA 1E7WA 3AUAA 3H3FA 2O3TA 3PTZA 4PZDA 3JD1A 4R1SA 4IJWA 3WJAA 3QVXA 1HDGO 1T24A 2QG4A 3ZNOA 5CDYA 2VNAA 1H93A 1KVRA 1QG6A 3EYWA 4RPLA 2J3KA 3DZKA 4J1TA 1NQAO 1VRWA 4J7XA 2PH3A 4R69A 2H5LA 1IUKA 1B14A 3IUPA 5JCXA 4BO5A 1IZ9A 3A4VA 4XYBA 3FBGA 4FFNA 3ZHZA 4Q3AA 3KRTA 3HHPA 3LC1O 4MIYA 3TL2A 3RASA 1PZFA 3I9JA 2OP1A 4PLHA 3KHUA 3GH3A 3CMMA 5G0VA 5IZCA 4K28A 2X5OA 3DTTA 4I9UA 1X15A 3I23A 5KJ6A 1YE3A 4GAEA 5G4KA 4BS9A 1CEQA 3DAFA 4WGGA 2NU9A 4YVFA 5U1PA 3U09A 1T2EA 3PLRA 3LC2O 3D3WB 4Y9DA 4BO3A 3UCXA 4Q3NA 1B3BA 4CMKA 2Q49A 4HXYA 4XRGA 4OKNA 3I3OA 3ONEA 2PD6A 4J7CA 3M2PA 4W7HA 4R1TA 2C20A 3JQFC 5BNFA 3UFXA 1YONA 1ZVMA 4RVHA 4ILKA 4YJFA 5IZCC 1Y1PA 4FD3A 3ITDA 3GVXA 2PA3A 3OICA 4IPTA 4E3ZA 4H15A 4DC1A 1U28A 1U2DA 2A4KA 4MP3A 3V1YA 2OBYA 3OH8A 1NWCA 4XZ3A 3D4OA 4R9RA 2DUUA 5TQVA 3KYDB 4W82A 5F5NA 4PLWA 5JCJD 3F9IA 1GYQA 3RUDA 2D5CA 4S3MA 3SLKA 2X0RA 4XR9A 4A10A 1WDKA 3ZHYA 2DUWA 3TFOA 4YAKA 2EJVA 3L4BA 2CDAA 3P19A 1IOLA 2PD4A 1M75A 3A28A 4CM9A 1DAOA 3U4DA 1F0YA 2BFMA 2C07A 1ZK3A 1A27A 3OJFA 1OFGA 3WFJA 2D3TA 3EUWA 3QRWA 4KZPA 4BKOA 4NPCA 1KEWA 3L4SO 5BNIA 4AJ4A 3TQHA 1I5RA 2LDBA 2NSDA 2YUTA 3E8XA 4EEXA 3H6KA 4QFDA 3QHAA 3P5SA 1VE9A 1QSGA 4L4SA 3QV1A 1ZEJA 3NDIA 5L9AA 1HDOA 2CUKA 3OJ0A 2VN8A 2YHUA 4D45A 1LSUA 3WOHA 2PZJA 3C3XA 3DMYA 3K9QO 3SJUA 5JDCC 3H8VA 2TMGA 4PIVA 2YDXA 4PVDA 4Q3DA 4GLLA 1JKJA 1GADO 2Q1UA 3ZWNA 3PHJA 1H9BA 1E7MA 3QE3A 5G0TA 1SC6A 2FHSA 3SBOA 5HTOA 3ZZNA 1QV6A 4J91A 4PLZA 4CQMB 1YDWA 2ZTLA 4E2YA 3HE3A 3TOZA 2VOEA 3SVTA 1LX6A 3GGOA 3BAZA 4Q3BA 4R3WA 1HYEA 4Z0HO 4D42A 5IAAA 1VJ0A 2CDBA 3VC7A 3FPLA 3FN4A 2CVZA 4NFYA 4AJ2A 2P5YA 4YRAA 5FI3A 2E82A 2CDCA 1HZJA 2WMDA 3ZHBA 4AJJA 4J3FA 2B69A 3RJ9A 3FNGA 3ZV4A 4R5HA 4ZA2A 3GNTA 3JQ9C 1UZMA 3JD4A 1TT5B 4E21A 3VPSA 1LC0A 1Y5RA 3HDHA 3PDJA 2Y1FA 4U7WA 1LSJA 2IEBA 2I5PO 4XB1A 1NNUA 1JVBA 3GG2A 2X1HA 5F1KA 5JW6A 2UDPA 3WGHA 1Z7BA 3NAQA 5DULA 5DBFA 5CAEA 3C1TA 4BMSA 1OI7A 3JQFA 3ZW9A 1E3WA 1NQOA 3X2EA 4R16A 4DXHA 4JX8A 4ZICA 5F3RA 1IL0A 4GH5A 2EEZA 3H65A 1JWBB 1EDOA 5CHEA 3WIEA 4FOOA 4CMIA 5ITVA 2J6IA 4I9NA 5L7TA 1ZEMA 4OXYA 3M2TA 2W98A 2HMWA 1IY8A 1E6EA 1I10A 2W2KB 2GGSA 2HJRA 1NR7A 3FCOA 4KUHA 4L73A 4AJLA 1A4UA 3GA0A 1HE3A 1D1SA 4XIJA 4D79A 3RUCA 1ADBA 5A3VA 4ZGWA 2WTBA 1LDEA 3E9NA 4CM4A 4MKRA 4JP2A 3D5TA 3GVCA 2B0JA 2X22A 1CETA 3PIIA 3OECA 4E2XA 1O95A 5KVSA 2OMEA 3CIFA 1AXGA 2BELA 3WNQA 1QYCA 2C59A 1RM3A 3ZGYA 2OGUA 4FJ1A 1N1EA 3PWZA 2Y0EA 3AFMA 3DB2A 2X0JA 3G79A 4U0KA 3RBXA 1EBFA 1FJHA 2AMFA 2D8AA 2DLDA 4IDGA 3W4IA 1NBOA 5H82A 4ND1A 3UKOA 4CMEC 3JQCA 1I2ZA 4UVEA 5GZ1A 2Q2WA 5GY7A 5L3ZA 3U0BA 3JYOA 1PIWA 2CNBA 2EV9A 4DBZA 3DBRB 3GZ4A 5L51A 5IDYA 1BTOA 4BHTA 5C3MA 2JD1A 4XJTA 5DN9A 4RQUA 1ENYA 1ZKMA 3I9NA 3IC5A 3KSUA 3SLGA 5JY1A 3N58A 4W99A 4D3SA 5A1TA 1SZJG 4YACA 4RVFA 2YHIA 2O48X 4LCEA 4O0LA 5IFLA 1ZCJA 2AQIA 2ZYGA 4YAJA 1K3TA 1BDMA 3NDRA 2G0TA 1P9LA 4RO0A 4DBVO 2UVDA 4OHUA 1XQ6A 4RZHA 4MVJM 5K0ZA 3KM0A 1JKFA 3H9JA 4AICA 2I66A 1C1DA 3EHEA 2NACA 5ENVA 3QWAA 2HMVA 1PJ4A 4KTTE 5DZSA 2J5RA 1JLLA 5L45A 3RC9A 3RKRA 4Y6RA 3MJSA 2AXQA 3LU1A 2B5VA 5B37A 1C1DB 2JL1A 4YT5A 1E5QA 2C54A 3DBLA 3ICCA 4JP3A 1YRLA 4J1NA 2GDZA 4E5PA 4Y6SA 5BSHA 2CZCA 3GEDA 4PG4A 1HRDA 2EP5A 4XIYA 2V6MA 1GYPA 3ADPA 4O63O 4G65A 2DPGA 3WYCA 1E3LA 4ID9A 1WDMA 5B4TA 3AJRA 3FNEA 3KO8A 1FDSA 3UICA 4UUOA 1B0AA 1H2BA 1YL7A 2VWQA 1B2LA 4PRLA 2JHFA 4XDZA 2F00A 1NAIA 4I8XA 4X54A 2EGHA 1I36A 3RUAA 2B4TO 3WLEA 2D0IA 3K96A 1GQQA 4BMNA 2FZWA 1NFQA 3JQ8B 1DHTA 3JD0A 5TF4A 4DIOA 3AOEC 5LDGA 4D46A 3WXBA 2OBNA 4I1IA 2VNSA 3PK0A 4E5MA 2ZKLA 1ZJYA 1PQPA 1XCBA 5JFOA 2WYWA 4BKQA 1XGKA 3DONA 2DTEA 2P5UA 1KOLA 1AE1A 4GI2A 4JJFA 4M86A 1R12A 3VAZA 4ALIA 3F5QA 2PGDA 1H6CA 2GSDA 2V65A 2UAGA 4RF4A 2YY7A 3WBBA 2UUPA 3I9OA 4AFNA 5T6BA 3VVCA 3TOXA 3PRJA 1CF2O 1PWXA 1B15A 1HKUA 3KV3O 3BMQB 3CZRA 1E92A 4WNCA 5A9SA 1VL8A 4CM5A 1T2AA 2CFCA 4B4UA 4CQMD 3ADOA 4RV9A 4WLOA 3PGJA 3RKUA 3S2FA 1UJMA 4GBJA 4CLDA 2AG5A 1X7GA 1KEUA 1U3WA 1MC4A 5JS6A 4XQ9A 3LVFO 4G5HA 1F14A 2DTXA 3QWHA 4OKIA 3WWYA 4E5NA 1GTMA 2P68A 3IMFA 2GF2A 3OJLA 1FDTA 2Q1TA 2P9GA 2X6TA 1JVSA 2OORA 4RL6A 4XQCA 1FMCA 3GY0A 4FS3A 1YB1A 4HV4A 3RIHA 5HA5A 3MWDB 4IS2A 9LDBA 4XDYA 3DZJA 4K1LA 1LDMA 4UVDA 4BO9A 3KYCB 2C82A 4H3VA 5JO0A 4Y67A 5G0UA 1LDYA 2Y1GA 4NJMA 5B12A 3DHYA 5G4KB 1G1AA 2J5QA 1U3TA 4K6CA 4RGBA 4YB8A 1DIAA 3WB9A 2FSVA 3KOUA 4XR4A 1R16A 1U9JA 2QX7A 4NBRA 5JAQA 2XOXA 3GC6A 1QR6A 4I5EA 3AI1A 3NJ8A 4IBOA 3Q0EA 5AXCA 1RYEA 4WOKA 3VZSA 1LNQA 2HMTA 4R54A 2BLLA 1DFIA 2NU8A 1I32A 4R3NA 1PZGA 1Z7EA 1ZW1A 1Z75A 5CP8A 4CMJA 3LSYA 2E37A 3VKVA 3OETA 4PLTA 2DM6A 1NASA 3NGLA 2FSSA 5C37A 1UP7A 1HSOA 3IJRA 2RBEA 5EINA 1KVSA 4IQ0A 1PJ2A 1E3SA 4YT4A 4BKPA 3GOHA 4ND3A 4GGOA 5HM8A 1Z6ZA 2H9IA 3OHSX 4IIVA 4CLOB 3DOOA 4NBVA 3VZPA 5BNTA 3NTRA 3JYNA 4YBZA 4O1MA 2DFDA 3ONFA 4HP8A 1M6WA 1XR3A 1OC4A 3MJ4A 3HWRA 3ETDA 4OOFA 1DXYA 2JD2A 3ONDA 3UXYA 2Y99A 5B4UA 4OH1A 4LN1A 3RUIA 3ZWAA 1DC6A 5COBA 5CFZA 3OIGA 1E1NA 1MG5A 4CMGA 4ITUA 4NU5A 1LU9A 2PTGA 3QWIA 4FFOA 4N5LA 2J3IA 1BHSA 2BD0A 1FDVA 4YJDA 3S2EA 1ML3A 3ZU4A 2BGMA 4RQTA 4FOSA 2W2LA 5ICSA 5JSFA 2BI7A 1BXGB 5B1YA 4YJHB 1BG6A 3CH6A 1MG0A 2HMUA 3DBHA 2BHLA 4J0FA 4WCFA 5AVOA 3PJGA 3OQ6A 1XHLA 1K6XA 3S8MA 1DRVA 5K6AA 5CG2A 3CTMA 1YQGA 1XELA 4WPGA 4R01A 3ABIA 3JQ8A 5EERA 3HDJA 1VL6A 5ER9A 1D1TA 1EQ2A 4E12A 3A9WA 1ZNQO 3CUKA 3WGOA 2Q99A 2GN9A 3WFIA 1U5CA 1CERA 3HG7A 2DQ4A 4BGUA 3C7DB 5J23A 1EVYA 1EZ4A 4BKUA 1GQ2A 1VI2A 1WZEA 3AK4A 3LF2A 1GZ4A 2DPHA 3DWFA 3EZLA 1E1KA 4HBGA 5EESA 4OSPA 4RVSA 3WBFA 4E2WA 4FB5A 2PGLA 1CRWG 1ZBQA 3K31A 1DO8A 2YV2A 3GQVA 3TFQA 4QQRA 2BMAA 3WGZA 4J4TA 3WWZA 2F1KA 5HWSA 3STHA 2EKLA 4OMUA 4WLEA 3RUEA 1E7RA 3OFSA 3ZWXA 1ARZA 2HQ1A 4ALJA 2NWQA 3GDGA 2Z1MA 1YL6A 3E03A 4XGKA 2FWMX 3DZGA 5HBRA 5IZ4A 3BHIA 1QKIA 1F8GA 2ILTA 2A94A 3TZCA 1XYGA 1I01A 4FFRA 4PG5A 5KVCA 1EQUA 4C7KA 3AUUA 4CV3A 1L7DA 3CSDA 5K9ZA 3E5RA 4I5DA 4JBIA 4UUMA 1E3EA 3H4VA 1EBUA 1MFPA 1PR3A 1SB8A 3HZZA 3TF5A 1HTBA 1SMKA 1NAHA 1YJ8A 2X9NA 3JQGA 3QVWA 4H16A 4DGSA 4YR9A 1KY4A 3PJEA 4E13A 2OFPA 1DIRA 2FPGA 4YRDA 4GKBA 3ENKA 4XYGA 2UUOA 4RORA 4A2CA 4B4WA 1IZ0A 3BMNA 1P3DA 1XQ1A 3WQSB 4QEDA 2BFPA 2YQ4A 4O5OA 4P4NA 1YVEI 4JJGA 3NUGA 2V6FA 1KETA 1EMDA 3WGTA 1MP0A 3NRCA 1A9YA 3UUWA 4KUGA 4CL8A 1J0XO 1T4BA 5I9MA 4GX5A 2D4AA 5I8WA 2GO1A 5JDIA 4BQRA 1GEEA 2X58A 4ZU3A 4Z0TA 1OZAA 5A03A 2XXJA 2PKRA 3ROKA 4PLYA 1P77A 3FRJA 1M2WA 4Y8VA 1EUZA 4CLEA 4EITA 1DC4A 5T57A 3KLPX 4ALNA 3Q3CA 5AXBA 2I99A 3GDOA 1YBMA 3EVTA 2VRBA 3G49A 2C29D 3E5MA 4WLNA 1SO8A 3G1UA 5A3JA 2QZZA 1PX0A 2PD3A 2QRLA 1ISHA 3JQ7A 3R0IA 3F46A 5AOVA 1VSUA 2RH4A 3DOJA 1GY8A 3LT4A 5A9TA 1YWGO 5BQFA 4WLVA 5A5FA 4C4OA 1B3RA 1H6DA 3ANMA 4HWKA 1GZ6A 1FXSA 2HSDA 2YDYA 4I9HA 5JAMA 2FN7A 3MTGA 2C2XA 4N18A 1V3TA 1WPQA 5THQA 4DA9A 4Z3KA 1T1SA 1TT7A 4URFA 1PGJA 3G1TA 3PYLA 4R1UA 1XIVA 1YO6A 1E7QA 4U8GA 4GLOA 1QYWA 2X86A 2AHRA 2V6BA 2JD0A 1H0KA 3HUDA 3ORFA 5T5QA 3C7CB 1VKOA 3ZU3A 5TGDA 4IDEA 5ITWA 4FQ8A 1M66A 2HUNA 2PNFA 3L6DA 1HDCA 5EN4A 1B16A 5F5LA 1T26A 5A5EA 5C7IO 4XYLA 1G0OA 5A9SB 3LT2A 3NTQA 4Z9FA 4BNXA 5A9RA 2ZB8A 4CM8A 4PRKA 3DL2A 5IXSA 4TQGA 2IZ1A 2WE7A 3ZWOA 1DRUA 1HEUA 3AUSA 2EJWA 3NX4A 1Y5MA 4OO3A 1RKXA 4KWIA 3DHEA 2QYTA 2O7SA 3JQGB 3IUSA 4PG7A 2A92A 1Y81A 3BHJA 4EEZA 2W2LD 3W6UA 5KIAA 2EF1A 3QA9A 1C0PA 2VZ9A 5LC1A 4YPOA 2W8ZA 3ZHXA 1LC3A 2PV7A 1VKNA 2QRKA 2NV6A 3DHNA 2JHGA 4IQGA 2G5CA 2VOJA 2Z5LA 2YV3A 4TMFA 5EIOA 1KERA 4YQYA 2ZIZA 3U3XA 3B70A 3TJRA 1K2WA 3DFUA 4GX2A 1GD1O 3A1NA 3H9GA 3WQQA 4JK3A 3L9WA 4JROA 1A7KA 5KJ1A 4WKGA 4YAEA 4BO7A 4YXFA 5U9CA 3W8DA 1YB5A 3OQBA 1H6AA 4RPHA 4GMGA 3DFZA 1F17A 4AJHA 3WX0A 5MDHA 2RHCA 3ZV6A 3K2EA 3WGQA 5JC8A 1DFGA 4ZQEA 5G0SA 3ETGA 1N2SA 3E18A 3ZWPA 3RVDA 2P4QA 2EKPA 4OQYA 4AJEA 4FIZA 5IDQA 4N5NA 3V5NA 1PJLA 3UGKA 4BO4A 4LVUA 4CMHA 3BZUA 3GPDG 3TZQA 1U2GA 3EC7A 1N7HA 4PLGA 1X1TA 3GRKA 3F4LA 3GMDA 4BV8A 4GMFA 1AGNA 3INRA 1M76A 2EHDA 3N74A 1GPDG 1GR0A 1PJQA 3TZKA 4CR7A 4XX0A 3VTZA 5I8ZA 1HDZA 5TT0A 3LQFA 4OYRA 2Q1WA 4GX1A 3GF4A 4KWHA 4CUKA 2Z1NA 3F4BA 3F47A 3R3JA 3WDSA 1K6IA 2VWHA 4LCJA 3KB6A 4N54A 2QQ5A 4E30A 5C7LO 2JKVA 4IJUA 4GX0A 3IP3A 5JLAA 1HWYA 2RIRA 4OIMA 5AQ1A 1RJWA 1Q1NA 1U4OA 1Z73A 4NDNE 1LUAA 3C1OA 5LCXA 1KIFA 1JN0A 3HQ4O 2Q4BA 4K26A 3BHMA 3HN7A 1LI4A 4ALMA 4AJIA 2JAPA 2W90A 3LT1A 5DP1A 3L6OO 4CM3A 4GSLA 4YT8A 4YJGB 2GN4A 4BNGA 4FFPA 5IDXA 1V3UA 1E1MA 3UCEA 1AXEA 3AU9A 5DBGA 4HNGA 5TSDA 4YQZA 2Y67A 3TPCA 3BTSA 4XYMA 3PXXA 1ENOA 3RUFA 2HJSA 1UDCA 5T64A 3L07A 4K9DA 1SB9A 2WM3A 2X9GA 2VHZA 4B79A 2VYND 1P1IA 1YBAA 3H9EO 2HK8A 5JYEA 2G76A 1I24A 1PWZA 2HMSA 3AOGA 3I6IA 2YYYA 2CVOA 1JWAB 4LMPA 4YT2A 2CMDA 2V7PA 3PYXA 4RPGA 3NYWA 5L4LA 3QP9A 1OBFO 3I52A 5KNLA 1EEHA 3Q2KA 4BNZA 3WGIA 3VTFA 2IODA 1R4MB 3BMOB 3I83A 1EDZA 4EJ0A 4K6FA 4AVYA 5EQDA 4NK4A 4BGEA 3E48A 3GFBA 4QO8A 4CM1A 1LRLA 1YQDA 3BMCB 3RD5A 1UXGA 1LLQA 3DO5A 3VDRA 4BNIA 1EVJA 2VWPA 3FR7A 4IGFA 3I1JA 4ZJUA 2G17A 1QMGA 2BFAA 4BV9A 1Z45A 3PZBA 1C1XB 3VPXA 1YOVB 3GT0A 5MGBA 1PJ3A 3M1LA 5HS4A 3WGGA 4YJGA 1ULUA 4A27A 4AL4A 1LSOA 3JQAA 4B4OA 3SEFA 2GRAA 3FI9A 3IQDB 4A26A 3WJ7A 1P1FA 3V2GA 4LRSB 1ZMTA 2VZ0A 2VZ8A 4A0SA 3DQPA 2DU8A 2O2YA 2EWMA 4TWRA 4IS3A
chains in the Genus database with same CATH superfamily
2BKVA 4JVLA 2WJAA 2HJVA 4YGYA 3DZIA 2JH3A 4G4SO 4HB3A 4ZO9A 5D3MA 2A9VA 1JTVA 1R3DA 3V1TC 3W2TA 2P4EA 2SECE 3C5HA 4OJTA 4TV8A 1RE0A 4B09A 3HGTA 3QW4B 5IRCD 2XRZA 1JXAA 4B4VA 2PX6A 2YNMC 1W8DA 1DSSG 3KX2A 4LJ8A 3MTJA 1NW4A 1YJQA 3EPLA 3TNDA 3AO0B 2HK7A 4RLFA 4C07A 5C8DA 1T3ZA 4IDCA 2JGNA 2WKPA 3PCRB 4PZ0A 3S0JA 1UZLA 4KIFA 1QXSA 4L16A 4QYIB 1PS0A 4QU9A 2QUHA 2JVKA 3AKDA 4QUKA 2E2WA 4XWYA 4MJXA 2P9YA 4DVGA 1M3SA 2EWVA 2NIPA 1W8IA 1W85A 4MUIA 4WBNB 3U4QB 4IZOA 3II6X 2OAGA 1UKVY 4UHHA 3FUTA 2FSUA 4P84A 4IJVA 1F8FA 2Q4RA 2QMQA 4R6XA 3RRXA 3NM4A 4Y18A 3UN1A 4NCJA 4HYTA 1QX3A 2REXB 4IFTA 4QA9A 4AZWA 5A4MS 5BSWA 3C70A 5FB3A 3H0CA 2JCVA 4CHTA 1DJPA 2R1VB 3BCSA 3SR4A 1C9MA 4PLPA 1DQYA 3Q88A 1Z25A 1GGJA 4BB5A 4RKQA 1X2BA 3O8DA 4QQFA 1IPEA 3M33A 4MUAA 3WMRA 2DFKB 3DNMA 3D6MA 4L1KA 4NG5A 1WBDA 4GLJA 4M8SA 3DO8A 4OU4A 4G89A 1JQ5A 5TPWB 4G41A 2C7VA 3MRVA 4CYMA 5M29A 3RVQA 2PKYX 4EUKA 1Q7GA 1GDDA 1VFPA 1YIAA 2DSNA 5FBLB 3UUFA 5JHHB 2ZT6A 1I33A 4OQXA 2R00C 4JSTA 1G3QA 3RIYA 2WAAA 3WDKA 5A5GA 2IS1A 3OA0A 5EKDA 3DMTC 3VR2D 3DAGA 1E66A 1IK4A 2R6JA 3E27A 1RHMA 3AVQA 2JAOA 1VHDA 3D1JA 3EIFA 3GT7A 5DM60 1EP2B 4KAAA 1KZ6A 2PJZA 2QY9A 1WHTB 4KXQA 1WQ1R 4ZOBA 4ZALA 1W6RA 2FZ4A 2J8ZA 2NPIA 3B51X 3WYEA 1AKMA 2GAFA 1RPTA 5C34B 1ORRA 1XYYA 4HPWA 4D5EA 5JH7F 3G17A 2QZ4A 5L3QA 2IDZA 1UM8A 3DXXA 3W7AA 1OH8A 3KEOA 2JPDA 1ITZA 1Q92A 4TTPA 3MSXA 1OZGA 4QOGA 3N8HA 2IX3A 4OGFA 1NHWA 5HK8A 4G0WA 1V5FA 4QO7A 4XGQA 2RJOA 4L08A 4MVJD 1Y3AA 4RY9A 4EPWA 2DEUA 4MWSA 4RULA 3N05A 4NARA 3PR3A 1EE1A 2RB5A 4RH0A 5IAJA 2G9ZA 4YK7A 2WRZA 5ALPA 3BXXA 4OQ4A 1ONNA 3DXZA 1NVFA 1YHYA 2I6GA 2EBFX 4Q5IA 1K7FB 4GVXA 3OLWA 1XTSA 1U5BB 2E0IA 3L7NA 3L4BC 2OHHA 1JEJA 5D5PA 1ZGHA 2PXCA 1MQ8B 3AUKA 2ZB7A 3CZ4A 5HG0A 5AW8A 4JR2A 4FR2A 4NC9A 4G8CA 3W6ZA 1HBJA 4II2A 1IYZA 2ZQZA 4FYVA 2XI4A 5K3DA 1I3LA 1T2FA 4TV8F 3ND5A 2Q6TA 1V1RB 3DW1X 5CVDA 3M9LA 4PXAA 1TUBB 1EFAA 1OYVA 4XLTA 4RL4A 3KT3A 4GDMA 4Q9DA 2WIGA 1R88A 5FLYA 3T7IA 2LVBA 4MW9A 4KE7A 3RU2A 1GNQA 1ZVQA 1SURA 1JKIA 1U81A 2HAEA 2E49A 2ZYAA 1P4AA 4FGUA 3FDXA 3E3NA 2AQKA 4PBSA 4RF2A 4MPDA 5ILQA 1P2VA 3HB7A 3F6CA 1EJ6A 3EXFB 3D3WA 1H05A 5FWAA 1SVWA 2BISA 3UJDA 3P7MA 1IM8A 4BNFA 2OXIA 1UXJA 3TOVA 1AS3A 3DZ8A 2D7DA 3WJ2A 3ZN2A 1ULTA 1U0EA 4IDOA 4NNJA 4ADSG 1M0WA 1TQDA 4LZLA 4MQ6A 5DGIA 5CA0B 2ZBVA 3F6EX 1FTWA 2XUOA 5H70A 5HRCA 2W2QA 3Q7PA 4JR0A 4BO9A 1KIAA 1ZK4A 1HK7A 2QP4A 1Q95A 2BEVA 4QSMA 3IDSA 3TDNA 3V34A 2B2CA 3DAPA 4BMXA 1ISFA 1BDJA 3UB2A 1A5ZA 3IAUA 2MWMA 3X44A 1NXTA 2CFIA 4O1HA 3C8HA 4HDQB 4I2NA 3QLJA 2J9FA 2QRPA 2AFRA 2ZRKA 2WU0A 4INPA 2GHRA 2O3RA 1GPJA 4X64B 1M8KA 2XQIA 2ATIA 4IDHA 3K2BA 1QO7A 2EERA 2HCBA 3ZX5A 3FFTA 2HF7A 5IKOA 5DP2A 3L77A 2R84A 3T3GA 4EF4A 3AJDA 2P3QA 5A4AA 2UYYA 2XWJI 4XA8A 3DLIA 2IZ6A 3P4YA 1QYIA 4LTNA 3WIUA 2I78A 2ZIXB 2GJAA 4DLAA 1FSPA 3P9KA 4UREA 1K7SN 1J4AA 1I30A 2FPIB 1MX1A 1QFYA 1YGYA 2ZJ3A 3MUEA 4OJNA 4PCAA 1JEEA 3AHIA 4BN4A 2IZ5A 1HQYE 1NQ5A 2ZBGA 1H2WA 2MCFA 3P96A 5DXJA 1B41A 4BLRA 2ID9A 3OQJA 3ROPA 3FTNA 5JRZA 2HDWA 3F6PA 4P86A 1MV5A 2HKIA 2CLSA 3ZS9A 1U2DC 5E4TA 3P26A 2C5SA 2R7KA 3BSYA 3BWXA 4GYYA 3DKIA 4UMFA 5GIOE 1H2RS 1U7UA 4LGYA 2QLJA 3DWIA 2M6LA 3RTBA 3ZDQA 3BQ9A 4PIPA 4QVKA 3THOA 3WMWA 5LMUB 2PCLA 2QIOA 4DV4B 1EUDA 2J0VA 1Y8CA 2MHCA 2ZJAA 4LNUB 4UM9B 1KGSA 4ZI2A 4MCAA 2H57A 3AESB 3HCNA 4TV9A 5JAHA 7MHTA 3AY7A 3LT0A 3KQNA 2QVYX 1E4OA 1DB3A 2JJ1D 9GPBA 1VFNA 2C03A 1CQPA 4EHNA 3ANLA 1NVAA 2YVKA 4PGAA 4J43A 1DTWA 1AGRA 5DM70 1IQ0A 1QQ7A 2ZXEA 1YBVA 3HDQA 4L9SA 4DJFC 4DUGD 4QXPA 1JDUA 4BRZA 1EWYA 2NO0A 2GZMA 4JDPA 1SKMA 3CNOA 2QMUA 1JH9A 2EW1A 3OIDA 3T9AA 3P9CA 3ENNA 4WN9B 2CJWB 4O2AA 2HRQA 3WLTA 2Y92A 2JGIA 3DTVD 4FVTA 4LAFA 2EGGA 3ROGA 4WL0A 4ZQFA 2QLTA 3QLEA 3PR1A 2XRYA 5CIYA 4AO8A 4HY3A 3L41A 1N78A 1HLPA 5C8YB 4WOCA 1Z9BA 2UV8A 4ID3A 1Q1EA 3OX4A 4BNKA 4NU8X 5JS1A 1YRYE 1MN6A 3FETA 3F6YA 4UHKA 3U3DA 2GAOA 4CLRB 4AX8A 3THXA 2IHUA 5IF9A 1U2PA 1R15A 4HNSA 1QIJA 3KQHA 2XQJA 3K53A 3CJTA 3VA7A 3DDOA 4GIBA 3GLKA 2ZTVA 1GILA 3ZI4A 1MABB 1G5QA 4Y9SA 5ISMA 4X24A 4N6GA 4B81A 3MS7A 3VMFA 1SXQA 3LUCA 1ZIOA 2VHCA 3KTAA 3MWYW 4CI9A 2R8OA 4DJEC 4YUZA 4KR3A 1U90A 1C3VA 2GM4A 3PJFA 4FGSA 4HQLA 5HUJA 4IX1A 2FG7C 1CU1A 2PSFA 4V0RA 5TRTA 2Z43A 5I7HA 2FP4A 4FC7A 1CKEA 2B4RO 3EC2A 2JRLA 4V38A 3EBLA 3HP1A 5HJ7A 3ETNA 5HK9A 1HEYA 2VDUE 2EL9A 1QE5A 3MMNA 1OD6A 3A25A 4GPD1 4A8HA 4OLAA 2A9QA 5JNUA 3V46A 1MX3A 2FDXA 2AFHB 3CX7A 2VBFA 3SZUA 4JP1A 4G25A 3DDUA 3OQ1A 2NUTB 2VJQA 3G5AA 4L0QA 4UVGA 4ES6A 4TKLA 3GOQA 4Y2GA 3LH5A 4F1KA 3AEKB 1GYRA 1Q5PA 3WRYC 4RIEA 5D3QA 5AM2A 3KTDA 1R4NB 2R00A 4IUDS 3I6YA 3DR3A 3MEQA 4UQLA 4FGJA 3ET4A 4GC9A 4DCMA 1L5OA 1C8BA 3EVFA 1U0GA 5EVJA 3I05A 1XD9A 5BNWA 2CVQA 4KO1S 1FS4A 2P4HX 3S29A 3BRSA 2CJXA 3CRQA 3L8YA 5JTUA 1QVWA 3NEPX 2P1DA 1MHTA 4JC0A 1CEXA 1GL7A 5KKNB 4D96A 1FRVA 3QY9A 4QU8A 4QRIA 1SQ0A 3DV2A 4V1CI 4ENSA 3WFZA 1D2AA 2RK6A 4BNYA 3GGSA 4QGHA 4HFRA 4LDQA 1BVRA 4FFDA 4YH1A 3UJ6A 5IKPA 4JUBA 3QWFA 4V02A 1UDWA 2FVYA 4C6RA 2ZUWA 1TJNA 3U4IA 3CZMA 4HAUA 4P38A 3CWCA 1T5DX 2VYVA 4KFSA 3BEDA 4MWCA 2FPUA 4TMVA 2Q4TA 2PBZA 2DULA 5TPZA 4PXYA 3RYCA 2Y1EA 3P9PA 2VWGA 4LSWA 3TI9A 1GKIA 3M0EA 4JLJA 3HA7A 5JYBA 1BXKA 1RXWA 2OZVA 2FXVA 3R3SA 2RCYA 2Z30A 2P9BA 2ACVA 1QHHA 2XA1A 4KO4S 1QCYA 3JQAB 3PNKA 3RCBA 4LYFA 5DGCA 1VPDA 2QRZA 3ZUPA 1YUNA 4MYCA 2O07A 3U2QA 1USUA 3GLVA 3OZEA 5E6SB 1OH7A 5J2UA 1K6EA 2ZSEA 5HIIA 3TSYA 3GJZA 2GILA 2Q45A 3UVEA 4ZZ3A 1U2RA 1O95D 2IYPA 4F5WA 5K4HA 1LTHR 3O1JC 3QE0A 5KHAA 1P1RA 1VYHA 5B1HA 4AXBA 2E4AA 4IGIA 3PNBA 5CT4A 2YZMA 4MRMB 4Q34A 4O4HB 4B6JA 3CF4G 5BN4A 1O9GA 3PU6A 1SXJB 3E9YA 4H27A 2NQTA 4NE2A 4X93A 4QDTA 1ULSA 4U5XA 5FO0A 5JWOA 3DOCA 4B48A 1UJNA 3V6LA 1H2HA 3TRIA 4D0RA 1W4BA 4JLSA 1PVVA 3S7ZA 1SU7A 3MAJA 4DEVA 4C4AA 5HZMA 4DNXA 5IJXA 5BP7A 5H68A 4JKYA 4O59O 2OUIA 1IB0A 1V39A 2QX4A 3BB3A 4OOEA 3U9LA 3DLTA 4C05A 3LUBA 2YKGA 4XFJA 4G5YA 2F67A 3DMTA 1FU7A 2G67A 1KI6A 3MW8A 4HVCA 1NRWA 4F4FA 3EVNA 1N6OA 2NO4A 2NXWA 1G1MA 3HCPA 3IB6A 3PE4A 4DDUA 3OLYA 4Z49A 5AXAA 1QF9A 4MVJG 3HSKA 1QK5A 1ZOOA 1KZ9A 1UF9A 1E96A 3D43A 4G8JA 4PFJA 4O4JF 3GRZA 4OHRA 3WL6A 3GLQA 4DCNA 4C0BA 5FOTA 4MQ4A 1DKRA 3QFSA 5C80A 1ZM2A 4KLNA 5C35A 3HS3A 5DSZA 2VDPB 3LYAA 1QBGA 3ED5A 1R8JA 4HB4A 5G53C 3AFNA 4OEHA 2YWDA 1TT5A 2HCTA 3AWDA 3IAHA 1Z12A 2DBYA 1A9TA 2OYSA 4XM2A 2H0QA 4B3CA 2C9DA 4D44A 2G07A 1CRPA 1ZLXA 4EX7A 1WM1A 1NPDA 1OTXA 2IYTA 1E61A 3W1EA 4HXEB 2BBWA 5IG2A 4LF8B 1IVYA 5KC8A 3QPUA 1ISIA 3U40A 4OL9A 3UK2A 1IQUA 1LVGA 1YJAA 2CEAA 1IUNA 1Q1BA 4FDLA 4POAA 1QP0A 3WHKA 2QW0X 3UCFA 2HWUA 2ZCUA 1ZSVA 3P4XA 4U6QA 2F6RA 3PPVA 5FFFA 1WOMA 2BFDB 1JU9A 2BSXA 2ZSFA 3DULA 3AF4A 2VNKA 1X1EA 3EXEA 5FL3A 3V4VB 2GXAA 2PZMA 3AR4A 3D8TA 2C2BA 2PUBA 5HXAA 3EGEA 1FDUA 3H2ZA 3ELYA 3RAEC 2CYCA 4TYPA 3ITKA 3ZIDA 3VR4D 3ZE9A 5H3HA 3RFTA 2I3BA 3KBOA 1LLDA 2HJGA 2OXTA 2VJBA 1XUOA 4PIMA 4DCUA 1AZSC 2PKXA 1XP8A 3LUDA 3FVQA 4D0LB 1TADA 1KARA 4ZEOA 3T7SA 2R2GA 3JVUA 1MENA 4LNAA 4ENUA 1SK9A 2XOKD 2UZ0A 4I8DA 3QKRB 4W7SA 5CA0A 1NUQA 1JYFA 1Z68A 3MJDA 3VGPA 2FMTA 1ZN9A 3F6BX 4FYJA 5CJ2A 1BGWA 5G2OA 5TMBA 3VOSA 1LBSA 2VH5R 4KOEC 2Q29A 4HLCA 3BF7A 1ES9A 2PRYA 1LQUA 3IPLA 2V9CA 2IRWA 4YLEA 4ZVTA 3PB3A 2VZEA 1AS2A 3U4HA 4BXOA 2H3HA 2MSKA 2XJ4A 1YCGA 4H4DA 4JBNA 3ZKAA 2N46A 4R84A 4QECA 5A04A 5KNCD 4TOIA 4M0KA 3I8XA 3M4NA 3X0DA 5EJEA 1XJCA 3MELA 4ILEA 3UHOA 4NFHA 1DVRA 2H1LA 2RKOA 3BA6A 3FCXA 2H1RA 3WNVA 1G2IA 3AZPA 4DSTA 3T61A 2HBYA 5CJJA 2OO5A 2MSDB 5J2UB 1MAAA 2V0NA 4PLCA 1DEXA 5CCXA 1HETA 1ZSNA 2IZZA 3WA7A 5LNK6 1MPXA 1YZHA 1Q2UA 4DQXA 2HDHA 3B1ZA 4OXXA 1KP2A 4GE0A 4KVZA 4YJ2B 5KINB 3WQRA 2HSEA 4OFWA 2JIBA 3BXZA 3R3HA 5JCOA 3B1KA 1DZ3A 1UBOS 3RFCA 1NV9A 5AICA 2ZSUA 3EDMA 2A7XA 4PSCA 1NG1A 1Q7EA 3NNSA 1Z74A 5CCDA 2HF8A 4ZI7B 4BLOA 3RI3A 5HOQA 4C5CA 1AMOA 1RAEA 2Z4SA 4MSUA 3CBGA 4WEOA 4XB2A 1RFLA 1YU9A 1YXMA 1PHRA 2Y05A 4U3JA 2O0LA 3P1JA 3S68A 5BOSB 2I67A 2HIHA 1Z4OA 2C4MA 2DQYA 1T36B 3L6CA 2VAWA 5C8VA 3B1JA 4FPXA 4J0KA 2IYXA 1JALA 4RHUA 5J9FA 1JHYA 1Z6QA 5FOUA 1TRHA 4ZCSA 5I7EA 3VKHA 3QVTA 2VDKB 4URUR 2Z0MA 3VSEA 4DMKA 2QNBA 3GDFA 4V3CA 5K0CA 2V9PA 1DDOA 3KKEA 4JLDA 7ADHA 1QK4A 1QO0D 3FLEA 3GEPA 4WZAA 5JD5A 1C41A 2PZLA 3VV2A 2BF7A 1I80A 1XRRA 3QNWA 5ITZB 5F1OA 3COPA 2OV8A 5ALOA 2RHBA 4UOQA 2GCEA 3NHUA 4CLHA 1EVIA 1V25A 4GP6A 3I0ZA 4Y6LA 4ZQHA 1Z16A 2YXPX 4YUVA 1C9YA 1C29B 2W4IA 3AIOA 4AT1A 3STXA 4L8YA 2WT8A 2QNIA 1OTHA 5GMOA 5IJZA 1TQ8A 4D9FA 3A3YA 1K0UA 4UHCA 1Y6QA 4Q7EA 3WOVA 1ENPA 4L5CA 4EGJA 3N5CA 3SP1A 2YRXA 5LIRA 3OX2A 1ZZEA 1Z62A 4XVUA 2QI9F 2IU6A 4PTYA 4FNOA 2WUDA 4MV6A 3AVPA 3EIOA 1B7GO 1PQUA 1YJBA 1P7ZA 3C6YA 3S3TA 3RNLA 1CZLA 2JGRA 1WZUA 5AH0A 4AY5A 4EKEA 4XD7D 3I4FA 4JMPA 4L50A 1EP9A 1QGYA 1OJLA 3EOAI 4Y2QA 3EWNA 4QTZA 2I8LA 2AOWA 3PD7A 2MT9A 4IINA 4U6SA 3T9CA 4F46A 2CNOA 3KS9A 5HRAA 3KQTA 1HE5A 2QV7A 3ND9A 5DTJA 5FUYA 1V6CA 4B7AA 3DE4X 2HHHB 1W4RA 1G6KA 2HIGA 4EGCB 5FX2A 3PEFA 3GHHA 3FPGA 3VH4A 3R0QA 4QLBA 1F12A 3CZAA 1JB9A 5CX1B 2HA4A 1OGYA 1Z0JA 3G23A 3UATA 2IXBA 3A6FA 4RNDB 1RSZA 1P6UA 3UUGA 3B5JA 3RODA 1E9SA 1YIDA 4HSEA 4EYQA 1ZI9A 2PUGA 3RC1A 4A03A 4DPLA 2XUIA 3U7GA 1I7PA 1XU4A 4B6SA 3BJZA 3SZOA 2J09A 2GAAA 3LUAA 1E1CB 5EZ5A 1QWOA 3HUTA 1MLDA 4M4SA 4N5MA 4WASA 1F38A 2GTPA 3NHRA 3FWZA 4FMDB 4NONA 2ZM5A 1EGMB 4E07A 1DEHA 4E6EA 4F06A 3VKGA 1BKYA 4J8PA 5J40A 2OCKA 2WHPA 2B78A 3FJYA 4NBNA 3L8GA 1M10A 1X8XA 4DN6A 1E6WA 2NYRA 4D3ZA 3EPJA 4K9LA 2C4WA 2C84A 1DWOA 1E5VA 2H29A 1MV8A 5F35A 1QUEA 2C31A 3B78A 3MTBA 3SLRA 2YRWA 2Q46A 3P9IA 3HYRA 5KVAA 1OWNA 1KI7A 1OKKA 2AJLI 3CLSD 5GOTA 4YR7A 4Q4JA 4Z6KA 4KOAA 4IXWA 1FJGB 3EXAA 2FWPA 4O2LA 2C1EA 1AT1A 4LSZA 5JJBA 5J5VA 1G6HA 2J5KA 2PZEA 3PQ8A 3QKSB 1YB4A 3O21A 3ZE2B 1MR3F 1YNOA 1A4RA 2P27A 1WSAA 4MO9A 2IYSA 4C3OB 621PA 3UJ9A 4Y7DA 4RY8A 1VMEA 3IBYA 5J43A 1WMBA 1VXRA 1KJZA 2CJYA 4UEJA 3U4CA 2H1HA 1BU5A 1BVUA 2A2ZA 2V3VA 5GZ3A 4CM8A 4Z7JA 2EFDB 3A6ZA 4QFMA 1U8CB 4RPJA 3TLMA 4CL2A 2QLLA 4UNPA 2O2DA 3O03A 2O6HA 1U4SA 2ZW9A 4P7FA 5LDHA 4AY2A 1I0LA 3RK0A 2B5OA 1AUQA 4COOA 2DAPA 3OOJA 3THWA 1VIVA 5FAXA 3TE7A 1ECPA 3DBVO 4WUVA 4L9AA 1ZP6A 3VPGA 3K73O 1RXSA 4O2BF 2AK3A 4UNSA 1WUTA 3CT4A 3TDKA 4QU5A 4L6AA 2HA0A 5DCWA 3IHWA 3CUTA 1SWVA 3QX3A 1P18A 3ZWBA 4BLUA 1TLLA 1L4EA 2WJ3A 4S35A 4BNUA 4EA8A 5A6SA 1JKJB 2WU3A 1IY9A 2X2FA 3MJHA 4G4GA 5JMTA 3GPBA 5IXYA 1I0IA 3JTMA 5ADVA 5DLPA 3AR8A 4MVCA 1RI5A 1P3Y1 3ICEA 4XFKA 4IKEA 1E3WB 3X1WA 3C1AA 3PDIA 4AG5A 1ZVVA 2GUGA 1UL1X 4RA9A 4YYZA 1S4QA 2E85A 1Q0LA 1ECCA 1F4LA 2VDWA 3LPLA 4NZOA 1X0VA 4FBLA 4FDUA 2IQ5A 1QPZA 2IYOA 2IA5A 5I51A 4AMYA 2DWPA 1V1JA 1AO3A 3WGYA 3ZHRA 1QV7A 1KYQA 2YASA 3I72A 1G64A 1F7UA 4BV2A 4NG4A 2C8VA 1U6KA 2RI0A 2ZLBA 4L6CA 1Q0HA 4HH4A 1PI3A 1DTWB 2RHGB 2PVCA 4OD0A 5PNTA 6ADHA 4ZTZB 1Q2XA 4QGGA 1NQXA 2HJ9A 3RVLA 4DOMA 1MGPA 2WFAA 1ZCAA 2HMAA 3WZMA 4ZAFA 4LQLA 1CUCA 5B6PA 5IW8A 1REQB 2XDWA 1HUQA 1KORA 5FBRB 1FNNA 5FUWA 4ZVPA 2RGXA 5JXIA 1TL7C 4MO2A 4P0PB 2IXGA 4XJSA 2LCQA 3P0EA 3PI7A 1DEAA 3RVBA 3IMEA 1FRNA 3HBFA 4MZXA 1PS9A 2QTCA 1FDIA 5FYDA 2WDZA 1QMPA 4WZZA 4XGRA 3ZDCA 3VGJA 1E6UA 5JU6A 5HM6A 2Y93A 5ALXA 3LXMA 4GWLA 3GVIA 2C77A 2O5CA 2VXYA 1O87A 2BGWA 3LFHA 4LY6A 5K8CA 2QX9A 3LECA 4YONB 5FHQA 4D6YA 3U44B 3L0ZA 4MV0A 3GLGB 2CV0A 2FMIA 5T41A 5ALEA 3DBHB 5I7VA 1C0KA 1UZUA 1H9CA 4KO3S 2A9KA 4FFVA 3ZK9A 1IC6A 3VISA 1SQ6A 2J3MA 1WHTA 2HZ7A 1KKMA 4S1PA 3QELB 4Q1EA 2H65A 3UIEA 3I9FA 3AKEA 3QLVA 3M6UA 4DYDA 3IAEA 3OTOB 2Q1XA 1L5SA 3E9MA 1YQTA 3NHFA 3ZE7A 1Q6YA 1G38A 5HJ2A 4Z86A 1VG8A 2QTZA 2R96A 4NQZA 2JLWA 1T9AA 1R5OA 1D4AA 4W9NA 5BN3A 5LQJA 1S89A 1HE2A 1XDWA 1YQWA 2P67A 4I1UA 4Z1MD 2C58A 1R0LA 2Q6LA 5CXXA 1OAKA 1Z28A 2BGNA 2O2EA 1GVNB 1G9XA 1BE0A 1JG7A 1FQWA 1LW6E 2ZK7A 1SUDA 3VZCA 3GNSA 3EQ2A 4LRXA 3C4VA 1IUPA 1XDGA 4EJ6A 1CZNA 3HB5X 2QL6A 4J4BA 3TMAA 2VTDA 3DB1A 3IKVA 5HKOA 3GJ6A 2WFLA 4AMVA 1ZM9A 1PTJC 13PKA 2PL3A 1LS6A 2NZ2A 1AK2A 3I01M 2BJWA 2CXHA 3IDZA 2VJMB 4MNTA 4OYLA 3OP4A 3V2HA 3W9YA 5LMNB 3HU5A 1R9NA 2IWRA 3LGAA 2ZYVX 4ZVKA 1NP3A 1TTQB 4BB0A 3O9VA 2A0WA 3DEKA 3QVKA 4CT4B 1WPXA 2GNOA 4BMCA 1SULA 3K32A 3QPAA 3JVEA 4BQOA 2Y0CA 3LOUA 5DGDA 4BGDA 1FVFA 2E55A 1LI5A 3DLAA 1DJQA 3ESCA 2HZBA 5WRFA 2WINI 4BY9E 1DKMA 3K09C 3H9UA 1MB2A 2ZIAA 3JZDA 3VUEA 2PAFA 1HYBA 1SXJA 1Y89A 4D0SA 4PR0A 2YR0A 1OGIA 1U3CA 2Y0PA 3KXKA 2JJ8A 1ZL0A 3KYDA 5L40A 3KQKA 5IVHA 2AMLA 1NW6A 2RH8A 3JQ7B 5KX5F 4GC5A 3QPBA 3UHAA 1GGFA 2QM7A 1FFXA 5D3MB 2JKZA 1QOQB 2VG8A 2BBSA 5HCIA 4IIJB 5AVUA 2P9JA 2H2GA 3LQ2A 4TLCA 4YO7A 3V1UA 5IJ9A 4XQ0A 3GJXC 3RTAA 1FU8A 1ORHA 2BGJA 1CUUA 5LQNA 1E1QD 5EJ8A 5IM4A 4CBVA 5EFZA 4UUPA 1SKUA 4HQRA 2FNAA 4JLBA 5F4ZA 5B7GA 4KWCA 3T4PA 1PQWA 2IGBA 5ULLA 1BCRB 4NJEA 3E9DA 1NZDA 5E0OA 3EIXA 3R6LA 1HYGA 2JJ2A 1KK0A 2UUBB 2G09A 3IB3A 2AFIA 5KTKA 2EKQA 4G09A 1J20A 1PJ8A 1QH8A 3MB8A 4Q7KA 1TMKA 2IIBA 4P7GA 4QXRA 2W83A 4H59A 1Z2EA 4P8RA 3WYAA 1W88A 3RU7A 1D6MA 5CX4A 5EJMA 4RJLA 4MQFA 3VR1A 1XDDA 3UMJA 1X38A 1WY7A 3AHFA 3UH1A 2ZRNA 1XD8A 3EWSA 2FX2A 3UMYA 3ZOZA 6ABPA 5HF8A 3UAZA 1VC2A 3NDPA 1G4AE 1RKBA 1P4JA 2CHQA 3BOSA 3MZ0A 5DYIA 2KBEA 4BP8A 1H5UA 1H3NA 1X3LA 5JBNA 2YIVX 3HR4A 3QKUA 3R41A 2QNRA 4QULA 3GJ5A 3ZEIA 5T4EA 2ENWA 1X1DA 2Q21A 3G89A 4J75A 4AZSA 3V48A 4B9AA 1A2OA 2D2IA 4EB6A 1X7YA 1BQ4A 1NC1A 5EJIA 4L4XA 5KYGA 4IGEA 221PA 3ROZA 1PYDA 3ZCPA 1XD2A 1P1JA 3SFVA 1MABA 1F9AA 3H4IA 1OXTA 1G3UA 3DEYX 3H87A 4M1KA 4N3AA 4FI3F 2B4YA 2ZWMA 3FD8A 3KTAB 2YZKA 2A33A 2JGAA 3GVHA 4ZC8A 2PS1A 2PMWB 4HX9A 2XUZA 2YXBA 1A2KC 1FTGA 2EC5A 4C89A 1XD2B 3CNHA 5A4JA 1RPNA 3N8NA 4DR5B 4NZMA 2ODNA 2RHRA 1PJTA 3NKFA 4LKOA 2VSNA 3H1PA 2PM8A 3HA2A 3N8IA 4PAQA 1XO1A 1NFRA 2J85A 1QLJA 2WAMA 5EA2A 2P75A 4DUYB 3UWOA 1VZ2A 2X6QA 2A5YB 4ZT3A 4TSFD 1ATIA 3WE7A 4CKBA 3GLHB 4LOJA 1XG5A 1M2HA 4WOJA 4Z1OA 1G7CA 1WMEA 1EK0A 1LLUA 1MC1A 1QZTA 2VUSA 3JZIA 1WU8A 3MCTA 3R3WA 4I4IA 4LXHA 4ZAZA 5GINE 1QGUA 2GD1O 4NS4A 2E18A 4H3HB 3OJXA 3QFTA 4IDQA 4BWYA 5LA6B 4O2AB 1JQLB 1RWOA 1OMOA 3L1KA 1PUIA 4JEMA 3OCUA 4IKOA 1UC8A 3DFMA 3BICA 5FTNA 1X92A 3CVUA 2I65A 2PU7A 2FEAA 3CPSA 3GR6A 1IXRC 3I01A 4D81A 1XHEA 4M0CA 1Z6YA 3OF3A 4K9SA 3MWFA 4X7RA 2H7YA 3BDVA 4O4HF 1Z0ZA 3FW1A 4ARBA 4QOEA 1SCNE 4LVNA 1UQRA 1X13A 5B3LA 1J1ZA 5K0GA 2YIDA 3ZK7A 2VO1A 3Q9UA 5C4GB 2Q5OA 4H1TA 4YCCA 2HPHA 2IPMA 2O8EB 1TECE 4GRIA 4EW2A 4AJOA 1FBNA 3JQBA 3IE0A 3PHIA 2ES4A 2QAGC 3WK5A 2PMEA 1HXHA 1I7NA 1J6UA 1QE0A 1MUUA 1XA0A 4CPDA 1ZCFA 1TD9A 2Q0QA 2QR2A 4IHJF 5I9NA 4A36A 4P4TA 4L3VA 4MR9B 1GRVA 3SBXA 4B7UA 4FLEA 1U6IA 3W6OA 1T36A 3W9UA 1C30A 4XPIB 4GPZA 2G1PA 5E1OA 1L3IA 3OUZA 4R9UC 2JNWA 4GP9A 4YAGA 1D0IA 3QBEA 1EK6A 5BQXA 2PKWA 1Q84A 4MVJE 4YCLA 3ZIUA 1GL3A 2F1JA 1Z5GA 3PC3A 3F5FA 4MITA 1FQKA 5AOAA 3BH6A 3NH9A 4WX2B 3F78A 4C4XA 5FWXB 1CDDA 4TKMA 5HP4A 3DMRA 1N2GA 3JAKB 4I9GA 3MJTA 2OD7A 4BKRA 4CGYA 4C7XA 3PPIA 3QI2A 4C0AC 3KJQA 1F06A 5KTMA 2VT7A 2QN1A 5I7RA 4MVJP 3ED1A 3RQSA 4LDPA 3OZBA 3B89A 2I3AA 3ILHA 1QJCA 3BGVA 1PQ4A 4BFSA 4TXLA 1NPTO 2NT3A 3NKLA 4PZPA 4ENQA 2B2NA 1W88B 3OMXA 3PHGA 3PQ7A 2WTXA 4X1YA 4B44A 4TRNA 4PO3X 1I4OA 3ZNQA 3EVAA 3P8ZA 4EHLA 5GIPE 4GPTA 1OHHD 2QZSA 5AHOA 2HI0A 1GUZA 2VPYA 5AVSA 2OOSA 1DJNA 2FPIA 2GI4A 2O14A 3QLTA 4HWPA 1K0FA 1Z4JA 3JALB 4GZ5A 1JPJA 3I6ZA 1XQXA 3ZWMA 2JJ1A 4G5OA 3BIJA 3FPBA 1QCDA 2M6KA 4IX9A 4PCLA 1LFAA 1QH1B 3PUJA 4PNZA 3FIJA 4B6PA 1RR6A 4DWVA 1I14A 3M89A 4Q9JA 5F4BA 4YHBA 4FT2A 4L2IB 3RTCA 4TRJA 1BEZA 5DI3A 4P1ZA 3MGGA 5JPDA 3W5CA 1DAFA 3SX4A 2WUFA 2QZJA 1KZHA 3NHZA 2GHTA 1E0JA 3UJNA 1G2QA 3HRKA 5CVTA 4TWIA 2BFFB 2YV4A 3GEGA 4F7WA 4YAWA 3AIMA 1OFIA 1K8RA 3GP8A 2CLFB 4NMWA 2VXBA 1WW8A 4M1QA 3WP1B 1SAYA 1VXOA 2XUGA 5AK0A 4KVFA 3TTSA 1RRCA 1AKWA 1WXEA 4J2HA 4JN6B 1XU9A 2GAJA 3A7EA 4R5MA 1GO2A 1NVMB 2P91A 3BB1A 2VHXA 5E7IA 2KQUA 4PYLA 5C0OE 4IYRA 1Q0UA 5JECA 4BFTA 1Q11A 3CB4A 4FFBA 4HVAA 4LQ4A 2XZOA 1JX6A 4U1RA 1U7HA 3AUTA 1J1UA 1DNPA 3B3JA 1T9CA 1ZWLA 2Z83A 1ZR4A 4QBFA 2X5JO 4R8SA 4UPDA 2ZM6B 1N77A 2O19A 1UKEA 4GF5A 2CNWD 4PHGA 3TNLA 2FE1A 3UXEA 4ZZ0A 4FK8A 2VQFB 1TXGA 2WWRA 4HUJA 2QD1A 2HHAA 1ZJZA 3CYFA 1OWOA 4ZVVA 1SOAA 4DWJA 3SN6A 5C31A 2JK0A 2ZIFA 3NM5A 4CDMA 1FF9A 2SBTA 1EESA 4QXQA 1QFSA 3O95A 1S02A 4V03A 3TLBA 1Q1QA 1MOZA 3OMLA 3JVIA 4UM9D 1YQQA 5J4LA 5H4HA 4C0WA 4ZU6X 5T8KA 3RU9A 2FRDA 1XV5A 3ENQA 1I7DA 1QKKA 1SCUB 4PZEA 4GR4A 1Z7GA 2PL1A 3RIGA 4YAIA 4YWJA 3RWBA 1ZVJA 4PSUA 1PT5A 4DW8A 2ZRLA 4RSGA 5AI5A 5A06A 4MOWA 2G7MC 2QAGB 2I1VB 3FUWA 2OC9A 1FFWA 2QL5A 5JMWA 1KEEA 1EUYA 1V1MA 4XYEA 1PNOA 16PKA 3E9RA 5CPFA 3G8BA 3V2UA 2QG6A 3D1LA 2ZREA 4EM6A 5CH8A 4HFNA 2OCAA 4W63A 1UBGA 1KYZA 2VCYA 2C2YA 1KU0A 4EO4A 4IEIA 4ZHSA 5DHPA 3WDMA 4Z0PA 5JNWA 2QZ9A 2AGVA 4I6EA 5AO9A 1SBYA 1E7WA 1U9IC 2WWTA 4XARA 1Y4AE 3PTZA 3QIAA 3NMUF 2F8MA 3HKEB 4B31A 4R1SA 4OHZA 2NYAA 1G7TA 3TCXB 3QBTA 5EFOA 2QG4A 3CY6A 5LKAA 3UHFA 2A1UB 2VNAA 1GA6A 1UPAA 1KR2A 1MAUA 3L79A 1ESNA 2X6RA 3H1BA 4TSFA 4D8XA 5C46F 4J1TA 1NQAO 1VRWA 2R4TA 3CIOA 2PH3A 1Z88A 1B14A 2L69A 3IUPA 1XVVA 5JCXA 4XYBA 4ZOAA 1APBA 4FFNA 1HNZB 4A23A 3KRTA 5D6OA 5IT4A 1O5TA 3HHPA 4MI3A 5CDHA 3LDFA 2GM3A 4NAVA 4ZV7A 4PGMA 1ESEA 3I9JA 3OOEA 3Q7SA 5AESA 5IZCA 4K28A 3BILA 3V4PB 3RANA 3DTTA 3R4CA 4YRIA 1YT5A 2AC2A 1BWRA 1UIRA 3FMIA 3OFVA 4FZ5A 4KFRA 4EUNA 5KJ6A 4G4JA 1F2VA 1HOXA 2JIZA 4QGFA 3DAFA 2D4HA 4ZYXA 1T2EA 2W2VA 1SVMA 4GL2A 4Q3KA 4Y9DA 3ES9A 4BO3A 3UCXA 3ESZA 3BF8A 1N6NA 4FZJA 3COWA 3LWDA 4X20A 4Y2JA 3NPMA 1L5FA 5K0LA 1BNCA 1C80A 1FW6A 4A2QA 3JQFC 4NZZA 4X8MA 1UFKA 2LTAA 1YONA 4Q4AB 4RTQA 1R4AA 3AVVA 5H7XA 3GVXA 1DDGA 1IZ7A 3OICA 1IM5A 2CVPA 1BE6A 4K9KA 5I8PA 3KWLA 2LIVA 4D9HA 2Q62A 5JQGB 5JUWA 3BIXA 2A9OA 2A4KA 2X0KA 5HCNA 2I2BA 4EQ6B 2PDAA 2OBYA 3OH8A 1NWCA 1KNXA 2BM8A 3O47A 3AUFA 3CCBA 2C99A 1UBMS 2XMSA 1LPPA 2IP2A 3GQBB 3KG2A 2N9UA 5TGZA 5JCJD 2VHJA 3HB1A 4HN4B 4LK2A 4KBYA 5AKKA 3RUDA 3TEFA 5LQRA 5IMSA 4JDUA 4OMCA 3VPBA 1CRZA 3MAAC 1XVLA 2ZS7A 4KX5A 3PXUA 4U8HA 4CU2A 4P9NA 4H3SA 2QBYA 2PX2A 2HBRA 3EH1A 3P0JA 5AVRA 1CUWA 1UJ2A 3QE9Y 1T91A 3VVLA 3UPDA 4G5XA 3T3DA 2YRFA 2ZZKA 1NJGA 4YAKA 2E4UA 3L4BA 1U0SY 2P79A 4AF8A 1TJ4A 1MOSA 2Y9PB 3CLKA 4HAIA 4CM9A 4XIIA 2QBYB 2QN9A 2SICE 2OG1A 1ZK3A 2Z6AA 3LCVB 2Q3LA 1JSLA 4G84A 2XTZA 5DX8A 3QRWA 4EB3A 4Q12A 1P9RA 3SBDA 4HEQA 1KMHA 4RA6A 1II8B 3TQHA 2NSDA 2EZ9A 2YUTA 1UBEA 3RSZA 1RABA 3INYA 1LV7A 2DP4E 4ER6A 4N4AA 1FNCA 3R09A 3R7WA 2WAXA 4D9EA 2PL5A 3JATB 1V26A 2XUFA 4MS1A 4BECA 2ZBUA 3QV1A 3ZEAA 3I8OA 5EIXA 3OIWA 3PTLA 4LBVA 3TPFA 2B7BA 3H1FA 3LHIA 3BD7A 1XMOB 4MDFA 3K0CA 1EAYA 3PUKA 2VN8A 3Q0IA 5AR1A 3RHTA 3Q7EA 2ZSKA 3TTWA 3DMYA 1R8SA 3LNTA 1E9VA 1U6JA 2YH2A 3ZE8A 1E69A 2I33A 3H8VA 2TMGA 5IXJA 3ZXUB 2XVAA 2QR5A 2ZI5A 3PHJA 2GLTA 1II9A 1DRKA 2WY2D 1O77A 3QE3A 3ZKWB 2WF9A 1YKSA 3L06A 1W36D 4MX8A 5E3IA 2W8BA 2CE2X 2ECPA 1CE8A 2XUKA 3EZGA 4RY0A 1KAQA 3EYAA 4QJ4A 4P92A 5FTMA 1LX6A 4H18A 2O1WA 1WVIA 2ENUA 2VP2A 5LOVB 2B8TA 3A26A 3R5SA 5E7QA 4H7DA 2GVDC 4YRSA 1MDFA 5TQ0B 5IAAA 3PKZA 3NHSA 3ZXIA 1SCQA 1L6IA 4LE1A 2HIAA 1A95A 2BJHA 3I0NA 3KJZA 3QVGA 4UC0A 4N7JA 5C18A 3EZNA 1K6MA 5LMCA 1OXBB 3T3PB 2E82A 2IZ7A 3CC8A 3N0TA 3FZEA 3ZHBA 5LP6B 4C7BA 1R6VA 5AKXA 2Q9BA 4DMFA 2XQFA 3FNGA 4ML3A 3JQ9C 1UZMA 1PVOA 1JHZA 3A4NA 5FPSA 5J1TB 1KEEB 2EEPA 2QVCA 2A14A 3OZUA 2WHXA 3AJAA 2IEBA 4BE7B 2I5PO 4XB1A 3DQQA 4RIGA 3LUHA 3CLUD 3UAXA 1UAAA 1ST2A 2XIQA 1R4ZA 3ESDA</