2VZ0A

Pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066641
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
publication title Development and Validation of a Cytochrome C Coupled Assay for Pteridine Reductase 1 and Dihydrofolate Reductase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vz0A00
1EVYA 2QHXA 3WFJA 1PQPA 3AUUA 1E3WA 1PJBA 3K92A 4R69A 4Z9FA 2GZ3A 1D3AA 3KBOA 1DIGA 1ONOA 4DQXA 3OQBA 1GFSA 1DBVO 2NTJA 1F17A 1HLPA 5DOVA 3WYCA 1Q2XA 2Y93A 3OIFA 3ENKA 2JCYA 4TRNA 2DBVO 4ITUA 4DBVO 4CM9D 2VUTA 4NFSA 3JQ8B 4BIIA 1G0NA 4IMPA 1PGNA 1U3VA 2PNFA 5EJ2A 3H9JA 4A7PA 3ONEA 4NFYA 3UICA 5JYDA 3GMSA 2BD0A 1NWHA 4R16A 1PEDA 3SEFA 1XR3A 4CUZA 1NR7A 5C3MA 2JAPA 4BMVA 5JDIC 4YT2A 4XRRA 2RAFA 2UV8A 1KYQA 2VHXA 2AMFA 2GO1A 1R6DA 3IIEA 3HN2A 1IPFA 2V7PA 3KYDB 5C5IA 4GVXA 4GAEA 4JGBA 3WB9A 4B7CA 1SEPA 1RM3A 3CMCO 4JK3A 3ZI0A 2BH9A 5T6BA 1ID1A 4GX5A 2NVUB 4CM8B 1IOLA 4CLOA 1E7YA 4BL5A 1DAPA 2X58A 4ALIA 1C0IA 4NJMA 3GLQA 3JD4A 7ADHA 5H83A 1QLHA 3QP9A 1H5QA 4AJNA 1GUZA 1FDUA 5IFLA 2EP7A 3HB4X 3KEOA 4FOOA 6LDHA 5J23A 1LLDA 2FPGA 3GQVA 3OSUA 4TKMA 1M76A 3DBLA 4HX5A 1F14A 3O03A 3K8ZA 1TB4A 2C59A 3GZ4A 3RUAA 1DLJA 5F1PA 1E5LA 2AQIA 3KUXA 1KEPA 1LNQA 2J6IA 3D4PA 4IINA 4UREA 5JW6A 2VYNA 2GPTA 2JFFA 2B0JA 3NT2A 1N1EA 2I3AA 2NU7A 3ZWWA 4KUGA 2JJYA 2X9VA 1AHIA 4K26A 3ZWAA 4RF4A 4RVFA 2Y1DA 5F1KA 3CKYA 5KCZA 1EE2A 3ASVA 1DC5A 3WGQA 1IL0A 1BDBA 1WVGA 3NEPX 3JQGB 1K3TA 3EY4A 4JBIA 4PG5A 4AJEA 3R3SA 4XD2A 5FYDA 1L7DA 1DEHA 2DUUA 3DZBA 4XGIA 2C7GA 2DKNA 4J16A 4PN3A 1ML3A 1IYZA 1Y6JA 1P0FA 3E9MA 3QLJA 1DC3A 3PRJA 1WAMA 4DTIA 4IGFA 2G76A 4I08A 4Y6RA 4BNZA 4DPLA 1DJQA 1LDEA 4OSOA 3F5QA 3NT4A 3H9QA 2YJZA 2BFMA 4TVBA 4QUKA 1B15A 2UUPA 4GMGA 4I9UA 3O4RA 4LSWA 4PLGA 3DBRB 1KBZA 5FWNA 1K6XA 3COSA 1C1XB 2NWQA 3IP3A 5B37A 3QWHA 3AI1A 4Q3DA 3LDHA 3OIGA 1U5AA 3RCBA 5U1PA 4E33A 2O3JA 2PA3A 2Q3EA 1U28A 1E77A 3DMYA 3WMWA 4KUEA 2XPCA 4YBZA 4YQZA 1ISHA 2P5YA 4YJGA 2EV9A 4YJFA 3QHAA 2FR8A 3ROQA 3FRJA 4D0SA 2J3HA 1HTBA 2WYWA 1PJ2A 2V65A 1NHWA 1M2WA 1LX6A 3C7AA 3PJGA 5JC1A 1Q0HA 3CXRA 5JDCC 1EDOA 3ZV6A 3OM9A 4BNXA 2X8LA 1WZEA 2Y66A 3I9JA 4XZ3A 3QWAA 4J90A 4R1UA 1HYEA 2PD3A 4H3VA 3U4CA 3CH6A 3RVDA 3K31A 2I99A 5CAEA 4MVJM 5A3JA 4WKGA 1XEAA 1Y5RA 1I33A 2WJPA 3WDSA 4OXNA 3E5RA 4ALNA 4AJKA 1R4NB 1T2FA 2DUWA 4A10A 5B4VA 1ISGA 2GLXA 2CF6A 3AI3A 3PHLA 1I5RA 1HSZA 3BA1A 4W7IA 4HV4A 1E6UA 3FWZA 1FXSA 5A9TA 5BNTA 2C7VA 4K9DA 2PD4A 4XGKA 3P2OA 4MPDA 4FJ0A 3EMKA 2PWZA 1YOVB 2JD0A 4HFNA 3GA0A 1AXEA 3HFSA 4RVGA 1V3UA 3WTBA 3IUSA 4J4HA 1OI7A 1P1JA 1E5QA 2YFHA 5CPFA 2DQ4A 1IB6A 4D0RA 4DIFA 4U6SA 4BO7A 2FSSA 2GSDA 2XOXA 2C54A 1P3DA 3IAHA 4MVJF 4UEJA 1KEUA 4MOWA 3RC2A 3C7DB 3JYLA 1H6CA 4DC1A 4W7HA 5L95A 4WNIA 4NJOA 2FPPA 1V3VA 2ILTA 4G65A 1NR1A 2GN9A 4GH5A 3GC6A 3UOGA 1I30A 1N7HA 1VE9A 3ABIA 3QVSA 4P8RA 1LUAA 4EEXA 4D41A 2QZZA 3IMFA 2CZCA 3MCVA 3IJRA 4CQMA 4BNHA 1AHHA 3BMQB 4LRSB 2E48A 2HQ1A 2FMUA 3ZWNA 4AJOA 1E3LA 5I8ZA 1T4DA 2BRUA 1RJWA 5KVCA 3LC7O 3UUWA 1E6WA 1GCOA 4DRYA 1ZO8A 3QW2A 4NU5A 1Z7EA 1BWSA 1GR0A 4NQZA 2EW8A 3I4CA 3U49A 4U0JA 5HTOA 5L4NA 4PG4A 5KNLA 3ST7A 2H63A 3OP4A 4K6FA 2AEJA 3S2IA 1WWKA 3VDQA 3SXPA 1ENYA 4R9RA 2C2YA 2ZJ1A 1DIAA 3PLRA 4LGVA 4FGSA 3PGXA 1R0KA 3VTZA 1KVSA 4DQUA 2Y0CA 3H5RA 4JQCA 4QEDA 5A06A 3DTYA 5I7SA 1YONA 2GNAA 1E1KA 2QW8A 4XRGA 3ROKA 1PQWA 3X2EA 5JDCA 5DF1A 4ZGWA 3DB2A 3ROPA 2O3UA 3IC5A 4OGWA 4R1TA 1KVUA 5G4KA 3F6YA 4NIMA 1YQGA 3AY6A 4MO2A 1MXFA 2D4AA 3RAJA 3GH3A 2JFGA 3RUFA 2I67A 2Y1CA 4NBVA 4TQGA 4CL3A 5MDHA 3HNPA 1ZMTA 1YBMA 4Z6KA 1B26A 1G0OA 4MIYA 5LDHA 4EUEA 4NBUA 4XQ9A 4NG5A 4NDNE 3INTA 3CTMA 3G0OA 1DLIA 1HKUA 1C0LA 2Y99A 4GKBA 3D64A 2V6GA 3QWFA 1GZ3A 3E1KA 1RWBA 1TI7A 1MC5A 1P31A 1PJLA 4E5NA 1F8GA 1PL6A 3RC7A 3UVEA 2YFQA 4OSPA 4GBJA 1MGOA 3F5SA 5I9NA 4IQGA 4IDBA 4BKOA 1YQDA 1IPEA 1NXQA 1HDGO 3PYXA 3F4LA 4B79A 5TT1A 2GCGA 3IS3A 3NGLA 1M67A 3F9IA 1K6JA 3GEGA 4CLOB 4S1VA 2YV3A 1ZKMA 4H16A 4XYEA 4FS3A 4NJMB 3GN1A 4WEOA 2NM0A 2B4TO 3AW9A 3BHJA 1Q0QA 1KS9A 1WMBA 1XQ6A 2QYSA 3G1UA 3VPXA 2AEMA 3ZWBA 4WCDA 2B36A 3L4BC 4XJSA 1LRJA 2Y1GA 3RASA 3VPHA 1PWZA 3GZNA 1OFGA 1SNYA 4RQTA 3EDMA 1FDTA 4IGEA 2O48X 5TJ9A 4YJDA 3W4KA 2Y1FA 3AUSA 4JJGA 4DQVA 1DC4A 2CF5A 4N18A 3S55A 3ZU5A 4CLXA 2EG9A 4I8XA 4R3WA 3L77A 3WBBA 1DAOA 4RDIA 4RGBA 2F00A 3FR8A 5DN9A 3I9OA 3K5PA 4GX2A 5A05A 1HETA 1YJ8A 3C85A 1DHRA 3WXBA 5IN4A 4J0EA 4FBGA 5GZ1A 4NZ9A 1NNUA 1MG5A 3U62A 1YL7A 1HE3A 1I32A 2WSBA 2ZB4A 5F21A 2O7QA 3I6IA 3IOYA 3V2UA 1LTHR 4X54A 4EI2A 1LLQA 3D1LA 5CFZA 1CERA 1QORA 1HE2A 4PLTA 5JYEA 4M49A 4XB1A 3TZCA 4TZTA 3E9QA 4YAIA 4XKJA 2FN7A 2JCXA 3EC7A 4KTTE 2VHZA 3WR5A 4AFNA 4BO4A 3SVTA 1C1DA 2IYPA 1M6HA 2PY6A 4HWKA 4MINA 1W0CA 2NTNA 4EGFA 1DO8A 2YHIB 2JHGA 1E1LA 4B8ZA 5G4LA 2CVZA 2BI8A 4JLWA 1WXDA 2FP4A 3FCOA 2W2LD 4MVJP 1ZJYA 3QWBA 4YAEA 4BV9A 4WLVA 3SLKA 3PK0A 5BSFA 3PYMA 3BYZA 2NADA 2DU8A 4TSKA 2VZ0A 1ZK4A 3OIDA 1YB1A 4L75A 4PLHA 3RU7A 3E48A 2EXXA 2VYVD 3I83A 3PQFA 4YJGB 4YJFB 1Q1NA 4BHTA 3QWIA 2W2KA 2X5OA 5IG2A 1YL5A 4ND1A 4P4GA 3W6ZA 2OBNA 2VQ3A 4ALJA 3QA9A 2IZZA 2EERA 3AY3A 4QQRA 3WTCA 2CDAA 2Q4BA 4E30A 3I1JA 4LCJA 1AE1A 2FZEA 4Q3BA 3VVCA 3LLSA 3G1TA 4YJHA 4EUHA 3E03A 4FFMA 2PV7A 3U9LA 3JQ9C 3ETGA 4MIOA 3V2HA 4CMIB 3FPLA 4F46A 3SLGA 2XF8A 3RI3A 4BNFA 2CFCA 4BNNA 2HJSA 2GRAA 4I5GA 4NI5A 4OOEA 3RUHA 1LQTA 1D8AA 2GGSA 3I4FA 1BDMA 1BTOA 5AXBA 3WGGA 3S2EA 4JP2A 1LRKA 2BHLA 3U4DA 5L7TA 2B5WA 4R3NA 3KOUA 3OA0A 1NQ5A 1ISMA 1ZK3A 3GT0A 4FJ1A 1KEVA 1UR5A 5IDWA 3FBTA 1T1RA 3F46A 4KUHA 3FNEA 3V1YA 1B8VA 3CE6A 3FTPA 1Y1PA 1PGQA 5ER6A 2X1HA 2B35A 5TSDA 4DLLA 1PJCA 2DFDA 4XX0A 2WE8A 1X1TA 4Y6SA 1WMAA 1XLTA 3S8MA 3CSDA 4ND3A 1X13A 2VZ9A 4TRMA 1EVIA 5L53A 1NX6A 3Q2IA 3IDSA 4D46A 3B6ZA 1LDGA 3KSDO 3DAGA 4PRLA 1Z45A 3ETDA 3UFXA 3PHIA 1Y81A 5I9LA 1HDYA 2Z95A 2C5AA 4W99A 1L7EA 4GQAA 1GL3A 1EUCA 3HJAA 1VL6A 3H65A 4CLEA 5EPOA 3PWKA 4AJJA 1KETA 3DO5A 4J1TA 1B16A 4N5NA 2W98A 1C0KA 4UULA 3H6KA 5KWEA 5L7WA 1ZK1A 4C7JA 1JWAB 1PZFA 2A35A 3SC4A 3ONFA 3H3FA 4RV9A 1GADO 5JFOA 5T5QA 2Q2WA 2Y1EA 3LQFA 4BGVA 8ADHA 3T4EA 1KVRA 3OECA 4ROSA 4A73A 3RFXA 1N5DA 2X22A 3DFUA 4QX6A 1RYEA 2OBYA 3GGPA 3RC9A 3ZNNA 4RDHA 2VHWA 3ZV5A 2YYYA 1SOVA 5G4KB 1LA2A 1XQ1A 3MOGA 4PG6A 1H0KA 4EITA 2UVDA 4FFPA 2O3RA 1L1FA 3T7EA 4P4NA 1U1IA 1D4FA 1ENOA 3MJVA 4UVIA 1GPDG 5JCJD 1HRDA 1U2GA 4MP8A 3QVTA 1NQOA 4J7XA 2D8AA 3MJCA 1GUFA 1I2ZA 4PLCA 1UXKA 2EGHA 4CUJA 3ZWOA 2TMGA 4BNJA 2DTEA 2IEBA 3JCZA 3NT5A 4JXKA 3F1KA 4OIMA 5AOVA 3PTZA 1VLLA 3DZHA 3QJ5A 3GEDA 1KVTA 1QRRA 2G0TA 2EP5A 3TFQA 1ZK0A 3U0BA 2G82A 1I3NA 1E6EA 4OO3A 1OMOA 3G17A 3AOGA 3B1JA 4DMLA 3P2YA 2X6TA 3HADA 3PGJA 3F4BA 1NPYA 5AXAA 1RM0A 1YVEI 7MDHA 2VRCA 4J0FA 4CM6A 4QSMA 4CMGA 2LDXA 5F3RA 5DCYA 4OM8A 4YT8A 1QXSA 4TWRA 3RUDA 3VH3A 4LVCA 4M86A 4DIOA 3T4XA 4CR7A 3FNHA 5BSHA 4CQLA 5IZCA 1O94A 2RHCA 3DZJA 4KTVE 4WLOA 4AICA 1XIVA 3RUCA 3FSRA 2JKVA 1YL6A 3WX0A 2HKIA 3A06A 1T24A 2WD8A 2AE1A 1UAGA 2EEZA 1E7SA 1QYCA 2ZKLA 1YB5A 1EE9A 3OHSX 3GZNB 1YH3A 1GZ4A 4ZRMA 3RFTA 3KSUA 5KKCA 4GGPA 4CM9A 3ETEA 1EEHA 1H9AA 1IE3A 3NTOA 2PD6A 1NAIA 4TMFA 3GPDG 3ZU3A 1C3VA 3IL2A 1U3WA 4Q3EA 3IJPA 4LSMA 4YB8A 3VC7A 1BW9A 4MVJD 3DQPA 1I8TA 3L0DA 3ZWMA 3EZYA 3ZNPA 5L3ZA 3NGXA 3UKOA 5A04A 2D2IA 1JU9A 5TNXA 1ZXBA 1J6UA 1HL3A 1I36A 1P74A 2OXIA 4BO9A 3E9NA 5A4DA 3U09A 3WGOA 3A28A 4ALMA 5JO9A 2PK3A 3VZPA 5KVQA 4S3MA 4WCFA 4XYLA 3C3XA 4U8GA 1C1DB 3A9WA 1MLDA 1GQ2A 4PZEA 2FSVA 4KP7A 1D7OA 4BMSA 2CY0A 5TQVA 4A26A 2I76A 1R37A 3UH1A 3RSHA 3TL3A 3H4VA 3WBFA 3ZHZA 4L8VA 5BQFA 5FF9A 1B0AA 2G17A 5DBIA 3RJ9A 4AL4A 1HT0A 1XU7A 1Y9EA 3Q3CA 3VOSA 4MKRA 4WJZA 1WDMA 3WIDA 3RUIA 3TL2A 3GVXA 5ES3A 5CDUA 2QRKA 4JJFA 3KHUA 4OJNA 3B20A 4IJVA 3C24A 3F1LA 1DSSG 4INAA 3MZ0A 4TKLA 2IZ1A 4PZCA 2BI7A 2OGUA 3EZLA 1NM5A 2XXJA 3OA2A 5CP8A 3HDQA 5KJCA 3H3JA 4B7XA 3VH4A 1H9BA 2AHRA 1LDYA 1JA9A 4W82A 2WD7A 4KQXA 1NVTA 4YJHB 1NFRA 4XB2A 1GDHA 5L7YA 2QG4A 3AY7A 1P77A 1A7KA 5FI5A 1XA0A 2PH3A 2CSUA 3ZCXA 4C7KA 2ZTVA 4JX8A 3EVTA 1EUDA 2W8ZA 4IY1A 4O1MA 2NU8A 2PZMA 4IIUA 2YHUA 1ULUA 2G5CA 3GRKA 3G49A 1NBOA 2OHXA 1VL0A 1DXYA 3OQ1A 2NQ8A 4CLHA 1O89A 3NTRA 4L73A 3E5MA 1HWYA 1ISJA 2DLDA 1Q7BA 3EHEA 2PGDA 4IJWA 4M55A 4OH1A 3V1TC 1OZAA 3VPFA 2NQTA 4BKQA 4E5YA 4R01A 2DBZA 4U5QA 1JQBA 2I3GA 1HDRA 4Q9NA 5H81A 3KYBA 4CMKA 1MP0A 3HSKA 4QO8A 1UP4A 4B4OA 4PVCA 3OETA 5CEFA 1ONPA 1DRVA 4AJ1A 1I3LA 5L40A 1KC3A 1H6BA 5B12A 2DPHA 1X14A 2O23A 3OICA 4E21A 3EYWA 1SO8A 3M6IA 3GNQA 2E82A 2GZ2A 1XDWA 1XELA 3ON5A 3BZUA 4ND4A 1KY5A 1ZVMA 4ND5A 5ILOA 5DP2A 1TEHA 1T2CA 2IYOA 4UUOA 1HDOA 2ZCUA 5CDSA 3JQDA 2X0JA 3I52A 3RJ5A 3ZU2A 1GQYA 3LYLA 1ADBA 2O4CA 4TROA 1DFGA 2CMDA 3EAGA 3QRWA 5JSFA 3KLMX 4IDDA 3UHAA 1Y8RA 2EJVA 2BFAA 4LVUA 3HB5X 1YO6A 3LF1A 3RFVA 1K5HA 2QRLA 2ZTLA 4YT4A 2WE7A 4WUVA 1PSDA 3B1FA 4Q39A 2UUOA 5DBGA 4A0SA 3R6DA 4DL9A 5KKAA 2X0RA 2WTBA 4AJIA 1SOWA 4QXMA 1OBFO 3TNLA 1QP8A 3VPSA 1YS4A 4B4WA 4F6LA 1BXZA 3RQSA 1MXHA 4BO2A 3ITDA 2GN4A 4CMEA 1A7AA 4ZN6A 4CLRA 1A9ZA 1HEUA 4RPHA 4HBGA 3WSWA 1UXHA 5I9MA 2R6JA 1O6ZA 4CM4A 3I6QA 4FQ8A 1Z6ZA 1LLUA 2PZJA 3PHHA 4XJTA 3R1IA 3AWDA 3NAQA 4CMJA 1I0ZA 3HDHA 1NFQA 4BKPA 4HKTA 5IJZA 2HRZA 1BHSA 1X7DA 2DC1A 4RF5A 4XIYA 4BNGA 3O26A 3IKTA 4R51A 4BV8A 4YCAA 4J1NA 4BNLA 4EDFA 3VZSA 4E6PA 1NASA 4IDGA 1NFFA 3GVIA 2X4GA 2QYTA 2X9GA 4JNKA 3JQFC 1LC0A 3F47A 3ZV3A 4ZA2A 1XU9A 2VN8A 4OMUA 2P91A 3DC2A 4XDYA 2HO5A 3U4IA 4YWJA 3ZWYA 4NBRA 3M2TA 3NTQA 4WPGA 3DBHA 3DBVO 3DL2A 1I2CA 3DZFA 4K6CA 4NK5A 1T4BA 2PGJA 3HE3A 2Q50A 4MDHA 5B4UA 2DBQA 4IBOA 2RCYA 4IJKA 5AXCA 3SC6A 3LC1O 4CR6A 4JBGA 3VHRA 4RO0A 4OQZA 1CDOA 4O5OA 2I65A 3U3XA 3TJRA 5CEJA 3BHIA 4MVJH 4RPLA 1BG6A 2VT2A 5COQA 1U7HA 5T57A 4A27A 4EJMA 2VHVA 2J3KA 3TZKA 4I9HA 5C7OO 4UUPA 4LMPA 3H8VA 4WLFA 1ZBQA 1T26A 1WW8A 1GU7A 1IULA 4JBHA 4HADA 4JP3A 4XYGA 3D3EA 5G0WA 1QV7A 1BRMA 4RPGA 4YR9A 3OJOA 1O95A 1LSUA 2D5AA 2ZTUA 3MJTA 1XG5A 4YPOA 5MGBA 2EGGA 3KRTA 1Z73A 1BVRA 3TF5A 3WIEA 4DA9A 3R0IA 4H7PA 3TZ6A 5BSEA 3KSZO 2YQ5A 3KB6A 1CF2O 1E3WB 3BIOA 3QV1A 4AJPA 4AJ4A 1SZJG 2P4HX 3FF4A 4WK6A 4LRTB 3AM5A 1Z74A 2AXQA 4GMFA 4ZQBA 4NPCA 5TIIA 2C20A 4JN6B 2OP0A 3NDJA 3RROA 4K1LA 1ZJZA 3KEQA 1LI4A 3KLPX 3UF0A 2BF7A 4KWHA 1DOHA 1LJ8A 1FMCA 4TZKA 1X1EA 3H7AA 4IXWA 1S6YA 2H9IA 3H9GA 1IHYA 1ZH8A 4OOFA 2LDBA 4RJTA 2Q2VA 3PQEA 4HNHA 3RKUA 1RM4A 5LCXA 2PLAA 4ZICA 3JD3A 3PJDA 4ZQFA 1E7MA 3Q6IA 1CRWG 1EVJA 3PHJA 2PH5A 1XHLA 2BGKA 4BGIA 3FD8A 2FWMX 2I6TA 3E8XA 3QY9A 5HS4A 4U7WA 1Z82A 4CMCA 3DAPA 2H6EA 3WOHA 1MV8A 1OAAA 3GG9A 4RPKA 3M2PA 4ZHSA 2OORA 3DONA 1Y5MA 3KYCA 3QE3A 3CEAA 4IXTA 4MVJG 3RBXA 1RYDA 4WECA 2HRBA 1DJNA 3JQFA 1XKQA 3RU9A 4J49A 4ZU3A 2P9GA 2C2XA 3GPIA 2BGMA 1IUKA 4J3FA 2AEFA 4RZIA 4ZD6A 1UZNA 2Y68A 5JMWA 4IQ8A 4CR8A 4J1SA 1KVQA 1N8KA 3LZ6A 1PQUA 3ZWPA 4XQCA 1GAEO 3AU8A 1MC4A 3WLEA 2P68A 3PYLA 1F0YA 3H2ZA 1AGNA 5CG1A 1I10A 3TZHA 3O9ZA 2WD7B 1PU2A 5JS6A 1BXKA 1HF3A 1NPTO 2GR9A 2ZTMA 2WEKA 3L9WA 5JY1A 3BHMA 1DIRA 2JD2A 2ZYGA 2Y67A 4OHUA 3VDRA 3DBLB 3VAZA 1U3UA 1VM6A 1P1IA 1Q7GA 1Z75A 4RL6A 3H5NA 1E7RA 3LC2O 1E3SA 4RLSA 5DT9A 1VKNA 5C7LO 2UAGA 2VNSA 4IPTA 4Z0HO 3WSVA 1O8CA 4ALKA 3JYPA 3PHGA 4R5MA 1UDAA 5JCXA 2Q1SA 2YY7A 3CPSA 4DGSA 5TT0A 3JYOA 4BMNA 1BGVA 5K6AC 2W2LA 2XXBA 1NYTA 1PWXA 2CVQA 5FFFA 1O0SA 1R12A 4WOJA 4ZVVA 1LXCA 3DFZA 1NQTA 5GMOA 4CPDA 2UDPA 3NV9A 3WGIA 2V6BA 4Y8VA 3SJUA 2IEDA 5I7VA 5DNAA 1QV6A 3MWEB 4ZJUA 3W8EA 1FDVA 3ZW9A 1W6UA 2VYVA 1QG6A 3CINA 4BQRA 5EQDA 5ITVA 3FPCA 3WGYA 1I2BA 1X7GA 3ICPA 3DOOA 4XQGA 2J8ZA 1GPJA 2NV6A 5LC1A 3HQ4O 2HK7A 2EKLA 2OO5A 1ZXLA 5DOZA 5A9SA 1SB8A 2VCYA 4LISA 4DMMA 4LMRA 4EEZA 1P1HA 1QKIA 2HMTA 4PLZA 3JTMA 1B8UA 4Z0PA 2E6UX 4Z3DA 3LT0A 5KJ1A 4W6ZA 9LDTA 3TOZA 2WDZA 1VL8A 3Q0EA 4MP6A 3ANLA 2I5PO 4GX0A 3OMLA 1T2AA 1E92A 4A2CA 2F1KA 2FRDA 4P4LA 5JMPA 3GFGA 3W1VA 3VKUA 4HFMA 1NP3A 1ZW1A 1HE5A 3TQHA 5CEEA 1NWCA 1PR3A 3ZU4A 4FFLA 4L9RA 2J3JA 4UEOA 1E7WA 1NPDA 2X9NA 5AVOA 1W4ZA 4L74A 1A27A 3GAFA 5KJ6A 1FJHA 2B83A 5T67A 1BXGA 4J91A 4J7CA 2AG8A 1SCUA 3BMCA 4CLRB 3NJ4A 5BR7A 1EFLA 2OFPA 1R15A 2P9CA 3FR7A 4BB5A 1UDCA 2GDZA 4OXYA 1EBUA 1F8FA 4CM4B 4FD3A 5IAAA 3VTFA 3I5MA 1JN0A 1DB3A 1PTJA 2FPIA 4II3A 4C4OA 4Z0TA 2QZ9A 4PRKA 4CM8A 1QSGA 5CPBA 4DBZA 4TRJA 2V6MA 4ZQEA 4QECA 3WYBA 4F3YA 2NUAA 5AYVA 4KOAA 2JD1A 4N5LA 1N9GA 4D43A 3HUDA 3INRA 1KY4A 4FFRA 5ADHA 5K6AA 3GGOA 2D0IA 2AQKA 3KO8A 3GAZA 2J3IA 3K2EA 3JD2A 4PLWA 1NVMB 3GNSA 2FZWA 3WQSB 3FNGA 4FB5A 1M6WA 1EQ2A 4IDAA 1SC6A 4M54A 4DYDA 4D7AA 5DZSA 5GZ6A 1EVZA 1H2BA 1XYGA 2O2YA 4CQMB 1DRWA 3D5TA 3IQDB 2YDYA 3GVHA 5IZCC 1U4OA 1WPQA 4ZQGA 2DPGA 3TDKA 4CODB 2DFVA 2JAHA 1EDZA 3ADOA 3EVNA 3FNFA 1UZMA 4BO8A 2E37A 1ZCJA 1GYRA 1LLCA 3RWBA 4CMAA 4DPKA 3PJEA 1DHTA 1R16A 2HLPA 3ZNQA 2BMAA 1KIFA 1LSJA 1UAYA 5EMHA 5KTKA 1PJ4A 3PZRA 3NRCA 4FOSA 4NH4A 3VKVA 1LEHA 4GGOA 2HK9A 5K0ZA 1YB4A 1JKJA 2OOSA 1P1KA 3JD1A 4AVYA 4UEKA 2G1UA 1RPNA 1U5CA 4NR0A 5JAQA 5L9AA 1BSVA 1FK8A 5G2OA 2YV1A 3H2SA 3GDGA 5JO0A 1YDEA 3DBRA 4XCVA 1ARZA 1ADCA 3JQAA 5DCWA 1G1AA 3IP1A 1B3BA 1YXMA 4IMRA 5ENDA 1UXJA 3KXDA 2D3TA 3I23A 2ZB3A 4DYVA 1PJQA 4UVEA 3ASUA 3KTDA 4YRAA 3CIFA 4J9UE 1A4UA 2NVBA 3LSYA 4E12A 2GN8A 1N92A 3LT4A 4NNJA 4WCFC 4YRDA 5C37A 5TF4A 4CL8A 2ZIZA 1JAYA 1WZIA 3AFMA 3MJSA 5EL0A 3VZQA 1JAXA 1TLTA 3ZH2A 2A9FA 1G6KA 2VWQA 2EJWA 1X7HA 1E1NA 1Z7BA 4FFNA 3MOIA 1J0XO 4GI2A 4J9VA 1QYDA 3GOHA 3I9MA 3VH2A 5KIAA 1NTOA 2B4RO 3GGGA 1V35A 3C1TA 1ENZA 3NUGA 1GV1A 2JHFA 4E5MA 3ZHXA 1R4NA 4O6VA 4GKVA 2VTDA 3AI2A 3DAFA 3PFWO 1H2HA 3ZWCA 3OQ6A 3BAZA 3M1AA 1DIHA 2JL1A 5AXDA 1X0VA 4XQEA 3RIHA 4BNUA 2A92A 4RF3A 1GV0A 4FW8A 2R2GA 3M1LA 4E4YA 3OF2A 1GZ6A 1HSOA 2IODA 5B1YA 2YUTA 2ZATA 1A5ZA 4MVJA 5TC4A 3ZHYA 5HM8A 3LK7A 4G81A 3AU9A 3L6DA 4XGNA 1B14A 1ISFA 4G5HA 3W8DA 4R1NA 2Z5LA 1QYWA 3C1AA 4D3SA 1LDMA 1ZSYA 1F12A 1YRLA 3RD5A 2GUGA 5THKA 4H15A 1X15A 2PKQO 3JQ7A 3QSGA 5ENVA 2QIOA 4YXFA 2B4QA 2VWGA 4PFJA 3TFOA 1ZUD1 3BMQA 5EINA 2J5QA 4FFOA 1B7GO 1Y9AA 4B4VA 3D3WA 5CDGA 3UCEA 1V9LA 3ADPA 4WASA 1B2LA 3U5TA 4HFJA 1VI2A 3MTGA 3DZGA 3LT2A 4M1QA 3OJLA 5L4LA 4BVAA 3EUWA 2VWHA 5ILGA 5L4SA 4YRBA 2VRCD 1LSOA 2DBRA 2O2SA 5ICMA 1ZK2A 5I8WA 3MEQA 1CJCA 3CUKA 4R68A 2RIRA 3FBGA 3OFSA 3WNVA 4GWGA 1U2DA 1SMKA 4BGUA 3JQCA 1FF9A 5AQ1A 1VKOA 1CIVA 3I9NA 1I24A 2OZPA 4E2WA 1HYHA 2E4AA 4PZDA 2HDHA 5A9SB 4E13A 1WDKA 1YJQA 2Y0EA 3PP8A 4OYRA 3ZV4A 2RBEA 1FDWA 4LW8A 3NYWA 1OOEA 5K9ZA 3JV7A 5THQA 1RM5A 1FDSA 1K6IA 1U7TA 3CZRA 3FN4A 5I7EA 3BMOA 3D0OA 1GTMA 1NHGA 3QVXA 4FIZA 4WGGA 4D3FA 4CM1A 4BQPA 1YBAA 2D59A 1V3TA 3DMTA 2W2KB 5JNLA 3FWNA 3KM0A 3DOJA 5JAIA 2X7HA 4HFRA 1CEQA 3GN2A 5A3VA 1ZEMA 4O59O 3BMNA 2QX7A 2EIHA 2GF2A 2VOEA 4RVHA 2IXAA 3ORFA 4A5OA 1ZSNA 1JW9B 3PXXA 1JVSA 4CLDA 5KVVA 2HK8A 3INGA 4PCVA 1BXGB 4BO5A 3BMCB 4E5PA 4CMEC 5KJFA 4ND2A 4PLYA 2C0CA 3DWFA 1V0JA 5IZ4A 3K9QO 2GN6A 4MVJI 4P22A 2Q2QA 3ZWXA 3SX2A 2HMSA 1YQXA 4Q3AA 3LF2A 1VJTA 1DIBA 2NSDA 5EERA 1PGPA 1I3MA 4B3IA 4M89A 2IE0A 1TT7A 4IS2A 4JIGA 1WDLA 5GZ3A 2Y1OA 1N9GB 2A4KA 2B5VA 3O8QA 4BO3A 3GVPA 2VWPA 3TPCA 3UAGA 5DP1A 1TT5A 1Y8QA 3I9KA 3WWYA 3Q9NA 3QQPA 1P44A 1TXGA 1P33A 2O4UX 2BFOA 1DRUA 3GR6A 3LLVA 1LQUA 2GYYA 3DZKA 4M87A 2FHSA 2VZ8A 3NDRA 4RZHA 3UW3A 5JAMA 4CJXA 2UYYA 2ZYAA 4IDCA 4CM3A 3MJ4A 3T7CA 4I9NA 5C7IO 2Q1TA 3AJRA 4GPD1 4YEDA 4BNVA 2ZCVA 1P0CA 3E6AA 3DDNA 3V8BA 1SBYA 1GY8A 4RCVA 2O7SA 3R3JA 1HXHA 4RPJA 4EZBA 1TA4A 2VUSA 2ZQZA 3L4SO 3C7CB 4N5MA 4PLVA 4BO6A 1A9YA 2VTEA 1LSSA 3WGTA 1PR9A 5ITWA 2ZK7A 4R1SA 2C82A 2EWMA 4NU6A 4ZQHA 4XWYA 4YA6A 3GHYA 2YQ4A 3TZQA 4KMSA 2D1YA 4TRRA 4FGWA 1OC4A 2EW2A 2GD1O 3GHHA 4KZPA 4NBWA 4MVJE 3S2GA 1EMDA 1JTVA 5IN5A 3AUAA 4E3ZA 2WMDA 4DVJA 2VYND 1GCUA 4GL4A 3MJEA 3DXFA 4BNYA 4BO1A 4PLPA 3ICCA 4OAQA 2YHIA 3AOEC 3K73O 1WLYA 3STHA 3JQAB 5DDIP 3VPGA 1N1GA 3GNTA 4BGEA 1PZEA 3EK2A 1NVGA 2HCTA 3HWRA 3Q11A 4UVHA 5JDIA 4URFA 4DWVA 5A5EA 2YZ7A 4CV1A 5DCUA 4B3JA 4WEQA 4YTEA 3E82A 4YYZA 2POQX 3B70A 3UCFA 4YAKA 1W8DA 4NFHA 3GFBA 1E7QA 4NMHA 5EESA 1CYDA 1PZHA 5JE8A 4J4TA 2HAEA 1U9JA 3DZIA 5IDYA 1D1TA 6ADHA 4L4RA 1GYPA 3RBZA 3HG7A 1EFKA 1T2EA 1UP7A 3L6OO 4KWIA 5BNFA 3WS7A 4Y6PA 1HZZA 1QYXA 2C29D 3U4HA 4IS3A 5F5NA 1MB4A 1MA0A 4F45A 3QVOA 2X5KO 2QQ5A 3JSAA 4YT5A 4CMIA 3KZVA 4J43A 4IUYA 4N7RA 4E2XA 1SPXA 1CWUA 1J49A 4Y67A 4J2HA 4R9SA 1RKXA 5GY7A 4W9NC 2PGLA 3H9EO 4RQUA 3G79A 4HXYA 2VT3A 3DEYX 4UVGA 3D4NA 3V2GA 3PFFA 3OEWA 3GUCA 2GERA 5A03A 2NU6A 1PJ3A 5IF3A 3NDIA 4CQLB 3OJ0A 4J6FA 1HDCA 1ORRA 4AJ2A 5EN4A 1JKIA 4BKUA 5FEUA 3EGOA 3E18A 4NHEA 3QVWA 3NJ8A 3OJFA 4CMHA 5ICSA 3ZNOA 3WICA 5F5LA 3RBVA 1EUZA 2BFPA 3K96A 2NLOA 3L07A 1DFHA 3UXYA 1ONNA 4FN4A 2O50A 2C5EA 3JQ7B 4GWKA 4E2YA 2Q45A 2RH4A 5HA5A 3GK3A 4CMBA 3GEMA 4I5DA 3D3WB 4NK4A 4B4UA 2C07A 4IDFA 3S1LA 5CHEA 1ZZEA 1CETA 2HMVA 3AOEA 1F06A 1T2DA 2YV2A 1BW9B 3FHLA 3GMDA 4MKXA 1P1FA 1I3KA 4FSHA 4KDEA 4JJIA 5COBA 3WJAA 3P5SA 4BOYA 2WM3A 3UN1A 4YDRA 3D7LA 3IKVA 2P9EA 2SCUA 1PX0A 3ONDA 1P1RA 5ER9A 1GEGA 1H6DA 2CUKA 1C14A 5CG2A 2FR1A 4WCFB 2PR2A 4E32A 2PKQP 4CQMD 4D3DA 4DUPA 4UUMA 1J4AA 1A4IA 3BXXA 1K0UA 5DULA 1WNTA 4M8SA 1O5IA 1PL8A 2X86A 3HDJA 3JQBC 4Z9YA 2PFGA 2Q46A 1DC6A 1EK6A 1H93A 4FJ2A 3RUEA 4FCCA 4WNCA 4R41A 1HE4A 2BKAA 1EK5A 2PKRA 3DOCA 1R66A 3WMXA 4XEHA 4LK3A 3BTVA 4YAGA 5JBIA 3KETA 2WYVA 5EQFA 1UXGA 4TVOA 3W4JA 2E49A 3BMOB 3TWOA 3EW7A 3ULKA 1D1SA 5G0TA 3TN7A 2QRJA 1GUYA 4GSLA 4IZIA 3GF4A 1AXGA 4QFDA 1PGOA 4MKZA 5A5FA 4W9NA 3BTOA 1Q7CA 3NX4A 1GEEA 2NNLD 1K89A 4HNGA 3GDFA 2RH8A 1QMGA 1QR6A 3N58A 3PJFA 4OL9A 3BMNB 3LU1A 1PZGA 4KDFA 2VNAA 5COAA 5G0UA 3CMMA 1EZ4A 1GYQA 1XSEA 1U3TA 1U4SA 2HMUA 2R00C 3OEYA 1WP4A 3PLNA 2D5CA 1Q0LA 1TVEA 3HDYA 3SBOA 2W4QA 2AW5A 1HZJA 2IXBA 4I5FA 1QYVA 4I1IA 1PS9A 1PJSA 4HY3A 1A72A 4XDZA 3GRPA 4J2OA 3BTSA 3ANMA 5TX7A 4LCEA 4FPXA 1C0PA 3ZZNA 8LDHA 1N2SA 3AK4A 3WFIA 2VUUA 3MWDB 2RHRA 4L76A 3NKLA 5IXSA 1I01A 1HDXA 3AUTA 3X2FA 2EKPA 2VOJA 5HS6A 4B7UA 3ITKA 5FI3A 2GZ1A 2Q4EA 4FC7A 3JYQA 4Y9DA 1GQQA 4JCOA 4YQYA 5TGDA 3O8QB 4XA8A 4Q3NA 4GX1A 5LDGA 1R4MA 1TT5B 1PGJA 1Y8QB 2DVMA 3PVZA 3V1UA 3TRIA 4ZRNA 2X5JO 2X0NA 1E3EA 1E0DA 1E1MA 1VJ0A 4QFCA 4MJLA 4BUCA 1MUUA 4NBTA 4PLFA 5DBFA 4BNWA 4GLOA 2YW9A 1ADGA 5L51A 1UDBA 1EBFA 1OC2A 3HHPA 1XCBA 4PG7A 1JVBA 2P5UA 2DT5A 3WLFA 1UUFA 4EW6A 4DLBA 3PQDA 2ZB8A 4R4JA 5BSGA 4YVFA 4QTZA 3WGZA 3JQBA 4L0QA 3DHYA 2HJRA 1LBEA 3AM3A 5T8KC 1IZ0A 1PIWA 4DLAA 3L6EA 3PDJA 4ILKA 2FY8A 4DXHA 3OJEA 1J5PA 1VSVA 4I5EA 2WYUA 1JWBB 2AE2A 4UVDA 2PZLA 4L4SA 5TS3A 4XYMA 1UXIA 3JYNA 3O38A 3W8FA 4E31A 1Y8RB 3JQ8A 3ZGYA 1IZ9A 2DM6A 4EJ0A 2ZQYA 1B8PA 1XGKA 3D4OA 5G0VA 4KQWA 3P7MA 2ZJ0A 1DDOA 3PIIA 2CDBA 4HUJA 1H94A 2VRBA 2CVOA 3WG9A 4BNIA 1ZMOA 4UAGA 3LVFO 4Q3CA 2NU9A 4DPMA 1MFPA 5H82A 1YKFA 3WYEA 1S7CA 4WE3A 4RF2A 2R00A 3C1OA 2NVWA 5JY6A 2O3SA 4EYEA 2Z1MA 3K30A 2O3TA 2J5KA 4MIEA 4CV3A 1XWFA 3N74A 4B3HA 4RLHA 4AG3A 5BNIA 4DREA 3KYDA 5G0SA 4ID9A 4AJHA 4OKNA 1JLLA 1JKFA 1LC3A 4RVUA 2VHYA 4PGFA 2HU2A 2TMDA 3ENNA 2H5LA 2Y0DA 2IRWA 2P4QA 2HSDA 2NTVA 2Q1UA 2NVUA 3DHEA 3VH1A 2IDZA 5B4TA 2EHDA 5JAZA 3D5QA 4XYBA 2ZYDA 1Y7TA 4MP3A 4O0LA 4O63O 3ZWVA 1AN9A 1YDWA 4WOKA 1U8FO 1T1SA 3P19A 4R54A 4XR9A 3I9LA 1EQUA 3L4BA 3FTNA 2BLLA 3K6JA 4D79A 3DHNA 1E3IA 5T64A 3SJ7A 3VVBA 4CV2A 4IJUA 2P2SA 3H9UA 4CM7A 3A4VA 1LRLA 2DTXA 3AFNA 1ZSVA 4L4XA 1PL7A 9LDBA 2I9PA 1PJTA 3DBHB 4RORA 1O9BA 4EJ6A 5F1OA 3K2BA 5I7FA 2NACA 1HYGA 3S2FA 3PPIA 5TJHA 4DC0A 1LDBA 4QT0A 3V5NA 1QLJA 1LDNA 1X0XA 2DAPA 1UZLA 3L9XA 2YDXA 4FDAA 5T8KA 5JPIA 1YGYA 3GUYA 3GG2A 3JQGA 4FR5A 2OL4A 5BT9A 4FC6A 2J5RA 3ROMA 3MTJA 3HFGA 4E5KA 4RVSA 4B8WA 2PZKA 4PIVA 4W4TA 5JCJA 3PWZA 1HDZA 1IY8A 4IDEA 2EF1A 1GD1O 4BNKA 2Y05A 1R0SA 3I3OA 3H5AA 4OKIA 4Y98A 3G3EA 4ONEA 1CQIA 4WLUA 5A1TA 1ULSA 1PS0A 2Q1WA 4CV0A 1YWGO 2JFHA 3UCXA 4J7UA 4GVLA 2EKQA 3PEFA 4YACA 3GY0A 4E0BA 1C1XA 4K28A 2AQ8A 1U8XX 4D42A 1W73A 3JQ6A 4IZHA 3RC1A 3KV3O 5IDXA 4R5HA 1DFIA 1MX3A 3PI7A 3Q2KA 4BKRA 1ZNQO 2AG5A 1LU9A 3A14A 4J1QA 3C8MA 3AM4A 5JXWA 2V6FA 3PWSA 3UGKA 2AA3A 2GASA 1V6AA 1M75A 4F6CA 4II2A 2CD9A 3W4IA 2H1SA 4WLEA 4U0KA 2DTDA 1BMDA 1UJMA 3PZBA 4BS9A 1M66A 3QIVA 3PIDA 4IM7A 5U9CA 2X0IA 5HWSA 2FOIA 1A71A 3WGHA 4Z3KA 5HRUA 3ZDFA 4U6QA 4IIVA 4ALLA 5L45A 2BELA 3JQ9A 5KJEA 3KYCB 4A03A 4XIJA 2WWRA 1KOLA 4QO7A 4EUFA 4PG8A 1NAHA 3GVCA 1SEVA 3CZMA 2IZ0A 2Q49A 3DR3A 1UP6A 5KVSA 4DIBA 3DTTA 4OQYA 1KEWA 1P45A 2BGLA 1ZIDA 4D44A 1AUPA 1HLDA 2ET6A 1VC2A 3DMTC 1ADFA 1B3RA 1MFZA 2XAAA 1JDJA 5TRTA 3WNQA 3WQQA 4PVDA 4BNTA 1YBVA 1R0LA 4P38A 1BVUA 1YOVA 4N54A 3VZRA 2X23A 4Z9XA 2HUNA 1VSUA 3Q1LA 1UH5A 2HMWA 3JQAD 4E2ZA 1PS8A 2ZB7A 3JQEA 5A9RA 3OH8A 2B69A 4GSKA 4EBFA 3TOXA 3JD0A 1P9LA 4RVDA 5JLAA 1ISIA 3ZN2A 1YE3A 4GLLA 1ZEJA 1VRWA 1SAYA 1CQJA 3HN7A 4OXKA 5CDYA 4BB6A 5IDQA 4AJLA 2A94A 5IXYA 5HBRA 1KC1A 3TSCA 1K2WA 4ESOA 4JROA 2CDCA 2OUIA 4CM5A 5U4QA 2CNBA 4YAJA 3WJ7A 4XR4A 5A02A 2OMEA 3Q9UA 4D45A 4HP8A 1KERA 3ZHBA 3LT1A 4UUNA 1IHXA 1DPGA 4LN1A 1N7GA 5EIOA 2Z1NA 3WWZA 2I66A 5CDTA 1VPDA 3ANNA 5KOIA 4IQ0A 1V8BA 1R4MB 1VJ1A 1ZFNA 2OP1A 3B1KA 3KVOA 4G2NA 2JCVA 1E3JA 2PTGA 5TLSA 4J4BA 3W6UA 3N7UA 3IUPA 1NQAO 2AQHA 2O3QA 4WLNA 5JC8A 1T25A 2B37A 2W90A 1SB9A 3HZZA 3F3SA 3OBBA 1ENPA 3GDOA 3PDUA 3RKRA 3WQRA 2FR0A 4BNMA 2Q99A 3A1NA 1MG0A 3ZW8A 4BO0A 4CUKA 3FI9A 1H6AA 3BTUA
chains in the Genus database with same CATH superfamily
4Q7KA 4R2JA 1NP7A 2RK6A 5F2EA 5H0IA 3AUUA 1N32B 1JV2B 1VL2A 1TZ2A 3R0QA 1G2OA 2XOKD 5IBRA 1T3SA 4R7GA 2WILA 2OFOA 5FTLA 1M1YE 5C2JB 2GEBA 3DUWA 4NL4H 4EPVA 3ZIDA 1V95A 1F1JA 5DTEA 1L5FA 2PKCA 4X85A 4RDXA 1MJHA 5KYKA 4V0ME 3V7YA 3ZHRA 1V1RA 3DWGA 1WB6A 3A6EA 5TB5A 2DBVO 4ITUA 1Y1QA 3TI9A 1BAPA 1SG6A 2RJ3A 3AB8A 4G0YA 4TLAA 2WT9A 3JQ8B 2C8VA 1P5FA 3LKVA 1G0NA 2PX0A 4DSAA 4QDTA 1ESMA 1JQKA 2BHTA 2JCGA 4JMLA 1IWBB 2NUTB 4A8JB 1Q83A 2PBRA 3EOZA 3PE6A 4X61A 4Q6BA 3SYRA 3BWDD 1YFLA 4C4TA 3VTKA 1UEXC 3AP1A 5FBLB 3LKDA 3ONEA 3LUGA 4NFYA 3OZAA 3R6WA 4A9AA 2XDQB 4RXUA 3GMSA 2WG0A 3GDWA 1NWHA 1THTA 2YN2A 5IAJA 1CDZA 2XRYA 1QB8A 2CZQA 4KI0A 2I2DA 2ASVA 3TRHA 3CWCA 2I9KA 4I99A 4MB6A 3FRHA 3SEFA 1FJGB 5EEGA 1NR7A 1JR3A 1UKCA 5KOHB 1QTIA 1XVAA 3GEIA 4UPVA 5SYNA 1SBIA 1FNMA 2QTTA 2RAFA 1B6SA 4EYGA 4L07A 2XMSA 1G5PA 2F48A 5EC8A 2GO1A 2C00A 3IIEA 1P0PA 3R5HA 1OTHA 2V7PA 2QTZA 3BULA 4PR0A 4XEUA 3Q8LA 1JLLB 3K8YA 4X8LA 4JGBA 4P0QB 3H8JA 4PU0A 3SX0A 1Z8HA 3OURA 1Q0RA 1YZNA 4YGYA 4LFBB 1BU5A 1SKAA 4NE2A 4R40A 2BH9A 4ZOLB 5T6BA 3ROEA 3ZDBA 1YS6A 2Q9BA 4JYBA 4Z51A 4B74A 3BGOS 3ECSA 4CM8B 2ZM6B 2O1WA 3CEHA 1CS0A 3SK0A 4KSCA 3FM9A 3WMFA 1EGHA 3W9SA 3WY9A 3OWOA 1QLHA 3QP9A 5H83A 4F71A 4MUGA 1UK8A 2F1OA 2EP7A 2WVAA 3HB4X 3OTQA 4B84A 4FYJA 1LLDA 2BBSA 1XZFA 4DJJA 2LPMA 1NONA 1T9GR 4BVFA 2WKSA 4Y2PA 3TRKA 5AM4A 1CC1S 4BZXA 1F14A 3O03A 3UANA 4ZU6X 3VJKA 5FOQA 2X76A 5C52B 3WRVA 1P9WA 1TB4A 1CCWA 3OZXA 1DLJA 2HPHA 2P4EA 2OQ2A 3K1JA 3P0RA 3SQWA 1E4EB 1KEPA 1YBFA 1WMFA 3B6IA 1U9IC 4JZKA 2CXPA 2J6IA 3D4PA 3JWGA 4OL0A 3LDAA 2ZRIA 1G4UR 4M0EA 1ND5A 3GB9A 3CW8X 4XLZA 3DKRA 2B0JA 1CR1A 5E1DA 3TPFA 3QF7A 2XQFA 1GL9B 4KX5A 5EE3A 2D74A 3EXFB 2VAXA 5HZGA 2XUOA 4FEGA 3ZWAA 2DXIA 3OPXA 5SZKB 5JD4A 2PZFA 3CKYA 4D96A 2ZZMA 3ASVA 4ZCPA 2VQSA 1F3LA 1N6LA 2JJ1A 4FIDA 3WGQA 4XVCA 4L6IA 1IL0A 1HNNA 1WVGA 3QVGB 3LXRA 4H59A 1K3TA 1PBTA 1AT1A 5I9BA 2AI2A 3TAUA 1RBMA 3EDCA 3KXKA 1K5PA 3R3SA 3HVJA 4C2AA 5FYDA 3W5AA 2VDKB 4TTRA 2IYXA 4BLTA 4HH3C 1RXUA 2QROA 3QLVA 1NXPA 3I1IA 3ONVA 3CIOA 3QVVA 4J16A 1P2TA 1IYZA 1M8KA 1Y6JA 2J5XA 2X5XA 4Y1EA 3N05A 4BEWA 4QDOA 1HYBA 5FUQA 5H59A 3PRJA 1SUEA 3RJMA 3TTWA 1FYFA 1HDEA 4OGGA 1YKSA 4KE9A 1G21A 1NN5A 2PDAA 4EF5A 1YMQA 2G76A 4I08A 4UBIA 3ZY3A 5C46F 3CVWA 4QU9A 2EKZA 3ZZMA 1LDEA 1M10A 4D74A 6REQA 3F5QA 1GG5A 2UU9B 4F21A 4ZVNA 4UHHA 1CQIB 2O7RA 4QUKA 4WACA 5E1BA 2UUPA 4GMGA 4YCLA 4I9UA 1NW5A 1P81A 4X20A 1VP9A 1XNHA 3SP1A 3DMGA 4H1HA 3MBOA 3ZLUA 3VO2A 5FWNA 1U2QA 4JVSB 1C1XB 3BB1A 3MJRA 5GAJA 2R1TB 2XYQA 3AI1A 3FF1A 4GP6A 4ZCLA 5B37A 4R8KA 4UATA 1KFEB 4TZ6A 1HE1C 3RCBA 5U1PA 5C18A 4ZYLA 2O3JA 1FE8A 3UW3A 1EHIA 1U28A 1E77A 3O5AA 4UDNA 2P67A 3PC2A 2VJYA 3KUDA 3MT0A 2VAVA 2XIQA 3KJGA 4D56A 5EE1A 4YQZA 1ESDA 4YJGA 1LVUA 4Q1FA 3P2KA 4CEHB 1FQKA 1GGMA 2QRMA 3FRJA 2J3HA 4RE6A 1IUPA 1JIVA 3R9XB 3GLTA 3CLSC 3WGIA 2ZWOA 1QP0A 2V65A 1VG1A 5SZJA 1M2WA 3KR1A 3FWYA 1NI3A 1Q0HA 2X8LA 1G4AE 6GPBA 2Y66A 4XZ3A 4J90A 1YS2X 4E7PA 5DCLA 2PD3A 3SYTA 4INZA 3CH6A 2I99A 2R7KA 4MVJM 4N01A 3WISA 1JT9A 3F7MA 3AHCA 1T4CB 5FNVB 4EF6A 2DULA 3Q85A 3RVNA 1GGFA 1T2FA 1R27A 3WAJA 3OLYA 2AR9A 3MK31 4JVOA 4CIWA 2CF6A 1QOZA 3B6JA 1VXOA 3PHLA 4QUJA 3A2KA 1I5RA 1HSZA 4PBTA 4W7IA 3K6KA 4FFBB 1HORA 4DLXA 4HV4A 4HUQA 2B1JA 4K9DA 2PD4A 1QGUB 4XGKA 5C31A 3P2OA 4WSOA 1PT8A 2OK7A 1J1UA 3EMKA 5K2OA 3IDQA 3H5LA 1AH2A 3V9AA 5TY0A 4ZREA 2Q41A 1OTXA 1GFIA 1P1JA 3RGGA 1R0XA 1HOTA 2VBGA 4JCCA 3KJNA 2HA3A 3OCUA 3SZ3A 5J4LA 4FOPA 3L4KA 1IB6A 2WMOB 1ULZA 3DBOB 1REQB 4M6WB 4CKCA 5A62A 2R3SA 1TDJA 4QFBA 2FSSA 4BO7A 2GSDA 5J1SB 4JI2B 1EDDA 4MVJF 1KEUA 1DL5A 3BG5A 4MOWA 4UU1A 5HKKD 5FBHA 1V3VA 2ILTA 2EC5A 4WIAA 1X7WB 4ETWA 2GA9A 4D81A 1VE9A 4HLUC 3ZBTA 5MN4A 1XV5A 2C4HA 1OF1A 4MYHA 3OT4A 3K70C 5AM3A 3WYDA 4CQMA 3UA3A 4LV6A 3UB2A 2E48A 3NIWA 4NMLA 1L8OA 2FMUA 2I8AA 3GYGA 3IBFA 3I0ZA 4QVKA 5I8ZA 4N0MA 4GIBA 5K8LA 1ZOPA 3LC7O 1XZKA 2BT4A 1VE3A 3SHWA 2MMGA 3YASA 5IM4A 3ZWCA 3H11A 5AKKA 1XZ8A 2OVFA 4S35A 3JALA 2LBPA 1TVKB 2B34A 1UQRA 3NM4A 4U0JA 3WGMA 4PG4A 5HTOA 2V7QD 4HQOA 2V97A 4MQEB 4RPCA 3HYSA 2OHIA 5F3DA 2AEJA 2AN9A 1T43A 4MYTA 3D6AA 1WWKA 3SEAA 1CP3A 2C2YA 2ZJ1A 3V97A 3RF6A 4UM8B 1KGDA 2CL0X 1CD5A 4HDMA 3AH8A 3E7FA 3PGXA 1R0KA 1BHQ1 3VKFA 4DQUA 2EAUA 5ILQA 1OXTA 2ZRPA 3FOAA 2FW8A 3ZKAA 3ZJTA 3H0EA 1KBOA 1P6XA 2OHOA 4HATA 2JLSA 2J30A 5AI6A 4Q4LA 2QW8A 2OUKA 3VR3D 3TVTA 2C42A 2C4UA 4YRIA 1EFTA 3B36A 3DB2A 2O3UA 1URPA 1KFCB 4OGWA 4WNAB 1P4AA 4FT2A 4XX1A 1DAHA 4LOIA 1MEJA 4NIMA 1NBHA 3AY6A 3UMSA 3QKWA 1U8YA 2OXRA 2ZS8A 2G9NA 4Z9BA 1GGVA 2XTZA 3GH3A 4D82A 1CJKC 2JFGA 4R83A 1CVIA 1X9GA 2I67A 4N4AA 5G1NA 3SY8A 2QTNA 5AW9A 3H0CA 4US2R 2HCFA 4QYIA 4JS0A 3HNPA 2A0YA 3H9CA 3VR4A 2RGEA 3T9EA 5CBPB 1B26A 1G0OA 4Y2VA 3VR6A 4ZFNA 2HA0A 1Z12A 1JHUA 2JEOA 1MTOA 2NAPA 5GVRA 5DSTA 1QFSA 2CHFA 3CTMA 1QQ7A 2WAOA 3A9SA 3D64A 1WMDA 2V6GA 3PXAA 4JI7B 3T3NA 1GZ3A 1J7JA 3ZOKA 3E1KA 1J9EA 3GMIA 1YCDA 3K4QA 4OJMX 1Z2EA 2QM3A 4FQ5A 1JEEA 2JGDB 4UAUA 1LTKA 1P31A 5AW1A 3LFUA 3THSA 3T34A 5HRAA 4KQ9A 5GJBA 3OESA 1BGXT 2PZAA 2PLNA 3UVEA 1D7AA 2WIFA 3MTBA 2FW9A 5I7AA 2BVNA 3K1AA 1LH0A 4YRPA 4OGLA 1K63A 3M5CA 1HDGO 4IOJA 4YDQA 4B79A 1JEQA 1MMFB 2J87A 3B2QA 4XFJA 1BMFD 4N6NA 1LGYA 5E2AA 2VF5X 3NGLA 1M67A 3CW9A 1WHSB 1G3MA 1K6JA 1WRBA 2PE5A 4E3WA 5CLJA 5HP4A 1BD4A 5AM0A 4FKBA 4H16A 2A6PA 1QCCA 4MGZR 4PSVA 3KKMA 3Q2OA 2ZR9A 3E2PA 3G1UA 1L5NA 4CGZA 3DMDA 1LZLA 1QK3A 2FPGB 4JAVC 3RFFA 3AESA 5D6NA 1IBSA 1JDNA 2KMLA 3BJRA 3AEQA 1OFGA 1X80B 2IELA 5CNKA 1DGQA 4US0R 2FCAA 1P1BA 5K8CA 1N0IA 3T5GA 4RX1A 5BSTA 3E3LA 3IHKA 3W9BA 1RYZA 4D5EA 2XTMA 1AS2A 3AUSA 4JJGA 3LBHA 4WVLA 3B60A 1DC4A 4N18A 4M9QA 2EG9A 5C1IA 4R71A 5JD5A 1BOFA 2NU7B 2IPLA 2OC4A 5KTOA 4OB6A 3CGGA 2WHPB 1QO0A 1G8AA 1QNLA 1DG3A 1OVGA 2CLDX 1Z56C 3FR8A 2OTCA 3I9OA 1RZRA 2RJOA 5EIWA 4NONA 4P36A 3LLUA 1ORVA 4MRMB 4F5EA 1NNUA 1NMEA 1U90A 2IOFA 4UQPA 3DCNA 3W6NA 1HE3A 4B32A 3RVRA 3I6IA 3I2YX 1C5KA 2RIPA 3CF4G 4E1VA 1LLQA 1DI0A 3D1LA 2YJ4A 3FGZA 3ER8A 4RJKA 2W4MA 1QORA 1A3CA 4GE0A 4Q1CA 1L1RA 5HX7A 5JYEA 1ZR4A 3MTDA 3W9YA 4UBKA 4B3BA 4BWVA 3PDCA 4YIHA 1M1NA 4YAIA 3RS2A 1OXVA 3ZUGA 2JCXA 1G3IA 3EC7A 4KFRA 1IZYA 4YJ3F 2CNWA 3WR5A 2RJNA 1P5JA 1C1DA 4C2BA 3SVTA 4HL6A 3TQQA 3WGJA 4TT8A 2FJPA 3U40A 1W0CA 2ZI6A 1WB9A 2NTNA 4EGFA 2YHIB 3C43A 1D2MA 2AYZA 4UNSA 2VJBA 4ZIRB 1EVQA 2E4WA 4B8ZA 3L5OA 4YO8A 5G4LA 3TQOA 1Z0DA 1IPHA 2BI8A 3CB2A 1WXDA 4J2TA 3FCOA 2W2LD 3BWBA 1YV9A 4WDQA 4U3JA 1JLMA 3FCEA 4GBED 4LJLA 1HFEL 2XZDA 3SLKA 5IC5A 2G9RA 3L1VA 3UY4A 1J2EA 2JIZD 1GXSA 2FVXA 3PK0A 2AOTB 2GFHA 2PKYX 1DVRA 3BE6A 3OMWA 3PYMA 4NSNA 4TYQA 3ZK9A 5AW4A 1IXRC 3PUJA 4UHCA 4CG1A 2FYTA 3G85A 3L6UA 2QVGA 2VZ0A 4UTNA 1YB1A 2ST1A 3GEBA 5CIYA 1ZGZA 3RU7A 2VYQA 3GFRA 8ABPA 3I83A 4J8PA 4XARA 4YJFB 2L42A 1UFKA 1M2OA 1T1JA 4BHTA 4MWTA 4DHEA 1AQJA 1JIXA 1YL5A 4ND1A 2NTYC 3PD0A 3BFPA 4B83A 1VXRA 2C31A 2VQ3A 4GG1A 5SY6A 4ALJA 4AN1A 1S8AA 1U63A 3AY3A 1SR8A 1XLUA 4MSUA 4NEHB 4LCJA 2RHTA 2NNWB 4HDCA 3RREA 5B1SA 2HMYB 1PT6A 3X1ZA 5AK4A 2M6SA 4O4LB 5IAGA 3SHTA 3G1TA 2BCGY 2NYUA 4G24A 1KF0A 2JZNA 3B8EA 3FDXA 4YJHA 5CAEB 4FFMA 3P9CA 4C4SA 4EUHA 3G0GA 2PV7A 4EYKA 5BY2A 3NVMB 3JQ9C 1SD2A 4K8OA 3VVMA 1KJJA 4YLEA 1NRJB 3DEFA 3FPLA 1KSGA 4F46A 2XF8A 1B41A 4RSGA 5CB6A 5M04A 1UBUS 4U9IS 1KMHB 2CFSA 1XPJA 4PCAA 4I5GA 4FYWA 1X7XA 1U2GC 1ZW6A 2X6RA 2PIDA 5GWXA 3RUHA 4EKIA 5I4KA 2BMDA 2ZBUA 3BCRA 2HF8A 4D4GA 5AXBA 4KH1A 3WGGA 4YMLA 2H1OA 3OQOA 1LRKA 2GTHA 3PQ8A 3P9ZA 4M9UA 1WXFA 3KOUA 1RWMA 2F62A 5IH7A 2P9ZA 4PX2A 3INYA 2C94A 5ADWA 3QQ5A 3F0TA 3MCZA 2A1UB 1XZCA 3U44B 5IDWA 3CRZA 3AUFA 4EWLA 1JBEA 3W05A 3SFTA 2FZKA 2I3ZA 4K05A 3S8YA 2H1HA 3CE6A 4U7HA 3RE1A 1T0BA 3PC6A 1E64A 4AKEA 1XXHB 3EIQA 4HDRA 4CHTA 1HT3A 4QQFA 5TSDA 1XROA 1UJ6A 3N2GB 3OEED 1XTZA 2X2OA 3G8AA 1ESEA 3I30X 3S8MA 2IEGA 3CSDA 2KI5A 2HIAA 1FFCA 2FNAA 3CG4A 2H4JA 3NATA 4YFYA 3QEAZ 1P0IA 2G83A 1YR2A 3GJXC 3LUFA 3VDXA 1OB5A 3OE7D 1FPQA 4P08A 5DE3A 1QPGA 2ZI4A 1SD1A 3DAGA 4AZTA 2HHJA 4LJ4A 1EWTA 4W99A 2QG9A 4GQAA 2A8YA 5JAOA 2YASA 2JFZA 2AFHA 1QVVA 3BIXA 3TUIC 4N9QA 1ECJA 3R76A 1D6JA 1RP1A 2PSFA 2R60A 3O8OA 1WJGA 2ZG6A 4FFWA 4GVPA 4I4TB 5EPOA 4KAAA 3SFVA 1GA1A 4DF3A 1GSAA 1OFVA 2GH1A 3DO5A 5CYGA 2HK6A 3MA0A 3UBMA 2FPOA 3UT6A 1FMLA 5TVGA 3U60B 4N5NA 2FEWB 5AVZA 1N5KA 1NVXQ 1XWIA 3W5HA 3TSAA 3RODA 4UULA 3H6KA 1K97A 2N75A 5CB8A 3J7TA 2RGGA 1ZK1A 3EGDA 3HV2A 3OEHD 2VSXA 3ONFA 3PHCA 4KQEA 4RV9A 5JFOA 1E6LA 3U19A 2Y1EA 4BGVA 1T3TA 2R2AA 2B4AA 3T1OA 4EJSA 1Z0IA 1KVRA 3D43A 2ANBA 3O3OB 3RFXA 1MD9A 2C0QA 2G77B 4RHYA 5DLPA 2D7CA 2FAXA 3RIMA 3ROGA 3DVAB 1NRIA 2OBYA 2Q3HA 1ITZA 1N8NA 3ZNNA 2FFBA 1KOGA 4RDHA 3VNUA 4CG2A 1IBCA 2WF7A 2QR3A 1TMGE 3QK7A 1G5HA 4C89A 3RTBA 4C0HA 3RO7A 2JRCA 1YVPA 1G8GA 2A1TS 2BKUA 4WJLA 2UVDA 1E59A 2O3RA 3BMXA 3KJIA 1L1FA 2G67A 3T7EA 4P4NA 5LU9A 3OOYA 1D4FA 1ENOA 3MJVA 4KXFB 1GPDG 4WZBB 2JJQA 5JCJD 5FV7A 1L7XA 2HJ9A 4IG9A 2HWUA 2FSVC 5AI0A 4GO1A 3EB9A 4QLAA 4J7XA 3BK1A 3AL3A 3FYTA 2YJ5A 3GLHE 2EGHA 3PXEA 5ICGA 1MO4A 4HDKB 4UBOA 1OBCA 2TMGA 2YVAA 2PAAA 2VAWA 3JCZA 4ON9A 3GCDA 2RHDA 1SXJB 5CRIA 4QUAA 1JDSA 3AO0B 3DZHA 3T0IA 3QJ5A 1QRRA 1BU8A 2GI4A 3B13B 3DO6A 3HA5A 4QOJA 4YROA 4A92A 3NVAA 5JCOC 2EP5A 1ST2A 3QELA 1KTIA 1J8FA 4RMNA 3WAGA 2WOOA 1FZTA 3Q3IA 5CFOA 1I3NA 1ZD9A 4GKKB 4MV5A 1E6EA 4RTNA 3LKBA 3B1JA 3V4VB 3HADA 4ERXA 1RM0A 2ZI3A 1E0SA 2V8OA 1UMDA 2I80A 4Q18A 5BORA 2INGX 2QRHA 3JS5A 4YT8A 5DCYA 1L5HB 4MKFA 4H60A 1NX9A 2NQ2C 4TWRA 2YJ3A 3KX2A 3RUDA 1MX1A 4KKXB 4HH4A 2CK3A 1BD3A 4KYVA 3L1KA 3MNFA 1NM5C 1H2YA 1N1MA 4AYTA 2WRZA 1CY8A 4CQLA 3TUZC 3EISA 4C0AC 4WLOA 5L3SB 3L7BA 1BFUA 1T6ZA 1XIVA 3F74A 5I7OA 2VP5A 1WUTA 2XOKA 4C03A 2VATA 3ZZ1A 2JAOA 3EPKA 3WGUA 3LQKA 1KI7A 1O3YA 1T24A 3QXCA 1KEEA 2HGSA 2M1XA 5EEHA 4XWKA 2V7XA 3QVLA 1QYCA 2BM9A 1I9GA 4BLWA 1J0EA 1P7VA 1T5BA 1YB5A 2QDXA 5BSVA 1ELOA 3THOA 3GZNB 1EAMA 1KHTA 2WA1A 3MTEA 2OSBA 4ZRMA 3FOBA 1YC5A 1RJ9A 1WULS 5EQJB 5FX2A 2D5LA 2ERXA 3K72B 3M6MD 4IIDA 4XIGS 3ODGA 5BYJA 1W6RA 3RBAA 4KN6A 5IJWA 1NLYA 2ZEJA 1NYRA 3DE7X 4S24A 5E1MA 1SCQA 2W43A 1KH1A 1INLA 4AKGA 3AVOA 3VYUB 1EJ0A 1NMSA 4D25A 3EF0A 3ZLTA 4ER3A 4DA4A 1X77A 1KI1A 2OGSA 3SXJA 1JHAA 1RXSA 3Q5DA 4YP5A 5ALEA 3VSCA 2ZUWA 1T6BY 4Q3EA 3IJPA 1F4LA 1FMTA 1JILA 4LSMA 2I8LA 3M81A 5DKFA 4MCIA 2H4WA 4MVJD 2COKA 3DQPA 3TTTA 5FHRA 4C7OA 3FWKA 3ETNA 3FPEA 4B3SB 2PEYA 5C4GB 5K99A 1Z08A 1BHO1 4MMYB 1OWNA 1JU9A 1TE2A 3WA6A 4BFLA 1ZXBA 1J6UA 1HL3A 1P74A 1ZWKA 2OXIA 5A4DA 5IKMA 3THWB 5E4FA 1L7NA 2DSNA 3CUUA 3U7RA 4ZDIA 1DTWB 1WUYA 5ESWA 2H5EA 4S3MA 2ROQA 1RCFA 5KUTA 4CKWA 2H11A 4XYLA 1SVNA 1EHYA 3K0SA 3A9WA 3PCRB 5HILA 1MLDA 3BM5A 5C8YB 4KP7A 4M1ZA 1HNWB 4YR7A 1K7FB 2P6UA 3RSHA 2NGRA 3K9BA 3DE2X 3GP8A 4XVHA 3H4VA 3ZHZA 2JW5A 4EI8A 3QHQA 4DSOA 4DDWA 5JBNA 2FP4B 2XDYA 3D7SA 3HM9A 1U3FA 1UQUA 1SA0A 4R2WA 3D2LA 4C43A 2G28A 2G17A 3L82B 2J45A 4DS3A 5E7JA 2GBFA 1VBMA 2GZMA 4RUKA 3NM6B 4AT1A 1B76A 4E5UA 1SKQA 1RIIA 4YDSA 3KE9A 2I33A 4V0NA 1P60A 2MMCA 4NYMR 3IR5A 4IJVA 3NH6A 3SDBA 4HAXA 4BDTA 1AB5A 3B9BA 2H1LA 3C24A 3SFZA 4JQOA 4PYLA 1ZR2A 3OO0A 4NS4A 3L6CA 4JGGA 4P35A 3VPBA 3LDUA 3VU9A 5K0JA 4GOJA 4AZVA 3T9BA 4LRUA 3REQB 3H18A 3ZUPA 2JFYA 5REQA 3OA2A 5CP8A 3HDQA 3IUMA 3SIPA 2JLXA 4B7XA 3LUBA 2CHGA 2VF8A 2LIVA 4AG5A 2BM8A 3HKBB 3ED1A 2QTWB 4Q47A 1JA9A 4NZOA 5LKAA 1NFRA 1EFVB 4IGIA 3UJ6A 5HKBA 2QG4A 4U2CA 1SUDA 2GKOA 3RSGA 2BEVB 1D07A 2YW2A 4LPSA 4NH0A 3JWJA 3EVTA 2FP3A 4O1MA 2NU8A 1XEWX 3P8ZA 3QYJA 1E1RD 1ULUA 2G5CA 1O7JA 1NBOA 1J23A 2BZSA 2Y9MB 3HJUA 4KN9S 5J2UB 1X9HA 3EX7C 3VFDA 2PGNA 5KCMA 3V2IA 4LX0A 2OHVA 2NQ8A 3MWDA 2H2AA 2ZRDA 1VBKA 4CLHA 3EC1A 4PIPA 3QE2A 2YRXA 1ISJA 3ORHA 1EVLA 1R88A 1FW8A 1EP3B 3EHEA 3IT0A 2BZ1A 3V1NA 3IPAA 1KE2A 3VR1A 4HQKA 4X6XA 5CFLA 3A1CA 3H1EA 4R01A 5I51A 2DBZA 4LMBA 1JQBA 3D6TB 3OCZA 4U5QA 3I72A 1I1NA 5H81A 2ADOA 2X1VA 1CY1A 1MP0A 4FILA 2IZOA 3HSKA 5BN4B 1VYTA 4B4OA 4BQIA 1CEEA 4XDHA 3DYVA 3GLFA 4GEKA 3AILA 2BFNA 3SE7A 3LECA 1MF7A 3KQWA 1A9XA 4JEUA 1UBMS 4AJ1A 1I3LA 2Q6TA 4X66B 4OMFG 1H6BA 1UWCA 1ZNYA 3EGEA 3K6RA 4OD0A 3V34A 1CQPA 4NBLA 2I34A 3TNDA 4B3FX 2FZGA 3PDIA 2ZETA 3OICA 3P9NA 4IOLA 3ND5A 2JGFA 1SO8A 3BXOA 1G7CA 3N5CA 3WHLA 2UUBB 1AGRA 1ODKA 1J21A 1NLZA 4PAWA 5JQGA 3S2SA 2H5IA 2QU7A 1TEHA 5K0SA 2BRUC 1R0WA 2YVKA 3BCUA 4FUTA 2IYOA 3VMMA 1H5NA 1M7GA 3T7AA 4HDSB 4UUOA 5BT8A 1KAEA 2ZCUA 5FPTA 3JQDA 4GZMA 3TTSA 1G2IA 2HDWA 1Q7TA 4GPEA 4QIHA 4TROA 4RJLA 5EG5A 1DFGA 3SKYA 3KLMX 1U2RA 3IQXA 4PR3A 2QKYA 3ZH9B 4V24A 1W49A 1YHNA 3FTCA 3LY9A 1YMUA 4BFYA 2H92A 1Y98A 1ODIA 5BVHB 4LF5B 3IERA 3JAWA 2UUOA 3ZXXA 5J43A 2JHAA 2WWVD 3VPFA 3R6DA 2C92A 5KKAA 4DL9A 3PR1A 4C05A 2R96A 1PQYA 1U6KA 2FWPA 4POAA 1CNFA 4UAJA 2ONZA 3VUEA 3C16C 2D0OB 1BCSA 1I7PA 2TRSB 3PFHA 5CLGA 1MGPA 3TNLA 1QP8A 2JAWA 1YS4A 2XODA 4Q21A 1Z7YA 3X1JA 4B4WA 3O9MA 1XU4A 4M9XA 3K9FC 1K7XB 3G0CA 2IYZA 3AKDA 1XN4A 2Z9CA 3SMQA 4RTSA 1L2TA 1K9SA 3R8CA 5I01A 2GNOA 3V1LA 1OYWA 3D4BA 4URXR 1TMKA 2VAPA 4ZN6A 1KP3A 4CLRA 1A9ZA 5TMDA 3VZBA 2QM8A 1V8FA 3C8ZA 2C5BA 3QF4B 1O6ZA 4CM4A 3Q7EA 3IEXA 1KI6A 1QGZA 1EXNA 1Z6ZA 2H48A 2IKSA 3BILA 3FJOA 3K0BA 3LQYA 3Q9LA 1RXEA 2Q29A 1TF2A 4Q82A 1J56A 4XJTA 3DHWC 4RY8A 2OGZA 3G68A 5EUMA 4N5HX 4HQRA 2B4KA 3BWVA 1TGYA 2D7JA 3OZGA 4PGHA 2ZIUB 2O14A 4BEBA 4DLYA 2FN3A 1CUJA 2WT4A 3KUCA 4L9AA 2N42A 3GRUA 3TTXA 2FN9A 1NFQA 5IJZA 2HRZA 1X7DA 3LM8A 3A31A 1OI3A 2XZOA 1F60A 5EJ5A 1FC0A 4EDFA 3OLXA 1NUSA 1UIMA 1YI1A 4U7TB 3N7AA 4RHEA 1BX0A 3GVIA 3W0LB 2SKEA 4ENVA 5J4YA 1Z8NA 1LC0A 4CWAA 2DRIA 1V6CA 3M9LA 4LNUB 3EQZA 2WKRA 2CL7X 2EFJA 2V7WA 2V7QA 1QIGA 3DC2A 3VX4A 3ADDA 3OOHA 5K4HA 1IN1A 2IYUA 1OXMA 3U4IA 3BWXA 1RP7A 5DX0A 1U8AA 2VJOA 4NBRA 3M2TA 3RSSA 2GEKA 3N3AC 3DBVO 3DZFA 3H97A 3WNDA 1CSEE 4MQMA 1T4BA 2PGJA 4OFWA 2Q50A 3QYAA 1R5BA 1R0YA 4LIPD 3DE5X 2H65A 4OQZA 2YFKA 2B3DA 4HAZA 2B7BA 2I65A 4IOKA 4O5OA 3U3XA 4MVJH 3VR3A 4N76A 4NPHA 2VHUA 4GKJB 1U7HA 3QPAA 2WJ3A 3ILXA 4A27A 2FKNA 2EKBA 2VYFA 5CW1A 1DELA 2VVTA 5EIBD 4OJQA 5IC6A 1T26A 5LYJB 5FXMA 1WW8A 5FOWA 2ZRHA 4ZVMA 3BJMA 2GTIA 3IR6A 4JP3A 5AQEA 3BRCA 3D3EA 4O4IA 4Y2UA 5JTUA 4CRWB 1BRMA 3IPXA 5FWXB 2VTVA 2YXDA 4QDKA 5JJLA 4P3NA 1KPGA 4C7XA 1AV7A 1WSBA 2BDTA 3KRTA 5AKZA 3DT6A 4BC1A 3KZCA 4ZJYA 4HYEA 2Y4OA 4TYPA 3SF0A 4H7PA 4TV8F 5D5PA 5IUKC 3GEPA 2YXBA 2E89A 3KSZO 1T5SA 1ZHHA 2GCOA 3AERA 4LNHA 1KWKA 3KB6A 4LQLA 2FXIA 2Z57A 3GI1A 3L7LA 2YKGA 4WWHA 1CS4C 1OYYA 4AJ4A 1SZJG 3OCCA 4FXPA 3EPHA 1CRZA 1P62B 4ZQBA 3ES9A 3EOAI 3CEMA 4FMCB 3GGJA 4NPCA 5BOVA 5TIIA 3TVYA 2C20A 4PICA 2HPAA 2SBTA 2B21A 1RZUA 2OP0A 3NDJA 5KYXA 4CTJA 4PCLA 5AOCA 1LI4A 4MS1A 1H4QA 3KL4A 5JJIA 1DQPA 2BF7A 4KWHA 4V0KA 1X92A 1LJ8A 1PEAA 3RVMA 4K46A 2REXB 4AO8A 1FSGA 3AEZA 3M6LA 1S6YA 2H9IA 3CY6A 3H9GA 1ZH8A 3MC1A 2LDBA 3EEOA 3GA7A 5FOXA 2GYVA 1LJUA 3LCJA 2IVFA 1RLTA 1AKEA 4N3BA 3RKUA 4NCHA 4TXLA 1XHFA 2Z04A 3A6LA 3U5ZB 5LCXA 1ZI9A 1DXHA 2ZWIA 4HGOA 3RAGA 3C8HA 2BLNA 2P2DA 4F9GA 2SNIE 1BMFA 4WOPA 1QO9A 3TM5A 1KYTA 1XHLA 3MUOA 4G1FA 4BGIA 4BZPA 4LTNA 1G7TA 1AKTA 1Q6ZA 4CCAA 4CMCA 1TPYA 3DAPA 4DA8A 1T8UA 2XT0A 3KFLA 2Q7XA 2ZUCA 1JXAA 1OAAA 2M6LA 4LQDA 3M2PA 4YS6A 3CRVA 3NEJA 2FXVA 3QE3A 1E0AA 2VIIA 1I6MA 1J9ZA 3CEAA 4O2AB 3TFWA 4IXTA 5B2EA 2UZ4A 2EIXA 3W5VA 1DJNA 4EGJA 1XKQA 4IKPA 2I6GA 1M1UA 2C03A 5HGJA 4D8XA 2BGMA 3HPQA 4J3FA 1NUQA 3UJ7A 4D4IA 3FW1A 1EDBA 2FE4A 5ICCA 2ZJ3A 3GFVA 5LNK6 1T8WA 3SQLA 5JH7F 3OZEA 3ZWPA 1XI2A 4EI9A 1V8ZA 2CFIA 4XQCA 1GAEO 5BN5B 2ZPTX 1WD7A 1MC4A 2P68A 3QG1A 3NASA 3PYLA 3TCXB 1IQ0A 1I10A 4BQSA 1VJRA 4UDXX 5KSYA 1VPLA 4P1ZA 4DDMA 2ZBGA 3UHPA 5JS6A 5K6RA 2ZJ5A 2YJGA 1GSIA 3OQPA 3GWZA 3L9WA 3HYNA 1DIRA 1EUDB 3TI7A 4ZGGA 5HFAA 3KSRA 1VM6A 4RL6A 4BCBA 3IP6A 1QG0A 1ADYA 1EX6A 1IVYA 1YR8A 1B6RA 2WFLA 2VNSA 3IVAA 4IPTA 4UCXA 5DT9A 5IEBA 2KE5A 2QR2A 4JJ4A 4BRSA 4ALKA 1QFYA 3AHJA 2Q3BA 3CU5A 1IEVA 2A7QA 1AA9A 4Z5XA 1UDAA 3IYLW 5EKDA 1QHIA 4X95A 4JL6A 4MV3A 3GPLA 3GJ8A 3KR9A 3SF8A 5IWAB 3RT9A 2QJWA 2DBYA 4R2LA 1D4OA 2W2LA 4NAUA 1NYTA 1PWXA 1ZOSA 5FFFA 3EOBI 1R12A 1GZDA 1LXCA 2G07A 4C0BA 2JIZA 3K6SB 3RVSA 5BW4A 1USWA 2V3CC 5DNAA 1WDWB 3FPBA 2H57A 1T3LA 3SIWA 1XLTC 5FADA 4PONA 1GFZA 4OUDA 3E58A 4U7GA 1ODSA 1ESNA 2P3LA 5EQDA 2D0PB 3K0AA 5K1ZA 2BGGA 2RAPA 3M49A 4Q3OA 5GJVC 2JGRA 4ZYUA 4BECA 3E9YA 5B57C 5GIOE 4GOMD 1W96A 1KL7A 1Q3HA 1JZQA 3D0RA 4YRFA 3HQ4O 1A50B 3J7AC 1V16B 3P9XA 4H1UA 3LOUA 3DDZX 2RGXA 2GCEA 1L8LA 4LMRA 4Q4DA 4EEZA 1MOQA 2CHQA 1YQ9A 2WJHA 3M1YA 2DYKA 2C88A 3NJRA 4RKWA 3ZKWA 2CD7A 3DXZA 2TMKA 1NUHA 1S2DA 2QAGC 4M3NA 4MK4A 4Z0PA 1IHUA 3LT0A 1TM2A 3IP9A 4QQ8A 2IHVA 3U80A 3UTDA 3BBLA 4HEA6 2ZU6A 2H3HA 1BN6A 4H7FA 4ARBA 4TWAA 4NZMA 1G38A 4GX0A 1AV6A 4A2CA 1XA3A 1QZZA 2F1KA 3FMOB 4P4LA 3BGWA 3O3NB 4X6LA 4HNUA 2FOXA 1GZ7A 4Y0AA 4HFMA 4A91A 1M2FA 2R5FA 1FUKA 4C0WA 1GTRA 2H1CA 2WWWA 3TQHA 5CEEA 5GGYA 4D8VA 2HJVA 1PR3A 2J5BA 2GF9A 4EDHA 4AYXA 2FEOA 1YI8A 2ZZKA 3CNHA 2J3JA 3QX8A 2Z2JA 4UEOA 1NG1A 4GP7A 5AVOA 2P9HA 1XTTA 3KSMA 3GAFA 1C8BA 5KJ6A 4UHJA 1A5AB 2AMJA 4TL8A 4DUGA 4ISBA 5A2GA 2WQ6A 4J91A 4J7CA 5HIIA 3BMCA 2QR5A 3NJ4A 2A2ZA 3KXIA 4FD2A 1XJ0A 5CLIA 4WY2A 2P9CA 2PUTA 2WWFA 3OEEA 1I4TD 1KPHA 3PV0A 4FD3A 4XWGA 3VTFA 4EVRA 4QVIA 4BLPA 1JN0A 1I6WA 3C3WA 1Y8AA 1HFWA 1XDBA 1DB3A 2JVKA 3SZOA 4IGAA 1ZCFA 2OHHA 3KTAA 1J0AA 2QZ9A 2YOFA 3FPJA 4PRKA 4Z0TA 3Q5EA 3TNJA 3W8NA 1HG1A 1QSGA 4H0NA 3OE7A 4IIGA 4WJKB 3W5IA 2V6MA 1U8TA 3K1YA 2VK8A 4M1TA 4FLFA 4DADA 4F3YA 4RIEA 1JXQA 1CUVA 3TUJC 4KOAA 4DHWA 4UHFA 1M5UA 3SDSA 3U7QB 1N9GA 4BP8A 1MHTA 3ANSA 3WZMA 5K6AA 4ATNA 3KZ1E 13PKA 3RHTA 3O94A 3K2EA 3JD2A 2E4ZA 4CETA 1ZN8A 1PFGA 3WXMA 3FNGA 3IVCA 4J0HA 2ZVJA 2QRNA 4NCJA 3VSAA 4AJ9A 4FB5A 3EXG1 2QX9A 4IDAA 3EXAA 3N76A 4M21A 4RQAA 4KXXA 5HZKA 5DZSA 4AY4A 3K05A 2PTHA 3B78A 3VNBA 1Z88A 1IJEA 1UFQA 4S2EA 2PAFA 2UVPA 1GGKA 3FDZA 5J2TF 4DCCA 1H2BA 4QGAA 2JLVA 1LPSA 1Z22A 2Z3WA 4CQMB 2AYYA 3BIJA 3I9V1 3IQDB 5EIFA 1O94C 4ARCA 2ZAIA 3CZ9A 3OCYA 4Y7DA 1QIKA 5IARA 5KHOC 4XE5A 1P72A 2ZITA 1EXVA 2QE6A 4POOA 1UZMA 3MW8A 4CMAA 1IXZA 4DA7A 1YJAA 3UQYS 3LS2A 1YD7A 1N2JA 3E3MA 1IBMB 4XQ0A 2GWHA 3PGKA 1W76A 3AUXA 1T0HB 2E6KA 3TGWA 3W8DA 3CVJA 1LSJA 1Q95A 2ZJ4A 4KLZA 5AMXA 5EMHA 3ZV4A 1LZKA 1LPOA 4WZAE 3TECE 2VJPA 3Q10A 4OQEA 5ERYA 3SE0A 3WFZA 4UUAA 4TMZA 3D4LA 1CKEA 4NH4A 1GKYA 1SK8A 3LCVB 3VKVA 1L4MA 1L5QA 1LEHA 4GGOA 4M37A 2XCIA 2HK9A 1KJ8A 1SBNE 4OQMA 3FLEA 3NP9A 3UNXA 3WL7A 1JKJA 3MWGA 4DCGA 1NJ6A 4UEKA 2ORIA 1MENA 1U5CA 3URMA 3I5YA 3G0HA 4QVGA 1FK8A 5E6RA 2YV1A 1V8DA 3GDGA 3GFSA 3H2SA 3EEQA 3OP1A 2X8AA 4BJHB 5JO0A 3DBRA 3JQAA 1ADCA 1V43A 5DCWA 1V5WA 1W7AA 1R6XA 4URZR 1I3OA 4MYUA 4QXOA 2H5JA 4ZI5A 4FZVA 2QBYB 1RWNA 4BAZA 1FJ2A 5JSUA 1TZBA 1FNBA 3I23A 2Z30A 5DGHA 5AVYA 1U65A 3R0ZA 3IUYA 5CK5A 4OJKA 3W04A 5J4HA 1F4PA 3CIFA 4J9UE 3B82A 3LSYA 2CLFB 2NVBA 3P52A 1GPYA 2WK1A 5GINE 4WVFA 4NNJA 4WCFC 2ZWMA 5LZ8A 5TF4A 2J9XB 4C7BA 4QYIB 1ULAA 1EFCA 1WZIA 1E2FA 2AI1A 4K1XA 1VG0B 1C3OA 5HIKA 1Z63A 1WXXA 4J7AA 1UOPA 1YJBA 1HYQA 3CLTC 3D6NB 5B7NA 1CNEA 1Q1GA 1VCHA 3ZH2A 1AZSC 1X7HA 2OPBA 4QEZA 4RLQA 3ZHQA 4N47A 1NKTA 3A1VA 3GOHA 3I9MA 2WLSA 3B7GA 2B4RO 1CUUA 2CUTA 1A9QA 2Q0XA 1AURA 4FGKA 1ENZA 1BE1A 3CVUA 1RBYA 1GV1A 5EHIA 4BTLA 2IYFA 2QEQA 2I22A 1R4NA 1SOUA 3ZHXA 4D0GA 3Q88A 1F6WA 2XEDA 4GKVA 1OJ7A 4WCVA 3OZCA 1ZIXA 1FFAA 1H2HA 3MMNA 1K8YB 4E2FA